data_1Q84
# 
_entry.id   1Q84 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1Q84         
RCSB  RCSB020035   
WWPDB D_1000020035 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1Q83 . unspecified 
PDB 1J06 . unspecified 
PDB 1J07 . unspecified 
PDB 1N5M . unspecified 
PDB 1N5R . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1Q84 
_pdbx_database_status.recvd_initial_deposition_date   2003-08-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bourne, Y.'      1 
'Kolb, H.C.'      2 
'Radic, Z.'       3 
'Sharpless, K.B.' 4 
'Taylor, P.'      5 
'Marchot, P.'     6 
# 
_citation.id                        primary 
_citation.title                     'Freeze-frame inhibitor captures acetylcholinesterase in a unique conformation.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            101 
_citation.page_first                1449 
_citation.page_last                 1454 
_citation.year                      2004 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14757816 
_citation.pdbx_database_id_DOI      10.1073/pnas.0308206100 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bourne, Y.'      1 ? 
primary 'Kolb, H.C.'      2 ? 
primary 'Radic, Z.'       3 ? 
primary 'Sharpless, K.B.' 4 ? 
primary 'Taylor, P.'      5 ? 
primary 'Marchot, P.'     6 ? 
# 
_cell.entry_id           1Q84 
_cell.length_a           79.272 
_cell.length_b           111.765 
_cell.length_c           227.171 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1Q84 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase 63800.230 2   3.1.1.7 ? ? ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2   ?       ? ? ? 
3 non-polymer syn 'HEXAETHYLENE GLYCOL' 282.331   1   ?       ? ? ? 
4 non-polymer syn 
'3,8-DIAMINO-6-PHENYL-5-[6-[1-[2-[(1,2,3,4-TETRAHYDRO-9-ACRIDINYL)AMINO]ETHYL]-1H-1,2,3-TRIAZOL-4-YL]HEXYL]-PHENANTHRIDINIUM' 
661.860   2   ?       ? ? ? 
5 water       nat water 18.015    338 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MRPPWYPLHTPSLAFPLLFLLLSLLGGGARAEGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMP
PEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAAS
LDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASV
GMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVL
PQESIFRFSFVPVVDGDFLSDTPEALINTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQ
ASDLAAEAVVLHYTDWLHPEDPTHLRDAMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGY
EIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTC
AFWNRFLPKLLSATDTLDEA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MRPPWYPLHTPSLAFPLLFLLLSLLGGGARAEGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMP
PEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAAS
LDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASV
GMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVL
PQESIFRFSFVPVVDGDFLSDTPEALINTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQ
ASDLAAEAVVLHYTDWLHPEDPTHLRDAMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGY
EIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTC
AFWNRFLPKLLSATDTLDEA
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   PRO n 
1 4   PRO n 
1 5   TRP n 
1 6   TYR n 
1 7   PRO n 
1 8   LEU n 
1 9   HIS n 
1 10  THR n 
1 11  PRO n 
1 12  SER n 
1 13  LEU n 
1 14  ALA n 
1 15  PHE n 
1 16  PRO n 
1 17  LEU n 
1 18  LEU n 
1 19  PHE n 
1 20  LEU n 
1 21  LEU n 
1 22  LEU n 
1 23  SER n 
1 24  LEU n 
1 25  LEU n 
1 26  GLY n 
1 27  GLY n 
1 28  GLY n 
1 29  ALA n 
1 30  ARG n 
1 31  ALA n 
1 32  GLU n 
1 33  GLY n 
1 34  ARG n 
1 35  GLU n 
1 36  ASP n 
1 37  PRO n 
1 38  GLN n 
1 39  LEU n 
1 40  LEU n 
1 41  VAL n 
1 42  ARG n 
1 43  VAL n 
1 44  ARG n 
1 45  GLY n 
1 46  GLY n 
1 47  GLN n 
1 48  LEU n 
1 49  ARG n 
1 50  GLY n 
1 51  ILE n 
1 52  ARG n 
1 53  LEU n 
1 54  LYS n 
1 55  ALA n 
1 56  PRO n 
1 57  GLY n 
1 58  GLY n 
1 59  PRO n 
1 60  VAL n 
1 61  SER n 
1 62  ALA n 
1 63  PHE n 
1 64  LEU n 
1 65  GLY n 
1 66  ILE n 
1 67  PRO n 
1 68  PHE n 
1 69  ALA n 
1 70  GLU n 
1 71  PRO n 
1 72  PRO n 
1 73  VAL n 
1 74  GLY n 
1 75  SER n 
1 76  ARG n 
1 77  ARG n 
1 78  PHE n 
1 79  MET n 
1 80  PRO n 
1 81  PRO n 
1 82  GLU n 
1 83  PRO n 
1 84  LYS n 
1 85  ARG n 
1 86  PRO n 
1 87  TRP n 
1 88  SER n 
1 89  GLY n 
1 90  VAL n 
1 91  LEU n 
1 92  ASP n 
1 93  ALA n 
1 94  THR n 
1 95  THR n 
1 96  PHE n 
1 97  GLN n 
1 98  ASN n 
1 99  VAL n 
1 100 CYS n 
1 101 TYR n 
1 102 GLN n 
1 103 TYR n 
1 104 VAL n 
1 105 ASP n 
1 106 THR n 
1 107 LEU n 
1 108 TYR n 
1 109 PRO n 
1 110 GLY n 
1 111 PHE n 
1 112 GLU n 
1 113 GLY n 
1 114 THR n 
1 115 GLU n 
1 116 MET n 
1 117 TRP n 
1 118 ASN n 
1 119 PRO n 
1 120 ASN n 
1 121 ARG n 
1 122 GLU n 
1 123 LEU n 
1 124 SER n 
1 125 GLU n 
1 126 ASP n 
1 127 CYS n 
1 128 LEU n 
1 129 TYR n 
1 130 LEU n 
1 131 ASN n 
1 132 VAL n 
1 133 TRP n 
1 134 THR n 
1 135 PRO n 
1 136 TYR n 
1 137 PRO n 
1 138 ARG n 
1 139 PRO n 
1 140 ALA n 
1 141 SER n 
1 142 PRO n 
1 143 THR n 
1 144 PRO n 
1 145 VAL n 
1 146 LEU n 
1 147 ILE n 
1 148 TRP n 
1 149 ILE n 
1 150 TYR n 
1 151 GLY n 
1 152 GLY n 
1 153 GLY n 
1 154 PHE n 
1 155 TYR n 
1 156 SER n 
1 157 GLY n 
1 158 ALA n 
1 159 ALA n 
1 160 SER n 
1 161 LEU n 
1 162 ASP n 
1 163 VAL n 
1 164 TYR n 
1 165 ASP n 
1 166 GLY n 
1 167 ARG n 
1 168 PHE n 
1 169 LEU n 
1 170 ALA n 
1 171 GLN n 
1 172 VAL n 
1 173 GLU n 
1 174 GLY n 
1 175 ALA n 
1 176 VAL n 
1 177 LEU n 
1 178 VAL n 
1 179 SER n 
1 180 MET n 
1 181 ASN n 
1 182 TYR n 
1 183 ARG n 
1 184 VAL n 
1 185 GLY n 
1 186 THR n 
1 187 PHE n 
1 188 GLY n 
1 189 PHE n 
1 190 LEU n 
1 191 ALA n 
1 192 LEU n 
1 193 PRO n 
1 194 GLY n 
1 195 SER n 
1 196 ARG n 
1 197 GLU n 
1 198 ALA n 
1 199 PRO n 
1 200 GLY n 
1 201 ASN n 
1 202 VAL n 
1 203 GLY n 
1 204 LEU n 
1 205 LEU n 
1 206 ASP n 
1 207 GLN n 
1 208 ARG n 
1 209 LEU n 
1 210 ALA n 
1 211 LEU n 
1 212 GLN n 
1 213 TRP n 
1 214 VAL n 
1 215 GLN n 
1 216 GLU n 
1 217 ASN n 
1 218 ILE n 
1 219 ALA n 
1 220 ALA n 
1 221 PHE n 
1 222 GLY n 
1 223 GLY n 
1 224 ASP n 
1 225 PRO n 
1 226 MET n 
1 227 SER n 
1 228 VAL n 
1 229 THR n 
1 230 LEU n 
1 231 PHE n 
1 232 GLY n 
1 233 GLU n 
1 234 SER n 
1 235 ALA n 
1 236 GLY n 
1 237 ALA n 
1 238 ALA n 
1 239 SER n 
1 240 VAL n 
1 241 GLY n 
1 242 MET n 
1 243 HIS n 
1 244 ILE n 
1 245 LEU n 
1 246 SER n 
1 247 LEU n 
1 248 PRO n 
1 249 SER n 
1 250 ARG n 
1 251 SER n 
1 252 LEU n 
1 253 PHE n 
1 254 HIS n 
1 255 ARG n 
1 256 ALA n 
1 257 VAL n 
1 258 LEU n 
1 259 GLN n 
1 260 SER n 
1 261 GLY n 
1 262 THR n 
1 263 PRO n 
1 264 ASN n 
1 265 GLY n 
1 266 PRO n 
1 267 TRP n 
1 268 ALA n 
1 269 THR n 
1 270 VAL n 
1 271 SER n 
1 272 ALA n 
1 273 GLY n 
1 274 GLU n 
1 275 ALA n 
1 276 ARG n 
1 277 ARG n 
1 278 ARG n 
1 279 ALA n 
1 280 THR n 
1 281 LEU n 
1 282 LEU n 
1 283 ALA n 
1 284 ARG n 
1 285 LEU n 
1 286 VAL n 
1 287 GLY n 
1 288 CYS n 
1 289 PRO n 
1 290 PRO n 
1 291 GLY n 
1 292 GLY n 
1 293 ALA n 
1 294 GLY n 
1 295 GLY n 
1 296 ASN n 
1 297 ASP n 
1 298 THR n 
1 299 GLU n 
1 300 LEU n 
1 301 ILE n 
1 302 ALA n 
1 303 CYS n 
1 304 LEU n 
1 305 ARG n 
1 306 THR n 
1 307 ARG n 
1 308 PRO n 
1 309 ALA n 
1 310 GLN n 
1 311 ASP n 
1 312 LEU n 
1 313 VAL n 
1 314 ASP n 
1 315 HIS n 
1 316 GLU n 
1 317 TRP n 
1 318 HIS n 
1 319 VAL n 
1 320 LEU n 
1 321 PRO n 
1 322 GLN n 
1 323 GLU n 
1 324 SER n 
1 325 ILE n 
1 326 PHE n 
1 327 ARG n 
1 328 PHE n 
1 329 SER n 
1 330 PHE n 
1 331 VAL n 
1 332 PRO n 
1 333 VAL n 
1 334 VAL n 
1 335 ASP n 
1 336 GLY n 
1 337 ASP n 
1 338 PHE n 
1 339 LEU n 
1 340 SER n 
1 341 ASP n 
1 342 THR n 
1 343 PRO n 
1 344 GLU n 
1 345 ALA n 
1 346 LEU n 
1 347 ILE n 
1 348 ASN n 
1 349 THR n 
1 350 GLY n 
1 351 ASP n 
1 352 PHE n 
1 353 GLN n 
1 354 ASP n 
1 355 LEU n 
1 356 GLN n 
1 357 VAL n 
1 358 LEU n 
1 359 VAL n 
1 360 GLY n 
1 361 VAL n 
1 362 VAL n 
1 363 LYS n 
1 364 ASP n 
1 365 GLU n 
1 366 GLY n 
1 367 SER n 
1 368 TYR n 
1 369 PHE n 
1 370 LEU n 
1 371 VAL n 
1 372 TYR n 
1 373 GLY n 
1 374 VAL n 
1 375 PRO n 
1 376 GLY n 
1 377 PHE n 
1 378 SER n 
1 379 LYS n 
1 380 ASP n 
1 381 ASN n 
1 382 GLU n 
1 383 SER n 
1 384 LEU n 
1 385 ILE n 
1 386 SER n 
1 387 ARG n 
1 388 ALA n 
1 389 GLN n 
1 390 PHE n 
1 391 LEU n 
1 392 ALA n 
1 393 GLY n 
1 394 VAL n 
1 395 ARG n 
1 396 ILE n 
1 397 GLY n 
1 398 VAL n 
1 399 PRO n 
1 400 GLN n 
1 401 ALA n 
1 402 SER n 
1 403 ASP n 
1 404 LEU n 
1 405 ALA n 
1 406 ALA n 
1 407 GLU n 
1 408 ALA n 
1 409 VAL n 
1 410 VAL n 
1 411 LEU n 
1 412 HIS n 
1 413 TYR n 
1 414 THR n 
1 415 ASP n 
1 416 TRP n 
1 417 LEU n 
1 418 HIS n 
1 419 PRO n 
1 420 GLU n 
1 421 ASP n 
1 422 PRO n 
1 423 THR n 
1 424 HIS n 
1 425 LEU n 
1 426 ARG n 
1 427 ASP n 
1 428 ALA n 
1 429 MET n 
1 430 SER n 
1 431 ALA n 
1 432 VAL n 
1 433 VAL n 
1 434 GLY n 
1 435 ASP n 
1 436 HIS n 
1 437 ASN n 
1 438 VAL n 
1 439 VAL n 
1 440 CYS n 
1 441 PRO n 
1 442 VAL n 
1 443 ALA n 
1 444 GLN n 
1 445 LEU n 
1 446 ALA n 
1 447 GLY n 
1 448 ARG n 
1 449 LEU n 
1 450 ALA n 
1 451 ALA n 
1 452 GLN n 
1 453 GLY n 
1 454 ALA n 
1 455 ARG n 
1 456 VAL n 
1 457 TYR n 
1 458 ALA n 
1 459 TYR n 
1 460 ILE n 
1 461 PHE n 
1 462 GLU n 
1 463 HIS n 
1 464 ARG n 
1 465 ALA n 
1 466 SER n 
1 467 THR n 
1 468 LEU n 
1 469 THR n 
1 470 TRP n 
1 471 PRO n 
1 472 LEU n 
1 473 TRP n 
1 474 MET n 
1 475 GLY n 
1 476 VAL n 
1 477 PRO n 
1 478 HIS n 
1 479 GLY n 
1 480 TYR n 
1 481 GLU n 
1 482 ILE n 
1 483 GLU n 
1 484 PHE n 
1 485 ILE n 
1 486 PHE n 
1 487 GLY n 
1 488 LEU n 
1 489 PRO n 
1 490 LEU n 
1 491 ASP n 
1 492 PRO n 
1 493 SER n 
1 494 LEU n 
1 495 ASN n 
1 496 TYR n 
1 497 THR n 
1 498 THR n 
1 499 GLU n 
1 500 GLU n 
1 501 ARG n 
1 502 ILE n 
1 503 PHE n 
1 504 ALA n 
1 505 GLN n 
1 506 ARG n 
1 507 LEU n 
1 508 MET n 
1 509 LYS n 
1 510 TYR n 
1 511 TRP n 
1 512 THR n 
1 513 ASN n 
1 514 PHE n 
1 515 ALA n 
1 516 ARG n 
1 517 THR n 
1 518 GLY n 
1 519 ASP n 
1 520 PRO n 
1 521 ASN n 
1 522 ASP n 
1 523 PRO n 
1 524 ARG n 
1 525 ASP n 
1 526 SER n 
1 527 LYS n 
1 528 SER n 
1 529 PRO n 
1 530 GLN n 
1 531 TRP n 
1 532 PRO n 
1 533 PRO n 
1 534 TYR n 
1 535 THR n 
1 536 THR n 
1 537 ALA n 
1 538 ALA n 
1 539 GLN n 
1 540 GLN n 
1 541 TYR n 
1 542 VAL n 
1 543 SER n 
1 544 LEU n 
1 545 ASN n 
1 546 LEU n 
1 547 LYS n 
1 548 PRO n 
1 549 LEU n 
1 550 GLU n 
1 551 VAL n 
1 552 ARG n 
1 553 ARG n 
1 554 GLY n 
1 555 LEU n 
1 556 ARG n 
1 557 ALA n 
1 558 GLN n 
1 559 THR n 
1 560 CYS n 
1 561 ALA n 
1 562 PHE n 
1 563 TRP n 
1 564 ASN n 
1 565 ARG n 
1 566 PHE n 
1 567 LEU n 
1 568 PRO n 
1 569 LYS n 
1 570 LEU n 
1 571 LEU n 
1 572 SER n 
1 573 ALA n 
1 574 THR n 
1 575 ASP n 
1 576 THR n 
1 577 LEU n 
1 578 ASP n 
1 579 GLU n 
1 580 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ACHE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     Homo 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'HEK 293' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          virus 
_entity_src_gen.pdbx_host_org_vector               'LAMBDA-ZAP, LAMBDA-FIX' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MRPPWYPLHTPSLAFPLLFLLLSLLGGGARAEGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMP
PEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAAS
LDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASV
GMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVL
PQESIFRFSFVPVVDGDFLSDTPEALINTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQ
ASDLAAEAVVLHYTDWLHPEDPTHLRDAMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGY
EIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTC
AFWNRFLPKLLSATDTLDEA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1Q84 A 1 ? 580 ? P21836 1 ? 580 ? -30 549 
2 1 1Q84 B 1 ? 580 ? P21836 1 ? 580 ? -30 549 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE ?                            'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE ?                            'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE ?                            'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID' ?                            'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE ?                            'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE ?                            'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID' ?                            'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE ?                            'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE ?                            'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER ?                            'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE ?                            'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE ?                            'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE ?                            'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE ?                            'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ?                            'C8 H15 N O6'    221.208 
P6G non-polymer                  . 'HEXAETHYLENE GLYCOL' 'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7'     282.331 
PHE 'L-peptide linking'          y PHENYLALANINE ?                            'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE ?                            'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE ?                            'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE ?                            'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN ?                            'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE ?                            'C9 H11 N O3'    181.189 
TZ4 non-polymer                  . 
'3,8-DIAMINO-6-PHENYL-5-[6-[1-[2-[(1,2,3,4-TETRAHYDRO-9-ACRIDINYL)AMINO]ETHYL]-1H-1,2,3-TRIAZOL-4-YL]HEXYL]-PHENANTHRIDINIUM' ? 
'C42 H45 N8 1'   661.860 
VAL 'L-peptide linking'          y VALINE ?                            'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1Q84 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.94 
_exptl_crystal.density_percent_sol   68.78 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.75 
_exptl_crystal_grow.pdbx_details    '25-32% PEG 600, 20-100 mM Hepes, pH 6.75, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2002-12-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.933 
# 
_reflns.entry_id                     1Q84 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.45 
_reflns.d_resolution_low             20 
_reflns.number_all                   ? 
_reflns.number_obs                   74834 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.057 
_reflns.pdbx_netI_over_sigmaI        9.3 
_reflns.B_iso_Wilson_estimate        57.0 
_reflns.pdbx_redundancy              3.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1Q84 
_refine.ls_number_reflns_obs                     73140 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.45 
_refine.ls_percent_reflns_obs                    99.69 
_refine.ls_R_factor_obs                          0.18487 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18427 
_refine.ls_R_factor_R_free                       0.21404 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1507 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.961 
_refine.correlation_coeff_Fo_to_Fc_free          0.940 
_refine.B_iso_mean                               38.036 
_refine.aniso_B[1][1]                            3.32 
_refine.aniso_B[2][2]                            3.04 
_refine.aniso_B[3][3]                            -6.36 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1J06' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.219 
_refine.pdbx_overall_ESU_R_Free                  0.183 
_refine.overall_SU_ML                            0.134 
_refine.overall_SU_B                             6.013 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8314 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         147 
_refine_hist.number_atoms_solvent             338 
_refine_hist.number_atoms_total               8799 
_refine_hist.d_res_high                       2.45 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.015 0.021 ? 8732  'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.002 0.020 ? 7822  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.500 1.968 ? 11939 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        1.100 3.000 ? 18073 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.421 5.000 ? 1063  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.085 0.200 ? 1270  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.006 0.020 ? 9808  'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.003 0.020 ? 1891  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.201 0.200 ? 1716  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.234 0.200 ? 8833  'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.086 0.200 ? 5020  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.163 0.200 ? 294   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.123 0.200 ? 9     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.363 0.200 ? 49    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.209 0.200 ? 14    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other   ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.633 1.500 ? 5327  'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.259 2.000 ? 8580  'X-RAY DIFFRACTION' ? 
r_scbond_it              2.003 3.000 ? 3405  'X-RAY DIFFRACTION' ? 
r_scangle_it             3.451 4.500 ? 3359  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free        ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'tight positional' A 2866 0.04 0.05  1 'X-RAY DIFFRACTION' 1 ? ? ? 
1 'loose positional' A 4563 0.41 5.00  1 'X-RAY DIFFRACTION' 2 ? ? ? 
1 'tight thermal'    A 2866 0.12 0.50  1 'X-RAY DIFFRACTION' 3 ? ? ? 
1 'loose thermal'    A 4563 1.36 10.00 1 'X-RAY DIFFRACTION' 4 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.450 
_refine_ls_shell.d_res_low                        2.513 
_refine_ls_shell.number_reflns_R_work             5256 
_refine_ls_shell.R_factor_R_work                  0.264 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.27 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             102 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1  A 
1 2  B 
1 3  A 
1 4  B 
1 5  A 
1 6  B 
1 7  A 
1 8  B 
1 9  A 
1 10 B 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1  1 3 A 16  A 56  A GLN 47  . A TRP 87  . 1 ? 
2  1 3 B 16  B 56  B GLN 47  . B TRP 87  . 1 ? 
3  2 3 A 60  A 74  A LEU 91  . A ASP 105 . 1 ? 
4  2 3 B 60  B 74  B LEU 91  . B ASP 105 . 1 ? 
5  3 3 A 80  A 256 A PHE 111 . A GLY 287 . 1 ? 
6  3 3 B 80  B 256 B PHE 111 . B GLY 287 . 1 ? 
7  4 3 A 265 A 490 A ASN 296 . A ASN 521 . 1 ? 
8  4 3 B 265 B 490 B ASN 296 . B ASN 521 . 1 ? 
9  5 3 A 508 A 539 A GLN 539 . A LEU 570 . 1 ? 
10 5 3 B 508 B 539 B GLN 539 . B LEU 570 . 1 ? 
# 
_struct_ncs_ens.id            1 
_struct_ncs_ens.details       ? 
_struct_ncs_ens.point_group   ? 
# 
_struct.entry_id                  1Q84 
_struct.title                     'Crystal structure of the mouse acetylcholinesterase-TZ2PA6 anti complex' 
_struct.pdbx_descriptor           
;Acetylcholinesterase (E.C.3.1.1.7), HEXAETHYLENE GLYCOL, 3,8-DIAMINO-6-PHENYL-5-(6-{1-[2-(1,2,3,4-TETRAHYDROACRIDIN-9-YLAMINO)ETHYL]-1H-1,2,3-TRIAZOL-4-YL}HEXYL)PHENANTHRIDINIUM
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1Q84 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, SERINE ESTERASE, ACETYLCHOLINESTERASE, bifunctional inhibitor' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 36  ? GLN A 38  ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 73  ? ARG A 77  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 111 ? MET A 116 ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 161 ? ASP A 165 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 166 ? GLY A 174 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 184 ? LEU A 190 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 201 ? ILE A 218 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 219 ? PHE A 221 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  SER A 234 ? SER A 246 ? SER A 203 SER A 215 1 ? 13 
HELX_P HELX_P10 10 SER A 246 ? SER A 251 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 SER A 271 ? VAL A 286 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 12 ASN A 296 ? THR A 306 ? ASN A 265 THR A 275 1 ? 11 
HELX_P HELX_P13 13 PRO A 308 ? TRP A 317 ? PRO A 277 TRP A 286 1 ? 10 
HELX_P HELX_P14 14 HIS A 318 ? LEU A 320 ? HIS A 287 LEU A 289 5 ? 3  
HELX_P HELX_P15 15 THR A 342 ? GLY A 350 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 16 SER A 367 ? GLY A 373 ? SER A 336 GLY A 342 5 ? 7  
HELX_P HELX_P17 17 SER A 386 ? VAL A 398 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 402 ? THR A 414 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 421 ? VAL A 438 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 438 ? GLN A 452 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 471 ? GLY A 475 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 481 ? PHE A 486 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 487 ? ASN A 495 ? GLY A 456 ASN A 464 5 ? 9  
HELX_P HELX_P24 24 THR A 497 ? GLY A 518 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 25 ARG A 556 ? ARG A 565 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 26 ARG A 565 ? LEU A 570 ? ARG A 534 LEU A 539 1 ? 6  
HELX_P HELX_P27 27 ASP B 36  ? GLN B 38  ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P28 28 VAL B 73  ? ARG B 77  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 29 PHE B 111 ? MET B 116 ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 30 LEU B 161 ? ASP B 165 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 31 GLY B 166 ? GLY B 174 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P32 32 VAL B 184 ? LEU B 190 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 33 ASN B 201 ? ILE B 218 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P34 34 ALA B 219 ? PHE B 221 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 35 SER B 234 ? LEU B 245 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 36 SER B 246 ? SER B 251 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P37 37 SER B 271 ? VAL B 286 ? SER B 240 VAL B 255 1 ? 16 
HELX_P HELX_P38 38 ASN B 296 ? ARG B 307 ? ASN B 265 ARG B 276 1 ? 12 
HELX_P HELX_P39 39 PRO B 308 ? TRP B 317 ? PRO B 277 TRP B 286 1 ? 10 
HELX_P HELX_P40 40 HIS B 318 ? LEU B 320 ? HIS B 287 LEU B 289 5 ? 3  
HELX_P HELX_P41 41 THR B 342 ? GLY B 350 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P42 42 SER B 367 ? GLY B 373 ? SER B 336 GLY B 342 5 ? 7  
HELX_P HELX_P43 43 SER B 386 ? VAL B 398 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 44 SER B 402 ? THR B 414 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 45 ASP B 421 ? VAL B 438 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 46 VAL B 438 ? GLN B 452 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 47 PRO B 471 ? GLY B 475 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 48 GLU B 481 ? PHE B 486 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 49 GLY B 487 ? ASN B 495 ? GLY B 456 ASN B 464 5 ? 9  
HELX_P HELX_P50 50 THR B 497 ? GLY B 518 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 51 ARG B 556 ? ARG B 565 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 52 ARG B 565 ? LEU B 570 ? ARG B 534 LEU B 539 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 100 SG  ? ? ? 1_555 A CYS 127 SG ? ? A CYS 69  A CYS 96   1_555 ? ? ? ? ? ? ? 2.055 ? ?               
disulf2 disulf ?   ? A CYS 288 SG  ? ? ? 1_555 A CYS 303 SG ? ? A CYS 257 A CYS 272  1_555 ? ? ? ? ? ? ? 2.167 ? ?               
disulf3 disulf ?   ? A CYS 440 SG  ? ? ? 1_555 A CYS 560 SG ? ? A CYS 409 A CYS 529  1_555 ? ? ? ? ? ? ? 2.118 ? ?               
disulf4 disulf ?   ? B CYS 100 SG  ? ? ? 1_555 B CYS 127 SG ? ? B CYS 69  B CYS 96   1_555 ? ? ? ? ? ? ? 2.077 ? ?               
disulf5 disulf ?   ? B CYS 288 SG  ? ? ? 1_555 B CYS 303 SG ? ? B CYS 257 B CYS 272  1_555 ? ? ? ? ? ? ? 2.115 ? ?               
disulf6 disulf ?   ? B CYS 440 SG  ? ? ? 1_555 B CYS 560 SG ? ? B CYS 409 B CYS 529  1_555 ? ? ? ? ? ? ? 2.095 ? ?               
covale1 covale one ? A ASN 381 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 A NAG 1501 1_555 ? ? ? ? ? ? ? 1.482 ? N-Glycosylation 
covale2 covale one ? A ASN 495 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 464 A NAG 1701 1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 136 A . ? TYR 105 A PRO 137 A ? PRO 106 A 1 -6.03 
2 TYR 136 B . ? TYR 105 B PRO 137 B ? PRO 106 B 1 3.01  
3 CYS 288 B . ? CYS 257 B PRO 289 B ? PRO 258 B 1 10.69 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
C ? 2  ? 
D ? 3  ? 
E ? 11 ? 
F ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
C 1  2  ? parallel      
D 1  2  ? anti-parallel 
D 2  3  ? parallel      
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
E 3  4  ? anti-parallel 
E 4  5  ? parallel      
E 5  6  ? parallel      
E 6  7  ? parallel      
E 7  8  ? parallel      
E 8  9  ? parallel      
E 9  10 ? parallel      
E 10 11 ? anti-parallel 
F 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 40  ? VAL A 43  ? LEU A 9   VAL A 12  
A 2  GLY A 46  ? ARG A 49  ? GLY A 15  ARG A 18  
A 3  VAL A 90  ? ASP A 92  ? VAL A 59  ASP A 61  
B 1  ILE A 51  ? ALA A 55  ? ILE A 20  ALA A 24  
B 2  GLY A 58  ? PRO A 67  ? GLY A 27  PRO A 36  
B 3  TYR A 129 ? PRO A 135 ? TYR A 98  PRO A 104 
B 4  VAL A 176 ? MET A 180 ? VAL A 145 MET A 149 
B 5  THR A 143 ? ILE A 149 ? THR A 112 ILE A 118 
B 6  GLY A 223 ? GLU A 233 ? GLY A 192 GLU A 202 
B 7  ARG A 255 ? GLN A 259 ? ARG A 224 GLN A 228 
B 8  GLN A 356 ? VAL A 362 ? GLN A 325 VAL A 331 
B 9  ARG A 455 ? PHE A 461 ? ARG A 424 PHE A 430 
B 10 GLN A 540 ? LEU A 544 ? GLN A 509 LEU A 513 
B 11 GLU A 550 ? ARG A 553 ? GLU A 519 ARG A 522 
C 1  VAL A 99  ? CYS A 100 ? VAL A 68  CYS A 69  
C 2  LEU A 123 ? SER A 124 ? LEU A 92  SER A 93  
D 1  LEU B 40  ? VAL B 43  ? LEU B 9   VAL B 12  
D 2  GLY B 46  ? ARG B 49  ? GLY B 15  ARG B 18  
D 3  VAL B 90  ? ASP B 92  ? VAL B 59  ASP B 61  
E 1  ILE B 51  ? ALA B 55  ? ILE B 20  ALA B 24  
E 2  GLY B 58  ? PRO B 67  ? GLY B 27  PRO B 36  
E 3  TYR B 129 ? PRO B 135 ? TYR B 98  PRO B 104 
E 4  VAL B 176 ? MET B 180 ? VAL B 145 MET B 149 
E 5  THR B 143 ? ILE B 149 ? THR B 112 ILE B 118 
E 6  GLY B 223 ? GLU B 233 ? GLY B 192 GLU B 202 
E 7  ARG B 255 ? GLN B 259 ? ARG B 224 GLN B 228 
E 8  GLN B 356 ? VAL B 362 ? GLN B 325 VAL B 331 
E 9  ARG B 455 ? PHE B 461 ? ARG B 424 PHE B 430 
E 10 GLN B 540 ? LEU B 544 ? GLN B 509 LEU B 513 
E 11 GLU B 550 ? ARG B 553 ? GLU B 519 ARG B 522 
F 1  VAL B 99  ? CYS B 100 ? VAL B 68  CYS B 69  
F 2  LEU B 123 ? SER B 124 ? LEU B 92  SER B 93  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 41  ? N VAL A 10  O LEU A 48  ? O LEU A 17  
A 2  3  N GLN A 47  ? N GLN A 16  O LEU A 91  ? O LEU A 60  
B 1  2  N LEU A 53  ? N LEU A 22  O VAL A 60  ? O VAL A 29  
B 2  3  N PHE A 63  ? N PHE A 32  O VAL A 132 ? O VAL A 101 
B 3  4  N ASN A 131 ? N ASN A 100 O SER A 179 ? O SER A 148 
B 4  5  O VAL A 178 ? O VAL A 147 N LEU A 146 ? N LEU A 115 
B 5  6  N ILE A 147 ? N ILE A 116 O PHE A 231 ? O PHE A 200 
B 6  7  N GLY A 232 ? N GLY A 201 O GLN A 259 ? O GLN A 228 
B 7  8  N LEU A 258 ? N LEU A 227 O LEU A 358 ? O LEU A 327 
B 8  9  N VAL A 361 ? N VAL A 330 O PHE A 461 ? O PHE A 430 
B 9  10 N ILE A 460 ? N ILE A 429 O LEU A 544 ? O LEU A 513 
B 10 11 N TYR A 541 ? N TYR A 510 O ARG A 552 ? O ARG A 521 
C 1  2  N VAL A 99  ? N VAL A 68  O SER A 124 ? O SER A 93  
D 1  2  N VAL B 41  ? N VAL B 10  O LEU B 48  ? O LEU B 17  
D 2  3  N GLN B 47  ? N GLN B 16  O LEU B 91  ? O LEU B 60  
E 1  2  N LEU B 53  ? N LEU B 22  O VAL B 60  ? O VAL B 29  
E 2  3  N PHE B 63  ? N PHE B 32  O VAL B 132 ? O VAL B 101 
E 3  4  N ASN B 131 ? N ASN B 100 O SER B 179 ? O SER B 148 
E 4  5  O VAL B 178 ? O VAL B 147 N TRP B 148 ? N TRP B 117 
E 5  6  N ILE B 147 ? N ILE B 116 O PHE B 231 ? O PHE B 200 
E 6  7  N GLY B 232 ? N GLY B 201 O GLN B 259 ? O GLN B 228 
E 7  8  N LEU B 258 ? N LEU B 227 O LEU B 358 ? O LEU B 327 
E 8  9  N VAL B 361 ? N VAL B 330 O PHE B 461 ? O PHE B 430 
E 9  10 N ILE B 460 ? N ILE B 429 O LEU B 544 ? O LEU B 513 
E 10 11 N TYR B 541 ? N TYR B 510 O ARG B 552 ? O ARG B 521 
F 1  2  N VAL B 99  ? N VAL B 68  O SER B 124 ? O SER B 93  
# 
_database_PDB_matrix.entry_id          1Q84 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1Q84 
_atom_sites.fract_transf_matrix[1][1]   0.012615 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008947 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004402 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 32  ? 31.949  13.903  56.622  1.00 82.28  ? 1    GLU A N   1 
ATOM   2    C CA  . GLU A 1 32  ? 30.888  14.268  55.633  1.00 81.39  ? 1    GLU A CA  1 
ATOM   3    C C   . GLU A 1 32  ? 30.023  15.379  56.253  1.00 81.74  ? 1    GLU A C   1 
ATOM   4    O O   . GLU A 1 32  ? 30.246  16.572  55.963  1.00 82.51  ? 1    GLU A O   1 
ATOM   5    C CB  . GLU A 1 32  ? 30.041  12.996  55.209  1.00 81.00  ? 1    GLU A CB  1 
ATOM   6    N N   . GLY A 1 33  ? 29.065  14.989  57.107  1.00 81.22  ? 2    GLY A N   1 
ATOM   7    C CA  . GLY A 1 33  ? 28.367  15.903  57.994  1.00 80.98  ? 2    GLY A CA  1 
ATOM   8    C C   . GLY A 1 33  ? 27.001  16.360  57.529  1.00 79.70  ? 2    GLY A C   1 
ATOM   9    O O   . GLY A 1 33  ? 25.990  15.706  57.782  1.00 78.91  ? 2    GLY A O   1 
ATOM   10   N N   . ARG A 1 34  ? 26.996  17.489  56.821  1.00 78.42  ? 3    ARG A N   1 
ATOM   11   C CA  . ARG A 1 34  ? 25.783  18.297  56.601  1.00 78.05  ? 3    ARG A CA  1 
ATOM   12   C C   . ARG A 1 34  ? 25.262  18.350  55.160  1.00 75.48  ? 3    ARG A C   1 
ATOM   13   O O   . ARG A 1 34  ? 24.409  19.162  54.841  1.00 75.79  ? 3    ARG A O   1 
ATOM   14   C CB  . ARG A 1 34  ? 26.043  19.722  57.099  1.00 78.89  ? 3    ARG A CB  1 
ATOM   15   C CG  . ARG A 1 34  ? 25.867  19.875  58.596  1.00 81.83  ? 3    ARG A CG  1 
ATOM   16   C CD  . ARG A 1 34  ? 24.490  20.463  59.000  1.00 83.95  ? 3    ARG A CD  1 
ATOM   17   N NE  . ARG A 1 34  ? 24.010  20.062  60.337  1.00 86.22  ? 3    ARG A NE  1 
ATOM   18   C CZ  . ARG A 1 34  ? 24.684  20.191  61.498  1.00 86.58  ? 3    ARG A CZ  1 
ATOM   19   N NH1 . ARG A 1 34  ? 25.919  20.703  61.558  1.00 86.28  ? 3    ARG A NH1 1 
ATOM   20   N NH2 . ARG A 1 34  ? 24.100  19.789  62.622  1.00 86.31  ? 3    ARG A NH2 1 
ATOM   21   N N   . GLU A 1 35  ? 25.733  17.451  54.315  1.00 72.89  ? 4    GLU A N   1 
ATOM   22   C CA  . GLU A 1 35  ? 25.444  17.525  52.895  1.00 70.91  ? 4    GLU A CA  1 
ATOM   23   C C   . GLU A 1 35  ? 24.297  16.607  52.516  1.00 69.04  ? 4    GLU A C   1 
ATOM   24   O O   . GLU A 1 35  ? 23.968  15.674  53.220  1.00 69.37  ? 4    GLU A O   1 
ATOM   25   C CB  . GLU A 1 35  ? 26.680  17.172  52.046  1.00 70.14  ? 4    GLU A CB  1 
ATOM   26   C CG  . GLU A 1 35  ? 27.980  16.985  52.823  1.00 72.73  ? 4    GLU A CG  1 
ATOM   27   C CD  . GLU A 1 35  ? 29.191  16.925  51.917  1.00 74.70  ? 4    GLU A CD  1 
ATOM   28   O OE1 . GLU A 1 35  ? 30.210  16.324  52.335  1.00 77.21  ? 4    GLU A OE1 1 
ATOM   29   O OE2 . GLU A 1 35  ? 29.117  17.465  50.787  1.00 75.41  ? 4    GLU A OE2 1 
ATOM   30   N N   . ASP A 1 36  ? 23.703  16.891  51.373  1.00 66.87  ? 5    ASP A N   1 
ATOM   31   C CA  . ASP A 1 36  ? 22.621  16.088  50.859  1.00 65.60  ? 5    ASP A CA  1 
ATOM   32   C C   . ASP A 1 36  ? 23.202  14.684  50.696  1.00 64.74  ? 5    ASP A C   1 
ATOM   33   O O   . ASP A 1 36  ? 24.164  14.502  49.940  1.00 62.90  ? 5    ASP A O   1 
ATOM   34   C CB  . ASP A 1 36  ? 22.131  16.686  49.535  1.00 64.00  ? 5    ASP A CB  1 
ATOM   35   C CG  . ASP A 1 36  ? 20.839  16.083  49.055  1.00 63.36  ? 5    ASP A CG  1 
ATOM   36   O OD1 . ASP A 1 36  ? 20.536  14.922  49.407  1.00 63.52  ? 5    ASP A OD1 1 
ATOM   37   O OD2 . ASP A 1 36  ? 20.057  16.700  48.293  1.00 62.86  ? 5    ASP A OD2 1 
ATOM   38   N N   . PRO A 1 37  ? 22.661  13.710  51.438  1.00 65.70  ? 6    PRO A N   1 
ATOM   39   C CA  . PRO A 1 37  ? 23.177  12.321  51.404  1.00 64.94  ? 6    PRO A CA  1 
ATOM   40   C C   . PRO A 1 37  ? 22.957  11.633  50.053  1.00 63.68  ? 6    PRO A C   1 
ATOM   41   O O   . PRO A 1 37  ? 23.632  10.663  49.716  1.00 63.48  ? 6    PRO A O   1 
ATOM   42   C CB  . PRO A 1 37  ? 22.357  11.613  52.476  1.00 66.27  ? 6    PRO A CB  1 
ATOM   43   C CG  . PRO A 1 37  ? 21.084  12.437  52.631  1.00 67.08  ? 6    PRO A CG  1 
ATOM   44   C CD  . PRO A 1 37  ? 21.504  13.848  52.357  1.00 66.95  ? 6    PRO A CD  1 
ATOM   45   N N   . GLN A 1 38  ? 22.027  12.156  49.270  1.00 62.66  ? 7    GLN A N   1 
ATOM   46   C CA  . GLN A 1 38  ? 21.760  11.636  47.933  1.00 61.37  ? 7    GLN A CA  1 
ATOM   47   C C   . GLN A 1 38  ? 22.863  12.008  46.926  1.00 58.48  ? 7    GLN A C   1 
ATOM   48   O O   . GLN A 1 38  ? 22.885  11.494  45.813  1.00 58.27  ? 7    GLN A O   1 
ATOM   49   C CB  . GLN A 1 38  ? 20.375  12.138  47.496  1.00 62.34  ? 7    GLN A CB  1 
ATOM   50   C CG  . GLN A 1 38  ? 19.610  11.319  46.451  1.00 64.34  ? 7    GLN A CG  1 
ATOM   51   C CD  . GLN A 1 38  ? 19.428  9.844   46.780  1.00 67.57  ? 7    GLN A CD  1 
ATOM   52   O OE1 . GLN A 1 38  ? 19.721  9.007   45.930  1.00 69.94  ? 7    GLN A OE1 1 
ATOM   53   N NE2 . GLN A 1 38  ? 18.950  9.520   47.984  1.00 68.56  ? 7    GLN A NE2 1 
ATOM   54   N N   . LEU A 1 39  ? 23.801  12.866  47.324  1.00 56.65  ? 8    LEU A N   1 
ATOM   55   C CA  . LEU A 1 39  ? 24.862  13.364  46.433  1.00 54.33  ? 8    LEU A CA  1 
ATOM   56   C C   . LEU A 1 39  ? 26.258  12.832  46.739  1.00 53.41  ? 8    LEU A C   1 
ATOM   57   O O   . LEU A 1 39  ? 27.217  13.246  46.114  1.00 52.69  ? 8    LEU A O   1 
ATOM   58   C CB  . LEU A 1 39  ? 24.916  14.899  46.467  1.00 53.78  ? 8    LEU A CB  1 
ATOM   59   C CG  . LEU A 1 39  ? 23.601  15.624  46.136  1.00 54.04  ? 8    LEU A CG  1 
ATOM   60   C CD1 . LEU A 1 39  ? 23.713  17.126  46.357  1.00 54.34  ? 8    LEU A CD1 1 
ATOM   61   C CD2 . LEU A 1 39  ? 23.180  15.338  44.711  1.00 52.59  ? 8    LEU A CD2 1 
ATOM   62   N N   . LEU A 1 40  ? 26.382  11.928  47.702  1.00 54.04  ? 9    LEU A N   1 
ATOM   63   C CA  . LEU A 1 40  ? 27.672  11.308  48.008  1.00 53.67  ? 9    LEU A CA  1 
ATOM   64   C C   . LEU A 1 40  ? 27.660  9.908   47.473  1.00 52.75  ? 9    LEU A C   1 
ATOM   65   O O   . LEU A 1 40  ? 26.812  9.113   47.840  1.00 52.95  ? 9    LEU A O   1 
ATOM   66   C CB  . LEU A 1 40  ? 27.933  11.309  49.504  1.00 54.85  ? 9    LEU A CB  1 
ATOM   67   C CG  . LEU A 1 40  ? 27.769  12.703  50.133  1.00 56.50  ? 9    LEU A CG  1 
ATOM   68   C CD1 . LEU A 1 40  ? 27.866  12.641  51.701  1.00 57.37  ? 9    LEU A CD1 1 
ATOM   69   C CD2 . LEU A 1 40  ? 28.804  13.679  49.537  1.00 55.86  ? 9    LEU A CD2 1 
ATOM   70   N N   . VAL A 1 41  ? 28.597  9.620   46.586  1.00 51.72  ? 10   VAL A N   1 
ATOM   71   C CA  . VAL A 1 41  ? 28.654  8.340   45.911  1.00 51.70  ? 10   VAL A CA  1 
ATOM   72   C C   . VAL A 1 41  ? 30.100  7.897   45.752  1.00 51.38  ? 10   VAL A C   1 
ATOM   73   O O   . VAL A 1 41  ? 30.981  8.726   45.506  1.00 50.52  ? 10   VAL A O   1 
ATOM   74   C CB  . VAL A 1 41  ? 28.003  8.473   44.524  1.00 51.20  ? 10   VAL A CB  1 
ATOM   75   C CG1 . VAL A 1 41  ? 28.393  7.346   43.623  1.00 51.91  ? 10   VAL A CG1 1 
ATOM   76   C CG2 . VAL A 1 41  ? 26.472  8.507   44.674  1.00 52.40  ? 10   VAL A CG2 1 
ATOM   77   N N   . ARG A 1 42  ? 30.340  6.589   45.884  1.00 51.51  ? 11   ARG A N   1 
ATOM   78   C CA  . ARG A 1 42  ? 31.673  6.014   45.699  1.00 50.92  ? 11   ARG A CA  1 
ATOM   79   C C   . ARG A 1 42  ? 31.733  5.225   44.402  1.00 50.15  ? 11   ARG A C   1 
ATOM   80   O O   . ARG A 1 42  ? 30.869  4.376   44.145  1.00 50.19  ? 11   ARG A O   1 
ATOM   81   C CB  . ARG A 1 42  ? 32.010  5.072   46.853  1.00 52.04  ? 11   ARG A CB  1 
ATOM   82   C CG  . ARG A 1 42  ? 33.397  4.506   46.786  1.00 51.42  ? 11   ARG A CG  1 
ATOM   83   C CD  . ARG A 1 42  ? 33.810  3.724   48.007  1.00 53.08  ? 11   ARG A CD  1 
ATOM   84   N NE  . ARG A 1 42  ? 34.268  4.558   49.138  1.00 52.68  ? 11   ARG A NE  1 
ATOM   85   C CZ  . ARG A 1 42  ? 35.485  5.058   49.252  1.00 51.81  ? 11   ARG A CZ  1 
ATOM   86   N NH1 . ARG A 1 42  ? 35.797  5.796   50.304  1.00 51.91  ? 11   ARG A NH1 1 
ATOM   87   N NH2 . ARG A 1 42  ? 36.390  4.856   48.295  1.00 52.73  ? 11   ARG A NH2 1 
ATOM   88   N N   . VAL A 1 43  ? 32.751  5.511   43.601  1.00 49.13  ? 12   VAL A N   1 
ATOM   89   C CA  . VAL A 1 43  ? 33.096  4.710   42.437  1.00 49.13  ? 12   VAL A CA  1 
ATOM   90   C C   . VAL A 1 43  ? 34.495  4.063   42.660  1.00 49.96  ? 12   VAL A C   1 
ATOM   91   O O   . VAL A 1 43  ? 35.140  4.324   43.676  1.00 49.64  ? 12   VAL A O   1 
ATOM   92   C CB  . VAL A 1 43  ? 33.056  5.561   41.162  1.00 48.03  ? 12   VAL A CB  1 
ATOM   93   C CG1 . VAL A 1 43  ? 31.645  6.134   40.924  1.00 49.02  ? 12   VAL A CG1 1 
ATOM   94   C CG2 . VAL A 1 43  ? 34.074  6.710   41.229  1.00 47.67  ? 12   VAL A CG2 1 
ATOM   95   N N   . ARG A 1 44  ? 34.959  3.238   41.721  1.00 50.04  ? 13   ARG A N   1 
ATOM   96   C CA  . ARG A 1 44  ? 36.221  2.495   41.902  1.00 52.12  ? 13   ARG A CA  1 
ATOM   97   C C   . ARG A 1 44  ? 37.445  3.384   42.186  1.00 52.15  ? 13   ARG A C   1 
ATOM   98   O O   . ARG A 1 44  ? 38.372  2.967   42.827  1.00 52.83  ? 13   ARG A O   1 
ATOM   99   C CB  . ARG A 1 44  ? 36.467  1.599   40.684  1.00 52.29  ? 13   ARG A CB  1 
ATOM   100  C CG  . ARG A 1 44  ? 37.874  1.010   40.487  1.00 54.09  ? 13   ARG A CG  1 
ATOM   101  C CD  . ARG A 1 44  ? 38.242  -0.237  41.309  1.00 55.95  ? 13   ARG A CD  1 
ATOM   102  N NE  . ARG A 1 44  ? 39.300  0.208   42.201  1.00 58.65  ? 13   ARG A NE  1 
ATOM   103  C CZ  . ARG A 1 44  ? 40.439  -0.384  42.415  1.00 59.82  ? 13   ARG A CZ  1 
ATOM   104  N NH1 . ARG A 1 44  ? 40.729  -1.539  41.874  1.00 61.03  ? 13   ARG A NH1 1 
ATOM   105  N NH2 . ARG A 1 44  ? 41.288  0.172   43.248  1.00 63.31  ? 13   ARG A NH2 1 
ATOM   106  N N   . GLY A 1 45  ? 37.442  4.617   41.720  1.00 51.86  ? 14   GLY A N   1 
ATOM   107  C CA  . GLY A 1 45  ? 38.566  5.491   41.979  1.00 52.13  ? 14   GLY A CA  1 
ATOM   108  C C   . GLY A 1 45  ? 38.445  6.380   43.211  1.00 52.68  ? 14   GLY A C   1 
ATOM   109  O O   . GLY A 1 45  ? 39.398  7.104   43.532  1.00 52.50  ? 14   GLY A O   1 
ATOM   110  N N   . GLY A 1 46  ? 37.290  6.362   43.877  1.00 52.41  ? 15   GLY A N   1 
ATOM   111  C CA  . GLY A 1 46  ? 37.104  7.164   45.068  1.00 53.18  ? 15   GLY A CA  1 
ATOM   112  C C   . GLY A 1 46  ? 35.715  7.752   45.266  1.00 53.07  ? 15   GLY A C   1 
ATOM   113  O O   . GLY A 1 46  ? 34.767  7.367   44.596  1.00 52.19  ? 15   GLY A O   1 
ATOM   114  N N   . GLN A 1 47  ? 35.614  8.669   46.227  1.00 53.89  ? 16   GLN A N   1 
ATOM   115  C CA  . GLN A 1 47  ? 34.366  9.325   46.589  1.00 54.22  ? 16   GLN A CA  1 
ATOM   116  C C   . GLN A 1 47  ? 34.048  10.505  45.693  1.00 52.84  ? 16   GLN A C   1 
ATOM   117  O O   . GLN A 1 47  ? 34.947  11.224  45.282  1.00 53.13  ? 16   GLN A O   1 
ATOM   118  C CB  . GLN A 1 47  ? 34.477  9.816   48.027  1.00 55.11  ? 16   GLN A CB  1 
ATOM   119  C CG  . GLN A 1 47  ? 34.505  8.698   49.025  1.00 57.37  ? 16   GLN A CG  1 
ATOM   120  C CD  . GLN A 1 47  ? 34.496  9.199   50.454  1.00 59.29  ? 16   GLN A CD  1 
ATOM   121  O OE1 . GLN A 1 47  ? 35.455  9.856   50.883  1.00 60.13  ? 16   GLN A OE1 1 
ATOM   122  N NE2 . GLN A 1 47  ? 33.405  8.913   51.188  1.00 57.62  ? 16   GLN A NE2 1 
ATOM   123  N N   . LEU A 1 48  ? 32.765  10.723  45.421  1.00 52.22  ? 17   LEU A N   1 
ATOM   124  C CA  . LEU A 1 48  ? 32.307  11.840  44.588  1.00 51.34  ? 17   LEU A CA  1 
ATOM   125  C C   . LEU A 1 48  ? 31.253  12.627  45.304  1.00 51.90  ? 17   LEU A C   1 
ATOM   126  O O   . LEU A 1 48  ? 30.440  12.057  46.017  1.00 52.53  ? 17   LEU A O   1 
ATOM   127  C CB  . LEU A 1 48  ? 31.640  11.332  43.306  1.00 50.39  ? 17   LEU A CB  1 
ATOM   128  C CG  . LEU A 1 48  ? 32.488  10.521  42.356  1.00 49.10  ? 17   LEU A CG  1 
ATOM   129  C CD1 . LEU A 1 48  ? 31.593  9.915   41.275  1.00 48.29  ? 17   LEU A CD1 1 
ATOM   130  C CD2 . LEU A 1 48  ? 33.559  11.428  41.798  1.00 47.48  ? 17   LEU A CD2 1 
ATOM   131  N N   . ARG A 1 49  ? 31.229  13.931  45.055  1.00 52.11  ? 18   ARG A N   1 
ATOM   132  C CA  . ARG A 1 49  ? 30.132  14.764  45.475  1.00 53.01  ? 18   ARG A CA  1 
ATOM   133  C C   . ARG A 1 49  ? 29.513  15.393  44.250  1.00 51.91  ? 18   ARG A C   1 
ATOM   134  O O   . ARG A 1 49  ? 30.184  16.119  43.531  1.00 51.15  ? 18   ARG A O   1 
ATOM   135  C CB  . ARG A 1 49  ? 30.607  15.855  46.430  1.00 54.10  ? 18   ARG A CB  1 
ATOM   136  C CG  . ARG A 1 49  ? 29.444  16.732  46.993  1.00 57.45  ? 18   ARG A CG  1 
ATOM   137  C CD  . ARG A 1 49  ? 29.855  17.783  48.031  1.00 61.23  ? 18   ARG A CD  1 
ATOM   138  N NE  . ARG A 1 49  ? 31.204  18.257  47.744  1.00 63.92  ? 18   ARG A NE  1 
ATOM   139  C CZ  . ARG A 1 49  ? 32.279  18.075  48.508  1.00 64.40  ? 18   ARG A CZ  1 
ATOM   140  N NH1 . ARG A 1 49  ? 32.226  17.461  49.688  1.00 62.94  ? 18   ARG A NH1 1 
ATOM   141  N NH2 . ARG A 1 49  ? 33.437  18.535  48.059  1.00 67.09  ? 18   ARG A NH2 1 
ATOM   142  N N   . GLY A 1 50  ? 28.238  15.110  44.020  1.00 51.62  ? 19   GLY A N   1 
ATOM   143  C CA  . GLY A 1 50  ? 27.506  15.687  42.926  1.00 51.38  ? 19   GLY A CA  1 
ATOM   144  C C   . GLY A 1 50  ? 26.677  16.872  43.363  1.00 51.89  ? 19   GLY A C   1 
ATOM   145  O O   . GLY A 1 50  ? 26.813  17.355  44.474  1.00 53.10  ? 19   GLY A O   1 
ATOM   146  N N   . ILE A 1 51  ? 25.814  17.327  42.461  1.00 51.65  ? 20   ILE A N   1 
ATOM   147  C CA  . ILE A 1 51  ? 24.978  18.509  42.671  1.00 52.25  ? 20   ILE A CA  1 
ATOM   148  C C   . ILE A 1 51  ? 23.520  18.186  42.314  1.00 52.74  ? 20   ILE A C   1 
ATOM   149  O O   . ILE A 1 51  ? 23.228  17.449  41.370  1.00 51.68  ? 20   ILE A O   1 
ATOM   150  C CB  . ILE A 1 51  ? 25.507  19.684  41.814  1.00 51.23  ? 20   ILE A CB  1 
ATOM   151  C CG1 . ILE A 1 51  ? 24.861  21.018  42.231  1.00 51.99  ? 20   ILE A CG1 1 
ATOM   152  C CG2 . ILE A 1 51  ? 25.277  19.418  40.313  1.00 50.64  ? 20   ILE A CG2 1 
ATOM   153  C CD1 . ILE A 1 51  ? 25.303  22.243  41.398  1.00 49.84  ? 20   ILE A CD1 1 
ATOM   154  N N   . ARG A 1 52  ? 22.614  18.729  43.105  1.00 54.51  ? 21   ARG A N   1 
ATOM   155  C CA  . ARG A 1 52  ? 21.191  18.604  42.868  1.00 55.85  ? 21   ARG A CA  1 
ATOM   156  C C   . ARG A 1 52  ? 20.786  19.734  41.934  1.00 55.55  ? 21   ARG A C   1 
ATOM   157  O O   . ARG A 1 52  ? 20.961  20.899  42.277  1.00 56.06  ? 21   ARG A O   1 
ATOM   158  C CB  . ARG A 1 52  ? 20.477  18.719  44.208  1.00 57.82  ? 21   ARG A CB  1 
ATOM   159  C CG  . ARG A 1 52  ? 18.949  18.694  44.173  1.00 60.36  ? 21   ARG A CG  1 
ATOM   160  C CD  . ARG A 1 52  ? 18.308  19.168  45.478  1.00 63.90  ? 21   ARG A CD  1 
ATOM   161  N NE  . ARG A 1 52  ? 17.028  19.774  45.179  1.00 69.76  ? 21   ARG A NE  1 
ATOM   162  C CZ  . ARG A 1 52  ? 15.914  19.618  45.883  1.00 74.88  ? 21   ARG A CZ  1 
ATOM   163  N NH1 . ARG A 1 52  ? 15.893  18.895  47.007  1.00 78.64  ? 21   ARG A NH1 1 
ATOM   164  N NH2 . ARG A 1 52  ? 14.799  20.212  45.467  1.00 75.48  ? 21   ARG A NH2 1 
ATOM   165  N N   . LEU A 1 53  ? 20.302  19.384  40.748  1.00 55.10  ? 22   LEU A N   1 
ATOM   166  C CA  . LEU A 1 53  ? 19.915  20.354  39.731  1.00 55.56  ? 22   LEU A CA  1 
ATOM   167  C C   . LEU A 1 53  ? 18.422  20.432  39.610  1.00 56.37  ? 22   LEU A C   1 
ATOM   168  O O   . LEU A 1 53  ? 17.722  19.497  39.896  1.00 55.92  ? 22   LEU A O   1 
ATOM   169  C CB  . LEU A 1 53  ? 20.479  19.978  38.359  1.00 54.50  ? 22   LEU A CB  1 
ATOM   170  C CG  . LEU A 1 53  ? 22.004  19.924  38.209  1.00 54.83  ? 22   LEU A CG  1 
ATOM   171  C CD1 . LEU A 1 53  ? 22.344  19.361  36.839  1.00 54.94  ? 22   LEU A CD1 1 
ATOM   172  C CD2 . LEU A 1 53  ? 22.671  21.273  38.433  1.00 54.14  ? 22   LEU A CD2 1 
ATOM   173  N N   . LYS A 1 54  ? 17.945  21.561  39.132  1.00 57.96  ? 23   LYS A N   1 
ATOM   174  C CA  . LYS A 1 54  ? 16.530  21.741  38.906  1.00 59.58  ? 23   LYS A CA  1 
ATOM   175  C C   . LYS A 1 54  ? 16.206  21.352  37.469  1.00 58.14  ? 23   LYS A C   1 
ATOM   176  O O   . LYS A 1 54  ? 16.854  21.798  36.562  1.00 56.88  ? 23   LYS A O   1 
ATOM   177  C CB  . LYS A 1 54  ? 16.170  23.189  39.166  1.00 61.19  ? 23   LYS A CB  1 
ATOM   178  C CG  . LYS A 1 54  ? 14.942  23.388  40.030  1.00 66.41  ? 23   LYS A CG  1 
ATOM   179  C CD  . LYS A 1 54  ? 14.490  24.877  39.987  1.00 71.33  ? 23   LYS A CD  1 
ATOM   180  C CE  . LYS A 1 54  ? 13.796  25.248  38.635  1.00 72.63  ? 23   LYS A CE  1 
ATOM   181  N NZ  . LYS A 1 54  ? 12.317  25.452  38.791  1.00 74.75  ? 23   LYS A NZ  1 
ATOM   182  N N   . ALA A 1 55  ? 15.238  20.464  37.278  1.00 58.23  ? 24   ALA A N   1 
ATOM   183  C CA  . ALA A 1 55  ? 14.592  20.308  35.973  1.00 57.58  ? 24   ALA A CA  1 
ATOM   184  C C   . ALA A 1 55  ? 13.144  20.788  36.109  1.00 58.39  ? 24   ALA A C   1 
ATOM   185  O O   . ALA A 1 55  ? 12.663  20.986  37.224  1.00 59.47  ? 24   ALA A O   1 
ATOM   186  C CB  . ALA A 1 55  ? 14.676  18.868  35.476  1.00 56.85  ? 24   ALA A CB  1 
ATOM   187  N N   . PRO A 1 56  ? 12.468  21.043  34.990  1.00 58.27  ? 25   PRO A N   1 
ATOM   188  C CA  . PRO A 1 56  ? 11.064  21.517  35.023  1.00 58.85  ? 25   PRO A CA  1 
ATOM   189  C C   . PRO A 1 56  ? 10.129  20.723  35.957  1.00 59.09  ? 25   PRO A C   1 
ATOM   190  O O   . PRO A 1 56  ? 9.471   21.333  36.764  1.00 59.94  ? 25   PRO A O   1 
ATOM   191  C CB  . PRO A 1 56  ? 10.615  21.400  33.563  1.00 58.37  ? 25   PRO A CB  1 
ATOM   192  C CG  . PRO A 1 56  ? 11.871  21.517  32.769  1.00 57.37  ? 25   PRO A CG  1 
ATOM   193  C CD  . PRO A 1 56  ? 12.990  20.937  33.611  1.00 56.88  ? 25   PRO A CD  1 
ATOM   194  N N   . GLY A 1 57  ? 10.109  19.401  35.875  1.00 58.47  ? 26   GLY A N   1 
ATOM   195  C CA  . GLY A 1 57  ? 9.237   18.583  36.708  1.00 59.26  ? 26   GLY A CA  1 
ATOM   196  C C   . GLY A 1 57  ? 9.732   18.216  38.109  1.00 59.46  ? 26   GLY A C   1 
ATOM   197  O O   . GLY A 1 57  ? 8.999   17.572  38.852  1.00 60.13  ? 26   GLY A O   1 
ATOM   198  N N   . GLY A 1 58  ? 10.965  18.595  38.458  1.00 58.52  ? 27   GLY A N   1 
ATOM   199  C CA  . GLY A 1 58  ? 11.558  18.280  39.754  1.00 58.48  ? 27   GLY A CA  1 
ATOM   200  C C   . GLY A 1 58  ? 13.083  18.119  39.731  1.00 57.20  ? 27   GLY A C   1 
ATOM   201  O O   . GLY A 1 58  ? 13.735  18.335  38.708  1.00 56.41  ? 27   GLY A O   1 
ATOM   202  N N   . PRO A 1 59  ? 13.664  17.745  40.863  1.00 56.77  ? 28   PRO A N   1 
ATOM   203  C CA  . PRO A 1 59  ? 15.128  17.655  40.981  1.00 55.35  ? 28   PRO A CA  1 
ATOM   204  C C   . PRO A 1 59  ? 15.742  16.448  40.276  1.00 53.99  ? 28   PRO A C   1 
ATOM   205  O O   . PRO A 1 59  ? 15.037  15.449  40.118  1.00 53.57  ? 28   PRO A O   1 
ATOM   206  C CB  . PRO A 1 59  ? 15.363  17.550  42.488  1.00 56.00  ? 28   PRO A CB  1 
ATOM   207  C CG  . PRO A 1 59  ? 14.015  17.011  43.061  1.00 58.03  ? 28   PRO A CG  1 
ATOM   208  C CD  . PRO A 1 59  ? 12.956  17.395  42.112  1.00 57.80  ? 28   PRO A CD  1 
ATOM   209  N N   . VAL A 1 60  ? 17.009  16.579  39.846  1.00 52.34  ? 29   VAL A N   1 
ATOM   210  C CA  . VAL A 1 60  ? 17.832  15.462  39.407  1.00 51.85  ? 29   VAL A CA  1 
ATOM   211  C C   . VAL A 1 60  ? 19.205  15.549  40.057  1.00 51.45  ? 29   VAL A C   1 
ATOM   212  O O   . VAL A 1 60  ? 19.605  16.611  40.517  1.00 51.46  ? 29   VAL A O   1 
ATOM   213  C CB  . VAL A 1 60  ? 18.048  15.407  37.865  1.00 51.11  ? 29   VAL A CB  1 
ATOM   214  C CG1 . VAL A 1 60  ? 16.752  15.146  37.137  1.00 51.69  ? 29   VAL A CG1 1 
ATOM   215  C CG2 . VAL A 1 60  ? 18.684  16.687  37.345  1.00 51.43  ? 29   VAL A CG2 1 
ATOM   216  N N   . SER A 1 61  ? 19.914  14.423  40.098  1.00 50.36  ? 30   SER A N   1 
ATOM   217  C CA  . SER A 1 61  ? 21.280  14.391  40.567  1.00 50.06  ? 30   SER A CA  1 
ATOM   218  C C   . SER A 1 61  ? 22.223  14.399  39.370  1.00 48.22  ? 30   SER A C   1 
ATOM   219  O O   . SER A 1 61  ? 22.024  13.651  38.420  1.00 47.61  ? 30   SER A O   1 
ATOM   220  C CB  . SER A 1 61  ? 21.505  13.124  41.372  1.00 50.54  ? 30   SER A CB  1 
ATOM   221  O OG  . SER A 1 61  ? 20.630  13.039  42.487  1.00 52.79  ? 30   SER A OG  1 
ATOM   222  N N   . ALA A 1 62  ? 23.254  15.223  39.416  1.00 47.21  ? 31   ALA A N   1 
ATOM   223  C CA  . ALA A 1 62  ? 24.292  15.195  38.387  1.00 45.98  ? 31   ALA A CA  1 
ATOM   224  C C   . ALA A 1 62  ? 25.662  15.091  39.006  1.00 45.52  ? 31   ALA A C   1 
ATOM   225  O O   . ALA A 1 62  ? 25.955  15.765  39.996  1.00 45.78  ? 31   ALA A O   1 
ATOM   226  C CB  . ALA A 1 62  ? 24.243  16.422  37.540  1.00 46.20  ? 31   ALA A CB  1 
ATOM   227  N N   . PHE A 1 63  ? 26.496  14.244  38.402  1.00 44.59  ? 32   PHE A N   1 
ATOM   228  C CA  . PHE A 1 63  ? 27.868  14.039  38.805  1.00 43.39  ? 32   PHE A CA  1 
ATOM   229  C C   . PHE A 1 63  ? 28.670  14.380  37.587  1.00 42.90  ? 32   PHE A C   1 
ATOM   230  O O   . PHE A 1 63  ? 28.726  13.613  36.637  1.00 43.28  ? 32   PHE A O   1 
ATOM   231  C CB  . PHE A 1 63  ? 28.051  12.601  39.252  1.00 42.99  ? 32   PHE A CB  1 
ATOM   232  C CG  . PHE A 1 63  ? 27.269  12.268  40.468  1.00 43.05  ? 32   PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 63  ? 25.923  11.943  40.373  1.00 44.58  ? 32   PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 63  ? 27.846  12.307  41.715  1.00 42.92  ? 32   PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 63  ? 25.168  11.654  41.498  1.00 42.28  ? 32   PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 63  ? 27.083  12.015  42.851  1.00 44.70  ? 32   PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 63  ? 25.752  11.695  42.734  1.00 42.58  ? 32   PHE A CZ  1 
ATOM   238  N N   . LEU A 1 64  ? 29.212  15.579  37.572  1.00 42.73  ? 33   LEU A N   1 
ATOM   239  C CA  . LEU A 1 64  ? 29.836  16.137  36.387  1.00 42.08  ? 33   LEU A CA  1 
ATOM   240  C C   . LEU A 1 64  ? 31.328  16.223  36.588  1.00 42.28  ? 33   LEU A C   1 
ATOM   241  O O   . LEU A 1 64  ? 31.777  16.519  37.687  1.00 43.37  ? 33   LEU A O   1 
ATOM   242  C CB  . LEU A 1 64  ? 29.297  17.547  36.153  1.00 42.43  ? 33   LEU A CB  1 
ATOM   243  C CG  . LEU A 1 64  ? 27.787  17.727  36.034  1.00 42.01  ? 33   LEU A CG  1 
ATOM   244  C CD1 . LEU A 1 64  ? 27.425  19.205  35.931  1.00 43.46  ? 33   LEU A CD1 1 
ATOM   245  C CD2 . LEU A 1 64  ? 27.232  16.956  34.849  1.00 41.56  ? 33   LEU A CD2 1 
ATOM   246  N N   . GLY A 1 65  ? 32.100  15.924  35.549  1.00 41.89  ? 34   GLY A N   1 
ATOM   247  C CA  . GLY A 1 65  ? 33.543  16.052  35.604  1.00 41.80  ? 34   GLY A CA  1 
ATOM   248  C C   . GLY A 1 65  ? 34.259  14.955  36.352  1.00 42.29  ? 34   GLY A C   1 
ATOM   249  O O   . GLY A 1 65  ? 35.272  15.202  37.024  1.00 42.81  ? 34   GLY A O   1 
ATOM   250  N N   . ILE A 1 66  ? 33.754  13.728  36.233  1.00 42.80  ? 35   ILE A N   1 
ATOM   251  C CA  . ILE A 1 66  ? 34.395  12.565  36.854  1.00 43.00  ? 35   ILE A CA  1 
ATOM   252  C C   . ILE A 1 66  ? 35.530  12.134  35.946  1.00 43.43  ? 35   ILE A C   1 
ATOM   253  O O   . ILE A 1 66  ? 35.292  11.836  34.789  1.00 43.54  ? 35   ILE A O   1 
ATOM   254  C CB  . ILE A 1 66  ? 33.431  11.370  36.960  1.00 42.96  ? 35   ILE A CB  1 
ATOM   255  C CG1 . ILE A 1 66  ? 32.169  11.748  37.729  1.00 43.58  ? 35   ILE A CG1 1 
ATOM   256  C CG2 . ILE A 1 66  ? 34.139  10.190  37.615  1.00 43.92  ? 35   ILE A CG2 1 
ATOM   257  C CD1 . ILE A 1 66  ? 31.089  10.715  37.650  1.00 43.53  ? 35   ILE A CD1 1 
ATOM   258  N N   . PRO A 1 67  ? 36.756  12.047  36.437  1.00 44.20  ? 36   PRO A N   1 
ATOM   259  C CA  . PRO A 1 67  ? 37.861  11.619  35.564  1.00 43.76  ? 36   PRO A CA  1 
ATOM   260  C C   . PRO A 1 67  ? 37.762  10.135  35.343  1.00 43.85  ? 36   PRO A C   1 
ATOM   261  O O   . PRO A 1 67  ? 37.535  9.452   36.329  1.00 44.68  ? 36   PRO A O   1 
ATOM   262  C CB  . PRO A 1 67  ? 39.113  11.929  36.393  1.00 44.72  ? 36   PRO A CB  1 
ATOM   263  C CG  . PRO A 1 67  ? 38.651  11.895  37.817  1.00 44.91  ? 36   PRO A CG  1 
ATOM   264  C CD  . PRO A 1 67  ? 37.198  12.309  37.819  1.00 44.43  ? 36   PRO A CD  1 
ATOM   265  N N   . PHE A 1 68  ? 37.920  9.658   34.107  1.00 43.61  ? 37   PHE A N   1 
ATOM   266  C CA  . PHE A 1 68  ? 37.920  8.223   33.800  1.00 43.11  ? 37   PHE A CA  1 
ATOM   267  C C   . PHE A 1 68  ? 39.252  7.741   33.231  1.00 44.04  ? 37   PHE A C   1 
ATOM   268  O O   . PHE A 1 68  ? 39.444  6.536   33.015  1.00 45.10  ? 37   PHE A O   1 
ATOM   269  C CB  . PHE A 1 68  ? 36.755  7.858   32.879  1.00 42.33  ? 37   PHE A CB  1 
ATOM   270  C CG  . PHE A 1 68  ? 36.829  8.441   31.486  1.00 41.60  ? 37   PHE A CG  1 
ATOM   271  C CD1 . PHE A 1 68  ? 37.457  7.743   30.455  1.00 41.53  ? 37   PHE A CD1 1 
ATOM   272  C CD2 . PHE A 1 68  ? 36.200  9.652   31.185  1.00 42.21  ? 37   PHE A CD2 1 
ATOM   273  C CE1 . PHE A 1 68  ? 37.524  8.261   29.148  1.00 40.65  ? 37   PHE A CE1 1 
ATOM   274  C CE2 . PHE A 1 68  ? 36.257  10.189  29.882  1.00 41.53  ? 37   PHE A CE2 1 
ATOM   275  C CZ  . PHE A 1 68  ? 36.934  9.476   28.863  1.00 43.07  ? 37   PHE A CZ  1 
ATOM   276  N N   . ALA A 1 69  ? 40.175  8.668   32.994  1.00 44.28  ? 38   ALA A N   1 
ATOM   277  C CA  . ALA A 1 69  ? 41.517  8.336   32.505  1.00 44.74  ? 38   ALA A CA  1 
ATOM   278  C C   . ALA A 1 69  ? 42.570  9.230   33.138  1.00 45.19  ? 38   ALA A C   1 
ATOM   279  O O   . ALA A 1 69  ? 42.263  10.303  33.636  1.00 45.61  ? 38   ALA A O   1 
ATOM   280  C CB  . ALA A 1 69  ? 41.587  8.505   31.027  1.00 44.99  ? 38   ALA A CB  1 
ATOM   281  N N   . GLU A 1 70  ? 43.811  8.787   33.115  1.00 45.48  ? 39   GLU A N   1 
ATOM   282  C CA  . GLU A 1 70  ? 44.931  9.666   33.414  1.00 46.84  ? 39   GLU A CA  1 
ATOM   283  C C   . GLU A 1 70  ? 44.974  10.758  32.368  1.00 46.53  ? 39   GLU A C   1 
ATOM   284  O O   . GLU A 1 70  ? 44.754  10.497  31.192  1.00 46.74  ? 39   GLU A O   1 
ATOM   285  C CB  . GLU A 1 70  ? 46.247  8.883   33.382  1.00 47.68  ? 39   GLU A CB  1 
ATOM   286  C CG  . GLU A 1 70  ? 46.418  7.994   34.616  1.00 50.35  ? 39   GLU A CG  1 
ATOM   287  C CD  . GLU A 1 70  ? 46.470  8.826   35.885  1.00 53.68  ? 39   GLU A CD  1 
ATOM   288  O OE1 . GLU A 1 70  ? 47.332  9.723   35.966  1.00 59.69  ? 39   GLU A OE1 1 
ATOM   289  O OE2 . GLU A 1 70  ? 45.636  8.639   36.775  1.00 52.69  ? 39   GLU A OE2 1 
ATOM   290  N N   . PRO A 1 71  ? 45.232  11.987  32.770  1.00 47.05  ? 40   PRO A N   1 
ATOM   291  C CA  . PRO A 1 71  ? 45.336  13.072  31.781  1.00 46.59  ? 40   PRO A CA  1 
ATOM   292  C C   . PRO A 1 71  ? 46.326  12.676  30.668  1.00 46.76  ? 40   PRO A C   1 
ATOM   293  O O   . PRO A 1 71  ? 47.477  12.294  30.964  1.00 48.02  ? 40   PRO A O   1 
ATOM   294  C CB  . PRO A 1 71  ? 45.870  14.247  32.603  1.00 47.25  ? 40   PRO A CB  1 
ATOM   295  C CG  . PRO A 1 71  ? 45.503  13.916  34.040  1.00 47.88  ? 40   PRO A CG  1 
ATOM   296  C CD  . PRO A 1 71  ? 45.502  12.433  34.149  1.00 47.60  ? 40   PRO A CD  1 
ATOM   297  N N   . PRO A 1 72  ? 45.882  12.689  29.425  1.00 45.65  ? 41   PRO A N   1 
ATOM   298  C CA  . PRO A 1 72  ? 46.715  12.244  28.305  1.00 45.54  ? 41   PRO A CA  1 
ATOM   299  C C   . PRO A 1 72  ? 47.648  13.359  27.786  1.00 45.47  ? 41   PRO A C   1 
ATOM   300  O O   . PRO A 1 72  ? 47.604  13.743  26.620  1.00 43.87  ? 41   PRO A O   1 
ATOM   301  C CB  . PRO A 1 72  ? 45.674  11.850  27.271  1.00 45.05  ? 41   PRO A CB  1 
ATOM   302  C CG  . PRO A 1 72  ? 44.601  12.887  27.476  1.00 45.43  ? 41   PRO A CG  1 
ATOM   303  C CD  . PRO A 1 72  ? 44.534  13.080  28.982  1.00 45.59  ? 41   PRO A CD  1 
ATOM   304  N N   . VAL A 1 73  ? 48.523  13.822  28.671  1.00 45.99  ? 42   VAL A N   1 
ATOM   305  C CA  . VAL A 1 73  ? 49.368  14.981  28.419  1.00 46.57  ? 42   VAL A CA  1 
ATOM   306  C C   . VAL A 1 73  ? 50.840  14.561  28.383  1.00 47.66  ? 42   VAL A C   1 
ATOM   307  O O   . VAL A 1 73  ? 51.198  13.534  28.926  1.00 47.60  ? 42   VAL A O   1 
ATOM   308  C CB  . VAL A 1 73  ? 49.146  16.062  29.506  1.00 46.98  ? 42   VAL A CB  1 
ATOM   309  C CG1 . VAL A 1 73  ? 47.668  16.469  29.557  1.00 47.70  ? 42   VAL A CG1 1 
ATOM   310  C CG2 . VAL A 1 73  ? 49.584  15.579  30.908  1.00 46.36  ? 42   VAL A CG2 1 
ATOM   311  N N   . GLY A 1 74  ? 51.682  15.353  27.739  1.00 48.58  ? 43   GLY A N   1 
ATOM   312  C CA  . GLY A 1 74  ? 53.119  15.124  27.775  1.00 49.99  ? 43   GLY A CA  1 
ATOM   313  C C   . GLY A 1 74  ? 53.504  13.933  26.922  1.00 50.47  ? 43   GLY A C   1 
ATOM   314  O O   . GLY A 1 74  ? 53.220  13.906  25.725  1.00 50.85  ? 43   GLY A O   1 
ATOM   315  N N   . SER A 1 75  ? 54.127  12.925  27.525  1.00 51.76  ? 44   SER A N   1 
ATOM   316  C CA  . SER A 1 75  ? 54.496  11.707  26.783  1.00 52.38  ? 44   SER A CA  1 
ATOM   317  C C   . SER A 1 75  ? 53.288  10.828  26.448  1.00 51.86  ? 44   SER A C   1 
ATOM   318  O O   . SER A 1 75  ? 53.422  9.894   25.686  1.00 52.09  ? 44   SER A O   1 
ATOM   319  C CB  . SER A 1 75  ? 55.546  10.891  27.542  1.00 53.13  ? 44   SER A CB  1 
ATOM   320  O OG  . SER A 1 75  ? 55.003  10.330  28.722  1.00 51.77  ? 44   SER A OG  1 
ATOM   321  N N   . ARG A 1 76  ? 52.126  11.141  27.014  1.00 51.74  ? 45   ARG A N   1 
ATOM   322  C CA  . ARG A 1 76  ? 50.887  10.404  26.760  1.00 51.63  ? 45   ARG A CA  1 
ATOM   323  C C   . ARG A 1 76  ? 50.038  10.965  25.617  1.00 49.50  ? 45   ARG A C   1 
ATOM   324  O O   . ARG A 1 76  ? 48.989  10.406  25.282  1.00 48.90  ? 45   ARG A O   1 
ATOM   325  C CB  . ARG A 1 76  ? 50.064  10.367  28.044  1.00 52.36  ? 45   ARG A CB  1 
ATOM   326  C CG  . ARG A 1 76  ? 50.812  9.776   29.219  1.00 57.80  ? 45   ARG A CG  1 
ATOM   327  C CD  . ARG A 1 76  ? 50.212  8.476   29.756  1.00 65.65  ? 45   ARG A CD  1 
ATOM   328  N NE  . ARG A 1 76  ? 49.732  8.561   31.157  1.00 69.56  ? 45   ARG A NE  1 
ATOM   329  C CZ  . ARG A 1 76  ? 50.499  8.403   32.252  1.00 74.10  ? 45   ARG A CZ  1 
ATOM   330  N NH1 . ARG A 1 76  ? 49.939  8.474   33.458  1.00 77.06  ? 45   ARG A NH1 1 
ATOM   331  N NH2 . ARG A 1 76  ? 51.820  8.188   32.167  1.00 75.93  ? 45   ARG A NH2 1 
ATOM   332  N N   . ARG A 1 77  ? 50.483  12.054  25.007  1.00 48.23  ? 46   ARG A N   1 
ATOM   333  C CA  . ARG A 1 77  ? 49.798  12.558  23.821  1.00 46.69  ? 46   ARG A CA  1 
ATOM   334  C C   . ARG A 1 77  ? 49.945  11.581  22.660  1.00 46.04  ? 46   ARG A C   1 
ATOM   335  O O   . ARG A 1 77  ? 51.013  11.023  22.443  1.00 46.57  ? 46   ARG A O   1 
ATOM   336  C CB  . ARG A 1 77  ? 50.317  13.949  23.467  1.00 46.62  ? 46   ARG A CB  1 
ATOM   337  C CG  . ARG A 1 77  ? 49.639  14.594  22.298  1.00 45.29  ? 46   ARG A CG  1 
ATOM   338  C CD  . ARG A 1 77  ? 50.439  15.724  21.673  1.00 45.12  ? 46   ARG A CD  1 
ATOM   339  N NE  . ARG A 1 77  ? 50.322  16.938  22.457  1.00 45.13  ? 46   ARG A NE  1 
ATOM   340  C CZ  . ARG A 1 77  ? 50.936  18.064  22.164  1.00 46.53  ? 46   ARG A CZ  1 
ATOM   341  N NH1 . ARG A 1 77  ? 51.728  18.107  21.124  1.00 49.15  ? 46   ARG A NH1 1 
ATOM   342  N NH2 . ARG A 1 77  ? 50.777  19.143  22.920  1.00 44.84  ? 46   ARG A NH2 1 
ATOM   343  N N   . PHE A 1 78  ? 48.853  11.402  21.919  1.00 45.22  ? 47   PHE A N   1 
ATOM   344  C CA  . PHE A 1 78  ? 48.707  10.413  20.854  1.00 44.80  ? 47   PHE A CA  1 
ATOM   345  C C   . PHE A 1 78  ? 48.611  8.958   21.310  1.00 45.90  ? 47   PHE A C   1 
ATOM   346  O O   . PHE A 1 78  ? 48.425  8.074   20.454  1.00 46.53  ? 47   PHE A O   1 
ATOM   347  C CB  . PHE A 1 78  ? 49.829  10.522  19.813  1.00 44.93  ? 47   PHE A CB  1 
ATOM   348  C CG  . PHE A 1 78  ? 50.111  11.928  19.350  1.00 44.15  ? 47   PHE A CG  1 
ATOM   349  C CD1 . PHE A 1 78  ? 49.091  12.731  18.853  1.00 42.29  ? 47   PHE A CD1 1 
ATOM   350  C CD2 . PHE A 1 78  ? 51.410  12.445  19.405  1.00 43.75  ? 47   PHE A CD2 1 
ATOM   351  C CE1 . PHE A 1 78  ? 49.353  14.003  18.406  1.00 41.83  ? 47   PHE A CE1 1 
ATOM   352  C CE2 . PHE A 1 78  ? 51.671  13.717  18.961  1.00 42.33  ? 47   PHE A CE2 1 
ATOM   353  C CZ  . PHE A 1 78  ? 50.641  14.509  18.477  1.00 40.08  ? 47   PHE A CZ  1 
ATOM   354  N N   . MET A 1 79  ? 48.721  8.707   22.618  1.00 46.14  ? 48   MET A N   1 
ATOM   355  C CA  . MET A 1 79  ? 48.723  7.364   23.173  1.00 46.84  ? 48   MET A CA  1 
ATOM   356  C C   . MET A 1 79  ? 47.343  6.909   23.647  1.00 45.97  ? 48   MET A C   1 
ATOM   357  O O   . MET A 1 79  ? 46.529  7.726   24.063  1.00 45.05  ? 48   MET A O   1 
ATOM   358  C CB  . MET A 1 79  ? 49.679  7.300   24.382  1.00 47.81  ? 48   MET A CB  1 
ATOM   359  C CG  . MET A 1 79  ? 51.175  7.540   24.048  1.00 50.22  ? 48   MET A CG  1 
ATOM   360  S SD  . MET A 1 79  ? 51.891  6.171   23.086  1.00 54.54  ? 48   MET A SD  1 
ATOM   361  C CE  . MET A 1 79  ? 52.135  4.942   24.431  1.00 53.06  ? 48   MET A CE  1 
ATOM   362  N N   . PRO A 1 80  ? 47.122  5.596   23.685  1.00 46.69  ? 49   PRO A N   1 
ATOM   363  C CA  . PRO A 1 80  ? 45.903  5.043   24.275  1.00 46.80  ? 49   PRO A CA  1 
ATOM   364  C C   . PRO A 1 80  ? 45.728  5.535   25.714  1.00 47.08  ? 49   PRO A C   1 
ATOM   365  O O   . PRO A 1 80  ? 46.723  5.690   26.421  1.00 47.95  ? 49   PRO A O   1 
ATOM   366  C CB  . PRO A 1 80  ? 46.148  3.523   24.264  1.00 47.28  ? 49   PRO A CB  1 
ATOM   367  C CG  . PRO A 1 80  ? 47.223  3.280   23.305  1.00 47.76  ? 49   PRO A CG  1 
ATOM   368  C CD  . PRO A 1 80  ? 48.039  4.530   23.229  1.00 47.74  ? 49   PRO A CD  1 
ATOM   369  N N   . PRO A 1 81  ? 44.494  5.725   26.158  1.00 46.38  ? 50   PRO A N   1 
ATOM   370  C CA  . PRO A 1 81  ? 44.247  6.209   27.507  1.00 46.76  ? 50   PRO A CA  1 
ATOM   371  C C   . PRO A 1 81  ? 44.594  5.123   28.515  1.00 48.52  ? 50   PRO A C   1 
ATOM   372  O O   . PRO A 1 81  ? 44.442  3.921   28.225  1.00 48.33  ? 50   PRO A O   1 
ATOM   373  C CB  . PRO A 1 81  ? 42.745  6.466   27.509  1.00 46.01  ? 50   PRO A CB  1 
ATOM   374  C CG  . PRO A 1 81  ? 42.214  5.507   26.531  1.00 45.46  ? 50   PRO A CG  1 
ATOM   375  C CD  . PRO A 1 81  ? 43.251  5.406   25.455  1.00 46.01  ? 50   PRO A CD  1 
ATOM   376  N N   . GLU A 1 82  ? 45.086  5.541   29.678  1.00 50.01  ? 51   GLU A N   1 
ATOM   377  C CA  . GLU A 1 82  ? 45.226  4.637   30.819  1.00 51.71  ? 51   GLU A CA  1 
ATOM   378  C C   . GLU A 1 82  ? 44.120  4.962   31.818  1.00 50.27  ? 51   GLU A C   1 
ATOM   379  O O   . GLU A 1 82  ? 43.711  6.109   31.957  1.00 49.43  ? 51   GLU A O   1 
ATOM   380  C CB  . GLU A 1 82  ? 46.573  4.818   31.482  1.00 53.72  ? 51   GLU A CB  1 
ATOM   381  C CG  . GLU A 1 82  ? 47.755  4.777   30.522  1.00 59.23  ? 51   GLU A CG  1 
ATOM   382  C CD  . GLU A 1 82  ? 49.053  4.516   31.283  1.00 68.12  ? 51   GLU A CD  1 
ATOM   383  O OE1 . GLU A 1 82  ? 49.679  3.420   31.083  1.00 72.13  ? 51   GLU A OE1 1 
ATOM   384  O OE2 . GLU A 1 82  ? 49.403  5.396   32.129  1.00 72.23  ? 51   GLU A OE2 1 
ATOM   385  N N   . PRO A 1 83  ? 43.619  3.957   32.515  1.00 50.20  ? 52   PRO A N   1 
ATOM   386  C CA  . PRO A 1 83  ? 42.576  4.210   33.526  1.00 49.41  ? 52   PRO A CA  1 
ATOM   387  C C   . PRO A 1 83  ? 43.029  5.181   34.635  1.00 49.04  ? 52   PRO A C   1 
ATOM   388  O O   . PRO A 1 83  ? 44.186  5.150   35.059  1.00 48.74  ? 52   PRO A O   1 
ATOM   389  C CB  . PRO A 1 83  ? 42.276  2.814   34.070  1.00 50.42  ? 52   PRO A CB  1 
ATOM   390  C CG  . PRO A 1 83  ? 42.828  1.874   33.043  1.00 51.02  ? 52   PRO A CG  1 
ATOM   391  C CD  . PRO A 1 83  ? 43.972  2.531   32.385  1.00 49.96  ? 52   PRO A CD  1 
ATOM   392  N N   . LYS A 1 84  ? 42.105  6.010   35.112  1.00 48.46  ? 53   LYS A N   1 
ATOM   393  C CA  . LYS A 1 84  ? 42.405  6.985   36.155  1.00 48.94  ? 53   LYS A CA  1 
ATOM   394  C C   . LYS A 1 84  ? 42.838  6.310   37.462  1.00 50.44  ? 53   LYS A C   1 
ATOM   395  O O   . LYS A 1 84  ? 42.228  5.357   37.911  1.00 50.34  ? 53   LYS A O   1 
ATOM   396  C CB  . LYS A 1 84  ? 41.199  7.878   36.376  1.00 48.23  ? 53   LYS A CB  1 
ATOM   397  C CG  . LYS A 1 84  ? 41.298  8.812   37.551  1.00 48.49  ? 53   LYS A CG  1 
ATOM   398  C CD  . LYS A 1 84  ? 42.353  9.895   37.351  1.00 46.96  ? 53   LYS A CD  1 
ATOM   399  C CE  . LYS A 1 84  ? 42.229  10.990  38.417  1.00 45.30  ? 53   LYS A CE  1 
ATOM   400  N NZ  . LYS A 1 84  ? 43.233  12.055  38.244  1.00 43.60  ? 53   LYS A NZ  1 
ATOM   401  N N   . ARG A 1 85  ? 43.922  6.790   38.053  1.00 51.56  ? 54   ARG A N   1 
ATOM   402  C CA  . ARG A 1 85  ? 44.400  6.247   39.315  1.00 53.51  ? 54   ARG A CA  1 
ATOM   403  C C   . ARG A 1 85  ? 43.496  6.755   40.443  1.00 53.05  ? 54   ARG A C   1 
ATOM   404  O O   . ARG A 1 85  ? 43.042  7.892   40.394  1.00 52.92  ? 54   ARG A O   1 
ATOM   405  C CB  . ARG A 1 85  ? 45.882  6.596   39.514  1.00 54.87  ? 54   ARG A CB  1 
ATOM   406  C CG  . ARG A 1 85  ? 46.782  5.812   38.523  1.00 59.82  ? 54   ARG A CG  1 
ATOM   407  C CD  . ARG A 1 85  ? 48.249  5.682   38.947  1.00 68.35  ? 54   ARG A CD  1 
ATOM   408  N NE  . ARG A 1 85  ? 48.818  7.016   39.155  1.00 74.23  ? 54   ARG A NE  1 
ATOM   409  C CZ  . ARG A 1 85  ? 49.656  7.649   38.317  1.00 78.94  ? 54   ARG A CZ  1 
ATOM   410  N NH1 . ARG A 1 85  ? 50.099  7.065   37.187  1.00 79.93  ? 54   ARG A NH1 1 
ATOM   411  N NH2 . ARG A 1 85  ? 50.068  8.888   38.625  1.00 79.85  ? 54   ARG A NH2 1 
ATOM   412  N N   . PRO A 1 86  ? 43.186  5.912   41.423  1.00 53.17  ? 55   PRO A N   1 
ATOM   413  C CA  . PRO A 1 86  ? 42.326  6.340   42.526  1.00 53.32  ? 55   PRO A CA  1 
ATOM   414  C C   . PRO A 1 86  ? 42.846  7.622   43.185  1.00 53.61  ? 55   PRO A C   1 
ATOM   415  O O   . PRO A 1 86  ? 44.058  7.870   43.231  1.00 53.97  ? 55   PRO A O   1 
ATOM   416  C CB  . PRO A 1 86  ? 42.369  5.161   43.499  1.00 53.71  ? 55   PRO A CB  1 
ATOM   417  C CG  . PRO A 1 86  ? 42.699  4.000   42.662  1.00 54.04  ? 55   PRO A CG  1 
ATOM   418  C CD  . PRO A 1 86  ? 43.609  4.505   41.556  1.00 53.53  ? 55   PRO A CD  1 
ATOM   419  N N   . TRP A 1 87  ? 41.914  8.408   43.713  1.00 53.33  ? 56   TRP A N   1 
ATOM   420  C CA  . TRP A 1 87  ? 42.215  9.666   44.380  1.00 53.66  ? 56   TRP A CA  1 
ATOM   421  C C   . TRP A 1 87  ? 41.788  9.574   45.838  1.00 54.74  ? 56   TRP A C   1 
ATOM   422  O O   . TRP A 1 87  ? 41.137  8.591   46.280  1.00 55.62  ? 56   TRP A O   1 
ATOM   423  C CB  . TRP A 1 87  ? 41.509  10.814  43.656  1.00 53.38  ? 56   TRP A CB  1 
ATOM   424  C CG  . TRP A 1 87  ? 39.994  10.659  43.648  1.00 56.09  ? 56   TRP A CG  1 
ATOM   425  C CD1 . TRP A 1 87  ? 39.132  11.008  44.648  1.00 58.82  ? 56   TRP A CD1 1 
ATOM   426  C CD2 . TRP A 1 87  ? 39.182  10.093  42.607  1.00 55.37  ? 56   TRP A CD2 1 
ATOM   427  N NE1 . TRP A 1 87  ? 37.839  10.723  44.278  1.00 59.40  ? 56   TRP A NE1 1 
ATOM   428  C CE2 . TRP A 1 87  ? 37.848  10.153  43.032  1.00 56.49  ? 56   TRP A CE2 1 
ATOM   429  C CE3 . TRP A 1 87  ? 39.449  9.564   41.347  1.00 55.25  ? 56   TRP A CE3 1 
ATOM   430  C CZ2 . TRP A 1 87  ? 36.800  9.697   42.257  1.00 54.64  ? 56   TRP A CZ2 1 
ATOM   431  C CZ3 . TRP A 1 87  ? 38.411  9.113   40.587  1.00 54.17  ? 56   TRP A CZ3 1 
ATOM   432  C CH2 . TRP A 1 87  ? 37.105  9.172   41.045  1.00 54.67  ? 56   TRP A CH2 1 
ATOM   433  N N   . SER A 1 88  ? 42.192  10.572  46.604  1.00 55.83  ? 57   SER A N   1 
ATOM   434  C CA  . SER A 1 88  ? 41.844  10.595  48.006  1.00 57.07  ? 57   SER A CA  1 
ATOM   435  C C   . SER A 1 88  ? 40.920  11.782  48.246  1.00 57.03  ? 57   SER A C   1 
ATOM   436  O O   . SER A 1 88  ? 40.987  12.802  47.541  1.00 56.39  ? 57   SER A O   1 
ATOM   437  C CB  . SER A 1 88  ? 43.106  10.676  48.865  1.00 58.77  ? 57   SER A CB  1 
ATOM   438  O OG  . SER A 1 88  ? 43.798  11.866  48.571  1.00 58.43  ? 57   SER A OG  1 
ATOM   439  N N   . GLY A 1 89  ? 40.037  11.623  49.224  1.00 57.48  ? 58   GLY A N   1 
ATOM   440  C CA  . GLY A 1 89  ? 39.096  12.652  49.581  1.00 57.68  ? 58   GLY A CA  1 
ATOM   441  C C   . GLY A 1 89  ? 37.907  12.592  48.652  1.00 57.30  ? 58   GLY A C   1 
ATOM   442  O O   . GLY A 1 89  ? 37.798  11.702  47.806  1.00 56.54  ? 58   GLY A O   1 
ATOM   443  N N   . VAL A 1 90  ? 37.001  13.545  48.832  1.00 57.52  ? 59   VAL A N   1 
ATOM   444  C CA  . VAL A 1 90  ? 35.769  13.583  48.078  1.00 56.88  ? 59   VAL A CA  1 
ATOM   445  C C   . VAL A 1 90  ? 36.047  14.501  46.905  1.00 56.30  ? 59   VAL A C   1 
ATOM   446  O O   . VAL A 1 90  ? 36.303  15.695  47.084  1.00 56.87  ? 59   VAL A O   1 
ATOM   447  C CB  . VAL A 1 90  ? 34.589  14.091  48.953  1.00 57.79  ? 59   VAL A CB  1 
ATOM   448  C CG1 . VAL A 1 90  ? 33.271  14.002  48.216  1.00 56.61  ? 59   VAL A CG1 1 
ATOM   449  C CG2 . VAL A 1 90  ? 34.513  13.285  50.268  1.00 58.51  ? 59   VAL A CG2 1 
ATOM   450  N N   . LEU A 1 91  ? 36.053  13.922  45.711  1.00 54.84  ? 60   LEU A N   1 
ATOM   451  C CA  . LEU A 1 91  ? 36.215  14.696  44.486  1.00 54.50  ? 60   LEU A CA  1 
ATOM   452  C C   . LEU A 1 91  ? 34.953  15.495  44.172  1.00 54.08  ? 60   LEU A C   1 
ATOM   453  O O   . LEU A 1 91  ? 33.866  14.952  44.141  1.00 53.32  ? 60   LEU A O   1 
ATOM   454  C CB  . LEU A 1 91  ? 36.527  13.789  43.299  1.00 54.07  ? 60   LEU A CB  1 
ATOM   455  C CG  . LEU A 1 91  ? 36.797  14.436  41.944  1.00 54.08  ? 60   LEU A CG  1 
ATOM   456  C CD1 . LEU A 1 91  ? 38.064  13.875  41.295  1.00 56.41  ? 60   LEU A CD1 1 
ATOM   457  C CD2 . LEU A 1 91  ? 35.647  14.176  41.024  1.00 56.06  ? 60   LEU A CD2 1 
ATOM   458  N N   . ASP A 1 92  ? 35.118  16.788  43.923  1.00 54.37  ? 61   ASP A N   1 
ATOM   459  C CA  . ASP A 1 92  ? 33.983  17.653  43.579  1.00 54.78  ? 61   ASP A CA  1 
ATOM   460  C C   . ASP A 1 92  ? 33.530  17.404  42.127  1.00 52.97  ? 61   ASP A C   1 
ATOM   461  O O   . ASP A 1 92  ? 34.289  17.568  41.196  1.00 52.67  ? 61   ASP A O   1 
ATOM   462  C CB  . ASP A 1 92  ? 34.330  19.143  43.767  1.00 55.71  ? 61   ASP A CB  1 
ATOM   463  C CG  . ASP A 1 92  ? 33.118  20.056  43.531  1.00 59.33  ? 61   ASP A CG  1 
ATOM   464  O OD1 . ASP A 1 92  ? 32.765  20.305  42.345  1.00 62.54  ? 61   ASP A OD1 1 
ATOM   465  O OD2 . ASP A 1 92  ? 32.435  20.532  44.470  1.00 63.75  ? 61   ASP A OD2 1 
ATOM   466  N N   . ALA A 1 93  ? 32.289  16.988  41.965  1.00 52.02  ? 62   ALA A N   1 
ATOM   467  C CA  . ALA A 1 93  ? 31.764  16.587  40.673  1.00 50.78  ? 62   ALA A CA  1 
ATOM   468  C C   . ALA A 1 93  ? 30.488  17.378  40.406  1.00 50.33  ? 62   ALA A C   1 
ATOM   469  O O   . ALA A 1 93  ? 29.419  16.801  40.095  1.00 49.59  ? 62   ALA A O   1 
ATOM   470  C CB  . ALA A 1 93  ? 31.483  15.103  40.665  1.00 50.84  ? 62   ALA A CB  1 
ATOM   471  N N   . THR A 1 94  ? 30.624  18.701  40.541  1.00 49.73  ? 63   THR A N   1 
ATOM   472  C CA  . THR A 1 94  ? 29.492  19.624  40.451  1.00 49.77  ? 63   THR A CA  1 
ATOM   473  C C   . THR A 1 94  ? 29.567  20.547  39.258  1.00 48.85  ? 63   THR A C   1 
ATOM   474  O O   . THR A 1 94  ? 28.631  21.270  39.030  1.00 49.76  ? 63   THR A O   1 
ATOM   475  C CB  . THR A 1 94  ? 29.344  20.498  41.730  1.00 50.71  ? 63   THR A CB  1 
ATOM   476  O OG1 . THR A 1 94  ? 30.499  21.331  41.888  1.00 49.60  ? 63   THR A OG1 1 
ATOM   477  C CG2 . THR A 1 94  ? 29.324  19.628  43.017  1.00 51.27  ? 63   THR A CG2 1 
ATOM   478  N N   . THR A 1 95  ? 30.661  20.532  38.508  1.00 47.92  ? 64   THR A N   1 
ATOM   479  C CA  . THR A 1 95  ? 30.801  21.346  37.299  1.00 47.65  ? 64   THR A CA  1 
ATOM   480  C C   . THR A 1 95  ? 31.403  20.560  36.132  1.00 46.40  ? 64   THR A C   1 
ATOM   481  O O   . THR A 1 95  ? 32.162  19.629  36.310  1.00 46.48  ? 64   THR A O   1 
ATOM   482  C CB  . THR A 1 95  ? 31.731  22.561  37.557  1.00 48.16  ? 64   THR A CB  1 
ATOM   483  O OG1 . THR A 1 95  ? 33.020  22.095  37.970  1.00 49.61  ? 64   THR A OG1 1 
ATOM   484  C CG2 . THR A 1 95  ? 31.285  23.374  38.747  1.00 50.64  ? 64   THR A CG2 1 
ATOM   485  N N   . PHE A 1 96  ? 31.089  20.978  34.919  1.00 46.22  ? 65   PHE A N   1 
ATOM   486  C CA  . PHE A 1 96  ? 31.706  20.387  33.747  1.00 45.09  ? 65   PHE A CA  1 
ATOM   487  C C   . PHE A 1 96  ? 33.200  20.644  33.773  1.00 45.43  ? 65   PHE A C   1 
ATOM   488  O O   . PHE A 1 96  ? 33.639  21.669  34.230  1.00 46.39  ? 65   PHE A O   1 
ATOM   489  C CB  . PHE A 1 96  ? 31.086  20.927  32.483  1.00 43.52  ? 65   PHE A CB  1 
ATOM   490  C CG  . PHE A 1 96  ? 29.696  20.413  32.233  1.00 43.32  ? 65   PHE A CG  1 
ATOM   491  C CD1 . PHE A 1 96  ? 29.478  19.074  31.972  1.00 42.42  ? 65   PHE A CD1 1 
ATOM   492  C CD2 . PHE A 1 96  ? 28.602  21.274  32.233  1.00 43.84  ? 65   PHE A CD2 1 
ATOM   493  C CE1 . PHE A 1 96  ? 28.205  18.584  31.746  1.00 42.67  ? 65   PHE A CE1 1 
ATOM   494  C CE2 . PHE A 1 96  ? 27.321  20.797  31.995  1.00 44.06  ? 65   PHE A CE2 1 
ATOM   495  C CZ  . PHE A 1 96  ? 27.118  19.449  31.766  1.00 42.72  ? 65   PHE A CZ  1 
ATOM   496  N N   . GLN A 1 97  ? 33.979  19.682  33.303  1.00 45.21  ? 66   GLN A N   1 
ATOM   497  C CA  . GLN A 1 97  ? 35.420  19.829  33.221  1.00 45.16  ? 66   GLN A CA  1 
ATOM   498  C C   . GLN A 1 97  ? 35.831  20.338  31.849  1.00 44.41  ? 66   GLN A C   1 
ATOM   499  O O   . GLN A 1 97  ? 34.970  20.625  31.003  1.00 43.66  ? 66   GLN A O   1 
ATOM   500  C CB  . GLN A 1 97  ? 36.092  18.508  33.576  1.00 45.23  ? 66   GLN A CB  1 
ATOM   501  C CG  . GLN A 1 97  ? 36.426  18.482  35.047  1.00 47.09  ? 66   GLN A CG  1 
ATOM   502  C CD  . GLN A 1 97  ? 37.770  19.151  35.333  1.00 49.53  ? 66   GLN A CD  1 
ATOM   503  O OE1 . GLN A 1 97  ? 38.314  19.865  34.469  1.00 46.66  ? 66   GLN A OE1 1 
ATOM   504  N NE2 . GLN A 1 97  ? 38.327  18.885  36.521  1.00 46.43  ? 66   GLN A NE2 1 
ATOM   505  N N   . ASN A 1 98  ? 37.147  20.495  31.659  1.00 43.72  ? 67   ASN A N   1 
ATOM   506  C CA  . ASN A 1 98  ? 37.695  21.005  30.426  1.00 42.81  ? 67   ASN A CA  1 
ATOM   507  C C   . ASN A 1 98  ? 37.187  20.274  29.174  1.00 41.97  ? 67   ASN A C   1 
ATOM   508  O O   . ASN A 1 98  ? 36.918  19.058  29.182  1.00 41.46  ? 67   ASN A O   1 
ATOM   509  C CB  . ASN A 1 98  ? 39.203  20.854  30.441  1.00 42.91  ? 67   ASN A CB  1 
ATOM   510  C CG  . ASN A 1 98  ? 39.876  21.590  31.586  1.00 43.61  ? 67   ASN A CG  1 
ATOM   511  O OD1 . ASN A 1 98  ? 39.446  22.665  32.022  1.00 42.32  ? 67   ASN A OD1 1 
ATOM   512  N ND2 . ASN A 1 98  ? 40.974  21.004  32.073  1.00 44.34  ? 67   ASN A ND2 1 
ATOM   513  N N   . VAL A 1 99  ? 37.084  21.045  28.101  1.00 41.06  ? 68   VAL A N   1 
ATOM   514  C CA  . VAL A 1 99  ? 36.825  20.539  26.774  1.00 40.39  ? 68   VAL A CA  1 
ATOM   515  C C   . VAL A 1 99  ? 38.146  20.141  26.121  1.00 40.28  ? 68   VAL A C   1 
ATOM   516  O O   . VAL A 1 99  ? 39.180  20.797  26.326  1.00 40.99  ? 68   VAL A O   1 
ATOM   517  C CB  . VAL A 1 99  ? 36.126  21.620  25.972  1.00 40.16  ? 68   VAL A CB  1 
ATOM   518  C CG1 . VAL A 1 99  ? 35.928  21.190  24.541  1.00 41.06  ? 68   VAL A CG1 1 
ATOM   519  C CG2 . VAL A 1 99  ? 34.766  21.942  26.636  1.00 40.51  ? 68   VAL A CG2 1 
ATOM   520  N N   . CYS A 1 100 ? 38.132  19.061  25.352  1.00 39.80  ? 69   CYS A N   1 
ATOM   521  C CA  . CYS A 1 100 ? 39.342  18.612  24.675  1.00 40.29  ? 69   CYS A CA  1 
ATOM   522  C C   . CYS A 1 100 ? 39.777  19.637  23.637  1.00 40.33  ? 69   CYS A C   1 
ATOM   523  O O   . CYS A 1 100 ? 38.970  20.285  23.000  1.00 39.68  ? 69   CYS A O   1 
ATOM   524  C CB  . CYS A 1 100 ? 39.144  17.254  24.033  1.00 40.51  ? 69   CYS A CB  1 
ATOM   525  S SG  . CYS A 1 100 ? 38.845  15.921  25.238  1.00 42.99  ? 69   CYS A SG  1 
ATOM   526  N N   . TYR A 1 101 ? 41.082  19.809  23.528  1.00 41.22  ? 70   TYR A N   1 
ATOM   527  C CA  . TYR A 1 101 ? 41.671  20.817  22.670  1.00 42.09  ? 70   TYR A CA  1 
ATOM   528  C C   . TYR A 1 101 ? 41.184  20.676  21.245  1.00 41.36  ? 70   TYR A C   1 
ATOM   529  O O   . TYR A 1 101 ? 41.159  19.575  20.697  1.00 40.41  ? 70   TYR A O   1 
ATOM   530  C CB  . TYR A 1 101 ? 43.220  20.791  22.741  1.00 43.83  ? 70   TYR A CB  1 
ATOM   531  C CG  . TYR A 1 101 ? 43.786  22.167  22.944  1.00 47.44  ? 70   TYR A CG  1 
ATOM   532  C CD1 . TYR A 1 101 ? 44.327  22.588  24.162  1.00 51.80  ? 70   TYR A CD1 1 
ATOM   533  C CD2 . TYR A 1 101 ? 43.734  23.069  21.924  1.00 51.76  ? 70   TYR A CD2 1 
ATOM   534  C CE1 . TYR A 1 101 ? 44.831  23.905  24.318  1.00 53.17  ? 70   TYR A CE1 1 
ATOM   535  C CE2 . TYR A 1 101 ? 44.217  24.326  22.066  1.00 55.16  ? 70   TYR A CE2 1 
ATOM   536  C CZ  . TYR A 1 101 ? 44.759  24.754  23.254  1.00 56.39  ? 70   TYR A CZ  1 
ATOM   537  O OH  . TYR A 1 101 ? 45.220  26.073  23.269  1.00 64.28  ? 70   TYR A OH  1 
ATOM   538  N N   . GLN A 1 102 ? 40.751  21.798  20.667  1.00 41.45  ? 71   GLN A N   1 
ATOM   539  C CA  . GLN A 1 102 ? 40.110  21.786  19.358  1.00 41.23  ? 71   GLN A CA  1 
ATOM   540  C C   . GLN A 1 102 ? 40.000  23.143  18.677  1.00 42.25  ? 71   GLN A C   1 
ATOM   541  O O   . GLN A 1 102 ? 40.041  24.190  19.316  1.00 42.05  ? 71   GLN A O   1 
ATOM   542  C CB  . GLN A 1 102 ? 38.689  21.208  19.462  1.00 40.73  ? 71   GLN A CB  1 
ATOM   543  C CG  . GLN A 1 102 ? 37.739  21.989  20.345  1.00 39.64  ? 71   GLN A CG  1 
ATOM   544  C CD  . GLN A 1 102 ? 36.457  21.231  20.642  1.00 38.19  ? 71   GLN A CD  1 
ATOM   545  O OE1 . GLN A 1 102 ? 35.387  21.521  20.047  1.00 35.07  ? 71   GLN A OE1 1 
ATOM   546  N NE2 . GLN A 1 102 ? 36.543  20.268  21.572  1.00 32.58  ? 71   GLN A NE2 1 
ATOM   547  N N   . TYR A 1 103 ? 39.825  23.079  17.362  1.00 43.08  ? 72   TYR A N   1 
ATOM   548  C CA  . TYR A 1 103 ? 39.570  24.219  16.536  1.00 44.51  ? 72   TYR A CA  1 
ATOM   549  C C   . TYR A 1 103 ? 38.214  24.829  16.889  1.00 45.18  ? 72   TYR A C   1 
ATOM   550  O O   . TYR A 1 103 ? 37.201  24.126  16.996  1.00 44.90  ? 72   TYR A O   1 
ATOM   551  C CB  . TYR A 1 103 ? 39.588  23.802  15.045  1.00 45.19  ? 72   TYR A CB  1 
ATOM   552  C CG  . TYR A 1 103 ? 39.414  24.983  14.110  1.00 45.55  ? 72   TYR A CG  1 
ATOM   553  C CD1 . TYR A 1 103 ? 38.202  25.234  13.496  1.00 45.98  ? 72   TYR A CD1 1 
ATOM   554  C CD2 . TYR A 1 103 ? 40.472  25.866  13.865  1.00 49.48  ? 72   TYR A CD2 1 
ATOM   555  C CE1 . TYR A 1 103 ? 38.034  26.309  12.675  1.00 47.76  ? 72   TYR A CE1 1 
ATOM   556  C CE2 . TYR A 1 103 ? 40.314  26.956  13.038  1.00 49.41  ? 72   TYR A CE2 1 
ATOM   557  C CZ  . TYR A 1 103 ? 39.101  27.179  12.463  1.00 50.04  ? 72   TYR A CZ  1 
ATOM   558  O OH  . TYR A 1 103 ? 38.944  28.257  11.659  1.00 54.76  ? 72   TYR A OH  1 
ATOM   559  N N   . VAL A 1 104 ? 38.221  26.136  17.104  1.00 46.61  ? 73   VAL A N   1 
ATOM   560  C CA  . VAL A 1 104 ? 37.031  26.896  17.440  1.00 47.53  ? 73   VAL A CA  1 
ATOM   561  C C   . VAL A 1 104 ? 36.575  27.658  16.192  1.00 48.80  ? 73   VAL A C   1 
ATOM   562  O O   . VAL A 1 104 ? 37.325  28.414  15.564  1.00 50.14  ? 73   VAL A O   1 
ATOM   563  C CB  . VAL A 1 104 ? 37.279  27.887  18.601  1.00 48.10  ? 73   VAL A CB  1 
ATOM   564  C CG1 . VAL A 1 104 ? 36.051  28.796  18.817  1.00 47.83  ? 73   VAL A CG1 1 
ATOM   565  C CG2 . VAL A 1 104 ? 37.630  27.155  19.864  1.00 47.00  ? 73   VAL A CG2 1 
ATOM   566  N N   . ASP A 1 105 ? 35.325  27.427  15.857  1.00 50.16  ? 74   ASP A N   1 
ATOM   567  C CA  . ASP A 1 105 ? 34.669  27.951  14.671  1.00 51.09  ? 74   ASP A CA  1 
ATOM   568  C C   . ASP A 1 105 ? 34.473  29.463  14.797  1.00 51.96  ? 74   ASP A C   1 
ATOM   569  O O   . ASP A 1 105 ? 33.883  29.908  15.774  1.00 51.77  ? 74   ASP A O   1 
ATOM   570  C CB  . ASP A 1 105 ? 33.301  27.218  14.541  1.00 50.52  ? 74   ASP A CB  1 
ATOM   571  C CG  . ASP A 1 105 ? 32.457  27.672  13.348  1.00 52.76  ? 74   ASP A CG  1 
ATOM   572  O OD1 . ASP A 1 105 ? 32.947  28.383  12.439  1.00 57.33  ? 74   ASP A OD1 1 
ATOM   573  O OD2 . ASP A 1 105 ? 31.252  27.346  13.248  1.00 56.55  ? 74   ASP A OD2 1 
ATOM   574  N N   . THR A 1 106 ? 34.946  30.214  13.792  1.00 53.79  ? 75   THR A N   1 
ATOM   575  C CA  . THR A 1 106 ? 34.736  31.676  13.712  1.00 56.69  ? 75   THR A CA  1 
ATOM   576  C C   . THR A 1 106 ? 34.110  32.178  12.393  1.00 57.42  ? 75   THR A C   1 
ATOM   577  O O   . THR A 1 106 ? 34.163  33.356  12.112  1.00 58.64  ? 75   THR A O   1 
ATOM   578  C CB  . THR A 1 106 ? 36.081  32.469  13.959  1.00 57.95  ? 75   THR A CB  1 
ATOM   579  O OG1 . THR A 1 106 ? 37.104  31.955  13.113  1.00 57.37  ? 75   THR A OG1 1 
ATOM   580  C CG2 . THR A 1 106 ? 36.619  32.260  15.364  1.00 58.30  ? 75   THR A CG2 1 
ATOM   581  N N   . LEU A 1 107 ? 33.515  31.294  11.604  1.00 57.99  ? 76   LEU A N   1 
ATOM   582  C CA  . LEU A 1 107 ? 32.776  31.693  10.412  1.00 58.95  ? 76   LEU A CA  1 
ATOM   583  C C   . LEU A 1 107 ? 31.793  32.829  10.685  1.00 59.66  ? 76   LEU A C   1 
ATOM   584  O O   . LEU A 1 107 ? 31.830  33.853  10.001  1.00 60.82  ? 76   LEU A O   1 
ATOM   585  C CB  . LEU A 1 107 ? 31.998  30.507  9.821   1.00 58.64  ? 76   LEU A CB  1 
ATOM   586  C CG  . LEU A 1 107 ? 31.374  30.827  8.447   1.00 60.51  ? 76   LEU A CG  1 
ATOM   587  C CD1 . LEU A 1 107 ? 32.476  31.212  7.409   1.00 61.16  ? 76   LEU A CD1 1 
ATOM   588  C CD2 . LEU A 1 107 ? 30.490  29.672  7.943   1.00 60.16  ? 76   LEU A CD2 1 
ATOM   589  N N   . TYR A 1 108 ? 30.907  32.638  11.663  1.00 59.43  ? 77   TYR A N   1 
ATOM   590  C CA  . TYR A 1 108 ? 29.926  33.671  12.045  1.00 59.81  ? 77   TYR A CA  1 
ATOM   591  C C   . TYR A 1 108 ? 30.030  33.986  13.539  1.00 60.31  ? 77   TYR A C   1 
ATOM   592  O O   . TYR A 1 108 ? 29.169  33.603  14.332  1.00 59.77  ? 77   TYR A O   1 
ATOM   593  C CB  . TYR A 1 108 ? 28.498  33.225  11.723  1.00 59.21  ? 77   TYR A CB  1 
ATOM   594  C CG  . TYR A 1 108 ? 28.239  32.991  10.273  1.00 57.31  ? 77   TYR A CG  1 
ATOM   595  C CD1 . TYR A 1 108 ? 28.263  34.039  9.374   1.00 55.87  ? 77   TYR A CD1 1 
ATOM   596  C CD2 . TYR A 1 108 ? 27.967  31.709  9.801   1.00 55.39  ? 77   TYR A CD2 1 
ATOM   597  C CE1 . TYR A 1 108 ? 28.018  33.828  8.035   1.00 56.74  ? 77   TYR A CE1 1 
ATOM   598  C CE2 . TYR A 1 108 ? 27.725  31.478  8.468   1.00 56.58  ? 77   TYR A CE2 1 
ATOM   599  C CZ  . TYR A 1 108 ? 27.750  32.536  7.578   1.00 57.60  ? 77   TYR A CZ  1 
ATOM   600  O OH  . TYR A 1 108 ? 27.507  32.301  6.238   1.00 58.97  ? 77   TYR A OH  1 
ATOM   601  N N   . PRO A 1 109 ? 31.067  34.715  13.922  1.00 61.42  ? 78   PRO A N   1 
ATOM   602  C CA  . PRO A 1 109 ? 31.340  34.952  15.356  1.00 61.64  ? 78   PRO A CA  1 
ATOM   603  C C   . PRO A 1 109 ? 30.224  35.806  16.051  1.00 61.48  ? 78   PRO A C   1 
ATOM   604  O O   . PRO A 1 109 ? 29.723  36.771  15.471  1.00 61.01  ? 78   PRO A O   1 
ATOM   605  C CB  . PRO A 1 109 ? 32.713  35.661  15.354  1.00 62.58  ? 78   PRO A CB  1 
ATOM   606  C CG  . PRO A 1 109 ? 32.884  36.257  13.940  1.00 63.30  ? 78   PRO A CG  1 
ATOM   607  C CD  . PRO A 1 109 ? 31.989  35.444  13.020  1.00 62.22  ? 78   PRO A CD  1 
ATOM   608  N N   . GLY A 1 110 ? 29.825  35.396  17.262  1.00 60.45  ? 79   GLY A N   1 
ATOM   609  C CA  . GLY A 1 110 ? 28.703  36.017  17.968  1.00 60.12  ? 79   GLY A CA  1 
ATOM   610  C C   . GLY A 1 110 ? 27.312  35.448  17.663  1.00 58.24  ? 79   GLY A C   1 
ATOM   611  O O   . GLY A 1 110 ? 26.337  35.824  18.325  1.00 58.71  ? 79   GLY A O   1 
ATOM   612  N N   . PHE A 1 111 ? 27.224  34.553  16.675  1.00 55.05  ? 80   PHE A N   1 
ATOM   613  C CA  . PHE A 1 111 ? 25.949  34.068  16.154  1.00 53.69  ? 80   PHE A CA  1 
ATOM   614  C C   . PHE A 1 111 ? 25.583  32.782  16.867  1.00 52.65  ? 80   PHE A C   1 
ATOM   615  O O   . PHE A 1 111 ? 26.363  31.842  16.841  1.00 51.46  ? 80   PHE A O   1 
ATOM   616  C CB  . PHE A 1 111 ? 26.081  33.841  14.633  1.00 53.16  ? 80   PHE A CB  1 
ATOM   617  C CG  . PHE A 1 111 ? 24.903  33.148  13.988  1.00 51.33  ? 80   PHE A CG  1 
ATOM   618  C CD1 . PHE A 1 111 ? 23.639  33.745  13.969  1.00 51.52  ? 80   PHE A CD1 1 
ATOM   619  C CD2 . PHE A 1 111 ? 25.072  31.927  13.350  1.00 48.53  ? 80   PHE A CD2 1 
ATOM   620  C CE1 . PHE A 1 111 ? 22.557  33.111  13.355  1.00 50.70  ? 80   PHE A CE1 1 
ATOM   621  C CE2 . PHE A 1 111 ? 24.002  31.289  12.726  1.00 47.57  ? 80   PHE A CE2 1 
ATOM   622  C CZ  . PHE A 1 111 ? 22.747  31.873  12.726  1.00 49.51  ? 80   PHE A CZ  1 
ATOM   623  N N   . GLU A 1 112 ? 24.401  32.738  17.474  1.00 52.99  ? 81   GLU A N   1 
ATOM   624  C CA  . GLU A 1 112 ? 23.969  31.583  18.286  1.00 53.43  ? 81   GLU A CA  1 
ATOM   625  C C   . GLU A 1 112 ? 24.035  30.249  17.509  1.00 51.61  ? 81   GLU A C   1 
ATOM   626  O O   . GLU A 1 112 ? 24.380  29.195  18.071  1.00 50.66  ? 81   GLU A O   1 
ATOM   627  C CB  . GLU A 1 112 ? 22.553  31.791  18.882  1.00 55.33  ? 81   GLU A CB  1 
ATOM   628  C CG  . GLU A 1 112 ? 22.233  30.965  20.158  1.00 60.89  ? 81   GLU A CG  1 
ATOM   629  C CD  . GLU A 1 112 ? 21.277  29.744  19.949  1.00 68.74  ? 81   GLU A CD  1 
ATOM   630  O OE1 . GLU A 1 112 ? 20.976  29.019  20.962  1.00 71.29  ? 81   GLU A OE1 1 
ATOM   631  O OE2 . GLU A 1 112 ? 20.838  29.468  18.781  1.00 73.13  ? 81   GLU A OE2 1 
ATOM   632  N N   . GLY A 1 113 ? 23.745  30.313  16.209  1.00 50.23  ? 82   GLY A N   1 
ATOM   633  C CA  . GLY A 1 113 ? 23.694  29.138  15.370  1.00 48.53  ? 82   GLY A CA  1 
ATOM   634  C C   . GLY A 1 113 ? 24.985  28.370  15.291  1.00 47.42  ? 82   GLY A C   1 
ATOM   635  O O   . GLY A 1 113 ? 24.956  27.146  15.116  1.00 47.10  ? 82   GLY A O   1 
ATOM   636  N N   . THR A 1 114 ? 26.103  29.078  15.389  1.00 46.94  ? 83   THR A N   1 
ATOM   637  C CA  . THR A 1 114 ? 27.429  28.450  15.469  1.00 46.83  ? 83   THR A CA  1 
ATOM   638  C C   . THR A 1 114 ? 27.967  28.312  16.905  1.00 46.48  ? 83   THR A C   1 
ATOM   639  O O   . THR A 1 114 ? 28.543  27.300  17.248  1.00 46.09  ? 83   THR A O   1 
ATOM   640  C CB  . THR A 1 114 ? 28.456  29.223  14.613  1.00 46.86  ? 83   THR A CB  1 
ATOM   641  O OG1 . THR A 1 114 ? 28.279  30.631  14.796  1.00 50.77  ? 83   THR A OG1 1 
ATOM   642  C CG2 . THR A 1 114 ? 28.185  29.035  13.136  1.00 46.54  ? 83   THR A CG2 1 
ATOM   643  N N   . GLU A 1 115 ? 27.753  29.308  17.756  1.00 47.15  ? 84   GLU A N   1 
ATOM   644  C CA  . GLU A 1 115 ? 28.387  29.309  19.072  1.00 47.53  ? 84   GLU A CA  1 
ATOM   645  C C   . GLU A 1 115 ? 27.796  28.241  19.973  1.00 46.25  ? 84   GLU A C   1 
ATOM   646  O O   . GLU A 1 115 ? 28.470  27.763  20.879  1.00 46.81  ? 84   GLU A O   1 
ATOM   647  C CB  . GLU A 1 115 ? 28.311  30.688  19.751  1.00 49.18  ? 84   GLU A CB  1 
ATOM   648  C CG  . GLU A 1 115 ? 29.065  31.806  19.017  1.00 53.45  ? 84   GLU A CG  1 
ATOM   649  C CD  . GLU A 1 115 ? 30.593  31.804  19.211  1.00 58.48  ? 84   GLU A CD  1 
ATOM   650  O OE1 . GLU A 1 115 ? 31.166  30.943  19.960  1.00 59.24  ? 84   GLU A OE1 1 
ATOM   651  O OE2 . GLU A 1 115 ? 31.224  32.700  18.594  1.00 61.58  ? 84   GLU A OE2 1 
ATOM   652  N N   . MET A 1 116 ? 26.562  27.823  19.715  1.00 45.04  ? 85   MET A N   1 
ATOM   653  C CA  . MET A 1 116 ? 25.963  26.738  20.490  1.00 43.82  ? 85   MET A CA  1 
ATOM   654  C C   . MET A 1 116 ? 26.750  25.409  20.351  1.00 42.82  ? 85   MET A C   1 
ATOM   655  O O   . MET A 1 116 ? 26.598  24.531  21.187  1.00 42.33  ? 85   MET A O   1 
ATOM   656  C CB  . MET A 1 116 ? 24.498  26.539  20.094  1.00 43.80  ? 85   MET A CB  1 
ATOM   657  C CG  . MET A 1 116 ? 24.304  26.002  18.657  1.00 43.83  ? 85   MET A CG  1 
ATOM   658  S SD  . MET A 1 116 ? 22.556  25.579  18.335  1.00 44.16  ? 85   MET A SD  1 
ATOM   659  C CE  . MET A 1 116 ? 22.425  24.046  19.201  1.00 43.82  ? 85   MET A CE  1 
ATOM   660  N N   . TRP A 1 117 ? 27.565  25.270  19.297  1.00 41.59  ? 86   TRP A N   1 
ATOM   661  C CA  . TRP A 1 117 ? 28.396  24.084  19.105  1.00 40.85  ? 86   TRP A CA  1 
ATOM   662  C C   . TRP A 1 117 ? 29.825  24.289  19.639  1.00 40.98  ? 86   TRP A C   1 
ATOM   663  O O   . TRP A 1 117 ? 30.579  23.331  19.783  1.00 39.81  ? 86   TRP A O   1 
ATOM   664  C CB  . TRP A 1 117 ? 28.412  23.639  17.612  1.00 39.58  ? 86   TRP A CB  1 
ATOM   665  C CG  . TRP A 1 117 ? 27.035  23.477  17.027  1.00 38.53  ? 86   TRP A CG  1 
ATOM   666  C CD1 . TRP A 1 117 ? 26.403  24.340  16.189  1.00 39.19  ? 86   TRP A CD1 1 
ATOM   667  C CD2 . TRP A 1 117 ? 26.103  22.413  17.264  1.00 37.61  ? 86   TRP A CD2 1 
ATOM   668  N NE1 . TRP A 1 117 ? 25.143  23.876  15.874  1.00 39.36  ? 86   TRP A NE1 1 
ATOM   669  C CE2 . TRP A 1 117 ? 24.929  22.705  16.537  1.00 38.04  ? 86   TRP A CE2 1 
ATOM   670  C CE3 . TRP A 1 117 ? 26.140  21.243  18.007  1.00 36.15  ? 86   TRP A CE3 1 
ATOM   671  C CZ2 . TRP A 1 117 ? 23.830  21.869  16.528  1.00 38.41  ? 86   TRP A CZ2 1 
ATOM   672  C CZ3 . TRP A 1 117 ? 25.033  20.416  18.013  1.00 36.23  ? 86   TRP A CZ3 1 
ATOM   673  C CH2 . TRP A 1 117 ? 23.903  20.721  17.276  1.00 37.42  ? 86   TRP A CH2 1 
ATOM   674  N N   . ASN A 1 118 ? 30.201  25.531  19.904  1.00 41.49  ? 87   ASN A N   1 
ATOM   675  C CA  . ASN A 1 118 ? 31.577  25.833  20.287  1.00 42.32  ? 87   ASN A CA  1 
ATOM   676  C C   . ASN A 1 118 ? 31.851  25.433  21.735  1.00 42.12  ? 87   ASN A C   1 
ATOM   677  O O   . ASN A 1 118 ? 30.934  25.294  22.535  1.00 42.76  ? 87   ASN A O   1 
ATOM   678  C CB  . ASN A 1 118 ? 31.876  27.321  20.061  1.00 43.23  ? 87   ASN A CB  1 
ATOM   679  C CG  . ASN A 1 118 ? 32.437  27.609  18.660  1.00 46.22  ? 87   ASN A CG  1 
ATOM   680  O OD1 . ASN A 1 118 ? 32.769  26.683  17.905  1.00 49.18  ? 87   ASN A OD1 1 
ATOM   681  N ND2 . ASN A 1 118 ? 32.578  28.903  18.320  1.00 48.58  ? 87   ASN A ND2 1 
ATOM   682  N N   . PRO A 1 119 ? 33.106  25.234  22.089  1.00 41.67  ? 88   PRO A N   1 
ATOM   683  C CA  . PRO A 1 119 ? 33.432  24.874  23.478  1.00 41.65  ? 88   PRO A CA  1 
ATOM   684  C C   . PRO A 1 119 ? 32.920  25.885  24.524  1.00 42.35  ? 88   PRO A C   1 
ATOM   685  O O   . PRO A 1 119 ? 33.087  27.072  24.352  1.00 42.12  ? 88   PRO A O   1 
ATOM   686  C CB  . PRO A 1 119 ? 34.975  24.795  23.489  1.00 41.00  ? 88   PRO A CB  1 
ATOM   687  C CG  . PRO A 1 119 ? 35.360  24.624  22.069  1.00 41.14  ? 88   PRO A CG  1 
ATOM   688  C CD  . PRO A 1 119 ? 34.292  25.281  21.215  1.00 41.44  ? 88   PRO A CD  1 
ATOM   689  N N   . ASN A 1 120 ? 32.367  25.373  25.622  1.00 43.03  ? 89   ASN A N   1 
ATOM   690  C CA  . ASN A 1 120 ? 31.793  26.182  26.684  1.00 43.60  ? 89   ASN A CA  1 
ATOM   691  C C   . ASN A 1 120 ? 32.531  26.021  28.007  1.00 44.14  ? 89   ASN A C   1 
ATOM   692  O O   . ASN A 1 120 ? 32.103  26.500  29.035  1.00 45.18  ? 89   ASN A O   1 
ATOM   693  C CB  . ASN A 1 120 ? 30.308  25.858  26.845  1.00 43.69  ? 89   ASN A CB  1 
ATOM   694  C CG  . ASN A 1 120 ? 30.041  24.402  27.320  1.00 44.75  ? 89   ASN A CG  1 
ATOM   695  O OD1 . ASN A 1 120 ? 30.890  23.534  27.213  1.00 43.98  ? 89   ASN A OD1 1 
ATOM   696  N ND2 . ASN A 1 120 ? 28.821  24.151  27.821  1.00 46.70  ? 89   ASN A ND2 1 
ATOM   697  N N   . ARG A 1 121 ? 33.648  25.325  27.982  1.00 44.60  ? 90   ARG A N   1 
ATOM   698  C CA  . ARG A 1 121 ? 34.631  25.376  29.081  1.00 45.19  ? 90   ARG A CA  1 
ATOM   699  C C   . ARG A 1 121 ? 36.019  25.521  28.495  1.00 44.87  ? 90   ARG A C   1 
ATOM   700  O O   . ARG A 1 121 ? 36.211  25.453  27.280  1.00 44.93  ? 90   ARG A O   1 
ATOM   701  C CB  . ARG A 1 121 ? 34.626  24.121  29.958  1.00 45.81  ? 90   ARG A CB  1 
ATOM   702  C CG  . ARG A 1 121 ? 33.258  23.633  30.384  1.00 47.70  ? 90   ARG A CG  1 
ATOM   703  C CD  . ARG A 1 121 ? 32.563  24.552  31.329  1.00 51.86  ? 90   ARG A CD  1 
ATOM   704  N NE  . ARG A 1 121 ? 32.967  24.230  32.667  1.00 54.70  ? 90   ARG A NE  1 
ATOM   705  C CZ  . ARG A 1 121 ? 33.010  25.090  33.653  1.00 61.12  ? 90   ARG A CZ  1 
ATOM   706  N NH1 . ARG A 1 121 ? 33.424  24.681  34.856  1.00 62.58  ? 90   ARG A NH1 1 
ATOM   707  N NH2 . ARG A 1 121 ? 32.663  26.367  33.458  1.00 64.49  ? 90   ARG A NH2 1 
ATOM   708  N N   . GLU A 1 122 ? 36.985  25.710  29.370  1.00 45.19  ? 91   GLU A N   1 
ATOM   709  C CA  . GLU A 1 122 ? 38.355  25.866  28.963  1.00 45.08  ? 91   GLU A CA  1 
ATOM   710  C C   . GLU A 1 122 ? 38.843  24.663  28.140  1.00 43.95  ? 91   GLU A C   1 
ATOM   711  O O   . GLU A 1 122 ? 38.538  23.491  28.442  1.00 43.09  ? 91   GLU A O   1 
ATOM   712  C CB  . GLU A 1 122 ? 39.238  26.016  30.193  1.00 45.86  ? 91   GLU A CB  1 
ATOM   713  C CG  . GLU A 1 122 ? 40.731  25.951  29.877  1.00 48.36  ? 91   GLU A CG  1 
ATOM   714  C CD  . GLU A 1 122 ? 41.630  26.077  31.113  1.00 52.75  ? 91   GLU A CD  1 
ATOM   715  O OE1 . GLU A 1 122 ? 41.132  26.578  32.140  1.00 52.81  ? 91   GLU A OE1 1 
ATOM   716  O OE2 . GLU A 1 122 ? 42.835  25.676  31.047  1.00 54.27  ? 91   GLU A OE2 1 
ATOM   717  N N   . LEU A 1 123 ? 39.612  24.975  27.107  1.00 43.11  ? 92   LEU A N   1 
ATOM   718  C CA  . LEU A 1 123 ? 40.300  23.983  26.312  1.00 42.74  ? 92   LEU A CA  1 
ATOM   719  C C   . LEU A 1 123 ? 41.547  23.488  27.015  1.00 42.94  ? 92   LEU A C   1 
ATOM   720  O O   . LEU A 1 123 ? 42.360  24.269  27.446  1.00 43.33  ? 92   LEU A O   1 
ATOM   721  C CB  . LEU A 1 123 ? 40.731  24.550  24.973  1.00 42.88  ? 92   LEU A CB  1 
ATOM   722  C CG  . LEU A 1 123 ? 39.670  25.061  24.014  1.00 44.19  ? 92   LEU A CG  1 
ATOM   723  C CD1 . LEU A 1 123 ? 40.351  25.292  22.693  1.00 45.64  ? 92   LEU A CD1 1 
ATOM   724  C CD2 . LEU A 1 123 ? 38.529  24.060  23.850  1.00 44.96  ? 92   LEU A CD2 1 
ATOM   725  N N   . SER A 1 124 ? 41.687  22.167  27.096  1.00 42.57  ? 93   SER A N   1 
ATOM   726  C CA  . SER A 1 124 ? 42.879  21.546  27.652  1.00 42.49  ? 93   SER A CA  1 
ATOM   727  C C   . SER A 1 124 ? 43.053  20.131  27.083  1.00 42.35  ? 93   SER A C   1 
ATOM   728  O O   . SER A 1 124 ? 42.090  19.461  26.661  1.00 41.37  ? 93   SER A O   1 
ATOM   729  C CB  . SER A 1 124 ? 42.773  21.471  29.179  1.00 43.48  ? 93   SER A CB  1 
ATOM   730  O OG  . SER A 1 124 ? 43.922  20.866  29.770  1.00 43.20  ? 93   SER A OG  1 
ATOM   731  N N   . GLU A 1 125 ? 44.292  19.655  27.101  1.00 42.55  ? 94   GLU A N   1 
ATOM   732  C CA  . GLU A 1 125 ? 44.539  18.278  26.752  1.00 42.22  ? 94   GLU A CA  1 
ATOM   733  C C   . GLU A 1 125 ? 44.106  17.367  27.892  1.00 42.14  ? 94   GLU A C   1 
ATOM   734  O O   . GLU A 1 125 ? 43.898  16.170  27.692  1.00 42.26  ? 94   GLU A O   1 
ATOM   735  C CB  . GLU A 1 125 ? 45.991  18.065  26.440  1.00 43.24  ? 94   GLU A CB  1 
ATOM   736  C CG  . GLU A 1 125 ? 46.356  18.446  25.030  1.00 44.46  ? 94   GLU A CG  1 
ATOM   737  C CD  . GLU A 1 125 ? 47.812  18.153  24.744  1.00 47.42  ? 94   GLU A CD  1 
ATOM   738  O OE1 . GLU A 1 125 ? 48.146  17.007  24.338  1.00 47.04  ? 94   GLU A OE1 1 
ATOM   739  O OE2 . GLU A 1 125 ? 48.608  19.077  24.969  1.00 50.05  ? 94   GLU A OE2 1 
ATOM   740  N N   . ASP A 1 126 ? 43.987  17.945  29.086  1.00 42.19  ? 95   ASP A N   1 
ATOM   741  C CA  . ASP A 1 126 ? 43.505  17.247  30.272  1.00 42.40  ? 95   ASP A CA  1 
ATOM   742  C C   . ASP A 1 126 ? 41.988  17.374  30.234  1.00 41.21  ? 95   ASP A C   1 
ATOM   743  O O   . ASP A 1 126 ? 41.413  18.312  30.794  1.00 40.63  ? 95   ASP A O   1 
ATOM   744  C CB  . ASP A 1 126 ? 44.105  17.896  31.545  1.00 43.26  ? 95   ASP A CB  1 
ATOM   745  C CG  . ASP A 1 126 ? 43.636  17.238  32.836  1.00 44.97  ? 95   ASP A CG  1 
ATOM   746  O OD1 . ASP A 1 126 ? 42.743  16.344  32.794  1.00 46.03  ? 95   ASP A OD1 1 
ATOM   747  O OD2 . ASP A 1 126 ? 44.115  17.564  33.954  1.00 46.86  ? 95   ASP A OD2 1 
ATOM   748  N N   . CYS A 1 127 ? 41.357  16.432  29.550  1.00 40.52  ? 96   CYS A N   1 
ATOM   749  C CA  . CYS A 1 127 ? 39.958  16.559  29.207  1.00 40.43  ? 96   CYS A CA  1 
ATOM   750  C C   . CYS A 1 127 ? 39.117  15.307  29.321  1.00 39.63  ? 96   CYS A C   1 
ATOM   751  O O   . CYS A 1 127 ? 37.913  15.330  28.995  1.00 39.71  ? 96   CYS A O   1 
ATOM   752  C CB  . CYS A 1 127 ? 39.844  17.101  27.789  1.00 40.02  ? 96   CYS A CB  1 
ATOM   753  S SG  . CYS A 1 127 ? 40.440  15.974  26.533  1.00 41.45  ? 96   CYS A SG  1 
ATOM   754  N N   . LEU A 1 128 ? 39.720  14.239  29.799  1.00 39.33  ? 97   LEU A N   1 
ATOM   755  C CA  . LEU A 1 128 ? 39.062  12.946  29.824  1.00 39.10  ? 97   LEU A CA  1 
ATOM   756  C C   . LEU A 1 128 ? 38.218  12.791  31.102  1.00 39.23  ? 97   LEU A C   1 
ATOM   757  O O   . LEU A 1 128 ? 38.633  12.221  32.101  1.00 39.50  ? 97   LEU A O   1 
ATOM   758  C CB  . LEU A 1 128 ? 40.111  11.851  29.620  1.00 39.51  ? 97   LEU A CB  1 
ATOM   759  C CG  . LEU A 1 128 ? 40.750  11.932  28.227  1.00 38.85  ? 97   LEU A CG  1 
ATOM   760  C CD1 . LEU A 1 128 ? 41.577  10.716  27.952  1.00 38.62  ? 97   LEU A CD1 1 
ATOM   761  C CD2 . LEU A 1 128 ? 39.689  12.100  27.136  1.00 38.12  ? 97   LEU A CD2 1 
ATOM   762  N N   . TYR A 1 129 ? 37.029  13.373  31.033  1.00 39.08  ? 98   TYR A N   1 
ATOM   763  C CA  . TYR A 1 129 ? 36.073  13.377  32.116  1.00 39.14  ? 98   TYR A CA  1 
ATOM   764  C C   . TYR A 1 129 ? 34.733  12.955  31.565  1.00 38.62  ? 98   TYR A C   1 
ATOM   765  O O   . TYR A 1 129 ? 34.475  13.102  30.382  1.00 37.67  ? 98   TYR A O   1 
ATOM   766  C CB  . TYR A 1 129 ? 36.009  14.797  32.731  1.00 39.34  ? 98   TYR A CB  1 
ATOM   767  C CG  . TYR A 1 129 ? 37.336  15.246  33.301  1.00 39.83  ? 98   TYR A CG  1 
ATOM   768  C CD1 . TYR A 1 129 ? 37.707  14.936  34.623  1.00 41.35  ? 98   TYR A CD1 1 
ATOM   769  C CD2 . TYR A 1 129 ? 38.258  15.923  32.514  1.00 38.58  ? 98   TYR A CD2 1 
ATOM   770  C CE1 . TYR A 1 129 ? 38.971  15.330  35.145  1.00 39.21  ? 98   TYR A CE1 1 
ATOM   771  C CE2 . TYR A 1 129 ? 39.476  16.308  33.027  1.00 37.15  ? 98   TYR A CE2 1 
ATOM   772  C CZ  . TYR A 1 129 ? 39.832  16.013  34.341  1.00 38.41  ? 98   TYR A CZ  1 
ATOM   773  O OH  . TYR A 1 129 ? 41.083  16.404  34.805  1.00 37.56  ? 98   TYR A OH  1 
ATOM   774  N N   . LEU A 1 130 ? 33.885  12.403  32.417  1.00 39.58  ? 99   LEU A N   1 
ATOM   775  C CA  . LEU A 1 130 ? 32.522  12.058  32.008  1.00 39.48  ? 99   LEU A CA  1 
ATOM   776  C C   . LEU A 1 130 ? 31.488  12.564  33.005  1.00 39.83  ? 99   LEU A C   1 
ATOM   777  O O   . LEU A 1 130 ? 31.814  12.944  34.127  1.00 39.73  ? 99   LEU A O   1 
ATOM   778  C CB  . LEU A 1 130 ? 32.395  10.563  31.797  1.00 39.72  ? 99   LEU A CB  1 
ATOM   779  C CG  . LEU A 1 130 ? 32.690  9.608   32.951  1.00 40.94  ? 99   LEU A CG  1 
ATOM   780  C CD1 . LEU A 1 130 ? 31.510  9.562   33.899  1.00 41.31  ? 99   LEU A CD1 1 
ATOM   781  C CD2 . LEU A 1 130 ? 32.963  8.203   32.375  1.00 40.17  ? 99   LEU A CD2 1 
ATOM   782  N N   . ASN A 1 131 ? 30.237  12.539  32.566  1.00 39.62  ? 100  ASN A N   1 
ATOM   783  C CA  . ASN A 1 131 ? 29.140  13.127  33.281  1.00 39.76  ? 100  ASN A CA  1 
ATOM   784  C C   . ASN A 1 131 ? 28.039  12.098  33.448  1.00 40.24  ? 100  ASN A C   1 
ATOM   785  O O   . ASN A 1 131 ? 27.841  11.265  32.563  1.00 40.23  ? 100  ASN A O   1 
ATOM   786  C CB  . ASN A 1 131 ? 28.637  14.289  32.447  1.00 39.47  ? 100  ASN A CB  1 
ATOM   787  C CG  . ASN A 1 131 ? 29.738  15.232  32.043  1.00 40.63  ? 100  ASN A CG  1 
ATOM   788  O OD1 . ASN A 1 131 ? 30.429  15.785  32.905  1.00 41.63  ? 100  ASN A OD1 1 
ATOM   789  N ND2 . ASN A 1 131 ? 29.909  15.441  30.725  1.00 41.65  ? 100  ASN A ND2 1 
ATOM   790  N N   . VAL A 1 132 ? 27.324  12.165  34.572  1.00 41.08  ? 101  VAL A N   1 
ATOM   791  C CA  . VAL A 1 132 ? 26.225  11.256  34.884  1.00 41.46  ? 101  VAL A CA  1 
ATOM   792  C C   . VAL A 1 132 ? 25.061  12.041  35.444  1.00 42.22  ? 101  VAL A C   1 
ATOM   793  O O   . VAL A 1 132 ? 25.237  12.777  36.398  1.00 42.72  ? 101  VAL A O   1 
ATOM   794  C CB  . VAL A 1 132 ? 26.652  10.222  35.921  1.00 41.49  ? 101  VAL A CB  1 
ATOM   795  C CG1 . VAL A 1 132 ? 25.538  9.267   36.200  1.00 42.70  ? 101  VAL A CG1 1 
ATOM   796  C CG2 . VAL A 1 132 ? 27.847  9.443   35.427  1.00 42.90  ? 101  VAL A CG2 1 
ATOM   797  N N   . TRP A 1 133 ? 23.878  11.893  34.854  1.00 42.98  ? 102  TRP A N   1 
ATOM   798  C CA  . TRP A 1 133 ? 22.633  12.403  35.444  1.00 44.33  ? 102  TRP A CA  1 
ATOM   799  C C   . TRP A 1 133 ? 21.817  11.207  35.867  1.00 46.14  ? 102  TRP A C   1 
ATOM   800  O O   . TRP A 1 133 ? 21.768  10.210  35.155  1.00 46.84  ? 102  TRP A O   1 
ATOM   801  C CB  . TRP A 1 133 ? 21.795  13.201  34.448  1.00 43.72  ? 102  TRP A CB  1 
ATOM   802  C CG  . TRP A 1 133 ? 22.350  14.511  34.039  1.00 44.07  ? 102  TRP A CG  1 
ATOM   803  C CD1 . TRP A 1 133 ? 22.020  15.727  34.544  1.00 46.18  ? 102  TRP A CD1 1 
ATOM   804  C CD2 . TRP A 1 133 ? 23.333  14.763  33.022  1.00 43.43  ? 102  TRP A CD2 1 
ATOM   805  N NE1 . TRP A 1 133 ? 22.739  16.722  33.919  1.00 46.40  ? 102  TRP A NE1 1 
ATOM   806  C CE2 . TRP A 1 133 ? 23.542  16.152  32.971  1.00 44.22  ? 102  TRP A CE2 1 
ATOM   807  C CE3 . TRP A 1 133 ? 24.026  13.960  32.130  1.00 43.57  ? 102  TRP A CE3 1 
ATOM   808  C CZ2 . TRP A 1 133 ? 24.409  16.739  32.080  1.00 45.33  ? 102  TRP A CZ2 1 
ATOM   809  C CZ3 . TRP A 1 133 ? 24.895  14.540  31.252  1.00 43.79  ? 102  TRP A CZ3 1 
ATOM   810  C CH2 . TRP A 1 133 ? 25.079  15.917  31.226  1.00 45.50  ? 102  TRP A CH2 1 
ATOM   811  N N   . THR A 1 134 ? 21.145  11.300  37.006  1.00 48.00  ? 103  THR A N   1 
ATOM   812  C CA  . THR A 1 134 ? 20.266  10.232  37.465  1.00 49.23  ? 103  THR A CA  1 
ATOM   813  C C   . THR A 1 134 ? 19.091  10.892  38.133  1.00 50.03  ? 103  THR A C   1 
ATOM   814  O O   . THR A 1 134 ? 19.196  12.025  38.544  1.00 49.44  ? 103  THR A O   1 
ATOM   815  C CB  . THR A 1 134 ? 20.942  9.361   38.510  1.00 50.03  ? 103  THR A CB  1 
ATOM   816  O OG1 . THR A 1 134 ? 21.083  10.113  39.715  1.00 50.01  ? 103  THR A OG1 1 
ATOM   817  C CG2 . THR A 1 134 ? 22.393  9.033   38.144  1.00 51.71  ? 103  THR A CG2 1 
ATOM   818  N N   . PRO A 1 135 ? 17.974  10.187  38.263  1.00 51.17  ? 104  PRO A N   1 
ATOM   819  C CA  . PRO A 1 135 ? 16.862  10.691  39.057  1.00 52.82  ? 104  PRO A CA  1 
ATOM   820  C C   . PRO A 1 135 ? 17.261  11.032  40.486  1.00 53.90  ? 104  PRO A C   1 
ATOM   821  O O   . PRO A 1 135 ? 18.247  10.509  41.000  1.00 54.61  ? 104  PRO A O   1 
ATOM   822  C CB  . PRO A 1 135 ? 15.864  9.524   39.032  1.00 53.21  ? 104  PRO A CB  1 
ATOM   823  C CG  . PRO A 1 135 ? 16.115  8.893   37.787  1.00 52.00  ? 104  PRO A CG  1 
ATOM   824  C CD  . PRO A 1 135 ? 17.629  8.905   37.631  1.00 50.81  ? 104  PRO A CD  1 
ATOM   825  N N   . TYR A 1 136 ? 16.518  11.954  41.076  1.00 55.18  ? 105  TYR A N   1 
ATOM   826  C CA  . TYR A 1 136 ? 16.642  12.312  42.472  1.00 56.77  ? 105  TYR A CA  1 
ATOM   827  C C   . TYR A 1 136 ? 15.284  12.086  43.151  1.00 59.10  ? 105  TYR A C   1 
ATOM   828  O O   . TYR A 1 136 ? 14.312  12.702  42.747  1.00 58.02  ? 105  TYR A O   1 
ATOM   829  C CB  . TYR A 1 136 ? 17.062  13.780  42.576  1.00 55.71  ? 105  TYR A CB  1 
ATOM   830  C CG  . TYR A 1 136 ? 17.271  14.298  43.986  1.00 54.62  ? 105  TYR A CG  1 
ATOM   831  C CD1 . TYR A 1 136 ? 18.537  14.624  44.428  1.00 52.15  ? 105  TYR A CD1 1 
ATOM   832  C CD2 . TYR A 1 136 ? 16.190  14.525  44.865  1.00 54.36  ? 105  TYR A CD2 1 
ATOM   833  C CE1 . TYR A 1 136 ? 18.756  15.123  45.704  1.00 52.07  ? 105  TYR A CE1 1 
ATOM   834  C CE2 . TYR A 1 136 ? 16.412  15.041  46.154  1.00 54.67  ? 105  TYR A CE2 1 
ATOM   835  C CZ  . TYR A 1 136 ? 17.709  15.311  46.555  1.00 52.82  ? 105  TYR A CZ  1 
ATOM   836  O OH  . TYR A 1 136 ? 17.995  15.816  47.778  1.00 51.83  ? 105  TYR A OH  1 
ATOM   837  N N   . PRO A 1 137 ? 15.200  11.219  44.163  1.00 61.75  ? 106  PRO A N   1 
ATOM   838  C CA  . PRO A 1 137 ? 16.295  10.350  44.615  1.00 62.74  ? 106  PRO A CA  1 
ATOM   839  C C   . PRO A 1 137 ? 16.630  9.234   43.641  1.00 63.76  ? 106  PRO A C   1 
ATOM   840  O O   . PRO A 1 137 ? 15.783  8.899   42.816  1.00 63.28  ? 106  PRO A O   1 
ATOM   841  C CB  . PRO A 1 137 ? 15.758  9.746   45.918  1.00 63.62  ? 106  PRO A CB  1 
ATOM   842  C CG  . PRO A 1 137 ? 14.273  9.836   45.813  1.00 64.15  ? 106  PRO A CG  1 
ATOM   843  C CD  . PRO A 1 137 ? 13.992  11.061  44.996  1.00 63.30  ? 106  PRO A CD  1 
ATOM   844  N N   . ARG A 1 138 ? 17.842  8.677   43.765  1.00 65.47  ? 107  ARG A N   1 
ATOM   845  C CA  . ARG A 1 138 ? 18.339  7.638   42.864  1.00 66.72  ? 107  ARG A CA  1 
ATOM   846  C C   . ARG A 1 138 ? 17.407  6.444   42.866  1.00 68.76  ? 107  ARG A C   1 
ATOM   847  O O   . ARG A 1 138 ? 16.884  6.065   43.913  1.00 70.30  ? 107  ARG A O   1 
ATOM   848  C CB  . ARG A 1 138 ? 19.766  7.210   43.220  1.00 66.59  ? 107  ARG A CB  1 
ATOM   849  C CG  . ARG A 1 138 ? 20.825  8.260   42.848  1.00 66.73  ? 107  ARG A CG  1 
ATOM   850  C CD  . ARG A 1 138 ? 22.242  7.769   42.916  1.00 68.26  ? 107  ARG A CD  1 
ATOM   851  N NE  . ARG A 1 138 ? 22.531  7.006   44.136  1.00 70.23  ? 107  ARG A NE  1 
ATOM   852  C CZ  . ARG A 1 138 ? 23.088  7.517   45.226  1.00 70.50  ? 107  ARG A CZ  1 
ATOM   853  N NH1 . ARG A 1 138 ? 23.420  8.799   45.234  1.00 70.30  ? 107  ARG A NH1 1 
ATOM   854  N NH2 . ARG A 1 138 ? 23.297  6.754   46.309  1.00 70.45  ? 107  ARG A NH2 1 
ATOM   855  N N   . PRO A 1 139 ? 17.210  5.836   41.694  1.00 70.11  ? 108  PRO A N   1 
ATOM   856  C CA  . PRO A 1 139 ? 16.187  4.782   41.528  1.00 71.68  ? 108  PRO A CA  1 
ATOM   857  C C   . PRO A 1 139 ? 16.370  3.585   42.488  1.00 73.10  ? 108  PRO A C   1 
ATOM   858  O O   . PRO A 1 139 ? 17.482  3.171   42.801  1.00 72.92  ? 108  PRO A O   1 
ATOM   859  C CB  . PRO A 1 139 ? 16.359  4.331   40.058  1.00 71.10  ? 108  PRO A CB  1 
ATOM   860  C CG  . PRO A 1 139 ? 17.755  4.819   39.634  1.00 69.61  ? 108  PRO A CG  1 
ATOM   861  C CD  . PRO A 1 139 ? 17.983  6.067   40.449  1.00 69.27  ? 108  PRO A CD  1 
ATOM   862  N N   . ALA A 1 140 ? 15.254  3.034   42.929  1.00 74.83  ? 109  ALA A N   1 
ATOM   863  C CA  . ALA A 1 140 ? 15.248  1.840   43.795  1.00 76.37  ? 109  ALA A CA  1 
ATOM   864  C C   . ALA A 1 140 ? 15.818  0.585   43.083  1.00 75.87  ? 109  ALA A C   1 
ATOM   865  O O   . ALA A 1 140 ? 16.719  -0.084  43.601  1.00 75.76  ? 109  ALA A O   1 
ATOM   866  C CB  . ALA A 1 140 ? 13.795  1.560   44.293  1.00 77.84  ? 109  ALA A CB  1 
ATOM   867  N N   . SER A 1 141 ? 15.272  0.295   41.897  1.00 75.05  ? 110  SER A N   1 
ATOM   868  C CA  . SER A 1 141 ? 15.718  -0.816  41.052  1.00 74.28  ? 110  SER A CA  1 
ATOM   869  C C   . SER A 1 141 ? 16.604  -0.354  39.861  1.00 71.72  ? 110  SER A C   1 
ATOM   870  O O   . SER A 1 141 ? 16.458  0.765   39.361  1.00 70.69  ? 110  SER A O   1 
ATOM   871  C CB  . SER A 1 141 ? 14.505  -1.607  40.538  1.00 75.32  ? 110  SER A CB  1 
ATOM   872  O OG  . SER A 1 141 ? 13.608  -0.773  39.836  1.00 75.86  ? 110  SER A OG  1 
ATOM   873  N N   . PRO A 1 142 ? 17.504  -1.227  39.403  1.00 70.15  ? 111  PRO A N   1 
ATOM   874  C CA  . PRO A 1 142 ? 18.450  -0.876  38.335  1.00 67.95  ? 111  PRO A CA  1 
ATOM   875  C C   . PRO A 1 142 ? 17.770  -0.316  37.081  1.00 66.15  ? 111  PRO A C   1 
ATOM   876  O O   . PRO A 1 142 ? 16.817  -0.903  36.574  1.00 66.55  ? 111  PRO A O   1 
ATOM   877  C CB  . PRO A 1 142 ? 19.139  -2.218  38.020  1.00 68.61  ? 111  PRO A CB  1 
ATOM   878  C CG  . PRO A 1 142 ? 19.006  -3.027  39.268  1.00 69.97  ? 111  PRO A CG  1 
ATOM   879  C CD  . PRO A 1 142 ? 17.684  -2.623  39.846  1.00 70.95  ? 111  PRO A CD  1 
ATOM   880  N N   . THR A 1 143 ? 18.300  0.791   36.574  1.00 63.33  ? 112  THR A N   1 
ATOM   881  C CA  . THR A 1 143 ? 17.693  1.520   35.483  1.00 61.75  ? 112  THR A CA  1 
ATOM   882  C C   . THR A 1 143 ? 18.536  1.464   34.225  1.00 58.81  ? 112  THR A C   1 
ATOM   883  O O   . THR A 1 143 ? 19.746  1.565   34.291  1.00 57.95  ? 112  THR A O   1 
ATOM   884  C CB  . THR A 1 143 ? 17.566  2.970   35.888  1.00 61.59  ? 112  THR A CB  1 
ATOM   885  O OG1 . THR A 1 143 ? 16.860  3.044   37.134  1.00 64.54  ? 112  THR A OG1 1 
ATOM   886  C CG2 . THR A 1 143 ? 16.703  3.712   34.913  1.00 61.35  ? 112  THR A CG2 1 
ATOM   887  N N   . PRO A 1 144 ? 17.875  1.312   33.087  1.00 57.04  ? 113  PRO A N   1 
ATOM   888  C CA  . PRO A 1 144 ? 18.497  1.496   31.776  1.00 54.90  ? 113  PRO A CA  1 
ATOM   889  C C   . PRO A 1 144 ? 19.390  2.750   31.651  1.00 51.76  ? 113  PRO A C   1 
ATOM   890  O O   . PRO A 1 144 ? 18.998  3.850   32.020  1.00 51.08  ? 113  PRO A O   1 
ATOM   891  C CB  . PRO A 1 144 ? 17.275  1.599   30.862  1.00 55.68  ? 113  PRO A CB  1 
ATOM   892  C CG  . PRO A 1 144 ? 16.283  0.646   31.509  1.00 57.38  ? 113  PRO A CG  1 
ATOM   893  C CD  . PRO A 1 144 ? 16.463  0.878   32.966  1.00 58.50  ? 113  PRO A CD  1 
ATOM   894  N N   . VAL A 1 145 ? 20.577  2.537   31.113  1.00 48.83  ? 114  VAL A N   1 
ATOM   895  C CA  . VAL A 1 145 ? 21.610  3.553   30.987  1.00 46.86  ? 114  VAL A CA  1 
ATOM   896  C C   . VAL A 1 145 ? 21.687  3.961   29.526  1.00 45.12  ? 114  VAL A C   1 
ATOM   897  O O   . VAL A 1 145 ? 21.634  3.120   28.657  1.00 44.36  ? 114  VAL A O   1 
ATOM   898  C CB  . VAL A 1 145 ? 22.991  2.991   31.442  1.00 46.27  ? 114  VAL A CB  1 
ATOM   899  C CG1 . VAL A 1 145 ? 24.096  3.990   31.260  1.00 44.29  ? 114  VAL A CG1 1 
ATOM   900  C CG2 . VAL A 1 145 ? 22.913  2.559   32.880  1.00 47.99  ? 114  VAL A CG2 1 
ATOM   901  N N   . LEU A 1 146 ? 21.782  5.255   29.266  1.00 44.17  ? 115  LEU A N   1 
ATOM   902  C CA  . LEU A 1 146 ? 21.977  5.769   27.932  1.00 43.60  ? 115  LEU A CA  1 
ATOM   903  C C   . LEU A 1 146 ? 23.307  6.496   27.941  1.00 42.45  ? 115  LEU A C   1 
ATOM   904  O O   . LEU A 1 146 ? 23.525  7.351   28.797  1.00 42.67  ? 115  LEU A O   1 
ATOM   905  C CB  . LEU A 1 146 ? 20.854  6.737   27.604  1.00 44.36  ? 115  LEU A CB  1 
ATOM   906  C CG  . LEU A 1 146 ? 19.525  6.214   27.019  1.00 48.52  ? 115  LEU A CG  1 
ATOM   907  C CD1 . LEU A 1 146 ? 18.381  7.056   27.448  1.00 51.87  ? 115  LEU A CD1 1 
ATOM   908  C CD2 . LEU A 1 146 ? 19.561  6.295   25.504  1.00 52.40  ? 115  LEU A CD2 1 
ATOM   909  N N   . ILE A 1 147 ? 24.197  6.160   27.013  1.00 41.21  ? 116  ILE A N   1 
ATOM   910  C CA  . ILE A 1 147 ? 25.480  6.834   26.898  1.00 40.23  ? 116  ILE A CA  1 
ATOM   911  C C   . ILE A 1 147 ? 25.513  7.636   25.597  1.00 39.72  ? 116  ILE A C   1 
ATOM   912  O O   . ILE A 1 147 ? 25.421  7.055   24.510  1.00 39.76  ? 116  ILE A O   1 
ATOM   913  C CB  . ILE A 1 147 ? 26.632  5.825   26.913  1.00 40.58  ? 116  ILE A CB  1 
ATOM   914  C CG1 . ILE A 1 147 ? 26.471  4.908   28.124  1.00 41.86  ? 116  ILE A CG1 1 
ATOM   915  C CG2 . ILE A 1 147 ? 27.991  6.551   26.871  1.00 39.31  ? 116  ILE A CG2 1 
ATOM   916  C CD1 . ILE A 1 147 ? 27.558  3.955   28.312  1.00 43.05  ? 116  ILE A CD1 1 
ATOM   917  N N   . TRP A 1 148 ? 25.654  8.951   25.725  1.00 38.25  ? 117  TRP A N   1 
ATOM   918  C CA  . TRP A 1 148 ? 25.801  9.840   24.603  1.00 38.08  ? 117  TRP A CA  1 
ATOM   919  C C   . TRP A 1 148 ? 27.258  10.045  24.146  1.00 37.35  ? 117  TRP A C   1 
ATOM   920  O O   . TRP A 1 148 ? 28.154  10.257  24.949  1.00 36.44  ? 117  TRP A O   1 
ATOM   921  C CB  . TRP A 1 148 ? 25.222  11.198  24.957  1.00 38.03  ? 117  TRP A CB  1 
ATOM   922  C CG  . TRP A 1 148 ? 25.371  12.236  23.883  1.00 38.59  ? 117  TRP A CG  1 
ATOM   923  C CD1 . TRP A 1 148 ? 26.174  13.346  23.917  1.00 40.18  ? 117  TRP A CD1 1 
ATOM   924  C CD2 . TRP A 1 148 ? 24.649  12.309  22.658  1.00 37.81  ? 117  TRP A CD2 1 
ATOM   925  N NE1 . TRP A 1 148 ? 26.002  14.091  22.774  1.00 40.14  ? 117  TRP A NE1 1 
ATOM   926  C CE2 . TRP A 1 148 ? 25.067  13.478  21.987  1.00 39.59  ? 117  TRP A CE2 1 
ATOM   927  C CE3 . TRP A 1 148 ? 23.680  11.512  22.059  1.00 39.50  ? 117  TRP A CE3 1 
ATOM   928  C CZ2 . TRP A 1 148 ? 24.547  13.860  20.755  1.00 40.47  ? 117  TRP A CZ2 1 
ATOM   929  C CZ3 . TRP A 1 148 ? 23.166  11.888  20.829  1.00 40.30  ? 117  TRP A CZ3 1 
ATOM   930  C CH2 . TRP A 1 148 ? 23.591  13.051  20.196  1.00 40.11  ? 117  TRP A CH2 1 
ATOM   931  N N   . ILE A 1 149 ? 27.454  9.974   22.832  1.00 37.10  ? 118  ILE A N   1 
ATOM   932  C CA  . ILE A 1 149 ? 28.737  10.265  22.192  1.00 37.00  ? 118  ILE A CA  1 
ATOM   933  C C   . ILE A 1 149 ? 28.490  11.427  21.213  1.00 36.90  ? 118  ILE A C   1 
ATOM   934  O O   . ILE A 1 149 ? 27.814  11.273  20.214  1.00 37.44  ? 118  ILE A O   1 
ATOM   935  C CB  . ILE A 1 149 ? 29.269  9.040   21.450  1.00 36.61  ? 118  ILE A CB  1 
ATOM   936  C CG1 . ILE A 1 149 ? 29.297  7.812   22.377  1.00 36.65  ? 118  ILE A CG1 1 
ATOM   937  C CG2 . ILE A 1 149 ? 30.652  9.299   20.910  1.00 35.82  ? 118  ILE A CG2 1 
ATOM   938  C CD1 . ILE A 1 149 ? 29.809  6.590   21.699  1.00 37.24  ? 118  ILE A CD1 1 
ATOM   939  N N   . TYR A 1 150 ? 29.008  12.597  21.537  1.00 37.02  ? 119  TYR A N   1 
ATOM   940  C CA  . TYR A 1 150 ? 28.842  13.752  20.680  1.00 36.76  ? 119  TYR A CA  1 
ATOM   941  C C   . TYR A 1 150 ? 29.568  13.610  19.349  1.00 36.88  ? 119  TYR A C   1 
ATOM   942  O O   . TYR A 1 150 ? 30.582  12.862  19.207  1.00 36.09  ? 119  TYR A O   1 
ATOM   943  C CB  . TYR A 1 150 ? 29.334  15.018  21.357  1.00 36.30  ? 119  TYR A CB  1 
ATOM   944  C CG  . TYR A 1 150 ? 30.808  15.021  21.769  1.00 36.64  ? 119  TYR A CG  1 
ATOM   945  C CD1 . TYR A 1 150 ? 31.833  15.240  20.841  1.00 36.85  ? 119  TYR A CD1 1 
ATOM   946  C CD2 . TYR A 1 150 ? 31.156  14.876  23.107  1.00 37.23  ? 119  TYR A CD2 1 
ATOM   947  C CE1 . TYR A 1 150 ? 33.222  15.264  21.245  1.00 38.76  ? 119  TYR A CE1 1 
ATOM   948  C CE2 . TYR A 1 150 ? 32.469  14.906  23.509  1.00 41.66  ? 119  TYR A CE2 1 
ATOM   949  C CZ  . TYR A 1 150 ? 33.511  15.106  22.587  1.00 40.07  ? 119  TYR A CZ  1 
ATOM   950  O OH  . TYR A 1 150 ? 34.786  15.107  23.071  1.00 37.84  ? 119  TYR A OH  1 
ATOM   951  N N   . GLY A 1 151 ? 29.051  14.381  18.395  1.00 36.81  ? 120  GLY A N   1 
ATOM   952  C CA  . GLY A 1 151 ? 29.689  14.586  17.105  1.00 37.07  ? 120  GLY A CA  1 
ATOM   953  C C   . GLY A 1 151 ? 30.461  15.888  17.033  1.00 37.05  ? 120  GLY A C   1 
ATOM   954  O O   . GLY A 1 151 ? 30.763  16.530  18.055  1.00 37.76  ? 120  GLY A O   1 
ATOM   955  N N   . GLY A 1 152 ? 30.769  16.293  15.803  1.00 37.66  ? 121  GLY A N   1 
ATOM   956  C CA  . GLY A 1 152 ? 31.717  17.387  15.516  1.00 37.23  ? 121  GLY A CA  1 
ATOM   957  C C   . GLY A 1 152 ? 32.867  16.946  14.602  1.00 37.70  ? 121  GLY A C   1 
ATOM   958  O O   . GLY A 1 152 ? 34.003  17.439  14.720  1.00 38.29  ? 121  GLY A O   1 
ATOM   959  N N   . GLY A 1 153 ? 32.589  16.004  13.710  1.00 37.62  ? 122  GLY A N   1 
ATOM   960  C CA  . GLY A 1 153 ? 33.534  15.620  12.667  1.00 38.53  ? 122  GLY A CA  1 
ATOM   961  C C   . GLY A 1 153 ? 34.848  15.001  13.140  1.00 38.53  ? 122  GLY A C   1 
ATOM   962  O O   . GLY A 1 153 ? 35.829  15.018  12.411  1.00 38.65  ? 122  GLY A O   1 
ATOM   963  N N   . PHE A 1 154 ? 34.849  14.485  14.374  1.00 38.61  ? 123  PHE A N   1 
ATOM   964  C CA  . PHE A 1 154 ? 36.020  13.967  15.027  1.00 38.14  ? 123  PHE A CA  1 
ATOM   965  C C   . PHE A 1 154 ? 37.127  14.997  15.326  1.00 38.45  ? 123  PHE A C   1 
ATOM   966  O O   . PHE A 1 154 ? 38.218  14.605  15.730  1.00 39.03  ? 123  PHE A O   1 
ATOM   967  C CB  . PHE A 1 154 ? 36.561  12.833  14.182  1.00 38.86  ? 123  PHE A CB  1 
ATOM   968  C CG  . PHE A 1 154 ? 35.715  11.606  14.198  1.00 38.48  ? 123  PHE A CG  1 
ATOM   969  C CD1 . PHE A 1 154 ? 35.590  10.859  15.362  1.00 38.34  ? 123  PHE A CD1 1 
ATOM   970  C CD2 . PHE A 1 154 ? 35.106  11.157  13.041  1.00 37.81  ? 123  PHE A CD2 1 
ATOM   971  C CE1 . PHE A 1 154 ? 34.821  9.703   15.379  1.00 40.35  ? 123  PHE A CE1 1 
ATOM   972  C CE2 . PHE A 1 154 ? 34.367  9.976   13.038  1.00 37.13  ? 123  PHE A CE2 1 
ATOM   973  C CZ  . PHE A 1 154 ? 34.214  9.256   14.205  1.00 38.70  ? 123  PHE A CZ  1 
ATOM   974  N N   . TYR A 1 155 ? 36.826  16.289  15.152  1.00 38.17  ? 124  TYR A N   1 
ATOM   975  C CA  . TYR A 1 155 ? 37.763  17.413  15.326  1.00 38.48  ? 124  TYR A CA  1 
ATOM   976  C C   . TYR A 1 155 ? 37.267  18.397  16.411  1.00 38.29  ? 124  TYR A C   1 
ATOM   977  O O   . TYR A 1 155 ? 37.985  19.294  16.816  1.00 37.81  ? 124  TYR A O   1 
ATOM   978  C CB  . TYR A 1 155 ? 38.007  18.154  13.973  1.00 38.63  ? 124  TYR A CB  1 
ATOM   979  C CG  . TYR A 1 155 ? 37.022  19.234  13.633  1.00 39.01  ? 124  TYR A CG  1 
ATOM   980  C CD1 . TYR A 1 155 ? 37.175  20.524  14.125  1.00 42.61  ? 124  TYR A CD1 1 
ATOM   981  C CD2 . TYR A 1 155 ? 35.908  18.974  12.843  1.00 43.61  ? 124  TYR A CD2 1 
ATOM   982  C CE1 . TYR A 1 155 ? 36.272  21.543  13.825  1.00 40.60  ? 124  TYR A CE1 1 
ATOM   983  C CE2 . TYR A 1 155 ? 34.966  19.998  12.550  1.00 43.32  ? 124  TYR A CE2 1 
ATOM   984  C CZ  . TYR A 1 155 ? 35.168  21.273  13.059  1.00 41.74  ? 124  TYR A CZ  1 
ATOM   985  O OH  . TYR A 1 155 ? 34.277  22.292  12.788  1.00 45.11  ? 124  TYR A OH  1 
ATOM   986  N N   . SER A 1 156 ? 36.044  18.196  16.879  1.00 37.82  ? 125  SER A N   1 
ATOM   987  C CA  . SER A 1 156 ? 35.415  19.103  17.817  1.00 37.64  ? 125  SER A CA  1 
ATOM   988  C C   . SER A 1 156 ? 34.304  18.398  18.595  1.00 36.86  ? 125  SER A C   1 
ATOM   989  O O   . SER A 1 156 ? 33.967  17.239  18.342  1.00 36.46  ? 125  SER A O   1 
ATOM   990  C CB  . SER A 1 156 ? 34.762  20.274  17.058  1.00 38.44  ? 125  SER A CB  1 
ATOM   991  O OG  . SER A 1 156 ? 33.841  19.762  16.101  1.00 38.55  ? 125  SER A OG  1 
ATOM   992  N N   . GLY A 1 157 ? 33.715  19.154  19.501  1.00 36.19  ? 126  GLY A N   1 
ATOM   993  C CA  . GLY A 1 157 ? 32.656  18.678  20.343  1.00 36.28  ? 126  GLY A CA  1 
ATOM   994  C C   . GLY A 1 157 ? 33.054  18.651  21.804  1.00 35.98  ? 126  GLY A C   1 
ATOM   995  O O   . GLY A 1 157 ? 34.216  18.768  22.166  1.00 36.06  ? 126  GLY A O   1 
ATOM   996  N N   . ALA A 1 158 ? 32.043  18.499  22.629  1.00 35.92  ? 127  ALA A N   1 
ATOM   997  C CA  . ALA A 1 158 ? 32.191  18.420  24.067  1.00 36.90  ? 127  ALA A CA  1 
ATOM   998  C C   . ALA A 1 158 ? 30.882  17.877  24.676  1.00 36.79  ? 127  ALA A C   1 
ATOM   999  O O   . ALA A 1 158 ? 29.827  18.133  24.158  1.00 36.98  ? 127  ALA A O   1 
ATOM   1000 C CB  . ALA A 1 158 ? 32.516  19.808  24.635  1.00 37.15  ? 127  ALA A CB  1 
ATOM   1001 N N   . ALA A 1 159 ? 30.953  17.156  25.787  1.00 37.42  ? 128  ALA A N   1 
ATOM   1002 C CA  . ALA A 1 159 ? 29.737  16.628  26.430  1.00 37.65  ? 128  ALA A CA  1 
ATOM   1003 C C   . ALA A 1 159 ? 29.019  17.657  27.259  1.00 38.45  ? 128  ALA A C   1 
ATOM   1004 O O   . ALA A 1 159 ? 27.904  17.397  27.716  1.00 39.25  ? 128  ALA A O   1 
ATOM   1005 C CB  . ALA A 1 159 ? 30.040  15.434  27.285  1.00 37.92  ? 128  ALA A CB  1 
ATOM   1006 N N   . SER A 1 160 ? 29.636  18.819  27.439  1.00 38.54  ? 129  SER A N   1 
ATOM   1007 C CA  . SER A 1 160 ? 29.101  19.891  28.281  1.00 39.18  ? 129  SER A CA  1 
ATOM   1008 C C   . SER A 1 160 ? 28.182  20.893  27.555  1.00 39.62  ? 129  SER A C   1 
ATOM   1009 O O   . SER A 1 160 ? 27.660  21.814  28.177  1.00 40.75  ? 129  SER A O   1 
ATOM   1010 C CB  . SER A 1 160 ? 30.292  20.649  28.883  1.00 39.22  ? 129  SER A CB  1 
ATOM   1011 O OG  . SER A 1 160 ? 31.197  21.066  27.861  1.00 39.08  ? 129  SER A OG  1 
ATOM   1012 N N   . LEU A 1 161 ? 28.002  20.760  26.248  1.00 39.36  ? 130  LEU A N   1 
ATOM   1013 C CA  . LEU A 1 161 ? 27.163  21.696  25.518  1.00 39.81  ? 130  LEU A CA  1 
ATOM   1014 C C   . LEU A 1 161 ? 25.721  21.594  26.001  1.00 40.37  ? 130  LEU A C   1 
ATOM   1015 O O   . LEU A 1 161 ? 25.283  20.535  26.437  1.00 40.22  ? 130  LEU A O   1 
ATOM   1016 C CB  . LEU A 1 161 ? 27.226  21.431  24.013  1.00 39.68  ? 130  LEU A CB  1 
ATOM   1017 C CG  . LEU A 1 161 ? 28.607  21.334  23.364  1.00 40.66  ? 130  LEU A CG  1 
ATOM   1018 C CD1 . LEU A 1 161 ? 28.433  21.176  21.889  1.00 43.27  ? 130  LEU A CD1 1 
ATOM   1019 C CD2 . LEU A 1 161 ? 29.447  22.581  23.657  1.00 41.99  ? 130  LEU A CD2 1 
ATOM   1020 N N   . ASP A 1 162 ? 24.990  22.699  25.901  1.00 41.21  ? 131  ASP A N   1 
ATOM   1021 C CA  . ASP A 1 162 ? 23.639  22.772  26.406  1.00 42.82  ? 131  ASP A CA  1 
ATOM   1022 C C   . ASP A 1 162 ? 22.686  21.771  25.776  1.00 42.37  ? 131  ASP A C   1 
ATOM   1023 O O   . ASP A 1 162 ? 21.774  21.319  26.452  1.00 42.96  ? 131  ASP A O   1 
ATOM   1024 C CB  . ASP A 1 162 ? 23.060  24.197  26.236  1.00 43.52  ? 131  ASP A CB  1 
ATOM   1025 C CG  . ASP A 1 162 ? 23.649  25.199  27.222  1.00 46.62  ? 131  ASP A CG  1 
ATOM   1026 O OD1 . ASP A 1 162 ? 24.355  24.806  28.180  1.00 49.23  ? 131  ASP A OD1 1 
ATOM   1027 O OD2 . ASP A 1 162 ? 23.497  26.434  27.100  1.00 52.59  ? 131  ASP A OD2 1 
ATOM   1028 N N   . VAL A 1 163 ? 22.863  21.473  24.484  1.00 41.58  ? 132  VAL A N   1 
ATOM   1029 C CA  . VAL A 1 163 ? 21.972  20.547  23.778  1.00 41.56  ? 132  VAL A CA  1 
ATOM   1030 C C   . VAL A 1 163 ? 22.150  19.109  24.206  1.00 40.57  ? 132  VAL A C   1 
ATOM   1031 O O   . VAL A 1 163 ? 21.335  18.271  23.870  1.00 40.96  ? 132  VAL A O   1 
ATOM   1032 C CB  . VAL A 1 163 ? 22.103  20.626  22.234  1.00 41.29  ? 132  VAL A CB  1 
ATOM   1033 C CG1 . VAL A 1 163 ? 21.435  21.876  21.725  1.00 43.70  ? 132  VAL A CG1 1 
ATOM   1034 C CG2 . VAL A 1 163 ? 23.552  20.594  21.794  1.00 42.43  ? 132  VAL A CG2 1 
ATOM   1035 N N   . TYR A 1 164 ? 23.233  18.814  24.913  1.00 39.78  ? 133  TYR A N   1 
ATOM   1036 C CA  . TYR A 1 164 ? 23.447  17.467  25.452  1.00 39.46  ? 133  TYR A CA  1 
ATOM   1037 C C   . TYR A 1 164 ? 23.087  17.367  26.970  1.00 39.87  ? 133  TYR A C   1 
ATOM   1038 O O   . TYR A 1 164 ? 23.433  16.417  27.645  1.00 39.99  ? 133  TYR A O   1 
ATOM   1039 C CB  . TYR A 1 164 ? 24.887  17.017  25.206  1.00 38.64  ? 133  TYR A CB  1 
ATOM   1040 C CG  . TYR A 1 164 ? 25.417  17.184  23.813  1.00 38.19  ? 133  TYR A CG  1 
ATOM   1041 C CD1 . TYR A 1 164 ? 24.581  17.030  22.689  1.00 39.27  ? 133  TYR A CD1 1 
ATOM   1042 C CD2 . TYR A 1 164 ? 26.768  17.498  23.597  1.00 37.39  ? 133  TYR A CD2 1 
ATOM   1043 C CE1 . TYR A 1 164 ? 25.078  17.189  21.393  1.00 38.38  ? 133  TYR A CE1 1 
ATOM   1044 C CE2 . TYR A 1 164 ? 27.273  17.684  22.290  1.00 35.86  ? 133  TYR A CE2 1 
ATOM   1045 C CZ  . TYR A 1 164 ? 26.429  17.499  21.199  1.00 37.73  ? 133  TYR A CZ  1 
ATOM   1046 O OH  . TYR A 1 164 ? 26.896  17.655  19.901  1.00 35.85  ? 133  TYR A OH  1 
ATOM   1047 N N   . ASP A 1 165 ? 22.342  18.333  27.488  1.00 40.49  ? 134  ASP A N   1 
ATOM   1048 C CA  . ASP A 1 165 ? 21.955  18.329  28.902  1.00 41.19  ? 134  ASP A CA  1 
ATOM   1049 C C   . ASP A 1 165 ? 21.051  17.120  29.246  1.00 41.56  ? 134  ASP A C   1 
ATOM   1050 O O   . ASP A 1 165 ? 19.922  17.026  28.788  1.00 41.50  ? 134  ASP A O   1 
ATOM   1051 C CB  . ASP A 1 165 ? 21.256  19.635  29.208  1.00 41.73  ? 134  ASP A CB  1 
ATOM   1052 C CG  . ASP A 1 165 ? 21.014  19.859  30.673  1.00 43.53  ? 134  ASP A CG  1 
ATOM   1053 O OD1 . ASP A 1 165 ? 21.167  18.951  31.500  1.00 47.26  ? 134  ASP A OD1 1 
ATOM   1054 O OD2 . ASP A 1 165 ? 20.623  20.956  31.079  1.00 45.77  ? 134  ASP A OD2 1 
ATOM   1055 N N   . GLY A 1 166 ? 21.565  16.218  30.072  1.00 42.01  ? 135  GLY A N   1 
ATOM   1056 C CA  . GLY A 1 166 ? 20.849  15.000  30.448  1.00 42.56  ? 135  GLY A CA  1 
ATOM   1057 C C   . GLY A 1 166 ? 19.749  15.116  31.490  1.00 43.39  ? 135  GLY A C   1 
ATOM   1058 O O   . GLY A 1 166 ? 19.101  14.128  31.794  1.00 43.59  ? 135  GLY A O   1 
ATOM   1059 N N   . ARG A 1 167 ? 19.486  16.313  32.008  1.00 44.06  ? 136  ARG A N   1 
ATOM   1060 C CA  . ARG A 1 167 ? 18.552  16.454  33.130  1.00 45.20  ? 136  ARG A CA  1 
ATOM   1061 C C   . ARG A 1 167 ? 17.101  16.109  32.783  1.00 45.63  ? 136  ARG A C   1 
ATOM   1062 O O   . ARG A 1 167 ? 16.353  15.623  33.638  1.00 45.73  ? 136  ARG A O   1 
ATOM   1063 C CB  . ARG A 1 167 ? 18.641  17.856  33.766  1.00 45.50  ? 136  ARG A CB  1 
ATOM   1064 C CG  . ARG A 1 167 ? 17.991  18.980  32.992  1.00 46.79  ? 136  ARG A CG  1 
ATOM   1065 C CD  . ARG A 1 167 ? 18.077  20.363  33.653  1.00 48.61  ? 136  ARG A CD  1 
ATOM   1066 N NE  . ARG A 1 167 ? 19.466  20.815  33.707  1.00 52.05  ? 136  ARG A NE  1 
ATOM   1067 C CZ  . ARG A 1 167 ? 19.957  21.769  34.526  1.00 53.26  ? 136  ARG A CZ  1 
ATOM   1068 N NH1 . ARG A 1 167 ? 21.238  22.075  34.452  1.00 53.06  ? 136  ARG A NH1 1 
ATOM   1069 N NH2 . ARG A 1 167 ? 19.195  22.423  35.418  1.00 53.84  ? 136  ARG A NH2 1 
ATOM   1070 N N   . PHE A 1 168 ? 16.699  16.355  31.542  1.00 44.71  ? 137  PHE A N   1 
ATOM   1071 C CA  . PHE A 1 168 ? 15.319  16.126  31.165  1.00 45.15  ? 137  PHE A CA  1 
ATOM   1072 C C   . PHE A 1 168 ? 15.056  14.626  31.024  1.00 45.27  ? 137  PHE A C   1 
ATOM   1073 O O   . PHE A 1 168 ? 14.055  14.133  31.529  1.00 45.74  ? 137  PHE A O   1 
ATOM   1074 C CB  . PHE A 1 168 ? 14.942  16.886  29.880  1.00 44.65  ? 137  PHE A CB  1 
ATOM   1075 C CG  . PHE A 1 168 ? 15.315  18.302  29.922  1.00 44.37  ? 137  PHE A CG  1 
ATOM   1076 C CD1 . PHE A 1 168 ? 14.504  19.219  30.567  1.00 46.87  ? 137  PHE A CD1 1 
ATOM   1077 C CD2 . PHE A 1 168 ? 16.522  18.732  29.382  1.00 43.56  ? 137  PHE A CD2 1 
ATOM   1078 C CE1 . PHE A 1 168 ? 14.887  20.567  30.658  1.00 46.15  ? 137  PHE A CE1 1 
ATOM   1079 C CE2 . PHE A 1 168 ? 16.892  20.059  29.475  1.00 43.54  ? 137  PHE A CE2 1 
ATOM   1080 C CZ  . PHE A 1 168 ? 16.067  20.976  30.111  1.00 42.55  ? 137  PHE A CZ  1 
ATOM   1081 N N   . LEU A 1 169 ? 15.937  13.914  30.339  1.00 44.42  ? 138  LEU A N   1 
ATOM   1082 C CA  . LEU A 1 169 ? 15.765  12.475  30.173  1.00 45.80  ? 138  LEU A CA  1 
ATOM   1083 C C   . LEU A 1 169 ? 15.775  11.771  31.548  1.00 47.10  ? 138  LEU A C   1 
ATOM   1084 O O   . LEU A 1 169 ? 14.960  10.888  31.793  1.00 48.08  ? 138  LEU A O   1 
ATOM   1085 C CB  . LEU A 1 169 ? 16.863  11.892  29.260  1.00 44.86  ? 138  LEU A CB  1 
ATOM   1086 C CG  . LEU A 1 169 ? 16.641  12.140  27.768  1.00 44.49  ? 138  LEU A CG  1 
ATOM   1087 C CD1 . LEU A 1 169 ? 17.858  11.838  26.926  1.00 43.13  ? 138  LEU A CD1 1 
ATOM   1088 C CD2 . LEU A 1 169 ? 15.428  11.315  27.306  1.00 45.65  ? 138  LEU A CD2 1 
ATOM   1089 N N   . ALA A 1 170 ? 16.669  12.207  32.438  1.00 47.14  ? 139  ALA A N   1 
ATOM   1090 C CA  . ALA A 1 170 ? 16.768  11.660  33.785  1.00 48.23  ? 139  ALA A CA  1 
ATOM   1091 C C   . ALA A 1 170 ? 15.513  11.931  34.607  1.00 49.96  ? 139  ALA A C   1 
ATOM   1092 O O   . ALA A 1 170 ? 14.969  11.015  35.242  1.00 51.07  ? 139  ALA A O   1 
ATOM   1093 C CB  . ALA A 1 170 ? 18.014  12.200  34.517  1.00 47.80  ? 139  ALA A CB  1 
ATOM   1094 N N   . GLN A 1 171 ? 15.016  13.162  34.565  1.00 50.33  ? 140  GLN A N   1 
ATOM   1095 C CA  . GLN A 1 171 ? 13.862  13.525  35.379  1.00 51.59  ? 140  GLN A CA  1 
ATOM   1096 C C   . GLN A 1 171 ? 12.558  12.927  34.841  1.00 52.56  ? 140  GLN A C   1 
ATOM   1097 O O   . GLN A 1 171 ? 11.776  12.357  35.596  1.00 53.94  ? 140  GLN A O   1 
ATOM   1098 C CB  . GLN A 1 171 ? 13.712  15.041  35.465  1.00 51.71  ? 140  GLN A CB  1 
ATOM   1099 C CG  . GLN A 1 171 ? 12.945  15.508  36.679  1.00 52.62  ? 140  GLN A CG  1 
ATOM   1100 C CD  . GLN A 1 171 ? 11.422  15.327  36.561  1.00 53.22  ? 140  GLN A CD  1 
ATOM   1101 O OE1 . GLN A 1 171 ? 10.829  15.543  35.491  1.00 53.38  ? 140  GLN A OE1 1 
ATOM   1102 N NE2 . GLN A 1 171 ? 10.794  14.973  37.672  1.00 51.73  ? 140  GLN A NE2 1 
ATOM   1103 N N   . VAL A 1 172 ? 12.321  13.065  33.545  1.00 51.84  ? 141  VAL A N   1 
ATOM   1104 C CA  . VAL A 1 172 ? 11.031  12.682  32.982  1.00 52.36  ? 141  VAL A CA  1 
ATOM   1105 C C   . VAL A 1 172 ? 10.913  11.192  32.706  1.00 52.61  ? 141  VAL A C   1 
ATOM   1106 O O   . VAL A 1 172 ? 9.865   10.627  32.939  1.00 54.11  ? 141  VAL A O   1 
ATOM   1107 C CB  . VAL A 1 172 ? 10.721  13.451  31.699  1.00 51.88  ? 141  VAL A CB  1 
ATOM   1108 C CG1 . VAL A 1 172 ? 9.394   12.937  31.055  1.00 52.92  ? 141  VAL A CG1 1 
ATOM   1109 C CG2 . VAL A 1 172 ? 10.643  14.946  31.998  1.00 50.99  ? 141  VAL A CG2 1 
ATOM   1110 N N   . GLU A 1 173 ? 11.978  10.564  32.222  1.00 51.44  ? 142  GLU A N   1 
ATOM   1111 C CA  . GLU A 1 173 ? 11.950  9.152   31.871  1.00 51.61  ? 142  GLU A CA  1 
ATOM   1112 C C   . GLU A 1 173 ? 12.633  8.232   32.878  1.00 51.64  ? 142  GLU A C   1 
ATOM   1113 O O   . GLU A 1 173 ? 12.655  7.018   32.712  1.00 51.70  ? 142  GLU A O   1 
ATOM   1114 C CB  . GLU A 1 173 ? 12.597  8.966   30.503  1.00 51.11  ? 142  GLU A CB  1 
ATOM   1115 C CG  . GLU A 1 173 ? 11.838  9.618   29.373  1.00 52.08  ? 142  GLU A CG  1 
ATOM   1116 C CD  . GLU A 1 173 ? 10.449  9.029   29.194  1.00 57.11  ? 142  GLU A CD  1 
ATOM   1117 O OE1 . GLU A 1 173 ? 10.191  7.885   29.688  1.00 59.41  ? 142  GLU A OE1 1 
ATOM   1118 O OE2 . GLU A 1 173 ? 9.607   9.721   28.564  1.00 60.05  ? 142  GLU A OE2 1 
ATOM   1119 N N   . GLY A 1 174 ? 13.196  8.798   33.931  1.00 51.93  ? 143  GLY A N   1 
ATOM   1120 C CA  . GLY A 1 174 ? 13.876  7.994   34.935  1.00 52.12  ? 143  GLY A CA  1 
ATOM   1121 C C   . GLY A 1 174 ? 15.175  7.388   34.428  1.00 51.30  ? 143  GLY A C   1 
ATOM   1122 O O   . GLY A 1 174 ? 15.635  6.419   34.996  1.00 52.13  ? 143  GLY A O   1 
ATOM   1123 N N   . ALA A 1 175 ? 15.759  7.931   33.361  1.00 49.98  ? 144  ALA A N   1 
ATOM   1124 C CA  . ALA A 1 175 ? 16.990  7.359   32.796  1.00 48.91  ? 144  ALA A CA  1 
ATOM   1125 C C   . ALA A 1 175 ? 18.257  7.761   33.566  1.00 47.65  ? 144  ALA A C   1 
ATOM   1126 O O   . ALA A 1 175 ? 18.338  8.844   34.151  1.00 46.30  ? 144  ALA A O   1 
ATOM   1127 C CB  . ALA A 1 175 ? 17.151  7.791   31.342  1.00 48.58  ? 144  ALA A CB  1 
ATOM   1128 N N   . VAL A 1 176 ? 19.242  6.873   33.542  1.00 46.74  ? 145  VAL A N   1 
ATOM   1129 C CA  . VAL A 1 176 ? 20.602  7.234   33.886  1.00 46.40  ? 145  VAL A CA  1 
ATOM   1130 C C   . VAL A 1 176 ? 21.283  7.591   32.569  1.00 45.69  ? 145  VAL A C   1 
ATOM   1131 O O   . VAL A 1 176 ? 21.292  6.803   31.632  1.00 45.38  ? 145  VAL A O   1 
ATOM   1132 C CB  . VAL A 1 176 ? 21.345  6.096   34.599  1.00 46.62  ? 145  VAL A CB  1 
ATOM   1133 C CG1 . VAL A 1 176 ? 22.754  6.483   34.875  1.00 47.23  ? 145  VAL A CG1 1 
ATOM   1134 C CG2 . VAL A 1 176 ? 20.637  5.762   35.913  1.00 48.54  ? 145  VAL A CG2 1 
ATOM   1135 N N   . LEU A 1 177 ? 21.791  8.812   32.479  1.00 44.99  ? 146  LEU A N   1 
ATOM   1136 C CA  . LEU A 1 177 ? 22.415  9.265   31.266  1.00 44.20  ? 146  LEU A CA  1 
ATOM   1137 C C   . LEU A 1 177 ? 23.884  9.578   31.529  1.00 42.79  ? 146  LEU A C   1 
ATOM   1138 O O   . LEU A 1 177 ? 24.240  10.218  32.506  1.00 42.56  ? 146  LEU A O   1 
ATOM   1139 C CB  . LEU A 1 177 ? 21.673  10.476  30.697  1.00 44.55  ? 146  LEU A CB  1 
ATOM   1140 C CG  . LEU A 1 177 ? 21.979  10.715  29.210  1.00 45.56  ? 146  LEU A CG  1 
ATOM   1141 C CD1 . LEU A 1 177 ? 20.780  11.156  28.517  1.00 46.85  ? 146  LEU A CD1 1 
ATOM   1142 C CD2 . LEU A 1 177 ? 23.110  11.742  29.035  1.00 48.25  ? 146  LEU A CD2 1 
ATOM   1143 N N   . VAL A 1 178 ? 24.730  9.098   30.642  1.00 41.36  ? 147  VAL A N   1 
ATOM   1144 C CA  . VAL A 1 178 ? 26.155  9.252   30.787  1.00 40.62  ? 147  VAL A CA  1 
ATOM   1145 C C   . VAL A 1 178 ? 26.668  9.877   29.502  1.00 39.85  ? 147  VAL A C   1 
ATOM   1146 O O   . VAL A 1 178 ? 26.270  9.480   28.433  1.00 39.18  ? 147  VAL A O   1 
ATOM   1147 C CB  . VAL A 1 178 ? 26.874  7.908   30.991  1.00 40.52  ? 147  VAL A CB  1 
ATOM   1148 C CG1 . VAL A 1 178 ? 28.385  8.120   31.160  1.00 40.46  ? 147  VAL A CG1 1 
ATOM   1149 C CG2 . VAL A 1 178 ? 26.338  7.164   32.197  1.00 40.87  ? 147  VAL A CG2 1 
ATOM   1150 N N   . SER A 1 179 ? 27.546  10.865  29.619  1.00 39.17  ? 148  SER A N   1 
ATOM   1151 C CA  . SER A 1 179 ? 28.274  11.373  28.460  1.00 38.74  ? 148  SER A CA  1 
ATOM   1152 C C   . SER A 1 179 ? 29.750  11.574  28.804  1.00 38.33  ? 148  SER A C   1 
ATOM   1153 O O   . SER A 1 179 ? 30.111  11.863  29.939  1.00 39.27  ? 148  SER A O   1 
ATOM   1154 C CB  . SER A 1 179 ? 27.667  12.675  27.968  1.00 37.47  ? 148  SER A CB  1 
ATOM   1155 O OG  . SER A 1 179 ? 27.798  13.616  28.981  1.00 38.39  ? 148  SER A OG  1 
ATOM   1156 N N   . MET A 1 180 ? 30.601  11.415  27.815  1.00 38.03  ? 149  MET A N   1 
ATOM   1157 C CA  . MET A 1 180 ? 32.050  11.488  28.026  1.00 37.93  ? 149  MET A CA  1 
ATOM   1158 C C   . MET A 1 180 ? 32.705  12.383  27.013  1.00 37.40  ? 149  MET A C   1 
ATOM   1159 O O   . MET A 1 180 ? 32.240  12.512  25.872  1.00 36.59  ? 149  MET A O   1 
ATOM   1160 C CB  . MET A 1 180 ? 32.649  10.097  27.928  1.00 38.36  ? 149  MET A CB  1 
ATOM   1161 C CG  . MET A 1 180 ? 33.117  9.685   26.528  1.00 39.83  ? 149  MET A CG  1 
ATOM   1162 S SD  . MET A 1 180 ? 31.778  9.332   25.381  1.00 40.82  ? 149  MET A SD  1 
ATOM   1163 C CE  . MET A 1 180 ? 31.287  7.752   25.890  1.00 39.43  ? 149  MET A CE  1 
ATOM   1164 N N   . ASN A 1 181 ? 33.778  13.030  27.449  1.00 37.87  ? 150  ASN A N   1 
ATOM   1165 C CA  . ASN A 1 181 ? 34.686  13.721  26.541  1.00 37.49  ? 150  ASN A CA  1 
ATOM   1166 C C   . ASN A 1 181 ? 35.629  12.648  25.994  1.00 37.04  ? 150  ASN A C   1 
ATOM   1167 O O   . ASN A 1 181 ? 36.012  11.745  26.713  1.00 36.62  ? 150  ASN A O   1 
ATOM   1168 C CB  . ASN A 1 181 ? 35.491  14.787  27.259  1.00 37.86  ? 150  ASN A CB  1 
ATOM   1169 C CG  . ASN A 1 181 ? 34.696  16.047  27.559  1.00 40.32  ? 150  ASN A CG  1 
ATOM   1170 O OD1 . ASN A 1 181 ? 33.484  16.175  27.246  1.00 42.76  ? 150  ASN A OD1 1 
ATOM   1171 N ND2 . ASN A 1 181 ? 35.375  16.997  28.192  1.00 40.88  ? 150  ASN A ND2 1 
ATOM   1172 N N   . TYR A 1 182 ? 35.913  12.730  24.700  1.00 36.89  ? 151  TYR A N   1 
ATOM   1173 C CA  . TYR A 1 182 ? 36.959  11.956  24.043  1.00 36.58  ? 151  TYR A CA  1 
ATOM   1174 C C   . TYR A 1 182 ? 37.778  12.907  23.196  1.00 36.69  ? 151  TYR A C   1 
ATOM   1175 O O   . TYR A 1 182 ? 37.262  13.932  22.709  1.00 36.25  ? 151  TYR A O   1 
ATOM   1176 C CB  . TYR A 1 182 ? 36.382  10.859  23.167  1.00 35.85  ? 151  TYR A CB  1 
ATOM   1177 C CG  . TYR A 1 182 ? 35.509  11.331  22.040  1.00 35.25  ? 151  TYR A CG  1 
ATOM   1178 C CD1 . TYR A 1 182 ? 34.160  11.550  22.224  1.00 34.76  ? 151  TYR A CD1 1 
ATOM   1179 C CD2 . TYR A 1 182 ? 36.021  11.508  20.768  1.00 36.54  ? 151  TYR A CD2 1 
ATOM   1180 C CE1 . TYR A 1 182 ? 33.356  11.962  21.188  1.00 35.59  ? 151  TYR A CE1 1 
ATOM   1181 C CE2 . TYR A 1 182 ? 35.217  11.942  19.720  1.00 35.80  ? 151  TYR A CE2 1 
ATOM   1182 C CZ  . TYR A 1 182 ? 33.888  12.165  19.937  1.00 35.25  ? 151  TYR A CZ  1 
ATOM   1183 O OH  . TYR A 1 182 ? 33.086  12.585  18.895  1.00 36.91  ? 151  TYR A OH  1 
ATOM   1184 N N   . ARG A 1 183 ? 39.053  12.576  23.048  1.00 36.83  ? 152  ARG A N   1 
ATOM   1185 C CA  . ARG A 1 183 ? 39.990  13.397  22.286  1.00 37.23  ? 152  ARG A CA  1 
ATOM   1186 C C   . ARG A 1 183 ? 39.588  13.500  20.829  1.00 36.62  ? 152  ARG A C   1 
ATOM   1187 O O   . ARG A 1 183 ? 39.195  12.537  20.219  1.00 37.19  ? 152  ARG A O   1 
ATOM   1188 C CB  . ARG A 1 183 ? 41.425  12.823  22.371  1.00 37.32  ? 152  ARG A CB  1 
ATOM   1189 C CG  . ARG A 1 183 ? 42.078  13.081  23.702  1.00 38.03  ? 152  ARG A CG  1 
ATOM   1190 C CD  . ARG A 1 183 ? 43.417  12.400  23.910  1.00 38.48  ? 152  ARG A CD  1 
ATOM   1191 N NE  . ARG A 1 183 ? 43.220  11.001  24.191  1.00 38.28  ? 152  ARG A NE  1 
ATOM   1192 C CZ  . ARG A 1 183 ? 44.203  10.098  24.265  1.00 41.43  ? 152  ARG A CZ  1 
ATOM   1193 N NH1 . ARG A 1 183 ? 45.491  10.439  24.097  1.00 39.72  ? 152  ARG A NH1 1 
ATOM   1194 N NH2 . ARG A 1 183 ? 43.882  8.829   24.527  1.00 40.66  ? 152  ARG A NH2 1 
ATOM   1195 N N   . VAL A 1 184 ? 39.741  14.677  20.274  1.00 36.94  ? 153  VAL A N   1 
ATOM   1196 C CA  . VAL A 1 184 ? 39.438  14.930  18.886  1.00 37.29  ? 153  VAL A CA  1 
ATOM   1197 C C   . VAL A 1 184 ? 40.656  15.521  18.192  1.00 38.51  ? 153  VAL A C   1 
ATOM   1198 O O   . VAL A 1 184 ? 41.707  15.823  18.818  1.00 38.95  ? 153  VAL A O   1 
ATOM   1199 C CB  . VAL A 1 184 ? 38.255  15.897  18.768  1.00 37.47  ? 153  VAL A CB  1 
ATOM   1200 C CG1 . VAL A 1 184 ? 36.935  15.222  19.275  1.00 36.81  ? 153  VAL A CG1 1 
ATOM   1201 C CG2 . VAL A 1 184 ? 38.509  17.127  19.546  1.00 37.19  ? 153  VAL A CG2 1 
ATOM   1202 N N   . GLY A 1 185 ? 40.524  15.669  16.884  1.00 38.51  ? 154  GLY A N   1 
ATOM   1203 C CA  . GLY A 1 185 ? 41.580  16.234  16.079  1.00 38.92  ? 154  GLY A CA  1 
ATOM   1204 C C   . GLY A 1 185 ? 42.841  15.382  16.126  1.00 39.08  ? 154  GLY A C   1 
ATOM   1205 O O   . GLY A 1 185 ? 42.761  14.185  16.281  1.00 38.97  ? 154  GLY A O   1 
ATOM   1206 N N   . THR A 1 186 ? 43.993  16.020  15.983  1.00 39.16  ? 155  THR A N   1 
ATOM   1207 C CA  . THR A 1 186 ? 45.256  15.307  16.064  1.00 39.78  ? 155  THR A CA  1 
ATOM   1208 C C   . THR A 1 186 ? 45.371  14.550  17.386  1.00 39.51  ? 155  THR A C   1 
ATOM   1209 O O   . THR A 1 186 ? 45.859  13.460  17.404  1.00 40.97  ? 155  THR A O   1 
ATOM   1210 C CB  . THR A 1 186 ? 46.432  16.277  15.913  1.00 39.79  ? 155  THR A CB  1 
ATOM   1211 O OG1 . THR A 1 186 ? 46.293  17.339  16.861  1.00 38.84  ? 155  THR A OG1 1 
ATOM   1212 C CG2 . THR A 1 186 ? 46.406  16.952  14.576  1.00 39.21  ? 155  THR A CG2 1 
ATOM   1213 N N   . PHE A 1 187 ? 44.915  15.128  18.481  1.00 38.68  ? 156  PHE A N   1 
ATOM   1214 C CA  . PHE A 1 187 ? 45.125  14.517  19.791  1.00 39.14  ? 156  PHE A CA  1 
ATOM   1215 C C   . PHE A 1 187 ? 44.412  13.191  19.893  1.00 39.26  ? 156  PHE A C   1 
ATOM   1216 O O   . PHE A 1 187 ? 44.891  12.250  20.564  1.00 39.27  ? 156  PHE A O   1 
ATOM   1217 C CB  . PHE A 1 187 ? 44.678  15.459  20.913  1.00 39.24  ? 156  PHE A CB  1 
ATOM   1218 C CG  . PHE A 1 187 ? 45.170  16.853  20.727  1.00 39.20  ? 156  PHE A CG  1 
ATOM   1219 C CD1 . PHE A 1 187 ? 46.406  17.209  21.176  1.00 42.19  ? 156  PHE A CD1 1 
ATOM   1220 C CD2 . PHE A 1 187 ? 44.415  17.771  20.058  1.00 38.95  ? 156  PHE A CD2 1 
ATOM   1221 C CE1 . PHE A 1 187 ? 46.891  18.487  20.966  1.00 45.90  ? 156  PHE A CE1 1 
ATOM   1222 C CE2 . PHE A 1 187 ? 44.891  19.032  19.825  1.00 43.19  ? 156  PHE A CE2 1 
ATOM   1223 C CZ  . PHE A 1 187 ? 46.139  19.399  20.289  1.00 43.93  ? 156  PHE A CZ  1 
ATOM   1224 N N   . GLY A 1 188 ? 43.273  13.104  19.218  1.00 39.11  ? 157  GLY A N   1 
ATOM   1225 C CA  . GLY A 1 188 ? 42.499  11.880  19.247  1.00 39.32  ? 157  GLY A CA  1 
ATOM   1226 C C   . GLY A 1 188 ? 42.736  10.903  18.109  1.00 39.20  ? 157  GLY A C   1 
ATOM   1227 O O   . GLY A 1 188 ? 42.456  9.719   18.270  1.00 39.00  ? 157  GLY A O   1 
ATOM   1228 N N   . PHE A 1 189 ? 43.197  11.391  16.957  1.00 39.31  ? 158  PHE A N   1 
ATOM   1229 C CA  . PHE A 1 189 ? 43.153  10.597  15.719  1.00 39.65  ? 158  PHE A CA  1 
ATOM   1230 C C   . PHE A 1 189 ? 44.393  10.644  14.841  1.00 40.90  ? 158  PHE A C   1 
ATOM   1231 O O   . PHE A 1 189 ? 44.444  9.934   13.844  1.00 41.34  ? 158  PHE A O   1 
ATOM   1232 C CB  . PHE A 1 189 ? 41.883  10.929  14.946  1.00 38.58  ? 158  PHE A CB  1 
ATOM   1233 C CG  . PHE A 1 189 ? 40.661  10.520  15.693  1.00 38.72  ? 158  PHE A CG  1 
ATOM   1234 C CD1 . PHE A 1 189 ? 40.327  9.194   15.789  1.00 38.13  ? 158  PHE A CD1 1 
ATOM   1235 C CD2 . PHE A 1 189 ? 39.934  11.431  16.409  1.00 37.88  ? 158  PHE A CD2 1 
ATOM   1236 C CE1 . PHE A 1 189 ? 39.282  8.800   16.545  1.00 38.63  ? 158  PHE A CE1 1 
ATOM   1237 C CE2 . PHE A 1 189 ? 38.889  11.031  17.177  1.00 36.00  ? 158  PHE A CE2 1 
ATOM   1238 C CZ  . PHE A 1 189 ? 38.568  9.727   17.257  1.00 37.87  ? 158  PHE A CZ  1 
ATOM   1239 N N   . LEU A 1 190 ? 45.392  11.454  15.201  1.00 41.58  ? 159  LEU A N   1 
ATOM   1240 C CA  . LEU A 1 190 ? 46.620  11.467  14.437  1.00 42.87  ? 159  LEU A CA  1 
ATOM   1241 C C   . LEU A 1 190 ? 47.293  10.118  14.569  1.00 43.75  ? 159  LEU A C   1 
ATOM   1242 O O   . LEU A 1 190 ? 47.527  9.643   15.655  1.00 44.38  ? 159  LEU A O   1 
ATOM   1243 C CB  . LEU A 1 190 ? 47.564  12.579  14.887  1.00 43.66  ? 159  LEU A CB  1 
ATOM   1244 C CG  . LEU A 1 190 ? 48.914  12.673  14.120  1.00 43.14  ? 159  LEU A CG  1 
ATOM   1245 C CD1 . LEU A 1 190 ? 49.363  14.111  13.972  1.00 42.07  ? 159  LEU A CD1 1 
ATOM   1246 C CD2 . LEU A 1 190 ? 49.990  11.888  14.826  1.00 42.82  ? 159  LEU A CD2 1 
ATOM   1247 N N   . ALA A 1 191 ? 47.621  9.506   13.451  1.00 44.97  ? 160  ALA A N   1 
ATOM   1248 C CA  . ALA A 1 191 ? 48.147  8.149   13.469  1.00 46.37  ? 160  ALA A CA  1 
ATOM   1249 C C   . ALA A 1 191 ? 49.334  7.991   12.564  1.00 47.57  ? 160  ALA A C   1 
ATOM   1250 O O   . ALA A 1 191 ? 49.333  8.479   11.418  1.00 47.68  ? 160  ALA A O   1 
ATOM   1251 C CB  . ALA A 1 191 ? 47.068  7.183   13.054  1.00 46.58  ? 160  ALA A CB  1 
ATOM   1252 N N   . LEU A 1 192 ? 50.360  7.326   13.085  1.00 48.93  ? 161  LEU A N   1 
ATOM   1253 C CA  . LEU A 1 192 ? 51.385  6.706   12.247  1.00 50.41  ? 161  LEU A CA  1 
ATOM   1254 C C   . LEU A 1 192 ? 51.230  5.217   12.364  1.00 50.55  ? 161  LEU A C   1 
ATOM   1255 O O   . LEU A 1 192 ? 51.812  4.624   13.229  1.00 50.59  ? 161  LEU A O   1 
ATOM   1256 C CB  . LEU A 1 192 ? 52.752  7.167   12.680  1.00 51.32  ? 161  LEU A CB  1 
ATOM   1257 C CG  . LEU A 1 192 ? 52.810  8.655   12.330  1.00 53.94  ? 161  LEU A CG  1 
ATOM   1258 C CD1 . LEU A 1 192 ? 53.729  9.332   13.262  1.00 56.83  ? 161  LEU A CD1 1 
ATOM   1259 C CD2 . LEU A 1 192 ? 53.249  8.880   10.882  1.00 54.75  ? 161  LEU A CD2 1 
ATOM   1260 N N   . PRO A 1 193 ? 50.362  4.631   11.543  1.00 51.16  ? 162  PRO A N   1 
ATOM   1261 C CA  . PRO A 1 193 ? 49.933  3.233   11.728  1.00 52.29  ? 162  PRO A CA  1 
ATOM   1262 C C   . PRO A 1 193 ? 51.067  2.223   11.766  1.00 53.96  ? 162  PRO A C   1 
ATOM   1263 O O   . PRO A 1 193 ? 51.908  2.283   10.922  1.00 54.31  ? 162  PRO A O   1 
ATOM   1264 C CB  . PRO A 1 193 ? 49.023  2.994   10.511  1.00 52.02  ? 162  PRO A CB  1 
ATOM   1265 C CG  . PRO A 1 193 ? 48.492  4.319   10.200  1.00 50.04  ? 162  PRO A CG  1 
ATOM   1266 C CD  . PRO A 1 193 ? 49.648  5.247   10.411  1.00 50.36  ? 162  PRO A CD  1 
ATOM   1267 N N   . GLY A 1 194 ? 51.068  1.333   12.754  1.00 55.58  ? 163  GLY A N   1 
ATOM   1268 C CA  . GLY A 1 194 ? 52.143  0.386   12.982  1.00 57.24  ? 163  GLY A CA  1 
ATOM   1269 C C   . GLY A 1 194 ? 53.101  0.841   14.065  1.00 58.34  ? 163  GLY A C   1 
ATOM   1270 O O   . GLY A 1 194 ? 53.880  0.029   14.587  1.00 59.73  ? 163  GLY A O   1 
ATOM   1271 N N   . SER A 1 195 ? 53.061  2.129   14.398  1.00 58.25  ? 164  SER A N   1 
ATOM   1272 C CA  . SER A 1 195 ? 53.900  2.692   15.449  1.00 58.94  ? 164  SER A CA  1 
ATOM   1273 C C   . SER A 1 195 ? 53.406  2.350   16.850  1.00 59.88  ? 164  SER A C   1 
ATOM   1274 O O   . SER A 1 195 ? 52.235  2.002   17.074  1.00 59.59  ? 164  SER A O   1 
ATOM   1275 C CB  . SER A 1 195 ? 53.990  4.217   15.298  1.00 58.45  ? 164  SER A CB  1 
ATOM   1276 O OG  . SER A 1 195 ? 52.784  4.893   15.691  1.00 55.83  ? 164  SER A OG  1 
ATOM   1277 N N   . ARG A 1 196 ? 54.308  2.470   17.807  1.00 61.71  ? 165  ARG A N   1 
ATOM   1278 C CA  . ARG A 1 196 ? 53.957  2.240   19.200  1.00 62.76  ? 165  ARG A CA  1 
ATOM   1279 C C   . ARG A 1 196 ? 53.430  3.537   19.823  1.00 60.48  ? 165  ARG A C   1 
ATOM   1280 O O   . ARG A 1 196 ? 52.603  3.487   20.749  1.00 60.24  ? 165  ARG A O   1 
ATOM   1281 C CB  . ARG A 1 196 ? 55.181  1.693   19.985  1.00 65.24  ? 165  ARG A CB  1 
ATOM   1282 C CG  . ARG A 1 196 ? 54.813  0.959   21.310  1.00 70.95  ? 165  ARG A CG  1 
ATOM   1283 C CD  . ARG A 1 196 ? 55.859  1.096   22.477  1.00 78.51  ? 165  ARG A CD  1 
ATOM   1284 N NE  . ARG A 1 196 ? 55.448  2.140   23.448  1.00 82.82  ? 165  ARG A NE  1 
ATOM   1285 C CZ  . ARG A 1 196 ? 56.102  3.301   23.696  1.00 84.85  ? 165  ARG A CZ  1 
ATOM   1286 N NH1 . ARG A 1 196 ? 57.238  3.611   23.060  1.00 86.47  ? 165  ARG A NH1 1 
ATOM   1287 N NH2 . ARG A 1 196 ? 55.611  4.155   24.596  1.00 83.00  ? 165  ARG A NH2 1 
ATOM   1288 N N   . GLU A 1 197 ? 53.887  4.676   19.290  1.00 58.88  ? 166  GLU A N   1 
ATOM   1289 C CA  . GLU A 1 197 ? 53.727  5.989   19.912  1.00 58.03  ? 166  GLU A CA  1 
ATOM   1290 C C   . GLU A 1 197 ? 52.563  6.862   19.363  1.00 55.32  ? 166  GLU A C   1 
ATOM   1291 O O   . GLU A 1 197 ? 52.228  7.884   19.953  1.00 54.29  ? 166  GLU A O   1 
ATOM   1292 C CB  . GLU A 1 197 ? 55.035  6.774   19.753  1.00 59.18  ? 166  GLU A CB  1 
ATOM   1293 C CG  . GLU A 1 197 ? 56.270  6.124   20.403  1.00 63.23  ? 166  GLU A CG  1 
ATOM   1294 C CD  . GLU A 1 197 ? 57.201  5.376   19.419  1.00 67.73  ? 166  GLU A CD  1 
ATOM   1295 O OE1 . GLU A 1 197 ? 56.865  5.181   18.199  1.00 66.66  ? 166  GLU A OE1 1 
ATOM   1296 O OE2 . GLU A 1 197 ? 58.306  4.975   19.891  1.00 72.05  ? 166  GLU A OE2 1 
ATOM   1297 N N   . ALA A 1 198 ? 51.991  6.452   18.237  1.00 53.12  ? 167  ALA A N   1 
ATOM   1298 C CA  . ALA A 1 198 ? 50.791  7.055   17.645  1.00 50.96  ? 167  ALA A CA  1 
ATOM   1299 C C   . ALA A 1 198 ? 49.995  5.994   16.837  1.00 49.73  ? 167  ALA A C   1 
ATOM   1300 O O   . ALA A 1 198 ? 49.956  6.018   15.619  1.00 49.04  ? 167  ALA A O   1 
ATOM   1301 C CB  . ALA A 1 198 ? 51.164  8.234   16.756  1.00 50.05  ? 167  ALA A CB  1 
ATOM   1302 N N   . PRO A 1 199 ? 49.396  5.044   17.526  1.00 49.13  ? 168  PRO A N   1 
ATOM   1303 C CA  . PRO A 1 199 ? 48.768  3.891   16.857  1.00 49.32  ? 168  PRO A CA  1 
ATOM   1304 C C   . PRO A 1 199 ? 47.463  4.211   16.130  1.00 48.24  ? 168  PRO A C   1 
ATOM   1305 O O   . PRO A 1 199 ? 47.032  3.433   15.285  1.00 48.46  ? 168  PRO A O   1 
ATOM   1306 C CB  . PRO A 1 199 ? 48.505  2.913   18.024  1.00 49.61  ? 168  PRO A CB  1 
ATOM   1307 C CG  . PRO A 1 199 ? 48.391  3.813   19.289  1.00 49.05  ? 168  PRO A CG  1 
ATOM   1308 C CD  . PRO A 1 199 ? 49.309  4.965   19.001  1.00 49.22  ? 168  PRO A CD  1 
ATOM   1309 N N   . GLY A 1 200 ? 46.847  5.340   16.469  1.00 47.06  ? 169  GLY A N   1 
ATOM   1310 C CA  . GLY A 1 200 ? 45.598  5.759   15.866  1.00 45.87  ? 169  GLY A CA  1 
ATOM   1311 C C   . GLY A 1 200 ? 44.399  5.324   16.688  1.00 44.58  ? 169  GLY A C   1 
ATOM   1312 O O   . GLY A 1 200 ? 44.500  4.456   17.552  1.00 45.07  ? 169  GLY A O   1 
ATOM   1313 N N   . ASN A 1 201 ? 43.270  5.956   16.414  1.00 43.20  ? 170  ASN A N   1 
ATOM   1314 C CA  . ASN A 1 201 ? 41.989  5.630   17.031  1.00 42.17  ? 170  ASN A CA  1 
ATOM   1315 C C   . ASN A 1 201 ? 41.931  5.839   18.546  1.00 41.15  ? 170  ASN A C   1 
ATOM   1316 O O   . ASN A 1 201 ? 41.040  5.321   19.183  1.00 41.19  ? 170  ASN A O   1 
ATOM   1317 C CB  . ASN A 1 201 ? 41.574  4.188   16.672  1.00 42.27  ? 170  ASN A CB  1 
ATOM   1318 C CG  . ASN A 1 201 ? 41.348  3.998   15.175  1.00 43.38  ? 170  ASN A CG  1 
ATOM   1319 O OD1 . ASN A 1 201 ? 40.906  4.921   14.489  1.00 40.19  ? 170  ASN A OD1 1 
ATOM   1320 N ND2 . ASN A 1 201 ? 41.683  2.798   14.653  1.00 42.44  ? 170  ASN A ND2 1 
ATOM   1321 N N   . VAL A 1 202 ? 42.847  6.601   19.132  1.00 40.82  ? 171  VAL A N   1 
ATOM   1322 C CA  . VAL A 1 202 ? 42.886  6.715   20.589  1.00 40.41  ? 171  VAL A CA  1 
ATOM   1323 C C   . VAL A 1 202 ? 41.659  7.435   21.139  1.00 39.88  ? 171  VAL A C   1 
ATOM   1324 O O   . VAL A 1 202 ? 41.247  7.166   22.264  1.00 40.75  ? 171  VAL A O   1 
ATOM   1325 C CB  . VAL A 1 202 ? 44.185  7.321   21.121  1.00 40.60  ? 171  VAL A CB  1 
ATOM   1326 C CG1 . VAL A 1 202 ? 45.403  6.516   20.588  1.00 42.45  ? 171  VAL A CG1 1 
ATOM   1327 C CG2 . VAL A 1 202 ? 44.319  8.789   20.792  1.00 38.17  ? 171  VAL A CG2 1 
ATOM   1328 N N   . GLY A 1 203 ? 41.046  8.298   20.344  1.00 38.48  ? 172  GLY A N   1 
ATOM   1329 C CA  . GLY A 1 203 ? 39.801  8.909   20.745  1.00 38.18  ? 172  GLY A CA  1 
ATOM   1330 C C   . GLY A 1 203 ? 38.660  7.921   20.880  1.00 38.17  ? 172  GLY A C   1 
ATOM   1331 O O   . GLY A 1 203 ? 37.780  8.076   21.728  1.00 36.87  ? 172  GLY A O   1 
ATOM   1332 N N   . LEU A 1 204 ? 38.669  6.919   20.008  1.00 38.80  ? 173  LEU A N   1 
ATOM   1333 C CA  . LEU A 1 204 ? 37.744  5.806   20.104  1.00 39.32  ? 173  LEU A CA  1 
ATOM   1334 C C   . LEU A 1 204 ? 38.011  4.970   21.357  1.00 39.51  ? 173  LEU A C   1 
ATOM   1335 O O   . LEU A 1 204 ? 37.077  4.461   21.982  1.00 39.10  ? 173  LEU A O   1 
ATOM   1336 C CB  . LEU A 1 204 ? 37.811  4.926   18.853  1.00 39.58  ? 173  LEU A CB  1 
ATOM   1337 C CG  . LEU A 1 204 ? 37.171  5.562   17.621  1.00 40.76  ? 173  LEU A CG  1 
ATOM   1338 C CD1 . LEU A 1 204 ? 37.356  4.614   16.459  1.00 42.44  ? 173  LEU A CD1 1 
ATOM   1339 C CD2 . LEU A 1 204 ? 35.687  5.951   17.801  1.00 38.48  ? 173  LEU A CD2 1 
ATOM   1340 N N   . LEU A 1 205 ? 39.287  4.846   21.719  1.00 39.83  ? 174  LEU A N   1 
ATOM   1341 C CA  . LEU A 1 205 ? 39.686  4.113   22.910  1.00 39.73  ? 174  LEU A CA  1 
ATOM   1342 C C   . LEU A 1 205 ? 39.270  4.886   24.165  1.00 39.32  ? 174  LEU A C   1 
ATOM   1343 O O   . LEU A 1 205 ? 38.953  4.280   25.173  1.00 39.65  ? 174  LEU A O   1 
ATOM   1344 C CB  . LEU A 1 205 ? 41.192  3.862   22.903  1.00 39.60  ? 174  LEU A CB  1 
ATOM   1345 C CG  . LEU A 1 205 ? 41.691  2.878   21.850  1.00 42.35  ? 174  LEU A CG  1 
ATOM   1346 C CD1 . LEU A 1 205 ? 43.199  2.709   21.954  1.00 42.74  ? 174  LEU A CD1 1 
ATOM   1347 C CD2 . LEU A 1 205 ? 41.075  1.455   21.956  1.00 43.74  ? 174  LEU A CD2 1 
ATOM   1348 N N   . ASP A 1 206 ? 39.243  6.217   24.110  1.00 38.79  ? 175  ASP A N   1 
ATOM   1349 C CA  . ASP A 1 206 ? 38.745  7.017   25.250  1.00 38.24  ? 175  ASP A CA  1 
ATOM   1350 C C   . ASP A 1 206 ? 37.283  6.662   25.476  1.00 38.21  ? 175  ASP A C   1 
ATOM   1351 O O   . ASP A 1 206 ? 36.839  6.430   26.601  1.00 38.26  ? 175  ASP A O   1 
ATOM   1352 C CB  . ASP A 1 206 ? 38.872  8.522   24.981  1.00 37.78  ? 175  ASP A CB  1 
ATOM   1353 C CG  . ASP A 1 206 ? 40.333  8.976   24.739  1.00 38.90  ? 175  ASP A CG  1 
ATOM   1354 O OD1 . ASP A 1 206 ? 41.300  8.242   25.098  1.00 41.30  ? 175  ASP A OD1 1 
ATOM   1355 O OD2 . ASP A 1 206 ? 40.607  10.060  24.191  1.00 34.99  ? 175  ASP A OD2 1 
ATOM   1356 N N   . GLN A 1 207 ? 36.538  6.591   24.377  1.00 38.59  ? 176  GLN A N   1 
ATOM   1357 C CA  . GLN A 1 207 ? 35.115  6.280   24.423  1.00 38.92  ? 176  GLN A CA  1 
ATOM   1358 C C   . GLN A 1 207 ? 34.968  4.909   25.023  1.00 39.24  ? 176  GLN A C   1 
ATOM   1359 O O   . GLN A 1 207 ? 34.167  4.703   25.948  1.00 39.27  ? 176  GLN A O   1 
ATOM   1360 C CB  . GLN A 1 207 ? 34.492  6.332   23.020  1.00 39.23  ? 176  GLN A CB  1 
ATOM   1361 C CG  . GLN A 1 207 ? 34.450  7.757   22.382  1.00 39.11  ? 176  GLN A CG  1 
ATOM   1362 C CD  . GLN A 1 207 ? 33.952  7.736   20.912  1.00 41.23  ? 176  GLN A CD  1 
ATOM   1363 O OE1 . GLN A 1 207 ? 33.420  6.710   20.469  1.00 43.59  ? 176  GLN A OE1 1 
ATOM   1364 N NE2 . GLN A 1 207 ? 34.135  8.859   20.163  1.00 38.07  ? 176  GLN A NE2 1 
ATOM   1365 N N   . ARG A 1 208 ? 35.790  3.976   24.544  1.00 39.86  ? 177  ARG A N   1 
ATOM   1366 C CA  . ARG A 1 208 ? 35.700  2.591   25.050  1.00 40.54  ? 177  ARG A CA  1 
ATOM   1367 C C   . ARG A 1 208 ? 35.983  2.522   26.554  1.00 40.33  ? 177  ARG A C   1 
ATOM   1368 O O   . ARG A 1 208 ? 35.282  1.813   27.289  1.00 40.06  ? 177  ARG A O   1 
ATOM   1369 C CB  . ARG A 1 208 ? 36.628  1.639   24.301  1.00 41.21  ? 177  ARG A CB  1 
ATOM   1370 C CG  . ARG A 1 208 ? 36.582  0.229   24.859  1.00 42.89  ? 177  ARG A CG  1 
ATOM   1371 C CD  . ARG A 1 208 ? 37.476  -0.701  24.158  1.00 43.90  ? 177  ARG A CD  1 
ATOM   1372 N NE  . ARG A 1 208 ? 36.958  -1.030  22.832  1.00 46.32  ? 177  ARG A NE  1 
ATOM   1373 C CZ  . ARG A 1 208 ? 37.724  -1.437  21.815  1.00 47.54  ? 177  ARG A CZ  1 
ATOM   1374 N NH1 . ARG A 1 208 ? 39.057  -1.604  21.982  1.00 48.59  ? 177  ARG A NH1 1 
ATOM   1375 N NH2 . ARG A 1 208 ? 37.157  -1.726  20.650  1.00 44.68  ? 177  ARG A NH2 1 
ATOM   1376 N N   . LEU A 1 209 ? 36.992  3.267   26.999  1.00 39.84  ? 178  LEU A N   1 
ATOM   1377 C CA  . LEU A 1 209 ? 37.341  3.324   28.417  1.00 40.33  ? 178  LEU A CA  1 
ATOM   1378 C C   . LEU A 1 209 ? 36.195  3.881   29.245  1.00 39.94  ? 178  LEU A C   1 
ATOM   1379 O O   . LEU A 1 209 ? 35.916  3.366   30.321  1.00 40.22  ? 178  LEU A O   1 
ATOM   1380 C CB  . LEU A 1 209 ? 38.583  4.177   28.643  1.00 40.08  ? 178  LEU A CB  1 
ATOM   1381 C CG  . LEU A 1 209 ? 39.152  4.190   30.057  1.00 41.99  ? 178  LEU A CG  1 
ATOM   1382 C CD1 . LEU A 1 209 ? 39.455  2.776   30.529  1.00 42.24  ? 178  LEU A CD1 1 
ATOM   1383 C CD2 . LEU A 1 209 ? 40.418  5.039   30.094  1.00 43.11  ? 178  LEU A CD2 1 
ATOM   1384 N N   . ALA A 1 210 ? 35.497  4.900   28.736  1.00 39.42  ? 179  ALA A N   1 
ATOM   1385 C CA  . ALA A 1 210 ? 34.327  5.394   29.437  1.00 39.04  ? 179  ALA A CA  1 
ATOM   1386 C C   . ALA A 1 210 ? 33.247  4.339   29.499  1.00 39.82  ? 179  ALA A C   1 
ATOM   1387 O O   . ALA A 1 210 ? 32.526  4.285   30.491  1.00 40.72  ? 179  ALA A O   1 
ATOM   1388 C CB  . ALA A 1 210 ? 33.802  6.634   28.795  1.00 38.64  ? 179  ALA A CB  1 
ATOM   1389 N N   . LEU A 1 211 ? 33.096  3.529   28.450  1.00 40.19  ? 180  LEU A N   1 
ATOM   1390 C CA  . LEU A 1 211 ? 32.122  2.437   28.489  1.00 41.63  ? 180  LEU A CA  1 
ATOM   1391 C C   . LEU A 1 211 ? 32.499  1.383   29.540  1.00 42.81  ? 180  LEU A C   1 
ATOM   1392 O O   . LEU A 1 211 ? 31.611  0.841   30.190  1.00 42.45  ? 180  LEU A O   1 
ATOM   1393 C CB  . LEU A 1 211 ? 31.892  1.761   27.136  1.00 41.67  ? 180  LEU A CB  1 
ATOM   1394 C CG  . LEU A 1 211 ? 31.590  2.660   25.925  1.00 42.43  ? 180  LEU A CG  1 
ATOM   1395 C CD1 . LEU A 1 211 ? 30.963  1.853   24.851  1.00 43.82  ? 180  LEU A CD1 1 
ATOM   1396 C CD2 . LEU A 1 211 ? 30.697  3.845   26.247  1.00 44.15  ? 180  LEU A CD2 1 
ATOM   1397 N N   . GLN A 1 212 ? 33.799  1.119   29.712  1.00 43.62  ? 181  GLN A N   1 
ATOM   1398 C CA  . GLN A 1 212 ? 34.267  0.160   30.710  1.00 45.03  ? 181  GLN A CA  1 
ATOM   1399 C C   . GLN A 1 212 ? 33.993  0.737   32.098  1.00 44.95  ? 181  GLN A C   1 
ATOM   1400 O O   . GLN A 1 212 ? 33.543  0.029   32.999  1.00 44.72  ? 181  GLN A O   1 
ATOM   1401 C CB  . GLN A 1 212 ? 35.764  -0.186  30.534  1.00 46.09  ? 181  GLN A CB  1 
ATOM   1402 C CG  . GLN A 1 212 ? 36.068  -0.906  29.200  1.00 48.66  ? 181  GLN A CG  1 
ATOM   1403 C CD  . GLN A 1 212 ? 37.570  -1.123  28.886  1.00 51.78  ? 181  GLN A CD  1 
ATOM   1404 O OE1 . GLN A 1 212 ? 38.417  -0.322  29.259  1.00 54.53  ? 181  GLN A OE1 1 
ATOM   1405 N NE2 . GLN A 1 212 ? 37.873  -2.205  28.175  1.00 51.48  ? 181  GLN A NE2 1 
ATOM   1406 N N   . TRP A 1 213 ? 34.205  2.048   32.242  1.00 44.34  ? 182  TRP A N   1 
ATOM   1407 C CA  . TRP A 1 213 ? 33.889  2.740   33.471  1.00 43.87  ? 182  TRP A CA  1 
ATOM   1408 C C   . TRP A 1 213 ? 32.410  2.597   33.841  1.00 44.14  ? 182  TRP A C   1 
ATOM   1409 O O   . TRP A 1 213 ? 32.093  2.439   34.997  1.00 44.74  ? 182  TRP A O   1 
ATOM   1410 C CB  . TRP A 1 213 ? 34.260  4.206   33.372  1.00 43.45  ? 182  TRP A CB  1 
ATOM   1411 C CG  . TRP A 1 213 ? 34.097  4.975   34.657  1.00 43.66  ? 182  TRP A CG  1 
ATOM   1412 C CD1 . TRP A 1 213 ? 35.078  5.291   35.541  1.00 46.07  ? 182  TRP A CD1 1 
ATOM   1413 C CD2 . TRP A 1 213 ? 32.890  5.515   35.183  1.00 41.66  ? 182  TRP A CD2 1 
ATOM   1414 N NE1 . TRP A 1 213 ? 34.559  6.019   36.585  1.00 47.94  ? 182  TRP A NE1 1 
ATOM   1415 C CE2 . TRP A 1 213 ? 33.213  6.168   36.390  1.00 44.54  ? 182  TRP A CE2 1 
ATOM   1416 C CE3 . TRP A 1 213 ? 31.556  5.556   34.734  1.00 42.15  ? 182  TRP A CE3 1 
ATOM   1417 C CZ2 . TRP A 1 213 ? 32.262  6.845   37.164  1.00 43.91  ? 182  TRP A CZ2 1 
ATOM   1418 C CZ3 . TRP A 1 213 ? 30.604  6.216   35.512  1.00 41.16  ? 182  TRP A CZ3 1 
ATOM   1419 C CH2 . TRP A 1 213 ? 30.965  6.841   36.719  1.00 42.93  ? 182  TRP A CH2 1 
ATOM   1420 N N   . VAL A 1 214 ? 31.514  2.648   32.871  1.00 43.71  ? 183  VAL A N   1 
ATOM   1421 C CA  . VAL A 1 214 ? 30.092  2.513   33.152  1.00 44.29  ? 183  VAL A CA  1 
ATOM   1422 C C   . VAL A 1 214 ? 29.800  1.057   33.610  1.00 46.07  ? 183  VAL A C   1 
ATOM   1423 O O   . VAL A 1 214 ? 29.064  0.842   34.578  1.00 46.01  ? 183  VAL A O   1 
ATOM   1424 C CB  . VAL A 1 214 ? 29.231  2.942   31.933  1.00 43.42  ? 183  VAL A CB  1 
ATOM   1425 C CG1 . VAL A 1 214 ? 27.809  2.397   32.006  1.00 43.63  ? 183  VAL A CG1 1 
ATOM   1426 C CG2 . VAL A 1 214 ? 29.207  4.463   31.784  1.00 42.35  ? 183  VAL A CG2 1 
ATOM   1427 N N   . GLN A 1 215 ? 30.410  0.066   32.959  1.00 46.80  ? 184  GLN A N   1 
ATOM   1428 C CA  . GLN A 1 215 ? 30.246  -1.329  33.402  1.00 48.53  ? 184  GLN A CA  1 
ATOM   1429 C C   . GLN A 1 215 ? 30.619  -1.536  34.869  1.00 48.96  ? 184  GLN A C   1 
ATOM   1430 O O   . GLN A 1 215 ? 29.899  -2.182  35.609  1.00 49.26  ? 184  GLN A O   1 
ATOM   1431 C CB  . GLN A 1 215 ? 31.066  -2.281  32.534  1.00 48.25  ? 184  GLN A CB  1 
ATOM   1432 C CG  . GLN A 1 215 ? 30.455  -2.462  31.167  1.00 49.70  ? 184  GLN A CG  1 
ATOM   1433 C CD  . GLN A 1 215 ? 29.037  -3.010  31.194  1.00 49.65  ? 184  GLN A CD  1 
ATOM   1434 O OE1 . GLN A 1 215 ? 28.090  -2.338  30.774  1.00 52.18  ? 184  GLN A OE1 1 
ATOM   1435 N NE2 . GLN A 1 215 ? 28.895  -4.221  31.666  1.00 50.66  ? 184  GLN A NE2 1 
ATOM   1436 N N   . GLU A 1 216 ? 31.744  -0.966  35.279  1.00 49.10  ? 185  GLU A N   1 
ATOM   1437 C CA  . GLU A 1 216 ? 32.237  -1.209  36.627  1.00 49.92  ? 185  GLU A CA  1 
ATOM   1438 C C   . GLU A 1 216 ? 31.504  -0.331  37.646  1.00 49.27  ? 185  GLU A C   1 
ATOM   1439 O O   . GLU A 1 216 ? 31.322  -0.737  38.774  1.00 50.10  ? 185  GLU A O   1 
ATOM   1440 C CB  . GLU A 1 216 ? 33.774  -1.027  36.736  1.00 49.63  ? 185  GLU A CB  1 
ATOM   1441 C CG  . GLU A 1 216 ? 34.235  -0.917  38.186  1.00 51.33  ? 185  GLU A CG  1 
ATOM   1442 C CD  . GLU A 1 216 ? 35.659  -1.341  38.448  1.00 53.63  ? 185  GLU A CD  1 
ATOM   1443 O OE1 . GLU A 1 216 ? 35.882  -1.914  39.528  1.00 54.07  ? 185  GLU A OE1 1 
ATOM   1444 O OE2 . GLU A 1 216 ? 36.548  -1.069  37.615  1.00 53.86  ? 185  GLU A OE2 1 
ATOM   1445 N N   . ASN A 1 217 ? 31.087  0.864   37.254  1.00 47.81  ? 186  ASN A N   1 
ATOM   1446 C CA  . ASN A 1 217 ? 30.686  1.878   38.232  1.00 47.21  ? 186  ASN A CA  1 
ATOM   1447 C C   . ASN A 1 217 ? 29.254  2.360   38.200  1.00 46.82  ? 186  ASN A C   1 
ATOM   1448 O O   . ASN A 1 217 ? 28.795  2.919   39.189  1.00 47.92  ? 186  ASN A O   1 
ATOM   1449 C CB  . ASN A 1 217 ? 31.608  3.080   38.166  1.00 45.90  ? 186  ASN A CB  1 
ATOM   1450 C CG  . ASN A 1 217 ? 33.052  2.717   38.449  1.00 46.30  ? 186  ASN A CG  1 
ATOM   1451 O OD1 . ASN A 1 217 ? 33.383  2.349   39.572  1.00 46.61  ? 186  ASN A OD1 1 
ATOM   1452 N ND2 . ASN A 1 217 ? 33.926  2.809   37.424  1.00 46.47  ? 186  ASN A ND2 1 
ATOM   1453 N N   . ILE A 1 218 ? 28.508  2.112   37.132  1.00 46.36  ? 187  ILE A N   1 
ATOM   1454 C CA  . ILE A 1 218 ? 27.184  2.752   37.005  1.00 45.70  ? 187  ILE A CA  1 
ATOM   1455 C C   . ILE A 1 218 ? 26.132  2.256   38.023  1.00 46.79  ? 187  ILE A C   1 
ATOM   1456 O O   . ILE A 1 218 ? 25.183  2.972   38.340  1.00 46.57  ? 187  ILE A O   1 
ATOM   1457 C CB  . ILE A 1 218 ? 26.662  2.715   35.535  1.00 44.44  ? 187  ILE A CB  1 
ATOM   1458 C CG1 . ILE A 1 218 ? 25.725  3.889   35.280  1.00 44.68  ? 187  ILE A CG1 1 
ATOM   1459 C CG2 . ILE A 1 218 ? 25.969  1.404   35.166  1.00 43.74  ? 187  ILE A CG2 1 
ATOM   1460 C CD1 . ILE A 1 218 ? 26.366  5.232   35.483  1.00 44.76  ? 187  ILE A CD1 1 
ATOM   1461 N N   . ALA A 1 219 ? 26.294  1.036   38.524  1.00 47.77  ? 188  ALA A N   1 
ATOM   1462 C CA  . ALA A 1 219 ? 25.400  0.504   39.556  1.00 48.78  ? 188  ALA A CA  1 
ATOM   1463 C C   . ALA A 1 219 ? 25.413  1.335   40.834  1.00 48.93  ? 188  ALA A C   1 
ATOM   1464 O O   . ALA A 1 219 ? 24.430  1.371   41.528  1.00 49.81  ? 188  ALA A O   1 
ATOM   1465 C CB  . ALA A 1 219 ? 25.757  -0.907  39.882  1.00 49.91  ? 188  ALA A CB  1 
ATOM   1466 N N   . ALA A 1 220 ? 26.518  2.012   41.137  1.00 48.67  ? 189  ALA A N   1 
ATOM   1467 C CA  . ALA A 1 220 ? 26.594  2.910   42.291  1.00 48.52  ? 189  ALA A CA  1 
ATOM   1468 C C   . ALA A 1 220 ? 25.600  4.066   42.207  1.00 48.45  ? 189  ALA A C   1 
ATOM   1469 O O   . ALA A 1 220 ? 25.307  4.718   43.205  1.00 48.72  ? 189  ALA A O   1 
ATOM   1470 C CB  . ALA A 1 220 ? 27.992  3.482   42.411  1.00 47.79  ? 189  ALA A CB  1 
ATOM   1471 N N   . PHE A 1 221 ? 25.143  4.339   40.993  1.00 48.03  ? 190  PHE A N   1 
ATOM   1472 C CA  . PHE A 1 221 ? 24.281  5.458   40.668  1.00 47.65  ? 190  PHE A CA  1 
ATOM   1473 C C   . PHE A 1 221 ? 22.866  4.950   40.403  1.00 48.57  ? 190  PHE A C   1 
ATOM   1474 O O   . PHE A 1 221 ? 21.990  5.719   40.004  1.00 48.77  ? 190  PHE A O   1 
ATOM   1475 C CB  . PHE A 1 221 ? 24.809  6.161   39.402  1.00 46.44  ? 190  PHE A CB  1 
ATOM   1476 C CG  . PHE A 1 221 ? 26.143  6.815   39.574  1.00 45.52  ? 190  PHE A CG  1 
ATOM   1477 C CD1 . PHE A 1 221 ? 27.312  6.137   39.272  1.00 45.80  ? 190  PHE A CD1 1 
ATOM   1478 C CD2 . PHE A 1 221 ? 26.238  8.125   40.009  1.00 46.88  ? 190  PHE A CD2 1 
ATOM   1479 C CE1 . PHE A 1 221 ? 28.566  6.751   39.403  1.00 46.04  ? 190  PHE A CE1 1 
ATOM   1480 C CE2 . PHE A 1 221 ? 27.493  8.734   40.171  1.00 47.43  ? 190  PHE A CE2 1 
ATOM   1481 C CZ  . PHE A 1 221 ? 28.660  8.033   39.853  1.00 45.52  ? 190  PHE A CZ  1 
ATOM   1482 N N   . GLY A 1 222 ? 22.648  3.647   40.609  1.00 49.51  ? 191  GLY A N   1 
ATOM   1483 C CA  . GLY A 1 222 ? 21.381  3.017   40.279  1.00 49.97  ? 191  GLY A CA  1 
ATOM   1484 C C   . GLY A 1 222 ? 21.207  2.576   38.839  1.00 49.77  ? 191  GLY A C   1 
ATOM   1485 O O   . GLY A 1 222 ? 20.144  2.122   38.502  1.00 50.06  ? 191  GLY A O   1 
ATOM   1486 N N   . GLY A 1 223 ? 22.225  2.714   37.985  1.00 49.47  ? 192  GLY A N   1 
ATOM   1487 C CA  . GLY A 1 223 ? 22.143  2.223   36.619  1.00 49.14  ? 192  GLY A CA  1 
ATOM   1488 C C   . GLY A 1 223 ? 22.367  0.722   36.468  1.00 49.57  ? 192  GLY A C   1 
ATOM   1489 O O   . GLY A 1 223 ? 23.045  0.120   37.266  1.00 49.68  ? 192  GLY A O   1 
ATOM   1490 N N   . ASP A 1 224 ? 21.831  0.160   35.390  1.00 49.81  ? 193  ASP A N   1 
ATOM   1491 C CA  . ASP A 1 224 ? 21.886  -1.257  35.103  1.00 50.79  ? 193  ASP A CA  1 
ATOM   1492 C C   . ASP A 1 224 ? 22.953  -1.452  34.050  1.00 50.17  ? 193  ASP A C   1 
ATOM   1493 O O   . ASP A 1 224 ? 22.762  -1.090  32.907  1.00 49.62  ? 193  ASP A O   1 
ATOM   1494 C CB  . ASP A 1 224 ? 20.522  -1.731  34.576  1.00 51.32  ? 193  ASP A CB  1 
ATOM   1495 C CG  . ASP A 1 224 ? 20.427  -3.258  34.398  1.00 53.46  ? 193  ASP A CG  1 
ATOM   1496 O OD1 . ASP A 1 224 ? 21.463  -3.975  34.508  1.00 51.18  ? 193  ASP A OD1 1 
ATOM   1497 O OD2 . ASP A 1 224 ? 19.317  -3.822  34.135  1.00 55.76  ? 193  ASP A OD2 1 
ATOM   1498 N N   . PRO A 1 225 ? 24.077  -2.048  34.412  1.00 50.83  ? 194  PRO A N   1 
ATOM   1499 C CA  . PRO A 1 225 ? 25.134  -2.284  33.427  1.00 50.60  ? 194  PRO A CA  1 
ATOM   1500 C C   . PRO A 1 225 ? 24.755  -3.317  32.360  1.00 51.58  ? 194  PRO A C   1 
ATOM   1501 O O   . PRO A 1 225 ? 25.458  -3.409  31.349  1.00 50.70  ? 194  PRO A O   1 
ATOM   1502 C CB  . PRO A 1 225 ? 26.312  -2.743  34.285  1.00 51.10  ? 194  PRO A CB  1 
ATOM   1503 C CG  . PRO A 1 225 ? 25.703  -3.302  35.497  1.00 51.83  ? 194  PRO A CG  1 
ATOM   1504 C CD  . PRO A 1 225 ? 24.440  -2.546  35.747  1.00 51.05  ? 194  PRO A CD  1 
ATOM   1505 N N   . MET A 1 226 ? 23.668  -4.060  32.581  1.00 53.12  ? 195  MET A N   1 
ATOM   1506 C CA  . MET A 1 226 ? 23.180  -5.051  31.622  1.00 54.34  ? 195  MET A CA  1 
ATOM   1507 C C   . MET A 1 226 ? 22.209  -4.476  30.616  1.00 52.15  ? 195  MET A C   1 
ATOM   1508 O O   . MET A 1 226 ? 21.668  -5.194  29.788  1.00 52.65  ? 195  MET A O   1 
ATOM   1509 C CB  . MET A 1 226 ? 22.477  -6.200  32.340  1.00 56.91  ? 195  MET A CB  1 
ATOM   1510 C CG  . MET A 1 226 ? 23.209  -6.739  33.545  1.00 62.72  ? 195  MET A CG  1 
ATOM   1511 S SD  . MET A 1 226 ? 24.076  -8.255  33.208  1.00 74.95  ? 195  MET A SD  1 
ATOM   1512 C CE  . MET A 1 226 ? 25.015  -7.864  31.624  1.00 72.13  ? 195  MET A CE  1 
ATOM   1513 N N   . SER A 1 227 ? 21.970  -3.184  30.692  1.00 49.97  ? 196  SER A N   1 
ATOM   1514 C CA  . SER A 1 227 ? 21.090  -2.518  29.752  1.00 48.33  ? 196  SER A CA  1 
ATOM   1515 C C   . SER A 1 227 ? 21.658  -1.114  29.476  1.00 46.65  ? 196  SER A C   1 
ATOM   1516 O O   . SER A 1 227 ? 21.266  -0.120  30.087  1.00 44.98  ? 196  SER A O   1 
ATOM   1517 C CB  . SER A 1 227 ? 19.668  -2.499  30.312  1.00 48.96  ? 196  SER A CB  1 
ATOM   1518 O OG  . SER A 1 227 ? 18.752  -1.897  29.425  1.00 46.95  ? 196  SER A OG  1 
ATOM   1519 N N   . VAL A 1 228 ? 22.606  -1.089  28.543  1.00 45.81  ? 197  VAL A N   1 
ATOM   1520 C CA  . VAL A 1 228 ? 23.368  0.096   28.157  1.00 44.77  ? 197  VAL A CA  1 
ATOM   1521 C C   . VAL A 1 228 ? 23.128  0.306   26.686  1.00 43.62  ? 197  VAL A C   1 
ATOM   1522 O O   . VAL A 1 228 ? 23.428  -0.574  25.871  1.00 43.99  ? 197  VAL A O   1 
ATOM   1523 C CB  . VAL A 1 228 ? 24.901  -0.096  28.408  1.00 44.42  ? 197  VAL A CB  1 
ATOM   1524 C CG1 . VAL A 1 228 ? 25.701  1.000   27.755  1.00 43.69  ? 197  VAL A CG1 1 
ATOM   1525 C CG2 . VAL A 1 228 ? 25.202  -0.141  29.894  1.00 45.09  ? 197  VAL A CG2 1 
ATOM   1526 N N   . THR A 1 229 ? 22.579  1.470   26.365  1.00 42.65  ? 198  THR A N   1 
ATOM   1527 C CA  . THR A 1 229 ? 22.290  1.870   25.001  1.00 42.15  ? 198  THR A CA  1 
ATOM   1528 C C   . THR A 1 229 ? 23.203  3.049   24.653  1.00 41.30  ? 198  THR A C   1 
ATOM   1529 O O   . THR A 1 229 ? 23.205  4.061   25.352  1.00 41.19  ? 198  THR A O   1 
ATOM   1530 C CB  . THR A 1 229 ? 20.814  2.266   24.910  1.00 42.61  ? 198  THR A CB  1 
ATOM   1531 O OG1 . THR A 1 229 ? 20.008  1.106   25.154  1.00 44.33  ? 198  THR A OG1 1 
ATOM   1532 C CG2 . THR A 1 229 ? 20.416  2.685   23.510  1.00 42.03  ? 198  THR A CG2 1 
ATOM   1533 N N   . LEU A 1 230 ? 24.000  2.896   23.602  1.00 40.45  ? 199  LEU A N   1 
ATOM   1534 C CA  . LEU A 1 230 ? 24.814  3.980   23.102  1.00 39.73  ? 199  LEU A CA  1 
ATOM   1535 C C   . LEU A 1 230 ? 23.983  4.790   22.157  1.00 39.37  ? 199  LEU A C   1 
ATOM   1536 O O   . LEU A 1 230 ? 23.302  4.224   21.341  1.00 40.63  ? 199  LEU A O   1 
ATOM   1537 C CB  . LEU A 1 230 ? 26.023  3.464   22.333  1.00 39.70  ? 199  LEU A CB  1 
ATOM   1538 C CG  . LEU A 1 230 ? 26.836  2.335   22.933  1.00 41.33  ? 199  LEU A CG  1 
ATOM   1539 C CD1 . LEU A 1 230 ? 27.947  1.974   22.011  1.00 42.25  ? 199  LEU A CD1 1 
ATOM   1540 C CD2 . LEU A 1 230 ? 27.389  2.764   24.254  1.00 44.96  ? 199  LEU A CD2 1 
ATOM   1541 N N   . PHE A 1 231 ? 24.056  6.114   22.234  1.00 38.39  ? 200  PHE A N   1 
ATOM   1542 C CA  . PHE A 1 231 ? 23.488  6.939   21.198  1.00 37.71  ? 200  PHE A CA  1 
ATOM   1543 C C   . PHE A 1 231 ? 24.397  8.100   20.864  1.00 37.52  ? 200  PHE A C   1 
ATOM   1544 O O   . PHE A 1 231 ? 25.210  8.545   21.686  1.00 37.61  ? 200  PHE A O   1 
ATOM   1545 C CB  . PHE A 1 231 ? 22.002  7.311   21.463  1.00 38.41  ? 200  PHE A CB  1 
ATOM   1546 C CG  . PHE A 1 231 ? 21.758  8.364   22.526  1.00 37.53  ? 200  PHE A CG  1 
ATOM   1547 C CD1 . PHE A 1 231 ? 22.278  8.257   23.801  1.00 38.63  ? 200  PHE A CD1 1 
ATOM   1548 C CD2 . PHE A 1 231 ? 20.920  9.425   22.264  1.00 38.58  ? 200  PHE A CD2 1 
ATOM   1549 C CE1 . PHE A 1 231 ? 22.011  9.213   24.782  1.00 37.27  ? 200  PHE A CE1 1 
ATOM   1550 C CE2 . PHE A 1 231 ? 20.659  10.378  23.251  1.00 39.38  ? 200  PHE A CE2 1 
ATOM   1551 C CZ  . PHE A 1 231 ? 21.218  10.261  24.511  1.00 37.53  ? 200  PHE A CZ  1 
ATOM   1552 N N   . GLY A 1 232 ? 24.309  8.551   19.618  1.00 36.87  ? 201  GLY A N   1 
ATOM   1553 C CA  . GLY A 1 232 ? 25.207  9.574   19.152  1.00 37.11  ? 201  GLY A CA  1 
ATOM   1554 C C   . GLY A 1 232 ? 24.771  10.173  17.839  1.00 37.05  ? 201  GLY A C   1 
ATOM   1555 O O   . GLY A 1 232 ? 23.964  9.587   17.127  1.00 36.90  ? 201  GLY A O   1 
ATOM   1556 N N   . GLU A 1 233 ? 25.313  11.345  17.523  1.00 36.56  ? 202  GLU A N   1 
ATOM   1557 C CA  . GLU A 1 233 ? 24.947  11.999  16.292  1.00 36.69  ? 202  GLU A CA  1 
ATOM   1558 C C   . GLU A 1 233 ? 26.185  12.395  15.504  1.00 36.24  ? 202  GLU A C   1 
ATOM   1559 O O   . GLU A 1 233 ? 27.209  12.740  16.090  1.00 35.62  ? 202  GLU A O   1 
ATOM   1560 C CB  . GLU A 1 233 ? 24.040  13.184  16.575  1.00 37.18  ? 202  GLU A CB  1 
ATOM   1561 C CG  . GLU A 1 233 ? 23.471  13.855  15.329  1.00 38.16  ? 202  GLU A CG  1 
ATOM   1562 C CD  . GLU A 1 233 ? 24.320  15.006  14.870  1.00 39.46  ? 202  GLU A CD  1 
ATOM   1563 O OE1 . GLU A 1 233 ? 25.316  15.308  15.575  1.00 38.22  ? 202  GLU A OE1 1 
ATOM   1564 O OE2 . GLU A 1 233 ? 23.966  15.594  13.820  1.00 40.61  ? 202  GLU A OE2 1 
ATOM   1565 N N   . SER A 1 234 ? 26.070  12.320  14.173  1.00 36.15  ? 203  SER A N   1 
ATOM   1566 C CA  . SER A 1 234 ? 27.143  12.669  13.266  1.00 36.54  ? 203  SER A CA  1 
ATOM   1567 C C   . SER A 1 234 ? 28.377  11.811  13.555  1.00 36.22  ? 203  SER A C   1 
ATOM   1568 O O   . SER A 1 234 ? 28.262  10.588  13.549  1.00 36.58  ? 203  SER A O   1 
ATOM   1569 C CB  . SER A 1 234 ? 27.421  14.176  13.351  1.00 36.10  ? 203  SER A CB  1 
ATOM   1570 O OG  . SER A 1 234 ? 27.998  14.580  12.133  1.00 39.27  ? 203  SER A OG  1 
ATOM   1571 N N   . ALA A 1 235 ? 29.535  12.401  13.850  1.00 35.81  ? 204  ALA A N   1 
ATOM   1572 C CA  . ALA A 1 235 ? 30.716  11.578  14.187  1.00 36.00  ? 204  ALA A CA  1 
ATOM   1573 C C   . ALA A 1 235 ? 30.489  10.723  15.423  1.00 36.46  ? 204  ALA A C   1 
ATOM   1574 O O   . ALA A 1 235 ? 31.174  9.709   15.610  1.00 36.17  ? 204  ALA A O   1 
ATOM   1575 C CB  . ALA A 1 235 ? 31.951  12.436  14.395  1.00 35.95  ? 204  ALA A CB  1 
ATOM   1576 N N   . GLY A 1 236 ? 29.571  11.161  16.290  1.00 36.44  ? 205  GLY A N   1 
ATOM   1577 C CA  . GLY A 1 236 ? 29.164  10.384  17.457  1.00 36.86  ? 205  GLY A CA  1 
ATOM   1578 C C   . GLY A 1 236 ? 28.439  9.110   17.046  1.00 37.87  ? 205  GLY A C   1 
ATOM   1579 O O   . GLY A 1 236 ? 28.627  8.039   17.607  1.00 38.31  ? 205  GLY A O   1 
ATOM   1580 N N   . ALA A 1 237 ? 27.595  9.238   16.043  1.00 37.77  ? 206  ALA A N   1 
ATOM   1581 C CA  . ALA A 1 237 ? 26.915  8.114   15.482  1.00 37.94  ? 206  ALA A CA  1 
ATOM   1582 C C   . ALA A 1 237 ? 27.906  7.186   14.771  1.00 38.15  ? 206  ALA A C   1 
ATOM   1583 O O   . ALA A 1 237 ? 27.798  5.968   14.866  1.00 38.42  ? 206  ALA A O   1 
ATOM   1584 C CB  . ALA A 1 237 ? 25.829  8.587   14.533  1.00 38.23  ? 206  ALA A CB  1 
ATOM   1585 N N   . ALA A 1 238 ? 28.851  7.743   14.038  1.00 37.58  ? 207  ALA A N   1 
ATOM   1586 C CA  . ALA A 1 238 ? 29.829  6.911   13.371  1.00 38.03  ? 207  ALA A CA  1 
ATOM   1587 C C   . ALA A 1 238 ? 30.618  6.141   14.416  1.00 38.51  ? 207  ALA A C   1 
ATOM   1588 O O   . ALA A 1 238 ? 30.926  4.939   14.244  1.00 39.52  ? 207  ALA A O   1 
ATOM   1589 C CB  . ALA A 1 238 ? 30.747  7.759   12.534  1.00 38.63  ? 207  ALA A CB  1 
ATOM   1590 N N   . SER A 1 239 ? 30.905  6.829   15.517  1.00 37.77  ? 208  SER A N   1 
ATOM   1591 C CA  . SER A 1 239 ? 31.587  6.239   16.659  1.00 37.83  ? 208  SER A CA  1 
ATOM   1592 C C   . SER A 1 239 ? 30.763  5.057   17.197  1.00 38.04  ? 208  SER A C   1 
ATOM   1593 O O   . SER A 1 239 ? 31.316  4.003   17.440  1.00 37.96  ? 208  SER A O   1 
ATOM   1594 C CB  . SER A 1 239 ? 31.851  7.304   17.761  1.00 37.46  ? 208  SER A CB  1 
ATOM   1595 O OG  . SER A 1 239 ? 32.825  8.287   17.362  1.00 37.87  ? 208  SER A OG  1 
ATOM   1596 N N   . VAL A 1 240 ? 29.449  5.232   17.369  1.00 37.90  ? 209  VAL A N   1 
ATOM   1597 C CA  . VAL A 1 240 ? 28.601  4.155   17.865  1.00 38.58  ? 209  VAL A CA  1 
ATOM   1598 C C   . VAL A 1 240 ? 28.741  2.981   16.909  1.00 39.60  ? 209  VAL A C   1 
ATOM   1599 O O   . VAL A 1 240 ? 28.937  1.853   17.332  1.00 40.32  ? 209  VAL A O   1 
ATOM   1600 C CB  . VAL A 1 240 ? 27.118  4.573   17.964  1.00 38.87  ? 209  VAL A CB  1 
ATOM   1601 C CG1 . VAL A 1 240 ? 26.222  3.363   18.159  1.00 39.82  ? 209  VAL A CG1 1 
ATOM   1602 C CG2 . VAL A 1 240 ? 26.899  5.539   19.099  1.00 39.32  ? 209  VAL A CG2 1 
ATOM   1603 N N   . GLY A 1 241 ? 28.714  3.266   15.610  1.00 39.47  ? 210  GLY A N   1 
ATOM   1604 C CA  . GLY A 1 241 ? 28.854  2.241   14.606  1.00 40.38  ? 210  GLY A CA  1 
ATOM   1605 C C   . GLY A 1 241 ? 30.190  1.512   14.718  1.00 41.36  ? 210  GLY A C   1 
ATOM   1606 O O   . GLY A 1 241 ? 30.244  0.304   14.530  1.00 42.07  ? 210  GLY A O   1 
ATOM   1607 N N   . MET A 1 242 ? 31.267  2.231   15.008  1.00 41.54  ? 211  MET A N   1 
ATOM   1608 C CA  . MET A 1 242 ? 32.573  1.593   15.146  1.00 42.87  ? 211  MET A CA  1 
ATOM   1609 C C   . MET A 1 242 ? 32.650  0.695   16.371  1.00 42.93  ? 211  MET A C   1 
ATOM   1610 O O   . MET A 1 242 ? 33.287  -0.351  16.332  1.00 43.31  ? 211  MET A O   1 
ATOM   1611 C CB  . MET A 1 242 ? 33.667  2.643   15.124  1.00 42.64  ? 211  MET A CB  1 
ATOM   1612 C CG  . MET A 1 242 ? 33.874  3.096   13.705  1.00 44.60  ? 211  MET A CG  1 
ATOM   1613 S SD  . MET A 1 242 ? 34.798  4.516   13.583  1.00 50.65  ? 211  MET A SD  1 
ATOM   1614 C CE  . MET A 1 242 ? 34.398  5.005   11.932  1.00 50.31  ? 211  MET A CE  1 
ATOM   1615 N N   . HIS A 1 243 ? 31.943  1.060   17.433  1.00 42.60  ? 212  HIS A N   1 
ATOM   1616 C CA  . HIS A 1 243 ? 31.828  0.157   18.571  1.00 43.39  ? 212  HIS A CA  1 
ATOM   1617 C C   . HIS A 1 243 ? 31.020  -1.094  18.229  1.00 44.80  ? 212  HIS A C   1 
ATOM   1618 O O   . HIS A 1 243 ? 31.306  -2.143  18.748  1.00 46.16  ? 212  HIS A O   1 
ATOM   1619 C CB  . HIS A 1 243 ? 31.242  0.864   19.799  1.00 42.85  ? 212  HIS A CB  1 
ATOM   1620 C CG  . HIS A 1 243 ? 32.137  1.922   20.350  1.00 39.73  ? 212  HIS A CG  1 
ATOM   1621 N ND1 . HIS A 1 243 ? 33.391  1.647   20.823  1.00 39.75  ? 212  HIS A ND1 1 
ATOM   1622 C CD2 . HIS A 1 243 ? 31.972  3.258   20.474  1.00 39.61  ? 212  HIS A CD2 1 
ATOM   1623 C CE1 . HIS A 1 243 ? 33.965  2.769   21.220  1.00 41.38  ? 212  HIS A CE1 1 
ATOM   1624 N NE2 . HIS A 1 243 ? 33.135  3.769   20.992  1.00 38.74  ? 212  HIS A NE2 1 
ATOM   1625 N N   . ILE A 1 244 ? 30.035  -1.003  17.346  1.00 45.47  ? 213  ILE A N   1 
ATOM   1626 C CA  . ILE A 1 244 ? 29.344  -2.204  16.885  1.00 46.75  ? 213  ILE A CA  1 
ATOM   1627 C C   . ILE A 1 244 ? 30.314  -3.093  16.113  1.00 47.77  ? 213  ILE A C   1 
ATOM   1628 O O   . ILE A 1 244 ? 30.274  -4.303  16.245  1.00 49.35  ? 213  ILE A O   1 
ATOM   1629 C CB  . ILE A 1 244 ? 28.137  -1.849  16.019  1.00 46.84  ? 213  ILE A CB  1 
ATOM   1630 C CG1 . ILE A 1 244 ? 27.038  -1.225  16.872  1.00 47.70  ? 213  ILE A CG1 1 
ATOM   1631 C CG2 . ILE A 1 244 ? 27.581  -3.087  15.294  1.00 47.35  ? 213  ILE A CG2 1 
ATOM   1632 C CD1 . ILE A 1 244 ? 26.062  -0.409  16.057  1.00 48.02  ? 213  ILE A CD1 1 
ATOM   1633 N N   . LEU A 1 245 ? 31.200  -2.495  15.329  1.00 47.80  ? 214  LEU A N   1 
ATOM   1634 C CA  . LEU A 1 245 ? 32.080  -3.238  14.436  1.00 48.62  ? 214  LEU A CA  1 
ATOM   1635 C C   . LEU A 1 245 ? 33.387  -3.708  15.090  1.00 49.34  ? 214  LEU A C   1 
ATOM   1636 O O   . LEU A 1 245 ? 34.190  -4.406  14.443  1.00 49.81  ? 214  LEU A O   1 
ATOM   1637 C CB  . LEU A 1 245 ? 32.385  -2.363  13.204  1.00 48.01  ? 214  LEU A CB  1 
ATOM   1638 C CG  . LEU A 1 245 ? 31.128  -2.011  12.390  1.00 48.13  ? 214  LEU A CG  1 
ATOM   1639 C CD1 . LEU A 1 245 ? 31.426  -1.147  11.226  1.00 46.87  ? 214  LEU A CD1 1 
ATOM   1640 C CD2 . LEU A 1 245 ? 30.448  -3.285  11.908  1.00 49.70  ? 214  LEU A CD2 1 
ATOM   1641 N N   . SER A 1 246 ? 33.609  -3.338  16.353  1.00 49.40  ? 215  SER A N   1 
ATOM   1642 C CA  . SER A 1 246 ? 34.860  -3.674  17.038  1.00 50.19  ? 215  SER A CA  1 
ATOM   1643 C C   . SER A 1 246 ? 34.595  -4.558  18.242  1.00 51.81  ? 215  SER A C   1 
ATOM   1644 O O   . SER A 1 246 ? 33.960  -4.134  19.186  1.00 51.36  ? 215  SER A O   1 
ATOM   1645 C CB  . SER A 1 246 ? 35.594  -2.426  17.486  1.00 49.39  ? 215  SER A CB  1 
ATOM   1646 O OG  . SER A 1 246 ? 36.871  -2.783  17.971  1.00 47.91  ? 215  SER A OG  1 
ATOM   1647 N N   . LEU A 1 247 ? 35.112  -5.784  18.197  1.00 54.11  ? 216  LEU A N   1 
ATOM   1648 C CA  . LEU A 1 247 ? 34.746  -6.846  19.127  1.00 55.74  ? 216  LEU A CA  1 
ATOM   1649 C C   . LEU A 1 247 ? 34.931  -6.488  20.604  1.00 54.75  ? 216  LEU A C   1 
ATOM   1650 O O   . LEU A 1 247 ? 34.025  -6.689  21.389  1.00 55.31  ? 216  LEU A O   1 
ATOM   1651 C CB  . LEU A 1 247 ? 35.508  -8.148  18.764  1.00 58.19  ? 216  LEU A CB  1 
ATOM   1652 C CG  . LEU A 1 247 ? 34.666  -9.435  18.634  1.00 62.89  ? 216  LEU A CG  1 
ATOM   1653 C CD1 . LEU A 1 247 ? 35.553  -10.701 18.388  1.00 65.72  ? 216  LEU A CD1 1 
ATOM   1654 C CD2 . LEU A 1 247 ? 33.760  -9.656  19.897  1.00 64.84  ? 216  LEU A CD2 1 
ATOM   1655 N N   . PRO A 1 248 ? 36.078  -5.956  21.007  1.00 53.87  ? 217  PRO A N   1 
ATOM   1656 C CA  . PRO A 1 248 ? 36.239  -5.547  22.410  1.00 53.34  ? 217  PRO A CA  1 
ATOM   1657 C C   . PRO A 1 248 ? 35.192  -4.545  22.928  1.00 52.33  ? 217  PRO A C   1 
ATOM   1658 O O   . PRO A 1 248 ? 34.958  -4.535  24.126  1.00 53.42  ? 217  PRO A O   1 
ATOM   1659 C CB  . PRO A 1 248 ? 37.670  -4.964  22.453  1.00 53.06  ? 217  PRO A CB  1 
ATOM   1660 C CG  . PRO A 1 248 ? 38.382  -5.606  21.306  1.00 52.75  ? 217  PRO A CG  1 
ATOM   1661 C CD  . PRO A 1 248 ? 37.316  -5.748  20.228  1.00 53.56  ? 217  PRO A CD  1 
ATOM   1662 N N   . SER A 1 249 ? 34.573  -3.728  22.082  1.00 51.38  ? 218  SER A N   1 
ATOM   1663 C CA  . SER A 1 249 ? 33.518  -2.807  22.549  1.00 50.06  ? 218  SER A CA  1 
ATOM   1664 C C   . SER A 1 249 ? 32.170  -3.499  22.762  1.00 51.10  ? 218  SER A C   1 
ATOM   1665 O O   . SER A 1 249 ? 31.311  -2.996  23.482  1.00 49.62  ? 218  SER A O   1 
ATOM   1666 C CB  . SER A 1 249 ? 33.332  -1.637  21.580  1.00 49.24  ? 218  SER A CB  1 
ATOM   1667 O OG  . SER A 1 249 ? 34.452  -0.754  21.580  1.00 46.64  ? 218  SER A OG  1 
ATOM   1668 N N   . ARG A 1 250 ? 31.993  -4.662  22.143  1.00 52.66  ? 219  ARG A N   1 
ATOM   1669 C CA  . ARG A 1 250 ? 30.671  -5.295  22.058  1.00 54.08  ? 219  ARG A CA  1 
ATOM   1670 C C   . ARG A 1 250 ? 30.105  -5.807  23.367  1.00 54.70  ? 219  ARG A C   1 
ATOM   1671 O O   . ARG A 1 250 ? 28.894  -5.811  23.526  1.00 56.31  ? 219  ARG A O   1 
ATOM   1672 C CB  . ARG A 1 250 ? 30.659  -6.422  21.015  1.00 55.44  ? 219  ARG A CB  1 
ATOM   1673 C CG  . ARG A 1 250 ? 30.491  -5.951  19.585  1.00 56.37  ? 219  ARG A CG  1 
ATOM   1674 C CD  . ARG A 1 250 ? 29.228  -5.097  19.375  1.00 59.58  ? 219  ARG A CD  1 
ATOM   1675 N NE  . ARG A 1 250 ? 27.977  -5.854  19.450  1.00 62.06  ? 219  ARG A NE  1 
ATOM   1676 C CZ  . ARG A 1 250 ? 27.486  -6.601  18.456  1.00 65.92  ? 219  ARG A CZ  1 
ATOM   1677 N NH1 . ARG A 1 250 ? 28.139  -6.733  17.298  1.00 65.76  ? 219  ARG A NH1 1 
ATOM   1678 N NH2 . ARG A 1 250 ? 26.331  -7.241  18.625  1.00 69.56  ? 219  ARG A NH2 1 
ATOM   1679 N N   . SER A 1 251 ? 30.963  -6.193  24.305  1.00 54.48  ? 220  SER A N   1 
ATOM   1680 C CA  . SER A 1 251 ? 30.520  -6.601  25.621  1.00 54.78  ? 220  SER A CA  1 
ATOM   1681 C C   . SER A 1 251 ? 30.145  -5.439  26.554  1.00 53.09  ? 220  SER A C   1 
ATOM   1682 O O   . SER A 1 251 ? 29.682  -5.676  27.668  1.00 54.47  ? 220  SER A O   1 
ATOM   1683 C CB  . SER A 1 251 ? 31.599  -7.469  26.291  1.00 55.58  ? 220  SER A CB  1 
ATOM   1684 O OG  . SER A 1 251 ? 32.802  -6.742  26.473  1.00 56.31  ? 220  SER A OG  1 
ATOM   1685 N N   . LEU A 1 252 ? 30.321  -4.205  26.107  1.00 50.58  ? 221  LEU A N   1 
ATOM   1686 C CA  . LEU A 1 252 ? 30.144  -3.044  26.949  1.00 48.66  ? 221  LEU A CA  1 
ATOM   1687 C C   . LEU A 1 252 ? 28.830  -2.352  26.705  1.00 47.63  ? 221  LEU A C   1 
ATOM   1688 O O   . LEU A 1 252 ? 28.555  -1.362  27.382  1.00 47.65  ? 221  LEU A O   1 
ATOM   1689 C CB  . LEU A 1 252 ? 31.284  -2.035  26.733  1.00 47.80  ? 221  LEU A CB  1 
ATOM   1690 C CG  . LEU A 1 252 ? 32.719  -2.590  26.710  1.00 47.61  ? 221  LEU A CG  1 
ATOM   1691 C CD1 . LEU A 1 252 ? 33.678  -1.497  26.427  1.00 47.69  ? 221  LEU A CD1 1 
ATOM   1692 C CD2 . LEU A 1 252 ? 33.100  -3.290  28.017  1.00 48.46  ? 221  LEU A CD2 1 
ATOM   1693 N N   . PHE A 1 253 ? 28.035  -2.835  25.753  1.00 47.10  ? 222  PHE A N   1 
ATOM   1694 C CA  . PHE A 1 253 ? 26.696  -2.270  25.494  1.00 46.86  ? 222  PHE A CA  1 
ATOM   1695 C C   . PHE A 1 253 ? 25.765  -3.277  24.849  1.00 48.20  ? 222  PHE A C   1 
ATOM   1696 O O   . PHE A 1 253 ? 26.200  -4.287  24.366  1.00 48.60  ? 222  PHE A O   1 
ATOM   1697 C CB  . PHE A 1 253 ? 26.774  -0.989  24.632  1.00 45.73  ? 222  PHE A CB  1 
ATOM   1698 C CG  . PHE A 1 253 ? 27.207  -1.229  23.203  1.00 42.88  ? 222  PHE A CG  1 
ATOM   1699 C CD1 . PHE A 1 253 ? 28.515  -1.463  22.897  1.00 41.22  ? 222  PHE A CD1 1 
ATOM   1700 C CD2 . PHE A 1 253 ? 26.296  -1.203  22.177  1.00 44.95  ? 222  PHE A CD2 1 
ATOM   1701 C CE1 . PHE A 1 253 ? 28.909  -1.685  21.604  1.00 41.91  ? 222  PHE A CE1 1 
ATOM   1702 C CE2 . PHE A 1 253 ? 26.693  -1.434  20.867  1.00 44.99  ? 222  PHE A CE2 1 
ATOM   1703 C CZ  . PHE A 1 253 ? 28.003  -1.689  20.595  1.00 43.47  ? 222  PHE A CZ  1 
ATOM   1704 N N   . HIS A 1 254 ? 24.475  -2.991  24.845  1.00 49.69  ? 223  HIS A N   1 
ATOM   1705 C CA  . HIS A 1 254 ? 23.463  -3.948  24.355  1.00 51.92  ? 223  HIS A CA  1 
ATOM   1706 C C   . HIS A 1 254 ? 22.640  -3.430  23.162  1.00 51.42  ? 223  HIS A C   1 
ATOM   1707 O O   . HIS A 1 254 ? 22.155  -4.221  22.358  1.00 52.08  ? 223  HIS A O   1 
ATOM   1708 C CB  . HIS A 1 254 ? 22.567  -4.373  25.539  1.00 53.43  ? 223  HIS A CB  1 
ATOM   1709 C CG  . HIS A 1 254 ? 23.370  -4.729  26.754  1.00 58.87  ? 223  HIS A CG  1 
ATOM   1710 N ND1 . HIS A 1 254 ? 24.122  -5.889  26.831  1.00 62.84  ? 223  HIS A ND1 1 
ATOM   1711 C CD2 . HIS A 1 254 ? 23.659  -4.020  27.873  1.00 60.58  ? 223  HIS A CD2 1 
ATOM   1712 C CE1 . HIS A 1 254 ? 24.795  -5.898  27.968  1.00 63.74  ? 223  HIS A CE1 1 
ATOM   1713 N NE2 . HIS A 1 254 ? 24.521  -4.781  28.622  1.00 63.72  ? 223  HIS A NE2 1 
ATOM   1714 N N   . ARG A 1 255 ? 22.519  -2.107  23.029  1.00 50.36  ? 224  ARG A N   1 
ATOM   1715 C CA  . ARG A 1 255 ? 21.729  -1.510  21.946  1.00 50.03  ? 224  ARG A CA  1 
ATOM   1716 C C   . ARG A 1 255 ? 22.368  -0.204  21.474  1.00 47.37  ? 224  ARG A C   1 
ATOM   1717 O O   . ARG A 1 255 ? 23.276  0.341   22.119  1.00 46.71  ? 224  ARG A O   1 
ATOM   1718 C CB  . ARG A 1 255 ? 20.301  -1.276  22.419  1.00 51.46  ? 224  ARG A CB  1 
ATOM   1719 C CG  . ARG A 1 255 ? 19.477  -2.560  22.454  1.00 57.47  ? 224  ARG A CG  1 
ATOM   1720 C CD  . ARG A 1 255 ? 18.091  -2.435  23.115  1.00 62.11  ? 224  ARG A CD  1 
ATOM   1721 N NE  . ARG A 1 255 ? 18.263  -2.363  24.556  1.00 67.74  ? 224  ARG A NE  1 
ATOM   1722 C CZ  . ARG A 1 255 ? 18.539  -3.396  25.354  1.00 69.95  ? 224  ARG A CZ  1 
ATOM   1723 N NH1 . ARG A 1 255 ? 18.656  -4.634  24.891  1.00 72.51  ? 224  ARG A NH1 1 
ATOM   1724 N NH2 . ARG A 1 255 ? 18.717  -3.173  26.642  1.00 71.41  ? 224  ARG A NH2 1 
ATOM   1725 N N   . ALA A 1 256 ? 21.910  0.293   20.336  1.00 45.45  ? 225  ALA A N   1 
ATOM   1726 C CA  . ALA A 1 256 ? 22.601  1.388   19.704  1.00 43.35  ? 225  ALA A CA  1 
ATOM   1727 C C   . ALA A 1 256 ? 21.677  2.235   18.844  1.00 42.53  ? 225  ALA A C   1 
ATOM   1728 O O   . ALA A 1 256 ? 20.806  1.715   18.139  1.00 41.71  ? 225  ALA A O   1 
ATOM   1729 C CB  . ALA A 1 256 ? 23.786  0.859   18.870  1.00 42.92  ? 225  ALA A CB  1 
ATOM   1730 N N   . VAL A 1 257 ? 21.955  3.538   18.876  1.00 41.12  ? 226  VAL A N   1 
ATOM   1731 C CA  . VAL A 1 257 ? 21.250  4.546   18.112  1.00 40.77  ? 226  VAL A CA  1 
ATOM   1732 C C   . VAL A 1 257 ? 22.273  5.395   17.349  1.00 40.11  ? 226  VAL A C   1 
ATOM   1733 O O   . VAL A 1 257 ? 23.216  5.917   17.934  1.00 39.26  ? 226  VAL A O   1 
ATOM   1734 C CB  . VAL A 1 257 ? 20.504  5.446   19.031  1.00 40.43  ? 226  VAL A CB  1 
ATOM   1735 C CG1 . VAL A 1 257 ? 19.782  6.520   18.225  1.00 41.92  ? 226  VAL A CG1 1 
ATOM   1736 C CG2 . VAL A 1 257 ? 19.545  4.644   19.907  1.00 42.12  ? 226  VAL A CG2 1 
ATOM   1737 N N   . LEU A 1 258 ? 22.086  5.499   16.043  1.00 40.11  ? 227  LEU A N   1 
ATOM   1738 C CA  . LEU A 1 258 ? 22.967  6.226   15.157  1.00 39.63  ? 227  LEU A CA  1 
ATOM   1739 C C   . LEU A 1 258 ? 22.120  7.302   14.495  1.00 39.02  ? 227  LEU A C   1 
ATOM   1740 O O   . LEU A 1 258 ? 21.261  6.993   13.676  1.00 38.89  ? 227  LEU A O   1 
ATOM   1741 C CB  . LEU A 1 258 ? 23.500  5.257   14.099  1.00 40.19  ? 227  LEU A CB  1 
ATOM   1742 C CG  . LEU A 1 258 ? 24.571  4.252   14.588  1.00 42.71  ? 227  LEU A CG  1 
ATOM   1743 C CD1 . LEU A 1 258 ? 23.911  2.975   15.122  1.00 43.55  ? 227  LEU A CD1 1 
ATOM   1744 C CD2 . LEU A 1 258 ? 25.605  3.925   13.512  1.00 40.61  ? 227  LEU A CD2 1 
ATOM   1745 N N   . GLN A 1 259 ? 22.333  8.546   14.883  1.00 38.12  ? 228  GLN A N   1 
ATOM   1746 C CA  . GLN A 1 259 ? 21.581  9.675   14.338  1.00 38.65  ? 228  GLN A CA  1 
ATOM   1747 C C   . GLN A 1 259 ? 22.469  10.417  13.347  1.00 38.53  ? 228  GLN A C   1 
ATOM   1748 O O   . GLN A 1 259 ? 23.501  10.933  13.737  1.00 38.40  ? 228  GLN A O   1 
ATOM   1749 C CB  . GLN A 1 259 ? 21.151  10.642  15.463  1.00 38.30  ? 228  GLN A CB  1 
ATOM   1750 C CG  . GLN A 1 259 ? 20.525  9.965   16.655  1.00 39.35  ? 228  GLN A CG  1 
ATOM   1751 C CD  . GLN A 1 259 ? 20.182  10.882  17.809  1.00 40.94  ? 228  GLN A CD  1 
ATOM   1752 O OE1 . GLN A 1 259 ? 19.882  10.382  18.885  1.00 39.63  ? 228  GLN A OE1 1 
ATOM   1753 N NE2 . GLN A 1 259 ? 20.218  12.217  17.598  1.00 39.76  ? 228  GLN A NE2 1 
ATOM   1754 N N   . SER A 1 260 ? 22.095  10.439  12.077  1.00 38.86  ? 229  SER A N   1 
ATOM   1755 C CA  . SER A 1 260 ? 22.761  11.263  11.078  1.00 38.78  ? 229  SER A CA  1 
ATOM   1756 C C   . SER A 1 260 ? 24.262  10.965  10.993  1.00 38.77  ? 229  SER A C   1 
ATOM   1757 O O   . SER A 1 260 ? 25.087  11.884  10.918  1.00 38.43  ? 229  SER A O   1 
ATOM   1758 C CB  . SER A 1 260 ? 22.512  12.761  11.348  1.00 38.86  ? 229  SER A CB  1 
ATOM   1759 O OG  . SER A 1 260 ? 21.109  13.075  11.351  1.00 40.95  ? 229  SER A OG  1 
ATOM   1760 N N   . GLY A 1 261 ? 24.621  9.679   10.998  1.00 38.94  ? 230  GLY A N   1 
ATOM   1761 C CA  . GLY A 1 261 ? 26.001  9.289   10.855  1.00 38.76  ? 230  GLY A CA  1 
ATOM   1762 C C   . GLY A 1 261 ? 26.171  7.786   10.865  1.00 39.57  ? 230  GLY A C   1 
ATOM   1763 O O   . GLY A 1 261 ? 25.324  7.054   11.402  1.00 39.74  ? 230  GLY A O   1 
ATOM   1764 N N   . THR A 1 262 ? 27.290  7.352   10.283  1.00 39.73  ? 231  THR A N   1 
ATOM   1765 C CA  . THR A 1 262 ? 27.622  5.937   10.111  1.00 40.63  ? 231  THR A CA  1 
ATOM   1766 C C   . THR A 1 262 ? 29.121  5.718   10.063  1.00 40.45  ? 231  THR A C   1 
ATOM   1767 O O   . THR A 1 262 ? 29.887  6.631   9.747   1.00 40.58  ? 231  THR A O   1 
ATOM   1768 C CB  . THR A 1 262 ? 27.018  5.407   8.783   1.00 41.75  ? 231  THR A CB  1 
ATOM   1769 O OG1 . THR A 1 262 ? 27.522  6.157   7.674   1.00 39.65  ? 231  THR A OG1 1 
ATOM   1770 C CG2 . THR A 1 262 ? 25.522  5.646   8.712   1.00 42.85  ? 231  THR A CG2 1 
ATOM   1771 N N   . PRO A 1 263 ? 29.572  4.514   10.377  1.00 41.23  ? 232  PRO A N   1 
ATOM   1772 C CA  . PRO A 1 263 ? 31.005  4.197   10.263  1.00 41.31  ? 232  PRO A CA  1 
ATOM   1773 C C   . PRO A 1 263 ? 31.433  3.959   8.799   1.00 42.50  ? 232  PRO A C   1 
ATOM   1774 O O   . PRO A 1 263 ? 32.565  4.190   8.445   1.00 42.72  ? 232  PRO A O   1 
ATOM   1775 C CB  . PRO A 1 263 ? 31.131  2.948   11.132  1.00 42.37  ? 232  PRO A CB  1 
ATOM   1776 C CG  . PRO A 1 263 ? 29.812  2.285   11.040  1.00 41.79  ? 232  PRO A CG  1 
ATOM   1777 C CD  . PRO A 1 263 ? 28.796  3.390   10.926  1.00 41.83  ? 232  PRO A CD  1 
ATOM   1778 N N   . ASN A 1 264 ? 30.510  3.500   7.961   1.00 43.54  ? 233  ASN A N   1 
ATOM   1779 C CA  . ASN A 1 264 ? 30.708  3.412   6.512   1.00 44.06  ? 233  ASN A CA  1 
ATOM   1780 C C   . ASN A 1 264 ? 30.503  4.787   5.905   1.00 43.93  ? 233  ASN A C   1 
ATOM   1781 O O   . ASN A 1 264 ? 30.031  5.675   6.584   1.00 43.99  ? 233  ASN A O   1 
ATOM   1782 C CB  . ASN A 1 264 ? 29.715  2.427   5.872   1.00 44.26  ? 233  ASN A CB  1 
ATOM   1783 C CG  . ASN A 1 264 ? 28.275  2.731   6.238   1.00 42.82  ? 233  ASN A CG  1 
ATOM   1784 O OD1 . ASN A 1 264 ? 27.925  2.693   7.409   1.00 40.58  ? 233  ASN A OD1 1 
ATOM   1785 N ND2 . ASN A 1 264 ? 27.431  3.020   5.245   1.00 42.23  ? 233  ASN A ND2 1 
ATOM   1786 N N   . GLY A 1 265 ? 30.855  4.960   4.634   1.00 44.46  ? 234  GLY A N   1 
ATOM   1787 C CA  . GLY A 1 265 ? 30.751  6.252   3.988   1.00 44.48  ? 234  GLY A CA  1 
ATOM   1788 C C   . GLY A 1 265 ? 32.086  6.986   3.830   1.00 44.60  ? 234  GLY A C   1 
ATOM   1789 O O   . GLY A 1 265 ? 33.145  6.519   4.254   1.00 45.00  ? 234  GLY A O   1 
ATOM   1790 N N   . PRO A 1 266 ? 32.027  8.159   3.231   1.00 43.76  ? 235  PRO A N   1 
ATOM   1791 C CA  . PRO A 1 266 ? 33.212  8.797   2.681   1.00 43.63  ? 235  PRO A CA  1 
ATOM   1792 C C   . PRO A 1 266 ? 34.082  9.616   3.639   1.00 42.52  ? 235  PRO A C   1 
ATOM   1793 O O   . PRO A 1 266 ? 35.186  9.991   3.241   1.00 42.95  ? 235  PRO A O   1 
ATOM   1794 C CB  . PRO A 1 266 ? 32.627  9.712   1.587   1.00 43.47  ? 235  PRO A CB  1 
ATOM   1795 C CG  . PRO A 1 266 ? 31.194  9.902   1.908   1.00 43.49  ? 235  PRO A CG  1 
ATOM   1796 C CD  . PRO A 1 266 ? 30.805  8.939   2.992   1.00 43.73  ? 235  PRO A CD  1 
ATOM   1797 N N   . TRP A 1 267 ? 33.610  9.908   4.838   1.00 41.16  ? 236  TRP A N   1 
ATOM   1798 C CA  . TRP A 1 267 ? 34.297  10.836  5.738   1.00 40.06  ? 236  TRP A CA  1 
ATOM   1799 C C   . TRP A 1 267 ? 34.683  10.252  7.103   1.00 40.09  ? 236  TRP A C   1 
ATOM   1800 O O   . TRP A 1 267 ? 35.482  10.847  7.812   1.00 39.96  ? 236  TRP A O   1 
ATOM   1801 C CB  . TRP A 1 267 ? 33.437  12.081  5.981   1.00 39.18  ? 236  TRP A CB  1 
ATOM   1802 C CG  . TRP A 1 267 ? 32.089  11.782  6.558   1.00 39.71  ? 236  TRP A CG  1 
ATOM   1803 C CD1 . TRP A 1 267 ? 30.920  11.605  5.862   1.00 40.75  ? 236  TRP A CD1 1 
ATOM   1804 C CD2 . TRP A 1 267 ? 31.750  11.603  7.947   1.00 40.63  ? 236  TRP A CD2 1 
ATOM   1805 N NE1 . TRP A 1 267 ? 29.878  11.338  6.722   1.00 40.29  ? 236  TRP A NE1 1 
ATOM   1806 C CE2 . TRP A 1 267 ? 30.354  11.321  8.007   1.00 40.14  ? 236  TRP A CE2 1 
ATOM   1807 C CE3 . TRP A 1 267 ? 32.476  11.663  9.154   1.00 40.01  ? 236  TRP A CE3 1 
ATOM   1808 C CZ2 . TRP A 1 267 ? 29.684  11.098  9.206   1.00 38.09  ? 236  TRP A CZ2 1 
ATOM   1809 C CZ3 . TRP A 1 267 ? 31.810  11.421  10.349  1.00 38.39  ? 236  TRP A CZ3 1 
ATOM   1810 C CH2 . TRP A 1 267 ? 30.420  11.137  10.361  1.00 38.71  ? 236  TRP A CH2 1 
ATOM   1811 N N   . ALA A 1 268 ? 34.108  9.126   7.505   1.00 40.26  ? 237  ALA A N   1 
ATOM   1812 C CA  . ALA A 1 268 ? 34.293  8.667   8.878   1.00 40.27  ? 237  ALA A CA  1 
ATOM   1813 C C   . ALA A 1 268 ? 35.586  7.867   9.105   1.00 40.41  ? 237  ALA A C   1 
ATOM   1814 O O   . ALA A 1 268 ? 35.984  7.681   10.241  1.00 40.28  ? 237  ALA A O   1 
ATOM   1815 C CB  . ALA A 1 268 ? 33.108  7.858   9.323   1.00 40.34  ? 237  ALA A CB  1 
ATOM   1816 N N   . THR A 1 269 ? 36.205  7.353   8.057   1.00 40.74  ? 238  THR A N   1 
ATOM   1817 C CA  . THR A 1 269 ? 37.501  6.672   8.217   1.00 42.00  ? 238  THR A CA  1 
ATOM   1818 C C   . THR A 1 269 ? 38.469  7.063   7.129   1.00 42.34  ? 238  THR A C   1 
ATOM   1819 O O   . THR A 1 269 ? 38.100  7.700   6.162   1.00 42.45  ? 238  THR A O   1 
ATOM   1820 C CB  . THR A 1 269 ? 37.378  5.140   8.171   1.00 42.61  ? 238  THR A CB  1 
ATOM   1821 O OG1 . THR A 1 269 ? 36.775  4.768   6.947   1.00 43.18  ? 238  THR A OG1 1 
ATOM   1822 C CG2 . THR A 1 269 ? 36.401  4.621   9.203   1.00 43.71  ? 238  THR A CG2 1 
ATOM   1823 N N   . VAL A 1 270 ? 39.725  6.711   7.345   1.00 42.90  ? 239  VAL A N   1 
ATOM   1824 C CA  . VAL A 1 270 ? 40.744  6.809   6.331   1.00 43.45  ? 239  VAL A CA  1 
ATOM   1825 C C   . VAL A 1 270 ? 41.552  5.527   6.347   1.00 44.65  ? 239  VAL A C   1 
ATOM   1826 O O   . VAL A 1 270 ? 41.624  4.818   7.360   1.00 44.89  ? 239  VAL A O   1 
ATOM   1827 C CB  . VAL A 1 270 ? 41.671  8.012   6.584   1.00 43.29  ? 239  VAL A CB  1 
ATOM   1828 C CG1 . VAL A 1 270 ? 40.929  9.329   6.260   1.00 42.71  ? 239  VAL A CG1 1 
ATOM   1829 C CG2 . VAL A 1 270 ? 42.205  7.993   8.021   1.00 42.73  ? 239  VAL A CG2 1 
ATOM   1830 N N   . SER A 1 271 ? 42.169  5.234   5.220   1.00 45.31  ? 240  SER A N   1 
ATOM   1831 C CA  . SER A 1 271 ? 43.110  4.144   5.149   1.00 46.81  ? 240  SER A CA  1 
ATOM   1832 C C   . SER A 1 271 ? 44.331  4.456   5.989   1.00 46.96  ? 240  SER A C   1 
ATOM   1833 O O   . SER A 1 271 ? 44.587  5.594   6.342   1.00 45.74  ? 240  SER A O   1 
ATOM   1834 C CB  . SER A 1 271 ? 43.557  3.921   3.702   1.00 46.90  ? 240  SER A CB  1 
ATOM   1835 O OG  . SER A 1 271 ? 44.363  5.005   3.328   1.00 46.44  ? 240  SER A OG  1 
ATOM   1836 N N   . ALA A 1 272 ? 45.101  3.418   6.265   1.00 48.66  ? 241  ALA A N   1 
ATOM   1837 C CA  . ALA A 1 272 ? 46.329  3.564   7.001   1.00 49.39  ? 241  ALA A CA  1 
ATOM   1838 C C   . ALA A 1 272 ? 47.303  4.448   6.219   1.00 50.04  ? 241  ALA A C   1 
ATOM   1839 O O   . ALA A 1 272 ? 47.957  5.300   6.792   1.00 49.80  ? 241  ALA A O   1 
ATOM   1840 C CB  . ALA A 1 272 ? 46.919  2.198   7.271   1.00 50.67  ? 241  ALA A CB  1 
ATOM   1841 N N   . GLY A 1 273 ? 47.374  4.261   4.904   1.00 50.96  ? 242  GLY A N   1 
ATOM   1842 C CA  . GLY A 1 273 ? 48.253  5.069   4.070   1.00 51.39  ? 242  GLY A CA  1 
ATOM   1843 C C   . GLY A 1 273 ? 47.887  6.554   4.093   1.00 50.65  ? 242  GLY A C   1 
ATOM   1844 O O   . GLY A 1 273 ? 48.758  7.418   4.138   1.00 50.98  ? 242  GLY A O   1 
ATOM   1845 N N   . GLU A 1 274 ? 46.599  6.860   4.047   1.00 49.31  ? 243  GLU A N   1 
ATOM   1846 C CA  . GLU A 1 274 ? 46.178  8.247   4.017   1.00 48.86  ? 243  GLU A CA  1 
ATOM   1847 C C   . GLU A 1 274 ? 46.390  8.914   5.374   1.00 48.14  ? 243  GLU A C   1 
ATOM   1848 O O   . GLU A 1 274 ? 46.773  10.076  5.436   1.00 48.01  ? 243  GLU A O   1 
ATOM   1849 C CB  . GLU A 1 274 ? 44.724  8.361   3.543   1.00 48.67  ? 243  GLU A CB  1 
ATOM   1850 C CG  . GLU A 1 274 ? 44.130  9.774   3.549   1.00 49.24  ? 243  GLU A CG  1 
ATOM   1851 C CD  . GLU A 1 274 ? 44.789  10.764  2.588   1.00 49.45  ? 243  GLU A CD  1 
ATOM   1852 O OE1 . GLU A 1 274 ? 44.419  11.959  2.631   1.00 50.13  ? 243  GLU A OE1 1 
ATOM   1853 O OE2 . GLU A 1 274 ? 45.641  10.386  1.777   1.00 51.90  ? 243  GLU A OE2 1 
ATOM   1854 N N   . ALA A 1 275 ? 46.194  8.178   6.456   1.00 47.78  ? 244  ALA A N   1 
ATOM   1855 C CA  . ALA A 1 275 ? 46.445  8.726   7.777   1.00 47.44  ? 244  ALA A CA  1 
ATOM   1856 C C   . ALA A 1 275 ? 47.942  8.982   7.983   1.00 47.97  ? 244  ALA A C   1 
ATOM   1857 O O   . ALA A 1 275 ? 48.319  9.992   8.574   1.00 47.38  ? 244  ALA A O   1 
ATOM   1858 C CB  . ALA A 1 275 ? 45.911  7.799   8.847   1.00 47.25  ? 244  ALA A CB  1 
ATOM   1859 N N   . ARG A 1 276 ? 48.777  8.072   7.502   1.00 48.67  ? 245  ARG A N   1 
ATOM   1860 C CA  . ARG A 1 276 ? 50.216  8.258   7.571   1.00 50.15  ? 245  ARG A CA  1 
ATOM   1861 C C   . ARG A 1 276 ? 50.586  9.545   6.825   1.00 50.29  ? 245  ARG A C   1 
ATOM   1862 O O   . ARG A 1 276 ? 51.264  10.395  7.345   1.00 50.48  ? 245  ARG A O   1 
ATOM   1863 C CB  . ARG A 1 276 ? 50.969  7.060   6.968   1.00 51.40  ? 245  ARG A CB  1 
ATOM   1864 C CG  . ARG A 1 276 ? 52.493  7.274   6.865   1.00 53.31  ? 245  ARG A CG  1 
ATOM   1865 C CD  . ARG A 1 276 ? 53.311  6.000   6.620   1.00 54.39  ? 245  ARG A CD  1 
ATOM   1866 N NE  . ARG A 1 276 ? 53.204  5.060   7.729   1.00 55.55  ? 245  ARG A NE  1 
ATOM   1867 C CZ  . ARG A 1 276 ? 53.844  5.184   8.886   1.00 56.55  ? 245  ARG A CZ  1 
ATOM   1868 N NH1 . ARG A 1 276 ? 54.664  6.191   9.123   1.00 58.16  ? 245  ARG A NH1 1 
ATOM   1869 N NH2 . ARG A 1 276 ? 53.664  4.283   9.820   1.00 55.78  ? 245  ARG A NH2 1 
ATOM   1870 N N   . ARG A 1 277 ? 50.079  9.690   5.622   1.00 50.27  ? 246  ARG A N   1 
ATOM   1871 C CA  . ARG A 1 277 ? 50.379  10.842  4.799   1.00 51.36  ? 246  ARG A CA  1 
ATOM   1872 C C   . ARG A 1 277 ? 49.961  12.173  5.463   1.00 50.19  ? 246  ARG A C   1 
ATOM   1873 O O   . ARG A 1 277 ? 50.702  13.162  5.394   1.00 49.72  ? 246  ARG A O   1 
ATOM   1874 C CB  . ARG A 1 277 ? 49.638  10.650  3.477   1.00 52.44  ? 246  ARG A CB  1 
ATOM   1875 C CG  . ARG A 1 277 ? 50.075  11.501  2.315   1.00 54.98  ? 246  ARG A CG  1 
ATOM   1876 C CD  . ARG A 1 277 ? 48.879  11.956  1.463   1.00 59.20  ? 246  ARG A CD  1 
ATOM   1877 N NE  . ARG A 1 277 ? 48.785  13.403  1.586   1.00 62.78  ? 246  ARG A NE  1 
ATOM   1878 C CZ  . ARG A 1 277 ? 47.713  14.105  1.872   1.00 61.26  ? 246  ARG A CZ  1 
ATOM   1879 N NH1 . ARG A 1 277 ? 46.541  13.544  2.038   1.00 61.16  ? 246  ARG A NH1 1 
ATOM   1880 N NH2 . ARG A 1 277 ? 47.836  15.418  1.959   1.00 63.90  ? 246  ARG A NH2 1 
ATOM   1881 N N   . ARG A 1 278 ? 48.786  12.186  6.102   1.00 48.47  ? 247  ARG A N   1 
ATOM   1882 C CA  . ARG A 1 278 ? 48.311  13.391  6.783   1.00 47.59  ? 247  ARG A CA  1 
ATOM   1883 C C   . ARG A 1 278 ? 49.120  13.706  8.041   1.00 47.68  ? 247  ARG A C   1 
ATOM   1884 O O   . ARG A 1 278 ? 49.416  14.862  8.309   1.00 47.73  ? 247  ARG A O   1 
ATOM   1885 C CB  . ARG A 1 278 ? 46.843  13.271  7.135   1.00 46.18  ? 247  ARG A CB  1 
ATOM   1886 C CG  . ARG A 1 278 ? 45.950  13.140  5.929   1.00 44.83  ? 247  ARG A CG  1 
ATOM   1887 C CD  . ARG A 1 278 ? 44.504  13.049  6.322   1.00 44.82  ? 247  ARG A CD  1 
ATOM   1888 N NE  . ARG A 1 278 ? 43.638  12.839  5.182   1.00 45.29  ? 247  ARG A NE  1 
ATOM   1889 C CZ  . ARG A 1 278 ? 42.300  12.753  5.242   1.00 44.83  ? 247  ARG A CZ  1 
ATOM   1890 N NH1 . ARG A 1 278 ? 41.623  12.884  6.381   1.00 43.42  ? 247  ARG A NH1 1 
ATOM   1891 N NH2 . ARG A 1 278 ? 41.629  12.571  4.126   1.00 44.27  ? 247  ARG A NH2 1 
ATOM   1892 N N   . ALA A 1 279 ? 49.481  12.670  8.792   1.00 47.65  ? 248  ALA A N   1 
ATOM   1893 C CA  . ALA A 1 279 ? 50.300  12.821  9.990   1.00 47.70  ? 248  ALA A CA  1 
ATOM   1894 C C   . ALA A 1 279 ? 51.650  13.369  9.647   1.00 48.60  ? 248  ALA A C   1 
ATOM   1895 O O   . ALA A 1 279 ? 52.129  14.252  10.336  1.00 48.60  ? 248  ALA A O   1 
ATOM   1896 C CB  . ALA A 1 279 ? 50.478  11.519  10.699  1.00 47.86  ? 248  ALA A CB  1 
ATOM   1897 N N   . THR A 1 280 ? 52.276  12.861  8.594   1.00 49.64  ? 249  THR A N   1 
ATOM   1898 C CA  . THR A 1 280 ? 53.612  13.326  8.296   1.00 50.78  ? 249  THR A CA  1 
ATOM   1899 C C   . THR A 1 280 ? 53.599  14.690  7.614   1.00 50.78  ? 249  THR A C   1 
ATOM   1900 O O   . THR A 1 280 ? 54.482  15.470  7.842   1.00 50.83  ? 249  THR A O   1 
ATOM   1901 C CB  . THR A 1 280 ? 54.560  12.235  7.670   1.00 52.44  ? 249  THR A CB  1 
ATOM   1902 O OG1 . THR A 1 280 ? 55.175  12.692  6.457   1.00 53.13  ? 249  THR A OG1 1 
ATOM   1903 C CG2 . THR A 1 280 ? 53.881  10.901  7.346   1.00 51.51  ? 249  THR A CG2 1 
ATOM   1904 N N   . LEU A 1 281 ? 52.543  15.031  6.878   1.00 51.02  ? 250  LEU A N   1 
ATOM   1905 C CA  . LEU A 1 281 ? 52.407  16.397  6.351   1.00 50.76  ? 250  LEU A CA  1 
ATOM   1906 C C   . LEU A 1 281 ? 52.236  17.415  7.495   1.00 50.76  ? 250  LEU A C   1 
ATOM   1907 O O   . LEU A 1 281 ? 52.919  18.448  7.523   1.00 51.18  ? 250  LEU A O   1 
ATOM   1908 C CB  . LEU A 1 281 ? 51.249  16.525  5.375   1.00 50.07  ? 250  LEU A CB  1 
ATOM   1909 C CG  . LEU A 1 281 ? 50.989  17.931  4.787   1.00 50.25  ? 250  LEU A CG  1 
ATOM   1910 C CD1 . LEU A 1 281 ? 52.283  18.616  4.306   1.00 51.37  ? 250  LEU A CD1 1 
ATOM   1911 C CD2 . LEU A 1 281 ? 49.991  17.897  3.646   1.00 49.19  ? 250  LEU A CD2 1 
ATOM   1912 N N   . LEU A 1 282 ? 51.362  17.102  8.450   1.00 49.88  ? 251  LEU A N   1 
ATOM   1913 C CA  . LEU A 1 282 ? 51.157  17.952  9.610   1.00 49.74  ? 251  LEU A CA  1 
ATOM   1914 C C   . LEU A 1 282 ? 52.430  18.162  10.375  1.00 50.48  ? 251  LEU A C   1 
ATOM   1915 O O   . LEU A 1 282 ? 52.734  19.269  10.764  1.00 50.90  ? 251  LEU A O   1 
ATOM   1916 C CB  . LEU A 1 282 ? 50.098  17.377  10.574  1.00 49.25  ? 251  LEU A CB  1 
ATOM   1917 C CG  . LEU A 1 282 ? 49.894  18.372  11.729  1.00 49.60  ? 251  LEU A CG  1 
ATOM   1918 C CD1 . LEU A 1 282 ? 48.565  19.031  11.638  1.00 49.41  ? 251  LEU A CD1 1 
ATOM   1919 C CD2 . LEU A 1 282 ? 50.084  17.732  13.060  1.00 51.64  ? 251  LEU A CD2 1 
ATOM   1920 N N   . ALA A 1 283 ? 53.173  17.093  10.592  1.00 51.40  ? 252  ALA A N   1 
ATOM   1921 C CA  . ALA A 1 283 ? 54.481  17.187  11.211  1.00 52.71  ? 252  ALA A CA  1 
ATOM   1922 C C   . ALA A 1 283 ? 55.388  18.178  10.474  1.00 53.85  ? 252  ALA A C   1 
ATOM   1923 O O   . ALA A 1 283 ? 55.952  19.062  11.105  1.00 53.52  ? 252  ALA A O   1 
ATOM   1924 C CB  . ALA A 1 283 ? 55.137  15.789  11.303  1.00 53.03  ? 252  ALA A CB  1 
ATOM   1925 N N   . ARG A 1 284 ? 55.510  18.032  9.153   1.00 55.26  ? 253  ARG A N   1 
ATOM   1926 C CA  . ARG A 1 284 ? 56.288  18.978  8.321   1.00 57.46  ? 253  ARG A CA  1 
ATOM   1927 C C   . ARG A 1 284 ? 55.828  20.426  8.568   1.00 57.03  ? 253  ARG A C   1 
ATOM   1928 O O   . ARG A 1 284 ? 56.640  21.314  8.727   1.00 58.16  ? 253  ARG A O   1 
ATOM   1929 C CB  . ARG A 1 284 ? 56.165  18.680  6.815   1.00 57.86  ? 253  ARG A CB  1 
ATOM   1930 C CG  . ARG A 1 284 ? 56.923  17.461  6.278   1.00 63.01  ? 253  ARG A CG  1 
ATOM   1931 C CD  . ARG A 1 284 ? 57.418  17.610  4.803   1.00 69.80  ? 253  ARG A CD  1 
ATOM   1932 N NE  . ARG A 1 284 ? 56.330  17.575  3.792   1.00 75.39  ? 253  ARG A NE  1 
ATOM   1933 C CZ  . ARG A 1 284 ? 55.793  18.645  3.128   1.00 79.84  ? 253  ARG A CZ  1 
ATOM   1934 N NH1 . ARG A 1 284 ? 54.824  18.447  2.224   1.00 79.60  ? 253  ARG A NH1 1 
ATOM   1935 N NH2 . ARG A 1 284 ? 56.197  19.909  3.347   1.00 82.16  ? 253  ARG A NH2 1 
ATOM   1936 N N   . LEU A 1 285 ? 54.525  20.657  8.641   1.00 56.17  ? 254  LEU A N   1 
ATOM   1937 C CA  . LEU A 1 285 ? 54.011  22.032  8.756   1.00 56.52  ? 254  LEU A CA  1 
ATOM   1938 C C   . LEU A 1 285 ? 54.370  22.719  10.061  1.00 57.32  ? 254  LEU A C   1 
ATOM   1939 O O   . LEU A 1 285 ? 54.383  23.943  10.119  1.00 57.10  ? 254  LEU A O   1 
ATOM   1940 C CB  . LEU A 1 285 ? 52.493  22.105  8.551   1.00 54.70  ? 254  LEU A CB  1 
ATOM   1941 C CG  . LEU A 1 285 ? 52.027  21.649  7.174   1.00 55.08  ? 254  LEU A CG  1 
ATOM   1942 C CD1 . LEU A 1 285 ? 50.534  21.654  7.051   1.00 54.01  ? 254  LEU A CD1 1 
ATOM   1943 C CD2 . LEU A 1 285 ? 52.659  22.504  6.078   1.00 55.88  ? 254  LEU A CD2 1 
ATOM   1944 N N   . VAL A 1 286 ? 54.647  21.938  11.097  1.00 58.49  ? 255  VAL A N   1 
ATOM   1945 C CA  . VAL A 1 286 ? 55.020  22.484  12.402  1.00 59.68  ? 255  VAL A CA  1 
ATOM   1946 C C   . VAL A 1 286 ? 56.503  22.306  12.725  1.00 62.49  ? 255  VAL A C   1 
ATOM   1947 O O   . VAL A 1 286 ? 56.925  22.524  13.859  1.00 63.59  ? 255  VAL A O   1 
ATOM   1948 C CB  . VAL A 1 286 ? 54.145  21.923  13.545  1.00 58.22  ? 255  VAL A CB  1 
ATOM   1949 C CG1 . VAL A 1 286 ? 52.709  22.242  13.286  1.00 56.40  ? 255  VAL A CG1 1 
ATOM   1950 C CG2 . VAL A 1 286 ? 54.326  20.430  13.739  1.00 57.22  ? 255  VAL A CG2 1 
ATOM   1951 N N   . GLY A 1 287 ? 57.301  21.943  11.729  1.00 64.64  ? 256  GLY A N   1 
ATOM   1952 C CA  . GLY A 1 287 ? 58.743  21.961  11.882  1.00 67.15  ? 256  GLY A CA  1 
ATOM   1953 C C   . GLY A 1 287 ? 59.306  20.662  12.392  1.00 68.43  ? 256  GLY A C   1 
ATOM   1954 O O   . GLY A 1 287 ? 60.345  20.670  13.009  1.00 70.24  ? 256  GLY A O   1 
ATOM   1955 N N   . CYS A 1 288 ? 58.642  19.554  12.071  1.00 69.16  ? 257  CYS A N   1 
ATOM   1956 C CA  . CYS A 1 288 ? 58.982  18.232  12.575  1.00 70.00  ? 257  CYS A CA  1 
ATOM   1957 C C   . CYS A 1 288 ? 59.260  17.274  11.410  1.00 72.29  ? 257  CYS A C   1 
ATOM   1958 O O   . CYS A 1 288 ? 58.366  16.551  10.964  1.00 71.28  ? 257  CYS A O   1 
ATOM   1959 C CB  . CYS A 1 288 ? 57.851  17.692  13.475  1.00 68.38  ? 257  CYS A CB  1 
ATOM   1960 S SG  . CYS A 1 288 ? 57.782  18.450  15.128  1.00 65.61  ? 257  CYS A SG  1 
ATOM   1961 N N   . PRO A 1 289 ? 60.508  17.291  10.917  1.00 75.97  ? 258  PRO A N   1 
ATOM   1962 C CA  . PRO A 1 289 ? 61.109  16.143  10.215  1.00 77.40  ? 258  PRO A CA  1 
ATOM   1963 C C   . PRO A 1 289 ? 60.358  14.810  10.332  1.00 77.09  ? 258  PRO A C   1 
ATOM   1964 O O   . PRO A 1 289 ? 59.956  14.269  9.295   1.00 77.42  ? 258  PRO A O   1 
ATOM   1965 C CB  . PRO A 1 289 ? 62.468  16.035  10.926  1.00 78.89  ? 258  PRO A CB  1 
ATOM   1966 C CG  . PRO A 1 289 ? 62.654  17.496  11.623  1.00 79.00  ? 258  PRO A CG  1 
ATOM   1967 C CD  . PRO A 1 289 ? 61.514  18.368  11.035  1.00 77.12  ? 258  PRO A CD  1 
ATOM   1968 N N   . GLY A 1 295 ? 64.564  8.611   8.541   1.00 86.77  ? 264  GLY A N   1 
ATOM   1969 C CA  . GLY A 1 295 ? 63.537  9.296   9.343   1.00 85.29  ? 264  GLY A CA  1 
ATOM   1970 C C   . GLY A 1 295 ? 62.430  8.310   9.844   1.00 83.49  ? 264  GLY A C   1 
ATOM   1971 O O   . GLY A 1 295 ? 61.597  7.844   9.045   1.00 83.44  ? 264  GLY A O   1 
ATOM   1972 N N   . ASN A 1 296 ? 62.435  8.000   11.152  1.00 81.35  ? 265  ASN A N   1 
ATOM   1973 C CA  . ASN A 1 296 ? 61.512  7.008   11.746  1.00 79.21  ? 265  ASN A CA  1 
ATOM   1974 C C   . ASN A 1 296 ? 60.399  7.629   12.621  1.00 75.90  ? 265  ASN A C   1 
ATOM   1975 O O   . ASN A 1 296 ? 60.439  8.819   12.964  1.00 74.94  ? 265  ASN A O   1 
ATOM   1976 C CB  . ASN A 1 296 ? 62.294  5.865   12.475  1.00 80.87  ? 265  ASN A CB  1 
ATOM   1977 C CG  . ASN A 1 296 ? 62.858  6.267   13.882  1.00 82.81  ? 265  ASN A CG  1 
ATOM   1978 O OD1 . ASN A 1 296 ? 62.978  7.455   14.222  1.00 83.54  ? 265  ASN A OD1 1 
ATOM   1979 N ND2 . ASN A 1 296 ? 63.235  5.245   14.682  1.00 84.04  ? 265  ASN A ND2 1 
ATOM   1980 N N   . ASP A 1 297 ? 59.407  6.809   12.963  1.00 73.04  ? 266  ASP A N   1 
ATOM   1981 C CA  . ASP A 1 297 ? 58.198  7.296   13.621  1.00 70.05  ? 266  ASP A CA  1 
ATOM   1982 C C   . ASP A 1 297 ? 58.419  7.837   15.025  1.00 69.12  ? 266  ASP A C   1 
ATOM   1983 O O   . ASP A 1 297 ? 57.836  8.856   15.381  1.00 68.30  ? 266  ASP A O   1 
ATOM   1984 C CB  . ASP A 1 297 ? 57.126  6.213   13.651  1.00 68.89  ? 266  ASP A CB  1 
ATOM   1985 C CG  . ASP A 1 297 ? 56.589  5.893   12.278  1.00 66.76  ? 266  ASP A CG  1 
ATOM   1986 O OD1 . ASP A 1 297 ? 56.918  6.612   11.312  1.00 64.18  ? 266  ASP A OD1 1 
ATOM   1987 O OD2 . ASP A 1 297 ? 55.837  4.930   12.066  1.00 63.80  ? 266  ASP A OD2 1 
ATOM   1988 N N   . THR A 1 298 ? 59.249  7.162   15.812  1.00 68.85  ? 267  THR A N   1 
ATOM   1989 C CA  . THR A 1 298 ? 59.550  7.574   17.179  1.00 67.91  ? 267  THR A CA  1 
ATOM   1990 C C   . THR A 1 298 ? 60.029  9.006   17.243  1.00 67.61  ? 267  THR A C   1 
ATOM   1991 O O   . THR A 1 298 ? 59.558  9.768   18.056  1.00 66.46  ? 267  THR A O   1 
ATOM   1992 C CB  . THR A 1 298 ? 60.609  6.633   17.803  1.00 69.06  ? 267  THR A CB  1 
ATOM   1993 O OG1 . THR A 1 298 ? 60.121  5.287   17.773  1.00 67.97  ? 267  THR A OG1 1 
ATOM   1994 C CG2 . THR A 1 298 ? 60.834  6.920   19.313  1.00 67.59  ? 267  THR A CG2 1 
ATOM   1995 N N   . GLU A 1 299 ? 60.965  9.356   16.368  1.00 68.60  ? 268  GLU A N   1 
ATOM   1996 C CA  . GLU A 1 299 ? 61.609  10.677  16.348  1.00 68.83  ? 268  GLU A CA  1 
ATOM   1997 C C   . GLU A 1 299 ? 60.587  11.767  15.924  1.00 66.12  ? 268  GLU A C   1 
ATOM   1998 O O   . GLU A 1 299 ? 60.554  12.855  16.481  1.00 65.41  ? 268  GLU A O   1 
ATOM   1999 C CB  . GLU A 1 299 ? 62.880  10.619  15.442  1.00 70.46  ? 268  GLU A CB  1 
ATOM   2000 C CG  . GLU A 1 299 ? 63.684  11.914  15.342  1.00 74.05  ? 268  GLU A CG  1 
ATOM   2001 C CD  . GLU A 1 299 ? 65.001  11.781  14.533  1.00 79.53  ? 268  GLU A CD  1 
ATOM   2002 O OE1 . GLU A 1 299 ? 65.137  12.414  13.431  1.00 78.79  ? 268  GLU A OE1 1 
ATOM   2003 O OE2 . GLU A 1 299 ? 65.922  11.064  15.014  1.00 81.71  ? 268  GLU A OE2 1 
ATOM   2004 N N   . LEU A 1 300 ? 59.732  11.441  14.962  1.00 64.05  ? 269  LEU A N   1 
ATOM   2005 C CA  . LEU A 1 300 ? 58.717  12.369  14.456  1.00 61.80  ? 269  LEU A CA  1 
ATOM   2006 C C   . LEU A 1 300 ? 57.644  12.690  15.513  1.00 59.56  ? 269  LEU A C   1 
ATOM   2007 O O   . LEU A 1 300 ? 57.240  13.839  15.683  1.00 58.31  ? 269  LEU A O   1 
ATOM   2008 C CB  . LEU A 1 300 ? 58.063  11.758  13.213  1.00 60.99  ? 269  LEU A CB  1 
ATOM   2009 C CG  . LEU A 1 300 ? 57.094  12.610  12.410  1.00 59.04  ? 269  LEU A CG  1 
ATOM   2010 C CD1 . LEU A 1 300 ? 57.348  12.498  10.955  1.00 59.38  ? 269  LEU A CD1 1 
ATOM   2011 C CD2 . LEU A 1 300 ? 55.684  12.195  12.662  1.00 59.78  ? 269  LEU A CD2 1 
ATOM   2012 N N   . ILE A 1 301 ? 57.207  11.660  16.225  1.00 58.11  ? 270  ILE A N   1 
ATOM   2013 C CA  . ILE A 1 301 ? 56.172  11.789  17.232  1.00 56.37  ? 270  ILE A CA  1 
ATOM   2014 C C   . ILE A 1 301 ? 56.728  12.455  18.471  1.00 56.21  ? 270  ILE A C   1 
ATOM   2015 O O   . ILE A 1 301 ? 56.048  13.260  19.077  1.00 55.68  ? 270  ILE A O   1 
ATOM   2016 C CB  . ILE A 1 301 ? 55.583  10.426  17.546  1.00 55.62  ? 270  ILE A CB  1 
ATOM   2017 C CG1 . ILE A 1 301 ? 54.826  9.911   16.335  1.00 56.55  ? 270  ILE A CG1 1 
ATOM   2018 C CG2 . ILE A 1 301 ? 54.622  10.477  18.689  1.00 54.17  ? 270  ILE A CG2 1 
ATOM   2019 C CD1 . ILE A 1 301 ? 54.922  8.382   16.196  1.00 59.20  ? 270  ILE A CD1 1 
ATOM   2020 N N   . ALA A 1 302 ? 57.973  12.166  18.820  1.00 56.55  ? 271  ALA A N   1 
ATOM   2021 C CA  . ALA A 1 302 ? 58.606  12.816  19.949  1.00 57.14  ? 271  ALA A CA  1 
ATOM   2022 C C   . ALA A 1 302 ? 58.668  14.327  19.715  1.00 56.99  ? 271  ALA A C   1 
ATOM   2023 O O   . ALA A 1 302 ? 58.457  15.112  20.643  1.00 57.46  ? 271  ALA A O   1 
ATOM   2024 C CB  . ALA A 1 302 ? 60.028  12.235  20.227  1.00 57.74  ? 271  ALA A CB  1 
ATOM   2025 N N   . CYS A 1 303 ? 58.943  14.735  18.485  1.00 56.92  ? 272  CYS A N   1 
ATOM   2026 C CA  . CYS A 1 303 ? 58.982  16.159  18.139  1.00 57.48  ? 272  CYS A CA  1 
ATOM   2027 C C   . CYS A 1 303 ? 57.557  16.778  18.136  1.00 55.22  ? 272  CYS A C   1 
ATOM   2028 O O   . CYS A 1 303 ? 57.362  17.878  18.638  1.00 54.63  ? 272  CYS A O   1 
ATOM   2029 C CB  . CYS A 1 303 ? 59.705  16.352  16.797  1.00 58.25  ? 272  CYS A CB  1 
ATOM   2030 S SG  . CYS A 1 303 ? 59.661  18.016  16.117  1.00 63.71  ? 272  CYS A SG  1 
ATOM   2031 N N   . LEU A 1 304 ? 56.564  16.056  17.629  1.00 53.65  ? 273  LEU A N   1 
ATOM   2032 C CA  . LEU A 1 304 ? 55.181  16.532  17.714  1.00 52.53  ? 273  LEU A CA  1 
ATOM   2033 C C   . LEU A 1 304 ? 54.738  16.727  19.165  1.00 52.15  ? 273  LEU A C   1 
ATOM   2034 O O   . LEU A 1 304 ? 54.000  17.661  19.447  1.00 50.57  ? 273  LEU A O   1 
ATOM   2035 C CB  . LEU A 1 304 ? 54.212  15.584  17.032  1.00 51.50  ? 273  LEU A CB  1 
ATOM   2036 C CG  . LEU A 1 304 ? 54.102  15.655  15.522  1.00 52.35  ? 273  LEU A CG  1 
ATOM   2037 C CD1 . LEU A 1 304 ? 53.179  14.545  14.997  1.00 52.51  ? 273  LEU A CD1 1 
ATOM   2038 C CD2 . LEU A 1 304 ? 53.571  17.000  15.102  1.00 54.56  ? 273  LEU A CD2 1 
ATOM   2039 N N   . ARG A 1 305 ? 55.233  15.876  20.077  1.00 52.55  ? 274  ARG A N   1 
ATOM   2040 C CA  . ARG A 1 305 ? 54.867  15.951  21.494  1.00 52.24  ? 274  ARG A CA  1 
ATOM   2041 C C   . ARG A 1 305 ? 55.477  17.190  22.166  1.00 52.57  ? 274  ARG A C   1 
ATOM   2042 O O   . ARG A 1 305 ? 54.964  17.642  23.180  1.00 52.54  ? 274  ARG A O   1 
ATOM   2043 C CB  . ARG A 1 305 ? 55.279  14.674  22.251  1.00 52.59  ? 274  ARG A CB  1 
ATOM   2044 C CG  . ARG A 1 305 ? 54.370  13.463  21.971  1.00 53.71  ? 274  ARG A CG  1 
ATOM   2045 C CD  . ARG A 1 305 ? 54.514  12.271  22.905  1.00 54.84  ? 274  ARG A CD  1 
ATOM   2046 N NE  . ARG A 1 305 ? 55.922  12.031  23.170  1.00 60.84  ? 274  ARG A NE  1 
ATOM   2047 C CZ  . ARG A 1 305 ? 56.657  11.020  22.694  1.00 62.26  ? 274  ARG A CZ  1 
ATOM   2048 N NH1 . ARG A 1 305 ? 56.102  10.076  21.932  1.00 62.84  ? 274  ARG A NH1 1 
ATOM   2049 N NH2 . ARG A 1 305 ? 57.959  10.964  22.999  1.00 60.76  ? 274  ARG A NH2 1 
ATOM   2050 N N   . THR A 1 306 ? 56.541  17.761  21.602  1.00 52.71  ? 275  THR A N   1 
ATOM   2051 C CA  . THR A 1 306 ? 57.054  19.038  22.115  1.00 53.18  ? 275  THR A CA  1 
ATOM   2052 C C   . THR A 1 306 ? 56.286  20.253  21.655  1.00 52.55  ? 275  THR A C   1 
ATOM   2053 O O   . THR A 1 306 ? 56.513  21.333  22.157  1.00 53.82  ? 275  THR A O   1 
ATOM   2054 C CB  . THR A 1 306 ? 58.564  19.286  21.749  1.00 54.61  ? 275  THR A CB  1 
ATOM   2055 O OG1 . THR A 1 306 ? 58.711  19.423  20.326  1.00 54.81  ? 275  THR A OG1 1 
ATOM   2056 C CG2 . THR A 1 306 ? 59.425  18.133  22.119  1.00 52.42  ? 275  THR A CG2 1 
ATOM   2057 N N   . ARG A 1 307 ? 55.394  20.114  20.698  1.00 51.97  ? 276  ARG A N   1 
ATOM   2058 C CA  . ARG A 1 307 ? 54.667  21.272  20.194  1.00 51.94  ? 276  ARG A CA  1 
ATOM   2059 C C   . ARG A 1 307 ? 53.487  21.654  21.063  1.00 51.07  ? 276  ARG A C   1 
ATOM   2060 O O   . ARG A 1 307 ? 52.782  20.788  21.542  1.00 51.21  ? 276  ARG A O   1 
ATOM   2061 C CB  . ARG A 1 307 ? 54.196  21.038  18.759  1.00 51.65  ? 276  ARG A CB  1 
ATOM   2062 C CG  . ARG A 1 307 ? 55.365  20.978  17.756  1.00 54.35  ? 276  ARG A CG  1 
ATOM   2063 C CD  . ARG A 1 307 ? 56.095  22.304  17.617  1.00 60.21  ? 276  ARG A CD  1 
ATOM   2064 N NE  . ARG A 1 307 ? 57.231  22.222  16.696  1.00 66.80  ? 276  ARG A NE  1 
ATOM   2065 C CZ  . ARG A 1 307 ? 58.481  21.831  17.024  1.00 69.79  ? 276  ARG A CZ  1 
ATOM   2066 N NH1 . ARG A 1 307 ? 58.805  21.502  18.279  1.00 69.52  ? 276  ARG A NH1 1 
ATOM   2067 N NH2 . ARG A 1 307 ? 59.417  21.793  16.074  1.00 71.91  ? 276  ARG A NH2 1 
ATOM   2068 N N   . PRO A 1 308 ? 53.254  22.951  21.249  1.00 50.84  ? 277  PRO A N   1 
ATOM   2069 C CA  . PRO A 1 308 ? 52.084  23.413  21.980  1.00 49.82  ? 277  PRO A CA  1 
ATOM   2070 C C   . PRO A 1 308 ? 50.814  22.919  21.297  1.00 48.34  ? 277  PRO A C   1 
ATOM   2071 O O   . PRO A 1 308 ? 50.755  22.924  20.079  1.00 47.93  ? 277  PRO A O   1 
ATOM   2072 C CB  . PRO A 1 308 ? 52.170  24.942  21.844  1.00 50.72  ? 277  PRO A CB  1 
ATOM   2073 C CG  . PRO A 1 308 ? 53.597  25.245  21.537  1.00 52.27  ? 277  PRO A CG  1 
ATOM   2074 C CD  . PRO A 1 308 ? 54.048  24.081  20.718  1.00 52.28  ? 277  PRO A CD  1 
ATOM   2075 N N   . ALA A 1 309 ? 49.801  22.551  22.063  1.00 47.24  ? 278  ALA A N   1 
ATOM   2076 C CA  . ALA A 1 309 ? 48.543  22.087  21.483  1.00 46.61  ? 278  ALA A CA  1 
ATOM   2077 C C   . ALA A 1 309 ? 47.977  23.011  20.406  1.00 46.25  ? 278  ALA A C   1 
ATOM   2078 O O   . ALA A 1 309 ? 47.491  22.541  19.382  1.00 45.62  ? 278  ALA A O   1 
ATOM   2079 C CB  . ALA A 1 309 ? 47.502  21.830  22.580  1.00 46.09  ? 278  ALA A CB  1 
ATOM   2080 N N   . GLN A 1 310 ? 48.083  24.319  20.602  1.00 47.23  ? 279  GLN A N   1 
ATOM   2081 C CA  . GLN A 1 310 ? 47.478  25.262  19.670  1.00 47.53  ? 279  GLN A CA  1 
ATOM   2082 C C   . GLN A 1 310 ? 48.184  25.275  18.347  1.00 48.30  ? 279  GLN A C   1 
ATOM   2083 O O   . GLN A 1 310 ? 47.562  25.586  17.339  1.00 49.19  ? 279  GLN A O   1 
ATOM   2084 C CB  . GLN A 1 310 ? 47.461  26.661  20.277  1.00 48.57  ? 279  GLN A CB  1 
ATOM   2085 C CG  . GLN A 1 310 ? 46.576  27.678  19.568  1.00 49.03  ? 279  GLN A CG  1 
ATOM   2086 C CD  . GLN A 1 310 ? 45.112  27.299  19.555  1.00 48.49  ? 279  GLN A CD  1 
ATOM   2087 O OE1 . GLN A 1 310 ? 44.492  27.104  20.607  1.00 50.23  ? 279  GLN A OE1 1 
ATOM   2088 N NE2 . GLN A 1 310 ? 44.546  27.236  18.366  1.00 46.97  ? 279  GLN A NE2 1 
ATOM   2089 N N   . ASP A 1 311 ? 49.473  24.966  18.328  1.00 49.33  ? 280  ASP A N   1 
ATOM   2090 C CA  . ASP A 1 311 ? 50.179  24.764  17.073  1.00 50.36  ? 280  ASP A CA  1 
ATOM   2091 C C   . ASP A 1 311 ? 49.577  23.650  16.207  1.00 49.22  ? 280  ASP A C   1 
ATOM   2092 O O   . ASP A 1 311 ? 49.436  23.805  15.005  1.00 48.93  ? 280  ASP A O   1 
ATOM   2093 C CB  . ASP A 1 311 ? 51.648  24.441  17.336  1.00 52.16  ? 280  ASP A CB  1 
ATOM   2094 C CG  . ASP A 1 311 ? 52.539  25.547  16.952  1.00 55.43  ? 280  ASP A CG  1 
ATOM   2095 O OD1 . ASP A 1 311 ? 52.029  26.484  16.307  1.00 62.22  ? 280  ASP A OD1 1 
ATOM   2096 O OD2 . ASP A 1 311 ? 53.754  25.569  17.244  1.00 63.04  ? 280  ASP A OD2 1 
ATOM   2097 N N   . LEU A 1 312 ? 49.260  22.523  16.828  1.00 48.45  ? 281  LEU A N   1 
ATOM   2098 C CA  . LEU A 1 312 ? 48.720  21.399  16.099  1.00 47.99  ? 281  LEU A CA  1 
ATOM   2099 C C   . LEU A 1 312 ? 47.385  21.795  15.517  1.00 47.04  ? 281  LEU A C   1 
ATOM   2100 O O   . LEU A 1 312 ? 47.133  21.543  14.347  1.00 46.81  ? 281  LEU A O   1 
ATOM   2101 C CB  . LEU A 1 312 ? 48.619  20.128  16.974  1.00 47.75  ? 281  LEU A CB  1 
ATOM   2102 C CG  . LEU A 1 312 ? 49.969  19.661  17.568  1.00 48.97  ? 281  LEU A CG  1 
ATOM   2103 C CD1 . LEU A 1 312 ? 49.840  18.387  18.367  1.00 49.67  ? 281  LEU A CD1 1 
ATOM   2104 C CD2 . LEU A 1 312 ? 51.008  19.470  16.508  1.00 49.24  ? 281  LEU A CD2 1 
ATOM   2105 N N   . VAL A 1 313 ? 46.560  22.480  16.306  1.00 47.09  ? 282  VAL A N   1 
ATOM   2106 C CA  . VAL A 1 313 ? 45.241  22.960  15.854  1.00 46.48  ? 282  VAL A CA  1 
ATOM   2107 C C   . VAL A 1 313 ? 45.315  23.973  14.704  1.00 46.98  ? 282  VAL A C   1 
ATOM   2108 O O   . VAL A 1 313 ? 44.494  23.918  13.766  1.00 45.72  ? 282  VAL A O   1 
ATOM   2109 C CB  . VAL A 1 313 ? 44.400  23.538  17.065  1.00 46.74  ? 282  VAL A CB  1 
ATOM   2110 C CG1 . VAL A 1 313 ? 43.091  24.208  16.629  1.00 45.90  ? 282  VAL A CG1 1 
ATOM   2111 C CG2 . VAL A 1 313 ? 44.073  22.441  18.075  1.00 47.12  ? 282  VAL A CG2 1 
ATOM   2112 N N   . ASP A 1 314 ? 46.298  24.870  14.750  1.00 48.49  ? 283  ASP A N   1 
ATOM   2113 C CA  . ASP A 1 314 ? 46.489  25.885  13.680  1.00 49.78  ? 283  ASP A CA  1 
ATOM   2114 C C   . ASP A 1 314 ? 46.877  25.309  12.291  1.00 49.97  ? 283  ASP A C   1 
ATOM   2115 O O   . ASP A 1 314 ? 46.754  26.029  11.319  1.00 50.56  ? 283  ASP A O   1 
ATOM   2116 C CB  . ASP A 1 314 ? 47.499  26.967  14.106  1.00 50.63  ? 283  ASP A CB  1 
ATOM   2117 C CG  . ASP A 1 314 ? 46.993  27.869  15.281  1.00 53.95  ? 283  ASP A CG  1 
ATOM   2118 O OD1 . ASP A 1 314 ? 45.790  27.799  15.697  1.00 52.07  ? 283  ASP A OD1 1 
ATOM   2119 O OD2 . ASP A 1 314 ? 47.785  28.679  15.857  1.00 57.45  ? 283  ASP A OD2 1 
ATOM   2120 N N   . HIS A 1 315 ? 47.339  24.053  12.190  1.00 49.89  ? 284  HIS A N   1 
ATOM   2121 C CA  . HIS A 1 315 ? 47.694  23.460  10.896  1.00 50.66  ? 284  HIS A CA  1 
ATOM   2122 C C   . HIS A 1 315 ? 46.882  22.247  10.515  1.00 49.92  ? 284  HIS A C   1 
ATOM   2123 O O   . HIS A 1 315 ? 47.014  21.701  9.430   1.00 49.23  ? 284  HIS A O   1 
ATOM   2124 C CB  . HIS A 1 315 ? 49.185  23.139  10.895  1.00 52.11  ? 284  HIS A CB  1 
ATOM   2125 C CG  . HIS A 1 315 ? 50.030  24.359  11.013  1.00 52.74  ? 284  HIS A CG  1 
ATOM   2126 N ND1 . HIS A 1 315 ? 50.576  24.763  12.209  1.00 53.77  ? 284  HIS A ND1 1 
ATOM   2127 C CD2 . HIS A 1 315 ? 50.332  25.321  10.107  1.00 54.15  ? 284  HIS A CD2 1 
ATOM   2128 C CE1 . HIS A 1 315 ? 51.226  25.901  12.024  1.00 56.19  ? 284  HIS A CE1 1 
ATOM   2129 N NE2 . HIS A 1 315 ? 51.087  26.263  10.757  1.00 55.58  ? 284  HIS A NE2 1 
ATOM   2130 N N   . GLU A 1 316 ? 46.017  21.849  11.417  1.00 49.80  ? 285  GLU A N   1 
ATOM   2131 C CA  . GLU A 1 316 ? 45.162  20.686  11.230  1.00 50.30  ? 285  GLU A CA  1 
ATOM   2132 C C   . GLU A 1 316 ? 44.393  20.678  9.888   1.00 50.08  ? 285  GLU A C   1 
ATOM   2133 O O   . GLU A 1 316 ? 44.368  19.686  9.158   1.00 48.71  ? 285  GLU A O   1 
ATOM   2134 C CB  . GLU A 1 316 ? 44.186  20.684  12.397  1.00 50.17  ? 285  GLU A CB  1 
ATOM   2135 C CG  . GLU A 1 316 ? 43.406  19.426  12.557  1.00 52.48  ? 285  GLU A CG  1 
ATOM   2136 C CD  . GLU A 1 316 ? 42.321  19.577  13.589  1.00 55.55  ? 285  GLU A CD  1 
ATOM   2137 O OE1 . GLU A 1 316 ? 42.500  20.310  14.584  1.00 57.86  ? 285  GLU A OE1 1 
ATOM   2138 O OE2 . GLU A 1 316 ? 41.284  18.950  13.381  1.00 57.62  ? 285  GLU A OE2 1 
ATOM   2139 N N   . TRP A 1 317 ? 43.801  21.818  9.558   1.00 50.82  ? 286  TRP A N   1 
ATOM   2140 C CA  . TRP A 1 317 ? 42.996  21.949  8.344   1.00 51.80  ? 286  TRP A CA  1 
ATOM   2141 C C   . TRP A 1 317 ? 43.828  22.007  7.065   1.00 52.32  ? 286  TRP A C   1 
ATOM   2142 O O   . TRP A 1 317 ? 43.294  21.820  5.988   1.00 52.85  ? 286  TRP A O   1 
ATOM   2143 C CB  . TRP A 1 317 ? 42.025  23.152  8.461   1.00 52.12  ? 286  TRP A CB  1 
ATOM   2144 C CG  . TRP A 1 317 ? 40.919  22.809  9.414   1.00 54.28  ? 286  TRP A CG  1 
ATOM   2145 C CD1 . TRP A 1 317 ? 40.789  23.178  10.753  1.00 54.84  ? 286  TRP A CD1 1 
ATOM   2146 C CD2 . TRP A 1 317 ? 39.834  21.939  9.138   1.00 54.98  ? 286  TRP A CD2 1 
ATOM   2147 N NE1 . TRP A 1 317 ? 39.677  22.578  11.292  1.00 53.58  ? 286  TRP A NE1 1 
ATOM   2148 C CE2 . TRP A 1 317 ? 39.072  21.817  10.327  1.00 54.77  ? 286  TRP A CE2 1 
ATOM   2149 C CE3 . TRP A 1 317 ? 39.422  21.238  7.999   1.00 54.96  ? 286  TRP A CE3 1 
ATOM   2150 C CZ2 . TRP A 1 317 ? 37.929  21.042  10.392  1.00 56.13  ? 286  TRP A CZ2 1 
ATOM   2151 C CZ3 . TRP A 1 317 ? 38.296  20.461  8.068   1.00 54.33  ? 286  TRP A CZ3 1 
ATOM   2152 C CH2 . TRP A 1 317 ? 37.552  20.375  9.250   1.00 55.95  ? 286  TRP A CH2 1 
ATOM   2153 N N   . HIS A 1 318 ? 45.131  22.220  7.175   1.00 53.48  ? 287  HIS A N   1 
ATOM   2154 C CA  . HIS A 1 318 ? 45.982  22.322  5.981   1.00 55.09  ? 287  HIS A CA  1 
ATOM   2155 C C   . HIS A 1 318 ? 46.457  20.983  5.372   1.00 54.39  ? 287  HIS A C   1 
ATOM   2156 O O   . HIS A 1 318 ? 47.196  20.995  4.406   1.00 54.78  ? 287  HIS A O   1 
ATOM   2157 C CB  . HIS A 1 318 ? 47.166  23.266  6.278   1.00 56.49  ? 287  HIS A CB  1 
ATOM   2158 C CG  . HIS A 1 318 ? 46.738  24.642  6.708   1.00 61.17  ? 287  HIS A CG  1 
ATOM   2159 N ND1 . HIS A 1 318 ? 47.379  25.352  7.703   1.00 66.41  ? 287  HIS A ND1 1 
ATOM   2160 C CD2 . HIS A 1 318 ? 45.723  25.434  6.279   1.00 65.02  ? 287  HIS A CD2 1 
ATOM   2161 C CE1 . HIS A 1 318 ? 46.771  26.513  7.876   1.00 67.37  ? 287  HIS A CE1 1 
ATOM   2162 N NE2 . HIS A 1 318 ? 45.761  26.586  7.027   1.00 67.06  ? 287  HIS A NE2 1 
ATOM   2163 N N   . VAL A 1 319 ? 46.015  19.840  5.899   1.00 53.46  ? 288  VAL A N   1 
ATOM   2164 C CA  . VAL A 1 319 ? 46.476  18.549  5.376   1.00 53.40  ? 288  VAL A CA  1 
ATOM   2165 C C   . VAL A 1 319 ? 45.455  17.806  4.497   1.00 53.40  ? 288  VAL A C   1 
ATOM   2166 O O   . VAL A 1 319 ? 45.722  16.691  4.057   1.00 53.50  ? 288  VAL A O   1 
ATOM   2167 C CB  . VAL A 1 319 ? 46.966  17.613  6.525   1.00 52.70  ? 288  VAL A CB  1 
ATOM   2168 C CG1 . VAL A 1 319 ? 47.962  18.329  7.418   1.00 52.38  ? 288  VAL A CG1 1 
ATOM   2169 C CG2 . VAL A 1 319 ? 45.801  17.054  7.336   1.00 50.91  ? 288  VAL A CG2 1 
ATOM   2170 N N   . LEU A 1 320 ? 44.289  18.384  4.256   1.00 53.51  ? 289  LEU A N   1 
ATOM   2171 C CA  . LEU A 1 320 ? 43.279  17.682  3.447   1.00 54.66  ? 289  LEU A CA  1 
ATOM   2172 C C   . LEU A 1 320 ? 43.700  17.686  1.980   1.00 56.14  ? 289  LEU A C   1 
ATOM   2173 O O   . LEU A 1 320 ? 44.162  18.708  1.483   1.00 56.31  ? 289  LEU A O   1 
ATOM   2174 C CB  . LEU A 1 320 ? 41.884  18.324  3.561   1.00 53.92  ? 289  LEU A CB  1 
ATOM   2175 C CG  . LEU A 1 320 ? 41.067  17.971  4.807   1.00 53.68  ? 289  LEU A CG  1 
ATOM   2176 C CD1 . LEU A 1 320 ? 39.906  18.962  4.943   1.00 53.77  ? 289  LEU A CD1 1 
ATOM   2177 C CD2 . LEU A 1 320 ? 40.571  16.562  4.777   1.00 53.76  ? 289  LEU A CD2 1 
ATOM   2178 N N   . PRO A 1 321 ? 43.463  16.581  1.274   1.00 57.58  ? 290  PRO A N   1 
ATOM   2179 C CA  . PRO A 1 321 ? 44.015  16.406  -0.078  1.00 59.26  ? 290  PRO A CA  1 
ATOM   2180 C C   . PRO A 1 321 ? 43.348  17.278  -1.151  1.00 59.88  ? 290  PRO A C   1 
ATOM   2181 O O   . PRO A 1 321 ? 43.981  17.509  -2.172  1.00 61.12  ? 290  PRO A O   1 
ATOM   2182 C CB  . PRO A 1 321 ? 43.816  14.900  -0.368  1.00 59.55  ? 290  PRO A CB  1 
ATOM   2183 C CG  . PRO A 1 321 ? 42.714  14.410  0.620   1.00 58.62  ? 290  PRO A CG  1 
ATOM   2184 C CD  . PRO A 1 321 ? 42.591  15.457  1.679   1.00 57.47  ? 290  PRO A CD  1 
ATOM   2185 N N   . GLN A 1 322 ? 42.114  17.728  -0.933  1.00 59.95  ? 291  GLN A N   1 
ATOM   2186 C CA  . GLN A 1 322 ? 41.416  18.606  -1.880  1.00 60.79  ? 291  GLN A CA  1 
ATOM   2187 C C   . GLN A 1 322 ? 40.684  19.742  -1.144  1.00 59.62  ? 291  GLN A C   1 
ATOM   2188 O O   . GLN A 1 322 ? 40.596  19.750  0.086   1.00 59.42  ? 291  GLN A O   1 
ATOM   2189 C CB  . GLN A 1 322 ? 40.398  17.795  -2.741  1.00 61.75  ? 291  GLN A CB  1 
ATOM   2190 C CG  . GLN A 1 322 ? 40.966  16.537  -3.455  1.00 64.06  ? 291  GLN A CG  1 
ATOM   2191 C CD  . GLN A 1 322 ? 40.849  15.260  -2.583  1.00 68.71  ? 291  GLN A CD  1 
ATOM   2192 O OE1 . GLN A 1 322 ? 41.402  14.183  -2.929  1.00 68.98  ? 291  GLN A OE1 1 
ATOM   2193 N NE2 . GLN A 1 322 ? 40.137  15.382  -1.436  1.00 69.02  ? 291  GLN A NE2 1 
ATOM   2194 N N   . GLU A 1 323 ? 40.193  20.712  -1.914  1.00 59.57  ? 292  GLU A N   1 
ATOM   2195 C CA  . GLU A 1 323 ? 39.187  21.680  -1.460  1.00 58.73  ? 292  GLU A CA  1 
ATOM   2196 C C   . GLU A 1 323 ? 37.916  20.855  -1.266  1.00 56.91  ? 292  GLU A C   1 
ATOM   2197 O O   . GLU A 1 323 ? 37.515  20.111  -2.164  1.00 57.94  ? 292  GLU A O   1 
ATOM   2198 C CB  . GLU A 1 323 ? 38.995  22.788  -2.511  1.00 59.77  ? 292  GLU A CB  1 
ATOM   2199 C CG  . GLU A 1 323 ? 37.973  23.899  -2.178  1.00 63.32  ? 292  GLU A CG  1 
ATOM   2200 C CD  . GLU A 1 323 ? 37.998  25.086  -3.168  1.00 68.91  ? 292  GLU A CD  1 
ATOM   2201 O OE1 . GLU A 1 323 ? 39.041  25.294  -3.859  1.00 73.14  ? 292  GLU A OE1 1 
ATOM   2202 O OE2 . GLU A 1 323 ? 36.981  25.839  -3.262  1.00 71.83  ? 292  GLU A OE2 1 
ATOM   2203 N N   . SER A 1 324 ? 37.298  20.927  -0.095  1.00 54.17  ? 293  SER A N   1 
ATOM   2204 C CA  . SER A 1 324 ? 36.181  20.026  0.180   1.00 52.27  ? 293  SER A CA  1 
ATOM   2205 C C   . SER A 1 324 ? 35.284  20.461  1.325   1.00 50.42  ? 293  SER A C   1 
ATOM   2206 O O   . SER A 1 324 ? 35.657  21.293  2.135   1.00 50.01  ? 293  SER A O   1 
ATOM   2207 C CB  . SER A 1 324 ? 36.732  18.645  0.487   1.00 51.89  ? 293  SER A CB  1 
ATOM   2208 O OG  . SER A 1 324 ? 37.488  18.681  1.672   1.00 52.24  ? 293  SER A OG  1 
ATOM   2209 N N   . ILE A 1 325 ? 34.090  19.888  1.383   1.00 48.96  ? 294  ILE A N   1 
ATOM   2210 C CA  . ILE A 1 325 ? 33.273  19.996  2.589   1.00 47.47  ? 294  ILE A CA  1 
ATOM   2211 C C   . ILE A 1 325 ? 32.908  18.607  3.093   1.00 45.45  ? 294  ILE A C   1 
ATOM   2212 O O   . ILE A 1 325 ? 33.072  17.640  2.388   1.00 44.98  ? 294  ILE A O   1 
ATOM   2213 C CB  . ILE A 1 325 ? 32.035  20.864  2.374   1.00 47.76  ? 294  ILE A CB  1 
ATOM   2214 C CG1 . ILE A 1 325 ? 31.223  20.387  1.185   1.00 48.88  ? 294  ILE A CG1 1 
ATOM   2215 C CG2 . ILE A 1 325 ? 32.449  22.336  2.208   1.00 49.58  ? 294  ILE A CG2 1 
ATOM   2216 C CD1 . ILE A 1 325 ? 29.870  21.030  1.140   1.00 51.60  ? 294  ILE A CD1 1 
ATOM   2217 N N   . PHE A 1 326 ? 32.470  18.539  4.344   1.00 43.89  ? 295  PHE A N   1 
ATOM   2218 C CA  . PHE A 1 326 ? 32.159  17.296  5.024   1.00 42.75  ? 295  PHE A CA  1 
ATOM   2219 C C   . PHE A 1 326 ? 33.354  16.317  4.944   1.00 42.31  ? 295  PHE A C   1 
ATOM   2220 O O   . PHE A 1 326 ? 33.177  15.102  4.767   1.00 40.86  ? 295  PHE A O   1 
ATOM   2221 C CB  . PHE A 1 326 ? 30.885  16.697  4.447   1.00 42.51  ? 295  PHE A CB  1 
ATOM   2222 C CG  . PHE A 1 326 ? 30.012  16.056  5.459   1.00 43.53  ? 295  PHE A CG  1 
ATOM   2223 C CD1 . PHE A 1 326 ? 30.540  15.209  6.428   1.00 42.26  ? 295  PHE A CD1 1 
ATOM   2224 C CD2 . PHE A 1 326 ? 28.623  16.264  5.426   1.00 43.94  ? 295  PHE A CD2 1 
ATOM   2225 C CE1 . PHE A 1 326 ? 29.733  14.598  7.332   1.00 41.54  ? 295  PHE A CE1 1 
ATOM   2226 C CE2 . PHE A 1 326 ? 27.801  15.660  6.356   1.00 42.97  ? 295  PHE A CE2 1 
ATOM   2227 C CZ  . PHE A 1 326 ? 28.350  14.837  7.320   1.00 43.10  ? 295  PHE A CZ  1 
ATOM   2228 N N   . ARG A 1 327 ? 34.558  16.885  5.044   1.00 41.38  ? 296  ARG A N   1 
ATOM   2229 C CA  . ARG A 1 327 ? 35.780  16.103  5.213   1.00 41.56  ? 296  ARG A CA  1 
ATOM   2230 C C   . ARG A 1 327 ? 36.589  16.690  6.366   1.00 41.51  ? 296  ARG A C   1 
ATOM   2231 O O   . ARG A 1 327 ? 36.683  17.905  6.549   1.00 41.68  ? 296  ARG A O   1 
ATOM   2232 C CB  . ARG A 1 327 ? 36.671  16.051  3.963   1.00 41.59  ? 296  ARG A CB  1 
ATOM   2233 C CG  . ARG A 1 327 ? 36.071  15.396  2.776   1.00 40.87  ? 296  ARG A CG  1 
ATOM   2234 C CD  . ARG A 1 327 ? 35.821  13.924  2.931   1.00 43.25  ? 296  ARG A CD  1 
ATOM   2235 N NE  . ARG A 1 327 ? 35.267  13.370  1.690   1.00 44.20  ? 296  ARG A NE  1 
ATOM   2236 C CZ  . ARG A 1 327 ? 33.973  13.241  1.429   1.00 44.42  ? 296  ARG A CZ  1 
ATOM   2237 N NH1 . ARG A 1 327 ? 33.045  13.653  2.282   1.00 44.53  ? 296  ARG A NH1 1 
ATOM   2238 N NH2 . ARG A 1 327 ? 33.595  12.723  0.270   1.00 47.46  ? 296  ARG A NH2 1 
ATOM   2239 N N   . PHE A 1 328 ? 37.170  15.783  7.136   1.00 41.34  ? 297  PHE A N   1 
ATOM   2240 C CA  . PHE A 1 328 ? 37.887  16.124  8.322   1.00 40.59  ? 297  PHE A CA  1 
ATOM   2241 C C   . PHE A 1 328 ? 39.230  15.418  8.288   1.00 41.16  ? 297  PHE A C   1 
ATOM   2242 O O   . PHE A 1 328 ? 39.340  14.287  7.828   1.00 42.00  ? 297  PHE A O   1 
ATOM   2243 C CB  . PHE A 1 328 ? 37.050  15.710  9.515   1.00 40.34  ? 297  PHE A CB  1 
ATOM   2244 C CG  . PHE A 1 328 ? 35.587  15.996  9.349   1.00 39.17  ? 297  PHE A CG  1 
ATOM   2245 C CD1 . PHE A 1 328 ? 35.088  17.284  9.544   1.00 37.78  ? 297  PHE A CD1 1 
ATOM   2246 C CD2 . PHE A 1 328 ? 34.705  14.988  9.004   1.00 37.48  ? 297  PHE A CD2 1 
ATOM   2247 C CE1 . PHE A 1 328 ? 33.717  17.545  9.401   1.00 38.12  ? 297  PHE A CE1 1 
ATOM   2248 C CE2 . PHE A 1 328 ? 33.329  15.258  8.819   1.00 38.17  ? 297  PHE A CE2 1 
ATOM   2249 C CZ  . PHE A 1 328 ? 32.833  16.542  9.048   1.00 36.99  ? 297  PHE A CZ  1 
ATOM   2250 N N   . SER A 1 329 ? 40.246  16.113  8.768   1.00 41.25  ? 298  SER A N   1 
ATOM   2251 C CA  . SER A 1 329 ? 41.615  15.712  8.647   1.00 41.78  ? 298  SER A CA  1 
ATOM   2252 C C   . SER A 1 329 ? 42.010  14.474  9.469   1.00 41.78  ? 298  SER A C   1 
ATOM   2253 O O   . SER A 1 329 ? 42.709  13.599  8.977   1.00 42.92  ? 298  SER A O   1 
ATOM   2254 C CB  . SER A 1 329 ? 42.474  16.891  9.100   1.00 42.13  ? 298  SER A CB  1 
ATOM   2255 O OG  . SER A 1 329 ? 42.477  17.900  8.122   1.00 43.34  ? 298  SER A OG  1 
ATOM   2256 N N   . PHE A 1 330 ? 41.608  14.412  10.728  1.00 40.78  ? 299  PHE A N   1 
ATOM   2257 C CA  . PHE A 1 330 ? 42.033  13.328  11.606  1.00 39.91  ? 299  PHE A CA  1 
ATOM   2258 C C   . PHE A 1 330 ? 40.827  12.589  12.155  1.00 39.46  ? 299  PHE A C   1 
ATOM   2259 O O   . PHE A 1 330 ? 40.118  13.078  13.024  1.00 39.12  ? 299  PHE A O   1 
ATOM   2260 C CB  . PHE A 1 330 ? 42.930  13.904  12.675  1.00 39.87  ? 299  PHE A CB  1 
ATOM   2261 C CG  . PHE A 1 330 ? 44.214  14.454  12.112  1.00 38.82  ? 299  PHE A CG  1 
ATOM   2262 C CD1 . PHE A 1 330 ? 45.231  13.607  11.741  1.00 39.29  ? 299  PHE A CD1 1 
ATOM   2263 C CD2 . PHE A 1 330 ? 44.361  15.802  11.851  1.00 39.43  ? 299  PHE A CD2 1 
ATOM   2264 C CE1 . PHE A 1 330 ? 46.412  14.091  11.187  1.00 38.76  ? 299  PHE A CE1 1 
ATOM   2265 C CE2 . PHE A 1 330 ? 45.543  16.292  11.279  1.00 39.96  ? 299  PHE A CE2 1 
ATOM   2266 C CZ  . PHE A 1 330 ? 46.575  15.420  10.967  1.00 38.28  ? 299  PHE A CZ  1 
ATOM   2267 N N   . VAL A 1 331 ? 40.590  11.416  11.588  1.00 39.37  ? 300  VAL A N   1 
ATOM   2268 C CA  . VAL A 1 331 ? 39.417  10.580  11.878  1.00 39.13  ? 300  VAL A CA  1 
ATOM   2269 C C   . VAL A 1 331 ? 39.888  9.139   12.157  1.00 39.58  ? 300  VAL A C   1 
ATOM   2270 O O   . VAL A 1 331 ? 41.063  8.827   11.992  1.00 39.81  ? 300  VAL A O   1 
ATOM   2271 C CB  . VAL A 1 331 ? 38.407  10.596  10.677  1.00 38.43  ? 300  VAL A CB  1 
ATOM   2272 C CG1 . VAL A 1 331 ? 37.921  12.036  10.373  1.00 39.48  ? 300  VAL A CG1 1 
ATOM   2273 C CG2 . VAL A 1 331 ? 39.018  10.027  9.429   1.00 37.52  ? 300  VAL A CG2 1 
ATOM   2274 N N   . PRO A 1 332 ? 38.989  8.267   12.587  1.00 39.60  ? 301  PRO A N   1 
ATOM   2275 C CA  . PRO A 1 332 ? 39.337  6.861   12.747  1.00 40.44  ? 301  PRO A CA  1 
ATOM   2276 C C   . PRO A 1 332 ? 40.101  6.302   11.548  1.00 41.90  ? 301  PRO A C   1 
ATOM   2277 O O   . PRO A 1 332 ? 39.783  6.597   10.399  1.00 42.00  ? 301  PRO A O   1 
ATOM   2278 C CB  . PRO A 1 332 ? 37.982  6.203   12.884  1.00 39.73  ? 301  PRO A CB  1 
ATOM   2279 C CG  . PRO A 1 332 ? 37.193  7.231   13.659  1.00 39.51  ? 301  PRO A CG  1 
ATOM   2280 C CD  . PRO A 1 332 ? 37.606  8.538   13.033  1.00 39.14  ? 301  PRO A CD  1 
ATOM   2281 N N   . VAL A 1 333 ? 41.132  5.523   11.831  1.00 42.99  ? 302  VAL A N   1 
ATOM   2282 C CA  . VAL A 1 333 ? 41.902  4.863   10.802  1.00 44.25  ? 302  VAL A CA  1 
ATOM   2283 C C   . VAL A 1 333 ? 41.613  3.332   10.779  1.00 45.78  ? 302  VAL A C   1 
ATOM   2284 O O   . VAL A 1 333 ? 41.383  2.689   11.835  1.00 45.36  ? 302  VAL A O   1 
ATOM   2285 C CB  . VAL A 1 333 ? 43.410  5.152   10.954  1.00 44.23  ? 302  VAL A CB  1 
ATOM   2286 C CG1 . VAL A 1 333 ? 43.959  4.645   12.270  1.00 44.83  ? 302  VAL A CG1 1 
ATOM   2287 C CG2 . VAL A 1 333 ? 44.185  4.508   9.838   1.00 46.54  ? 302  VAL A CG2 1 
ATOM   2288 N N   . VAL A 1 334 ? 41.632  2.767   9.568   1.00 46.79  ? 303  VAL A N   1 
ATOM   2289 C CA  . VAL A 1 334 ? 41.489  1.342   9.368   1.00 47.96  ? 303  VAL A CA  1 
ATOM   2290 C C   . VAL A 1 334 ? 42.866  0.777   9.643   1.00 49.40  ? 303  VAL A C   1 
ATOM   2291 O O   . VAL A 1 334 ? 43.713  0.674   8.750   1.00 49.82  ? 303  VAL A O   1 
ATOM   2292 C CB  . VAL A 1 334 ? 40.970  0.996   7.944   1.00 48.60  ? 303  VAL A CB  1 
ATOM   2293 C CG1 . VAL A 1 334 ? 40.874  -0.507  7.741   1.00 50.12  ? 303  VAL A CG1 1 
ATOM   2294 C CG2 . VAL A 1 334 ? 39.605  1.594   7.710   1.00 48.44  ? 303  VAL A CG2 1 
ATOM   2295 N N   . ASP A 1 335 ? 43.068  0.446   10.917  1.00 50.28  ? 304  ASP A N   1 
ATOM   2296 C CA  . ASP A 1 335 ? 44.364  0.066   11.469  1.00 51.05  ? 304  ASP A CA  1 
ATOM   2297 C C   . ASP A 1 335 ? 44.633  -1.441  11.465  1.00 52.34  ? 304  ASP A C   1 
ATOM   2298 O O   . ASP A 1 335 ? 45.769  -1.869  11.698  1.00 52.99  ? 304  ASP A O   1 
ATOM   2299 C CB  . ASP A 1 335 ? 44.530  0.651   12.894  1.00 50.39  ? 304  ASP A CB  1 
ATOM   2300 C CG  . ASP A 1 335 ? 43.454  0.177   13.888  1.00 51.05  ? 304  ASP A CG  1 
ATOM   2301 O OD1 . ASP A 1 335 ? 42.396  -0.343  13.472  1.00 50.67  ? 304  ASP A OD1 1 
ATOM   2302 O OD2 . ASP A 1 335 ? 43.570  0.321   15.132  1.00 52.61  ? 304  ASP A OD2 1 
ATOM   2303 N N   . GLY A 1 336 ? 43.603  -2.239  11.191  1.00 52.91  ? 305  GLY A N   1 
ATOM   2304 C CA  . GLY A 1 336 ? 43.682  -3.694  11.346  1.00 54.34  ? 305  GLY A CA  1 
ATOM   2305 C C   . GLY A 1 336 ? 43.612  -4.176  12.796  1.00 55.05  ? 305  GLY A C   1 
ATOM   2306 O O   . GLY A 1 336 ? 43.891  -5.331  13.072  1.00 55.89  ? 305  GLY A O   1 
ATOM   2307 N N   . ASP A 1 337 ? 43.226  -3.291  13.723  1.00 54.66  ? 306  ASP A N   1 
ATOM   2308 C CA  . ASP A 1 337 ? 43.200  -3.581  15.175  1.00 54.68  ? 306  ASP A CA  1 
ATOM   2309 C C   . ASP A 1 337 ? 41.824  -3.182  15.744  1.00 53.13  ? 306  ASP A C   1 
ATOM   2310 O O   . ASP A 1 337 ? 40.955  -4.055  15.856  1.00 53.60  ? 306  ASP A O   1 
ATOM   2311 C CB  . ASP A 1 337 ? 44.371  -2.877  15.895  1.00 54.98  ? 306  ASP A CB  1 
ATOM   2312 C CG  . ASP A 1 337 ? 44.386  -3.115  17.406  1.00 56.17  ? 306  ASP A CG  1 
ATOM   2313 O OD1 . ASP A 1 337 ? 43.805  -4.110  17.889  1.00 56.00  ? 306  ASP A OD1 1 
ATOM   2314 O OD2 . ASP A 1 337 ? 44.978  -2.340  18.195  1.00 57.96  ? 306  ASP A OD2 1 
ATOM   2315 N N   . PHE A 1 338 ? 41.612  -1.900  16.074  1.00 51.07  ? 307  PHE A N   1 
ATOM   2316 C CA  . PHE A 1 338 ? 40.286  -1.410  16.454  1.00 49.58  ? 307  PHE A CA  1 
ATOM   2317 C C   . PHE A 1 338 ? 39.295  -1.730  15.337  1.00 49.80  ? 307  PHE A C   1 
ATOM   2318 O O   . PHE A 1 338 ? 38.231  -2.275  15.585  1.00 49.96  ? 307  PHE A O   1 
ATOM   2319 C CB  . PHE A 1 338 ? 40.288  0.101   16.757  1.00 48.63  ? 307  PHE A CB  1 
ATOM   2320 C CG  . PHE A 1 338 ? 39.053  0.575   17.478  1.00 47.56  ? 307  PHE A CG  1 
ATOM   2321 C CD1 . PHE A 1 338 ? 37.834  0.616   16.834  1.00 48.13  ? 307  PHE A CD1 1 
ATOM   2322 C CD2 . PHE A 1 338 ? 39.102  0.906   18.821  1.00 47.86  ? 307  PHE A CD2 1 
ATOM   2323 C CE1 . PHE A 1 338 ? 36.670  0.980   17.514  1.00 47.65  ? 307  PHE A CE1 1 
ATOM   2324 C CE2 . PHE A 1 338 ? 37.963  1.286   19.505  1.00 47.70  ? 307  PHE A CE2 1 
ATOM   2325 C CZ  . PHE A 1 338 ? 36.735  1.323   18.852  1.00 47.36  ? 307  PHE A CZ  1 
ATOM   2326 N N   . LEU A 1 339 ? 39.655  -1.371  14.110  1.00 50.12  ? 308  LEU A N   1 
ATOM   2327 C CA  . LEU A 1 339 ? 38.914  -1.765  12.911  1.00 50.71  ? 308  LEU A CA  1 
ATOM   2328 C C   . LEU A 1 339 ? 39.701  -2.802  12.124  1.00 52.34  ? 308  LEU A C   1 
ATOM   2329 O O   . LEU A 1 339 ? 40.658  -2.474  11.452  1.00 52.39  ? 308  LEU A O   1 
ATOM   2330 C CB  . LEU A 1 339 ? 38.658  -0.541  12.020  1.00 49.86  ? 308  LEU A CB  1 
ATOM   2331 C CG  . LEU A 1 339 ? 37.733  0.503   12.636  1.00 49.10  ? 308  LEU A CG  1 
ATOM   2332 C CD1 . LEU A 1 339 ? 37.642  1.678   11.741  1.00 49.33  ? 308  LEU A CD1 1 
ATOM   2333 C CD2 . LEU A 1 339 ? 36.333  -0.094  12.872  1.00 51.28  ? 308  LEU A CD2 1 
ATOM   2334 N N   . SER A 1 340 ? 39.285  -4.061  12.202  1.00 54.00  ? 309  SER A N   1 
ATOM   2335 C CA  . SER A 1 340 ? 40.016  -5.153  11.582  1.00 55.82  ? 309  SER A CA  1 
ATOM   2336 C C   . SER A 1 340 ? 39.987  -5.074  10.067  1.00 56.09  ? 309  SER A C   1 
ATOM   2337 O O   . SER A 1 340 ? 40.771  -5.731  9.394   1.00 57.52  ? 309  SER A O   1 
ATOM   2338 C CB  . SER A 1 340 ? 39.480  -6.510  12.077  1.00 57.24  ? 309  SER A CB  1 
ATOM   2339 O OG  . SER A 1 340 ? 38.124  -6.715  11.694  1.00 60.04  ? 309  SER A OG  1 
ATOM   2340 N N   . ASP A 1 341 ? 39.078  -4.280  9.531   1.00 55.41  ? 310  ASP A N   1 
ATOM   2341 C CA  . ASP A 1 341 ? 38.948  -4.087  8.082   1.00 55.69  ? 310  ASP A CA  1 
ATOM   2342 C C   . ASP A 1 341 ? 38.110  -2.812  7.838   1.00 54.10  ? 310  ASP A C   1 
ATOM   2343 O O   . ASP A 1 341 ? 37.652  -2.188  8.784   1.00 53.04  ? 310  ASP A O   1 
ATOM   2344 C CB  . ASP A 1 341 ? 38.270  -5.322  7.474   1.00 56.76  ? 310  ASP A CB  1 
ATOM   2345 C CG  . ASP A 1 341 ? 38.623  -5.551  6.007   1.00 58.26  ? 310  ASP A CG  1 
ATOM   2346 O OD1 . ASP A 1 341 ? 39.000  -4.600  5.276   1.00 59.31  ? 310  ASP A OD1 1 
ATOM   2347 O OD2 . ASP A 1 341 ? 38.521  -6.685  5.499   1.00 60.48  ? 310  ASP A OD2 1 
ATOM   2348 N N   . THR A 1 342 ? 37.884  -2.419  6.593   1.00 54.30  ? 311  THR A N   1 
ATOM   2349 C CA  . THR A 1 342 ? 37.081  -1.216  6.358   1.00 53.96  ? 311  THR A CA  1 
ATOM   2350 C C   . THR A 1 342 ? 35.692  -1.458  6.929   1.00 54.08  ? 311  THR A C   1 
ATOM   2351 O O   . THR A 1 342 ? 35.249  -2.610  6.960   1.00 54.37  ? 311  THR A O   1 
ATOM   2352 C CB  . THR A 1 342 ? 36.976  -0.912  4.861   1.00 54.78  ? 311  THR A CB  1 
ATOM   2353 O OG1 . THR A 1 342 ? 36.436  -2.059  4.184   1.00 57.57  ? 311  THR A OG1 1 
ATOM   2354 C CG2 . THR A 1 342 ? 38.383  -0.699  4.208   1.00 54.10  ? 311  THR A CG2 1 
ATOM   2355 N N   . PRO A 1 343 ? 35.011  -0.416  7.415   1.00 53.59  ? 312  PRO A N   1 
ATOM   2356 C CA  . PRO A 1 343 ? 33.607  -0.545  7.824   1.00 54.07  ? 312  PRO A CA  1 
ATOM   2357 C C   . PRO A 1 343 ? 32.705  -1.141  6.749   1.00 55.95  ? 312  PRO A C   1 
ATOM   2358 O O   . PRO A 1 343 ? 31.798  -1.883  7.088   1.00 55.96  ? 312  PRO A O   1 
ATOM   2359 C CB  . PRO A 1 343 ? 33.191  0.894   8.139   1.00 52.79  ? 312  PRO A CB  1 
ATOM   2360 C CG  . PRO A 1 343 ? 34.422  1.545   8.534   1.00 52.33  ? 312  PRO A CG  1 
ATOM   2361 C CD  . PRO A 1 343 ? 35.507  0.941   7.660   1.00 52.89  ? 312  PRO A CD  1 
ATOM   2362 N N   . GLU A 1 344 ? 32.958  -0.827  5.478   1.00 58.03  ? 313  GLU A N   1 
ATOM   2363 C CA  . GLU A 1 344 ? 32.206  -1.422  4.360   1.00 60.29  ? 313  GLU A CA  1 
ATOM   2364 C C   . GLU A 1 344 ? 32.366  -2.957  4.379   1.00 60.81  ? 313  GLU A C   1 
ATOM   2365 O O   . GLU A 1 344 ? 31.398  -3.685  4.273   1.00 61.07  ? 313  GLU A O   1 
ATOM   2366 C CB  . GLU A 1 344 ? 32.629  -0.824  2.993   1.00 61.14  ? 313  GLU A CB  1 
ATOM   2367 C CG  . GLU A 1 344 ? 31.480  -0.595  1.990   1.00 66.30  ? 313  GLU A CG  1 
ATOM   2368 C CD  . GLU A 1 344 ? 31.758  -1.169  0.575   1.00 73.74  ? 313  GLU A CD  1 
ATOM   2369 O OE1 . GLU A 1 344 ? 32.756  -0.746  -0.084  1.00 75.61  ? 313  GLU A OE1 1 
ATOM   2370 O OE2 . GLU A 1 344 ? 30.975  -2.056  0.104   1.00 78.62  ? 313  GLU A OE2 1 
ATOM   2371 N N   . ALA A 1 345 ? 33.590  -3.440  4.540   1.00 60.78  ? 314  ALA A N   1 
ATOM   2372 C CA  . ALA A 1 345 ? 33.809  -4.880  4.586   1.00 62.13  ? 314  ALA A CA  1 
ATOM   2373 C C   . ALA A 1 345 ? 33.098  -5.507  5.789   1.00 62.52  ? 314  ALA A C   1 
ATOM   2374 O O   . ALA A 1 345 ? 32.561  -6.607  5.684   1.00 63.90  ? 314  ALA A O   1 
ATOM   2375 C CB  . ALA A 1 345 ? 35.317  -5.222  4.606   1.00 62.06  ? 314  ALA A CB  1 
ATOM   2376 N N   . LEU A 1 346 ? 33.091  -4.814  6.928   1.00 61.85  ? 315  LEU A N   1 
ATOM   2377 C CA  . LEU A 1 346 ? 32.593  -5.400  8.179   1.00 61.87  ? 315  LEU A CA  1 
ATOM   2378 C C   . LEU A 1 346 ? 31.074  -5.437  8.250   1.00 62.60  ? 315  LEU A C   1 
ATOM   2379 O O   . LEU A 1 346 ? 30.517  -6.369  8.812   1.00 63.35  ? 315  LEU A O   1 
ATOM   2380 C CB  . LEU A 1 346 ? 33.148  -4.669  9.397   1.00 60.42  ? 315  LEU A CB  1 
ATOM   2381 C CG  . LEU A 1 346 ? 34.645  -4.829  9.572   1.00 59.41  ? 315  LEU A CG  1 
ATOM   2382 C CD1 . LEU A 1 346 ? 35.088  -3.988  10.715  1.00 57.04  ? 315  LEU A CD1 1 
ATOM   2383 C CD2 . LEU A 1 346 ? 35.041  -6.309  9.756   1.00 58.48  ? 315  LEU A CD2 1 
ATOM   2384 N N   . ILE A 1 347 ? 30.401  -4.441  7.688   1.00 62.89  ? 316  ILE A N   1 
ATOM   2385 C CA  . ILE A 1 347 ? 28.940  -4.467  7.639   1.00 64.14  ? 316  ILE A CA  1 
ATOM   2386 C C   . ILE A 1 347 ? 28.435  -5.460  6.565   1.00 66.32  ? 316  ILE A C   1 
ATOM   2387 O O   . ILE A 1 347 ? 27.338  -6.014  6.700   1.00 66.89  ? 316  ILE A O   1 
ATOM   2388 C CB  . ILE A 1 347 ? 28.279  -3.050  7.459   1.00 62.64  ? 316  ILE A CB  1 
ATOM   2389 C CG1 . ILE A 1 347 ? 28.570  -2.435  6.098   1.00 64.06  ? 316  ILE A CG1 1 
ATOM   2390 C CG2 . ILE A 1 347 ? 28.716  -2.090  8.538   1.00 61.63  ? 316  ILE A CG2 1 
ATOM   2391 C CD1 . ILE A 1 347 ? 27.592  -1.246  5.704   1.00 63.36  ? 316  ILE A CD1 1 
ATOM   2392 N N   . ASN A 1 348 ? 29.236  -5.698  5.523   1.00 67.54  ? 317  ASN A N   1 
ATOM   2393 C CA  . ASN A 1 348 ? 28.859  -6.660  4.481   1.00 69.60  ? 317  ASN A CA  1 
ATOM   2394 C C   . ASN A 1 348 ? 29.001  -8.117  4.971   1.00 70.99  ? 317  ASN A C   1 
ATOM   2395 O O   . ASN A 1 348 ? 28.218  -8.954  4.559   1.00 72.11  ? 317  ASN A O   1 
ATOM   2396 C CB  . ASN A 1 348 ? 29.645  -6.464  3.166   1.00 70.21  ? 317  ASN A CB  1 
ATOM   2397 C CG  . ASN A 1 348 ? 29.297  -5.138  2.411   1.00 70.85  ? 317  ASN A CG  1 
ATOM   2398 O OD1 . ASN A 1 348 ? 28.392  -4.368  2.791   1.00 73.02  ? 317  ASN A OD1 1 
ATOM   2399 N ND2 . ASN A 1 348 ? 30.040  -4.882  1.327   1.00 71.22  ? 317  ASN A ND2 1 
ATOM   2400 N N   . THR A 1 349 ? 29.946  -8.411  5.870   1.00 70.98  ? 318  THR A N   1 
ATOM   2401 C CA  . THR A 1 349 ? 30.151  -9.791  6.356   1.00 72.72  ? 318  THR A CA  1 
ATOM   2402 C C   . THR A 1 349 ? 29.859  -10.021 7.841   1.00 72.57  ? 318  THR A C   1 
ATOM   2403 O O   . THR A 1 349 ? 30.096  -11.102 8.358   1.00 73.58  ? 318  THR A O   1 
ATOM   2404 C CB  . THR A 1 349 ? 31.602  -10.209 6.130   1.00 73.52  ? 318  THR A CB  1 
ATOM   2405 O OG1 . THR A 1 349 ? 32.456  -9.414  6.972   1.00 72.30  ? 318  THR A OG1 1 
ATOM   2406 C CG2 . THR A 1 349 ? 32.043  -9.921  4.692   1.00 74.39  ? 318  THR A CG2 1 
ATOM   2407 N N   . GLY A 1 350 ? 29.385  -9.006  8.543   1.00 71.67  ? 319  GLY A N   1 
ATOM   2408 C CA  . GLY A 1 350 ? 29.134  -9.154  9.964   1.00 71.70  ? 319  GLY A CA  1 
ATOM   2409 C C   . GLY A 1 350 ? 27.891  -9.994  10.230  1.00 72.87  ? 319  GLY A C   1 
ATOM   2410 O O   . GLY A 1 350 ? 26.958  -10.053 9.395   1.00 73.06  ? 319  GLY A O   1 
ATOM   2411 N N   . ASP A 1 351 ? 27.895  -10.636 11.397  1.00 73.31  ? 320  ASP A N   1 
ATOM   2412 C CA  . ASP A 1 351 ? 26.736  -11.317 11.925  1.00 74.55  ? 320  ASP A CA  1 
ATOM   2413 C C   . ASP A 1 351 ? 26.184  -10.413 13.030  1.00 73.22  ? 320  ASP A C   1 
ATOM   2414 O O   . ASP A 1 351 ? 26.850  -10.177 14.040  1.00 72.48  ? 320  ASP A O   1 
ATOM   2415 C CB  . ASP A 1 351 ? 27.157  -12.705 12.442  1.00 76.47  ? 320  ASP A CB  1 
ATOM   2416 C CG  . ASP A 1 351 ? 26.045  -13.440 13.171  1.00 77.86  ? 320  ASP A CG  1 
ATOM   2417 O OD1 . ASP A 1 351 ? 24.854  -13.161 12.918  1.00 79.05  ? 320  ASP A OD1 1 
ATOM   2418 O OD2 . ASP A 1 351 ? 26.285  -14.317 14.025  1.00 80.57  ? 320  ASP A OD2 1 
ATOM   2419 N N   . PHE A 1 352 ? 24.980  -9.889  12.813  1.00 72.94  ? 321  PHE A N   1 
ATOM   2420 C CA  . PHE A 1 352 ? 24.368  -8.904  13.714  1.00 72.03  ? 321  PHE A CA  1 
ATOM   2421 C C   . PHE A 1 352 ? 23.064  -9.425  14.327  1.00 73.52  ? 321  PHE A C   1 
ATOM   2422 O O   . PHE A 1 352 ? 22.137  -8.665  14.574  1.00 72.80  ? 321  PHE A O   1 
ATOM   2423 C CB  . PHE A 1 352 ? 24.127  -7.607  12.937  1.00 70.59  ? 321  PHE A CB  1 
ATOM   2424 C CG  . PHE A 1 352 ? 25.373  -7.023  12.372  1.00 68.63  ? 321  PHE A CG  1 
ATOM   2425 C CD1 . PHE A 1 352 ? 26.358  -6.529  13.213  1.00 67.33  ? 321  PHE A CD1 1 
ATOM   2426 C CD2 . PHE A 1 352 ? 25.587  -6.993  11.010  1.00 69.10  ? 321  PHE A CD2 1 
ATOM   2427 C CE1 . PHE A 1 352 ? 27.537  -5.991  12.705  1.00 66.94  ? 321  PHE A CE1 1 
ATOM   2428 C CE2 . PHE A 1 352 ? 26.767  -6.461  10.497  1.00 69.27  ? 321  PHE A CE2 1 
ATOM   2429 C CZ  . PHE A 1 352 ? 27.741  -5.958  11.355  1.00 67.26  ? 321  PHE A CZ  1 
ATOM   2430 N N   . GLN A 1 353 ? 23.023  -10.726 14.602  1.00 75.98  ? 322  GLN A N   1 
ATOM   2431 C CA  . GLN A 1 353 ? 21.803  -11.396 15.057  1.00 77.83  ? 322  GLN A CA  1 
ATOM   2432 C C   . GLN A 1 353 ? 21.257  -10.842 16.374  1.00 76.83  ? 322  GLN A C   1 
ATOM   2433 O O   . GLN A 1 353 ? 20.052  -10.672 16.534  1.00 77.18  ? 322  GLN A O   1 
ATOM   2434 C CB  . GLN A 1 353 ? 22.074  -12.896 15.197  1.00 80.12  ? 322  GLN A CB  1 
ATOM   2435 C CG  . GLN A 1 353 ? 20.830  -13.768 15.359  1.00 84.47  ? 322  GLN A CG  1 
ATOM   2436 C CD  . GLN A 1 353 ? 20.375  -14.393 14.042  1.00 88.90  ? 322  GLN A CD  1 
ATOM   2437 O OE1 . GLN A 1 353 ? 20.423  -15.624 13.876  1.00 90.66  ? 322  GLN A OE1 1 
ATOM   2438 N NE2 . GLN A 1 353 ? 19.928  -13.548 13.106  1.00 88.68  ? 322  GLN A NE2 1 
ATOM   2439 N N   . ASP A 1 354 ? 22.144  -10.543 17.310  1.00 75.59  ? 323  ASP A N   1 
ATOM   2440 C CA  . ASP A 1 354 ? 21.721  -10.147 18.663  1.00 75.25  ? 323  ASP A CA  1 
ATOM   2441 C C   . ASP A 1 354 ? 21.594  -8.628  18.873  1.00 71.42  ? 323  ASP A C   1 
ATOM   2442 O O   . ASP A 1 354 ? 21.640  -8.155  20.010  1.00 70.67  ? 323  ASP A O   1 
ATOM   2443 C CB  . ASP A 1 354 ? 22.719  -10.736 19.719  1.00 76.66  ? 323  ASP A CB  1 
ATOM   2444 C CG  . ASP A 1 354 ? 24.233  -10.390 19.410  1.00 78.76  ? 323  ASP A CG  1 
ATOM   2445 O OD1 . ASP A 1 354 ? 24.538  -9.308  18.841  1.00 80.22  ? 323  ASP A OD1 1 
ATOM   2446 O OD2 . ASP A 1 354 ? 25.183  -11.172 19.700  1.00 84.08  ? 323  ASP A OD2 1 
ATOM   2447 N N   . LEU A 1 355 ? 21.415  -7.879  17.790  1.00 68.26  ? 324  LEU A N   1 
ATOM   2448 C CA  . LEU A 1 355 ? 21.614  -6.431  17.814  1.00 64.82  ? 324  LEU A CA  1 
ATOM   2449 C C   . LEU A 1 355 ? 20.367  -5.667  17.448  1.00 62.32  ? 324  LEU A C   1 
ATOM   2450 O O   . LEU A 1 355 ? 19.767  -5.928  16.416  1.00 62.30  ? 324  LEU A O   1 
ATOM   2451 C CB  . LEU A 1 355 ? 22.697  -6.036  16.815  1.00 64.32  ? 324  LEU A CB  1 
ATOM   2452 C CG  . LEU A 1 355 ? 23.130  -4.576  16.933  1.00 63.43  ? 324  LEU A CG  1 
ATOM   2453 C CD1 . LEU A 1 355 ? 24.127  -4.429  18.074  1.00 63.01  ? 324  LEU A CD1 1 
ATOM   2454 C CD2 . LEU A 1 355 ? 23.701  -4.083  15.624  1.00 63.87  ? 324  LEU A CD2 1 
ATOM   2455 N N   . GLN A 1 356 ? 19.999  -4.711  18.287  1.00 59.35  ? 325  GLN A N   1 
ATOM   2456 C CA  . GLN A 1 356 ? 18.920  -3.798  17.984  1.00 57.72  ? 325  GLN A CA  1 
ATOM   2457 C C   . GLN A 1 356 ? 19.493  -2.405  17.801  1.00 54.85  ? 325  GLN A C   1 
ATOM   2458 O O   . GLN A 1 356 ? 20.197  -1.913  18.683  1.00 53.63  ? 325  GLN A O   1 
ATOM   2459 C CB  . GLN A 1 356 ? 17.899  -3.805  19.117  1.00 58.64  ? 325  GLN A CB  1 
ATOM   2460 C CG  . GLN A 1 356 ? 17.227  -5.137  19.322  1.00 63.00  ? 325  GLN A CG  1 
ATOM   2461 C CD  . GLN A 1 356 ? 17.556  -5.747  20.658  1.00 68.37  ? 325  GLN A CD  1 
ATOM   2462 O OE1 . GLN A 1 356 ? 18.264  -6.747  20.717  1.00 72.79  ? 325  GLN A OE1 1 
ATOM   2463 N NE2 . GLN A 1 356 ? 17.056  -5.149  21.735  1.00 69.29  ? 325  GLN A NE2 1 
ATOM   2464 N N   . VAL A 1 357 ? 19.183  -1.784  16.660  1.00 53.10  ? 326  VAL A N   1 
ATOM   2465 C CA  . VAL A 1 357 ? 19.614  -0.436  16.346  1.00 51.83  ? 326  VAL A CA  1 
ATOM   2466 C C   . VAL A 1 357 ? 18.480  0.424   15.849  1.00 50.63  ? 326  VAL A C   1 
ATOM   2467 O O   . VAL A 1 357 ? 17.609  -0.041  15.106  1.00 51.44  ? 326  VAL A O   1 
ATOM   2468 C CB  . VAL A 1 357 ? 20.697  -0.328  15.243  1.00 51.73  ? 326  VAL A CB  1 
ATOM   2469 C CG1 . VAL A 1 357 ? 21.938  -0.986  15.671  1.00 53.21  ? 326  VAL A CG1 1 
ATOM   2470 C CG2 . VAL A 1 357 ? 20.195  -0.918  13.927  1.00 54.80  ? 326  VAL A CG2 1 
ATOM   2471 N N   . LEU A 1 358 ? 18.559  1.697   16.221  1.00 48.38  ? 327  LEU A N   1 
ATOM   2472 C CA  . LEU A 1 358 ? 17.683  2.733   15.725  1.00 48.01  ? 327  LEU A CA  1 
ATOM   2473 C C   . LEU A 1 358 ? 18.556  3.724   14.960  1.00 45.85  ? 327  LEU A C   1 
ATOM   2474 O O   . LEU A 1 358 ? 19.617  4.117   15.448  1.00 44.08  ? 327  LEU A O   1 
ATOM   2475 C CB  . LEU A 1 358 ? 16.967  3.387   16.913  1.00 49.08  ? 327  LEU A CB  1 
ATOM   2476 C CG  . LEU A 1 358 ? 16.162  4.698   16.811  1.00 52.08  ? 327  LEU A CG  1 
ATOM   2477 C CD1 . LEU A 1 358 ? 15.091  4.670   15.773  1.00 53.06  ? 327  LEU A CD1 1 
ATOM   2478 C CD2 . LEU A 1 358 ? 15.498  4.961   18.147  1.00 55.11  ? 327  LEU A CD2 1 
ATOM   2479 N N   . VAL A 1 359 ? 18.143  4.068   13.743  1.00 44.79  ? 328  VAL A N   1 
ATOM   2480 C CA  . VAL A 1 359 ? 18.916  4.939   12.871  1.00 44.13  ? 328  VAL A CA  1 
ATOM   2481 C C   . VAL A 1 359 ? 18.024  5.928   12.165  1.00 43.59  ? 328  VAL A C   1 
ATOM   2482 O O   . VAL A 1 359 ? 16.850  5.655   11.891  1.00 43.86  ? 328  VAL A O   1 
ATOM   2483 C CB  . VAL A 1 359 ? 19.717  4.150   11.769  1.00 44.61  ? 328  VAL A CB  1 
ATOM   2484 C CG1 . VAL A 1 359 ? 20.540  3.111   12.388  1.00 45.97  ? 328  VAL A CG1 1 
ATOM   2485 C CG2 . VAL A 1 359 ? 18.778  3.471   10.744  1.00 45.40  ? 328  VAL A CG2 1 
ATOM   2486 N N   . GLY A 1 360 ? 18.591  7.070   11.805  1.00 42.37  ? 329  GLY A N   1 
ATOM   2487 C CA  . GLY A 1 360 ? 17.830  7.974   10.973  1.00 42.20  ? 329  GLY A CA  1 
ATOM   2488 C C   . GLY A 1 360 ? 18.596  9.190   10.564  1.00 41.42  ? 329  GLY A C   1 
ATOM   2489 O O   . GLY A 1 360 ? 19.791  9.288   10.811  1.00 40.89  ? 329  GLY A O   1 
ATOM   2490 N N   . VAL A 1 361 ? 17.861  10.112  9.951   1.00 41.51  ? 330  VAL A N   1 
ATOM   2491 C CA  . VAL A 1 361 ? 18.391  11.304  9.333   1.00 41.07  ? 330  VAL A CA  1 
ATOM   2492 C C   . VAL A 1 361 ? 17.416  12.446  9.532   1.00 41.69  ? 330  VAL A C   1 
ATOM   2493 O O   . VAL A 1 361 ? 16.244  12.232  9.861   1.00 42.01  ? 330  VAL A O   1 
ATOM   2494 C CB  . VAL A 1 361 ? 18.609  11.088  7.812   1.00 41.52  ? 330  VAL A CB  1 
ATOM   2495 C CG1 . VAL A 1 361 ? 19.677  9.999   7.551   1.00 41.85  ? 330  VAL A CG1 1 
ATOM   2496 C CG2 . VAL A 1 361 ? 17.321  10.720  7.093   1.00 41.75  ? 330  VAL A CG2 1 
ATOM   2497 N N   . VAL A 1 362 ? 17.912  13.665  9.347   1.00 41.73  ? 331  VAL A N   1 
ATOM   2498 C CA  . VAL A 1 362 ? 17.067  14.867  9.310   1.00 42.16  ? 331  VAL A CA  1 
ATOM   2499 C C   . VAL A 1 362 ? 16.791  15.204  7.850   1.00 42.98  ? 331  VAL A C   1 
ATOM   2500 O O   . VAL A 1 362 ? 17.470  14.705  6.945   1.00 42.92  ? 331  VAL A O   1 
ATOM   2501 C CB  . VAL A 1 362 ? 17.720  16.074  10.037  1.00 40.92  ? 331  VAL A CB  1 
ATOM   2502 C CG1 . VAL A 1 362 ? 17.934  15.735  11.475  1.00 41.50  ? 331  VAL A CG1 1 
ATOM   2503 C CG2 . VAL A 1 362 ? 19.053  16.464  9.420   1.00 39.94  ? 331  VAL A CG2 1 
ATOM   2504 N N   . LYS A 1 363 ? 15.809  16.066  7.629   1.00 44.34  ? 332  LYS A N   1 
ATOM   2505 C CA  . LYS A 1 363 ? 15.292  16.352  6.288   1.00 45.01  ? 332  LYS A CA  1 
ATOM   2506 C C   . LYS A 1 363 ? 16.370  17.026  5.443   1.00 44.28  ? 332  LYS A C   1 
ATOM   2507 O O   . LYS A 1 363 ? 16.405  16.824  4.247   1.00 43.98  ? 332  LYS A O   1 
ATOM   2508 C CB  . LYS A 1 363 ? 14.048  17.243  6.388   1.00 45.92  ? 332  LYS A CB  1 
ATOM   2509 C CG  . LYS A 1 363 ? 13.243  17.484  5.084   1.00 48.13  ? 332  LYS A CG  1 
ATOM   2510 C CD  . LYS A 1 363 ? 11.917  18.296  5.375   1.00 52.03  ? 332  LYS A CD  1 
ATOM   2511 C CE  . LYS A 1 363 ? 11.812  19.678  4.628   1.00 55.98  ? 332  LYS A CE  1 
ATOM   2512 N NZ  . LYS A 1 363 ? 12.644  20.894  5.171   1.00 53.82  ? 332  LYS A NZ  1 
ATOM   2513 N N   . ASP A 1 364 ? 17.273  17.794  6.062   1.00 43.22  ? 333  ASP A N   1 
ATOM   2514 C CA  . ASP A 1 364 ? 18.260  18.564  5.277   1.00 42.95  ? 333  ASP A CA  1 
ATOM   2515 C C   . ASP A 1 364 ? 19.700  18.419  5.780   1.00 41.95  ? 333  ASP A C   1 
ATOM   2516 O O   . ASP A 1 364 ? 20.338  19.383  6.223   1.00 41.20  ? 333  ASP A O   1 
ATOM   2517 C CB  . ASP A 1 364 ? 17.855  20.036  5.218   1.00 43.01  ? 333  ASP A CB  1 
ATOM   2518 C CG  . ASP A 1 364 ? 16.501  20.227  4.587   1.00 44.09  ? 333  ASP A CG  1 
ATOM   2519 O OD1 . ASP A 1 364 ? 15.480  20.143  5.290   1.00 45.93  ? 333  ASP A OD1 1 
ATOM   2520 O OD2 . ASP A 1 364 ? 16.367  20.370  3.375   1.00 44.66  ? 333  ASP A OD2 1 
ATOM   2521 N N   . GLU A 1 365 ? 20.202  17.200  5.669   1.00 41.51  ? 334  GLU A N   1 
ATOM   2522 C CA  . GLU A 1 365 ? 21.516  16.863  6.178   1.00 41.38  ? 334  GLU A CA  1 
ATOM   2523 C C   . GLU A 1 365 ? 22.651  17.739  5.615   1.00 40.97  ? 334  GLU A C   1 
ATOM   2524 O O   . GLU A 1 365 ? 23.574  18.090  6.340   1.00 40.85  ? 334  GLU A O   1 
ATOM   2525 C CB  . GLU A 1 365 ? 21.816  15.393  5.873   1.00 41.97  ? 334  GLU A CB  1 
ATOM   2526 C CG  . GLU A 1 365 ? 20.975  14.385  6.650   1.00 43.26  ? 334  GLU A CG  1 
ATOM   2527 C CD  . GLU A 1 365 ? 21.395  14.281  8.095   1.00 43.30  ? 334  GLU A CD  1 
ATOM   2528 O OE1 . GLU A 1 365 ? 22.429  14.892  8.442   1.00 42.84  ? 334  GLU A OE1 1 
ATOM   2529 O OE2 . GLU A 1 365 ? 20.702  13.580  8.878   1.00 44.01  ? 334  GLU A OE2 1 
ATOM   2530 N N   . GLY A 1 366 ? 22.578  18.081  4.334   1.00 40.96  ? 335  GLY A N   1 
ATOM   2531 C CA  . GLY A 1 366 ? 23.647  18.789  3.669   1.00 41.30  ? 335  GLY A CA  1 
ATOM   2532 C C   . GLY A 1 366 ? 23.644  20.299  3.773   1.00 41.55  ? 335  GLY A C   1 
ATOM   2533 O O   . GLY A 1 366 ? 24.645  20.920  3.503   1.00 41.85  ? 335  GLY A O   1 
ATOM   2534 N N   . SER A 1 367 ? 22.522  20.898  4.149   1.00 42.09  ? 336  SER A N   1 
ATOM   2535 C CA  . SER A 1 367 ? 22.334  22.314  3.939   1.00 42.24  ? 336  SER A CA  1 
ATOM   2536 C C   . SER A 1 367 ? 23.434  23.161  4.555   1.00 42.25  ? 336  SER A C   1 
ATOM   2537 O O   . SER A 1 367 ? 23.955  24.018  3.891   1.00 43.18  ? 336  SER A O   1 
ATOM   2538 C CB  . SER A 1 367 ? 20.952  22.760  4.442   1.00 42.94  ? 336  SER A CB  1 
ATOM   2539 O OG  . SER A 1 367 ? 20.852  22.652  5.856   1.00 43.16  ? 336  SER A OG  1 
ATOM   2540 N N   . TYR A 1 368 ? 23.798  22.927  5.804   1.00 42.45  ? 337  TYR A N   1 
ATOM   2541 C CA  . TYR A 1 368 ? 24.666  23.865  6.532   1.00 42.94  ? 337  TYR A CA  1 
ATOM   2542 C C   . TYR A 1 368 ? 26.107  23.809  6.071   1.00 42.77  ? 337  TYR A C   1 
ATOM   2543 O O   . TYR A 1 368 ? 26.814  24.808  6.100   1.00 42.71  ? 337  TYR A O   1 
ATOM   2544 C CB  . TYR A 1 368 ? 24.557  23.673  8.068   1.00 43.25  ? 337  TYR A CB  1 
ATOM   2545 C CG  . TYR A 1 368 ? 25.596  22.815  8.764   1.00 43.20  ? 337  TYR A CG  1 
ATOM   2546 C CD1 . TYR A 1 368 ? 26.904  23.256  8.950   1.00 46.61  ? 337  TYR A CD1 1 
ATOM   2547 C CD2 . TYR A 1 368 ? 25.259  21.588  9.275   1.00 44.45  ? 337  TYR A CD2 1 
ATOM   2548 C CE1 . TYR A 1 368 ? 27.874  22.451  9.598   1.00 44.97  ? 337  TYR A CE1 1 
ATOM   2549 C CE2 . TYR A 1 368 ? 26.185  20.793  9.940   1.00 45.64  ? 337  TYR A CE2 1 
ATOM   2550 C CZ  . TYR A 1 368 ? 27.506  21.219  10.110  1.00 47.16  ? 337  TYR A CZ  1 
ATOM   2551 O OH  . TYR A 1 368 ? 28.414  20.377  10.795  1.00 43.92  ? 337  TYR A OH  1 
ATOM   2552 N N   . PHE A 1 369 ? 26.523  22.633  5.646   1.00 42.84  ? 338  PHE A N   1 
ATOM   2553 C CA  . PHE A 1 369 ? 27.874  22.432  5.158   1.00 43.43  ? 338  PHE A CA  1 
ATOM   2554 C C   . PHE A 1 369 ? 28.210  23.366  3.997   1.00 43.76  ? 338  PHE A C   1 
ATOM   2555 O O   . PHE A 1 369 ? 29.362  23.780  3.830   1.00 43.29  ? 338  PHE A O   1 
ATOM   2556 C CB  . PHE A 1 369 ? 28.053  20.973  4.734   1.00 44.10  ? 338  PHE A CB  1 
ATOM   2557 C CG  . PHE A 1 369 ? 28.067  20.019  5.901   1.00 44.60  ? 338  PHE A CG  1 
ATOM   2558 C CD1 . PHE A 1 369 ? 26.898  19.348  6.284   1.00 45.18  ? 338  PHE A CD1 1 
ATOM   2559 C CD2 . PHE A 1 369 ? 29.222  19.834  6.640   1.00 43.82  ? 338  PHE A CD2 1 
ATOM   2560 C CE1 . PHE A 1 369 ? 26.893  18.509  7.385   1.00 44.65  ? 338  PHE A CE1 1 
ATOM   2561 C CE2 . PHE A 1 369 ? 29.230  18.981  7.750   1.00 44.05  ? 338  PHE A CE2 1 
ATOM   2562 C CZ  . PHE A 1 369 ? 28.073  18.322  8.120   1.00 44.80  ? 338  PHE A CZ  1 
ATOM   2563 N N   . LEU A 1 370 ? 27.185  23.732  3.231   1.00 43.71  ? 339  LEU A N   1 
ATOM   2564 C CA  . LEU A 1 370 ? 27.397  24.549  2.059   1.00 44.07  ? 339  LEU A CA  1 
ATOM   2565 C C   . LEU A 1 370 ? 27.992  25.933  2.373   1.00 44.18  ? 339  LEU A C   1 
ATOM   2566 O O   . LEU A 1 370 ? 28.729  26.452  1.570   1.00 44.11  ? 339  LEU A O   1 
ATOM   2567 C CB  . LEU A 1 370 ? 26.087  24.689  1.287   1.00 44.56  ? 339  LEU A CB  1 
ATOM   2568 C CG  . LEU A 1 370 ? 25.342  23.404  0.923   1.00 44.65  ? 339  LEU A CG  1 
ATOM   2569 C CD1 . LEU A 1 370 ? 24.093  23.735  0.092   1.00 45.58  ? 339  LEU A CD1 1 
ATOM   2570 C CD2 . LEU A 1 370 ? 26.281  22.461  0.175   1.00 44.73  ? 339  LEU A CD2 1 
ATOM   2571 N N   . VAL A 1 371 ? 27.675  26.526  3.525   1.00 44.47  ? 340  VAL A N   1 
ATOM   2572 C CA  . VAL A 1 371 ? 28.190  27.861  3.859   1.00 45.25  ? 340  VAL A CA  1 
ATOM   2573 C C   . VAL A 1 371 ? 29.605  27.806  4.401   1.00 45.39  ? 340  VAL A C   1 
ATOM   2574 O O   . VAL A 1 371 ? 30.240  28.813  4.536   1.00 44.97  ? 340  VAL A O   1 
ATOM   2575 C CB  . VAL A 1 371 ? 27.300  28.649  4.842   1.00 44.84  ? 340  VAL A CB  1 
ATOM   2576 C CG1 . VAL A 1 371 ? 25.854  28.681  4.369   1.00 46.59  ? 340  VAL A CG1 1 
ATOM   2577 C CG2 . VAL A 1 371 ? 27.347  28.071  6.223   1.00 46.10  ? 340  VAL A CG2 1 
ATOM   2578 N N   . TYR A 1 372 ? 30.084  26.615  4.719   1.00 46.48  ? 341  TYR A N   1 
ATOM   2579 C CA  . TYR A 1 372 ? 31.467  26.447  5.153   1.00 47.69  ? 341  TYR A CA  1 
ATOM   2580 C C   . TYR A 1 372 ? 32.437  26.184  3.997   1.00 48.61  ? 341  TYR A C   1 
ATOM   2581 O O   . TYR A 1 372 ? 33.488  25.619  4.226   1.00 50.25  ? 341  TYR A O   1 
ATOM   2582 C CB  . TYR A 1 372 ? 31.581  25.331  6.208   1.00 47.03  ? 341  TYR A CB  1 
ATOM   2583 C CG  . TYR A 1 372 ? 31.070  25.723  7.582   1.00 48.70  ? 341  TYR A CG  1 
ATOM   2584 C CD1 . TYR A 1 372 ? 29.723  25.584  7.924   1.00 49.49  ? 341  TYR A CD1 1 
ATOM   2585 C CD2 . TYR A 1 372 ? 31.929  26.249  8.540   1.00 50.21  ? 341  TYR A CD2 1 
ATOM   2586 C CE1 . TYR A 1 372 ? 29.257  25.944  9.184   1.00 49.92  ? 341  TYR A CE1 1 
ATOM   2587 C CE2 . TYR A 1 372 ? 31.455  26.645  9.794   1.00 49.71  ? 341  TYR A CE2 1 
ATOM   2588 C CZ  . TYR A 1 372 ? 30.122  26.492  10.106  1.00 49.61  ? 341  TYR A CZ  1 
ATOM   2589 O OH  . TYR A 1 372 ? 29.666  26.848  11.359  1.00 48.87  ? 341  TYR A OH  1 
ATOM   2590 N N   . GLY A 1 373 ? 32.120  26.586  2.773   1.00 49.58  ? 342  GLY A N   1 
ATOM   2591 C CA  . GLY A 1 373 ? 33.090  26.466  1.689   1.00 49.92  ? 342  GLY A CA  1 
ATOM   2592 C C   . GLY A 1 373 ? 32.620  26.316  0.237   1.00 50.15  ? 342  GLY A C   1 
ATOM   2593 O O   . GLY A 1 373 ? 33.470  26.143  -0.637  1.00 50.95  ? 342  GLY A O   1 
ATOM   2594 N N   . VAL A 1 374 ? 31.314  26.335  -0.044  1.00 49.14  ? 343  VAL A N   1 
ATOM   2595 C CA  . VAL A 1 374 ? 30.862  26.332  -1.441  1.00 49.01  ? 343  VAL A CA  1 
ATOM   2596 C C   . VAL A 1 374 ? 30.581  27.781  -1.862  1.00 48.45  ? 343  VAL A C   1 
ATOM   2597 O O   . VAL A 1 374 ? 29.733  28.437  -1.271  1.00 47.75  ? 343  VAL A O   1 
ATOM   2598 C CB  . VAL A 1 374 ? 29.594  25.437  -1.691  1.00 48.87  ? 343  VAL A CB  1 
ATOM   2599 C CG1 . VAL A 1 374 ? 29.167  25.501  -3.166  1.00 48.93  ? 343  VAL A CG1 1 
ATOM   2600 C CG2 . VAL A 1 374 ? 29.864  24.016  -1.333  1.00 49.54  ? 343  VAL A CG2 1 
ATOM   2601 N N   . PRO A 1 375 ? 31.282  28.299  -2.860  1.00 48.57  ? 344  PRO A N   1 
ATOM   2602 C CA  . PRO A 1 375 ? 31.012  29.686  -3.292  1.00 49.43  ? 344  PRO A CA  1 
ATOM   2603 C C   . PRO A 1 375 ? 29.553  29.822  -3.719  1.00 49.37  ? 344  PRO A C   1 
ATOM   2604 O O   . PRO A 1 375 ? 29.032  28.916  -4.398  1.00 49.13  ? 344  PRO A O   1 
ATOM   2605 C CB  . PRO A 1 375 ? 31.972  29.915  -4.482  1.00 49.56  ? 344  PRO A CB  1 
ATOM   2606 C CG  . PRO A 1 375 ? 33.054  28.843  -4.327  1.00 49.33  ? 344  PRO A CG  1 
ATOM   2607 C CD  . PRO A 1 375 ? 32.362  27.677  -3.641  1.00 48.77  ? 344  PRO A CD  1 
ATOM   2608 N N   . GLY A 1 376 ? 28.924  30.911  -3.273  1.00 49.38  ? 345  GLY A N   1 
ATOM   2609 C CA  . GLY A 1 376 ? 27.545  31.236  -3.584  1.00 49.39  ? 345  GLY A CA  1 
ATOM   2610 C C   . GLY A 1 376 ? 26.587  31.033  -2.428  1.00 48.89  ? 345  GLY A C   1 
ATOM   2611 O O   . GLY A 1 376 ? 25.457  31.510  -2.493  1.00 49.22  ? 345  GLY A O   1 
ATOM   2612 N N   . PHE A 1 377 ? 27.041  30.354  -1.372  1.00 48.34  ? 346  PHE A N   1 
ATOM   2613 C CA  . PHE A 1 377 ? 26.209  30.044  -0.215  1.00 47.92  ? 346  PHE A CA  1 
ATOM   2614 C C   . PHE A 1 377 ? 26.559  30.873  0.996   1.00 48.97  ? 346  PHE A C   1 
ATOM   2615 O O   . PHE A 1 377 ? 27.725  31.039  1.329   1.00 49.75  ? 346  PHE A O   1 
ATOM   2616 C CB  . PHE A 1 377 ? 26.308  28.575  0.131   1.00 46.66  ? 346  PHE A CB  1 
ATOM   2617 C CG  . PHE A 1 377 ? 25.656  27.701  -0.870  1.00 44.50  ? 346  PHE A CG  1 
ATOM   2618 C CD1 . PHE A 1 377 ? 26.349  27.297  -1.999  1.00 42.80  ? 346  PHE A CD1 1 
ATOM   2619 C CD2 . PHE A 1 377 ? 24.342  27.304  -0.703  1.00 42.62  ? 346  PHE A CD2 1 
ATOM   2620 C CE1 . PHE A 1 377 ? 25.752  26.492  -2.944  1.00 42.45  ? 346  PHE A CE1 1 
ATOM   2621 C CE2 . PHE A 1 377 ? 23.729  26.518  -1.635  1.00 43.34  ? 346  PHE A CE2 1 
ATOM   2622 C CZ  . PHE A 1 377 ? 24.434  26.111  -2.776  1.00 44.01  ? 346  PHE A CZ  1 
ATOM   2623 N N   . SER A 1 378 ? 25.521  31.386  1.650   1.00 49.75  ? 347  SER A N   1 
ATOM   2624 C CA  . SER A 1 378 ? 25.644  32.187  2.864   1.00 50.26  ? 347  SER A CA  1 
ATOM   2625 C C   . SER A 1 378 ? 24.411  32.001  3.751   1.00 50.42  ? 347  SER A C   1 
ATOM   2626 O O   . SER A 1 378 ? 23.322  31.712  3.244   1.00 51.70  ? 347  SER A O   1 
ATOM   2627 C CB  . SER A 1 378 ? 25.763  33.667  2.485   1.00 50.96  ? 347  SER A CB  1 
ATOM   2628 O OG  . SER A 1 378 ? 25.611  34.480  3.617   1.00 50.65  ? 347  SER A OG  1 
ATOM   2629 N N   . LYS A 1 379 ? 24.561  32.197  5.058   1.00 50.14  ? 348  LYS A N   1 
ATOM   2630 C CA  . LYS A 1 379 ? 23.413  32.165  5.969   1.00 50.11  ? 348  LYS A CA  1 
ATOM   2631 C C   . LYS A 1 379 ? 22.585  33.436  5.882   1.00 50.78  ? 348  LYS A C   1 
ATOM   2632 O O   . LYS A 1 379 ? 21.446  33.422  6.305   1.00 50.24  ? 348  LYS A O   1 
ATOM   2633 C CB  . LYS A 1 379 ? 23.843  31.936  7.436   1.00 49.42  ? 348  LYS A CB  1 
ATOM   2634 C CG  . LYS A 1 379 ? 24.325  33.180  8.179   1.00 50.46  ? 348  LYS A CG  1 
ATOM   2635 C CD  . LYS A 1 379 ? 24.479  32.962  9.668   1.00 50.92  ? 348  LYS A CD  1 
ATOM   2636 C CE  . LYS A 1 379 ? 24.749  34.251  10.423  1.00 51.44  ? 348  LYS A CE  1 
ATOM   2637 N NZ  . LYS A 1 379 ? 23.477  35.045  10.604  1.00 52.72  ? 348  LYS A NZ  1 
ATOM   2638 N N   . ASP A 1 380 ? 23.177  34.519  5.354   1.00 52.16  ? 349  ASP A N   1 
ATOM   2639 C CA  . ASP A 1 380 ? 22.571  35.885  5.350   1.00 53.82  ? 349  ASP A CA  1 
ATOM   2640 C C   . ASP A 1 380 ? 21.795  36.295  4.077   1.00 54.75  ? 349  ASP A C   1 
ATOM   2641 O O   . ASP A 1 380 ? 21.319  37.423  3.988   1.00 55.73  ? 349  ASP A O   1 
ATOM   2642 C CB  . ASP A 1 380 ? 23.655  36.943  5.641   1.00 54.09  ? 349  ASP A CB  1 
ATOM   2643 C CG  . ASP A 1 380 ? 24.257  36.799  7.033   1.00 54.72  ? 349  ASP A CG  1 
ATOM   2644 O OD1 . ASP A 1 380 ? 23.504  36.435  7.969   1.00 53.50  ? 349  ASP A OD1 1 
ATOM   2645 O OD2 . ASP A 1 380 ? 25.475  36.991  7.279   1.00 56.33  ? 349  ASP A OD2 1 
ATOM   2646 N N   . ASN A 1 381 ? 21.722  35.396  3.093   1.00 55.06  ? 350  ASN A N   1 
ATOM   2647 C CA  . ASN A 1 381 ? 20.867  35.542  1.917   1.00 55.95  ? 350  ASN A CA  1 
ATOM   2648 C C   . ASN A 1 381 ? 20.269  34.188  1.523   1.00 54.57  ? 350  ASN A C   1 
ATOM   2649 O O   . ASN A 1 381 ? 20.493  33.184  2.199   1.00 53.59  ? 350  ASN A O   1 
ATOM   2650 C CB  . ASN A 1 381 ? 21.574  36.276  0.732   1.00 57.22  ? 350  ASN A CB  1 
ATOM   2651 C CG  . ASN A 1 381 ? 22.750  35.508  0.133   1.00 62.03  ? 350  ASN A CG  1 
ATOM   2652 O OD1 . ASN A 1 381 ? 22.692  34.290  -0.040  1.00 63.82  ? 350  ASN A OD1 1 
ATOM   2653 N ND2 . ASN A 1 381 ? 23.828  36.245  -0.205  1.00 73.72  ? 350  ASN A ND2 1 
ATOM   2654 N N   . GLU A 1 382 ? 19.495  34.180  0.443   1.00 54.31  ? 351  GLU A N   1 
ATOM   2655 C CA  . GLU A 1 382 ? 18.762  32.994  -0.013  1.00 53.96  ? 351  GLU A CA  1 
ATOM   2656 C C   . GLU A 1 382 ? 19.603  31.958  -0.753  1.00 51.46  ? 351  GLU A C   1 
ATOM   2657 O O   . GLU A 1 382 ? 19.118  30.887  -1.064  1.00 50.44  ? 351  GLU A O   1 
ATOM   2658 C CB  . GLU A 1 382 ? 17.575  33.415  -0.910  1.00 55.54  ? 351  GLU A CB  1 
ATOM   2659 C CG  . GLU A 1 382 ? 16.394  34.040  -0.177  1.00 60.98  ? 351  GLU A CG  1 
ATOM   2660 C CD  . GLU A 1 382 ? 16.062  33.293  1.097   1.00 67.60  ? 351  GLU A CD  1 
ATOM   2661 O OE1 . GLU A 1 382 ? 15.197  32.354  1.071   1.00 74.61  ? 351  GLU A OE1 1 
ATOM   2662 O OE2 . GLU A 1 382 ? 16.703  33.625  2.127   1.00 71.43  ? 351  GLU A OE2 1 
ATOM   2663 N N   . SER A 1 383 ? 20.844  32.300  -1.052  1.00 50.08  ? 352  SER A N   1 
ATOM   2664 C CA  . SER A 1 383 ? 21.801  31.384  -1.664  1.00 49.48  ? 352  SER A CA  1 
ATOM   2665 C C   . SER A 1 383 ? 21.307  30.769  -2.985  1.00 49.83  ? 352  SER A C   1 
ATOM   2666 O O   . SER A 1 383 ? 21.577  29.610  -3.295  1.00 49.42  ? 352  SER A O   1 
ATOM   2667 C CB  . SER A 1 383 ? 22.233  30.274  -0.676  1.00 48.56  ? 352  SER A CB  1 
ATOM   2668 O OG  . SER A 1 383 ? 22.920  30.802  0.442   1.00 46.87  ? 352  SER A OG  1 
ATOM   2669 N N   . LEU A 1 384 ? 20.604  31.570  -3.774  1.00 50.68  ? 353  LEU A N   1 
ATOM   2670 C CA  . LEU A 1 384 ? 20.191  31.164  -5.101  1.00 50.94  ? 353  LEU A CA  1 
ATOM   2671 C C   . LEU A 1 384 ? 21.453  31.149  -5.955  1.00 50.49  ? 353  LEU A C   1 
ATOM   2672 O O   . LEU A 1 384 ? 22.146  32.150  -6.028  1.00 52.20  ? 353  LEU A O   1 
ATOM   2673 C CB  . LEU A 1 384 ? 19.163  32.140  -5.639  1.00 51.30  ? 353  LEU A CB  1 
ATOM   2674 C CG  . LEU A 1 384 ? 17.875  32.213  -4.818  1.00 52.14  ? 353  LEU A CG  1 
ATOM   2675 C CD1 . LEU A 1 384 ? 16.917  33.100  -5.575  1.00 54.22  ? 353  LEU A CD1 1 
ATOM   2676 C CD2 . LEU A 1 384 ? 17.235  30.881  -4.579  1.00 51.29  ? 353  LEU A CD2 1 
ATOM   2677 N N   . ILE A 1 385 ? 21.764  30.013  -6.557  1.00 49.40  ? 354  ILE A N   1 
ATOM   2678 C CA  . ILE A 1 385 ? 22.986  29.838  -7.304  1.00 48.71  ? 354  ILE A CA  1 
ATOM   2679 C C   . ILE A 1 385 ? 22.740  29.528  -8.769  1.00 49.28  ? 354  ILE A C   1 
ATOM   2680 O O   . ILE A 1 385 ? 21.673  29.089  -9.162  1.00 48.39  ? 354  ILE A O   1 
ATOM   2681 C CB  . ILE A 1 385 ? 23.854  28.709  -6.688  1.00 47.58  ? 354  ILE A CB  1 
ATOM   2682 C CG1 . ILE A 1 385 ? 23.070  27.396  -6.540  1.00 45.54  ? 354  ILE A CG1 1 
ATOM   2683 C CG2 . ILE A 1 385 ? 24.409  29.144  -5.353  1.00 47.60  ? 354  ILE A CG2 1 
ATOM   2684 C CD1 . ILE A 1 385 ? 23.937  26.156  -6.648  1.00 45.29  ? 354  ILE A CD1 1 
ATOM   2685 N N   . SER A 1 386 ? 23.779  29.757  -9.561  1.00 50.16  ? 355  SER A N   1 
ATOM   2686 C CA  . SER A 1 386 ? 23.809  29.448  -10.985 1.00 51.32  ? 355  SER A CA  1 
ATOM   2687 C C   . SER A 1 386 ? 24.217  27.992  -11.236 1.00 51.61  ? 355  SER A C   1 
ATOM   2688 O O   . SER A 1 386 ? 24.785  27.308  -10.372 1.00 50.58  ? 355  SER A O   1 
ATOM   2689 C CB  . SER A 1 386 ? 24.838  30.331  -11.678 1.00 51.38  ? 355  SER A CB  1 
ATOM   2690 O OG  . SER A 1 386 ? 26.183  29.949  -11.310 1.00 50.50  ? 355  SER A OG  1 
ATOM   2691 N N   . ARG A 1 387 ? 23.959  27.546  -12.449 1.00 52.77  ? 356  ARG A N   1 
ATOM   2692 C CA  . ARG A 1 387 ? 24.399  26.246  -12.897 1.00 53.67  ? 356  ARG A CA  1 
ATOM   2693 C C   . ARG A 1 387 ? 25.902  26.063  -12.758 1.00 52.93  ? 356  ARG A C   1 
ATOM   2694 O O   . ARG A 1 387 ? 26.375  25.003  -12.318 1.00 51.99  ? 356  ARG A O   1 
ATOM   2695 C CB  . ARG A 1 387 ? 24.001  26.047  -14.346 1.00 55.71  ? 356  ARG A CB  1 
ATOM   2696 C CG  . ARG A 1 387 ? 24.349  24.680  -14.897 1.00 58.93  ? 356  ARG A CG  1 
ATOM   2697 C CD  . ARG A 1 387 ? 23.225  24.034  -15.707 1.00 62.13  ? 356  ARG A CD  1 
ATOM   2698 N NE  . ARG A 1 387 ? 23.541  22.620  -15.847 1.00 64.08  ? 356  ARG A NE  1 
ATOM   2699 C CZ  . ARG A 1 387 ? 22.982  21.622  -15.172 1.00 63.65  ? 356  ARG A CZ  1 
ATOM   2700 N NH1 . ARG A 1 387 ? 21.997  21.836  -14.296 1.00 62.99  ? 356  ARG A NH1 1 
ATOM   2701 N NH2 . ARG A 1 387 ? 23.401  20.384  -15.423 1.00 64.21  ? 356  ARG A NH2 1 
ATOM   2702 N N   . ALA A 1 388 ? 26.668  27.082  -13.124 1.00 52.93  ? 357  ALA A N   1 
ATOM   2703 C CA  . ALA A 1 388 ? 28.132  26.970  -12.996 1.00 52.58  ? 357  ALA A CA  1 
ATOM   2704 C C   . ALA A 1 388 ? 28.537  26.774  -11.528 1.00 50.99  ? 357  ALA A C   1 
ATOM   2705 O O   . ALA A 1 388 ? 29.436  26.000  -11.216 1.00 50.58  ? 357  ALA A O   1 
ATOM   2706 C CB  . ALA A 1 388 ? 28.870  28.191  -13.607 1.00 53.06  ? 357  ALA A CB  1 
ATOM   2707 N N   . GLN A 1 389 ? 27.872  27.490  -10.634 1.00 50.37  ? 358  GLN A N   1 
ATOM   2708 C CA  . GLN A 1 389 ? 28.175  27.402  -9.221  1.00 49.55  ? 358  GLN A CA  1 
ATOM   2709 C C   . GLN A 1 389 ? 27.781  26.021  -8.692  1.00 48.86  ? 358  GLN A C   1 
ATOM   2710 O O   . GLN A 1 389 ? 28.441  25.512  -7.802  1.00 47.68  ? 358  GLN A O   1 
ATOM   2711 C CB  . GLN A 1 389 ? 27.472  28.513  -8.423  1.00 49.82  ? 358  GLN A CB  1 
ATOM   2712 C CG  . GLN A 1 389 ? 28.063  29.940  -8.589  1.00 51.15  ? 358  GLN A CG  1 
ATOM   2713 C CD  . GLN A 1 389 ? 27.189  31.007  -7.930  1.00 52.49  ? 358  GLN A CD  1 
ATOM   2714 O OE1 . GLN A 1 389 ? 25.969  30.997  -8.084  1.00 55.58  ? 358  GLN A OE1 1 
ATOM   2715 N NE2 . GLN A 1 389 ? 27.797  31.889  -7.172  1.00 49.62  ? 358  GLN A NE2 1 
ATOM   2716 N N   . PHE A 1 390 ? 26.732  25.419  -9.264  1.00 48.61  ? 359  PHE A N   1 
ATOM   2717 C CA  . PHE A 1 390 ? 26.329  24.066  -8.928  1.00 47.88  ? 359  PHE A CA  1 
ATOM   2718 C C   . PHE A 1 390 ? 27.361  23.033  -9.363  1.00 48.04  ? 359  PHE A C   1 
ATOM   2719 O O   . PHE A 1 390 ? 27.684  22.179  -8.572  1.00 46.70  ? 359  PHE A O   1 
ATOM   2720 C CB  . PHE A 1 390 ? 24.927  23.754  -9.514  1.00 48.44  ? 359  PHE A CB  1 
ATOM   2721 C CG  . PHE A 1 390 ? 24.478  22.326  -9.327  1.00 46.45  ? 359  PHE A CG  1 
ATOM   2722 C CD1 . PHE A 1 390 ? 24.256  21.515  -10.404 1.00 46.05  ? 359  PHE A CD1 1 
ATOM   2723 C CD2 . PHE A 1 390 ? 24.300  21.799  -8.066  1.00 47.49  ? 359  PHE A CD2 1 
ATOM   2724 C CE1 . PHE A 1 390 ? 23.836  20.216  -10.229 1.00 47.01  ? 359  PHE A CE1 1 
ATOM   2725 C CE2 . PHE A 1 390 ? 23.910  20.483  -7.891  1.00 46.61  ? 359  PHE A CE2 1 
ATOM   2726 C CZ  . PHE A 1 390 ? 23.665  19.706  -8.977  1.00 46.98  ? 359  PHE A CZ  1 
ATOM   2727 N N   . LEU A 1 391 ? 27.890  23.110  -10.590 1.00 49.52  ? 360  LEU A N   1 
ATOM   2728 C CA  . LEU A 1 391 ? 28.937  22.163  -11.029 1.00 50.94  ? 360  LEU A CA  1 
ATOM   2729 C C   . LEU A 1 391 ? 30.176  22.263  -10.177 1.00 49.98  ? 360  LEU A C   1 
ATOM   2730 O O   . LEU A 1 391 ? 30.815  21.251  -9.916  1.00 50.37  ? 360  LEU A O   1 
ATOM   2731 C CB  . LEU A 1 391 ? 29.392  22.331  -12.488 1.00 52.62  ? 360  LEU A CB  1 
ATOM   2732 C CG  . LEU A 1 391 ? 28.380  22.447  -13.653 1.00 58.46  ? 360  LEU A CG  1 
ATOM   2733 C CD1 . LEU A 1 391 ? 29.036  22.213  -15.065 1.00 61.32  ? 360  LEU A CD1 1 
ATOM   2734 C CD2 . LEU A 1 391 ? 27.138  21.563  -13.492 1.00 59.22  ? 360  LEU A CD2 1 
ATOM   2735 N N   . ALA A 1 392 ? 30.526  23.484  -9.776  1.00 49.37  ? 361  ALA A N   1 
ATOM   2736 C CA  . ALA A 1 392 ? 31.708  23.751  -8.930  1.00 48.56  ? 361  ALA A CA  1 
ATOM   2737 C C   . ALA A 1 392 ? 31.477  23.295  -7.488  1.00 47.77  ? 361  ALA A C   1 
ATOM   2738 O O   . ALA A 1 392 ? 32.392  22.797  -6.805  1.00 47.03  ? 361  ALA A O   1 
ATOM   2739 C CB  . ALA A 1 392 ? 32.089  25.259  -8.968  1.00 47.92  ? 361  ALA A CB  1 
ATOM   2740 N N   . GLY A 1 393 ? 30.236  23.436  -7.031  1.00 47.32  ? 362  GLY A N   1 
ATOM   2741 C CA  . GLY A 1 393 ? 29.850  22.904  -5.740  1.00 46.67  ? 362  GLY A CA  1 
ATOM   2742 C C   . GLY A 1 393 ? 29.951  21.385  -5.654  1.00 46.59  ? 362  GLY A C   1 
ATOM   2743 O O   . GLY A 1 393 ? 30.294  20.847  -4.617  1.00 46.01  ? 362  GLY A O   1 
ATOM   2744 N N   . VAL A 1 394 ? 29.646  20.699  -6.742  1.00 47.29  ? 363  VAL A N   1 
ATOM   2745 C CA  . VAL A 1 394 ? 29.681  19.254  -6.768  1.00 47.92  ? 363  VAL A CA  1 
ATOM   2746 C C   . VAL A 1 394 ? 31.109  18.725  -6.693  1.00 49.38  ? 363  VAL A C   1 
ATOM   2747 O O   . VAL A 1 394 ? 31.339  17.685  -6.082  1.00 49.31  ? 363  VAL A O   1 
ATOM   2748 C CB  . VAL A 1 394 ? 28.974  18.717  -8.036  1.00 48.46  ? 363  VAL A CB  1 
ATOM   2749 C CG1 . VAL A 1 394 ? 29.310  17.285  -8.306  1.00 48.64  ? 363  VAL A CG1 1 
ATOM   2750 C CG2 . VAL A 1 394 ? 27.451  18.875  -7.914  1.00 46.85  ? 363  VAL A CG2 1 
ATOM   2751 N N   . ARG A 1 395 ? 32.065  19.407  -7.318  1.00 50.74  ? 364  ARG A N   1 
ATOM   2752 C CA  . ARG A 1 395 ? 33.475  19.009  -7.206  1.00 52.12  ? 364  ARG A CA  1 
ATOM   2753 C C   . ARG A 1 395 ? 33.977  19.117  -5.782  1.00 51.98  ? 364  ARG A C   1 
ATOM   2754 O O   . ARG A 1 395 ? 34.787  18.325  -5.353  1.00 52.14  ? 364  ARG A O   1 
ATOM   2755 C CB  . ARG A 1 395 ? 34.386  19.870  -8.075  1.00 53.02  ? 364  ARG A CB  1 
ATOM   2756 C CG  . ARG A 1 395 ? 34.075  19.855  -9.585  1.00 55.97  ? 364  ARG A CG  1 
ATOM   2757 C CD  . ARG A 1 395 ? 33.580  18.530  -10.113 1.00 59.52  ? 364  ARG A CD  1 
ATOM   2758 N NE  . ARG A 1 395 ? 34.626  17.507  -10.102 1.00 63.57  ? 364  ARG A NE  1 
ATOM   2759 C CZ  . ARG A 1 395 ? 35.468  17.281  -11.124 1.00 65.72  ? 364  ARG A CZ  1 
ATOM   2760 N NH1 . ARG A 1 395 ? 35.371  17.975  -12.266 1.00 64.46  ? 364  ARG A NH1 1 
ATOM   2761 N NH2 . ARG A 1 395 ? 36.381  16.319  -11.008 1.00 64.73  ? 364  ARG A NH2 1 
ATOM   2762 N N   . ILE A 1 396 ? 33.477  20.101  -5.056  1.00 52.35  ? 365  ILE A N   1 
ATOM   2763 C CA  . ILE A 1 396 ? 33.860  20.332  -3.669  1.00 52.25  ? 365  ILE A CA  1 
ATOM   2764 C C   . ILE A 1 396 ? 33.120  19.395  -2.709  1.00 51.51  ? 365  ILE A C   1 
ATOM   2765 O O   . ILE A 1 396 ? 33.677  18.924  -1.733  1.00 51.14  ? 365  ILE A O   1 
ATOM   2766 C CB  . ILE A 1 396 ? 33.587  21.809  -3.322  1.00 52.17  ? 365  ILE A CB  1 
ATOM   2767 C CG1 . ILE A 1 396 ? 34.624  22.672  -4.030  1.00 53.29  ? 365  ILE A CG1 1 
ATOM   2768 C CG2 . ILE A 1 396 ? 33.665  22.080  -1.797  1.00 52.99  ? 365  ILE A CG2 1 
ATOM   2769 C CD1 . ILE A 1 396 ? 34.215  24.137  -4.126  1.00 53.87  ? 365  ILE A CD1 1 
ATOM   2770 N N   . GLY A 1 397 ? 31.846  19.158  -2.985  1.00 51.72  ? 366  GLY A N   1 
ATOM   2771 C CA  . GLY A 1 397 ? 31.008  18.310  -2.159  1.00 51.26  ? 366  GLY A CA  1 
ATOM   2772 C C   . GLY A 1 397 ? 31.263  16.840  -2.421  1.00 51.30  ? 366  GLY A C   1 
ATOM   2773 O O   . GLY A 1 397 ? 30.893  16.001  -1.605  1.00 52.11  ? 366  GLY A O   1 
ATOM   2774 N N   . VAL A 1 398 ? 31.885  16.516  -3.545  1.00 51.27  ? 367  VAL A N   1 
ATOM   2775 C CA  . VAL A 1 398 ? 32.178  15.137  -3.897  1.00 51.73  ? 367  VAL A CA  1 
ATOM   2776 C C   . VAL A 1 398 ? 33.634  15.112  -4.337  1.00 52.83  ? 367  VAL A C   1 
ATOM   2777 O O   . VAL A 1 398 ? 33.943  14.804  -5.474  1.00 53.03  ? 367  VAL A O   1 
ATOM   2778 C CB  . VAL A 1 398 ? 31.221  14.629  -5.020  1.00 52.18  ? 367  VAL A CB  1 
ATOM   2779 C CG1 . VAL A 1 398 ? 31.265  13.121  -5.108  1.00 52.37  ? 367  VAL A CG1 1 
ATOM   2780 C CG2 . VAL A 1 398 ? 29.783  15.099  -4.768  1.00 51.28  ? 367  VAL A CG2 1 
ATOM   2781 N N   . PRO A 1 399 ? 34.535  15.469  -3.416  1.00 54.16  ? 368  PRO A N   1 
ATOM   2782 C CA  . PRO A 1 399 ? 35.928  15.772  -3.765  1.00 54.96  ? 368  PRO A CA  1 
ATOM   2783 C C   . PRO A 1 399 ? 36.714  14.609  -4.306  1.00 56.67  ? 368  PRO A C   1 
ATOM   2784 O O   . PRO A 1 399 ? 37.679  14.833  -5.027  1.00 57.18  ? 368  PRO A O   1 
ATOM   2785 C CB  . PRO A 1 399 ? 36.527  16.259  -2.451  1.00 54.14  ? 368  PRO A CB  1 
ATOM   2786 C CG  . PRO A 1 399 ? 35.676  15.723  -1.403  1.00 54.03  ? 368  PRO A CG  1 
ATOM   2787 C CD  . PRO A 1 399 ? 34.291  15.621  -1.964  1.00 53.55  ? 368  PRO A CD  1 
ATOM   2788 N N   . GLN A 1 400 ? 36.295  13.391  -3.993  1.00 58.55  ? 369  GLN A N   1 
ATOM   2789 C CA  . GLN A 1 400 ? 37.010  12.178  -4.460  1.00 60.71  ? 369  GLN A CA  1 
ATOM   2790 C C   . GLN A 1 400 ? 36.573  11.747  -5.863  1.00 62.13  ? 369  GLN A C   1 
ATOM   2791 O O   . GLN A 1 400 ? 37.152  10.828  -6.424  1.00 63.65  ? 369  GLN A O   1 
ATOM   2792 C CB  . GLN A 1 400 ? 36.841  11.000  -3.463  1.00 60.63  ? 369  GLN A CB  1 
ATOM   2793 C CG  . GLN A 1 400 ? 37.884  10.949  -2.272  1.00 61.99  ? 369  GLN A CG  1 
ATOM   2794 C CD  . GLN A 1 400 ? 37.732  12.099  -1.215  1.00 62.81  ? 369  GLN A CD  1 
ATOM   2795 O OE1 . GLN A 1 400 ? 36.836  12.068  -0.313  1.00 59.88  ? 369  GLN A OE1 1 
ATOM   2796 N NE2 . GLN A 1 400 ? 38.610  13.106  -1.332  1.00 60.51  ? 369  GLN A NE2 1 
ATOM   2797 N N   . ALA A 1 401 ? 35.574  12.420  -6.432  1.00 62.40  ? 370  ALA A N   1 
ATOM   2798 C CA  . ALA A 1 401 ? 34.974  12.007  -7.695  1.00 63.33  ? 370  ALA A CA  1 
ATOM   2799 C C   . ALA A 1 401 ? 35.712  12.521  -8.921  1.00 63.91  ? 370  ALA A C   1 
ATOM   2800 O O   . ALA A 1 401 ? 36.064  13.697  -9.015  1.00 63.57  ? 370  ALA A O   1 
ATOM   2801 C CB  . ALA A 1 401 ? 33.521  12.464  -7.768  1.00 63.40  ? 370  ALA A CB  1 
ATOM   2802 N N   . SER A 1 402 ? 35.859  11.628  -9.887  1.00 64.79  ? 371  SER A N   1 
ATOM   2803 C CA  . SER A 1 402 ? 36.433  11.951  -11.169 1.00 65.88  ? 371  SER A CA  1 
ATOM   2804 C C   . SER A 1 402 ? 35.543  12.916  -11.943 1.00 65.64  ? 371  SER A C   1 
ATOM   2805 O O   . SER A 1 402 ? 34.514  13.361  -11.450 1.00 65.24  ? 371  SER A O   1 
ATOM   2806 C CB  . SER A 1 402 ? 36.625  10.656  -11.953 1.00 67.25  ? 371  SER A CB  1 
ATOM   2807 O OG  . SER A 1 402 ? 35.372  10.101  -12.345 1.00 68.56  ? 371  SER A OG  1 
ATOM   2808 N N   . ASP A 1 403 ? 35.966  13.265  -13.148 1.00 66.26  ? 372  ASP A N   1 
ATOM   2809 C CA  . ASP A 1 403 ? 35.194  14.148  -14.003 1.00 66.32  ? 372  ASP A CA  1 
ATOM   2810 C C   . ASP A 1 403 ? 33.874  13.485  -14.418 1.00 65.75  ? 372  ASP A C   1 
ATOM   2811 O O   . ASP A 1 403 ? 32.787  14.099  -14.359 1.00 64.91  ? 372  ASP A O   1 
ATOM   2812 C CB  . ASP A 1 403 ? 36.025  14.520  -15.232 1.00 67.82  ? 372  ASP A CB  1 
ATOM   2813 C CG  . ASP A 1 403 ? 36.906  15.725  -14.987 1.00 70.07  ? 372  ASP A CG  1 
ATOM   2814 O OD1 . ASP A 1 403 ? 37.399  15.882  -13.851 1.00 71.20  ? 372  ASP A OD1 1 
ATOM   2815 O OD2 . ASP A 1 403 ? 37.144  16.575  -15.873 1.00 74.75  ? 372  ASP A OD2 1 
ATOM   2816 N N   . LEU A 1 404 ? 34.004  12.229  -14.845 1.00 65.36  ? 373  LEU A N   1 
ATOM   2817 C CA  . LEU A 1 404 ? 32.882  11.419  -15.293 1.00 64.90  ? 373  LEU A CA  1 
ATOM   2818 C C   . LEU A 1 404 ? 31.848  11.235  -14.173 1.00 62.92  ? 373  LEU A C   1 
ATOM   2819 O O   . LEU A 1 404 ? 30.658  11.417  -14.384 1.00 62.97  ? 373  LEU A O   1 
ATOM   2820 C CB  . LEU A 1 404 ? 33.412  10.061  -15.791 1.00 65.67  ? 373  LEU A CB  1 
ATOM   2821 C CG  . LEU A 1 404 ? 32.392  9.086   -16.378 1.00 66.99  ? 373  LEU A CG  1 
ATOM   2822 C CD1 . LEU A 1 404 ? 31.606  9.737   -17.536 1.00 68.26  ? 373  LEU A CD1 1 
ATOM   2823 C CD2 . LEU A 1 404 ? 33.057  7.795   -16.829 1.00 67.50  ? 373  LEU A CD2 1 
ATOM   2824 N N   . ALA A 1 405 ? 32.326  10.906  -12.986 1.00 61.28  ? 374  ALA A N   1 
ATOM   2825 C CA  . ALA A 1 405 ? 31.477  10.697  -11.811 1.00 59.95  ? 374  ALA A CA  1 
ATOM   2826 C C   . ALA A 1 405 ? 30.751  11.967  -11.368 1.00 58.38  ? 374  ALA A C   1 
ATOM   2827 O O   . ALA A 1 405 ? 29.614  11.907  -10.952 1.00 57.79  ? 374  ALA A O   1 
ATOM   2828 C CB  . ALA A 1 405 ? 32.309  10.127  -10.657 1.00 59.22  ? 374  ALA A CB  1 
ATOM   2829 N N   . ALA A 1 406 ? 31.401  13.111  -11.494 1.00 57.64  ? 375  ALA A N   1 
ATOM   2830 C CA  . ALA A 1 406 ? 30.789  14.383  -11.131 1.00 57.00  ? 375  ALA A CA  1 
ATOM   2831 C C   . ALA A 1 406 ? 29.743  14.805  -12.155 1.00 57.48  ? 375  ALA A C   1 
ATOM   2832 O O   . ALA A 1 406 ? 28.801  15.541  -11.827 1.00 57.40  ? 375  ALA A O   1 
ATOM   2833 C CB  . ALA A 1 406 ? 31.858  15.479  -11.009 1.00 56.82  ? 375  ALA A CB  1 
ATOM   2834 N N   . GLU A 1 407 ? 29.928  14.390  -13.405 1.00 57.96  ? 376  GLU A N   1 
ATOM   2835 C CA  . GLU A 1 407 ? 28.956  14.715  -14.438 1.00 58.42  ? 376  GLU A CA  1 
ATOM   2836 C C   . GLU A 1 407 ? 27.762  13.808  -14.201 1.00 56.31  ? 376  GLU A C   1 
ATOM   2837 O O   . GLU A 1 407 ? 26.646  14.235  -14.362 1.00 55.64  ? 376  GLU A O   1 
ATOM   2838 C CB  . GLU A 1 407 ? 29.551  14.609  -15.858 1.00 60.24  ? 376  GLU A CB  1 
ATOM   2839 C CG  . GLU A 1 407 ? 28.787  15.331  -16.996 1.00 65.82  ? 376  GLU A CG  1 
ATOM   2840 C CD  . GLU A 1 407 ? 28.193  16.734  -16.673 1.00 71.13  ? 376  GLU A CD  1 
ATOM   2841 O OE1 . GLU A 1 407 ? 28.912  17.639  -16.151 1.00 73.76  ? 376  GLU A OE1 1 
ATOM   2842 O OE2 . GLU A 1 407 ? 26.982  16.955  -16.986 1.00 74.35  ? 376  GLU A OE2 1 
ATOM   2843 N N   . ALA A 1 408 ? 28.001  12.584  -13.742 1.00 54.71  ? 377  ALA A N   1 
ATOM   2844 C CA  . ALA A 1 408 ? 26.907  11.702  -13.350 1.00 53.84  ? 377  ALA A CA  1 
ATOM   2845 C C   . ALA A 1 408 ? 26.066  12.304  -12.214 1.00 52.17  ? 377  ALA A C   1 
ATOM   2846 O O   . ALA A 1 408 ? 24.837  12.302  -12.295 1.00 51.89  ? 377  ALA A O   1 
ATOM   2847 C CB  . ALA A 1 408 ? 27.431  10.363  -12.962 1.00 53.84  ? 377  ALA A CB  1 
ATOM   2848 N N   . VAL A 1 409 ? 26.730  12.872  -11.207 1.00 50.34  ? 378  VAL A N   1 
ATOM   2849 C CA  . VAL A 1 409 ? 26.036  13.493  -10.080 1.00 49.20  ? 378  VAL A CA  1 
ATOM   2850 C C   . VAL A 1 409 ? 25.191  14.658  -10.595 1.00 48.94  ? 378  VAL A C   1 
ATOM   2851 O O   . VAL A 1 409 ? 24.003  14.771  -10.289 1.00 48.46  ? 378  VAL A O   1 
ATOM   2852 C CB  . VAL A 1 409 ? 27.044  13.985  -8.995  1.00 48.29  ? 378  VAL A CB  1 
ATOM   2853 C CG1 . VAL A 1 409 ? 26.358  14.807  -7.946  1.00 47.80  ? 378  VAL A CG1 1 
ATOM   2854 C CG2 . VAL A 1 409 ? 27.749  12.804  -8.338  1.00 47.72  ? 378  VAL A CG2 1 
ATOM   2855 N N   . VAL A 1 410 ? 25.810  15.504  -11.410 1.00 48.77  ? 379  VAL A N   1 
ATOM   2856 C CA  . VAL A 1 410 ? 25.149  16.692  -11.918 1.00 49.01  ? 379  VAL A CA  1 
ATOM   2857 C C   . VAL A 1 410 ? 23.924  16.310  -12.738 1.00 49.72  ? 379  VAL A C   1 
ATOM   2858 O O   . VAL A 1 410 ? 22.857  16.870  -12.567 1.00 48.79  ? 379  VAL A O   1 
ATOM   2859 C CB  . VAL A 1 410 ? 26.110  17.547  -12.766 1.00 49.34  ? 379  VAL A CB  1 
ATOM   2860 C CG1 . VAL A 1 410 ? 25.327  18.556  -13.607 1.00 49.32  ? 379  VAL A CG1 1 
ATOM   2861 C CG2 . VAL A 1 410 ? 27.106  18.274  -11.861 1.00 48.72  ? 379  VAL A CG2 1 
ATOM   2862 N N   . LEU A 1 411 ? 24.097  15.330  -13.608 1.00 50.87  ? 380  LEU A N   1 
ATOM   2863 C CA  . LEU A 1 411 ? 23.025  14.877  -14.461 1.00 52.61  ? 380  LEU A CA  1 
ATOM   2864 C C   . LEU A 1 411 ? 21.875  14.215  -13.670 1.00 52.06  ? 380  LEU A C   1 
ATOM   2865 O O   . LEU A 1 411 ? 20.728  14.351  -14.039 1.00 52.70  ? 380  LEU A O   1 
ATOM   2866 C CB  . LEU A 1 411 ? 23.584  13.938  -15.540 1.00 54.20  ? 380  LEU A CB  1 
ATOM   2867 C CG  . LEU A 1 411 ? 24.578  14.572  -16.510 1.00 57.01  ? 380  LEU A CG  1 
ATOM   2868 C CD1 . LEU A 1 411 ? 25.149  13.510  -17.403 1.00 60.26  ? 380  LEU A CD1 1 
ATOM   2869 C CD2 . LEU A 1 411 ? 23.948  15.672  -17.370 1.00 60.46  ? 380  LEU A CD2 1 
ATOM   2870 N N   . HIS A 1 412 ? 22.192  13.531  -12.581 1.00 51.40  ? 381  HIS A N   1 
ATOM   2871 C CA  . HIS A 1 412 ? 21.188  12.891  -11.739 1.00 51.20  ? 381  HIS A CA  1 
ATOM   2872 C C   . HIS A 1 412 ? 20.361  13.890  -10.942 1.00 50.38  ? 381  HIS A C   1 
ATOM   2873 O O   . HIS A 1 412 ? 19.180  13.707  -10.745 1.00 50.50  ? 381  HIS A O   1 
ATOM   2874 C CB  . HIS A 1 412 ? 21.869  11.917  -10.767 1.00 51.11  ? 381  HIS A CB  1 
ATOM   2875 C CG  . HIS A 1 412 ? 20.908  11.165  -9.910  1.00 51.28  ? 381  HIS A CG  1 
ATOM   2876 N ND1 . HIS A 1 412 ? 20.136  10.133  -10.391 1.00 54.35  ? 381  HIS A ND1 1 
ATOM   2877 C CD2 . HIS A 1 412 ? 20.541  11.339  -8.621  1.00 51.80  ? 381  HIS A CD2 1 
ATOM   2878 C CE1 . HIS A 1 412 ? 19.357  9.681   -9.423  1.00 54.52  ? 381  HIS A CE1 1 
ATOM   2879 N NE2 . HIS A 1 412 ? 19.583  10.395  -8.336  1.00 51.98  ? 381  HIS A NE2 1 
ATOM   2880 N N   . TYR A 1 413 ? 20.990  14.964  -10.495 1.00 50.08  ? 382  TYR A N   1 
ATOM   2881 C CA  . TYR A 1 413 ? 20.372  15.915  -9.566  1.00 48.98  ? 382  TYR A CA  1 
ATOM   2882 C C   . TYR A 1 413 ? 19.798  17.119  -10.263 1.00 49.64  ? 382  TYR A C   1 
ATOM   2883 O O   . TYR A 1 413 ? 19.047  17.853  -9.662  1.00 49.61  ? 382  TYR A O   1 
ATOM   2884 C CB  . TYR A 1 413 ? 21.402  16.371  -8.543  1.00 47.90  ? 382  TYR A CB  1 
ATOM   2885 C CG  . TYR A 1 413 ? 21.526  15.423  -7.386  1.00 46.00  ? 382  TYR A CG  1 
ATOM   2886 C CD1 . TYR A 1 413 ? 22.442  14.380  -7.407  1.00 44.33  ? 382  TYR A CD1 1 
ATOM   2887 C CD2 . TYR A 1 413 ? 20.686  15.544  -6.282  1.00 44.20  ? 382  TYR A CD2 1 
ATOM   2888 C CE1 . TYR A 1 413 ? 22.524  13.493  -6.362  1.00 44.14  ? 382  TYR A CE1 1 
ATOM   2889 C CE2 . TYR A 1 413 ? 20.776  14.684  -5.227  1.00 43.59  ? 382  TYR A CE2 1 
ATOM   2890 C CZ  . TYR A 1 413 ? 21.692  13.658  -5.270  1.00 43.40  ? 382  TYR A CZ  1 
ATOM   2891 O OH  . TYR A 1 413 ? 21.780  12.825  -4.213  1.00 44.04  ? 382  TYR A OH  1 
ATOM   2892 N N   . THR A 1 414 ? 20.140  17.315  -11.531 1.00 50.62  ? 383  THR A N   1 
ATOM   2893 C CA  . THR A 1 414 ? 19.518  18.350  -12.357 1.00 51.42  ? 383  THR A CA  1 
ATOM   2894 C C   . THR A 1 414 ? 18.058  17.999  -12.581 1.00 53.30  ? 383  THR A C   1 
ATOM   2895 O O   . THR A 1 414 ? 17.731  16.852  -12.845 1.00 54.78  ? 383  THR A O   1 
ATOM   2896 C CB  . THR A 1 414 ? 20.225  18.425  -13.734 1.00 51.62  ? 383  THR A CB  1 
ATOM   2897 O OG1 . THR A 1 414 ? 21.563  18.872  -13.577 1.00 49.98  ? 383  THR A OG1 1 
ATOM   2898 C CG2 . THR A 1 414 ? 19.606  19.449  -14.663 1.00 50.68  ? 383  THR A CG2 1 
ATOM   2899 N N   . ASP A 1 415 ? 17.188  18.984  -12.449 1.00 54.86  ? 384  ASP A N   1 
ATOM   2900 C CA  . ASP A 1 415 ? 15.804  18.885  -12.872 1.00 56.78  ? 384  ASP A CA  1 
ATOM   2901 C C   . ASP A 1 415 ? 15.771  19.338  -14.322 1.00 57.86  ? 384  ASP A C   1 
ATOM   2902 O O   . ASP A 1 415 ? 15.985  20.512  -14.601 1.00 57.34  ? 384  ASP A O   1 
ATOM   2903 C CB  . ASP A 1 415 ? 14.961  19.845  -12.046 1.00 57.22  ? 384  ASP A CB  1 
ATOM   2904 C CG  . ASP A 1 415 ? 13.532  19.920  -12.512 1.00 60.00  ? 384  ASP A CG  1 
ATOM   2905 O OD1 . ASP A 1 415 ? 13.180  19.273  -13.511 1.00 61.97  ? 384  ASP A OD1 1 
ATOM   2906 O OD2 . ASP A 1 415 ? 12.682  20.605  -11.917 1.00 65.71  ? 384  ASP A OD2 1 
ATOM   2907 N N   . TRP A 1 416 ? 15.500  18.427  -15.250 1.00 58.96  ? 385  TRP A N   1 
ATOM   2908 C CA  . TRP A 1 416 ? 15.664  18.753  -16.667 1.00 60.04  ? 385  TRP A CA  1 
ATOM   2909 C C   . TRP A 1 416 ? 14.501  19.548  -17.242 1.00 62.06  ? 385  TRP A C   1 
ATOM   2910 O O   . TRP A 1 416 ? 14.599  20.030  -18.355 1.00 63.19  ? 385  TRP A O   1 
ATOM   2911 C CB  . TRP A 1 416 ? 16.013  17.512  -17.510 1.00 60.47  ? 385  TRP A CB  1 
ATOM   2912 C CG  . TRP A 1 416 ? 17.363  16.996  -17.160 1.00 56.55  ? 385  TRP A CG  1 
ATOM   2913 C CD1 . TRP A 1 416 ? 17.651  16.009  -16.285 1.00 53.92  ? 385  TRP A CD1 1 
ATOM   2914 C CD2 . TRP A 1 416 ? 18.614  17.517  -17.596 1.00 53.43  ? 385  TRP A CD2 1 
ATOM   2915 N NE1 . TRP A 1 416 ? 19.009  15.855  -16.166 1.00 50.34  ? 385  TRP A NE1 1 
ATOM   2916 C CE2 . TRP A 1 416 ? 19.624  16.776  -16.957 1.00 50.58  ? 385  TRP A CE2 1 
ATOM   2917 C CE3 . TRP A 1 416 ? 18.988  18.561  -18.443 1.00 54.48  ? 385  TRP A CE3 1 
ATOM   2918 C CZ2 . TRP A 1 416 ? 20.978  17.020  -17.149 1.00 52.42  ? 385  TRP A CZ2 1 
ATOM   2919 C CZ3 . TRP A 1 416 ? 20.343  18.815  -18.636 1.00 55.08  ? 385  TRP A CZ3 1 
ATOM   2920 C CH2 . TRP A 1 416 ? 21.325  18.035  -17.998 1.00 54.42  ? 385  TRP A CH2 1 
ATOM   2921 N N   . LEU A 1 417 ? 13.424  19.693  -16.474 1.00 63.20  ? 386  LEU A N   1 
ATOM   2922 C CA  . LEU A 1 417 ? 12.385  20.687  -16.755 1.00 64.86  ? 386  LEU A CA  1 
ATOM   2923 C C   . LEU A 1 417 ? 12.780  22.139  -16.404 1.00 64.62  ? 386  LEU A C   1 
ATOM   2924 O O   . LEU A 1 417 ? 12.292  23.082  -17.019 1.00 65.69  ? 386  LEU A O   1 
ATOM   2925 C CB  . LEU A 1 417 ? 11.113  20.340  -15.987 1.00 65.31  ? 386  LEU A CB  1 
ATOM   2926 C CG  . LEU A 1 417 ? 10.049  19.599  -16.764 1.00 68.48  ? 386  LEU A CG  1 
ATOM   2927 C CD1 . LEU A 1 417 ? 8.769   19.599  -15.937 1.00 69.73  ? 386  LEU A CD1 1 
ATOM   2928 C CD2 . LEU A 1 417 ? 9.846   20.249  -18.159 1.00 70.81  ? 386  LEU A CD2 1 
ATOM   2929 N N   . HIS A 1 418 ? 13.593  22.316  -15.365 1.00 63.79  ? 387  HIS A N   1 
ATOM   2930 C CA  . HIS A 1 418 ? 14.035  23.638  -14.931 1.00 63.39  ? 387  HIS A CA  1 
ATOM   2931 C C   . HIS A 1 418 ? 15.550  23.586  -14.654 1.00 61.67  ? 387  HIS A C   1 
ATOM   2932 O O   . HIS A 1 418 ? 15.995  23.867  -13.555 1.00 60.63  ? 387  HIS A O   1 
ATOM   2933 C CB  . HIS A 1 418 ? 13.237  24.086  -13.701 1.00 63.65  ? 387  HIS A CB  1 
ATOM   2934 C CG  . HIS A 1 418 ? 11.753  24.117  -13.919 1.00 67.47  ? 387  HIS A CG  1 
ATOM   2935 N ND1 . HIS A 1 418 ? 10.980  22.974  -13.944 1.00 69.94  ? 387  HIS A ND1 1 
ATOM   2936 C CD2 . HIS A 1 418 ? 10.897  25.154  -14.112 1.00 71.71  ? 387  HIS A CD2 1 
ATOM   2937 C CE1 . HIS A 1 418 ? 9.715   23.304  -14.163 1.00 71.94  ? 387  HIS A CE1 1 
ATOM   2938 N NE2 . HIS A 1 418 ? 9.636   24.619  -14.270 1.00 72.14  ? 387  HIS A NE2 1 
ATOM   2939 N N   . PRO A 1 419 ? 16.350  23.234  -15.663 1.00 61.51  ? 388  PRO A N   1 
ATOM   2940 C CA  . PRO A 1 419 ? 17.782  22.977  -15.460 1.00 60.08  ? 388  PRO A CA  1 
ATOM   2941 C C   . PRO A 1 419 ? 18.601  24.160  -14.941 1.00 58.96  ? 388  PRO A C   1 
ATOM   2942 O O   . PRO A 1 419 ? 19.736  23.952  -14.534 1.00 58.13  ? 388  PRO A O   1 
ATOM   2943 C CB  . PRO A 1 419 ? 18.280  22.583  -16.860 1.00 60.62  ? 388  PRO A CB  1 
ATOM   2944 C CG  . PRO A 1 419 ? 17.292  23.167  -17.797 1.00 61.93  ? 388  PRO A CG  1 
ATOM   2945 C CD  . PRO A 1 419 ? 15.977  23.092  -17.087 1.00 62.57  ? 388  PRO A CD  1 
ATOM   2946 N N   . GLU A 1 420 ? 18.044  25.362  -14.966 1.00 59.09  ? 389  GLU A N   1 
ATOM   2947 C CA  . GLU A 1 420 ? 18.778  26.576  -14.618 1.00 58.79  ? 389  GLU A CA  1 
ATOM   2948 C C   . GLU A 1 420 ? 18.120  27.352  -13.490 1.00 56.70  ? 389  GLU A C   1 
ATOM   2949 O O   . GLU A 1 420 ? 18.569  28.432  -13.156 1.00 56.09  ? 389  GLU A O   1 
ATOM   2950 C CB  . GLU A 1 420 ? 18.870  27.503  -15.853 1.00 60.53  ? 389  GLU A CB  1 
ATOM   2951 C CG  . GLU A 1 420 ? 19.454  26.843  -17.103 1.00 64.49  ? 389  GLU A CG  1 
ATOM   2952 C CD  . GLU A 1 420 ? 20.709  27.535  -17.590 1.00 69.95  ? 389  GLU A CD  1 
ATOM   2953 O OE1 . GLU A 1 420 ? 21.822  27.239  -17.064 1.00 71.97  ? 389  GLU A OE1 1 
ATOM   2954 O OE2 . GLU A 1 420 ? 20.568  28.404  -18.486 1.00 75.82  ? 389  GLU A OE2 1 
ATOM   2955 N N   . ASP A 1 421 ? 17.047  26.814  -12.929 1.00 55.07  ? 390  ASP A N   1 
ATOM   2956 C CA  . ASP A 1 421 ? 16.355  27.456  -11.837 1.00 54.27  ? 390  ASP A CA  1 
ATOM   2957 C C   . ASP A 1 421 ? 17.270  27.496  -10.595 1.00 52.79  ? 390  ASP A C   1 
ATOM   2958 O O   . ASP A 1 421 ? 17.752  26.476  -10.130 1.00 50.86  ? 390  ASP A O   1 
ATOM   2959 C CB  . ASP A 1 421 ? 15.059  26.719  -11.545 1.00 54.34  ? 390  ASP A CB  1 
ATOM   2960 C CG  . ASP A 1 421 ? 14.322  27.304  -10.390 1.00 55.42  ? 390  ASP A CG  1 
ATOM   2961 O OD1 . ASP A 1 421 ? 13.791  28.392  -10.520 1.00 57.66  ? 390  ASP A OD1 1 
ATOM   2962 O OD2 . ASP A 1 421 ? 14.226  26.766  -9.289  1.00 60.42  ? 390  ASP A OD2 1 
ATOM   2963 N N   . PRO A 1 422 ? 17.562  28.689  -10.106 1.00 52.56  ? 391  PRO A N   1 
ATOM   2964 C CA  . PRO A 1 422 ? 18.521  28.821  -9.015  1.00 51.28  ? 391  PRO A CA  1 
ATOM   2965 C C   . PRO A 1 422 ? 18.012  28.283  -7.675  1.00 50.87  ? 391  PRO A C   1 
ATOM   2966 O O   . PRO A 1 422 ? 18.846  27.827  -6.896  1.00 49.60  ? 391  PRO A O   1 
ATOM   2967 C CB  . PRO A 1 422 ? 18.858  30.311  -8.998  1.00 51.29  ? 391  PRO A CB  1 
ATOM   2968 C CG  . PRO A 1 422 ? 17.797  31.010  -9.777  1.00 52.86  ? 391  PRO A CG  1 
ATOM   2969 C CD  . PRO A 1 422 ? 17.032  29.988  -10.566 1.00 53.25  ? 391  PRO A CD  1 
ATOM   2970 N N   . THR A 1 423 ? 16.703  28.277  -7.426  1.00 51.18  ? 392  THR A N   1 
ATOM   2971 C CA  . THR A 1 423 ? 16.172  27.633  -6.227  1.00 50.59  ? 392  THR A CA  1 
ATOM   2972 C C   . THR A 1 423 ? 16.420  26.118  -6.267  1.00 50.29  ? 392  THR A C   1 
ATOM   2973 O O   . THR A 1 423 ? 16.804  25.533  -5.267  1.00 48.74  ? 392  THR A O   1 
ATOM   2974 C CB  . THR A 1 423 ? 14.660  27.933  -6.069  1.00 50.92  ? 392  THR A CB  1 
ATOM   2975 O OG1 . THR A 1 423 ? 14.494  29.307  -5.715  1.00 51.40  ? 392  THR A OG1 1 
ATOM   2976 C CG2 . THR A 1 423 ? 14.071  27.192  -4.874  1.00 49.91  ? 392  THR A CG2 1 
ATOM   2977 N N   . HIS A 1 424 ? 16.154  25.488  -7.410  1.00 51.40  ? 393  HIS A N   1 
ATOM   2978 C CA  . HIS A 1 424 ? 16.330  24.047  -7.523  1.00 51.90  ? 393  HIS A CA  1 
ATOM   2979 C C   . HIS A 1 424 ? 17.809  23.684  -7.440  1.00 49.86  ? 393  HIS A C   1 
ATOM   2980 O O   . HIS A 1 424 ? 18.147  22.700  -6.832  1.00 49.54  ? 393  HIS A O   1 
ATOM   2981 C CB  . HIS A 1 424 ? 15.733  23.428  -8.783  1.00 52.94  ? 393  HIS A CB  1 
ATOM   2982 C CG  . HIS A 1 424 ? 16.067  21.967  -8.900  1.00 59.84  ? 393  HIS A CG  1 
ATOM   2983 N ND1 . HIS A 1 424 ? 15.219  20.964  -8.447  1.00 68.28  ? 393  HIS A ND1 1 
ATOM   2984 C CD2 . HIS A 1 424 ? 17.214  21.339  -9.289  1.00 63.07  ? 393  HIS A CD2 1 
ATOM   2985 C CE1 . HIS A 1 424 ? 15.816  19.787  -8.594  1.00 68.07  ? 393  HIS A CE1 1 
ATOM   2986 N NE2 . HIS A 1 424 ? 17.023  19.989  -9.110  1.00 65.53  ? 393  HIS A NE2 1 
ATOM   2987 N N   . LEU A 1 425 ? 18.685  24.479  -8.038  1.00 48.81  ? 394  LEU A N   1 
ATOM   2988 C CA  . LEU A 1 425 ? 20.126  24.216  -7.958  1.00 47.97  ? 394  LEU A CA  1 
ATOM   2989 C C   . LEU A 1 425 ? 20.670  24.305  -6.531  1.00 46.30  ? 394  LEU A C   1 
ATOM   2990 O O   . LEU A 1 425 ? 21.482  23.517  -6.145  1.00 45.08  ? 394  LEU A O   1 
ATOM   2991 C CB  . LEU A 1 425 ? 20.936  25.139  -8.877  1.00 47.50  ? 394  LEU A CB  1 
ATOM   2992 C CG  . LEU A 1 425 ? 20.666  24.845  -10.358 1.00 48.54  ? 394  LEU A CG  1 
ATOM   2993 C CD1 . LEU A 1 425 ? 20.957  26.066  -11.241 1.00 49.72  ? 394  LEU A CD1 1 
ATOM   2994 C CD2 . LEU A 1 425 ? 21.395  23.631  -10.881 1.00 45.43  ? 394  LEU A CD2 1 
ATOM   2995 N N   . ARG A 1 426 ? 20.177  25.262  -5.764  1.00 46.41  ? 395  ARG A N   1 
ATOM   2996 C CA  . ARG A 1 426 ? 20.547  25.440  -4.377  1.00 45.85  ? 395  ARG A CA  1 
ATOM   2997 C C   . ARG A 1 426 ? 20.185  24.185  -3.576  1.00 45.81  ? 395  ARG A C   1 
ATOM   2998 O O   . ARG A 1 426 ? 21.082  23.534  -3.005  1.00 45.06  ? 395  ARG A O   1 
ATOM   2999 C CB  . ARG A 1 426 ? 19.867  26.683  -3.843  1.00 45.70  ? 395  ARG A CB  1 
ATOM   3000 C CG  . ARG A 1 426 ? 20.002  26.935  -2.337  1.00 46.47  ? 395  ARG A CG  1 
ATOM   3001 C CD  . ARG A 1 426 ? 18.645  26.777  -1.626  1.00 47.91  ? 395  ARG A CD  1 
ATOM   3002 N NE  . ARG A 1 426 ? 18.027  28.048  -1.441  1.00 47.79  ? 395  ARG A NE  1 
ATOM   3003 C CZ  . ARG A 1 426 ? 16.728  28.272  -1.314  1.00 48.18  ? 395  ARG A CZ  1 
ATOM   3004 N NH1 . ARG A 1 426 ? 15.833  27.309  -1.348  1.00 45.20  ? 395  ARG A NH1 1 
ATOM   3005 N NH2 . ARG A 1 426 ? 16.323  29.526  -1.163  1.00 51.20  ? 395  ARG A NH2 1 
ATOM   3006 N N   . ASP A 1 427 ? 18.906  23.804  -3.633  1.00 45.49  ? 396  ASP A N   1 
ATOM   3007 C CA  . ASP A 1 427 ? 18.381  22.622  -2.949  1.00 45.58  ? 396  ASP A CA  1 
ATOM   3008 C C   . ASP A 1 427 ? 19.015  21.312  -3.427  1.00 45.17  ? 396  ASP A C   1 
ATOM   3009 O O   . ASP A 1 427 ? 19.114  20.353  -2.671  1.00 45.06  ? 396  ASP A O   1 
ATOM   3010 C CB  . ASP A 1 427 ? 16.832  22.539  -3.117  1.00 45.77  ? 396  ASP A CB  1 
ATOM   3011 C CG  . ASP A 1 427 ? 16.131  23.726  -2.494  1.00 46.68  ? 396  ASP A CG  1 
ATOM   3012 O OD1 . ASP A 1 427 ? 16.808  24.426  -1.688  1.00 48.02  ? 396  ASP A OD1 1 
ATOM   3013 O OD2 . ASP A 1 427 ? 14.956  24.075  -2.757  1.00 48.83  ? 396  ASP A OD2 1 
ATOM   3014 N N   . ALA A 1 428 ? 19.429  21.269  -4.679  1.00 45.10  ? 397  ALA A N   1 
ATOM   3015 C CA  . ALA A 1 428 ? 20.073  20.082  -5.219  1.00 45.25  ? 397  ALA A CA  1 
ATOM   3016 C C   . ALA A 1 428 ? 21.512  19.962  -4.685  1.00 44.14  ? 397  ALA A C   1 
ATOM   3017 O O   . ALA A 1 428 ? 21.964  18.870  -4.391  1.00 43.70  ? 397  ALA A O   1 
ATOM   3018 C CB  . ALA A 1 428 ? 20.081  20.127  -6.746  1.00 46.33  ? 397  ALA A CB  1 
ATOM   3019 N N   . MET A 1 429 ? 22.210  21.088  -4.552  1.00 43.25  ? 398  MET A N   1 
ATOM   3020 C CA  . MET A 1 429 ? 23.555  21.098  -3.980  1.00 42.61  ? 398  MET A CA  1 
ATOM   3021 C C   . MET A 1 429 ? 23.488  20.631  -2.529  1.00 41.90  ? 398  MET A C   1 
ATOM   3022 O O   . MET A 1 429 ? 24.340  19.847  -2.076  1.00 41.27  ? 398  MET A O   1 
ATOM   3023 C CB  . MET A 1 429 ? 24.151  22.503  -4.075  1.00 42.84  ? 398  MET A CB  1 
ATOM   3024 C CG  . MET A 1 429 ? 25.590  22.633  -3.635  1.00 44.03  ? 398  MET A CG  1 
ATOM   3025 S SD  . MET A 1 429 ? 26.631  21.891  -4.849  1.00 43.70  ? 398  MET A SD  1 
ATOM   3026 C CE  . MET A 1 429 ? 27.010  20.418  -4.058  1.00 41.10  ? 398  MET A CE  1 
ATOM   3027 N N   . SER A 1 430 ? 22.457  21.074  -1.805  1.00 41.28  ? 399  SER A N   1 
ATOM   3028 C CA  . SER A 1 430 ? 22.265  20.607  -0.432  1.00 40.94  ? 399  SER A CA  1 
ATOM   3029 C C   . SER A 1 430 ? 22.018  19.099  -0.404  1.00 40.70  ? 399  SER A C   1 
ATOM   3030 O O   . SER A 1 430 ? 22.600  18.395  0.404   1.00 40.39  ? 399  SER A O   1 
ATOM   3031 C CB  . SER A 1 430 ? 21.104  21.304  0.278   1.00 40.43  ? 399  SER A CB  1 
ATOM   3032 O OG  . SER A 1 430 ? 20.791  20.578  1.454   1.00 40.23  ? 399  SER A OG  1 
ATOM   3033 N N   . ALA A 1 431 ? 21.165  18.615  -1.291  1.00 40.84  ? 400  ALA A N   1 
ATOM   3034 C CA  . ALA A 1 431 ? 20.846  17.177  -1.345  1.00 41.23  ? 400  ALA A CA  1 
ATOM   3035 C C   . ALA A 1 431 ? 22.043  16.297  -1.740  1.00 40.73  ? 400  ALA A C   1 
ATOM   3036 O O   . ALA A 1 431 ? 22.227  15.228  -1.206  1.00 41.02  ? 400  ALA A O   1 
ATOM   3037 C CB  . ALA A 1 431 ? 19.634  16.912  -2.265  1.00 41.41  ? 400  ALA A CB  1 
ATOM   3038 N N   . VAL A 1 432 ? 22.858  16.750  -2.668  1.00 41.42  ? 401  VAL A N   1 
ATOM   3039 C CA  . VAL A 1 432 ? 24.062  16.008  -3.065  1.00 41.99  ? 401  VAL A CA  1 
ATOM   3040 C C   . VAL A 1 432 ? 24.943  15.740  -1.853  1.00 41.55  ? 401  VAL A C   1 
ATOM   3041 O O   . VAL A 1 432 ? 25.372  14.626  -1.631  1.00 41.91  ? 401  VAL A O   1 
ATOM   3042 C CB  . VAL A 1 432 ? 24.888  16.791  -4.099  1.00 42.29  ? 401  VAL A CB  1 
ATOM   3043 C CG1 . VAL A 1 432 ? 26.292  16.191  -4.251  1.00 41.68  ? 401  VAL A CG1 1 
ATOM   3044 C CG2 . VAL A 1 432 ? 24.146  16.854  -5.439  1.00 42.85  ? 401  VAL A CG2 1 
ATOM   3045 N N   . VAL A 1 433 ? 25.169  16.772  -1.058  1.00 41.63  ? 402  VAL A N   1 
ATOM   3046 C CA  . VAL A 1 433 ? 26.071  16.699  0.081   1.00 41.74  ? 402  VAL A CA  1 
ATOM   3047 C C   . VAL A 1 433 ? 25.434  15.877  1.198   1.00 41.29  ? 402  VAL A C   1 
ATOM   3048 O O   . VAL A 1 433 ? 26.085  15.036  1.827   1.00 41.64  ? 402  VAL A O   1 
ATOM   3049 C CB  . VAL A 1 433 ? 26.468  18.122  0.562   1.00 41.78  ? 402  VAL A CB  1 
ATOM   3050 C CG1 . VAL A 1 433 ? 27.073  18.094  1.926   1.00 42.57  ? 402  VAL A CG1 1 
ATOM   3051 C CG2 . VAL A 1 433 ? 27.438  18.734  -0.404  1.00 42.19  ? 402  VAL A CG2 1 
ATOM   3052 N N   . GLY A 1 434 ? 24.153  16.090  1.415   1.00 41.15  ? 403  GLY A N   1 
ATOM   3053 C CA  . GLY A 1 434 ? 23.395  15.307  2.375   1.00 40.87  ? 403  GLY A CA  1 
ATOM   3054 C C   . GLY A 1 434 ? 23.315  13.834  2.027   1.00 41.09  ? 403  GLY A C   1 
ATOM   3055 O O   . GLY A 1 434 ? 23.539  12.998  2.882   1.00 40.75  ? 403  GLY A O   1 
ATOM   3056 N N   . ASP A 1 435 ? 22.999  13.520  0.773   1.00 41.52  ? 404  ASP A N   1 
ATOM   3057 C CA  . ASP A 1 435 ? 22.830  12.133  0.346   1.00 42.25  ? 404  ASP A CA  1 
ATOM   3058 C C   . ASP A 1 435 ? 24.162  11.366  0.328   1.00 42.17  ? 404  ASP A C   1 
ATOM   3059 O O   . ASP A 1 435 ? 24.221  10.215  0.727   1.00 42.39  ? 404  ASP A O   1 
ATOM   3060 C CB  . ASP A 1 435 ? 22.204  12.048  -1.042  1.00 42.92  ? 404  ASP A CB  1 
ATOM   3061 C CG  . ASP A 1 435 ? 20.780  12.576  -1.105  1.00 44.50  ? 404  ASP A CG  1 
ATOM   3062 O OD1 . ASP A 1 435 ? 20.112  12.766  -0.047  1.00 43.98  ? 404  ASP A OD1 1 
ATOM   3063 O OD2 . ASP A 1 435 ? 20.243  12.824  -2.214  1.00 45.15  ? 404  ASP A OD2 1 
ATOM   3064 N N   . HIS A 1 436 ? 25.217  11.994  -0.181  1.00 42.01  ? 405  HIS A N   1 
ATOM   3065 C CA  . HIS A 1 436 ? 26.522  11.337  -0.323  1.00 41.48  ? 405  HIS A CA  1 
ATOM   3066 C C   . HIS A 1 436 ? 27.124  11.028  1.053   1.00 41.00  ? 405  HIS A C   1 
ATOM   3067 O O   . HIS A 1 436 ? 27.633  9.957   1.291   1.00 41.50  ? 405  HIS A O   1 
ATOM   3068 C CB  . HIS A 1 436 ? 27.419  12.256  -1.154  1.00 41.85  ? 405  HIS A CB  1 
ATOM   3069 C CG  . HIS A 1 436 ? 28.850  11.838  -1.236  1.00 41.46  ? 405  HIS A CG  1 
ATOM   3070 N ND1 . HIS A 1 436 ? 29.236  10.543  -1.463  1.00 44.01  ? 405  HIS A ND1 1 
ATOM   3071 C CD2 . HIS A 1 436 ? 29.987  12.562  -1.153  1.00 41.80  ? 405  HIS A CD2 1 
ATOM   3072 C CE1 . HIS A 1 436 ? 30.556  10.482  -1.497  1.00 44.72  ? 405  HIS A CE1 1 
ATOM   3073 N NE2 . HIS A 1 436 ? 31.034  11.696  -1.326  1.00 43.93  ? 405  HIS A NE2 1 
ATOM   3074 N N   . ASN A 1 437 ? 27.019  11.969  1.974   1.00 40.72  ? 406  ASN A N   1 
ATOM   3075 C CA  . ASN A 1 437 ? 27.666  11.858  3.268   1.00 40.26  ? 406  ASN A CA  1 
ATOM   3076 C C   . ASN A 1 437 ? 26.828  11.206  4.394   1.00 40.78  ? 406  ASN A C   1 
ATOM   3077 O O   . ASN A 1 437 ? 27.417  10.614  5.284   1.00 41.96  ? 406  ASN A O   1 
ATOM   3078 C CB  . ASN A 1 437 ? 28.112  13.234  3.718   1.00 40.01  ? 406  ASN A CB  1 
ATOM   3079 C CG  . ASN A 1 437 ? 29.234  13.790  2.866   1.00 38.03  ? 406  ASN A CG  1 
ATOM   3080 O OD1 . ASN A 1 437 ? 30.298  13.215  2.828   1.00 37.25  ? 406  ASN A OD1 1 
ATOM   3081 N ND2 . ASN A 1 437 ? 28.990  14.910  2.184   1.00 36.26  ? 406  ASN A ND2 1 
ATOM   3082 N N   . VAL A 1 438 ? 25.497  11.269  4.343   1.00 40.28  ? 407  VAL A N   1 
ATOM   3083 C CA  . VAL A 1 438 ? 24.656  10.803  5.445   1.00 40.74  ? 407  VAL A CA  1 
ATOM   3084 C C   . VAL A 1 438 ? 23.519  9.888   4.992   1.00 41.79  ? 407  VAL A C   1 
ATOM   3085 O O   . VAL A 1 438 ? 23.506  8.712   5.340   1.00 42.35  ? 407  VAL A O   1 
ATOM   3086 C CB  . VAL A 1 438 ? 24.029  11.988  6.267   1.00 40.09  ? 407  VAL A CB  1 
ATOM   3087 C CG1 . VAL A 1 438 ? 23.260  11.481  7.436   1.00 40.17  ? 407  VAL A CG1 1 
ATOM   3088 C CG2 . VAL A 1 438 ? 25.102  12.932  6.780   1.00 40.14  ? 407  VAL A CG2 1 
ATOM   3089 N N   . VAL A 1 439 ? 22.577  10.403  4.201   1.00 42.18  ? 408  VAL A N   1 
ATOM   3090 C CA  . VAL A 1 439 ? 21.358  9.656   3.918   1.00 42.68  ? 408  VAL A CA  1 
ATOM   3091 C C   . VAL A 1 439 ? 21.671  8.327   3.245   1.00 43.79  ? 408  VAL A C   1 
ATOM   3092 O O   . VAL A 1 439 ? 21.073  7.316   3.601   1.00 43.85  ? 408  VAL A O   1 
ATOM   3093 C CB  . VAL A 1 439 ? 20.327  10.443  3.056   1.00 42.53  ? 408  VAL A CB  1 
ATOM   3094 C CG1 . VAL A 1 439 ? 19.089  9.605   2.820   1.00 42.72  ? 408  VAL A CG1 1 
ATOM   3095 C CG2 . VAL A 1 439 ? 19.909  11.712  3.727   1.00 42.97  ? 408  VAL A CG2 1 
ATOM   3096 N N   . CYS A 1 440 ? 22.597  8.311   2.287   1.00 43.81  ? 409  CYS A N   1 
ATOM   3097 C CA  . CYS A 1 440 ? 22.854  7.060   1.557   1.00 45.11  ? 409  CYS A CA  1 
ATOM   3098 C C   . CYS A 1 440 ? 23.727  6.052   2.318   1.00 45.27  ? 409  CYS A C   1 
ATOM   3099 O O   . CYS A 1 440 ? 23.458  4.871   2.256   1.00 46.48  ? 409  CYS A O   1 
ATOM   3100 C CB  . CYS A 1 440 ? 23.380  7.318   0.140   1.00 45.27  ? 409  CYS A CB  1 
ATOM   3101 S SG  . CYS A 1 440 ? 22.100  8.080   -0.894  1.00 46.59  ? 409  CYS A SG  1 
ATOM   3102 N N   . PRO A 1 441 ? 24.763  6.486   3.010   1.00 44.51  ? 410  PRO A N   1 
ATOM   3103 C CA  . PRO A 1 441 ? 25.411  5.614   3.999   1.00 44.82  ? 410  PRO A CA  1 
ATOM   3104 C C   . PRO A 1 441 ? 24.475  5.059   5.104   1.00 44.76  ? 410  PRO A C   1 
ATOM   3105 O O   . PRO A 1 441 ? 24.632  3.914   5.488   1.00 45.06  ? 410  PRO A O   1 
ATOM   3106 C CB  . PRO A 1 441 ? 26.502  6.499   4.577   1.00 44.05  ? 410  PRO A CB  1 
ATOM   3107 C CG  . PRO A 1 441 ? 26.857  7.429   3.406   1.00 43.98  ? 410  PRO A CG  1 
ATOM   3108 C CD  . PRO A 1 441 ? 25.489  7.757   2.843   1.00 44.38  ? 410  PRO A CD  1 
ATOM   3109 N N   . VAL A 1 442 ? 23.527  5.839   5.595   1.00 44.12  ? 411  VAL A N   1 
ATOM   3110 C CA  . VAL A 1 442 ? 22.578  5.324   6.561   1.00 44.68  ? 411  VAL A CA  1 
ATOM   3111 C C   . VAL A 1 442 ? 21.665  4.252   5.933   1.00 46.37  ? 411  VAL A C   1 
ATOM   3112 O O   . VAL A 1 442 ? 21.403  3.223   6.537   1.00 46.72  ? 411  VAL A O   1 
ATOM   3113 C CB  . VAL A 1 442 ? 21.729  6.444   7.163   1.00 44.14  ? 411  VAL A CB  1 
ATOM   3114 C CG1 . VAL A 1 442 ? 20.511  5.894   7.898   1.00 45.42  ? 411  VAL A CG1 1 
ATOM   3115 C CG2 . VAL A 1 442 ? 22.534  7.241   8.108   1.00 43.40  ? 411  VAL A CG2 1 
ATOM   3116 N N   . ALA A 1 443 ? 21.184  4.488   4.717   1.00 47.11  ? 412  ALA A N   1 
ATOM   3117 C CA  . ALA A 1 443 ? 20.372  3.503   4.008   1.00 48.10  ? 412  ALA A CA  1 
ATOM   3118 C C   . ALA A 1 443 ? 21.144  2.222   3.758   1.00 48.65  ? 412  ALA A C   1 
ATOM   3119 O O   . ALA A 1 443 ? 20.617  1.131   3.877   1.00 49.90  ? 412  ALA A O   1 
ATOM   3120 C CB  . ALA A 1 443 ? 19.878  4.078   2.681   1.00 48.36  ? 412  ALA A CB  1 
ATOM   3121 N N   . GLN A 1 444 ? 22.404  2.360   3.410   1.00 48.53  ? 413  GLN A N   1 
ATOM   3122 C CA  . GLN A 1 444 ? 23.262  1.205   3.202   1.00 49.51  ? 413  GLN A CA  1 
ATOM   3123 C C   . GLN A 1 444 ? 23.469  0.428   4.505   1.00 48.97  ? 413  GLN A C   1 
ATOM   3124 O O   . GLN A 1 444 ? 23.328  -0.791  4.526   1.00 48.87  ? 413  GLN A O   1 
ATOM   3125 C CB  . GLN A 1 444 ? 24.596  1.667   2.654   1.00 49.40  ? 413  GLN A CB  1 
ATOM   3126 C CG  . GLN A 1 444 ? 25.669  0.617   2.655   1.00 53.99  ? 413  GLN A CG  1 
ATOM   3127 C CD  . GLN A 1 444 ? 26.059  0.225   1.286   1.00 60.26  ? 413  GLN A CD  1 
ATOM   3128 O OE1 . GLN A 1 444 ? 25.359  -0.587  0.650   1.00 63.47  ? 413  GLN A OE1 1 
ATOM   3129 N NE2 . GLN A 1 444 ? 27.167  0.819   0.780   1.00 63.52  ? 413  GLN A NE2 1 
ATOM   3130 N N   . LEU A 1 445 ? 23.791  1.147   5.588   1.00 47.39  ? 414  LEU A N   1 
ATOM   3131 C CA  . LEU A 1 445 ? 23.948  0.533   6.892   1.00 46.91  ? 414  LEU A CA  1 
ATOM   3132 C C   . LEU A 1 445 ? 22.677  -0.214  7.322   1.00 47.49  ? 414  LEU A C   1 
ATOM   3133 O O   . LEU A 1 445 ? 22.751  -1.385  7.672   1.00 47.23  ? 414  LEU A O   1 
ATOM   3134 C CB  . LEU A 1 445 ? 24.336  1.557   7.944   1.00 46.04  ? 414  LEU A CB  1 
ATOM   3135 C CG  . LEU A 1 445 ? 24.570  0.996   9.352   1.00 45.89  ? 414  LEU A CG  1 
ATOM   3136 C CD1 . LEU A 1 445 ? 25.812  0.129   9.367   1.00 47.16  ? 414  LEU A CD1 1 
ATOM   3137 C CD2 . LEU A 1 445 ? 24.699  2.112   10.328  1.00 46.30  ? 414  LEU A CD2 1 
ATOM   3138 N N   . ALA A 1 446 ? 21.529  0.449   7.271   1.00 47.36  ? 415  ALA A N   1 
ATOM   3139 C CA  . ALA A 1 446 ? 20.256  -0.180  7.673   1.00 48.70  ? 415  ALA A CA  1 
ATOM   3140 C C   . ALA A 1 446 ? 19.953  -1.446  6.872   1.00 50.74  ? 415  ALA A C   1 
ATOM   3141 O O   . ALA A 1 446 ? 19.512  -2.449  7.415   1.00 51.37  ? 415  ALA A O   1 
ATOM   3142 C CB  . ALA A 1 446 ? 19.093  0.806   7.532   1.00 48.40  ? 415  ALA A CB  1 
ATOM   3143 N N   . GLY A 1 447 ? 20.172  -1.377  5.566   1.00 51.75  ? 416  GLY A N   1 
ATOM   3144 C CA  . GLY A 1 447 ? 19.990  -2.513  4.689   1.00 53.24  ? 416  GLY A CA  1 
ATOM   3145 C C   . GLY A 1 447 ? 20.884  -3.702  5.007   1.00 54.38  ? 416  GLY A C   1 
ATOM   3146 O O   . GLY A 1 447 ? 20.431  -4.848  4.988   1.00 55.48  ? 416  GLY A O   1 
ATOM   3147 N N   . ARG A 1 448 ? 22.158  -3.458  5.289   1.00 54.31  ? 417  ARG A N   1 
ATOM   3148 C CA  . ARG A 1 448 ? 23.068  -4.560  5.588   1.00 55.75  ? 417  ARG A CA  1 
ATOM   3149 C C   . ARG A 1 448 ? 22.748  -5.137  6.961   1.00 55.88  ? 417  ARG A C   1 
ATOM   3150 O O   . ARG A 1 448 ? 22.574  -6.356  7.098   1.00 57.11  ? 417  ARG A O   1 
ATOM   3151 C CB  . ARG A 1 448 ? 24.527  -4.129  5.467   1.00 55.74  ? 417  ARG A CB  1 
ATOM   3152 C CG  . ARG A 1 448 ? 24.966  -3.695  4.041   1.00 59.11  ? 417  ARG A CG  1 
ATOM   3153 C CD  . ARG A 1 448 ? 24.596  -4.626  2.885   1.00 65.87  ? 417  ARG A CD  1 
ATOM   3154 N NE  . ARG A 1 448 ? 25.322  -5.899  2.965   1.00 72.28  ? 417  ARG A NE  1 
ATOM   3155 C CZ  . ARG A 1 448 ? 25.842  -6.584  1.929   1.00 77.20  ? 417  ARG A CZ  1 
ATOM   3156 N NH1 . ARG A 1 448 ? 25.729  -6.155  0.669   1.00 78.16  ? 417  ARG A NH1 1 
ATOM   3157 N NH2 . ARG A 1 448 ? 26.499  -7.722  2.168   1.00 79.85  ? 417  ARG A NH2 1 
ATOM   3158 N N   . LEU A 1 449 ? 22.592  -4.272  7.958   1.00 54.89  ? 418  LEU A N   1 
ATOM   3159 C CA  . LEU A 1 449 ? 22.232  -4.729  9.293   1.00 55.36  ? 418  LEU A CA  1 
ATOM   3160 C C   . LEU A 1 449 ? 20.963  -5.592  9.275   1.00 56.78  ? 418  LEU A C   1 
ATOM   3161 O O   . LEU A 1 449 ? 20.944  -6.667  9.855   1.00 57.65  ? 418  LEU A O   1 
ATOM   3162 C CB  . LEU A 1 449 ? 22.078  -3.551  10.262  1.00 54.05  ? 418  LEU A CB  1 
ATOM   3163 C CG  . LEU A 1 449 ? 23.327  -2.693  10.482  1.00 53.42  ? 418  LEU A CG  1 
ATOM   3164 C CD1 . LEU A 1 449 ? 23.034  -1.658  11.543  1.00 54.03  ? 418  LEU A CD1 1 
ATOM   3165 C CD2 . LEU A 1 449 ? 24.546  -3.505  10.860  1.00 54.14  ? 418  LEU A CD2 1 
ATOM   3166 N N   . ALA A 1 450 ? 19.926  -5.138  8.585   1.00 57.15  ? 419  ALA A N   1 
ATOM   3167 C CA  . ALA A 1 450 ? 18.649  -5.852  8.543   1.00 58.76  ? 419  ALA A CA  1 
ATOM   3168 C C   . ALA A 1 450 ? 18.764  -7.236  7.884   1.00 61.01  ? 419  ALA A C   1 
ATOM   3169 O O   . ALA A 1 450 ? 18.226  -8.238  8.377   1.00 62.46  ? 419  ALA A O   1 
ATOM   3170 C CB  . ALA A 1 450 ? 17.617  -5.027  7.813   1.00 58.24  ? 419  ALA A CB  1 
ATOM   3171 N N   . ALA A 1 451 ? 19.484  -7.271  6.768   1.00 61.49  ? 420  ALA A N   1 
ATOM   3172 C CA  . ALA A 1 451 ? 19.673  -8.483  5.989   1.00 62.94  ? 420  ALA A CA  1 
ATOM   3173 C C   . ALA A 1 451 ? 20.501  -9.483  6.751   1.00 63.86  ? 420  ALA A C   1 
ATOM   3174 O O   . ALA A 1 451 ? 20.456  -10.663 6.440   1.00 65.65  ? 420  ALA A O   1 
ATOM   3175 C CB  . ALA A 1 451 ? 20.351  -8.169  4.645   1.00 62.73  ? 420  ALA A CB  1 
ATOM   3176 N N   . GLN A 1 452 ? 21.252  -9.024  7.746   1.00 63.19  ? 421  GLN A N   1 
ATOM   3177 C CA  . GLN A 1 452 ? 22.166  -9.896  8.466   1.00 63.70  ? 421  GLN A CA  1 
ATOM   3178 C C   . GLN A 1 452 ? 21.808  -10.054 9.950   1.00 62.87  ? 421  GLN A C   1 
ATOM   3179 O O   . GLN A 1 452 ? 22.679  -10.301 10.779  1.00 62.62  ? 421  GLN A O   1 
ATOM   3180 C CB  . GLN A 1 452 ? 23.601  -9.430  8.211   1.00 63.46  ? 421  GLN A CB  1 
ATOM   3181 C CG  . GLN A 1 452 ? 24.040  -9.718  6.747   1.00 66.09  ? 421  GLN A CG  1 
ATOM   3182 C CD  . GLN A 1 452 ? 25.016  -8.688  6.224   1.00 69.79  ? 421  GLN A CD  1 
ATOM   3183 O OE1 . GLN A 1 452 ? 24.953  -8.273  5.047   1.00 72.05  ? 421  GLN A OE1 1 
ATOM   3184 N NE2 . GLN A 1 452 ? 25.927  -8.258  7.096   1.00 71.04  ? 421  GLN A NE2 1 
ATOM   3185 N N   . GLY A 1 453 ? 20.505  -9.966  10.252  1.00 62.66  ? 422  GLY A N   1 
ATOM   3186 C CA  . GLY A 1 453 ? 19.946  -10.417 11.523  1.00 62.60  ? 422  GLY A CA  1 
ATOM   3187 C C   . GLY A 1 453 ? 19.563  -9.382  12.568  1.00 61.31  ? 422  GLY A C   1 
ATOM   3188 O O   . GLY A 1 453 ? 19.014  -9.733  13.613  1.00 61.91  ? 422  GLY A O   1 
ATOM   3189 N N   . ALA A 1 454 ? 19.868  -8.112  12.319  1.00 59.34  ? 423  ALA A N   1 
ATOM   3190 C CA  . ALA A 1 454 ? 19.579  -7.054  13.270  1.00 57.55  ? 423  ALA A CA  1 
ATOM   3191 C C   . ALA A 1 454 ? 18.119  -6.626  13.214  1.00 57.19  ? 423  ALA A C   1 
ATOM   3192 O O   . ALA A 1 454 ? 17.503  -6.651  12.167  1.00 57.23  ? 423  ALA A O   1 
ATOM   3193 C CB  . ALA A 1 454 ? 20.475  -5.856  12.983  1.00 56.30  ? 423  ALA A CB  1 
ATOM   3194 N N   . ARG A 1 455 ? 17.579  -6.243  14.366  1.00 56.60  ? 424  ARG A N   1 
ATOM   3195 C CA  . ARG A 1 455 ? 16.319  -5.519  14.435  1.00 56.32  ? 424  ARG A CA  1 
ATOM   3196 C C   . ARG A 1 455 ? 16.695  -4.044  14.232  1.00 53.12  ? 424  ARG A C   1 
ATOM   3197 O O   . ARG A 1 455 ? 17.444  -3.473  15.019  1.00 50.63  ? 424  ARG A O   1 
ATOM   3198 C CB  . ARG A 1 455 ? 15.618  -5.723  15.787  1.00 57.18  ? 424  ARG A CB  1 
ATOM   3199 C CG  . ARG A 1 455 ? 14.093  -5.388  15.804  1.00 62.10  ? 424  ARG A CG  1 
ATOM   3200 C CD  . ARG A 1 455 ? 13.200  -6.309  16.741  1.00 70.37  ? 424  ARG A CD  1 
ATOM   3201 N NE  . ARG A 1 455 ? 12.170  -7.063  15.968  1.00 77.57  ? 424  ARG A NE  1 
ATOM   3202 C CZ  . ARG A 1 455 ? 10.908  -7.355  16.372  1.00 81.12  ? 424  ARG A CZ  1 
ATOM   3203 N NH1 . ARG A 1 455 ? 10.446  -7.001  17.574  1.00 82.41  ? 424  ARG A NH1 1 
ATOM   3204 N NH2 . ARG A 1 455 ? 10.096  -8.021  15.557  1.00 83.67  ? 424  ARG A NH2 1 
ATOM   3205 N N   . VAL A 1 456 ? 16.163  -3.442  13.178  1.00 51.11  ? 425  VAL A N   1 
ATOM   3206 C CA  . VAL A 1 456 ? 16.493  -2.072  12.805  1.00 48.59  ? 425  VAL A CA  1 
ATOM   3207 C C   . VAL A 1 456 ? 15.215  -1.253  12.801  1.00 47.84  ? 425  VAL A C   1 
ATOM   3208 O O   . VAL A 1 456 ? 14.208  -1.740  12.315  1.00 48.19  ? 425  VAL A O   1 
ATOM   3209 C CB  . VAL A 1 456 ? 17.060  -1.983  11.383  1.00 48.13  ? 425  VAL A CB  1 
ATOM   3210 C CG1 . VAL A 1 456 ? 17.467  -0.517  11.062  1.00 47.28  ? 425  VAL A CG1 1 
ATOM   3211 C CG2 . VAL A 1 456 ? 18.227  -2.920  11.200  1.00 47.94  ? 425  VAL A CG2 1 
ATOM   3212 N N   . TYR A 1 457 ? 15.259  -0.040  13.368  1.00 46.04  ? 426  TYR A N   1 
ATOM   3213 C CA  . TYR A 1 457 ? 14.177  0.928   13.230  1.00 45.73  ? 426  TYR A CA  1 
ATOM   3214 C C   . TYR A 1 457 ? 14.770  2.139   12.616  1.00 45.20  ? 426  TYR A C   1 
ATOM   3215 O O   . TYR A 1 457 ? 15.859  2.540   12.998  1.00 44.75  ? 426  TYR A O   1 
ATOM   3216 C CB  . TYR A 1 457 ? 13.572  1.295   14.589  1.00 46.12  ? 426  TYR A CB  1 
ATOM   3217 C CG  . TYR A 1 457 ? 12.838  0.138   15.245  1.00 46.46  ? 426  TYR A CG  1 
ATOM   3218 C CD1 . TYR A 1 457 ? 13.514  -0.730  16.098  1.00 46.21  ? 426  TYR A CD1 1 
ATOM   3219 C CD2 . TYR A 1 457 ? 11.493  -0.108  14.972  1.00 48.30  ? 426  TYR A CD2 1 
ATOM   3220 C CE1 . TYR A 1 457 ? 12.886  -1.821  16.681  1.00 49.41  ? 426  TYR A CE1 1 
ATOM   3221 C CE2 . TYR A 1 457 ? 10.820  -1.213  15.571  1.00 51.18  ? 426  TYR A CE2 1 
ATOM   3222 C CZ  . TYR A 1 457 ? 11.538  -2.056  16.422  1.00 50.66  ? 426  TYR A CZ  1 
ATOM   3223 O OH  . TYR A 1 457 ? 10.957  -3.126  17.008  1.00 52.33  ? 426  TYR A OH  1 
ATOM   3224 N N   . ALA A 1 458 ? 14.061  2.757   11.679  1.00 45.92  ? 427  ALA A N   1 
ATOM   3225 C CA  . ALA A 1 458 ? 14.604  3.892   10.932  1.00 44.91  ? 427  ALA A CA  1 
ATOM   3226 C C   . ALA A 1 458 ? 13.641  5.050   10.911  1.00 45.22  ? 427  ALA A C   1 
ATOM   3227 O O   . ALA A 1 458 ? 12.432  4.836   10.917  1.00 45.77  ? 427  ALA A O   1 
ATOM   3228 C CB  . ALA A 1 458 ? 14.920  3.468   9.518   1.00 45.71  ? 427  ALA A CB  1 
ATOM   3229 N N   . TYR A 1 459 ? 14.179  6.276   10.864  1.00 44.30  ? 428  TYR A N   1 
ATOM   3230 C CA  . TYR A 1 459 ? 13.371  7.483   10.883  1.00 44.24  ? 428  TYR A CA  1 
ATOM   3231 C C   . TYR A 1 459 ? 13.918  8.568   9.944   1.00 44.21  ? 428  TYR A C   1 
ATOM   3232 O O   . TYR A 1 459 ? 15.082  8.547   9.527   1.00 43.14  ? 428  TYR A O   1 
ATOM   3233 C CB  . TYR A 1 459 ? 13.253  8.028   12.329  1.00 43.94  ? 428  TYR A CB  1 
ATOM   3234 C CG  . TYR A 1 459 ? 14.538  8.620   12.879  1.00 43.01  ? 428  TYR A CG  1 
ATOM   3235 C CD1 . TYR A 1 459 ? 14.931  9.906   12.559  1.00 42.41  ? 428  TYR A CD1 1 
ATOM   3236 C CD2 . TYR A 1 459 ? 15.381  7.870   13.678  1.00 42.40  ? 428  TYR A CD2 1 
ATOM   3237 C CE1 . TYR A 1 459 ? 16.140  10.439  13.026  1.00 41.69  ? 428  TYR A CE1 1 
ATOM   3238 C CE2 . TYR A 1 459 ? 16.570  8.375   14.141  1.00 41.72  ? 428  TYR A CE2 1 
ATOM   3239 C CZ  . TYR A 1 459 ? 16.956  9.666   13.829  1.00 43.02  ? 428  TYR A CZ  1 
ATOM   3240 O OH  . TYR A 1 459 ? 18.157  10.170  14.312  1.00 43.15  ? 428  TYR A OH  1 
ATOM   3241 N N   . ILE A 1 460 ? 13.042  9.513   9.607   1.00 44.96  ? 429  ILE A N   1 
ATOM   3242 C CA  . ILE A 1 460 ? 13.445  10.809  9.090   1.00 44.59  ? 429  ILE A CA  1 
ATOM   3243 C C   . ILE A 1 460 ? 12.795  11.851  9.986   1.00 44.57  ? 429  ILE A C   1 
ATOM   3244 O O   . ILE A 1 460 ? 11.589  11.820  10.236  1.00 45.96  ? 429  ILE A O   1 
ATOM   3245 C CB  . ILE A 1 460 ? 13.062  10.998  7.636   1.00 44.83  ? 429  ILE A CB  1 
ATOM   3246 C CG1 . ILE A 1 460 ? 13.610  12.322  7.142   1.00 46.54  ? 429  ILE A CG1 1 
ATOM   3247 C CG2 . ILE A 1 460 ? 11.579  11.020  7.446   1.00 47.00  ? 429  ILE A CG2 1 
ATOM   3248 C CD1 . ILE A 1 460 ? 13.406  12.540  5.658   1.00 50.03  ? 429  ILE A CD1 1 
ATOM   3249 N N   . PHE A 1 461 ? 13.613  12.756  10.484  1.00 43.85  ? 430  PHE A N   1 
ATOM   3250 C CA  . PHE A 1 461 ? 13.193  13.826  11.364  1.00 44.13  ? 430  PHE A CA  1 
ATOM   3251 C C   . PHE A 1 461 ? 12.969  15.064  10.526  1.00 44.16  ? 430  PHE A C   1 
ATOM   3252 O O   . PHE A 1 461 ? 13.904  15.554  9.906   1.00 42.73  ? 430  PHE A O   1 
ATOM   3253 C CB  . PHE A 1 461 ? 14.317  14.089  12.365  1.00 43.20  ? 430  PHE A CB  1 
ATOM   3254 C CG  . PHE A 1 461 ? 13.970  15.062  13.402  1.00 42.98  ? 430  PHE A CG  1 
ATOM   3255 C CD1 . PHE A 1 461 ? 14.243  16.392  13.232  1.00 43.70  ? 430  PHE A CD1 1 
ATOM   3256 C CD2 . PHE A 1 461 ? 13.384  14.645  14.578  1.00 45.21  ? 430  PHE A CD2 1 
ATOM   3257 C CE1 . PHE A 1 461 ? 13.903  17.295  14.205  1.00 44.06  ? 430  PHE A CE1 1 
ATOM   3258 C CE2 . PHE A 1 461 ? 13.077  15.533  15.553  1.00 44.85  ? 430  PHE A CE2 1 
ATOM   3259 C CZ  . PHE A 1 461 ? 13.338  16.861  15.367  1.00 44.45  ? 430  PHE A CZ  1 
ATOM   3260 N N   . GLU A 1 462 ? 11.745  15.584  10.532  1.00 45.85  ? 431  GLU A N   1 
ATOM   3261 C CA  . GLU A 1 462 ? 11.373  16.689  9.634   1.00 47.00  ? 431  GLU A CA  1 
ATOM   3262 C C   . GLU A 1 462 ? 10.855  17.930  10.308  1.00 47.13  ? 431  GLU A C   1 
ATOM   3263 O O   . GLU A 1 462 ? 10.340  18.813  9.632   1.00 48.07  ? 431  GLU A O   1 
ATOM   3264 C CB  . GLU A 1 462 ? 10.286  16.264  8.675   1.00 48.25  ? 431  GLU A CB  1 
ATOM   3265 C CG  . GLU A 1 462 ? 10.455  14.893  8.067   1.00 51.65  ? 431  GLU A CG  1 
ATOM   3266 C CD  . GLU A 1 462 ? 9.300   14.570  7.128   1.00 54.20  ? 431  GLU A CD  1 
ATOM   3267 O OE1 . GLU A 1 462 ? 8.110   14.602  7.581   1.00 53.73  ? 431  GLU A OE1 1 
ATOM   3268 O OE2 . GLU A 1 462 ? 9.605   14.316  5.945   1.00 53.10  ? 431  GLU A OE2 1 
ATOM   3269 N N   . HIS A 1 463 ? 10.962  18.030  11.620  1.00 46.73  ? 432  HIS A N   1 
ATOM   3270 C CA  . HIS A 1 463 ? 10.504  19.246  12.259  1.00 46.85  ? 432  HIS A CA  1 
ATOM   3271 C C   . HIS A 1 463 ? 11.637  20.280  12.459  1.00 46.10  ? 432  HIS A C   1 
ATOM   3272 O O   . HIS A 1 463 ? 12.639  19.998  13.102  1.00 45.21  ? 432  HIS A O   1 
ATOM   3273 C CB  . HIS A 1 463 ? 9.851   18.939  13.586  1.00 47.18  ? 432  HIS A CB  1 
ATOM   3274 C CG  . HIS A 1 463 ? 9.463   20.170  14.320  1.00 47.24  ? 432  HIS A CG  1 
ATOM   3275 N ND1 . HIS A 1 463 ? 8.475   21.010  13.866  1.00 47.64  ? 432  HIS A ND1 1 
ATOM   3276 C CD2 . HIS A 1 463 ? 9.994   20.760  15.412  1.00 48.28  ? 432  HIS A CD2 1 
ATOM   3277 C CE1 . HIS A 1 463 ? 8.377   22.042  14.682  1.00 50.58  ? 432  HIS A CE1 1 
ATOM   3278 N NE2 . HIS A 1 463 ? 9.295   21.919  15.624  1.00 50.11  ? 432  HIS A NE2 1 
ATOM   3279 N N   . ARG A 1 464 ? 11.437  21.470  11.909  1.00 46.84  ? 433  ARG A N   1 
ATOM   3280 C CA  . ARG A 1 464 ? 12.333  22.615  12.078  1.00 46.99  ? 433  ARG A CA  1 
ATOM   3281 C C   . ARG A 1 464 ? 11.990  23.350  13.366  1.00 47.60  ? 433  ARG A C   1 
ATOM   3282 O O   . ARG A 1 464 ? 10.863  23.803  13.543  1.00 48.54  ? 433  ARG A O   1 
ATOM   3283 C CB  . ARG A 1 464 ? 12.158  23.589  10.914  1.00 47.55  ? 433  ARG A CB  1 
ATOM   3284 C CG  . ARG A 1 464 ? 12.934  24.892  11.081  1.00 51.12  ? 433  ARG A CG  1 
ATOM   3285 C CD  . ARG A 1 464 ? 12.673  25.973  10.033  1.00 53.29  ? 433  ARG A CD  1 
ATOM   3286 N NE  . ARG A 1 464 ? 13.903  26.147  9.325   1.00 55.89  ? 433  ARG A NE  1 
ATOM   3287 C CZ  . ARG A 1 464 ? 14.755  27.162  9.436   1.00 57.29  ? 433  ARG A CZ  1 
ATOM   3288 N NH1 . ARG A 1 464 ? 14.515  28.229  10.184  1.00 55.92  ? 433  ARG A NH1 1 
ATOM   3289 N NH2 . ARG A 1 464 ? 15.879  27.094  8.734   1.00 56.73  ? 433  ARG A NH2 1 
ATOM   3290 N N   . ALA A 1 465 ? 12.957  23.511  14.265  1.00 47.49  ? 434  ALA A N   1 
ATOM   3291 C CA  . ALA A 1 465 ? 12.667  24.168  15.542  1.00 47.87  ? 434  ALA A CA  1 
ATOM   3292 C C   . ALA A 1 465 ? 12.188  25.585  15.286  1.00 48.71  ? 434  ALA A C   1 
ATOM   3293 O O   . ALA A 1 465 ? 12.730  26.267  14.427  1.00 48.33  ? 434  ALA A O   1 
ATOM   3294 C CB  . ALA A 1 465 ? 13.872  24.177  16.424  1.00 47.28  ? 434  ALA A CB  1 
ATOM   3295 N N   . SER A 1 466 ? 11.176  26.019  16.031  1.00 49.80  ? 435  SER A N   1 
ATOM   3296 C CA  . SER A 1 466 ? 10.693  27.401  15.958  1.00 51.20  ? 435  SER A CA  1 
ATOM   3297 C C   . SER A 1 466 ? 11.792  28.403  16.337  1.00 50.99  ? 435  SER A C   1 
ATOM   3298 O O   . SER A 1 466 ? 11.787  29.513  15.872  1.00 51.65  ? 435  SER A O   1 
ATOM   3299 C CB  . SER A 1 466 ? 9.478   27.591  16.874  1.00 52.15  ? 435  SER A CB  1 
ATOM   3300 O OG  . SER A 1 466 ? 9.863   27.467  18.238  1.00 53.07  ? 435  SER A OG  1 
ATOM   3301 N N   . THR A 1 467 ? 12.748  27.981  17.148  1.00 51.02  ? 436  THR A N   1 
ATOM   3302 C CA  . THR A 1 467 ? 13.826  28.846  17.637  1.00 51.19  ? 436  THR A CA  1 
ATOM   3303 C C   . THR A 1 467 ? 15.080  28.847  16.789  1.00 50.50  ? 436  THR A C   1 
ATOM   3304 O O   . THR A 1 467 ? 16.062  29.487  17.178  1.00 50.68  ? 436  THR A O   1 
ATOM   3305 C CB  . THR A 1 467 ? 14.246  28.392  19.046  1.00 50.91  ? 436  THR A CB  1 
ATOM   3306 O OG1 . THR A 1 467 ? 14.608  27.004  19.023  1.00 51.60  ? 436  THR A OG1 1 
ATOM   3307 C CG2 . THR A 1 467 ? 13.071  28.457  19.987  1.00 51.82  ? 436  THR A CG2 1 
ATOM   3308 N N   . LEU A 1 468 ? 15.072  28.145  15.654  1.00 50.04  ? 437  LEU A N   1 
ATOM   3309 C CA  . LEU A 1 468 ? 16.263  28.070  14.797  1.00 49.45  ? 437  LEU A CA  1 
ATOM   3310 C C   . LEU A 1 468 ? 16.666  29.462  14.269  1.00 49.69  ? 437  LEU A C   1 
ATOM   3311 O O   . LEU A 1 468 ? 15.814  30.277  13.932  1.00 50.81  ? 437  LEU A O   1 
ATOM   3312 C CB  . LEU A 1 468 ? 16.032  27.091  13.641  1.00 49.56  ? 437  LEU A CB  1 
ATOM   3313 C CG  . LEU A 1 468 ? 17.239  26.261  13.166  1.00 50.84  ? 437  LEU A CG  1 
ATOM   3314 C CD1 . LEU A 1 468 ? 17.652  25.293  14.174  1.00 52.03  ? 437  LEU A CD1 1 
ATOM   3315 C CD2 . LEU A 1 468 ? 16.906  25.491  11.920  1.00 53.66  ? 437  LEU A CD2 1 
ATOM   3316 N N   . THR A 1 469 ? 17.956  29.744  14.227  1.00 48.73  ? 438  THR A N   1 
ATOM   3317 C CA  . THR A 1 469 ? 18.436  31.052  13.785  1.00 49.19  ? 438  THR A CA  1 
ATOM   3318 C C   . THR A 1 469 ? 19.091  30.984  12.423  1.00 48.56  ? 438  THR A C   1 
ATOM   3319 O O   . THR A 1 469 ? 19.440  32.021  11.863  1.00 49.01  ? 438  THR A O   1 
ATOM   3320 C CB  . THR A 1 469 ? 19.428  31.630  14.805  1.00 49.32  ? 438  THR A CB  1 
ATOM   3321 O OG1 . THR A 1 469 ? 20.461  30.670  15.104  1.00 49.65  ? 438  THR A OG1 1 
ATOM   3322 C CG2 . THR A 1 469 ? 18.732  31.839  16.138  1.00 50.56  ? 438  THR A CG2 1 
ATOM   3323 N N   . TRP A 1 470 ? 19.307  29.765  11.916  1.00 47.22  ? 439  TRP A N   1 
ATOM   3324 C CA  . TRP A 1 470 ? 19.756  29.555  10.548  1.00 45.97  ? 439  TRP A CA  1 
ATOM   3325 C C   . TRP A 1 470 ? 18.576  29.870  9.649   1.00 46.22  ? 439  TRP A C   1 
ATOM   3326 O O   . TRP A 1 470 ? 17.456  29.786  10.084  1.00 46.71  ? 439  TRP A O   1 
ATOM   3327 C CB  . TRP A 1 470 ? 20.198  28.104  10.327  1.00 45.00  ? 439  TRP A CB  1 
ATOM   3328 C CG  . TRP A 1 470 ? 21.377  27.761  11.072  1.00 41.57  ? 439  TRP A CG  1 
ATOM   3329 C CD1 . TRP A 1 470 ? 21.421  27.076  12.232  1.00 38.65  ? 439  TRP A CD1 1 
ATOM   3330 C CD2 . TRP A 1 470 ? 22.731  28.103  10.744  1.00 40.24  ? 439  TRP A CD2 1 
ATOM   3331 N NE1 . TRP A 1 470 ? 22.719  26.981  12.669  1.00 38.89  ? 439  TRP A NE1 1 
ATOM   3332 C CE2 . TRP A 1 470 ? 23.545  27.596  11.768  1.00 37.58  ? 439  TRP A CE2 1 
ATOM   3333 C CE3 . TRP A 1 470 ? 23.331  28.802  9.695   1.00 39.57  ? 439  TRP A CE3 1 
ATOM   3334 C CZ2 . TRP A 1 470 ? 24.922  27.747  11.777  1.00 39.93  ? 439  TRP A CZ2 1 
ATOM   3335 C CZ3 . TRP A 1 470 ? 24.698  28.942  9.687   1.00 41.74  ? 439  TRP A CZ3 1 
ATOM   3336 C CH2 . TRP A 1 470 ? 25.494  28.404  10.726  1.00 41.59  ? 439  TRP A CH2 1 
ATOM   3337 N N   . PRO A 1 471 ? 18.836  30.262  8.409   1.00 46.25  ? 440  PRO A N   1 
ATOM   3338 C CA  . PRO A 1 471 ? 17.779  30.721  7.510   1.00 46.62  ? 440  PRO A CA  1 
ATOM   3339 C C   . PRO A 1 471 ? 16.891  29.604  7.031   1.00 47.01  ? 440  PRO A C   1 
ATOM   3340 O O   . PRO A 1 471 ? 17.310  28.453  7.037   1.00 46.60  ? 440  PRO A O   1 
ATOM   3341 C CB  . PRO A 1 471 ? 18.568  31.286  6.332   1.00 46.82  ? 440  PRO A CB  1 
ATOM   3342 C CG  . PRO A 1 471 ? 19.844  30.532  6.332   1.00 45.81  ? 440  PRO A CG  1 
ATOM   3343 C CD  . PRO A 1 471 ? 20.165  30.315  7.766   1.00 45.37  ? 440  PRO A CD  1 
ATOM   3344 N N   . LEU A 1 472 ? 15.688  29.953  6.596   1.00 48.23  ? 441  LEU A N   1 
ATOM   3345 C CA  . LEU A 1 472 ? 14.692  28.995  6.157   1.00 49.14  ? 441  LEU A CA  1 
ATOM   3346 C C   . LEU A 1 472 ? 15.160  28.016  5.078   1.00 47.91  ? 441  LEU A C   1 
ATOM   3347 O O   . LEU A 1 472 ? 14.693  26.870  5.037   1.00 47.64  ? 441  LEU A O   1 
ATOM   3348 C CB  . LEU A 1 472 ? 13.459  29.752  5.643   1.00 51.45  ? 441  LEU A CB  1 
ATOM   3349 C CG  . LEU A 1 472 ? 12.522  30.197  6.766   1.00 54.93  ? 441  LEU A CG  1 
ATOM   3350 C CD1 . LEU A 1 472 ? 11.678  31.422  6.310   1.00 56.90  ? 441  LEU A CD1 1 
ATOM   3351 C CD2 . LEU A 1 472 ? 11.657  28.997  7.191   1.00 56.88  ? 441  LEU A CD2 1 
ATOM   3352 N N   . TRP A 1 473 ? 16.048  28.461  4.192   1.00 46.71  ? 442  TRP A N   1 
ATOM   3353 C CA  . TRP A 1 473 ? 16.442  27.615  3.082   1.00 45.95  ? 442  TRP A CA  1 
ATOM   3354 C C   . TRP A 1 473 ? 17.200  26.371  3.541   1.00 45.04  ? 442  TRP A C   1 
ATOM   3355 O O   . TRP A 1 473 ? 17.256  25.391  2.798   1.00 44.72  ? 442  TRP A O   1 
ATOM   3356 C CB  . TRP A 1 473 ? 17.243  28.388  2.027   1.00 45.65  ? 442  TRP A CB  1 
ATOM   3357 C CG  . TRP A 1 473 ? 18.651  28.810  2.384   1.00 44.77  ? 442  TRP A CG  1 
ATOM   3358 C CD1 . TRP A 1 473 ? 19.060  30.064  2.710   1.00 45.99  ? 442  TRP A CD1 1 
ATOM   3359 C CD2 . TRP A 1 473 ? 19.840  28.008  2.343   1.00 43.60  ? 442  TRP A CD2 1 
ATOM   3360 N NE1 . TRP A 1 473 ? 20.417  30.088  2.922   1.00 45.42  ? 442  TRP A NE1 1 
ATOM   3361 C CE2 . TRP A 1 473 ? 20.918  28.836  2.712   1.00 42.05  ? 442  TRP A CE2 1 
ATOM   3362 C CE3 . TRP A 1 473 ? 20.099  26.662  2.056   1.00 43.80  ? 442  TRP A CE3 1 
ATOM   3363 C CZ2 . TRP A 1 473 ? 22.212  28.387  2.798   1.00 40.83  ? 442  TRP A CZ2 1 
ATOM   3364 C CZ3 . TRP A 1 473 ? 21.413  26.212  2.139   1.00 43.93  ? 442  TRP A CZ3 1 
ATOM   3365 C CH2 . TRP A 1 473 ? 22.448  27.080  2.506   1.00 42.35  ? 442  TRP A CH2 1 
ATOM   3366 N N   . MET A 1 474 ? 17.811  26.431  4.732   1.00 43.93  ? 443  MET A N   1 
ATOM   3367 C CA  . MET A 1 474 ? 18.561  25.303  5.280   1.00 42.81  ? 443  MET A CA  1 
ATOM   3368 C C   . MET A 1 474 ? 17.655  24.229  5.841   1.00 41.96  ? 443  MET A C   1 
ATOM   3369 O O   . MET A 1 474 ? 18.108  23.138  6.149   1.00 41.00  ? 443  MET A O   1 
ATOM   3370 C CB  . MET A 1 474 ? 19.528  25.768  6.361   1.00 42.58  ? 443  MET A CB  1 
ATOM   3371 C CG  . MET A 1 474 ? 20.700  26.574  5.820   1.00 43.71  ? 443  MET A CG  1 
ATOM   3372 S SD  . MET A 1 474 ? 21.883  26.812  7.127   1.00 45.62  ? 443  MET A SD  1 
ATOM   3373 C CE  . MET A 1 474 ? 23.003  27.751  6.311   1.00 47.35  ? 443  MET A CE  1 
ATOM   3374 N N   . GLY A 1 475 ? 16.377  24.543  5.966   1.00 42.11  ? 444  GLY A N   1 
ATOM   3375 C CA  . GLY A 1 475 ? 15.381  23.558  6.352   1.00 42.42  ? 444  GLY A CA  1 
ATOM   3376 C C   . GLY A 1 475 ? 15.605  23.045  7.762   1.00 41.86  ? 444  GLY A C   1 
ATOM   3377 O O   . GLY A 1 475 ? 15.626  23.821  8.707   1.00 42.41  ? 444  GLY A O   1 
ATOM   3378 N N   . VAL A 1 476 ? 15.776  21.736  7.901   1.00 41.48  ? 445  VAL A N   1 
ATOM   3379 C CA  . VAL A 1 476 ? 16.115  21.106  9.193   1.00 40.67  ? 445  VAL A CA  1 
ATOM   3380 C C   . VAL A 1 476 ? 17.564  20.648  9.093   1.00 40.04  ? 445  VAL A C   1 
ATOM   3381 O O   . VAL A 1 476 ? 17.842  19.570  8.589   1.00 39.44  ? 445  VAL A O   1 
ATOM   3382 C CB  . VAL A 1 476 ? 15.237  19.869  9.486   1.00 40.77  ? 445  VAL A CB  1 
ATOM   3383 C CG1 . VAL A 1 476 ? 15.525  19.313  10.873  1.00 40.37  ? 445  VAL A CG1 1 
ATOM   3384 C CG2 . VAL A 1 476 ? 13.767  20.186  9.337   1.00 41.71  ? 445  VAL A CG2 1 
ATOM   3385 N N   . PRO A 1 477 ? 18.510  21.461  9.529   1.00 39.87  ? 446  PRO A N   1 
ATOM   3386 C CA  . PRO A 1 477 ? 19.921  21.110  9.344   1.00 39.03  ? 446  PRO A CA  1 
ATOM   3387 C C   . PRO A 1 477 ? 20.414  19.994  10.248  1.00 38.77  ? 446  PRO A C   1 
ATOM   3388 O O   . PRO A 1 477 ? 19.827  19.652  11.262  1.00 38.25  ? 446  PRO A O   1 
ATOM   3389 C CB  . PRO A 1 477 ? 20.644  22.398  9.670   1.00 38.80  ? 446  PRO A CB  1 
ATOM   3390 C CG  . PRO A 1 477 ? 19.601  23.412  9.779   1.00 40.49  ? 446  PRO A CG  1 
ATOM   3391 C CD  . PRO A 1 477 ? 18.345  22.745  10.211  1.00 40.22  ? 446  PRO A CD  1 
ATOM   3392 N N   . HIS A 1 478 ? 21.522  19.431  9.826   1.00 39.02  ? 447  HIS A N   1 
ATOM   3393 C CA  . HIS A 1 478 ? 22.315  18.418  10.562  1.00 38.95  ? 447  HIS A CA  1 
ATOM   3394 C C   . HIS A 1 478 ? 22.564  18.910  12.010  1.00 38.66  ? 447  HIS A C   1 
ATOM   3395 O O   . HIS A 1 478 ? 23.140  19.971  12.227  1.00 38.22  ? 447  HIS A O   1 
ATOM   3396 C CB  . HIS A 1 478 ? 23.631  18.266  9.761   1.00 38.50  ? 447  HIS A CB  1 
ATOM   3397 C CG  . HIS A 1 478 ? 24.553  17.191  10.216  1.00 39.03  ? 447  HIS A CG  1 
ATOM   3398 N ND1 . HIS A 1 478 ? 24.255  15.851  10.091  1.00 40.81  ? 447  HIS A ND1 1 
ATOM   3399 C CD2 . HIS A 1 478 ? 25.833  17.254  10.658  1.00 40.13  ? 447  HIS A CD2 1 
ATOM   3400 C CE1 . HIS A 1 478 ? 25.281  15.139  10.521  1.00 41.66  ? 447  HIS A CE1 1 
ATOM   3401 N NE2 . HIS A 1 478 ? 26.262  15.965  10.845  1.00 40.86  ? 447  HIS A NE2 1 
ATOM   3402 N N   . GLY A 1 479 ? 22.080  18.142  12.982  1.00 38.93  ? 448  GLY A N   1 
ATOM   3403 C CA  . GLY A 1 479 ? 22.235  18.434  14.395  1.00 38.51  ? 448  GLY A CA  1 
ATOM   3404 C C   . GLY A 1 479 ? 20.975  18.947  15.093  1.00 38.66  ? 448  GLY A C   1 
ATOM   3405 O O   . GLY A 1 479 ? 20.923  18.946  16.318  1.00 39.14  ? 448  GLY A O   1 
ATOM   3406 N N   . TYR A 1 480 ? 19.967  19.387  14.348  1.00 38.38  ? 449  TYR A N   1 
ATOM   3407 C CA  . TYR A 1 480 ? 18.838  20.103  14.971  1.00 39.04  ? 449  TYR A CA  1 
ATOM   3408 C C   . TYR A 1 480 ? 17.672  19.226  15.411  1.00 39.80  ? 449  TYR A C   1 
ATOM   3409 O O   . TYR A 1 480 ? 16.661  19.719  15.814  1.00 40.24  ? 449  TYR A O   1 
ATOM   3410 C CB  . TYR A 1 480 ? 18.426  21.306  14.132  1.00 38.42  ? 449  TYR A CB  1 
ATOM   3411 C CG  . TYR A 1 480 ? 19.468  22.374  14.317  1.00 37.58  ? 449  TYR A CG  1 
ATOM   3412 C CD1 . TYR A 1 480 ? 20.527  22.502  13.443  1.00 36.78  ? 449  TYR A CD1 1 
ATOM   3413 C CD2 . TYR A 1 480 ? 19.464  23.189  15.458  1.00 36.39  ? 449  TYR A CD2 1 
ATOM   3414 C CE1 . TYR A 1 480 ? 21.523  23.479  13.656  1.00 35.07  ? 449  TYR A CE1 1 
ATOM   3415 C CE2 . TYR A 1 480 ? 20.437  24.128  15.666  1.00 35.26  ? 449  TYR A CE2 1 
ATOM   3416 C CZ  . TYR A 1 480 ? 21.455  24.266  14.766  1.00 34.32  ? 449  TYR A CZ  1 
ATOM   3417 O OH  . TYR A 1 480 ? 22.405  25.198  15.006  1.00 36.62  ? 449  TYR A OH  1 
ATOM   3418 N N   . GLU A 1 481 ? 17.877  17.909  15.431  1.00 40.31  ? 450  GLU A N   1 
ATOM   3419 C CA  . GLU A 1 481 ? 16.972  17.009  16.137  1.00 40.66  ? 450  GLU A CA  1 
ATOM   3420 C C   . GLU A 1 481 ? 17.416  16.807  17.575  1.00 40.47  ? 450  GLU A C   1 
ATOM   3421 O O   . GLU A 1 481 ? 16.618  16.428  18.429  1.00 40.25  ? 450  GLU A O   1 
ATOM   3422 C CB  . GLU A 1 481 ? 16.868  15.667  15.439  1.00 40.64  ? 450  GLU A CB  1 
ATOM   3423 C CG  . GLU A 1 481 ? 17.932  14.667  15.847  1.00 43.05  ? 450  GLU A CG  1 
ATOM   3424 C CD  . GLU A 1 481 ? 19.302  14.853  15.180  1.00 42.70  ? 450  GLU A CD  1 
ATOM   3425 O OE1 . GLU A 1 481 ? 19.680  15.976  14.780  1.00 41.90  ? 450  GLU A OE1 1 
ATOM   3426 O OE2 . GLU A 1 481 ? 20.009  13.831  15.077  1.00 44.37  ? 450  GLU A OE2 1 
ATOM   3427 N N   . ILE A 1 482 ? 18.693  17.059  17.849  1.00 40.28  ? 451  ILE A N   1 
ATOM   3428 C CA  . ILE A 1 482 ? 19.265  16.638  19.142  1.00 39.91  ? 451  ILE A CA  1 
ATOM   3429 C C   . ILE A 1 482 ? 18.577  17.306  20.349  1.00 39.96  ? 451  ILE A C   1 
ATOM   3430 O O   . ILE A 1 482 ? 18.249  16.649  21.345  1.00 40.71  ? 451  ILE A O   1 
ATOM   3431 C CB  . ILE A 1 482 ? 20.775  16.931  19.210  1.00 39.27  ? 451  ILE A CB  1 
ATOM   3432 C CG1 . ILE A 1 482 ? 21.539  16.198  18.107  1.00 38.67  ? 451  ILE A CG1 1 
ATOM   3433 C CG2 . ILE A 1 482 ? 21.303  16.529  20.579  1.00 39.00  ? 451  ILE A CG2 1 
ATOM   3434 C CD1 . ILE A 1 482 ? 22.978  16.756  17.917  1.00 39.33  ? 451  ILE A CD1 1 
ATOM   3435 N N   . GLU A 1 483 ? 18.358  18.608  20.259  1.00 39.65  ? 452  GLU A N   1 
ATOM   3436 C CA  . GLU A 1 483 ? 17.687  19.337  21.327  1.00 40.12  ? 452  GLU A CA  1 
ATOM   3437 C C   . GLU A 1 483 ? 16.291  18.775  21.644  1.00 40.39  ? 452  GLU A C   1 
ATOM   3438 O O   . GLU A 1 483 ? 15.854  18.889  22.777  1.00 40.74  ? 452  GLU A O   1 
ATOM   3439 C CB  . GLU A 1 483 ? 17.598  20.818  20.995  1.00 40.87  ? 452  GLU A CB  1 
ATOM   3440 C CG  . GLU A 1 483 ? 16.832  21.130  19.712  1.00 43.02  ? 452  GLU A CG  1 
ATOM   3441 C CD  . GLU A 1 483 ? 17.278  22.438  19.047  1.00 43.66  ? 452  GLU A CD  1 
ATOM   3442 O OE1 . GLU A 1 483 ? 16.427  23.311  18.787  1.00 45.08  ? 452  GLU A OE1 1 
ATOM   3443 O OE2 . GLU A 1 483 ? 18.470  22.589  18.772  1.00 42.68  ? 452  GLU A OE2 1 
ATOM   3444 N N   . PHE A 1 484 ? 15.623  18.143  20.677  1.00 39.84  ? 453  PHE A N   1 
ATOM   3445 C CA  . PHE A 1 484 ? 14.317  17.510  20.912  1.00 40.75  ? 453  PHE A CA  1 
ATOM   3446 C C   . PHE A 1 484 ? 14.410  16.155  21.626  1.00 40.82  ? 453  PHE A C   1 
ATOM   3447 O O   . PHE A 1 484 ? 13.696  15.924  22.544  1.00 41.31  ? 453  PHE A O   1 
ATOM   3448 C CB  . PHE A 1 484 ? 13.534  17.389  19.598  1.00 41.38  ? 453  PHE A CB  1 
ATOM   3449 C CG  . PHE A 1 484 ? 13.096  18.730  19.037  1.00 41.28  ? 453  PHE A CG  1 
ATOM   3450 C CD1 . PHE A 1 484 ? 11.880  19.280  19.393  1.00 42.40  ? 453  PHE A CD1 1 
ATOM   3451 C CD2 . PHE A 1 484 ? 13.903  19.424  18.173  1.00 40.39  ? 453  PHE A CD2 1 
ATOM   3452 C CE1 . PHE A 1 484 ? 11.496  20.511  18.892  1.00 44.70  ? 453  PHE A CE1 1 
ATOM   3453 C CE2 . PHE A 1 484 ? 13.526  20.657  17.679  1.00 42.64  ? 453  PHE A CE2 1 
ATOM   3454 C CZ  . PHE A 1 484 ? 12.318  21.198  18.032  1.00 42.62  ? 453  PHE A CZ  1 
ATOM   3455 N N   . ILE A 1 485 ? 15.335  15.296  21.223  1.00 41.14  ? 454  ILE A N   1 
ATOM   3456 C CA  . ILE A 1 485 ? 15.611  14.018  21.882  1.00 41.40  ? 454  ILE A CA  1 
ATOM   3457 C C   . ILE A 1 485 ? 15.974  14.198  23.358  1.00 41.41  ? 454  ILE A C   1 
ATOM   3458 O O   . ILE A 1 485 ? 15.496  13.457  24.211  1.00 41.61  ? 454  ILE A O   1 
ATOM   3459 C CB  . ILE A 1 485 ? 16.826  13.303  21.182  1.00 41.07  ? 454  ILE A CB  1 
ATOM   3460 C CG1 . ILE A 1 485 ? 16.601  13.082  19.681  1.00 41.95  ? 454  ILE A CG1 1 
ATOM   3461 C CG2 . ILE A 1 485 ? 17.135  11.977  21.852  1.00 40.32  ? 454  ILE A CG2 1 
ATOM   3462 C CD1 . ILE A 1 485 ? 15.278  12.609  19.375  1.00 45.19  ? 454  ILE A CD1 1 
ATOM   3463 N N   . PHE A 1 486 ? 16.843  15.167  23.641  1.00 41.05  ? 455  PHE A N   1 
ATOM   3464 C CA  . PHE A 1 486 ? 17.259  15.472  25.010  1.00 41.42  ? 455  PHE A CA  1 
ATOM   3465 C C   . PHE A 1 486 ? 16.193  16.224  25.830  1.00 42.65  ? 455  PHE A C   1 
ATOM   3466 O O   . PHE A 1 486 ? 16.319  16.355  27.052  1.00 42.56  ? 455  PHE A O   1 
ATOM   3467 C CB  . PHE A 1 486 ? 18.573  16.249  25.030  1.00 40.92  ? 455  PHE A CB  1 
ATOM   3468 C CG  . PHE A 1 486 ? 19.798  15.375  24.928  1.00 39.36  ? 455  PHE A CG  1 
ATOM   3469 C CD1 . PHE A 1 486 ? 20.258  14.938  23.700  1.00 38.39  ? 455  PHE A CD1 1 
ATOM   3470 C CD2 . PHE A 1 486 ? 20.479  14.987  26.066  1.00 40.54  ? 455  PHE A CD2 1 
ATOM   3471 C CE1 . PHE A 1 486 ? 21.416  14.119  23.612  1.00 39.92  ? 455  PHE A CE1 1 
ATOM   3472 C CE2 . PHE A 1 486 ? 21.633  14.175  25.989  1.00 39.87  ? 455  PHE A CE2 1 
ATOM   3473 C CZ  . PHE A 1 486 ? 22.098  13.754  24.748  1.00 38.86  ? 455  PHE A CZ  1 
ATOM   3474 N N   . GLY A 1 487 ? 15.145  16.709  25.174  1.00 43.19  ? 456  GLY A N   1 
ATOM   3475 C CA  . GLY A 1 487 ? 14.015  17.275  25.888  1.00 44.28  ? 456  GLY A CA  1 
ATOM   3476 C C   . GLY A 1 487 ? 14.125  18.731  26.278  1.00 44.59  ? 456  GLY A C   1 
ATOM   3477 O O   . GLY A 1 487 ? 13.392  19.172  27.143  1.00 45.67  ? 456  GLY A O   1 
ATOM   3478 N N   . LEU A 1 488 ? 15.004  19.495  25.633  1.00 44.48  ? 457  LEU A N   1 
ATOM   3479 C CA  . LEU A 1 488 ? 15.126  20.924  25.915  1.00 45.09  ? 457  LEU A CA  1 
ATOM   3480 C C   . LEU A 1 488 ? 13.827  21.723  25.841  1.00 46.68  ? 457  LEU A C   1 
ATOM   3481 O O   . LEU A 1 488 ? 13.604  22.608  26.657  1.00 47.52  ? 457  LEU A O   1 
ATOM   3482 C CB  . LEU A 1 488 ? 16.170  21.562  25.009  1.00 44.63  ? 457  LEU A CB  1 
ATOM   3483 C CG  . LEU A 1 488 ? 17.593  21.582  25.578  1.00 43.61  ? 457  LEU A CG  1 
ATOM   3484 C CD1 . LEU A 1 488 ? 18.222  20.177  25.597  1.00 43.59  ? 457  LEU A CD1 1 
ATOM   3485 C CD2 . LEU A 1 488 ? 18.457  22.515  24.799  1.00 42.61  ? 457  LEU A CD2 1 
ATOM   3486 N N   . PRO A 1 489 ? 12.975  21.460  24.863  1.00 47.65  ? 458  PRO A N   1 
ATOM   3487 C CA  . PRO A 1 489 ? 11.698  22.173  24.792  1.00 49.28  ? 458  PRO A CA  1 
ATOM   3488 C C   . PRO A 1 489 ? 10.867  22.163  26.070  1.00 50.89  ? 458  PRO A C   1 
ATOM   3489 O O   . PRO A 1 489 ? 10.026  23.032  26.201  1.00 51.44  ? 458  PRO A O   1 
ATOM   3490 C CB  . PRO A 1 489 ? 10.988  21.479  23.628  1.00 49.28  ? 458  PRO A CB  1 
ATOM   3491 C CG  . PRO A 1 489 ? 12.167  21.116  22.730  1.00 47.54  ? 458  PRO A CG  1 
ATOM   3492 C CD  . PRO A 1 489 ? 13.166  20.571  23.700  1.00 46.92  ? 458  PRO A CD  1 
ATOM   3493 N N   . LEU A 1 490 ? 11.117  21.232  26.979  1.00 52.03  ? 459  LEU A N   1 
ATOM   3494 C CA  . LEU A 1 490 ? 10.437  21.201  28.282  1.00 53.99  ? 459  LEU A CA  1 
ATOM   3495 C C   . LEU A 1 490 ? 10.813  22.352  29.204  1.00 55.23  ? 459  LEU A C   1 
ATOM   3496 O O   . LEU A 1 490 ? 10.084  22.648  30.128  1.00 56.53  ? 459  LEU A O   1 
ATOM   3497 C CB  . LEU A 1 490 ? 10.723  19.882  29.021  1.00 53.85  ? 459  LEU A CB  1 
ATOM   3498 C CG  . LEU A 1 490 ? 9.842   18.668  28.708  1.00 54.23  ? 459  LEU A CG  1 
ATOM   3499 C CD1 . LEU A 1 490 ? 9.716   18.468  27.241  1.00 54.32  ? 459  LEU A CD1 1 
ATOM   3500 C CD2 . LEU A 1 490 ? 10.432  17.429  29.312  1.00 54.67  ? 459  LEU A CD2 1 
ATOM   3501 N N   . ASP A 1 491 ? 11.963  22.971  28.973  1.00 56.07  ? 460  ASP A N   1 
ATOM   3502 C CA  . ASP A 1 491 ? 12.388  24.131  29.741  1.00 57.80  ? 460  ASP A CA  1 
ATOM   3503 C C   . ASP A 1 491 ? 11.645  25.376  29.256  1.00 59.16  ? 460  ASP A C   1 
ATOM   3504 O O   . ASP A 1 491 ? 11.903  25.864  28.161  1.00 58.71  ? 460  ASP A O   1 
ATOM   3505 C CB  . ASP A 1 491 ? 13.900  24.329  29.590  1.00 57.51  ? 460  ASP A CB  1 
ATOM   3506 C CG  . ASP A 1 491 ? 14.451  25.396  30.525  1.00 58.73  ? 460  ASP A CG  1 
ATOM   3507 O OD1 . ASP A 1 491 ? 13.685  26.255  31.013  1.00 61.81  ? 460  ASP A OD1 1 
ATOM   3508 O OD2 . ASP A 1 491 ? 15.645  25.435  30.837  1.00 60.58  ? 460  ASP A OD2 1 
ATOM   3509 N N   . PRO A 1 492 ? 10.735  25.918  30.058  1.00 61.56  ? 461  PRO A N   1 
ATOM   3510 C CA  . PRO A 1 492 ? 9.851   26.987  29.543  1.00 62.67  ? 461  PRO A CA  1 
ATOM   3511 C C   . PRO A 1 492 ? 10.614  28.282  29.252  1.00 62.52  ? 461  PRO A C   1 
ATOM   3512 O O   . PRO A 1 492 ? 10.207  29.052  28.385  1.00 63.45  ? 461  PRO A O   1 
ATOM   3513 C CB  . PRO A 1 492 ? 8.800   27.179  30.655  1.00 64.18  ? 461  PRO A CB  1 
ATOM   3514 C CG  . PRO A 1 492 ? 9.129   26.174  31.760  1.00 63.67  ? 461  PRO A CG  1 
ATOM   3515 C CD  . PRO A 1 492 ? 10.506  25.636  31.492  1.00 62.28  ? 461  PRO A CD  1 
ATOM   3516 N N   . SER A 1 493 ? 11.742  28.484  29.919  1.00 62.20  ? 462  SER A N   1 
ATOM   3517 C CA  . SER A 1 493 ? 12.624  29.621  29.607  1.00 62.43  ? 462  SER A CA  1 
ATOM   3518 C C   . SER A 1 493 ? 13.239  29.640  28.173  1.00 61.36  ? 462  SER A C   1 
ATOM   3519 O O   . SER A 1 493 ? 13.733  30.683  27.724  1.00 61.18  ? 462  SER A O   1 
ATOM   3520 C CB  . SER A 1 493 ? 13.744  29.726  30.659  1.00 62.36  ? 462  SER A CB  1 
ATOM   3521 O OG  . SER A 1 493 ? 14.767  28.759  30.454  1.00 62.79  ? 462  SER A OG  1 
ATOM   3522 N N   . LEU A 1 494 ? 13.196  28.506  27.457  1.00 60.51  ? 463  LEU A N   1 
ATOM   3523 C CA  . LEU A 1 494 ? 13.754  28.415  26.095  1.00 59.14  ? 463  LEU A CA  1 
ATOM   3524 C C   . LEU A 1 494 ? 12.780  28.807  24.947  1.00 59.32  ? 463  LEU A C   1 
ATOM   3525 O O   . LEU A 1 494 ? 13.205  28.954  23.795  1.00 58.48  ? 463  LEU A O   1 
ATOM   3526 C CB  . LEU A 1 494 ? 14.381  27.022  25.846  1.00 57.36  ? 463  LEU A CB  1 
ATOM   3527 C CG  . LEU A 1 494 ? 15.578  26.620  26.747  1.00 56.68  ? 463  LEU A CG  1 
ATOM   3528 C CD1 . LEU A 1 494 ? 16.092  25.210  26.393  1.00 54.09  ? 463  LEU A CD1 1 
ATOM   3529 C CD2 . LEU A 1 494 ? 16.755  27.614  26.739  1.00 54.30  ? 463  LEU A CD2 1 
ATOM   3530 N N   . ASN A 1 495 ? 11.502  28.991  25.248  1.00 60.39  ? 464  ASN A N   1 
ATOM   3531 C CA  . ASN A 1 495 ? 10.545  29.597  24.275  1.00 61.65  ? 464  ASN A CA  1 
ATOM   3532 C C   . ASN A 1 495 ? 10.132  28.712  23.101  1.00 59.75  ? 464  ASN A C   1 
ATOM   3533 O O   . ASN A 1 495 ? 9.777   29.209  22.038  1.00 59.52  ? 464  ASN A O   1 
ATOM   3534 C CB  . ASN A 1 495 ? 11.057  30.943  23.690  1.00 62.33  ? 464  ASN A CB  1 
ATOM   3535 C CG  . ASN A 1 495 ? 11.208  32.020  24.726  1.00 68.14  ? 464  ASN A CG  1 
ATOM   3536 O OD1 . ASN A 1 495 ? 10.619  31.946  25.814  1.00 66.99  ? 464  ASN A OD1 1 
ATOM   3537 N ND2 . ASN A 1 495 ? 12.004  33.052  24.387  1.00 81.87  ? 464  ASN A ND2 1 
ATOM   3538 N N   . TYR A 1 496 ? 10.183  27.405  23.282  1.00 58.26  ? 465  TYR A N   1 
ATOM   3539 C CA  . TYR A 1 496 ? 9.609   26.510  22.302  1.00 57.03  ? 465  TYR A CA  1 
ATOM   3540 C C   . TYR A 1 496 ? 8.108   26.584  22.417  1.00 57.65  ? 465  TYR A C   1 
ATOM   3541 O O   . TYR A 1 496 ? 7.602   26.986  23.434  1.00 58.74  ? 465  TYR A O   1 
ATOM   3542 C CB  . TYR A 1 496 ? 10.068  25.092  22.548  1.00 56.05  ? 465  TYR A CB  1 
ATOM   3543 C CG  . TYR A 1 496 ? 11.522  24.841  22.220  1.00 53.63  ? 465  TYR A CG  1 
ATOM   3544 C CD1 . TYR A 1 496 ? 11.899  24.402  20.971  1.00 51.58  ? 465  TYR A CD1 1 
ATOM   3545 C CD2 . TYR A 1 496 ? 12.517  25.017  23.175  1.00 52.05  ? 465  TYR A CD2 1 
ATOM   3546 C CE1 . TYR A 1 496 ? 13.222  24.165  20.677  1.00 51.27  ? 465  TYR A CE1 1 
ATOM   3547 C CE2 . TYR A 1 496 ? 13.842  24.769  22.887  1.00 50.35  ? 465  TYR A CE2 1 
ATOM   3548 C CZ  . TYR A 1 496 ? 14.191  24.355  21.637  1.00 49.61  ? 465  TYR A CZ  1 
ATOM   3549 O OH  . TYR A 1 496 ? 15.502  24.074  21.343  1.00 49.74  ? 465  TYR A OH  1 
ATOM   3550 N N   . THR A 1 497 ? 7.387   26.201  21.374  1.00 57.71  ? 466  THR A N   1 
ATOM   3551 C CA  . THR A 1 497 ? 5.918   26.144  21.433  1.00 58.40  ? 466  THR A CA  1 
ATOM   3552 C C   . THR A 1 497 ? 5.450   24.973  22.271  1.00 58.93  ? 466  THR A C   1 
ATOM   3553 O O   . THR A 1 497 ? 6.217   24.071  22.583  1.00 58.61  ? 466  THR A O   1 
ATOM   3554 C CB  . THR A 1 497 ? 5.280   26.007  20.029  1.00 58.18  ? 466  THR A CB  1 
ATOM   3555 O OG1 . THR A 1 497 ? 5.526   24.693  19.486  1.00 57.29  ? 466  THR A OG1 1 
ATOM   3556 C CG2 . THR A 1 497 ? 5.884   27.001  19.026  1.00 56.30  ? 466  THR A CG2 1 
ATOM   3557 N N   . THR A 1 498 ? 4.177   24.981  22.613  1.00 60.29  ? 467  THR A N   1 
ATOM   3558 C CA  . THR A 1 498 ? 3.572   23.880  23.348  1.00 61.01  ? 467  THR A CA  1 
ATOM   3559 C C   . THR A 1 498 ? 3.613   22.564  22.555  1.00 60.50  ? 467  THR A C   1 
ATOM   3560 O O   . THR A 1 498 ? 3.826   21.494  23.122  1.00 60.26  ? 467  THR A O   1 
ATOM   3561 C CB  . THR A 1 498 ? 2.095   24.238  23.730  1.00 62.85  ? 467  THR A CB  1 
ATOM   3562 O OG1 . THR A 1 498 ? 2.098   25.157  24.826  1.00 63.28  ? 467  THR A OG1 1 
ATOM   3563 C CG2 . THR A 1 498 ? 1.335   23.016  24.301  1.00 63.63  ? 467  THR A CG2 1 
ATOM   3564 N N   . GLU A 1 499 ? 3.366   22.658  21.251  1.00 60.45  ? 468  GLU A N   1 
ATOM   3565 C CA  . GLU A 1 499 ? 3.361   21.494  20.358  1.00 60.30  ? 468  GLU A CA  1 
ATOM   3566 C C   . GLU A 1 499 ? 4.759   20.848  20.339  1.00 57.84  ? 468  GLU A C   1 
ATOM   3567 O O   . GLU A 1 499 ? 4.882   19.632  20.356  1.00 56.48  ? 468  GLU A O   1 
ATOM   3568 C CB  . GLU A 1 499 ? 2.918   21.899  18.944  1.00 61.09  ? 468  GLU A CB  1 
ATOM   3569 C CG  . GLU A 1 499 ? 1.664   22.809  18.883  1.00 67.27  ? 468  GLU A CG  1 
ATOM   3570 C CD  . GLU A 1 499 ? 2.002   24.305  18.633  1.00 72.10  ? 468  GLU A CD  1 
ATOM   3571 O OE1 . GLU A 1 499 ? 1.944   25.122  19.609  1.00 73.96  ? 468  GLU A OE1 1 
ATOM   3572 O OE2 . GLU A 1 499 ? 2.357   24.661  17.461  1.00 73.60  ? 468  GLU A OE2 1 
ATOM   3573 N N   . GLU A 1 500 ? 5.788   21.697  20.323  1.00 56.09  ? 469  GLU A N   1 
ATOM   3574 C CA  . GLU A 1 500 ? 7.181   21.268  20.400  1.00 54.74  ? 469  GLU A CA  1 
ATOM   3575 C C   . GLU A 1 500 ? 7.540   20.577  21.709  1.00 54.24  ? 469  GLU A C   1 
ATOM   3576 O O   . GLU A 1 500 ? 8.330   19.661  21.715  1.00 53.15  ? 469  GLU A O   1 
ATOM   3577 C CB  . GLU A 1 500 ? 8.118   22.457  20.172  1.00 53.65  ? 469  GLU A CB  1 
ATOM   3578 C CG  . GLU A 1 500 ? 8.215   22.788  18.711  1.00 52.56  ? 469  GLU A CG  1 
ATOM   3579 C CD  . GLU A 1 500 ? 9.058   24.000  18.427  1.00 51.58  ? 469  GLU A CD  1 
ATOM   3580 O OE1 . GLU A 1 500 ? 8.936   25.001  19.163  1.00 49.08  ? 469  GLU A OE1 1 
ATOM   3581 O OE2 . GLU A 1 500 ? 9.803   23.954  17.430  1.00 49.92  ? 469  GLU A OE2 1 
ATOM   3582 N N   . ARG A 1 501 ? 6.956   21.040  22.805  1.00 54.97  ? 470  ARG A N   1 
ATOM   3583 C CA  . ARG A 1 501 ? 7.129   20.414  24.099  1.00 55.44  ? 470  ARG A CA  1 
ATOM   3584 C C   . ARG A 1 501 ? 6.510   19.018  24.073  1.00 54.62  ? 470  ARG A C   1 
ATOM   3585 O O   . ARG A 1 501 ? 7.126   18.083  24.533  1.00 53.92  ? 470  ARG A O   1 
ATOM   3586 C CB  . ARG A 1 501 ? 6.513   21.291  25.186  1.00 57.33  ? 470  ARG A CB  1 
ATOM   3587 C CG  . ARG A 1 501 ? 6.839   20.894  26.632  1.00 62.58  ? 470  ARG A CG  1 
ATOM   3588 C CD  . ARG A 1 501 ? 5.755   21.353  27.693  1.00 69.70  ? 470  ARG A CD  1 
ATOM   3589 N NE  . ARG A 1 501 ? 4.841   20.250  28.032  1.00 74.76  ? 470  ARG A NE  1 
ATOM   3590 C CZ  . ARG A 1 501 ? 3.505   20.237  27.856  1.00 79.49  ? 470  ARG A CZ  1 
ATOM   3591 N NH1 . ARG A 1 501 ? 2.829   21.299  27.380  1.00 80.74  ? 470  ARG A NH1 1 
ATOM   3592 N NH2 . ARG A 1 501 ? 2.832   19.140  28.190  1.00 81.16  ? 470  ARG A NH2 1 
ATOM   3593 N N   . ILE A 1 502 ? 5.314   18.871  23.490  1.00 54.51  ? 471  ILE A N   1 
ATOM   3594 C CA  . ILE A 1 502 ? 4.637   17.563  23.396  1.00 54.08  ? 471  ILE A CA  1 
ATOM   3595 C C   . ILE A 1 502 ? 5.391   16.590  22.445  1.00 52.44  ? 471  ILE A C   1 
ATOM   3596 O O   . ILE A 1 502 ? 5.537   15.400  22.732  1.00 52.27  ? 471  ILE A O   1 
ATOM   3597 C CB  . ILE A 1 502 ? 3.140   17.781  22.992  1.00 55.30  ? 471  ILE A CB  1 
ATOM   3598 C CG1 . ILE A 1 502 ? 2.335   18.247  24.212  1.00 57.27  ? 471  ILE A CG1 1 
ATOM   3599 C CG2 . ILE A 1 502 ? 2.490   16.527  22.392  1.00 54.88  ? 471  ILE A CG2 1 
ATOM   3600 C CD1 . ILE A 1 502 ? 1.110   19.051  23.851  1.00 58.80  ? 471  ILE A CD1 1 
ATOM   3601 N N   . PHE A 1 503 ? 5.878   17.128  21.335  1.00 50.70  ? 472  PHE A N   1 
ATOM   3602 C CA  . PHE A 1 503 ? 6.727   16.406  20.376  1.00 49.40  ? 472  PHE A CA  1 
ATOM   3603 C C   . PHE A 1 503 ? 8.020   15.912  21.044  1.00 48.25  ? 472  PHE A C   1 
ATOM   3604 O O   . PHE A 1 503 ? 8.392   14.753  20.892  1.00 48.07  ? 472  PHE A O   1 
ATOM   3605 C CB  . PHE A 1 503 ? 7.033   17.337  19.201  1.00 48.81  ? 472  PHE A CB  1 
ATOM   3606 C CG  . PHE A 1 503 ? 7.915   16.750  18.131  1.00 48.22  ? 472  PHE A CG  1 
ATOM   3607 C CD1 . PHE A 1 503 ? 7.640   15.512  17.570  1.00 48.47  ? 472  PHE A CD1 1 
ATOM   3608 C CD2 . PHE A 1 503 ? 8.987   17.485  17.640  1.00 45.35  ? 472  PHE A CD2 1 
ATOM   3609 C CE1 . PHE A 1 503 ? 8.452   14.997  16.569  1.00 48.05  ? 472  PHE A CE1 1 
ATOM   3610 C CE2 . PHE A 1 503 ? 9.786   16.985  16.653  1.00 46.21  ? 472  PHE A CE2 1 
ATOM   3611 C CZ  . PHE A 1 503 ? 9.529   15.741  16.109  1.00 47.53  ? 472  PHE A CZ  1 
ATOM   3612 N N   . ALA A 1 504 ? 8.681   16.761  21.823  1.00 47.52  ? 473  ALA A N   1 
ATOM   3613 C CA  . ALA A 1 504 ? 9.880   16.338  22.556  1.00 46.89  ? 473  ALA A CA  1 
ATOM   3614 C C   . ALA A 1 504 ? 9.555   15.204  23.531  1.00 48.16  ? 473  ALA A C   1 
ATOM   3615 O O   . ALA A 1 504 ? 10.274  14.229  23.604  1.00 48.08  ? 473  ALA A O   1 
ATOM   3616 C CB  . ALA A 1 504 ? 10.465  17.478  23.263  1.00 45.95  ? 473  ALA A CB  1 
ATOM   3617 N N   . GLN A 1 505 ? 8.440   15.307  24.244  1.00 49.96  ? 474  GLN A N   1 
ATOM   3618 C CA  . GLN A 1 505 ? 8.020   14.232  25.151  1.00 51.27  ? 474  GLN A CA  1 
ATOM   3619 C C   . GLN A 1 505 ? 7.858   12.915  24.400  1.00 51.17  ? 474  GLN A C   1 
ATOM   3620 O O   . GLN A 1 505 ? 8.297   11.856  24.894  1.00 51.22  ? 474  GLN A O   1 
ATOM   3621 C CB  . GLN A 1 505 ? 6.733   14.589  25.922  1.00 52.45  ? 474  GLN A CB  1 
ATOM   3622 C CG  . GLN A 1 505 ? 6.927   15.729  26.983  1.00 55.67  ? 474  GLN A CG  1 
ATOM   3623 C CD  . GLN A 1 505 ? 5.608   16.149  27.669  1.00 61.14  ? 474  GLN A CD  1 
ATOM   3624 O OE1 . GLN A 1 505 ? 4.779   16.860  27.083  1.00 63.79  ? 474  GLN A OE1 1 
ATOM   3625 N NE2 . GLN A 1 505 ? 5.419   15.698  28.901  1.00 63.49  ? 474  GLN A NE2 1 
ATOM   3626 N N   . ARG A 1 506 ? 7.272   12.984  23.201  1.00 51.07  ? 475  ARG A N   1 
ATOM   3627 C CA  . ARG A 1 506 ? 7.085   11.805  22.349  1.00 51.32  ? 475  ARG A CA  1 
ATOM   3628 C C   . ARG A 1 506 ? 8.418   11.148  21.987  1.00 49.58  ? 475  ARG A C   1 
ATOM   3629 O O   . ARG A 1 506 ? 8.561   9.918   22.111  1.00 49.01  ? 475  ARG A O   1 
ATOM   3630 C CB  . ARG A 1 506 ? 6.358   12.172  21.050  1.00 51.69  ? 475  ARG A CB  1 
ATOM   3631 C CG  . ARG A 1 506 ? 4.935   11.749  20.983  1.00 54.15  ? 475  ARG A CG  1 
ATOM   3632 C CD  . ARG A 1 506 ? 4.194   12.273  19.725  1.00 55.16  ? 475  ARG A CD  1 
ATOM   3633 N NE  . ARG A 1 506 ? 4.635   11.480  18.593  1.00 54.82  ? 475  ARG A NE  1 
ATOM   3634 C CZ  . ARG A 1 506 ? 4.905   11.929  17.381  1.00 55.71  ? 475  ARG A CZ  1 
ATOM   3635 N NH1 . ARG A 1 506 ? 4.740   13.217  17.045  1.00 54.51  ? 475  ARG A NH1 1 
ATOM   3636 N NH2 . ARG A 1 506 ? 5.344   11.051  16.479  1.00 56.44  ? 475  ARG A NH2 1 
ATOM   3637 N N   . LEU A 1 507 ? 9.368   11.966  21.537  1.00 47.80  ? 476  LEU A N   1 
ATOM   3638 C CA  . LEU A 1 507 ? 10.686  11.462  21.123  1.00 47.26  ? 476  LEU A CA  1 
ATOM   3639 C C   . LEU A 1 507 ? 11.451  10.882  22.265  1.00 46.41  ? 476  LEU A C   1 
ATOM   3640 O O   . LEU A 1 507 ? 12.074  9.861   22.102  1.00 46.54  ? 476  LEU A O   1 
ATOM   3641 C CB  . LEU A 1 507 ? 11.545  12.550  20.464  1.00 46.88  ? 476  LEU A CB  1 
ATOM   3642 C CG  . LEU A 1 507 ? 10.932  13.162  19.211  1.00 48.30  ? 476  LEU A CG  1 
ATOM   3643 C CD1 . LEU A 1 507 ? 11.605  14.463  18.923  1.00 48.72  ? 476  LEU A CD1 1 
ATOM   3644 C CD2 . LEU A 1 507 ? 11.055  12.225  18.044  1.00 48.67  ? 476  LEU A CD2 1 
ATOM   3645 N N   . MET A 1 508 ? 11.398  11.522  23.426  1.00 46.82  ? 477  MET A N   1 
ATOM   3646 C CA  . MET A 1 508 ? 12.100  11.041  24.614  1.00 47.15  ? 477  MET A CA  1 
ATOM   3647 C C   . MET A 1 508 ? 11.598  9.658   24.965  1.00 48.23  ? 477  MET A C   1 
ATOM   3648 O O   . MET A 1 508 ? 12.369  8.797   25.395  1.00 48.08  ? 477  MET A O   1 
ATOM   3649 C CB  . MET A 1 508 ? 11.875  11.979  25.793  1.00 47.13  ? 477  MET A CB  1 
ATOM   3650 C CG  . MET A 1 508 ? 12.684  13.253  25.725  1.00 47.78  ? 477  MET A CG  1 
ATOM   3651 S SD  . MET A 1 508 ? 12.109  14.452  26.938  1.00 52.40  ? 477  MET A SD  1 
ATOM   3652 C CE  . MET A 1 508 ? 12.981  13.998  28.292  1.00 50.83  ? 477  MET A CE  1 
ATOM   3653 N N   . LYS A 1 509 ? 10.295  9.467   24.767  1.00 49.35  ? 478  LYS A N   1 
ATOM   3654 C CA  . LYS A 1 509 ? 9.612   8.213   25.032  1.00 50.63  ? 478  LYS A CA  1 
ATOM   3655 C C   . LYS A 1 509 ? 10.044  7.144   23.999  1.00 49.18  ? 478  LYS A C   1 
ATOM   3656 O O   . LYS A 1 509 ? 10.332  6.001   24.374  1.00 49.15  ? 478  LYS A O   1 
ATOM   3657 C CB  . LYS A 1 509 ? 8.092   8.471   25.020  1.00 52.46  ? 478  LYS A CB  1 
ATOM   3658 C CG  . LYS A 1 509 ? 7.182   7.623   25.902  1.00 58.38  ? 478  LYS A CG  1 
ATOM   3659 C CD  . LYS A 1 509 ? 7.821   7.122   27.249  1.00 65.08  ? 478  LYS A CD  1 
ATOM   3660 C CE  . LYS A 1 509 ? 6.784   6.958   28.402  1.00 67.77  ? 478  LYS A CE  1 
ATOM   3661 N NZ  . LYS A 1 509 ? 6.120   8.288   28.600  1.00 69.58  ? 478  LYS A NZ  1 
ATOM   3662 N N   . TYR A 1 510 ? 10.141  7.506   22.720  1.00 47.31  ? 479  TYR A N   1 
ATOM   3663 C CA  . TYR A 1 510 ? 10.618  6.538   21.726  1.00 46.79  ? 479  TYR A CA  1 
ATOM   3664 C C   . TYR A 1 510 ? 12.048  6.077   22.048  1.00 45.97  ? 479  TYR A C   1 
ATOM   3665 O O   . TYR A 1 510 ? 12.316  4.888   22.049  1.00 45.64  ? 479  TYR A O   1 
ATOM   3666 C CB  . TYR A 1 510 ? 10.611  7.113   20.317  1.00 46.35  ? 479  TYR A CB  1 
ATOM   3667 C CG  . TYR A 1 510 ? 9.266   7.386   19.709  1.00 45.47  ? 479  TYR A CG  1 
ATOM   3668 C CD1 . TYR A 1 510 ? 8.195   6.496   19.836  1.00 46.96  ? 479  TYR A CD1 1 
ATOM   3669 C CD2 . TYR A 1 510 ? 9.084   8.523   18.959  1.00 44.23  ? 479  TYR A CD2 1 
ATOM   3670 C CE1 . TYR A 1 510 ? 6.963   6.762   19.230  1.00 46.54  ? 479  TYR A CE1 1 
ATOM   3671 C CE2 . TYR A 1 510 ? 7.905   8.798   18.367  1.00 46.32  ? 479  TYR A CE2 1 
ATOM   3672 C CZ  . TYR A 1 510 ? 6.837   7.934   18.496  1.00 47.74  ? 479  TYR A CZ  1 
ATOM   3673 O OH  . TYR A 1 510 ? 5.682   8.309   17.860  1.00 48.50  ? 479  TYR A OH  1 
ATOM   3674 N N   . TRP A 1 511 ? 12.940  7.028   22.339  1.00 45.06  ? 480  TRP A N   1 
ATOM   3675 C CA  . TRP A 1 511 ? 14.347  6.715   22.565  1.00 44.74  ? 480  TRP A CA  1 
ATOM   3676 C C   . TRP A 1 511 ? 14.546  5.851   23.799  1.00 45.38  ? 480  TRP A C   1 
ATOM   3677 O O   . TRP A 1 511 ? 15.297  4.873   23.748  1.00 45.57  ? 480  TRP A O   1 
ATOM   3678 C CB  . TRP A 1 511 ? 15.206  7.991   22.672  1.00 44.43  ? 480  TRP A CB  1 
ATOM   3679 C CG  . TRP A 1 511 ? 15.966  8.373   21.410  1.00 42.88  ? 480  TRP A CG  1 
ATOM   3680 C CD1 . TRP A 1 511 ? 17.310  8.515   21.288  1.00 42.52  ? 480  TRP A CD1 1 
ATOM   3681 C CD2 . TRP A 1 511 ? 15.418  8.671   20.113  1.00 43.06  ? 480  TRP A CD2 1 
ATOM   3682 N NE1 . TRP A 1 511 ? 17.631  8.879   20.004  1.00 41.09  ? 480  TRP A NE1 1 
ATOM   3683 C CE2 . TRP A 1 511 ? 16.486  8.988   19.268  1.00 40.10  ? 480  TRP A CE2 1 
ATOM   3684 C CE3 . TRP A 1 511 ? 14.121  8.689   19.578  1.00 45.00  ? 480  TRP A CE3 1 
ATOM   3685 C CZ2 . TRP A 1 511 ? 16.311  9.316   17.933  1.00 42.75  ? 480  TRP A CZ2 1 
ATOM   3686 C CZ3 . TRP A 1 511 ? 13.947  9.021   18.256  1.00 44.18  ? 480  TRP A CZ3 1 
ATOM   3687 C CH2 . TRP A 1 511 ? 15.036  9.334   17.445  1.00 43.88  ? 480  TRP A CH2 1 
ATOM   3688 N N   . THR A 1 512 ? 13.873  6.191   24.899  1.00 45.98  ? 481  THR A N   1 
ATOM   3689 C CA  . THR A 1 512 ? 14.033  5.441   26.154  1.00 46.07  ? 481  THR A CA  1 
ATOM   3690 C C   . THR A 1 512 ? 13.256  4.146   26.131  1.00 47.46  ? 481  THR A C   1 
ATOM   3691 O O   . THR A 1 512 ? 13.644  3.231   26.842  1.00 48.18  ? 481  THR A O   1 
ATOM   3692 C CB  . THR A 1 512 ? 13.674  6.255   27.411  1.00 45.65  ? 481  THR A CB  1 
ATOM   3693 O OG1 . THR A 1 512 ? 12.368  6.819   27.294  1.00 47.10  ? 481  THR A OG1 1 
ATOM   3694 C CG2 . THR A 1 512 ? 14.572  7.467   27.542  1.00 45.83  ? 481  THR A CG2 1 
ATOM   3695 N N   . ASN A 1 513 ? 12.159  4.060   25.368  1.00 48.33  ? 482  ASN A N   1 
ATOM   3696 C CA  . ASN A 1 513 ? 11.493  2.770   25.179  1.00 49.95  ? 482  ASN A CA  1 
ATOM   3697 C C   . ASN A 1 513 ? 12.446  1.844   24.444  1.00 50.38  ? 482  ASN A C   1 
ATOM   3698 O O   . ASN A 1 513 ? 12.531  0.647   24.786  1.00 51.24  ? 482  ASN A O   1 
ATOM   3699 C CB  . ASN A 1 513 ? 10.222  2.840   24.329  1.00 50.98  ? 482  ASN A CB  1 
ATOM   3700 C CG  . ASN A 1 513 ? 8.980   3.269   25.101  1.00 51.12  ? 482  ASN A CG  1 
ATOM   3701 O OD1 . ASN A 1 513 ? 8.936   3.270   26.321  1.00 50.59  ? 482  ASN A OD1 1 
ATOM   3702 N ND2 . ASN A 1 513 ? 7.951   3.623   24.354  1.00 53.01  ? 482  ASN A ND2 1 
ATOM   3703 N N   . PHE A 1 514 ? 13.128  2.389   23.430  1.00 49.29  ? 483  PHE A N   1 
ATOM   3704 C CA  . PHE A 1 514 ? 14.109  1.640   22.683  1.00 49.70  ? 483  PHE A CA  1 
ATOM   3705 C C   . PHE A 1 514 ? 15.265  1.187   23.602  1.00 50.44  ? 483  PHE A C   1 
ATOM   3706 O O   . PHE A 1 514 ? 15.724  0.034   23.513  1.00 50.76  ? 483  PHE A O   1 
ATOM   3707 C CB  . PHE A 1 514 ? 14.688  2.439   21.494  1.00 48.74  ? 483  PHE A CB  1 
ATOM   3708 C CG  . PHE A 1 514 ? 15.725  1.667   20.740  1.00 47.39  ? 483  PHE A CG  1 
ATOM   3709 C CD1 . PHE A 1 514 ? 15.349  0.616   19.903  1.00 48.86  ? 483  PHE A CD1 1 
ATOM   3710 C CD2 . PHE A 1 514 ? 17.060  1.897   20.953  1.00 46.48  ? 483  PHE A CD2 1 
ATOM   3711 C CE1 . PHE A 1 514 ? 16.309  -0.150  19.227  1.00 48.68  ? 483  PHE A CE1 1 
ATOM   3712 C CE2 . PHE A 1 514 ? 18.022  1.150   20.294  1.00 46.69  ? 483  PHE A CE2 1 
ATOM   3713 C CZ  . PHE A 1 514 ? 17.646  0.114   19.424  1.00 47.39  ? 483  PHE A CZ  1 
ATOM   3714 N N   . ALA A 1 515 ? 15.732  2.078   24.483  1.00 50.57  ? 484  ALA A N   1 
ATOM   3715 C CA  . ALA A 1 515 ? 16.800  1.706   25.424  1.00 50.95  ? 484  ALA A CA  1 
ATOM   3716 C C   . ALA A 1 515 ? 16.354  0.578   26.339  1.00 52.46  ? 484  ALA A C   1 
ATOM   3717 O O   . ALA A 1 515 ? 17.111  -0.356  26.559  1.00 52.36  ? 484  ALA A O   1 
ATOM   3718 C CB  . ALA A 1 515 ? 17.224  2.876   26.238  1.00 50.61  ? 484  ALA A CB  1 
ATOM   3719 N N   . ARG A 1 516 ? 15.112  0.659   26.821  1.00 53.84  ? 485  ARG A N   1 
ATOM   3720 C CA  . ARG A 1 516 ? 14.566  -0.294  27.772  1.00 55.91  ? 485  ARG A CA  1 
ATOM   3721 C C   . ARG A 1 516 ? 14.369  -1.669  27.138  1.00 55.55  ? 485  ARG A C   1 
ATOM   3722 O O   . ARG A 1 516 ? 14.697  -2.650  27.757  1.00 56.10  ? 485  ARG A O   1 
ATOM   3723 C CB  . ARG A 1 516 ? 13.207  0.178   28.352  1.00 58.08  ? 485  ARG A CB  1 
ATOM   3724 C CG  . ARG A 1 516 ? 13.249  1.272   29.483  1.00 62.87  ? 485  ARG A CG  1 
ATOM   3725 C CD  . ARG A 1 516 ? 11.823  1.611   30.122  1.00 68.30  ? 485  ARG A CD  1 
ATOM   3726 N NE  . ARG A 1 516 ? 11.091  2.616   29.323  1.00 70.72  ? 485  ARG A NE  1 
ATOM   3727 C CZ  . ARG A 1 516 ? 11.223  3.960   29.436  1.00 71.46  ? 485  ARG A CZ  1 
ATOM   3728 N NH1 . ARG A 1 516 ? 12.034  4.492   30.358  1.00 70.34  ? 485  ARG A NH1 1 
ATOM   3729 N NH2 . ARG A 1 516 ? 10.521  4.780   28.629  1.00 70.36  ? 485  ARG A NH2 1 
ATOM   3730 N N   . THR A 1 517 ? 13.852  -1.729  25.915  1.00 54.75  ? 486  THR A N   1 
ATOM   3731 C CA  . THR A 1 517 ? 13.298  -2.973  25.358  1.00 55.25  ? 486  THR A CA  1 
ATOM   3732 C C   . THR A 1 517 ? 13.787  -3.358  23.976  1.00 54.95  ? 486  THR A C   1 
ATOM   3733 O O   . THR A 1 517 ? 13.501  -4.450  23.539  1.00 56.58  ? 486  THR A O   1 
ATOM   3734 C CB  . THR A 1 517 ? 11.753  -2.899  25.270  1.00 56.13  ? 486  THR A CB  1 
ATOM   3735 O OG1 . THR A 1 517 ? 11.370  -1.936  24.282  1.00 55.11  ? 486  THR A OG1 1 
ATOM   3736 C CG2 . THR A 1 517 ? 11.097  -2.379  26.567  1.00 55.03  ? 486  THR A CG2 1 
ATOM   3737 N N   . GLY A 1 518 ? 14.499  -2.487  23.276  1.00 53.35  ? 487  GLY A N   1 
ATOM   3738 C CA  . GLY A 1 518 ? 14.854  -2.735  21.886  1.00 52.96  ? 487  GLY A CA  1 
ATOM   3739 C C   . GLY A 1 518 ? 13.772  -2.387  20.884  1.00 53.45  ? 487  GLY A C   1 
ATOM   3740 O O   . GLY A 1 518 ? 13.914  -2.707  19.708  1.00 53.54  ? 487  GLY A O   1 
ATOM   3741 N N   . ASP A 1 519 ? 12.724  -1.695  21.350  1.00 53.91  ? 488  ASP A N   1 
ATOM   3742 C CA  . ASP A 1 519 ? 11.521  -1.383  20.581  1.00 54.58  ? 488  ASP A CA  1 
ATOM   3743 C C   . ASP A 1 519 ? 11.032  0.018   20.997  1.00 54.62  ? 488  ASP A C   1 
ATOM   3744 O O   . ASP A 1 519 ? 10.686  0.204   22.159  1.00 54.26  ? 488  ASP A O   1 
ATOM   3745 C CB  . ASP A 1 519 ? 10.435  -2.429  20.917  1.00 56.33  ? 488  ASP A CB  1 
ATOM   3746 C CG  . ASP A 1 519 ? 9.155   -2.306  20.064  1.00 56.21  ? 488  ASP A CG  1 
ATOM   3747 O OD1 . ASP A 1 519 ? 8.926   -1.282  19.389  1.00 55.45  ? 488  ASP A OD1 1 
ATOM   3748 O OD2 . ASP A 1 519 ? 8.291   -3.209  20.025  1.00 57.13  ? 488  ASP A OD2 1 
ATOM   3749 N N   . PRO A 1 520 ? 10.974  0.991   20.075  1.00 54.92  ? 489  PRO A N   1 
ATOM   3750 C CA  . PRO A 1 520 ? 10.554  2.355   20.422  1.00 55.59  ? 489  PRO A CA  1 
ATOM   3751 C C   . PRO A 1 520 ? 9.053   2.483   20.726  1.00 58.43  ? 489  PRO A C   1 
ATOM   3752 O O   . PRO A 1 520 ? 8.627   3.484   21.300  1.00 58.73  ? 489  PRO A O   1 
ATOM   3753 C CB  . PRO A 1 520 ? 10.891  3.147   19.169  1.00 54.65  ? 489  PRO A CB  1 
ATOM   3754 C CG  . PRO A 1 520 ? 10.750  2.173   18.088  1.00 55.60  ? 489  PRO A CG  1 
ATOM   3755 C CD  . PRO A 1 520 ? 11.262  0.872   18.640  1.00 54.89  ? 489  PRO A CD  1 
ATOM   3756 N N   . ASN A 1 521 ? 8.270   1.487   20.342  1.00 61.40  ? 490  ASN A N   1 
ATOM   3757 C CA  . ASN A 1 521 ? 6.829   1.522   20.548  1.00 64.70  ? 490  ASN A CA  1 
ATOM   3758 C C   . ASN A 1 521 ? 6.454   1.309   22.012  1.00 68.13  ? 490  ASN A C   1 
ATOM   3759 O O   . ASN A 1 521 ? 7.131   0.569   22.739  1.00 67.82  ? 490  ASN A O   1 
ATOM   3760 C CB  . ASN A 1 521 ? 6.128   0.431   19.710  1.00 65.39  ? 490  ASN A CB  1 
ATOM   3761 C CG  . ASN A 1 521 ? 6.251   0.667   18.219  1.00 63.67  ? 490  ASN A CG  1 
ATOM   3762 O OD1 . ASN A 1 521 ? 5.615   1.571   17.676  1.00 60.43  ? 490  ASN A OD1 1 
ATOM   3763 N ND2 . ASN A 1 521 ? 7.086   -0.133  17.550  1.00 60.03  ? 490  ASN A ND2 1 
ATOM   3764 N N   . ASP A 1 522 ? 5.353   1.933   22.432  1.00 72.75  ? 491  ASP A N   1 
ATOM   3765 C CA  . ASP A 1 522 ? 4.768   1.653   23.745  1.00 77.08  ? 491  ASP A CA  1 
ATOM   3766 C C   . ASP A 1 522 ? 3.868   0.395   23.673  1.00 80.77  ? 491  ASP A C   1 
ATOM   3767 O O   . ASP A 1 522 ? 2.911   0.369   22.884  1.00 81.70  ? 491  ASP A O   1 
ATOM   3768 C CB  . ASP A 1 522 ? 3.945   2.851   24.257  1.00 77.93  ? 491  ASP A CB  1 
ATOM   3769 C CG  . ASP A 1 522 ? 3.807   2.866   25.804  1.00 81.02  ? 491  ASP A CG  1 
ATOM   3770 O OD1 . ASP A 1 522 ? 4.438   3.766   26.425  1.00 82.99  ? 491  ASP A OD1 1 
ATOM   3771 O OD2 . ASP A 1 522 ? 3.120   2.025   26.471  1.00 82.62  ? 491  ASP A OD2 1 
ATOM   3772 N N   . PRO A 1 523 ? 4.150   -0.623  24.494  1.00 84.06  ? 492  PRO A N   1 
ATOM   3773 C CA  . PRO A 1 523 ? 3.295   -1.844  24.541  1.00 87.68  ? 492  PRO A CA  1 
ATOM   3774 C C   . PRO A 1 523 ? 1.833   -1.570  24.968  1.00 90.65  ? 492  PRO A C   1 
ATOM   3775 O O   . PRO A 1 523 ? 0.890   -2.085  24.348  1.00 92.06  ? 492  PRO A O   1 
ATOM   3776 C CB  . PRO A 1 523 ? 3.988   -2.765  25.580  1.00 87.77  ? 492  PRO A CB  1 
ATOM   3777 C CG  . PRO A 1 523 ? 5.127   -1.924  26.234  1.00 85.85  ? 492  PRO A CG  1 
ATOM   3778 C CD  . PRO A 1 523 ? 5.283   -0.660  25.446  1.00 83.14  ? 492  PRO A CD  1 
ATOM   3779 N N   . ARG A 1 524 ? 1.676   -0.757  26.018  1.00 92.48  ? 493  ARG A N   1 
ATOM   3780 C CA  . ARG A 1 524 ? 0.366   -0.383  26.585  1.00 95.17  ? 493  ARG A CA  1 
ATOM   3781 C C   . ARG A 1 524 ? -0.511  0.452   25.628  1.00 96.27  ? 493  ARG A C   1 
ATOM   3782 O O   . ARG A 1 524 ? -1.724  0.219   25.534  1.00 97.99  ? 493  ARG A O   1 
ATOM   3783 C CB  . ARG A 1 524 ? 0.561   0.370   27.953  1.00 94.89  ? 493  ARG A CB  1 
ATOM   3784 N N   . ASP A 1 525 ? 0.109   1.413   24.936  1.00 95.87  ? 494  ASP A N   1 
ATOM   3785 C CA  . ASP A 1 525 ? -0.579  2.286   23.966  1.00 96.50  ? 494  ASP A CA  1 
ATOM   3786 C C   . ASP A 1 525 ? -0.781  1.614   22.571  1.00 97.06  ? 494  ASP A C   1 
ATOM   3787 O O   . ASP A 1 525 ? -0.013  1.850   21.626  1.00 96.30  ? 494  ASP A O   1 
ATOM   3788 C CB  . ASP A 1 525 ? 0.195   3.608   23.836  1.00 95.07  ? 494  ASP A CB  1 
ATOM   3789 C CG  . ASP A 1 525 ? -0.525  4.635   22.972  1.00 96.34  ? 494  ASP A CG  1 
ATOM   3790 O OD1 . ASP A 1 525 ? -1.690  4.388   22.565  1.00 98.90  ? 494  ASP A OD1 1 
ATOM   3791 O OD2 . ASP A 1 525 ? 0.008   5.721   22.643  1.00 95.04  ? 494  ASP A OD2 1 
ATOM   3792 N N   . SER A 1 526 ? -1.842  0.808   22.461  1.00 98.69  ? 495  SER A N   1 
ATOM   3793 C CA  . SER A 1 526 ? -2.130  -0.007  21.271  1.00 99.16  ? 495  SER A CA  1 
ATOM   3794 C C   . SER A 1 526 ? -2.499  0.814   20.027  1.00 98.53  ? 495  SER A C   1 
ATOM   3795 O O   . SER A 1 526 ? -2.005  0.531   18.930  1.00 98.27  ? 495  SER A O   1 
ATOM   3796 C CB  . SER A 1 526 ? -3.263  -1.034  21.587  1.00 101.01 ? 495  SER A CB  1 
ATOM   3797 N N   . LYS A 1 527 ? -3.364  1.819   20.210  1.00 98.29  ? 496  LYS A N   1 
ATOM   3798 C CA  . LYS A 1 527 ? -3.990  2.566   19.101  1.00 97.55  ? 496  LYS A CA  1 
ATOM   3799 C C   . LYS A 1 527 ? -3.073  3.626   18.440  1.00 94.82  ? 496  LYS A C   1 
ATOM   3800 O O   . LYS A 1 527 ? -3.257  3.962   17.256  1.00 94.95  ? 496  LYS A O   1 
ATOM   3801 C CB  . LYS A 1 527 ? -5.298  3.214   19.585  1.00 98.81  ? 496  LYS A CB  1 
ATOM   3802 N N   . SER A 1 528 ? -2.107  4.161   19.196  1.00 91.81  ? 497  SER A N   1 
ATOM   3803 C CA  . SER A 1 528 ? -1.043  5.001   18.615  1.00 88.66  ? 497  SER A CA  1 
ATOM   3804 C C   . SER A 1 528 ? -0.415  4.258   17.430  1.00 86.68  ? 497  SER A C   1 
ATOM   3805 O O   . SER A 1 528 ? -0.186  3.023   17.522  1.00 87.50  ? 497  SER A O   1 
ATOM   3806 C CB  . SER A 1 528 ? 0.066   5.299   19.638  1.00 87.50  ? 497  SER A CB  1 
ATOM   3807 O OG  . SER A 1 528 ? 0.256   6.693   19.828  1.00 86.86  ? 497  SER A OG  1 
ATOM   3808 N N   . PRO A 1 529 ? -0.097  4.975   16.342  1.00 83.26  ? 498  PRO A N   1 
ATOM   3809 C CA  . PRO A 1 529 ? 0.352   4.289   15.118  1.00 80.84  ? 498  PRO A CA  1 
ATOM   3810 C C   . PRO A 1 529 ? 1.721   3.661   15.388  1.00 76.74  ? 498  PRO A C   1 
ATOM   3811 O O   . PRO A 1 529 ? 2.524   4.248   16.087  1.00 74.74  ? 498  PRO A O   1 
ATOM   3812 C CB  . PRO A 1 529 ? 0.413   5.409   14.061  1.00 80.33  ? 498  PRO A CB  1 
ATOM   3813 C CG  . PRO A 1 529 ? -0.230  6.620   14.715  1.00 81.49  ? 498  PRO A CG  1 
ATOM   3814 C CD  . PRO A 1 529 ? -0.046  6.446   16.197  1.00 82.38  ? 498  PRO A CD  1 
ATOM   3815 N N   . GLN A 1 530 ? 1.936   2.460   14.873  1.00 74.09  ? 499  GLN A N   1 
ATOM   3816 C CA  . GLN A 1 530 ? 3.123   1.688   15.181  1.00 70.65  ? 499  GLN A CA  1 
ATOM   3817 C C   . GLN A 1 530 ? 4.303   2.104   14.310  1.00 66.56  ? 499  GLN A C   1 
ATOM   3818 O O   . GLN A 1 530 ? 4.139   2.659   13.234  1.00 65.76  ? 499  GLN A O   1 
ATOM   3819 C CB  . GLN A 1 530 ? 2.832   0.191   15.023  1.00 72.01  ? 499  GLN A CB  1 
ATOM   3820 C CG  . GLN A 1 530 ? 1.822   -0.350  16.048  1.00 73.75  ? 499  GLN A CG  1 
ATOM   3821 C CD  . GLN A 1 530 ? 2.379   -0.350  17.470  1.00 73.31  ? 499  GLN A CD  1 
ATOM   3822 O OE1 . GLN A 1 530 ? 3.400   -1.024  17.753  1.00 72.36  ? 499  GLN A OE1 1 
ATOM   3823 N NE2 . GLN A 1 530 ? 1.733   0.412   18.360  1.00 70.79  ? 499  GLN A NE2 1 
ATOM   3824 N N   . TRP A 1 531 ? 5.495   1.833   14.825  1.00 62.74  ? 500  TRP A N   1 
ATOM   3825 C CA  . TRP A 1 531 ? 6.754   2.076   14.146  1.00 59.15  ? 500  TRP A CA  1 
ATOM   3826 C C   . TRP A 1 531 ? 7.230   0.666   13.823  1.00 58.18  ? 500  TRP A C   1 
ATOM   3827 O O   . TRP A 1 531 ? 7.680   -0.056  14.706  1.00 56.92  ? 500  TRP A O   1 
ATOM   3828 C CB  . TRP A 1 531 ? 7.710   2.852   15.069  1.00 56.89  ? 500  TRP A CB  1 
ATOM   3829 C CG  . TRP A 1 531 ? 9.057   3.206   14.512  1.00 54.39  ? 500  TRP A CG  1 
ATOM   3830 C CD1 . TRP A 1 531 ? 9.678   2.665   13.424  1.00 53.69  ? 500  TRP A CD1 1 
ATOM   3831 C CD2 . TRP A 1 531 ? 9.959   4.198   15.026  1.00 50.96  ? 500  TRP A CD2 1 
ATOM   3832 N NE1 . TRP A 1 531 ? 10.904  3.257   13.232  1.00 53.42  ? 500  TRP A NE1 1 
ATOM   3833 C CE2 . TRP A 1 531 ? 11.099  4.201   14.203  1.00 50.52  ? 500  TRP A CE2 1 
ATOM   3834 C CE3 . TRP A 1 531 ? 9.920   5.074   16.105  1.00 49.59  ? 500  TRP A CE3 1 
ATOM   3835 C CZ2 . TRP A 1 531 ? 12.181  5.030   14.432  1.00 49.69  ? 500  TRP A CZ2 1 
ATOM   3836 C CZ3 . TRP A 1 531 ? 10.982  5.923   16.315  1.00 49.18  ? 500  TRP A CZ3 1 
ATOM   3837 C CH2 . TRP A 1 531 ? 12.105  5.886   15.498  1.00 48.99  ? 500  TRP A CH2 1 
ATOM   3838 N N   . PRO A 1 532 ? 7.087   0.260   12.562  1.00 57.97  ? 501  PRO A N   1 
ATOM   3839 C CA  . PRO A 1 532 ? 7.514   -1.079  12.142  1.00 58.02  ? 501  PRO A CA  1 
ATOM   3840 C C   . PRO A 1 532 ? 9.008   -1.065  11.866  1.00 56.65  ? 501  PRO A C   1 
ATOM   3841 O O   . PRO A 1 532 ? 9.538   -0.034  11.440  1.00 54.68  ? 501  PRO A O   1 
ATOM   3842 C CB  . PRO A 1 532 ? 6.752   -1.312  10.838  1.00 58.82  ? 501  PRO A CB  1 
ATOM   3843 C CG  . PRO A 1 532 ? 6.445   0.047   10.292  1.00 58.67  ? 501  PRO A CG  1 
ATOM   3844 C CD  . PRO A 1 532 ? 6.550   1.043   11.431  1.00 57.81  ? 501  PRO A CD  1 
ATOM   3845 N N   . PRO A 1 533 ? 9.672   -2.191  12.109  1.00 56.67  ? 502  PRO A N   1 
ATOM   3846 C CA  . PRO A 1 533 ? 11.081  -2.347  11.765  1.00 55.39  ? 502  PRO A CA  1 
ATOM   3847 C C   . PRO A 1 533 ? 11.374  -2.148  10.273  1.00 55.27  ? 502  PRO A C   1 
ATOM   3848 O O   . PRO A 1 533 ? 10.520  -2.442  9.431   1.00 55.78  ? 502  PRO A O   1 
ATOM   3849 C CB  . PRO A 1 533 ? 11.378  -3.798  12.157  1.00 56.31  ? 502  PRO A CB  1 
ATOM   3850 C CG  . PRO A 1 533 ? 10.306  -4.211  13.058  1.00 57.34  ? 502  PRO A CG  1 
ATOM   3851 C CD  . PRO A 1 533 ? 9.122   -3.385  12.771  1.00 57.63  ? 502  PRO A CD  1 
ATOM   3852 N N   . TYR A 1 534 ? 12.572  -1.644  9.974   1.00 53.88  ? 503  TYR A N   1 
ATOM   3853 C CA  . TYR A 1 534 ? 13.132  -1.646  8.630   1.00 54.07  ? 503  TYR A CA  1 
ATOM   3854 C C   . TYR A 1 534 ? 13.579  -3.060  8.187   1.00 55.07  ? 503  TYR A C   1 
ATOM   3855 O O   . TYR A 1 534 ? 14.343  -3.716  8.869   1.00 53.77  ? 503  TYR A O   1 
ATOM   3856 C CB  . TYR A 1 534 ? 14.319  -0.687  8.598   1.00 52.76  ? 503  TYR A CB  1 
ATOM   3857 C CG  . TYR A 1 534 ? 14.911  -0.444  7.234   1.00 53.37  ? 503  TYR A CG  1 
ATOM   3858 C CD1 . TYR A 1 534 ? 15.915  -1.270  6.746   1.00 54.88  ? 503  TYR A CD1 1 
ATOM   3859 C CD2 . TYR A 1 534 ? 14.500  0.630   6.445   1.00 53.55  ? 503  TYR A CD2 1 
ATOM   3860 C CE1 . TYR A 1 534 ? 16.471  -1.065  5.506   1.00 55.11  ? 503  TYR A CE1 1 
ATOM   3861 C CE2 . TYR A 1 534 ? 15.057  0.845   5.201   1.00 54.65  ? 503  TYR A CE2 1 
ATOM   3862 C CZ  . TYR A 1 534 ? 16.041  -0.016  4.739   1.00 56.09  ? 503  TYR A CZ  1 
ATOM   3863 O OH  . TYR A 1 534 ? 16.615  0.153   3.512   1.00 60.57  ? 503  TYR A OH  1 
ATOM   3864 N N   . THR A 1 535 ? 13.089  -3.504  7.034   1.00 57.01  ? 504  THR A N   1 
ATOM   3865 C CA  . THR A 1 535 ? 13.506  -4.768  6.409   1.00 59.12  ? 504  THR A CA  1 
ATOM   3866 C C   . THR A 1 535 ? 13.940  -4.505  4.963   1.00 59.96  ? 504  THR A C   1 
ATOM   3867 O O   . THR A 1 535 ? 13.544  -3.505  4.377   1.00 59.36  ? 504  THR A O   1 
ATOM   3868 C CB  . THR A 1 535 ? 12.336  -5.781  6.389   1.00 60.82  ? 504  THR A CB  1 
ATOM   3869 O OG1 . THR A 1 535 ? 11.199  -5.177  5.758   1.00 61.53  ? 504  THR A OG1 1 
ATOM   3870 C CG2 . THR A 1 535 ? 11.859  -6.115  7.802   1.00 60.29  ? 504  THR A CG2 1 
ATOM   3871 N N   . THR A 1 536 ? 14.735  -5.401  4.376   1.00 61.45  ? 505  THR A N   1 
ATOM   3872 C CA  . THR A 1 536 ? 15.115  -5.237  2.972   1.00 62.31  ? 505  THR A CA  1 
ATOM   3873 C C   . THR A 1 536 ? 13.870  -5.358  2.092   1.00 63.67  ? 505  THR A C   1 
ATOM   3874 O O   . THR A 1 536 ? 13.748  -4.626  1.102   1.00 63.57  ? 505  THR A O   1 
ATOM   3875 C CB  . THR A 1 536 ? 16.217  -6.261  2.528   1.00 63.23  ? 505  THR A CB  1 
ATOM   3876 O OG1 . THR A 1 536 ? 15.753  -7.599  2.694   1.00 64.77  ? 505  THR A OG1 1 
ATOM   3877 C CG2 . THR A 1 536 ? 17.458  -6.182  3.437   1.00 63.22  ? 505  THR A CG2 1 
ATOM   3878 N N   . ALA A 1 537 ? 12.947  -6.250  2.468   1.00 64.40  ? 506  ALA A N   1 
ATOM   3879 C CA  . ALA A 1 537 ? 11.731  -6.468  1.684   1.00 66.07  ? 506  ALA A CA  1 
ATOM   3880 C C   . ALA A 1 537 ? 10.849  -5.240  1.590   1.00 65.15  ? 506  ALA A C   1 
ATOM   3881 O O   . ALA A 1 537 ? 10.449  -4.873  0.498   1.00 66.77  ? 506  ALA A O   1 
ATOM   3882 C CB  . ALA A 1 537 ? 10.901  -7.644  2.240   1.00 67.70  ? 506  ALA A CB  1 
ATOM   3883 N N   . ALA A 1 538 ? 10.532  -4.620  2.724   1.00 63.41  ? 507  ALA A N   1 
ATOM   3884 C CA  . ALA A 1 538 ? 9.552   -3.531  2.760   1.00 62.03  ? 507  ALA A CA  1 
ATOM   3885 C C   . ALA A 1 538 ? 10.173  -2.146  2.977   1.00 59.59  ? 507  ALA A C   1 
ATOM   3886 O O   . ALA A 1 538 ? 9.539   -1.141  2.705   1.00 58.96  ? 507  ALA A O   1 
ATOM   3887 C CB  . ALA A 1 538 ? 8.496   -3.824  3.824   1.00 62.73  ? 507  ALA A CB  1 
ATOM   3888 N N   . GLN A 1 539 ? 11.398  -2.097  3.494   1.00 57.94  ? 508  GLN A N   1 
ATOM   3889 C CA  . GLN A 1 539 ? 12.160  -0.835  3.642   1.00 55.95  ? 508  GLN A CA  1 
ATOM   3890 C C   . GLN A 1 539 ? 11.359  0.268   4.336   1.00 54.47  ? 508  GLN A C   1 
ATOM   3891 O O   . GLN A 1 539 ? 11.406  1.406   3.942   1.00 53.35  ? 508  GLN A O   1 
ATOM   3892 C CB  . GLN A 1 539 ? 12.657  -0.331  2.277   1.00 55.79  ? 508  GLN A CB  1 
ATOM   3893 C CG  . GLN A 1 539 ? 13.586  -1.305  1.516   1.00 56.97  ? 508  GLN A CG  1 
ATOM   3894 C CD  . GLN A 1 539 ? 13.948  -0.819  0.109   1.00 57.28  ? 508  GLN A CD  1 
ATOM   3895 O OE1 . GLN A 1 539 ? 14.598  0.224   -0.042  1.00 57.65  ? 508  GLN A OE1 1 
ATOM   3896 N NE2 . GLN A 1 539 ? 13.522  -1.565  -0.913  1.00 57.04  ? 508  GLN A NE2 1 
ATOM   3897 N N   . GLN A 1 540 ? 10.622  -0.081  5.374   1.00 54.18  ? 509  GLN A N   1 
ATOM   3898 C CA  . GLN A 1 540 ? 9.815   0.901   6.099   1.00 53.41  ? 509  GLN A CA  1 
ATOM   3899 C C   . GLN A 1 540 ? 10.597  1.736   7.121   1.00 51.33  ? 509  GLN A C   1 
ATOM   3900 O O   . GLN A 1 540 ? 11.511  1.237   7.795   1.00 50.31  ? 509  GLN A O   1 
ATOM   3901 C CB  . GLN A 1 540 ? 8.659   0.219   6.824   1.00 54.08  ? 509  GLN A CB  1 
ATOM   3902 C CG  . GLN A 1 540 ? 7.713   -0.485  5.920   1.00 56.02  ? 509  GLN A CG  1 
ATOM   3903 C CD  . GLN A 1 540 ? 6.809   -1.436  6.686   1.00 57.69  ? 509  GLN A CD  1 
ATOM   3904 O OE1 . GLN A 1 540 ? 5.623   -1.165  6.835   1.00 59.37  ? 509  GLN A OE1 1 
ATOM   3905 N NE2 . GLN A 1 540 ? 7.376   -2.523  7.204   1.00 54.27  ? 509  GLN A NE2 1 
ATOM   3906 N N   . TYR A 1 541 ? 10.189  2.994   7.219   1.00 50.25  ? 510  TYR A N   1 
ATOM   3907 C CA  . TYR A 1 541 ? 10.719  3.955   8.155   1.00 49.64  ? 510  TYR A CA  1 
ATOM   3908 C C   . TYR A 1 541 ? 9.627   4.972   8.499   1.00 50.25  ? 510  TYR A C   1 
ATOM   3909 O O   . TYR A 1 541 ? 8.557   4.940   7.897   1.00 51.64  ? 510  TYR A O   1 
ATOM   3910 C CB  . TYR A 1 541 ? 11.927  4.651   7.563   1.00 48.18  ? 510  TYR A CB  1 
ATOM   3911 C CG  . TYR A 1 541 ? 11.648  5.581   6.393   1.00 49.10  ? 510  TYR A CG  1 
ATOM   3912 C CD1 . TYR A 1 541 ? 11.371  5.088   5.111   1.00 48.90  ? 510  TYR A CD1 1 
ATOM   3913 C CD2 . TYR A 1 541 ? 11.728  6.957   6.549   1.00 49.05  ? 510  TYR A CD2 1 
ATOM   3914 C CE1 . TYR A 1 541 ? 11.143  5.957   4.041   1.00 48.27  ? 510  TYR A CE1 1 
ATOM   3915 C CE2 . TYR A 1 541 ? 11.496  7.824   5.490   1.00 48.35  ? 510  TYR A CE2 1 
ATOM   3916 C CZ  . TYR A 1 541 ? 11.204  7.329   4.238   1.00 48.93  ? 510  TYR A CZ  1 
ATOM   3917 O OH  . TYR A 1 541 ? 10.967  8.235   3.198   1.00 48.01  ? 510  TYR A OH  1 
ATOM   3918 N N   . VAL A 1 542 ? 9.861   5.854   9.477   1.00 49.43  ? 511  VAL A N   1 
ATOM   3919 C CA  . VAL A 1 542 ? 8.803   6.756   9.924   1.00 49.54  ? 511  VAL A CA  1 
ATOM   3920 C C   . VAL A 1 542 ? 9.203   8.196   9.889   1.00 48.64  ? 511  VAL A C   1 
ATOM   3921 O O   . VAL A 1 542 ? 10.382  8.525   10.028  1.00 47.56  ? 511  VAL A O   1 
ATOM   3922 C CB  . VAL A 1 542 ? 8.265   6.443   11.352  1.00 50.14  ? 511  VAL A CB  1 
ATOM   3923 C CG1 . VAL A 1 542 ? 7.480   5.158   11.347  1.00 52.46  ? 511  VAL A CG1 1 
ATOM   3924 C CG2 . VAL A 1 542 ? 9.350   6.383   12.381  1.00 49.27  ? 511  VAL A CG2 1 
ATOM   3925 N N   . SER A 1 543 ? 8.212   9.062   9.705   1.00 49.10  ? 512  SER A N   1 
ATOM   3926 C CA  . SER A 1 543 ? 8.433   10.503  9.789   1.00 48.90  ? 512  SER A CA  1 
ATOM   3927 C C   . SER A 1 543 ? 8.267   10.937  11.242  1.00 48.40  ? 512  SER A C   1 
ATOM   3928 O O   . SER A 1 543 ? 7.272   10.603  11.864  1.00 49.38  ? 512  SER A O   1 
ATOM   3929 C CB  . SER A 1 543 ? 7.454   11.284  8.863   1.00 49.28  ? 512  SER A CB  1 
ATOM   3930 O OG  . SER A 1 543 ? 6.078   11.011  9.163   1.00 53.52  ? 512  SER A OG  1 
ATOM   3931 N N   . LEU A 1 544 ? 9.270   11.638  11.775  1.00 47.60  ? 513  LEU A N   1 
ATOM   3932 C CA  . LEU A 1 544 ? 9.202   12.279  13.075  1.00 47.05  ? 513  LEU A CA  1 
ATOM   3933 C C   . LEU A 1 544 ? 8.951   13.772  12.837  1.00 47.16  ? 513  LEU A C   1 
ATOM   3934 O O   . LEU A 1 544 ? 9.837   14.525  12.393  1.00 45.99  ? 513  LEU A O   1 
ATOM   3935 C CB  . LEU A 1 544 ? 10.503  12.043  13.861  1.00 46.46  ? 513  LEU A CB  1 
ATOM   3936 C CG  . LEU A 1 544 ? 10.845  10.576  14.171  1.00 47.08  ? 513  LEU A CG  1 
ATOM   3937 C CD1 . LEU A 1 544 ? 12.078  10.498  15.004  1.00 45.50  ? 513  LEU A CD1 1 
ATOM   3938 C CD2 . LEU A 1 544 ? 9.688   9.881   14.898  1.00 48.68  ? 513  LEU A CD2 1 
ATOM   3939 N N   . ASN A 1 545 ? 7.713   14.178  13.077  1.00 48.39  ? 514  ASN A N   1 
ATOM   3940 C CA  . ASN A 1 545 ? 7.319   15.586  13.032  1.00 49.03  ? 514  ASN A CA  1 
ATOM   3941 C C   . ASN A 1 545 ? 6.139   15.828  13.985  1.00 50.16  ? 514  ASN A C   1 
ATOM   3942 O O   . ASN A 1 545 ? 5.854   14.997  14.817  1.00 50.08  ? 514  ASN A O   1 
ATOM   3943 C CB  . ASN A 1 545 ? 7.030   16.040  11.587  1.00 49.19  ? 514  ASN A CB  1 
ATOM   3944 C CG  . ASN A 1 545 ? 5.979   15.174  10.889  1.00 51.54  ? 514  ASN A CG  1 
ATOM   3945 O OD1 . ASN A 1 545 ? 4.923   14.839  11.463  1.00 53.75  ? 514  ASN A OD1 1 
ATOM   3946 N ND2 . ASN A 1 545 ? 6.267   14.798  9.640   1.00 53.31  ? 514  ASN A ND2 1 
ATOM   3947 N N   . LEU A 1 546 ? 5.486   16.979  13.908  1.00 51.99  ? 515  LEU A N   1 
ATOM   3948 C CA  . LEU A 1 546 ? 4.414   17.309  14.875  1.00 53.70  ? 515  LEU A CA  1 
ATOM   3949 C C   . LEU A 1 546 ? 3.163   16.455  14.696  1.00 55.17  ? 515  LEU A C   1 
ATOM   3950 O O   . LEU A 1 546 ? 2.378   16.317  15.611  1.00 55.44  ? 515  LEU A O   1 
ATOM   3951 C CB  . LEU A 1 546 ? 4.018   18.779  14.781  1.00 53.65  ? 515  LEU A CB  1 
ATOM   3952 C CG  . LEU A 1 546 ? 5.168   19.765  14.991  1.00 53.55  ? 515  LEU A CG  1 
ATOM   3953 C CD1 . LEU A 1 546 ? 4.648   21.211  14.934  1.00 52.75  ? 515  LEU A CD1 1 
ATOM   3954 C CD2 . LEU A 1 546 ? 5.880   19.484  16.332  1.00 52.59  ? 515  LEU A CD2 1 
ATOM   3955 N N   . LYS A 1 547 ? 2.981   15.911  13.498  1.00 56.48  ? 516  LYS A N   1 
ATOM   3956 C CA  . LYS A 1 547 ? 1.868   15.006  13.209  1.00 58.39  ? 516  LYS A CA  1 
ATOM   3957 C C   . LYS A 1 547 ? 2.196   13.610  13.760  1.00 57.94  ? 516  LYS A C   1 
ATOM   3958 O O   . LYS A 1 547 ? 3.350   13.300  14.036  1.00 56.82  ? 516  LYS A O   1 
ATOM   3959 C CB  . LYS A 1 547 ? 1.571   14.939  11.705  1.00 58.97  ? 516  LYS A CB  1 
ATOM   3960 C CG  . LYS A 1 547 ? 1.287   16.299  11.054  1.00 62.24  ? 516  LYS A CG  1 
ATOM   3961 C CD  . LYS A 1 547 ? 0.697   16.155  9.612   1.00 68.26  ? 516  LYS A CD  1 
ATOM   3962 C CE  . LYS A 1 547 ? 1.779   16.098  8.503   1.00 70.46  ? 516  LYS A CE  1 
ATOM   3963 N NZ  . LYS A 1 547 ? 1.179   15.770  7.142   1.00 73.14  ? 516  LYS A NZ  1 
ATOM   3964 N N   . PRO A 1 548 ? 1.177   12.782  13.963  1.00 58.66  ? 517  PRO A N   1 
ATOM   3965 C CA  . PRO A 1 548 ? 1.408   11.395  14.372  1.00 58.47  ? 517  PRO A CA  1 
ATOM   3966 C C   . PRO A 1 548 ? 2.298   10.653  13.391  1.00 57.69  ? 517  PRO A C   1 
ATOM   3967 O O   . PRO A 1 548 ? 2.375   11.027  12.224  1.00 57.18  ? 517  PRO A O   1 
ATOM   3968 C CB  . PRO A 1 548 ? -0.012  10.794  14.388  1.00 59.99  ? 517  PRO A CB  1 
ATOM   3969 C CG  . PRO A 1 548 ? -0.903  11.968  14.626  1.00 60.38  ? 517  PRO A CG  1 
ATOM   3970 C CD  . PRO A 1 548 ? -0.266  13.102  13.875  1.00 59.58  ? 517  PRO A CD  1 
ATOM   3971 N N   . LEU A 1 549 ? 2.973   9.610   13.862  1.00 57.64  ? 518  LEU A N   1 
ATOM   3972 C CA  . LEU A 1 549 ? 3.861   8.816   13.006  1.00 57.36  ? 518  LEU A CA  1 
ATOM   3973 C C   . LEU A 1 549 ? 3.197   8.417   11.705  1.00 58.33  ? 518  LEU A C   1 
ATOM   3974 O O   . LEU A 1 549 ? 2.088   7.899   11.703  1.00 59.86  ? 518  LEU A O   1 
ATOM   3975 C CB  . LEU A 1 549 ? 4.263   7.507   13.683  1.00 57.01  ? 518  LEU A CB  1 
ATOM   3976 C CG  . LEU A 1 549 ? 5.243   7.497   14.816  1.00 56.27  ? 518  LEU A CG  1 
ATOM   3977 C CD1 . LEU A 1 549 ? 5.543   6.043   15.140  1.00 58.42  ? 518  LEU A CD1 1 
ATOM   3978 C CD2 . LEU A 1 549 ? 6.506   8.218   14.468  1.00 55.50  ? 518  LEU A CD2 1 
ATOM   3979 N N   . GLU A 1 550 ? 3.923   8.599   10.618  1.00 58.14  ? 519  GLU A N   1 
ATOM   3980 C CA  . GLU A 1 550 ? 3.509   8.112   9.317   1.00 59.54  ? 519  GLU A CA  1 
ATOM   3981 C C   . GLU A 1 550 ? 4.616   7.171   8.790   1.00 58.07  ? 519  GLU A C   1 
ATOM   3982 O O   . GLU A 1 550 ? 5.825   7.418   8.951   1.00 56.87  ? 519  GLU A O   1 
ATOM   3983 C CB  . GLU A 1 550 ? 3.208   9.317   8.393   1.00 60.24  ? 519  GLU A CB  1 
ATOM   3984 C CG  . GLU A 1 550 ? 3.341   9.082   6.890   1.00 64.60  ? 519  GLU A CG  1 
ATOM   3985 C CD  . GLU A 1 550 ? 3.004   10.325  6.062   1.00 68.00  ? 519  GLU A CD  1 
ATOM   3986 O OE1 . GLU A 1 550 ? 1.908   10.877  6.290   1.00 73.17  ? 519  GLU A OE1 1 
ATOM   3987 O OE2 . GLU A 1 550 ? 3.826   10.750  5.204   1.00 67.61  ? 519  GLU A OE2 1 
ATOM   3988 N N   . VAL A 1 551 ? 4.188   6.063   8.206   1.00 58.22  ? 520  VAL A N   1 
ATOM   3989 C CA  . VAL A 1 551 ? 5.089   5.041   7.721   1.00 57.27  ? 520  VAL A CA  1 
ATOM   3990 C C   . VAL A 1 551 ? 5.327   5.312   6.242   1.00 56.83  ? 520  VAL A C   1 
ATOM   3991 O O   . VAL A 1 551 ? 4.381   5.509   5.491   1.00 57.79  ? 520  VAL A O   1 
ATOM   3992 C CB  . VAL A 1 551 ? 4.488   3.646   7.938   1.00 58.64  ? 520  VAL A CB  1 
ATOM   3993 C CG1 . VAL A 1 551 ? 5.380   2.572   7.322   1.00 59.19  ? 520  VAL A CG1 1 
ATOM   3994 C CG2 . VAL A 1 551 ? 4.282   3.391   9.441   1.00 58.11  ? 520  VAL A CG2 1 
ATOM   3995 N N   . ARG A 1 552 ? 6.601   5.363   5.851   1.00 55.38  ? 521  ARG A N   1 
ATOM   3996 C CA  . ARG A 1 552 ? 7.010   5.504   4.459   1.00 55.26  ? 521  ARG A CA  1 
ATOM   3997 C C   . ARG A 1 552 ? 7.848   4.314   4.062   1.00 55.39  ? 521  ARG A C   1 
ATOM   3998 O O   . ARG A 1 552 ? 8.312   3.591   4.929   1.00 54.76  ? 521  ARG A O   1 
ATOM   3999 C CB  . ARG A 1 552 ? 7.814   6.785   4.304   1.00 54.33  ? 521  ARG A CB  1 
ATOM   4000 C CG  . ARG A 1 552 ? 6.965   7.987   4.646   1.00 55.59  ? 521  ARG A CG  1 
ATOM   4001 C CD  . ARG A 1 552 ? 7.579   9.305   4.352   1.00 55.18  ? 521  ARG A CD  1 
ATOM   4002 N NE  . ARG A 1 552 ? 6.856   10.384  5.032   1.00 56.37  ? 521  ARG A NE  1 
ATOM   4003 C CZ  . ARG A 1 552 ? 7.385   11.583  5.296   1.00 53.83  ? 521  ARG A CZ  1 
ATOM   4004 N NH1 . ARG A 1 552 ? 8.615   11.862  4.944   1.00 52.53  ? 521  ARG A NH1 1 
ATOM   4005 N NH2 . ARG A 1 552 ? 6.681   12.503  5.923   1.00 54.02  ? 521  ARG A NH2 1 
ATOM   4006 N N   . ARG A 1 553 ? 8.004   4.096   2.757   1.00 56.06  ? 522  ARG A N   1 
ATOM   4007 C CA  . ARG A 1 553 ? 8.786   2.978   2.223   1.00 57.14  ? 522  ARG A CA  1 
ATOM   4008 C C   . ARG A 1 553 ? 9.902   3.534   1.358   1.00 56.40  ? 522  ARG A C   1 
ATOM   4009 O O   . ARG A 1 553 ? 9.694   4.450   0.540   1.00 56.10  ? 522  ARG A O   1 
ATOM   4010 C CB  . ARG A 1 553 ? 7.901   2.057   1.362   1.00 59.12  ? 522  ARG A CB  1 
ATOM   4011 C CG  . ARG A 1 553 ? 7.201   0.940   2.162   1.00 64.91  ? 522  ARG A CG  1 
ATOM   4012 C CD  . ARG A 1 553 ? 5.763   0.584   1.747   1.00 72.56  ? 522  ARG A CD  1 
ATOM   4013 N NE  . ARG A 1 553 ? 4.746   1.352   2.502   1.00 78.99  ? 522  ARG A NE  1 
ATOM   4014 C CZ  . ARG A 1 553 ? 4.250   1.046   3.734   1.00 82.67  ? 522  ARG A CZ  1 
ATOM   4015 N NH1 . ARG A 1 553 ? 4.663   -0.020  4.432   1.00 81.84  ? 522  ARG A NH1 1 
ATOM   4016 N NH2 . ARG A 1 553 ? 3.327   1.839   4.284   1.00 84.50  ? 522  ARG A NH2 1 
ATOM   4017 N N   . GLY A 1 554 ? 11.089  2.974   1.514   1.00 56.10  ? 523  GLY A N   1 
ATOM   4018 C CA  . GLY A 1 554 ? 12.178  3.299   0.626   1.00 56.28  ? 523  GLY A CA  1 
ATOM   4019 C C   . GLY A 1 554 ? 12.822  4.599   1.019   1.00 55.60  ? 523  GLY A C   1 
ATOM   4020 O O   . GLY A 1 554 ? 12.283  5.682   0.820   1.00 55.69  ? 523  GLY A O   1 
ATOM   4021 N N   . LEU A 1 555 ? 13.987  4.475   1.612   1.00 55.72  ? 524  LEU A N   1 
ATOM   4022 C CA  . LEU A 1 555 ? 14.731  5.616   2.076   1.00 55.72  ? 524  LEU A CA  1 
ATOM   4023 C C   . LEU A 1 555 ? 15.567  6.170   0.931   1.00 54.93  ? 524  LEU A C   1 
ATOM   4024 O O   . LEU A 1 555 ? 16.659  5.671   0.654   1.00 55.06  ? 524  LEU A O   1 
ATOM   4025 C CB  . LEU A 1 555 ? 15.622  5.141   3.216   1.00 56.07  ? 524  LEU A CB  1 
ATOM   4026 C CG  . LEU A 1 555 ? 16.328  6.189   4.076   1.00 59.01  ? 524  LEU A CG  1 
ATOM   4027 C CD1 . LEU A 1 555 ? 15.627  7.599   4.087   1.00 59.98  ? 524  LEU A CD1 1 
ATOM   4028 C CD2 . LEU A 1 555 ? 16.463  5.558   5.486   1.00 61.57  ? 524  LEU A CD2 1 
ATOM   4029 N N   . ARG A 1 556 ? 15.031  7.163   0.232   1.00 54.71  ? 525  ARG A N   1 
ATOM   4030 C CA  . ARG A 1 556 ? 15.675  7.681   -0.971  1.00 54.95  ? 525  ARG A CA  1 
ATOM   4031 C C   . ARG A 1 556 ? 16.166  6.557   -1.884  1.00 54.64  ? 525  ARG A C   1 
ATOM   4032 O O   . ARG A 1 556 ? 17.294  6.612   -2.365  1.00 53.92  ? 525  ARG A O   1 
ATOM   4033 C CB  . ARG A 1 556 ? 16.867  8.577   -0.588  1.00 54.70  ? 525  ARG A CB  1 
ATOM   4034 C CG  . ARG A 1 556 ? 16.448  9.898   0.049   1.00 56.84  ? 525  ARG A CG  1 
ATOM   4035 C CD  . ARG A 1 556 ? 16.367  11.044  -0.931  1.00 60.45  ? 525  ARG A CD  1 
ATOM   4036 N NE  . ARG A 1 556 ? 17.108  12.218  -0.463  1.00 62.83  ? 525  ARG A NE  1 
ATOM   4037 C CZ  . ARG A 1 556 ? 16.722  13.014  0.537   1.00 63.08  ? 525  ARG A CZ  1 
ATOM   4038 N NH1 . ARG A 1 556 ? 15.603  12.794  1.212   1.00 65.52  ? 525  ARG A NH1 1 
ATOM   4039 N NH2 . ARG A 1 556 ? 17.461  14.052  0.864   1.00 64.40  ? 525  ARG A NH2 1 
ATOM   4040 N N   . ALA A 1 557 ? 15.327  5.559   -2.141  1.00 54.72  ? 526  ALA A N   1 
ATOM   4041 C CA  . ALA A 1 557 ? 15.810  4.309   -2.717  1.00 55.03  ? 526  ALA A CA  1 
ATOM   4042 C C   . ALA A 1 557 ? 16.467  4.477   -4.080  1.00 54.89  ? 526  ALA A C   1 
ATOM   4043 O O   . ALA A 1 557 ? 17.549  3.961   -4.298  1.00 54.82  ? 526  ALA A O   1 
ATOM   4044 C CB  . ALA A 1 557 ? 14.700  3.290   -2.801  1.00 56.91  ? 526  ALA A CB  1 
ATOM   4045 N N   . GLN A 1 558 ? 15.842  5.221   -4.983  1.00 54.85  ? 527  GLN A N   1 
ATOM   4046 C CA  . GLN A 1 558 ? 16.377  5.369   -6.341  1.00 55.20  ? 527  GLN A CA  1 
ATOM   4047 C C   . GLN A 1 558 ? 17.738  6.069   -6.344  1.00 53.66  ? 527  GLN A C   1 
ATOM   4048 O O   . GLN A 1 558 ? 18.702  5.603   -6.948  1.00 53.45  ? 527  GLN A O   1 
ATOM   4049 C CB  . GLN A 1 558 ? 15.356  6.118   -7.223  1.00 55.45  ? 527  GLN A CB  1 
ATOM   4050 C CG  . GLN A 1 558 ? 15.229  5.604   -8.620  1.00 58.07  ? 527  GLN A CG  1 
ATOM   4051 C CD  . GLN A 1 558 ? 14.923  4.092   -8.748  1.00 60.90  ? 527  GLN A CD  1 
ATOM   4052 O OE1 . GLN A 1 558 ? 14.349  3.454   -7.840  1.00 60.60  ? 527  GLN A OE1 1 
ATOM   4053 N NE2 . GLN A 1 558 ? 15.302  3.527   -9.901  1.00 62.29  ? 527  GLN A NE2 1 
ATOM   4054 N N   . THR A 1 559 ? 17.800  7.179   -5.634  1.00 52.25  ? 528  THR A N   1 
ATOM   4055 C CA  . THR A 1 559 ? 19.006  7.977   -5.536  1.00 51.48  ? 528  THR A CA  1 
ATOM   4056 C C   . THR A 1 559 ? 20.112  7.254   -4.782  1.00 51.23  ? 528  THR A C   1 
ATOM   4057 O O   . THR A 1 559 ? 21.271  7.438   -5.076  1.00 51.31  ? 528  THR A O   1 
ATOM   4058 C CB  . THR A 1 559 ? 18.681  9.294   -4.812  1.00 50.48  ? 528  THR A CB  1 
ATOM   4059 O OG1 . THR A 1 559 ? 17.959  10.149  -5.687  1.00 49.42  ? 528  THR A OG1 1 
ATOM   4060 C CG2 . THR A 1 559 ? 19.936  10.093  -4.484  1.00 50.45  ? 528  THR A CG2 1 
ATOM   4061 N N   . CYS A 1 560 ? 19.772  6.452   -3.785  1.00 51.64  ? 529  CYS A N   1 
ATOM   4062 C CA  . CYS A 1 560 ? 20.801  5.743   -3.032  1.00 51.80  ? 529  CYS A CA  1 
ATOM   4063 C C   . CYS A 1 560 ? 21.297  4.545   -3.808  1.00 52.06  ? 529  CYS A C   1 
ATOM   4064 O O   . CYS A 1 560 ? 22.389  4.087   -3.568  1.00 52.03  ? 529  CYS A O   1 
ATOM   4065 C CB  . CYS A 1 560 ? 20.341  5.392   -1.602  1.00 51.68  ? 529  CYS A CB  1 
ATOM   4066 S SG  . CYS A 1 560 ? 20.368  6.903   -0.577  1.00 53.97  ? 529  CYS A SG  1 
ATOM   4067 N N   . ALA A 1 561 ? 20.518  4.061   -4.765  1.00 52.66  ? 530  ALA A N   1 
ATOM   4068 C CA  . ALA A 1 561 ? 21.051  3.101   -5.717  1.00 53.62  ? 530  ALA A CA  1 
ATOM   4069 C C   . ALA A 1 561 ? 22.110  3.775   -6.582  1.00 53.09  ? 530  ALA A C   1 
ATOM   4070 O O   . ALA A 1 561 ? 23.099  3.144   -6.921  1.00 53.50  ? 530  ALA A O   1 
ATOM   4071 C CB  . ALA A 1 561 ? 19.957  2.475   -6.577  1.00 54.81  ? 530  ALA A CB  1 
ATOM   4072 N N   . PHE A 1 562 ? 21.928  5.057   -6.906  1.00 52.28  ? 531  PHE A N   1 
ATOM   4073 C CA  . PHE A 1 562 ? 22.962  5.792   -7.629  1.00 51.66  ? 531  PHE A CA  1 
ATOM   4074 C C   . PHE A 1 562 ? 24.260  5.807   -6.821  1.00 51.13  ? 531  PHE A C   1 
ATOM   4075 O O   . PHE A 1 562 ? 25.292  5.402   -7.308  1.00 51.61  ? 531  PHE A O   1 
ATOM   4076 C CB  . PHE A 1 562 ? 22.513  7.209   -8.018  1.00 50.90  ? 531  PHE A CB  1 
ATOM   4077 C CG  . PHE A 1 562 ? 23.630  8.089   -8.597  1.00 49.89  ? 531  PHE A CG  1 
ATOM   4078 C CD1 . PHE A 1 562 ? 23.960  8.027   -9.942  1.00 49.67  ? 531  PHE A CD1 1 
ATOM   4079 C CD2 . PHE A 1 562 ? 24.302  9.000   -7.798  1.00 48.17  ? 531  PHE A CD2 1 
ATOM   4080 C CE1 . PHE A 1 562 ? 24.952  8.819   -10.470 1.00 49.57  ? 531  PHE A CE1 1 
ATOM   4081 C CE2 . PHE A 1 562 ? 25.311  9.811   -8.321  1.00 47.78  ? 531  PHE A CE2 1 
ATOM   4082 C CZ  . PHE A 1 562 ? 25.636  9.714   -9.654  1.00 49.01  ? 531  PHE A CZ  1 
ATOM   4083 N N   . TRP A 1 563 ? 24.203  6.232   -5.569  1.00 50.71  ? 532  TRP A N   1 
ATOM   4084 C CA  . TRP A 1 563 ? 25.440  6.418   -4.775  1.00 50.10  ? 532  TRP A CA  1 
ATOM   4085 C C   . TRP A 1 563 ? 26.084  5.119   -4.315  1.00 51.48  ? 532  TRP A C   1 
ATOM   4086 O O   . TRP A 1 563 ? 27.311  5.014   -4.280  1.00 51.89  ? 532  TRP A O   1 
ATOM   4087 C CB  . TRP A 1 563 ? 25.195  7.287   -3.541  1.00 47.99  ? 532  TRP A CB  1 
ATOM   4088 C CG  . TRP A 1 563 ? 24.873  8.694   -3.838  1.00 44.11  ? 532  TRP A CG  1 
ATOM   4089 C CD1 . TRP A 1 563 ? 23.628  9.272   -3.866  1.00 43.72  ? 532  TRP A CD1 1 
ATOM   4090 C CD2 . TRP A 1 563 ? 25.795  9.731   -4.134  1.00 41.75  ? 532  TRP A CD2 1 
ATOM   4091 N NE1 . TRP A 1 563 ? 23.728  10.617  -4.141  1.00 40.85  ? 532  TRP A NE1 1 
ATOM   4092 C CE2 . TRP A 1 563 ? 25.051  10.918  -4.336  1.00 41.48  ? 532  TRP A CE2 1 
ATOM   4093 C CE3 . TRP A 1 563 ? 27.185  9.791   -4.244  1.00 41.97  ? 532  TRP A CE3 1 
ATOM   4094 C CZ2 . TRP A 1 563 ? 25.654  12.127  -4.644  1.00 40.73  ? 532  TRP A CZ2 1 
ATOM   4095 C CZ3 . TRP A 1 563 ? 27.785  11.015  -4.561  1.00 41.33  ? 532  TRP A CZ3 1 
ATOM   4096 C CH2 . TRP A 1 563 ? 27.023  12.157  -4.738  1.00 40.55  ? 532  TRP A CH2 1 
ATOM   4097 N N   . ASN A 1 564 ? 25.255  4.133   -3.980  1.00 52.85  ? 533  ASN A N   1 
ATOM   4098 C CA  . ASN A 1 564 ? 25.720  2.905   -3.330  1.00 53.70  ? 533  ASN A CA  1 
ATOM   4099 C C   . ASN A 1 564 ? 25.992  1.758   -4.283  1.00 55.98  ? 533  ASN A C   1 
ATOM   4100 O O   . ASN A 1 564 ? 26.689  0.840   -3.918  1.00 56.35  ? 533  ASN A O   1 
ATOM   4101 C CB  . ASN A 1 564 ? 24.723  2.441   -2.248  1.00 53.27  ? 533  ASN A CB  1 
ATOM   4102 C CG  . ASN A 1 564 ? 24.533  3.476   -1.140  1.00 50.93  ? 533  ASN A CG  1 
ATOM   4103 O OD1 . ASN A 1 564 ? 25.424  4.280   -0.882  1.00 50.41  ? 533  ASN A OD1 1 
ATOM   4104 N ND2 . ASN A 1 564 ? 23.382  3.460   -0.491  1.00 47.06  ? 533  ASN A ND2 1 
ATOM   4105 N N   . ARG A 1 565 ? 25.438  1.790   -5.491  1.00 58.17  ? 534  ARG A N   1 
ATOM   4106 C CA  . ARG A 1 565 ? 25.613  0.680   -6.437  1.00 60.45  ? 534  ARG A CA  1 
ATOM   4107 C C   . ARG A 1 565 ? 26.268  1.139   -7.712  1.00 61.43  ? 534  ARG A C   1 
ATOM   4108 O O   . ARG A 1 565 ? 27.146  0.453   -8.230  1.00 62.69  ? 534  ARG A O   1 
ATOM   4109 C CB  . ARG A 1 565 ? 24.288  0.012   -6.777  1.00 61.32  ? 534  ARG A CB  1 
ATOM   4110 C CG  . ARG A 1 565 ? 23.551  -0.550  -5.598  1.00 62.85  ? 534  ARG A CG  1 
ATOM   4111 C CD  . ARG A 1 565 ? 22.078  -0.821  -5.892  1.00 65.59  ? 534  ARG A CD  1 
ATOM   4112 N NE  . ARG A 1 565 ? 21.314  -1.297  -4.728  1.00 67.35  ? 534  ARG A NE  1 
ATOM   4113 C CZ  . ARG A 1 565 ? 21.238  -2.568  -4.328  1.00 67.75  ? 534  ARG A CZ  1 
ATOM   4114 N NH1 . ARG A 1 565 ? 21.886  -3.522  -4.985  1.00 69.55  ? 534  ARG A NH1 1 
ATOM   4115 N NH2 . ARG A 1 565 ? 20.500  -2.892  -3.270  1.00 66.64  ? 534  ARG A NH2 1 
ATOM   4116 N N   . PHE A 1 566 ? 25.850  2.283   -8.239  1.00 61.66  ? 535  PHE A N   1 
ATOM   4117 C CA  . PHE A 1 566 ? 26.398  2.706   -9.501  1.00 62.49  ? 535  PHE A CA  1 
ATOM   4118 C C   . PHE A 1 566 ? 27.745  3.378   -9.325  1.00 63.12  ? 535  PHE A C   1 
ATOM   4119 O O   . PHE A 1 566 ? 28.686  2.963   -9.959  1.00 63.63  ? 535  PHE A O   1 
ATOM   4120 C CB  . PHE A 1 566 ? 25.460  3.594   -10.316 1.00 61.91  ? 535  PHE A CB  1 
ATOM   4121 C CG  . PHE A 1 566 ? 26.081  4.032   -11.593 1.00 59.58  ? 535  PHE A CG  1 
ATOM   4122 C CD1 . PHE A 1 566 ? 26.345  3.105   -12.583 1.00 59.13  ? 535  PHE A CD1 1 
ATOM   4123 C CD2 . PHE A 1 566 ? 26.507  5.334   -11.761 1.00 56.79  ? 535  PHE A CD2 1 
ATOM   4124 C CE1 . PHE A 1 566 ? 26.978  3.477   -13.737 1.00 59.80  ? 535  PHE A CE1 1 
ATOM   4125 C CE2 . PHE A 1 566 ? 27.131  5.721   -12.921 1.00 57.45  ? 535  PHE A CE2 1 
ATOM   4126 C CZ  . PHE A 1 566 ? 27.371  4.797   -13.911 1.00 58.87  ? 535  PHE A CZ  1 
ATOM   4127 N N   . LEU A 1 567 ? 27.833  4.429   -8.512  1.00 63.99  ? 536  LEU A N   1 
ATOM   4128 C CA  . LEU A 1 567 ? 29.072  5.218   -8.419  1.00 65.64  ? 536  LEU A CA  1 
ATOM   4129 C C   . LEU A 1 567 ? 30.357  4.427   -8.125  1.00 68.30  ? 536  LEU A C   1 
ATOM   4130 O O   . LEU A 1 567 ? 31.390  4.662   -8.770  1.00 68.76  ? 536  LEU A O   1 
ATOM   4131 C CB  . LEU A 1 567 ? 28.953  6.335   -7.391  1.00 64.19  ? 536  LEU A CB  1 
ATOM   4132 C CG  . LEU A 1 567 ? 28.668  7.759   -7.892  1.00 64.59  ? 536  LEU A CG  1 
ATOM   4133 C CD1 . LEU A 1 567 ? 29.548  8.744   -7.147  1.00 64.20  ? 536  LEU A CD1 1 
ATOM   4134 C CD2 . LEU A 1 567 ? 28.830  7.948   -9.427  1.00 65.49  ? 536  LEU A CD2 1 
ATOM   4135 N N   . PRO A 1 568 ? 30.328  3.519   -7.149  1.00 71.15  ? 537  PRO A N   1 
ATOM   4136 C CA  . PRO A 1 568 ? 31.487  2.654   -6.909  1.00 73.52  ? 537  PRO A CA  1 
ATOM   4137 C C   . PRO A 1 568 ? 31.974  1.983   -8.191  1.00 76.94  ? 537  PRO A C   1 
ATOM   4138 O O   . PRO A 1 568 ? 33.174  2.031   -8.409  1.00 77.87  ? 537  PRO A O   1 
ATOM   4139 C CB  . PRO A 1 568 ? 30.969  1.630   -5.894  1.00 73.41  ? 537  PRO A CB  1 
ATOM   4140 C CG  . PRO A 1 568 ? 29.907  2.351   -5.171  1.00 71.94  ? 537  PRO A CG  1 
ATOM   4141 C CD  . PRO A 1 568 ? 29.248  3.246   -6.188  1.00 70.97  ? 537  PRO A CD  1 
ATOM   4142 N N   . LYS A 1 569 ? 31.081  1.418   -9.016  1.00 80.12  ? 538  LYS A N   1 
ATOM   4143 C CA  . LYS A 1 569 ? 31.455  0.817   -10.315 1.00 82.85  ? 538  LYS A CA  1 
ATOM   4144 C C   . LYS A 1 569 ? 32.055  1.814   -11.326 1.00 84.17  ? 538  LYS A C   1 
ATOM   4145 O O   . LYS A 1 569 ? 32.663  1.411   -12.293 1.00 85.67  ? 538  LYS A O   1 
ATOM   4146 C CB  . LYS A 1 569 ? 30.275  0.033   -10.896 1.00 83.80  ? 538  LYS A CB  1 
ATOM   4147 C CG  . LYS A 1 569 ? 29.946  -1.203  -10.045 1.00 84.87  ? 538  LYS A CG  1 
ATOM   4148 C CD  . LYS A 1 569 ? 28.806  -2.050  -10.589 1.00 86.72  ? 538  LYS A CD  1 
ATOM   4149 C CE  . LYS A 1 569 ? 28.544  -3.256  -9.674  1.00 87.44  ? 538  LYS A CE  1 
ATOM   4150 N NZ  . LYS A 1 569 ? 28.061  -4.440  -10.448 1.00 89.87  ? 538  LYS A NZ  1 
ATOM   4151 N N   . LEU A 1 570 ? 31.904  3.108   -11.070 1.00 85.02  ? 539  LEU A N   1 
ATOM   4152 C CA  . LEU A 1 570 ? 32.584  4.182   -11.808 1.00 86.36  ? 539  LEU A CA  1 
ATOM   4153 C C   . LEU A 1 570 ? 33.849  4.723   -11.069 1.00 87.84  ? 539  LEU A C   1 
ATOM   4154 O O   . LEU A 1 570 ? 34.185  5.922   -11.141 1.00 87.07  ? 539  LEU A O   1 
ATOM   4155 C CB  . LEU A 1 570 ? 31.575  5.312   -12.012 1.00 85.50  ? 539  LEU A CB  1 
ATOM   4156 C CG  . LEU A 1 570 ? 31.673  6.245   -13.200 1.00 84.79  ? 539  LEU A CG  1 
ATOM   4157 C CD1 . LEU A 1 570 ? 31.530  5.470   -14.488 1.00 85.53  ? 539  LEU A CD1 1 
ATOM   4158 C CD2 . LEU A 1 570 ? 30.586  7.293   -13.078 1.00 83.27  ? 539  LEU A CD2 1 
ATOM   4159 N N   . LEU A 1 571 ? 34.500  3.858   -10.288 1.00 90.46  ? 540  LEU A N   1 
ATOM   4160 C CA  . LEU A 1 571 ? 35.897  4.084   -9.848  1.00 91.90  ? 540  LEU A CA  1 
ATOM   4161 C C   . LEU A 1 571 ? 36.799  2.886   -10.286 1.00 93.90  ? 540  LEU A C   1 
ATOM   4162 O O   . LEU A 1 571 ? 38.028  2.990   -10.250 1.00 94.51  ? 540  LEU A O   1 
ATOM   4163 C CB  . LEU A 1 571 ? 36.003  4.445   -8.332  1.00 90.97  ? 540  LEU A CB  1 
ATOM   4164 C CG  . LEU A 1 571 ? 36.107  3.382   -7.203  1.00 92.48  ? 540  LEU A CG  1 
ATOM   4165 C CD1 . LEU A 1 571 ? 37.589  2.943   -6.890  1.00 94.16  ? 540  LEU A CD1 1 
ATOM   4166 C CD2 . LEU A 1 571 ? 35.393  3.848   -5.906  1.00 90.66  ? 540  LEU A CD2 1 
ATOM   4167 N N   . SER A 1 572 ? 36.178  1.774   -10.711 1.00 95.61  ? 541  SER A N   1 
ATOM   4168 C CA  . SER A 1 572 ? 36.845  0.755   -11.552 1.00 97.49  ? 541  SER A CA  1 
ATOM   4169 C C   . SER A 1 572 ? 36.863  1.210   -13.038 1.00 98.37  ? 541  SER A C   1 
ATOM   4170 O O   . SER A 1 572 ? 36.334  0.540   -13.935 1.00 99.16  ? 541  SER A O   1 
ATOM   4171 C CB  . SER A 1 572 ? 36.172  -0.628  -11.403 1.00 98.21  ? 541  SER A CB  1 
ATOM   4172 O OG  . SER A 1 572 ? 35.886  -0.924  -10.043 1.00 97.20  ? 541  SER A OG  1 
ATOM   4173 N N   . GLU B 1 35  ? -17.657 4.976   -69.391 1.00 90.31  ? 4    GLU B N   1 
ATOM   4174 C CA  . GLU B 1 35  ? -16.379 5.586   -68.899 1.00 88.73  ? 4    GLU B CA  1 
ATOM   4175 C C   . GLU B 1 35  ? -16.626 6.852   -68.042 1.00 87.55  ? 4    GLU B C   1 
ATOM   4176 O O   . GLU B 1 35  ? -17.314 7.782   -68.465 1.00 88.94  ? 4    GLU B O   1 
ATOM   4177 C CB  . GLU B 1 35  ? -15.463 5.900   -70.093 1.00 88.95  ? 4    GLU B CB  1 
ATOM   4178 C CG  . GLU B 1 35  ? -14.153 6.617   -69.742 1.00 89.48  ? 4    GLU B CG  1 
ATOM   4179 C CD  . GLU B 1 35  ? -12.934 5.697   -69.690 1.00 90.76  ? 4    GLU B CD  1 
ATOM   4180 O OE1 . GLU B 1 35  ? -12.186 5.727   -68.671 1.00 91.49  ? 4    GLU B OE1 1 
ATOM   4181 O OE2 . GLU B 1 35  ? -12.711 4.950   -70.668 1.00 92.24  ? 4    GLU B OE2 1 
ATOM   4182 N N   . ASP B 1 36  ? -16.043 6.876   -66.848 1.00 84.95  ? 5    ASP B N   1 
ATOM   4183 C CA  . ASP B 1 36  ? -16.222 7.963   -65.875 1.00 83.74  ? 5    ASP B CA  1 
ATOM   4184 C C   . ASP B 1 36  ? -15.049 8.951   -65.995 1.00 82.32  ? 5    ASP B C   1 
ATOM   4185 O O   . ASP B 1 36  ? -13.924 8.584   -65.702 1.00 81.16  ? 5    ASP B O   1 
ATOM   4186 C CB  . ASP B 1 36  ? -16.284 7.355   -64.459 1.00 82.48  ? 5    ASP B CB  1 
ATOM   4187 C CG  . ASP B 1 36  ? -16.719 8.344   -63.391 1.00 80.52  ? 5    ASP B CG  1 
ATOM   4188 O OD1 . ASP B 1 36  ? -17.139 7.876   -62.310 1.00 75.97  ? 5    ASP B OD1 1 
ATOM   4189 O OD2 . ASP B 1 36  ? -16.654 9.583   -63.524 1.00 78.47  ? 5    ASP B OD2 1 
ATOM   4190 N N   . PRO B 1 37  ? -15.286 10.186  -66.434 1.00 82.59  ? 6    PRO B N   1 
ATOM   4191 C CA  . PRO B 1 37  ? -14.182 11.125  -66.696 1.00 81.42  ? 6    PRO B CA  1 
ATOM   4192 C C   . PRO B 1 37  ? -13.451 11.620  -65.459 1.00 79.66  ? 6    PRO B C   1 
ATOM   4193 O O   . PRO B 1 37  ? -12.388 12.198  -65.643 1.00 79.39  ? 6    PRO B O   1 
ATOM   4194 C CB  . PRO B 1 37  ? -14.867 12.305  -67.402 1.00 83.26  ? 6    PRO B CB  1 
ATOM   4195 C CG  . PRO B 1 37  ? -16.302 12.248  -66.955 1.00 84.62  ? 6    PRO B CG  1 
ATOM   4196 C CD  . PRO B 1 37  ? -16.602 10.787  -66.722 1.00 84.43  ? 6    PRO B CD  1 
ATOM   4197 N N   . GLN B 1 38  ? -14.004 11.438  -64.257 1.00 78.58  ? 7    GLN B N   1 
ATOM   4198 C CA  . GLN B 1 38  ? -13.269 11.705  -63.012 1.00 76.57  ? 7    GLN B CA  1 
ATOM   4199 C C   . GLN B 1 38  ? -12.187 10.653  -62.761 1.00 74.24  ? 7    GLN B C   1 
ATOM   4200 O O   . GLN B 1 38  ? -11.235 10.900  -62.014 1.00 72.94  ? 7    GLN B O   1 
ATOM   4201 C CB  . GLN B 1 38  ? -14.208 11.719  -61.799 1.00 77.03  ? 7    GLN B CB  1 
ATOM   4202 C CG  . GLN B 1 38  ? -15.264 12.825  -61.818 1.00 79.04  ? 7    GLN B CG  1 
ATOM   4203 C CD  . GLN B 1 38  ? -14.676 14.189  -61.521 1.00 79.15  ? 7    GLN B CD  1 
ATOM   4204 O OE1 . GLN B 1 38  ? -13.866 14.338  -60.613 1.00 77.85  ? 7    GLN B OE1 1 
ATOM   4205 N NE2 . GLN B 1 38  ? -15.078 15.182  -62.288 1.00 80.60  ? 7    GLN B NE2 1 
ATOM   4206 N N   . LEU B 1 39  ? -12.354 9.474   -63.353 1.00 73.21  ? 8    LEU B N   1 
ATOM   4207 C CA  . LEU B 1 39  ? -11.380 8.409   -63.224 1.00 71.38  ? 8    LEU B CA  1 
ATOM   4208 C C   . LEU B 1 39  ? -10.352 8.410   -64.349 1.00 70.43  ? 8    LEU B C   1 
ATOM   4209 O O   . LEU B 1 39  ? -9.517  7.541   -64.392 1.00 69.24  ? 8    LEU B O   1 
ATOM   4210 C CB  . LEU B 1 39  ? -12.071 7.048   -63.134 1.00 71.63  ? 8    LEU B CB  1 
ATOM   4211 C CG  . LEU B 1 39  ? -13.166 6.933   -62.068 1.00 72.48  ? 8    LEU B CG  1 
ATOM   4212 C CD1 . LEU B 1 39  ? -13.816 5.540   -62.061 1.00 73.22  ? 8    LEU B CD1 1 
ATOM   4213 C CD2 . LEU B 1 39  ? -12.613 7.291   -60.686 1.00 71.33  ? 8    LEU B CD2 1 
ATOM   4214 N N   . LEU B 1 40  ? -10.391 9.385   -65.245 1.00 70.62  ? 9    LEU B N   1 
ATOM   4215 C CA  . LEU B 1 40  ? -9.380  9.469   -66.301 1.00 70.21  ? 9    LEU B CA  1 
ATOM   4216 C C   . LEU B 1 40  ? -8.462  10.648  -66.020 1.00 68.80  ? 9    LEU B C   1 
ATOM   4217 O O   . LEU B 1 40  ? -8.930  11.770  -65.930 1.00 69.62  ? 9    LEU B O   1 
ATOM   4218 C CB  . LEU B 1 40  ? -10.045 9.665   -67.668 1.00 71.84  ? 9    LEU B CB  1 
ATOM   4219 C CG  . LEU B 1 40  ? -10.001 8.507   -68.662 1.00 73.37  ? 9    LEU B CG  1 
ATOM   4220 C CD1 . LEU B 1 40  ? -10.733 8.912   -69.968 1.00 75.35  ? 9    LEU B CD1 1 
ATOM   4221 C CD2 . LEU B 1 40  ? -8.556  8.081   -68.943 1.00 73.53  ? 9    LEU B CD2 1 
ATOM   4222 N N   . VAL B 1 41  ? -7.167  10.406  -65.887 1.00 66.68  ? 10   VAL B N   1 
ATOM   4223 C CA  . VAL B 1 41  ? -6.235  11.490  -65.644 1.00 65.74  ? 10   VAL B CA  1 
ATOM   4224 C C   . VAL B 1 41  ? -5.072  11.387  -66.603 1.00 65.40  ? 10   VAL B C   1 
ATOM   4225 O O   . VAL B 1 41  ? -4.648  10.296  -66.941 1.00 65.02  ? 10   VAL B O   1 
ATOM   4226 C CB  . VAL B 1 41  ? -5.720  11.439  -64.192 1.00 64.67  ? 10   VAL B CB  1 
ATOM   4227 C CG1 . VAL B 1 41  ? -4.781  12.599  -63.888 1.00 63.53  ? 10   VAL B CG1 1 
ATOM   4228 C CG2 . VAL B 1 41  ? -6.898  11.464  -63.244 1.00 65.56  ? 10   VAL B CG2 1 
ATOM   4229 N N   . ARG B 1 42  ? -4.559  12.531  -67.035 1.00 65.46  ? 11   ARG B N   1 
ATOM   4230 C CA  . ARG B 1 42  ? -3.366  12.581  -67.850 1.00 65.52  ? 11   ARG B CA  1 
ATOM   4231 C C   . ARG B 1 42  ? -2.236  13.110  -66.991 1.00 63.95  ? 11   ARG B C   1 
ATOM   4232 O O   . ARG B 1 42  ? -2.259  14.265  -66.573 1.00 64.17  ? 11   ARG B O   1 
ATOM   4233 C CB  . ARG B 1 42  ? -3.577  13.489  -69.066 1.00 67.53  ? 11   ARG B CB  1 
ATOM   4234 C CG  . ARG B 1 42  ? -2.311  13.781  -69.879 1.00 70.76  ? 11   ARG B CG  1 
ATOM   4235 C CD  . ARG B 1 42  ? -2.562  14.302  -71.306 1.00 77.14  ? 11   ARG B CD  1 
ATOM   4236 N NE  . ARG B 1 42  ? -1.938  13.405  -72.288 1.00 82.05  ? 11   ARG B NE  1 
ATOM   4237 C CZ  . ARG B 1 42  ? -2.558  12.418  -72.952 1.00 84.98  ? 11   ARG B CZ  1 
ATOM   4238 N NH1 . ARG B 1 42  ? -3.858  12.185  -72.789 1.00 87.04  ? 11   ARG B NH1 1 
ATOM   4239 N NH2 . ARG B 1 42  ? -1.868  11.659  -73.800 1.00 85.58  ? 11   ARG B NH2 1 
ATOM   4240 N N   . VAL B 1 43  ? -1.263  12.245  -66.718 1.00 62.52  ? 12   VAL B N   1 
ATOM   4241 C CA  . VAL B 1 43  ? 0.009   12.625  -66.109 1.00 61.26  ? 12   VAL B CA  1 
ATOM   4242 C C   . VAL B 1 43  ? 1.071   12.744  -67.227 1.00 62.05  ? 12   VAL B C   1 
ATOM   4243 O O   . VAL B 1 43  ? 0.754   12.446  -68.374 1.00 62.91  ? 12   VAL B O   1 
ATOM   4244 C CB  . VAL B 1 43  ? 0.397   11.611  -65.004 1.00 59.91  ? 12   VAL B CB  1 
ATOM   4245 C CG1 . VAL B 1 43  ? -0.730  11.510  -63.956 1.00 59.60  ? 12   VAL B CG1 1 
ATOM   4246 C CG2 . VAL B 1 43  ? 0.685   10.244  -65.566 1.00 58.67  ? 12   VAL B CG2 1 
ATOM   4247 N N   . ARG B 1 44  ? 2.300   13.175  -66.909 1.00 61.76  ? 13   ARG B N   1 
ATOM   4248 C CA  . ARG B 1 44  ? 3.356   13.398  -67.920 1.00 63.06  ? 13   ARG B CA  1 
ATOM   4249 C C   . ARG B 1 44  ? 3.670   12.165  -68.770 1.00 62.00  ? 13   ARG B C   1 
ATOM   4250 O O   . ARG B 1 44  ? 4.037   12.290  -69.934 1.00 62.68  ? 13   ARG B O   1 
ATOM   4251 C CB  . ARG B 1 44  ? 4.694   13.860  -67.288 1.00 63.46  ? 13   ARG B CB  1 
ATOM   4252 C CG  . ARG B 1 44  ? 4.651   15.229  -66.587 1.00 68.34  ? 13   ARG B CG  1 
ATOM   4253 C CD  . ARG B 1 44  ? 5.237   16.428  -67.375 1.00 75.20  ? 13   ARG B CD  1 
ATOM   4254 N NE  . ARG B 1 44  ? 5.393   17.603  -66.497 1.00 80.17  ? 13   ARG B NE  1 
ATOM   4255 C CZ  . ARG B 1 44  ? 6.488   17.893  -65.752 1.00 82.81  ? 13   ARG B CZ  1 
ATOM   4256 N NH1 . ARG B 1 44  ? 7.578   17.111  -65.777 1.00 82.45  ? 13   ARG B NH1 1 
ATOM   4257 N NH2 . ARG B 1 44  ? 6.492   18.980  -64.971 1.00 82.73  ? 13   ARG B NH2 1 
ATOM   4258 N N   . GLY B 1 45  ? 3.553   10.985  -68.183 1.00 59.76  ? 14   GLY B N   1 
ATOM   4259 C CA  . GLY B 1 45  ? 3.940   9.781   -68.868 1.00 59.26  ? 14   GLY B CA  1 
ATOM   4260 C C   . GLY B 1 45  ? 2.830   9.144   -69.669 1.00 59.14  ? 14   GLY B C   1 
ATOM   4261 O O   . GLY B 1 45  ? 3.080   8.140   -70.323 1.00 58.66  ? 14   GLY B O   1 
ATOM   4262 N N   . GLY B 1 46  ? 1.615   9.693   -69.579 1.00 59.08  ? 15   GLY B N   1 
ATOM   4263 C CA  . GLY B 1 46  ? 0.453   9.202   -70.309 1.00 59.55  ? 15   GLY B CA  1 
ATOM   4264 C C   . GLY B 1 46  ? -0.843  9.138   -69.489 1.00 59.63  ? 15   GLY B C   1 
ATOM   4265 O O   . GLY B 1 46  ? -0.969  9.778   -68.436 1.00 59.12  ? 15   GLY B O   1 
ATOM   4266 N N   . GLN B 1 47  ? -1.794  8.330   -69.959 1.00 59.66  ? 16   GLN B N   1 
ATOM   4267 C CA  . GLN B 1 47  ? -3.125  8.264   -69.367 1.00 60.14  ? 16   GLN B CA  1 
ATOM   4268 C C   . GLN B 1 47  ? -3.305  7.153   -68.348 1.00 58.40  ? 16   GLN B C   1 
ATOM   4269 O O   . GLN B 1 47  ? -2.749  6.077   -68.495 1.00 58.53  ? 16   GLN B O   1 
ATOM   4270 C CB  . GLN B 1 47  ? -4.197  8.116   -70.459 1.00 62.26  ? 16   GLN B CB  1 
ATOM   4271 C CG  . GLN B 1 47  ? -4.332  9.344   -71.375 1.00 66.42  ? 16   GLN B CG  1 
ATOM   4272 C CD  . GLN B 1 47  ? -5.787  9.786   -71.558 1.00 72.12  ? 16   GLN B CD  1 
ATOM   4273 O OE1 . GLN B 1 47  ? -6.472  9.316   -72.491 1.00 73.73  ? 16   GLN B OE1 1 
ATOM   4274 N NE2 . GLN B 1 47  ? -6.270  10.671  -70.662 1.00 73.33  ? 16   GLN B NE2 1 
ATOM   4275 N N   . LEU B 1 48  ? -4.133  7.431   -67.347 1.00 57.56  ? 17   LEU B N   1 
ATOM   4276 C CA  . LEU B 1 48  ? -4.432  6.529   -66.251 1.00 57.06  ? 17   LEU B CA  1 
ATOM   4277 C C   . LEU B 1 48  ? -5.922  6.361   -66.108 1.00 58.05  ? 17   LEU B C   1 
ATOM   4278 O O   . LEU B 1 48  ? -6.656  7.304   -66.308 1.00 58.93  ? 17   LEU B O   1 
ATOM   4279 C CB  . LEU B 1 48  ? -3.929  7.127   -64.929 1.00 56.15  ? 17   LEU B CB  1 
ATOM   4280 C CG  . LEU B 1 48  ? -2.440  7.446   -64.904 1.00 55.54  ? 17   LEU B CG  1 
ATOM   4281 C CD1 . LEU B 1 48  ? -2.039  8.146   -63.643 1.00 53.95  ? 17   LEU B CD1 1 
ATOM   4282 C CD2 . LEU B 1 48  ? -1.655  6.152   -65.123 1.00 55.79  ? 17   LEU B CD2 1 
ATOM   4283 N N   . ARG B 1 49  ? -6.362  5.168   -65.733 1.00 58.51  ? 18   ARG B N   1 
ATOM   4284 C CA  . ARG B 1 49  ? -7.730  4.938   -65.310 1.00 59.44  ? 18   ARG B CA  1 
ATOM   4285 C C   . ARG B 1 49  ? -7.667  4.430   -63.888 1.00 58.40  ? 18   ARG B C   1 
ATOM   4286 O O   . ARG B 1 49  ? -7.019  3.422   -63.595 1.00 57.07  ? 18   ARG B O   1 
ATOM   4287 C CB  . ARG B 1 49  ? -8.469  3.926   -66.182 1.00 61.04  ? 18   ARG B CB  1 
ATOM   4288 C CG  . ARG B 1 49  ? -10.000 3.961   -66.012 1.00 64.40  ? 18   ARG B CG  1 
ATOM   4289 C CD  . ARG B 1 49  ? -10.724 2.681   -66.489 1.00 70.80  ? 18   ARG B CD  1 
ATOM   4290 N NE  . ARG B 1 49  ? -10.022 2.030   -67.623 1.00 76.99  ? 18   ARG B NE  1 
ATOM   4291 C CZ  . ARG B 1 49  ? -10.037 2.474   -68.891 1.00 79.33  ? 18   ARG B CZ  1 
ATOM   4292 N NH1 . ARG B 1 49  ? -10.738 3.564   -69.211 1.00 82.13  ? 18   ARG B NH1 1 
ATOM   4293 N NH2 . ARG B 1 49  ? -9.357  1.839   -69.838 1.00 77.91  ? 18   ARG B NH2 1 
ATOM   4294 N N   . GLY B 1 50  ? -8.365  5.141   -63.016 1.00 58.21  ? 19   GLY B N   1 
ATOM   4295 C CA  . GLY B 1 50  ? -8.532  4.739   -61.649 1.00 57.85  ? 19   GLY B CA  1 
ATOM   4296 C C   . GLY B 1 50  ? -9.878  4.116   -61.435 1.00 58.89  ? 19   GLY B C   1 
ATOM   4297 O O   . GLY B 1 50  ? -10.621 3.827   -62.370 1.00 60.70  ? 19   GLY B O   1 
ATOM   4298 N N   . ILE B 1 51  ? -10.197 3.931   -60.172 1.00 58.88  ? 20   ILE B N   1 
ATOM   4299 C CA  . ILE B 1 51  ? -11.405 3.240   -59.758 1.00 60.06  ? 20   ILE B CA  1 
ATOM   4300 C C   . ILE B 1 51  ? -12.103 4.053   -58.664 1.00 60.83  ? 20   ILE B C   1 
ATOM   4301 O O   . ILE B 1 51  ? -11.440 4.679   -57.817 1.00 59.75  ? 20   ILE B O   1 
ATOM   4302 C CB  . ILE B 1 51  ? -11.046 1.828   -59.274 1.00 59.68  ? 20   ILE B CB  1 
ATOM   4303 C CG1 . ILE B 1 51  ? -12.278 1.099   -58.767 1.00 60.55  ? 20   ILE B CG1 1 
ATOM   4304 C CG2 . ILE B 1 51  ? -9.982  1.864   -58.164 1.00 58.29  ? 20   ILE B CG2 1 
ATOM   4305 C CD1 . ILE B 1 51  ? -12.025 -0.362  -58.451 1.00 60.72  ? 20   ILE B CD1 1 
ATOM   4306 N N   . ARG B 1 52  ? -13.431 4.061   -58.703 1.00 62.95  ? 21   ARG B N   1 
ATOM   4307 C CA  . ARG B 1 52  ? -14.247 4.733   -57.702 1.00 64.44  ? 21   ARG B CA  1 
ATOM   4308 C C   . ARG B 1 52  ? -14.448 3.749   -56.569 1.00 64.22  ? 21   ARG B C   1 
ATOM   4309 O O   . ARG B 1 52  ? -14.944 2.659   -56.781 1.00 65.18  ? 21   ARG B O   1 
ATOM   4310 C CB  . ARG B 1 52  ? -15.597 5.167   -58.286 1.00 66.96  ? 21   ARG B CB  1 
ATOM   4311 C CG  . ARG B 1 52  ? -16.741 5.300   -57.260 1.00 70.98  ? 21   ARG B CG  1 
ATOM   4312 C CD  . ARG B 1 52  ? -17.876 6.219   -57.694 1.00 76.18  ? 21   ARG B CD  1 
ATOM   4313 N NE  . ARG B 1 52  ? -19.190 5.595   -57.543 1.00 81.93  ? 21   ARG B NE  1 
ATOM   4314 C CZ  . ARG B 1 52  ? -19.662 4.600   -58.311 1.00 87.93  ? 21   ARG B CZ  1 
ATOM   4315 N NH1 . ARG B 1 52  ? -18.933 4.075   -59.298 1.00 89.06  ? 21   ARG B NH1 1 
ATOM   4316 N NH2 . ARG B 1 52  ? -20.889 4.117   -58.099 1.00 91.87  ? 21   ARG B NH2 1 
ATOM   4317 N N   . LEU B 1 53  ? -14.035 4.139   -55.375 1.00 63.66  ? 22   LEU B N   1 
ATOM   4318 C CA  . LEU B 1 53  ? -14.117 3.294   -54.199 1.00 64.05  ? 22   LEU B CA  1 
ATOM   4319 C C   . LEU B 1 53  ? -15.164 3.839   -53.265 1.00 65.19  ? 22   LEU B C   1 
ATOM   4320 O O   . LEU B 1 53  ? -15.438 5.033   -53.254 1.00 64.59  ? 22   LEU B O   1 
ATOM   4321 C CB  . LEU B 1 53  ? -12.768 3.268   -53.464 1.00 62.51  ? 22   LEU B CB  1 
ATOM   4322 C CG  . LEU B 1 53  ? -11.600 2.559   -54.170 1.00 62.37  ? 22   LEU B CG  1 
ATOM   4323 C CD1 . LEU B 1 53  ? -10.349 2.589   -53.293 1.00 61.59  ? 22   LEU B CD1 1 
ATOM   4324 C CD2 . LEU B 1 53  ? -11.961 1.112   -54.565 1.00 63.36  ? 22   LEU B CD2 1 
ATOM   4325 N N   . LYS B 1 54  ? -15.731 2.951   -52.460 1.00 67.03  ? 23   LYS B N   1 
ATOM   4326 C CA  . LYS B 1 54  ? -16.721 3.341   -51.458 1.00 68.78  ? 23   LYS B CA  1 
ATOM   4327 C C   . LYS B 1 54  ? -15.992 3.645   -50.170 1.00 67.16  ? 23   LYS B C   1 
ATOM   4328 O O   . LYS B 1 54  ? -15.212 2.833   -49.693 1.00 66.32  ? 23   LYS B O   1 
ATOM   4329 C CB  . LYS B 1 54  ? -17.764 2.226   -51.239 1.00 70.79  ? 23   LYS B CB  1 
ATOM   4330 C CG  . LYS B 1 54  ? -18.495 2.255   -49.861 1.00 74.94  ? 23   LYS B CG  1 
ATOM   4331 C CD  . LYS B 1 54  ? -19.828 1.434   -49.883 1.00 79.82  ? 23   LYS B CD  1 
ATOM   4332 C CE  . LYS B 1 54  ? -20.676 1.632   -48.602 1.00 81.21  ? 23   LYS B CE  1 
ATOM   4333 N NZ  . LYS B 1 54  ? -21.997 0.906   -48.720 1.00 85.31  ? 23   LYS B NZ  1 
ATOM   4334 N N   . ALA B 1 55  ? -16.223 4.832   -49.628 1.00 66.89  ? 24   ALA B N   1 
ATOM   4335 C CA  . ALA B 1 55  ? -15.933 5.113   -48.221 1.00 66.22  ? 24   ALA B CA  1 
ATOM   4336 C C   . ALA B 1 55  ? -17.262 5.308   -47.465 1.00 67.46  ? 24   ALA B C   1 
ATOM   4337 O O   . ALA B 1 55  ? -18.314 5.538   -48.077 1.00 68.68  ? 24   ALA B O   1 
ATOM   4338 C CB  . ALA B 1 55  ? -15.046 6.350   -48.090 1.00 65.24  ? 24   ALA B CB  1 
ATOM   4339 N N   . PRO B 1 56  ? -17.229 5.171   -46.143 1.00 67.22  ? 25   PRO B N   1 
ATOM   4340 C CA  . PRO B 1 56  ? -18.430 5.347   -45.306 1.00 68.18  ? 25   PRO B CA  1 
ATOM   4341 C C   . PRO B 1 56  ? -19.334 6.526   -45.692 1.00 68.49  ? 25   PRO B C   1 
ATOM   4342 O O   . PRO B 1 56  ? -20.520 6.313   -45.901 1.00 69.61  ? 25   PRO B O   1 
ATOM   4343 C CB  . PRO B 1 56  ? -17.847 5.583   -43.911 1.00 67.23  ? 25   PRO B CB  1 
ATOM   4344 C CG  . PRO B 1 56  ? -16.607 4.815   -43.907 1.00 67.12  ? 25   PRO B CG  1 
ATOM   4345 C CD  . PRO B 1 56  ? -16.061 4.769   -45.343 1.00 65.96  ? 25   PRO B CD  1 
ATOM   4346 N N   . GLY B 1 57  ? -18.764 7.728   -45.793 1.00 67.19  ? 26   GLY B N   1 
ATOM   4347 C CA  . GLY B 1 57  ? -19.519 8.935   -46.092 1.00 67.82  ? 26   GLY B CA  1 
ATOM   4348 C C   . GLY B 1 57  ? -19.751 9.251   -47.575 1.00 68.23  ? 26   GLY B C   1 
ATOM   4349 O O   . GLY B 1 57  ? -20.470 10.197  -47.895 1.00 69.22  ? 26   GLY B O   1 
ATOM   4350 N N   . GLY B 1 58  ? -19.160 8.472   -48.483 1.00 67.38  ? 27   GLY B N   1 
ATOM   4351 C CA  . GLY B 1 58  ? -19.312 8.716   -49.910 1.00 67.38  ? 27   GLY B CA  1 
ATOM   4352 C C   . GLY B 1 58  ? -18.174 8.173   -50.754 1.00 65.91  ? 27   GLY B C   1 
ATOM   4353 O O   . GLY B 1 58  ? -17.233 7.587   -50.221 1.00 65.05  ? 27   GLY B O   1 
ATOM   4354 N N   . PRO B 1 59  ? -18.241 8.387   -52.069 1.00 65.57  ? 28   PRO B N   1 
ATOM   4355 C CA  . PRO B 1 59  ? -17.236 7.859   -53.000 1.00 64.02  ? 28   PRO B CA  1 
ATOM   4356 C C   . PRO B 1 59  ? -15.880 8.582   -52.952 1.00 61.93  ? 28   PRO B C   1 
ATOM   4357 O O   . PRO B 1 59  ? -15.838 9.747   -52.595 1.00 61.55  ? 28   PRO B O   1 
ATOM   4358 C CB  . PRO B 1 59  ? -17.898 8.099   -54.356 1.00 65.47  ? 28   PRO B CB  1 
ATOM   4359 C CG  . PRO B 1 59  ? -18.706 9.343   -54.137 1.00 66.23  ? 28   PRO B CG  1 
ATOM   4360 C CD  . PRO B 1 59  ? -19.288 9.155   -52.777 1.00 66.98  ? 28   PRO B CD  1 
ATOM   4361 N N   . VAL B 1 60  ? -14.793 7.888   -53.288 1.00 60.33  ? 29   VAL B N   1 
ATOM   4362 C CA  . VAL B 1 60  ? -13.486 8.534   -53.518 1.00 59.20  ? 29   VAL B CA  1 
ATOM   4363 C C   . VAL B 1 60  ? -12.865 7.984   -54.799 1.00 58.48  ? 29   VAL B C   1 
ATOM   4364 O O   . VAL B 1 60  ? -13.229 6.902   -55.247 1.00 59.23  ? 29   VAL B O   1 
ATOM   4365 C CB  . VAL B 1 60  ? -12.469 8.350   -52.343 1.00 57.84  ? 29   VAL B CB  1 
ATOM   4366 C CG1 . VAL B 1 60  ? -13.108 8.528   -51.012 1.00 58.12  ? 29   VAL B CG1 1 
ATOM   4367 C CG2 . VAL B 1 60  ? -11.841 6.992   -52.376 1.00 59.66  ? 29   VAL B CG2 1 
ATOM   4368 N N   . SER B 1 61  ? -11.943 8.729   -55.394 1.00 57.14  ? 30   SER B N   1 
ATOM   4369 C CA  . SER B 1 61  ? -11.220 8.255   -56.566 1.00 56.84  ? 30   SER B CA  1 
ATOM   4370 C C   . SER B 1 61  ? -9.871  7.727   -56.143 1.00 54.74  ? 30   SER B C   1 
ATOM   4371 O O   . SER B 1 61  ? -9.174  8.375   -55.407 1.00 54.03  ? 30   SER B O   1 
ATOM   4372 C CB  . SER B 1 61  ? -11.034 9.371   -57.601 1.00 57.50  ? 30   SER B CB  1 
ATOM   4373 O OG  . SER B 1 61  ? -12.221 10.144  -57.787 1.00 59.84  ? 30   SER B OG  1 
ATOM   4374 N N   . ALA B 1 62  ? -9.500  6.544   -56.605 1.00 54.14  ? 31   ALA B N   1 
ATOM   4375 C CA  . ALA B 1 62  ? -8.194  5.987   -56.300 1.00 52.25  ? 31   ALA B CA  1 
ATOM   4376 C C   . ALA B 1 62  ? -7.463  5.642   -57.569 1.00 51.68  ? 31   ALA B C   1 
ATOM   4377 O O   . ALA B 1 62  ? -8.033  5.080   -58.471 1.00 52.27  ? 31   ALA B O   1 
ATOM   4378 C CB  . ALA B 1 62  ? -8.334  4.747   -55.424 1.00 52.41  ? 31   ALA B CB  1 
ATOM   4379 N N   . PHE B 1 63  ? -6.177  5.976   -57.615 1.00 50.58  ? 32   PHE B N   1 
ATOM   4380 C CA  . PHE B 1 63  ? -5.297  5.614   -58.705 1.00 49.79  ? 32   PHE B CA  1 
ATOM   4381 C C   . PHE B 1 63  ? -4.171  4.802   -58.088 1.00 48.94  ? 32   PHE B C   1 
ATOM   4382 O O   . PHE B 1 63  ? -3.201  5.336   -57.533 1.00 48.66  ? 32   PHE B O   1 
ATOM   4383 C CB  . PHE B 1 63  ? -4.811  6.864   -59.421 1.00 49.91  ? 32   PHE B CB  1 
ATOM   4384 C CG  . PHE B 1 63  ? -5.930  7.755   -59.862 1.00 52.20  ? 32   PHE B CG  1 
ATOM   4385 C CD1 . PHE B 1 63  ? -6.470  8.686   -59.004 1.00 53.35  ? 32   PHE B CD1 1 
ATOM   4386 C CD2 . PHE B 1 63  ? -6.478  7.629   -61.115 1.00 54.29  ? 32   PHE B CD2 1 
ATOM   4387 C CE1 . PHE B 1 63  ? -7.511  9.501   -59.412 1.00 54.54  ? 32   PHE B CE1 1 
ATOM   4388 C CE2 . PHE B 1 63  ? -7.515  8.437   -61.518 1.00 55.90  ? 32   PHE B CE2 1 
ATOM   4389 C CZ  . PHE B 1 63  ? -8.029  9.376   -60.661 1.00 54.92  ? 32   PHE B CZ  1 
ATOM   4390 N N   . LEU B 1 64  ? -4.322  3.490   -58.165 1.00 48.82  ? 33   LEU B N   1 
ATOM   4391 C CA  . LEU B 1 64  ? -3.417  2.576   -57.519 1.00 48.24  ? 33   LEU B CA  1 
ATOM   4392 C C   . LEU B 1 64  ? -2.457  1.944   -58.520 1.00 48.24  ? 33   LEU B C   1 
ATOM   4393 O O   . LEU B 1 64  ? -2.831  1.666   -59.632 1.00 49.34  ? 33   LEU B O   1 
ATOM   4394 C CB  . LEU B 1 64  ? -4.222  1.497   -56.806 1.00 48.29  ? 33   LEU B CB  1 
ATOM   4395 C CG  . LEU B 1 64  ? -5.341  2.041   -55.917 1.00 48.49  ? 33   LEU B CG  1 
ATOM   4396 C CD1 . LEU B 1 64  ? -6.165  0.898   -55.358 1.00 48.39  ? 33   LEU B CD1 1 
ATOM   4397 C CD2 . LEU B 1 64  ? -4.783  2.902   -54.812 1.00 45.09  ? 33   LEU B CD2 1 
ATOM   4398 N N   . GLY B 1 65  ? -1.207  1.747   -58.124 1.00 47.72  ? 34   GLY B N   1 
ATOM   4399 C CA  . GLY B 1 65  ? -0.257  1.032   -58.960 1.00 48.04  ? 34   GLY B CA  1 
ATOM   4400 C C   . GLY B 1 65  ? 0.314   1.839   -60.103 1.00 47.95  ? 34   GLY B C   1 
ATOM   4401 O O   . GLY B 1 65  ? 0.585   1.282   -61.135 1.00 48.92  ? 34   GLY B O   1 
ATOM   4402 N N   . ILE B 1 66  ? 0.516   3.138   -59.906 1.00 47.85  ? 35   ILE B N   1 
ATOM   4403 C CA  . ILE B 1 66  ? 1.058   4.009   -60.933 1.00 47.92  ? 35   ILE B CA  1 
ATOM   4404 C C   . ILE B 1 66  ? 2.570   3.892   -60.920 1.00 48.16  ? 35   ILE B C   1 
ATOM   4405 O O   . ILE B 1 66  ? 3.179   4.153   -59.896 1.00 48.40  ? 35   ILE B O   1 
ATOM   4406 C CB  . ILE B 1 66  ? 0.683   5.474   -60.645 1.00 47.31  ? 35   ILE B CB  1 
ATOM   4407 C CG1 . ILE B 1 66  ? -0.837  5.656   -60.543 1.00 47.80  ? 35   ILE B CG1 1 
ATOM   4408 C CG2 . ILE B 1 66  ? 1.266   6.368   -61.730 1.00 47.46  ? 35   ILE B CG2 1 
ATOM   4409 C CD1 . ILE B 1 66  ? -1.280  7.035   -60.038 1.00 47.45  ? 35   ILE B CD1 1 
ATOM   4410 N N   . PRO B 1 67  ? 3.199   3.557   -62.038 1.00 48.83  ? 36   PRO B N   1 
ATOM   4411 C CA  . PRO B 1 67  ? 4.660   3.386   -62.042 1.00 48.25  ? 36   PRO B CA  1 
ATOM   4412 C C   . PRO B 1 67  ? 5.341   4.722   -61.977 1.00 48.19  ? 36   PRO B C   1 
ATOM   4413 O O   . PRO B 1 67  ? 4.965   5.604   -62.746 1.00 49.12  ? 36   PRO B O   1 
ATOM   4414 C CB  . PRO B 1 67  ? 4.955   2.748   -63.405 1.00 48.73  ? 36   PRO B CB  1 
ATOM   4415 C CG  . PRO B 1 67  ? 3.685   2.900   -64.241 1.00 49.52  ? 36   PRO B CG  1 
ATOM   4416 C CD  . PRO B 1 67  ? 2.583   3.361   -63.369 1.00 49.18  ? 36   PRO B CD  1 
ATOM   4417 N N   . PHE B 1 68  ? 6.315   4.892   -61.095 1.00 47.71  ? 37   PHE B N   1 
ATOM   4418 C CA  . PHE B 1 68  ? 7.077   6.149   -61.060 1.00 47.71  ? 37   PHE B CA  1 
ATOM   4419 C C   . PHE B 1 68  ? 8.538   5.972   -61.421 1.00 48.17  ? 37   PHE B C   1 
ATOM   4420 O O   . PHE B 1 68  ? 9.253   6.948   -61.519 1.00 48.76  ? 37   PHE B O   1 
ATOM   4421 C CB  . PHE B 1 68  ? 6.942   6.868   -59.699 1.00 47.31  ? 37   PHE B CB  1 
ATOM   4422 C CG  . PHE B 1 68  ? 7.559   6.136   -58.532 1.00 45.09  ? 37   PHE B CG  1 
ATOM   4423 C CD1 . PHE B 1 68  ? 8.882   6.340   -58.192 1.00 45.72  ? 37   PHE B CD1 1 
ATOM   4424 C CD2 . PHE B 1 68  ? 6.802   5.286   -57.752 1.00 45.07  ? 37   PHE B CD2 1 
ATOM   4425 C CE1 . PHE B 1 68  ? 9.452   5.681   -57.094 1.00 47.22  ? 37   PHE B CE1 1 
ATOM   4426 C CE2 . PHE B 1 68  ? 7.365   4.619   -56.653 1.00 44.88  ? 37   PHE B CE2 1 
ATOM   4427 C CZ  . PHE B 1 68  ? 8.692   4.819   -56.327 1.00 44.66  ? 37   PHE B CZ  1 
ATOM   4428 N N   . ALA B 1 69  ? 8.968   4.729   -61.583 1.00 48.40  ? 38   ALA B N   1 
ATOM   4429 C CA  . ALA B 1 69  ? 10.339  4.408   -61.953 1.00 48.97  ? 38   ALA B CA  1 
ATOM   4430 C C   . ALA B 1 69  ? 10.367  3.243   -62.945 1.00 49.41  ? 38   ALA B C   1 
ATOM   4431 O O   . ALA B 1 69  ? 9.394   2.496   -63.068 1.00 49.28  ? 38   ALA B O   1 
ATOM   4432 C CB  . ALA B 1 69  ? 11.124  4.043   -60.729 1.00 48.39  ? 38   ALA B CB  1 
ATOM   4433 N N   . GLU B 1 70  ? 11.479  3.118   -63.652 1.00 49.95  ? 39   GLU B N   1 
ATOM   4434 C CA  . GLU B 1 70  ? 11.769  1.903   -64.395 1.00 51.47  ? 39   GLU B CA  1 
ATOM   4435 C C   . GLU B 1 70  ? 11.938  0.782   -63.394 1.00 51.06  ? 39   GLU B C   1 
ATOM   4436 O O   . GLU B 1 70  ? 12.568  0.981   -62.389 1.00 51.51  ? 39   GLU B O   1 
ATOM   4437 C CB  . GLU B 1 70  ? 13.037  2.066   -65.237 1.00 52.15  ? 39   GLU B CB  1 
ATOM   4438 C CG  . GLU B 1 70  ? 12.858  3.021   -66.408 1.00 52.81  ? 39   GLU B CG  1 
ATOM   4439 C CD  . GLU B 1 70  ? 11.973  2.430   -67.487 1.00 54.08  ? 39   GLU B CD  1 
ATOM   4440 O OE1 . GLU B 1 70  ? 12.481  1.594   -68.271 1.00 56.96  ? 39   GLU B OE1 1 
ATOM   4441 O OE2 . GLU B 1 70  ? 10.776  2.778   -67.545 1.00 54.57  ? 39   GLU B OE2 1 
ATOM   4442 N N   . PRO B 1 71  ? 11.341  -0.379  -63.630 1.00 51.78  ? 40   PRO B N   1 
ATOM   4443 C CA  . PRO B 1 71  ? 11.588  -1.556  -62.779 1.00 51.59  ? 40   PRO B CA  1 
ATOM   4444 C C   . PRO B 1 71  ? 13.087  -1.780  -62.482 1.00 51.76  ? 40   PRO B C   1 
ATOM   4445 O O   . PRO B 1 71  ? 13.842  -1.910  -63.429 1.00 52.88  ? 40   PRO B O   1 
ATOM   4446 C CB  . PRO B 1 71  ? 11.017  -2.688  -63.603 1.00 52.25  ? 40   PRO B CB  1 
ATOM   4447 C CG  . PRO B 1 71  ? 9.973   -2.058  -64.421 1.00 51.91  ? 40   PRO B CG  1 
ATOM   4448 C CD  . PRO B 1 71  ? 10.358  -0.650  -64.688 1.00 51.29  ? 40   PRO B CD  1 
ATOM   4449 N N   . PRO B 1 72  ? 13.507  -1.743  -61.214 1.00 50.92  ? 41   PRO B N   1 
ATOM   4450 C CA  . PRO B 1 72  ? 14.928  -1.797  -60.860 1.00 51.06  ? 41   PRO B CA  1 
ATOM   4451 C C   . PRO B 1 72  ? 15.433  -3.219  -60.781 1.00 51.47  ? 41   PRO B C   1 
ATOM   4452 O O   . PRO B 1 72  ? 15.841  -3.695  -59.716 1.00 50.89  ? 41   PRO B O   1 
ATOM   4453 C CB  . PRO B 1 72  ? 14.954  -1.145  -59.490 1.00 50.40  ? 41   PRO B CB  1 
ATOM   4454 C CG  . PRO B 1 72  ? 13.649  -1.544  -58.908 1.00 50.27  ? 41   PRO B CG  1 
ATOM   4455 C CD  . PRO B 1 72  ? 12.665  -1.574  -60.020 1.00 49.50  ? 41   PRO B CD  1 
ATOM   4456 N N   . VAL B 1 73  ? 15.432  -3.874  -61.930 1.00 52.09  ? 42   VAL B N   1 
ATOM   4457 C CA  . VAL B 1 73  ? 15.682  -5.300  -62.038 1.00 53.19  ? 42   VAL B CA  1 
ATOM   4458 C C   . VAL B 1 73  ? 16.893  -5.572  -62.927 1.00 54.12  ? 42   VAL B C   1 
ATOM   4459 O O   . VAL B 1 73  ? 17.238  -4.775  -63.784 1.00 53.79  ? 42   VAL B O   1 
ATOM   4460 C CB  . VAL B 1 73  ? 14.416  -6.003  -62.588 1.00 53.74  ? 42   VAL B CB  1 
ATOM   4461 C CG1 . VAL B 1 73  ? 13.230  -5.784  -61.611 1.00 53.08  ? 42   VAL B CG1 1 
ATOM   4462 C CG2 . VAL B 1 73  ? 14.029  -5.493  -63.984 1.00 54.05  ? 42   VAL B CG2 1 
ATOM   4463 N N   . GLY B 1 74  ? 17.537  -6.705  -62.718 1.00 55.44  ? 43   GLY B N   1 
ATOM   4464 C CA  . GLY B 1 74  ? 18.663  -7.092  -63.547 1.00 56.93  ? 43   GLY B CA  1 
ATOM   4465 C C   . GLY B 1 74  ? 19.867  -6.251  -63.213 1.00 57.27  ? 43   GLY B C   1 
ATOM   4466 O O   . GLY B 1 74  ? 20.312  -6.257  -62.065 1.00 57.75  ? 43   GLY B O   1 
ATOM   4467 N N   . SER B 1 75  ? 20.376  -5.518  -64.197 1.00 58.19  ? 44   SER B N   1 
ATOM   4468 C CA  . SER B 1 75  ? 21.531  -4.643  -63.991 1.00 59.17  ? 44   SER B CA  1 
ATOM   4469 C C   . SER B 1 75  ? 21.209  -3.407  -63.140 1.00 58.41  ? 44   SER B C   1 
ATOM   4470 O O   . SER B 1 75  ? 22.109  -2.679  -62.731 1.00 58.64  ? 44   SER B O   1 
ATOM   4471 C CB  . SER B 1 75  ? 22.108  -4.197  -65.339 1.00 60.26  ? 44   SER B CB  1 
ATOM   4472 O OG  . SER B 1 75  ? 21.449  -3.027  -65.814 1.00 60.90  ? 44   SER B OG  1 
ATOM   4473 N N   . ARG B 1 76  ? 19.920  -3.162  -62.906 1.00 58.15  ? 45   ARG B N   1 
ATOM   4474 C CA  . ARG B 1 76  ? 19.461  -2.014  -62.117 1.00 57.47  ? 45   ARG B CA  1 
ATOM   4475 C C   . ARG B 1 76  ? 19.308  -2.319  -60.636 1.00 55.74  ? 45   ARG B C   1 
ATOM   4476 O O   . ARG B 1 76  ? 18.978  -1.433  -59.860 1.00 55.20  ? 45   ARG B O   1 
ATOM   4477 C CB  . ARG B 1 76  ? 18.128  -1.495  -62.648 1.00 57.45  ? 45   ARG B CB  1 
ATOM   4478 C CG  . ARG B 1 76  ? 18.189  -0.810  -63.996 1.00 61.92  ? 45   ARG B CG  1 
ATOM   4479 C CD  . ARG B 1 76  ? 19.487  -0.004  -64.264 1.00 69.20  ? 45   ARG B CD  1 
ATOM   4480 N NE  . ARG B 1 76  ? 19.513  1.273   -63.534 1.00 73.60  ? 45   ARG B NE  1 
ATOM   4481 C CZ  . ARG B 1 76  ? 20.494  2.188   -63.580 1.00 76.49  ? 45   ARG B CZ  1 
ATOM   4482 N NH1 . ARG B 1 76  ? 20.371  3.318   -62.866 1.00 77.54  ? 45   ARG B NH1 1 
ATOM   4483 N NH2 . ARG B 1 76  ? 21.590  1.982   -64.310 1.00 77.69  ? 45   ARG B NH2 1 
ATOM   4484 N N   . ARG B 1 77  ? 19.539  -3.560  -60.238 1.00 54.95  ? 46   ARG B N   1 
ATOM   4485 C CA  . ARG B 1 77  ? 19.553  -3.910  -58.821 1.00 53.62  ? 46   ARG B CA  1 
ATOM   4486 C C   . ARG B 1 77  ? 20.662  -3.170  -58.088 1.00 53.10  ? 46   ARG B C   1 
ATOM   4487 O O   . ARG B 1 77  ? 21.771  -3.081  -58.595 1.00 54.07  ? 46   ARG B O   1 
ATOM   4488 C CB  . ARG B 1 77  ? 19.783  -5.405  -58.661 1.00 53.97  ? 46   ARG B CB  1 
ATOM   4489 C CG  . ARG B 1 77  ? 19.473  -5.935  -57.308 1.00 52.74  ? 46   ARG B CG  1 
ATOM   4490 C CD  . ARG B 1 77  ? 19.902  -7.374  -57.140 1.00 52.55  ? 46   ARG B CD  1 
ATOM   4491 N NE  . ARG B 1 77  ? 18.797  -8.312  -57.297 1.00 50.31  ? 46   ARG B NE  1 
ATOM   4492 C CZ  . ARG B 1 77  ? 18.948  -9.627  -57.228 1.00 52.27  ? 46   ARG B CZ  1 
ATOM   4493 N NH1 . ARG B 1 77  ? 20.164  -10.155 -57.055 1.00 51.95  ? 46   ARG B NH1 1 
ATOM   4494 N NH2 . ARG B 1 77  ? 17.889  -10.422 -57.378 1.00 52.45  ? 46   ARG B NH2 1 
ATOM   4495 N N   . PHE B 1 78  ? 20.347  -2.671  -56.888 1.00 52.20  ? 47   PHE B N   1 
ATOM   4496 C CA  . PHE B 1 78  ? 21.222  -1.821  -56.064 1.00 51.59  ? 47   PHE B CA  1 
ATOM   4497 C C   . PHE B 1 78  ? 21.495  -0.422  -56.634 1.00 52.14  ? 47   PHE B C   1 
ATOM   4498 O O   . PHE B 1 78  ? 22.250  0.370   -56.012 1.00 52.65  ? 47   PHE B O   1 
ATOM   4499 C CB  . PHE B 1 78  ? 22.569  -2.499  -55.737 1.00 52.21  ? 47   PHE B CB  1 
ATOM   4500 C CG  . PHE B 1 78  ? 22.457  -3.937  -55.343 1.00 50.57  ? 47   PHE B CG  1 
ATOM   4501 C CD1 . PHE B 1 78  ? 21.686  -4.319  -54.259 1.00 51.85  ? 47   PHE B CD1 1 
ATOM   4502 C CD2 . PHE B 1 78  ? 23.133  -4.908  -56.046 1.00 50.23  ? 47   PHE B CD2 1 
ATOM   4503 C CE1 . PHE B 1 78  ? 21.586  -5.662  -53.879 1.00 52.02  ? 47   PHE B CE1 1 
ATOM   4504 C CE2 . PHE B 1 78  ? 23.049  -6.238  -55.676 1.00 50.95  ? 47   PHE B CE2 1 
ATOM   4505 C CZ  . PHE B 1 78  ? 22.274  -6.616  -54.598 1.00 52.65  ? 47   PHE B CZ  1 
ATOM   4506 N N   . MET B 1 79  ? 20.899  -0.099  -57.785 1.00 52.28  ? 48   MET B N   1 
ATOM   4507 C CA  . MET B 1 79  ? 21.151  1.189   -58.464 1.00 52.82  ? 48   MET B CA  1 
ATOM   4508 C C   . MET B 1 79  ? 20.093  2.257   -58.157 1.00 51.34  ? 48   MET B C   1 
ATOM   4509 O O   . MET B 1 79  ? 18.954  1.937   -57.889 1.00 50.19  ? 48   MET B O   1 
ATOM   4510 C CB  . MET B 1 79  ? 21.210  0.998   -59.993 1.00 53.78  ? 48   MET B CB  1 
ATOM   4511 C CG  . MET B 1 79  ? 22.424  0.187   -60.521 1.00 57.10  ? 48   MET B CG  1 
ATOM   4512 S SD  . MET B 1 79  ? 23.976  1.063   -60.228 1.00 62.33  ? 48   MET B SD  1 
ATOM   4513 C CE  . MET B 1 79  ? 23.951  2.151   -61.664 1.00 63.06  ? 48   MET B CE  1 
ATOM   4514 N N   . PRO B 1 80  ? 20.457  3.529   -58.254 1.00 51.76  ? 49   PRO B N   1 
ATOM   4515 C CA  . PRO B 1 80  ? 19.462  4.600   -58.161 1.00 51.42  ? 49   PRO B CA  1 
ATOM   4516 C C   . PRO B 1 80  ? 18.357  4.381   -59.165 1.00 51.71  ? 49   PRO B C   1 
ATOM   4517 O O   . PRO B 1 80  ? 18.627  3.872   -60.258 1.00 52.91  ? 49   PRO B O   1 
ATOM   4518 C CB  . PRO B 1 80  ? 20.248  5.868   -58.547 1.00 51.58  ? 49   PRO B CB  1 
ATOM   4519 C CG  . PRO B 1 80  ? 21.646  5.559   -58.234 1.00 52.60  ? 49   PRO B CG  1 
ATOM   4520 C CD  . PRO B 1 80  ? 21.811  4.068   -58.483 1.00 52.77  ? 49   PRO B CD  1 
ATOM   4521 N N   . PRO B 1 81  ? 17.134  4.766   -58.823 1.00 51.34  ? 50   PRO B N   1 
ATOM   4522 C CA  . PRO B 1 81  ? 16.000  4.568   -59.715 1.00 51.31  ? 50   PRO B CA  1 
ATOM   4523 C C   . PRO B 1 81  ? 16.069  5.521   -60.888 1.00 52.64  ? 50   PRO B C   1 
ATOM   4524 O O   . PRO B 1 81  ? 16.558  6.617   -60.743 1.00 52.24  ? 50   PRO B O   1 
ATOM   4525 C CB  . PRO B 1 81  ? 14.814  4.899   -58.824 1.00 50.72  ? 50   PRO B CB  1 
ATOM   4526 C CG  . PRO B 1 81  ? 15.337  5.861   -57.848 1.00 49.76  ? 50   PRO B CG  1 
ATOM   4527 C CD  . PRO B 1 81  ? 16.731  5.427   -57.571 1.00 50.56  ? 50   PRO B CD  1 
ATOM   4528 N N   . GLU B 1 82  ? 15.621  5.084   -62.055 1.00 54.28  ? 51   GLU B N   1 
ATOM   4529 C CA  . GLU B 1 82  ? 15.492  5.972   -63.201 1.00 55.72  ? 51   GLU B CA  1 
ATOM   4530 C C   . GLU B 1 82  ? 14.009  6.259   -63.395 1.00 54.24  ? 51   GLU B C   1 
ATOM   4531 O O   . GLU B 1 82  ? 13.186  5.414   -63.101 1.00 53.39  ? 51   GLU B O   1 
ATOM   4532 C CB  . GLU B 1 82  ? 16.086  5.323   -64.454 1.00 57.45  ? 51   GLU B CB  1 
ATOM   4533 C CG  . GLU B 1 82  ? 17.596  5.133   -64.393 1.00 62.94  ? 51   GLU B CG  1 
ATOM   4534 C CD  . GLU B 1 82  ? 18.111  4.118   -65.417 1.00 70.32  ? 51   GLU B CD  1 
ATOM   4535 O OE1 . GLU B 1 82  ? 19.132  4.439   -66.076 1.00 77.44  ? 51   GLU B OE1 1 
ATOM   4536 O OE2 . GLU B 1 82  ? 17.527  3.000   -65.575 1.00 73.07  ? 51   GLU B OE2 1 
ATOM   4537 N N   . PRO B 1 83  ? 13.661  7.448   -63.873 1.00 53.99  ? 52   PRO B N   1 
ATOM   4538 C CA  . PRO B 1 83  ? 12.241  7.792   -64.085 1.00 53.55  ? 52   PRO B CA  1 
ATOM   4539 C C   . PRO B 1 83  ? 11.546  6.874   -65.105 1.00 53.23  ? 52   PRO B C   1 
ATOM   4540 O O   . PRO B 1 83  ? 12.171  6.399   -66.056 1.00 52.78  ? 52   PRO B O   1 
ATOM   4541 C CB  . PRO B 1 83  ? 12.272  9.259   -64.590 1.00 54.06  ? 52   PRO B CB  1 
ATOM   4542 C CG  . PRO B 1 83  ? 13.734  9.600   -64.884 1.00 54.98  ? 52   PRO B CG  1 
ATOM   4543 C CD  . PRO B 1 83  ? 14.579  8.549   -64.237 1.00 54.56  ? 52   PRO B CD  1 
ATOM   4544 N N   . LYS B 1 84  ? 10.270  6.607   -64.869 1.00 52.81  ? 53   LYS B N   1 
ATOM   4545 C CA  . LYS B 1 84  ? 9.483   5.700   -65.711 1.00 53.58  ? 53   LYS B CA  1 
ATOM   4546 C C   . LYS B 1 84  ? 9.316   6.287   -67.105 1.00 54.93  ? 53   LYS B C   1 
ATOM   4547 O O   . LYS B 1 84  ? 8.900   7.447   -67.250 1.00 54.83  ? 53   LYS B O   1 
ATOM   4548 C CB  . LYS B 1 84  ? 8.100   5.460   -65.087 1.00 53.16  ? 53   LYS B CB  1 
ATOM   4549 C CG  . LYS B 1 84  ? 7.072   4.681   -65.950 1.00 53.68  ? 53   LYS B CG  1 
ATOM   4550 C CD  . LYS B 1 84  ? 7.435   3.189   -66.096 1.00 54.15  ? 53   LYS B CD  1 
ATOM   4551 C CE  . LYS B 1 84  ? 6.430   2.456   -66.950 1.00 53.78  ? 53   LYS B CE  1 
ATOM   4552 N NZ  . LYS B 1 84  ? 6.650   2.866   -68.334 1.00 53.72  ? 53   LYS B NZ  1 
ATOM   4553 N N   . ARG B 1 85  ? 9.627   5.485   -68.130 1.00 55.95  ? 54   ARG B N   1 
ATOM   4554 C CA  . ARG B 1 85  ? 9.420   5.912   -69.516 1.00 57.14  ? 54   ARG B CA  1 
ATOM   4555 C C   . ARG B 1 85  ? 7.914   6.009   -69.805 1.00 57.36  ? 54   ARG B C   1 
ATOM   4556 O O   . ARG B 1 85  ? 7.108   5.236   -69.289 1.00 56.74  ? 54   ARG B O   1 
ATOM   4557 C CB  . ARG B 1 85  ? 10.048  4.947   -70.535 1.00 57.77  ? 54   ARG B CB  1 
ATOM   4558 C CG  . ARG B 1 85  ? 11.577  4.729   -70.443 1.00 56.22  ? 54   ARG B CG  1 
ATOM   4559 C CD  . ARG B 1 85  ? 12.050  3.564   -71.289 1.00 55.63  ? 54   ARG B CD  1 
ATOM   4560 N NE  . ARG B 1 85  ? 11.327  2.329   -70.932 1.00 56.80  ? 54   ARG B NE  1 
ATOM   4561 C CZ  . ARG B 1 85  ? 10.573  1.588   -71.757 1.00 57.10  ? 54   ARG B CZ  1 
ATOM   4562 N NH1 . ARG B 1 85  ? 9.983   0.510   -71.288 1.00 56.61  ? 54   ARG B NH1 1 
ATOM   4563 N NH2 . ARG B 1 85  ? 10.414  1.892   -73.043 1.00 57.86  ? 54   ARG B NH2 1 
ATOM   4564 N N   . PRO B 1 86  ? 7.535   6.974   -70.625 1.00 58.05  ? 55   PRO B N   1 
ATOM   4565 C CA  . PRO B 1 86  ? 6.140   7.115   -71.061 1.00 58.40  ? 55   PRO B CA  1 
ATOM   4566 C C   . PRO B 1 86  ? 5.552   5.868   -71.681 1.00 58.19  ? 55   PRO B C   1 
ATOM   4567 O O   . PRO B 1 86  ? 6.286   5.117   -72.273 1.00 59.08  ? 55   PRO B O   1 
ATOM   4568 C CB  . PRO B 1 86  ? 6.217   8.212   -72.135 1.00 59.94  ? 55   PRO B CB  1 
ATOM   4569 C CG  . PRO B 1 86  ? 7.444   9.047   -71.750 1.00 60.37  ? 55   PRO B CG  1 
ATOM   4570 C CD  . PRO B 1 86  ? 8.395   8.062   -71.133 1.00 59.13  ? 55   PRO B CD  1 
ATOM   4571 N N   . TRP B 1 87  ? 4.252   5.671   -71.525 1.00 57.59  ? 56   TRP B N   1 
ATOM   4572 C CA  . TRP B 1 87  ? 3.533   4.512   -72.012 1.00 57.72  ? 56   TRP B CA  1 
ATOM   4573 C C   . TRP B 1 87  ? 2.424   4.960   -72.972 1.00 58.91  ? 56   TRP B C   1 
ATOM   4574 O O   . TRP B 1 87  ? 2.014   6.115   -72.943 1.00 59.78  ? 56   TRP B O   1 
ATOM   4575 C CB  . TRP B 1 87  ? 2.894   3.788   -70.829 1.00 56.65  ? 56   TRP B CB  1 
ATOM   4576 C CG  . TRP B 1 87  ? 1.998   4.655   -69.988 1.00 55.37  ? 56   TRP B CG  1 
ATOM   4577 C CD1 . TRP B 1 87  ? 0.686   4.903   -70.201 1.00 54.43  ? 56   TRP B CD1 1 
ATOM   4578 C CD2 . TRP B 1 87  ? 2.353   5.380   -68.794 1.00 52.20  ? 56   TRP B CD2 1 
ATOM   4579 N NE1 . TRP B 1 87  ? 0.195   5.736   -69.223 1.00 54.75  ? 56   TRP B NE1 1 
ATOM   4580 C CE2 . TRP B 1 87  ? 1.200   6.046   -68.349 1.00 53.69  ? 56   TRP B CE2 1 
ATOM   4581 C CE3 . TRP B 1 87  ? 3.523   5.533   -68.063 1.00 50.71  ? 56   TRP B CE3 1 
ATOM   4582 C CZ2 . TRP B 1 87  ? 1.182   6.850   -67.192 1.00 52.78  ? 56   TRP B CZ2 1 
ATOM   4583 C CZ3 . TRP B 1 87  ? 3.513   6.335   -66.938 1.00 51.54  ? 56   TRP B CZ3 1 
ATOM   4584 C CH2 . TRP B 1 87  ? 2.339   6.988   -66.512 1.00 50.69  ? 56   TRP B CH2 1 
ATOM   4585 N N   . SER B 1 88  ? 1.928   4.044   -73.799 1.00 58.45  ? 57   SER B N   1 
ATOM   4586 C CA  . SER B 1 88  ? 0.884   4.319   -74.769 1.00 59.19  ? 57   SER B CA  1 
ATOM   4587 C C   . SER B 1 88  ? -0.454  4.027   -74.128 1.00 58.78  ? 57   SER B C   1 
ATOM   4588 O O   . SER B 1 88  ? -0.480  3.376   -73.108 1.00 57.09  ? 57   SER B O   1 
ATOM   4589 C CB  . SER B 1 88  ? 1.024   3.395   -75.975 1.00 59.98  ? 57   SER B CB  1 
ATOM   4590 O OG  . SER B 1 88  ? 0.604   2.066   -75.640 1.00 59.31  ? 57   SER B OG  1 
ATOM   4591 N N   . GLY B 1 89  ? -1.552  4.475   -74.740 1.00 59.08  ? 58   GLY B N   1 
ATOM   4592 C CA  . GLY B 1 89  ? -2.882  4.099   -74.293 1.00 59.42  ? 58   GLY B CA  1 
ATOM   4593 C C   . GLY B 1 89  ? -3.269  4.585   -72.908 1.00 58.83  ? 58   GLY B C   1 
ATOM   4594 O O   . GLY B 1 89  ? -2.720  5.566   -72.390 1.00 57.54  ? 58   GLY B O   1 
ATOM   4595 N N   . VAL B 1 90  ? -4.232  3.876   -72.320 1.00 59.53  ? 59   VAL B N   1 
ATOM   4596 C CA  . VAL B 1 90  ? -4.709  4.098   -70.952 1.00 59.49  ? 59   VAL B CA  1 
ATOM   4597 C C   . VAL B 1 90  ? -4.229  2.961   -70.011 1.00 59.75  ? 59   VAL B C   1 
ATOM   4598 O O   . VAL B 1 90  ? -4.690  1.813   -70.136 1.00 59.59  ? 59   VAL B O   1 
ATOM   4599 C CB  . VAL B 1 90  ? -6.273  4.153   -70.920 1.00 60.54  ? 59   VAL B CB  1 
ATOM   4600 C CG1 . VAL B 1 90  ? -6.789  4.465   -69.519 1.00 60.17  ? 59   VAL B CG1 1 
ATOM   4601 C CG2 . VAL B 1 90  ? -6.825  5.144   -71.949 1.00 60.68  ? 59   VAL B CG2 1 
ATOM   4602 N N   . LEU B 1 91  ? -3.305  3.308   -69.093 1.00 60.05  ? 60   LEU B N   1 
ATOM   4603 C CA  . LEU B 1 91  ? -2.757  2.417   -68.050 1.00 60.00  ? 60   LEU B CA  1 
ATOM   4604 C C   . LEU B 1 91  ? -3.759  2.157   -66.939 1.00 59.78  ? 60   LEU B C   1 
ATOM   4605 O O   . LEU B 1 91  ? -4.263  3.081   -66.337 1.00 59.15  ? 60   LEU B O   1 
ATOM   4606 C CB  . LEU B 1 91  ? -1.486  3.050   -67.442 1.00 59.35  ? 60   LEU B CB  1 
ATOM   4607 C CG  . LEU B 1 91  ? -0.512  2.152   -66.662 1.00 59.92  ? 60   LEU B CG  1 
ATOM   4608 C CD1 . LEU B 1 91  ? 0.069   1.028   -67.524 1.00 61.67  ? 60   LEU B CD1 1 
ATOM   4609 C CD2 . LEU B 1 91  ? 0.596   2.961   -66.162 1.00 60.02  ? 60   LEU B CD2 1 
ATOM   4610 N N   . ASP B 1 92  ? -4.015  0.893   -66.651 1.00 60.30  ? 61   ASP B N   1 
ATOM   4611 C CA  . ASP B 1 92  ? -4.982  0.523   -65.648 1.00 61.15  ? 61   ASP B CA  1 
ATOM   4612 C C   . ASP B 1 92  ? -4.360  0.713   -64.244 1.00 59.44  ? 61   ASP B C   1 
ATOM   4613 O O   . ASP B 1 92  ? -3.334  0.114   -63.920 1.00 59.24  ? 61   ASP B O   1 
ATOM   4614 C CB  . ASP B 1 92  ? -5.449  -0.907  -65.917 1.00 62.57  ? 61   ASP B CB  1 
ATOM   4615 C CG  . ASP B 1 92  ? -5.908  -1.606  -64.674 1.00 65.43  ? 61   ASP B CG  1 
ATOM   4616 O OD1 . ASP B 1 92  ? -5.463  -2.766  -64.456 1.00 68.84  ? 61   ASP B OD1 1 
ATOM   4617 O OD2 . ASP B 1 92  ? -6.686  -1.056  -63.863 1.00 66.76  ? 61   ASP B OD2 1 
ATOM   4618 N N   . ALA B 1 93  ? -4.984  1.573   -63.445 1.00 58.33  ? 62   ALA B N   1 
ATOM   4619 C CA  . ALA B 1 93  ? -4.503  1.939   -62.122 1.00 56.79  ? 62   ALA B CA  1 
ATOM   4620 C C   . ALA B 1 93  ? -5.625  1.735   -61.117 1.00 56.55  ? 62   ALA B C   1 
ATOM   4621 O O   . ALA B 1 93  ? -6.020  2.665   -60.433 1.00 56.18  ? 62   ALA B O   1 
ATOM   4622 C CB  . ALA B 1 93  ? -4.026  3.387   -62.106 1.00 56.23  ? 62   ALA B CB  1 
ATOM   4623 N N   . THR B 1 94  ? -6.144  0.514   -61.070 1.00 56.57  ? 63   THR B N   1 
ATOM   4624 C CA  . THR B 1 94  ? -7.306  0.162   -60.263 1.00 57.04  ? 63   THR B CA  1 
ATOM   4625 C C   . THR B 1 94  ? -6.990  -0.859  -59.186 1.00 56.18  ? 63   THR B C   1 
ATOM   4626 O O   . THR B 1 94  ? -7.873  -1.171  -58.395 1.00 56.90  ? 63   THR B O   1 
ATOM   4627 C CB  . THR B 1 94  ? -8.432  -0.428  -61.159 1.00 59.04  ? 63   THR B CB  1 
ATOM   4628 O OG1 . THR B 1 94  ? -7.956  -1.614  -61.817 1.00 58.25  ? 63   THR B OG1 1 
ATOM   4629 C CG2 . THR B 1 94  ? -8.855  0.538   -62.306 1.00 59.29  ? 63   THR B CG2 1 
ATOM   4630 N N   . THR B 1 95  ? -5.768  -1.388  -59.171 1.00 54.96  ? 64   THR B N   1 
ATOM   4631 C CA  . THR B 1 95  ? -5.330  -2.340  -58.149 1.00 55.11  ? 64   THR B CA  1 
ATOM   4632 C C   . THR B 1 95  ? -3.920  -2.000  -57.665 1.00 53.62  ? 64   THR B C   1 
ATOM   4633 O O   . THR B 1 95  ? -3.127  -1.407  -58.371 1.00 52.92  ? 64   THR B O   1 
ATOM   4634 C CB  . THR B 1 95  ? -5.320  -3.809  -58.672 1.00 56.40  ? 64   THR B CB  1 
ATOM   4635 O OG1 . THR B 1 95  ? -4.383  -3.942  -59.763 1.00 57.21  ? 64   THR B OG1 1 
ATOM   4636 C CG2 . THR B 1 95  ? -6.668  -4.232  -59.293 1.00 58.91  ? 64   THR B CG2 1 
ATOM   4637 N N   . PHE B 1 96  ? -3.622  -2.396  -56.441 1.00 53.26  ? 65   PHE B N   1 
ATOM   4638 C CA  . PHE B 1 96  ? -2.297  -2.275  -55.915 1.00 52.58  ? 65   PHE B CA  1 
ATOM   4639 C C   . PHE B 1 96  ? -1.329  -3.151  -56.709 1.00 52.72  ? 65   PHE B C   1 
ATOM   4640 O O   . PHE B 1 96  ? -1.647  -4.243  -57.138 1.00 53.34  ? 65   PHE B O   1 
ATOM   4641 C CB  . PHE B 1 96  ? -2.280  -2.708  -54.457 1.00 52.87  ? 65   PHE B CB  1 
ATOM   4642 C CG  . PHE B 1 96  ? -2.878  -1.715  -53.517 1.00 53.16  ? 65   PHE B CG  1 
ATOM   4643 C CD1 . PHE B 1 96  ? -2.378  -0.436  -53.432 1.00 51.52  ? 65   PHE B CD1 1 
ATOM   4644 C CD2 . PHE B 1 96  ? -3.944  -2.070  -52.705 1.00 54.16  ? 65   PHE B CD2 1 
ATOM   4645 C CE1 . PHE B 1 96  ? -2.914  0.470   -52.561 1.00 50.96  ? 65   PHE B CE1 1 
ATOM   4646 C CE2 . PHE B 1 96  ? -4.474  -1.168  -51.823 1.00 53.79  ? 65   PHE B CE2 1 
ATOM   4647 C CZ  . PHE B 1 96  ? -3.948  0.110   -51.753 1.00 53.02  ? 65   PHE B CZ  1 
ATOM   4648 N N   . GLN B 1 97  ? -0.125  -2.644  -56.870 1.00 52.21  ? 66   GLN B N   1 
ATOM   4649 C CA  . GLN B 1 97  ? 0.926   -3.366  -57.555 1.00 52.46  ? 66   GLN B CA  1 
ATOM   4650 C C   . GLN B 1 97  ? 1.742   -4.235  -56.586 1.00 51.51  ? 66   GLN B C   1 
ATOM   4651 O O   . GLN B 1 97  ? 1.468   -4.289  -55.387 1.00 50.99  ? 66   GLN B O   1 
ATOM   4652 C CB  . GLN B 1 97  ? 1.814   -2.348  -58.287 1.00 52.63  ? 66   GLN B CB  1 
ATOM   4653 C CG  . GLN B 1 97  ? 1.370   -2.121  -59.723 1.00 54.61  ? 66   GLN B CG  1 
ATOM   4654 C CD  . GLN B 1 97  ? 1.790   -3.263  -60.620 1.00 57.63  ? 66   GLN B CD  1 
ATOM   4655 O OE1 . GLN B 1 97  ? 2.418   -4.229  -60.151 1.00 61.55  ? 66   GLN B OE1 1 
ATOM   4656 N NE2 . GLN B 1 97  ? 1.472   -3.164  -61.900 1.00 56.87  ? 66   GLN B NE2 1 
ATOM   4657 N N   . ASN B 1 98  ? 2.731   -4.933  -57.120 1.00 51.04  ? 67   ASN B N   1 
ATOM   4658 C CA  . ASN B 1 98  ? 3.581   -5.789  -56.301 1.00 50.54  ? 67   ASN B CA  1 
ATOM   4659 C C   . ASN B 1 98  ? 4.268   -5.086  -55.118 1.00 49.25  ? 67   ASN B C   1 
ATOM   4660 O O   . ASN B 1 98  ? 4.609   -3.901  -55.165 1.00 48.56  ? 67   ASN B O   1 
ATOM   4661 C CB  . ASN B 1 98  ? 4.601   -6.517  -57.178 1.00 50.90  ? 67   ASN B CB  1 
ATOM   4662 C CG  . ASN B 1 98  ? 3.936   -7.539  -58.135 1.00 53.78  ? 67   ASN B CG  1 
ATOM   4663 O OD1 . ASN B 1 98  ? 2.822   -8.004  -57.888 1.00 52.92  ? 67   ASN B OD1 1 
ATOM   4664 N ND2 . ASN B 1 98  ? 4.630   -7.878  -59.235 1.00 57.51  ? 67   ASN B ND2 1 
ATOM   4665 N N   . VAL B 1 99  ? 4.428   -5.846  -54.046 1.00 48.72  ? 68   VAL B N   1 
ATOM   4666 C CA  . VAL B 1 99  ? 5.196   -5.457  -52.876 1.00 48.08  ? 68   VAL B CA  1 
ATOM   4667 C C   . VAL B 1 99  ? 6.685   -5.690  -53.133 1.00 47.68  ? 68   VAL B C   1 
ATOM   4668 O O   . VAL B 1 99  ? 7.038   -6.688  -53.733 1.00 48.74  ? 68   VAL B O   1 
ATOM   4669 C CB  . VAL B 1 99  ? 4.730   -6.312  -51.685 1.00 48.10  ? 68   VAL B CB  1 
ATOM   4670 C CG1 . VAL B 1 99  ? 5.648   -6.191  -50.512 1.00 47.88  ? 68   VAL B CG1 1 
ATOM   4671 C CG2 . VAL B 1 99  ? 3.326   -5.898  -51.297 1.00 49.68  ? 68   VAL B CG2 1 
ATOM   4672 N N   . CYS B 1 100 ? 7.542   -4.777  -52.691 1.00 46.84  ? 69   CYS B N   1 
ATOM   4673 C CA  . CYS B 1 100 ? 8.983   -4.911  -52.873 1.00 47.28  ? 69   CYS B CA  1 
ATOM   4674 C C   . CYS B 1 100 ? 9.474   -6.159  -52.151 1.00 48.15  ? 69   CYS B C   1 
ATOM   4675 O O   . CYS B 1 100 ? 9.013   -6.475  -51.041 1.00 47.82  ? 69   CYS B O   1 
ATOM   4676 C CB  . CYS B 1 100 ? 9.713   -3.674  -52.370 1.00 46.97  ? 69   CYS B CB  1 
ATOM   4677 S SG  . CYS B 1 100 ? 9.471   -2.176  -53.392 1.00 49.60  ? 69   CYS B SG  1 
ATOM   4678 N N   . TYR B 1 101 ? 10.392  -6.882  -52.803 1.00 49.03  ? 70   TYR B N   1 
ATOM   4679 C CA  . TYR B 1 101 ? 10.904  -8.137  -52.280 1.00 49.94  ? 70   TYR B CA  1 
ATOM   4680 C C   . TYR B 1 101 ? 11.445  -7.975  -50.862 1.00 49.57  ? 70   TYR B C   1 
ATOM   4681 O O   . TYR B 1 101 ? 12.240  -7.065  -50.588 1.00 48.50  ? 70   TYR B O   1 
ATOM   4682 C CB  . TYR B 1 101 ? 11.937  -8.786  -53.247 1.00 50.85  ? 70   TYR B CB  1 
ATOM   4683 C CG  . TYR B 1 101 ? 11.795  -10.274 -53.204 1.00 51.27  ? 70   TYR B CG  1 
ATOM   4684 C CD1 . TYR B 1 101 ? 10.850  -10.939 -53.968 1.00 53.41  ? 70   TYR B CD1 1 
ATOM   4685 C CD2 . TYR B 1 101 ? 12.516  -11.004 -52.301 1.00 52.25  ? 70   TYR B CD2 1 
ATOM   4686 C CE1 . TYR B 1 101 ? 10.694  -12.353 -53.851 1.00 54.27  ? 70   TYR B CE1 1 
ATOM   4687 C CE2 . TYR B 1 101 ? 12.369  -12.354 -52.179 1.00 52.74  ? 70   TYR B CE2 1 
ATOM   4688 C CZ  . TYR B 1 101 ? 11.462  -13.029 -52.934 1.00 54.29  ? 70   TYR B CZ  1 
ATOM   4689 O OH  . TYR B 1 101 ? 11.372  -14.383 -52.736 1.00 55.39  ? 70   TYR B OH  1 
ATOM   4690 N N   . GLN B 1 102 ? 10.979  -8.844  -49.963 1.00 50.15  ? 71   GLN B N   1 
ATOM   4691 C CA  . GLN B 1 102 ? 11.271  -8.719  -48.537 1.00 50.27  ? 71   GLN B CA  1 
ATOM   4692 C C   . GLN B 1 102 ? 11.013  -9.991  -47.762 1.00 52.06  ? 71   GLN B C   1 
ATOM   4693 O O   . GLN B 1 102 ? 10.248  -10.855 -48.205 1.00 52.45  ? 71   GLN B O   1 
ATOM   4694 C CB  . GLN B 1 102 ? 10.445  -7.587  -47.917 1.00 48.94  ? 71   GLN B CB  1 
ATOM   4695 C CG  . GLN B 1 102 ? 8.946   -7.841  -47.941 1.00 48.43  ? 71   GLN B CG  1 
ATOM   4696 C CD  . GLN B 1 102 ? 8.129   -6.629  -47.562 1.00 46.45  ? 71   GLN B CD  1 
ATOM   4697 O OE1 . GLN B 1 102 ? 7.545   -6.589  -46.493 1.00 48.08  ? 71   GLN B OE1 1 
ATOM   4698 N NE2 . GLN B 1 102 ? 8.076   -5.654  -48.435 1.00 44.28  ? 71   GLN B NE2 1 
ATOM   4699 N N   . TYR B 1 103 ? 11.648  -10.080 -46.587 1.00 53.52  ? 72   TYR B N   1 
ATOM   4700 C CA  . TYR B 1 103 ? 11.442  -11.170 -45.637 1.00 55.46  ? 72   TYR B CA  1 
ATOM   4701 C C   . TYR B 1 103 ? 10.032  -11.077 -45.117 1.00 55.97  ? 72   TYR B C   1 
ATOM   4702 O O   . TYR B 1 103 ? 9.552   -9.979  -44.774 1.00 55.29  ? 72   TYR B O   1 
ATOM   4703 C CB  . TYR B 1 103 ? 12.416  -11.042 -44.470 1.00 56.34  ? 72   TYR B CB  1 
ATOM   4704 C CG  . TYR B 1 103 ? 12.350  -12.153 -43.444 1.00 59.01  ? 72   TYR B CG  1 
ATOM   4705 C CD1 . TYR B 1 103 ? 11.681  -11.970 -42.212 1.00 60.29  ? 72   TYR B CD1 1 
ATOM   4706 C CD2 . TYR B 1 103 ? 12.991  -13.368 -43.674 1.00 60.23  ? 72   TYR B CD2 1 
ATOM   4707 C CE1 . TYR B 1 103 ? 11.641  -13.001 -41.253 1.00 62.43  ? 72   TYR B CE1 1 
ATOM   4708 C CE2 . TYR B 1 103 ? 12.951  -14.397 -42.740 1.00 62.35  ? 72   TYR B CE2 1 
ATOM   4709 C CZ  . TYR B 1 103 ? 12.279  -14.217 -41.534 1.00 65.12  ? 72   TYR B CZ  1 
ATOM   4710 O OH  . TYR B 1 103 ? 12.276  -15.255 -40.621 1.00 68.59  ? 72   TYR B OH  1 
ATOM   4711 N N   . VAL B 1 104 ? 9.389   -12.237 -45.056 1.00 57.64  ? 73   VAL B N   1 
ATOM   4712 C CA  . VAL B 1 104 ? 8.039   -12.382 -44.565 1.00 58.74  ? 73   VAL B CA  1 
ATOM   4713 C C   . VAL B 1 104 ? 8.110   -13.015 -43.173 1.00 60.78  ? 73   VAL B C   1 
ATOM   4714 O O   . VAL B 1 104 ? 8.764   -14.039 -42.958 1.00 62.36  ? 73   VAL B O   1 
ATOM   4715 C CB  . VAL B 1 104 ? 7.191   -13.209 -45.561 1.00 59.45  ? 73   VAL B CB  1 
ATOM   4716 C CG1 . VAL B 1 104 ? 5.866   -13.658 -44.944 1.00 60.44  ? 73   VAL B CG1 1 
ATOM   4717 C CG2 . VAL B 1 104 ? 6.945   -12.399 -46.833 1.00 57.39  ? 73   VAL B CG2 1 
ATOM   4718 N N   . ASP B 1 105 ? 7.452   -12.355 -42.224 1.00 61.87  ? 74   ASP B N   1 
ATOM   4719 C CA  . ASP B 1 105 ? 7.427   -12.760 -40.818 1.00 63.16  ? 74   ASP B CA  1 
ATOM   4720 C C   . ASP B 1 105 ? 6.594   -14.031 -40.581 1.00 64.54  ? 74   ASP B C   1 
ATOM   4721 O O   . ASP B 1 105 ? 5.428   -14.103 -40.974 1.00 64.58  ? 74   ASP B O   1 
ATOM   4722 C CB  . ASP B 1 105 ? 6.883   -11.595 -39.987 1.00 62.57  ? 74   ASP B CB  1 
ATOM   4723 C CG  . ASP B 1 105 ? 6.886   -11.871 -38.505 1.00 64.21  ? 74   ASP B CG  1 
ATOM   4724 O OD1 . ASP B 1 105 ? 6.170   -11.134 -37.804 1.00 67.54  ? 74   ASP B OD1 1 
ATOM   4725 O OD2 . ASP B 1 105 ? 7.560   -12.766 -37.954 1.00 66.77  ? 74   ASP B OD2 1 
ATOM   4726 N N   . THR B 1 106 ? 7.216   -15.013 -39.922 1.00 65.85  ? 75   THR B N   1 
ATOM   4727 C CA  . THR B 1 106 ? 6.603   -16.311 -39.626 1.00 67.43  ? 75   THR B CA  1 
ATOM   4728 C C   . THR B 1 106 ? 6.679   -16.692 -38.142 1.00 68.21  ? 75   THR B C   1 
ATOM   4729 O O   . THR B 1 106 ? 6.556   -17.856 -37.810 1.00 70.02  ? 75   THR B O   1 
ATOM   4730 C CB  . THR B 1 106 ? 7.281   -17.419 -40.470 1.00 68.78  ? 75   THR B CB  1 
ATOM   4731 O OG1 . THR B 1 106 ? 8.704   -17.389 -40.282 1.00 68.97  ? 75   THR B OG1 1 
ATOM   4732 C CG2 . THR B 1 106 ? 7.074   -17.189 -41.976 1.00 67.62  ? 75   THR B CG2 1 
ATOM   4733 N N   . LEU B 1 107 ? 6.841   -15.714 -37.251 1.00 67.57  ? 76   LEU B N   1 
ATOM   4734 C CA  . LEU B 1 107 ? 6.906   -15.962 -35.800 1.00 68.21  ? 76   LEU B CA  1 
ATOM   4735 C C   . LEU B 1 107 ? 5.581   -16.486 -35.235 1.00 69.01  ? 76   LEU B C   1 
ATOM   4736 O O   . LEU B 1 107 ? 5.571   -17.358 -34.356 1.00 70.54  ? 76   LEU B O   1 
ATOM   4737 C CB  . LEU B 1 107 ? 7.301   -14.675 -35.041 1.00 67.33  ? 76   LEU B CB  1 
ATOM   4738 C CG  . LEU B 1 107 ? 7.537   -14.807 -33.526 1.00 67.74  ? 76   LEU B CG  1 
ATOM   4739 C CD1 . LEU B 1 107 ? 8.745   -15.701 -33.247 1.00 69.74  ? 76   LEU B CD1 1 
ATOM   4740 C CD2 . LEU B 1 107 ? 7.716   -13.467 -32.870 1.00 66.42  ? 76   LEU B CD2 1 
ATOM   4741 N N   . TYR B 1 108 ? 4.475   -15.933 -35.726 1.00 68.12  ? 77   TYR B N   1 
ATOM   4742 C CA  . TYR B 1 108 ? 3.137   -16.343 -35.309 1.00 68.80  ? 77   TYR B CA  1 
ATOM   4743 C C   . TYR B 1 108 ? 2.268   -16.501 -36.567 1.00 69.10  ? 77   TYR B C   1 
ATOM   4744 O O   . TYR B 1 108 ? 1.484   -15.615 -36.907 1.00 67.91  ? 77   TYR B O   1 
ATOM   4745 C CB  . TYR B 1 108 ? 2.538   -15.304 -34.343 1.00 67.96  ? 77   TYR B CB  1 
ATOM   4746 C CG  . TYR B 1 108 ? 3.219   -15.234 -32.979 1.00 68.14  ? 77   TYR B CG  1 
ATOM   4747 C CD1 . TYR B 1 108 ? 3.324   -16.371 -32.169 1.00 69.44  ? 77   TYR B CD1 1 
ATOM   4748 C CD2 . TYR B 1 108 ? 3.765   -14.040 -32.502 1.00 65.81  ? 77   TYR B CD2 1 
ATOM   4749 C CE1 . TYR B 1 108 ? 3.947   -16.321 -30.912 1.00 69.08  ? 77   TYR B CE1 1 
ATOM   4750 C CE2 . TYR B 1 108 ? 4.382   -13.974 -31.248 1.00 66.15  ? 77   TYR B CE2 1 
ATOM   4751 C CZ  . TYR B 1 108 ? 4.470   -15.120 -30.452 1.00 68.55  ? 77   TYR B CZ  1 
ATOM   4752 O OH  . TYR B 1 108 ? 5.089   -15.080 -29.211 1.00 67.05  ? 77   TYR B OH  1 
ATOM   4753 N N   . PRO B 1 109 ? 2.403   -17.628 -37.269 1.00 70.56  ? 78   PRO B N   1 
ATOM   4754 C CA  . PRO B 1 109 ? 1.706   -17.791 -38.557 1.00 70.75  ? 78   PRO B CA  1 
ATOM   4755 C C   . PRO B 1 109 ? 0.178   -17.778 -38.391 1.00 71.18  ? 78   PRO B C   1 
ATOM   4756 O O   . PRO B 1 109 ? -0.330  -18.359 -37.431 1.00 72.26  ? 78   PRO B O   1 
ATOM   4757 C CB  . PRO B 1 109 ? 2.214   -19.152 -39.088 1.00 72.04  ? 78   PRO B CB  1 
ATOM   4758 C CG  . PRO B 1 109 ? 3.383   -19.535 -38.202 1.00 72.57  ? 78   PRO B CG  1 
ATOM   4759 C CD  . PRO B 1 109 ? 3.177   -18.831 -36.892 1.00 71.90  ? 78   PRO B CD  1 
ATOM   4760 N N   . GLY B 1 110 ? -0.527  -17.086 -39.287 1.00 70.37  ? 79   GLY B N   1 
ATOM   4761 C CA  . GLY B 1 110 ? -1.975  -16.963 -39.217 1.00 70.82  ? 79   GLY B CA  1 
ATOM   4762 C C   . GLY B 1 110 ? -2.531  -16.020 -38.162 1.00 70.12  ? 79   GLY B C   1 
ATOM   4763 O O   . GLY B 1 110 ? -3.739  -15.851 -38.076 1.00 70.54  ? 79   GLY B O   1 
ATOM   4764 N N   . PHE B 1 111 ? -1.662  -15.385 -37.380 1.00 69.29  ? 80   PHE B N   1 
ATOM   4765 C CA  . PHE B 1 111 ? -2.074  -14.472 -36.313 1.00 68.32  ? 80   PHE B CA  1 
ATOM   4766 C C   . PHE B 1 111 ? -2.283  -13.076 -36.897 1.00 66.50  ? 80   PHE B C   1 
ATOM   4767 O O   . PHE B 1 111 ? -1.390  -12.534 -37.511 1.00 65.00  ? 80   PHE B O   1 
ATOM   4768 C CB  . PHE B 1 111 ? -1.002  -14.456 -35.220 1.00 67.61  ? 80   PHE B CB  1 
ATOM   4769 C CG  . PHE B 1 111 ? -1.277  -13.493 -34.113 1.00 67.73  ? 80   PHE B CG  1 
ATOM   4770 C CD1 . PHE B 1 111 ? -2.501  -13.517 -33.435 1.00 69.09  ? 80   PHE B CD1 1 
ATOM   4771 C CD2 . PHE B 1 111 ? -0.313  -12.552 -33.734 1.00 65.67  ? 80   PHE B CD2 1 
ATOM   4772 C CE1 . PHE B 1 111 ? -2.762  -12.608 -32.391 1.00 68.70  ? 80   PHE B CE1 1 
ATOM   4773 C CE2 . PHE B 1 111 ? -0.559  -11.657 -32.698 1.00 65.99  ? 80   PHE B CE2 1 
ATOM   4774 C CZ  . PHE B 1 111 ? -1.791  -11.677 -32.023 1.00 67.50  ? 80   PHE B CZ  1 
ATOM   4775 N N   . GLU B 1 112 ? -3.463  -12.505 -36.706 1.00 66.81  ? 81   GLU B N   1 
ATOM   4776 C CA  . GLU B 1 112 ? -3.808  -11.191 -37.248 1.00 66.35  ? 81   GLU B CA  1 
ATOM   4777 C C   . GLU B 1 112 ? -2.783  -10.099 -36.891 1.00 64.03  ? 81   GLU B C   1 
ATOM   4778 O O   . GLU B 1 112 ? -2.456  -9.252  -37.716 1.00 62.93  ? 81   GLU B O   1 
ATOM   4779 C CB  . GLU B 1 112 ? -5.182  -10.793 -36.703 1.00 67.94  ? 81   GLU B CB  1 
ATOM   4780 C CG  . GLU B 1 112 ? -6.049  -9.913  -37.606 1.00 72.26  ? 81   GLU B CG  1 
ATOM   4781 C CD  . GLU B 1 112 ? -7.412  -9.591  -36.954 1.00 79.22  ? 81   GLU B CD  1 
ATOM   4782 O OE1 . GLU B 1 112 ? -7.533  -8.462  -36.380 1.00 81.28  ? 81   GLU B OE1 1 
ATOM   4783 O OE2 . GLU B 1 112 ? -8.347  -10.464 -36.982 1.00 80.48  ? 81   GLU B OE2 1 
ATOM   4784 N N   . GLY B 1 113 ? -2.282  -10.140 -35.659 1.00 62.83  ? 82   GLY B N   1 
ATOM   4785 C CA  . GLY B 1 113 ? -1.408  -9.127  -35.137 1.00 60.55  ? 82   GLY B CA  1 
ATOM   4786 C C   . GLY B 1 113 ? -0.118  -8.989  -35.884 1.00 59.01  ? 82   GLY B C   1 
ATOM   4787 O O   . GLY B 1 113 ? 0.457   -7.899  -35.891 1.00 57.79  ? 82   GLY B O   1 
ATOM   4788 N N   . THR B 1 114 ? 0.347   -10.085 -36.478 1.00 59.09  ? 83   THR B N   1 
ATOM   4789 C CA  . THR B 1 114 ? 1.527   -10.071 -37.334 1.00 58.40  ? 83   THR B CA  1 
ATOM   4790 C C   . THR B 1 114 ? 1.192   -10.002 -38.821 1.00 58.15  ? 83   THR B C   1 
ATOM   4791 O O   . THR B 1 114 ? 1.891   -9.331  -39.577 1.00 57.38  ? 83   THR B O   1 
ATOM   4792 C CB  . THR B 1 114 ? 2.458   -11.293 -37.079 1.00 59.47  ? 83   THR B CB  1 
ATOM   4793 O OG1 . THR B 1 114 ? 1.711   -12.523 -37.033 1.00 59.98  ? 83   THR B OG1 1 
ATOM   4794 C CG2 . THR B 1 114 ? 3.148   -11.191 -35.733 1.00 59.22  ? 83   THR B CG2 1 
ATOM   4795 N N   . GLU B 1 115 ? 0.151   -10.705 -39.254 1.00 58.98  ? 84   GLU B N   1 
ATOM   4796 C CA  . GLU B 1 115 ? -0.128  -10.821 -40.684 1.00 59.04  ? 84   GLU B CA  1 
ATOM   4797 C C   . GLU B 1 115 ? -0.617  -9.505  -41.273 1.00 57.45  ? 84   GLU B C   1 
ATOM   4798 O O   . GLU B 1 115 ? -0.499  -9.283  -42.470 1.00 57.62  ? 84   GLU B O   1 
ATOM   4799 C CB  . GLU B 1 115 ? -1.168  -11.911 -40.958 1.00 60.78  ? 84   GLU B CB  1 
ATOM   4800 C CG  . GLU B 1 115 ? -0.767  -13.332 -40.561 1.00 63.50  ? 84   GLU B CG  1 
ATOM   4801 C CD  . GLU B 1 115 ? 0.363   -13.939 -41.371 1.00 64.39  ? 84   GLU B CD  1 
ATOM   4802 O OE1 . GLU B 1 115 ? 0.836   -13.326 -42.355 1.00 64.56  ? 84   GLU B OE1 1 
ATOM   4803 O OE2 . GLU B 1 115 ? 0.779   -15.065 -41.004 1.00 67.46  ? 84   GLU B OE2 1 
ATOM   4804 N N   . MET B 1 116 ? -1.182  -8.639  -40.435 1.00 56.06  ? 85   MET B N   1 
ATOM   4805 C CA  . MET B 1 116 ? -1.610  -7.315  -40.875 1.00 54.37  ? 85   MET B CA  1 
ATOM   4806 C C   . MET B 1 116 ? -0.413  -6.458  -41.362 1.00 52.56  ? 85   MET B C   1 
ATOM   4807 O O   . MET B 1 116 ? -0.615  -5.458  -42.046 1.00 51.79  ? 85   MET B O   1 
ATOM   4808 C CB  . MET B 1 116 ? -2.375  -6.596  -39.753 1.00 54.31  ? 85   MET B CB  1 
ATOM   4809 C CG  . MET B 1 116 ? -1.525  -6.259  -38.515 1.00 54.06  ? 85   MET B CG  1 
ATOM   4810 S SD  . MET B 1 116 ? -2.358  -5.213  -37.305 1.00 53.56  ? 85   MET B SD  1 
ATOM   4811 C CE  . MET B 1 116 ? -2.435  -3.653  -38.208 1.00 51.50  ? 85   MET B CE  1 
ATOM   4812 N N   . TRP B 1 117 ? 0.811   -6.845  -40.992 1.00 51.52  ? 86   TRP B N   1 
ATOM   4813 C CA  . TRP B 1 117 ? 2.028   -6.141  -41.445 1.00 50.61  ? 86   TRP B CA  1 
ATOM   4814 C C   . TRP B 1 117 ? 2.751   -6.850  -42.609 1.00 50.58  ? 86   TRP B C   1 
ATOM   4815 O O   . TRP B 1 117 ? 3.639   -6.266  -43.222 1.00 48.76  ? 86   TRP B O   1 
ATOM   4816 C CB  . TRP B 1 117 ? 3.025   -5.925  -40.299 1.00 49.78  ? 86   TRP B CB  1 
ATOM   4817 C CG  . TRP B 1 117 ? 2.437   -5.286  -39.072 1.00 49.50  ? 86   TRP B CG  1 
ATOM   4818 C CD1 . TRP B 1 117 ? 2.140   -5.905  -37.902 1.00 50.52  ? 86   TRP B CD1 1 
ATOM   4819 C CD2 . TRP B 1 117 ? 2.075   -3.918  -38.902 1.00 46.89  ? 86   TRP B CD2 1 
ATOM   4820 N NE1 . TRP B 1 117 ? 1.598   -5.009  -37.017 1.00 50.67  ? 86   TRP B NE1 1 
ATOM   4821 C CE2 . TRP B 1 117 ? 1.561   -3.775  -37.605 1.00 49.10  ? 86   TRP B CE2 1 
ATOM   4822 C CE3 . TRP B 1 117 ? 2.126   -2.790  -39.718 1.00 46.20  ? 86   TRP B CE3 1 
ATOM   4823 C CZ2 . TRP B 1 117 ? 1.123   -2.534  -37.092 1.00 47.94  ? 86   TRP B CZ2 1 
ATOM   4824 C CZ3 . TRP B 1 117 ? 1.678   -1.563  -39.211 1.00 43.50  ? 86   TRP B CZ3 1 
ATOM   4825 C CH2 . TRP B 1 117 ? 1.190   -1.451  -37.917 1.00 44.26  ? 86   TRP B CH2 1 
ATOM   4826 N N   . ASN B 1 118 ? 2.354   -8.087  -42.906 1.00 51.52  ? 87   ASN B N   1 
ATOM   4827 C CA  . ASN B 1 118 ? 3.004   -8.875  -43.950 1.00 51.90  ? 87   ASN B CA  1 
ATOM   4828 C C   . ASN B 1 118 ? 2.502   -8.443  -45.338 1.00 51.49  ? 87   ASN B C   1 
ATOM   4829 O O   . ASN B 1 118 ? 1.436   -7.849  -45.457 1.00 51.74  ? 87   ASN B O   1 
ATOM   4830 C CB  . ASN B 1 118 ? 2.736   -10.378 -43.737 1.00 52.86  ? 87   ASN B CB  1 
ATOM   4831 C CG  . ASN B 1 118 ? 3.722   -11.057 -42.769 1.00 53.22  ? 87   ASN B CG  1 
ATOM   4832 O OD1 . ASN B 1 118 ? 4.858   -10.632 -42.613 1.00 50.35  ? 87   ASN B OD1 1 
ATOM   4833 N ND2 . ASN B 1 118 ? 3.287   -12.180 -42.167 1.00 54.93  ? 87   ASN B ND2 1 
ATOM   4834 N N   . PRO B 1 119 ? 3.259   -8.739  -46.392 1.00 51.26  ? 88   PRO B N   1 
ATOM   4835 C CA  . PRO B 1 119 ? 2.842   -8.389  -47.748 1.00 50.77  ? 88   PRO B CA  1 
ATOM   4836 C C   . PRO B 1 119 ? 1.485   -8.962  -48.095 1.00 51.99  ? 88   PRO B C   1 
ATOM   4837 O O   . PRO B 1 119 ? 1.224   -10.141 -47.822 1.00 52.28  ? 88   PRO B O   1 
ATOM   4838 C CB  . PRO B 1 119 ? 3.919   -9.032  -48.626 1.00 50.67  ? 88   PRO B CB  1 
ATOM   4839 C CG  . PRO B 1 119 ? 5.079   -9.201  -47.770 1.00 50.63  ? 88   PRO B CG  1 
ATOM   4840 C CD  . PRO B 1 119 ? 4.569   -9.418  -46.394 1.00 51.79  ? 88   PRO B CD  1 
ATOM   4841 N N   . ASN B 1 120 ? 0.650   -8.128  -48.708 1.00 52.24  ? 89   ASN B N   1 
ATOM   4842 C CA  . ASN B 1 120 ? -0.675  -8.515  -49.141 1.00 53.13  ? 89   ASN B CA  1 
ATOM   4843 C C   . ASN B 1 120 ? -0.817  -8.496  -50.666 1.00 53.61  ? 89   ASN B C   1 
ATOM   4844 O O   . ASN B 1 120 ? -1.913  -8.653  -51.163 1.00 54.75  ? 89   ASN B O   1 
ATOM   4845 C CB  . ASN B 1 120 ? -1.751  -7.657  -48.438 1.00 52.96  ? 89   ASN B CB  1 
ATOM   4846 C CG  . ASN B 1 120 ? -1.736  -6.198  -48.874 1.00 51.74  ? 89   ASN B CG  1 
ATOM   4847 O OD1 . ASN B 1 120 ? -0.741  -5.697  -49.375 1.00 52.62  ? 89   ASN B OD1 1 
ATOM   4848 N ND2 . ASN B 1 120 ? -2.849  -5.513  -48.681 1.00 51.77  ? 89   ASN B ND2 1 
ATOM   4849 N N   . ARG B 1 121 ? 0.276   -8.303  -51.403 1.00 53.50  ? 90   ARG B N   1 
ATOM   4850 C CA  . ARG B 1 121 ? 0.318   -8.597  -52.854 1.00 53.72  ? 90   ARG B CA  1 
ATOM   4851 C C   . ARG B 1 121 ? 1.586   -9.399  -53.144 1.00 53.95  ? 90   ARG B C   1 
ATOM   4852 O O   . ARG B 1 121 ? 2.390   -9.619  -52.240 1.00 54.12  ? 90   ARG B O   1 
ATOM   4853 C CB  . ARG B 1 121 ? 0.286   -7.304  -53.677 1.00 52.57  ? 90   ARG B CB  1 
ATOM   4854 C CG  . ARG B 1 121 ? -1.022  -6.529  -53.569 1.00 52.50  ? 90   ARG B CG  1 
ATOM   4855 C CD  . ARG B 1 121 ? -2.246  -7.333  -54.027 1.00 54.08  ? 90   ARG B CD  1 
ATOM   4856 N NE  . ARG B 1 121 ? -3.472  -6.545  -54.046 1.00 53.80  ? 90   ARG B NE  1 
ATOM   4857 C CZ  . ARG B 1 121 ? -4.247  -6.274  -52.993 1.00 53.65  ? 90   ARG B CZ  1 
ATOM   4858 N NH1 . ARG B 1 121 ? -3.975  -6.724  -51.781 1.00 52.89  ? 90   ARG B NH1 1 
ATOM   4859 N NH2 . ARG B 1 121 ? -5.327  -5.526  -53.162 1.00 55.11  ? 90   ARG B NH2 1 
ATOM   4860 N N   . GLU B 1 122 ? 1.756   -9.839  -54.391 1.00 54.48  ? 91   GLU B N   1 
ATOM   4861 C CA  . GLU B 1 122 ? 2.915   -10.641 -54.790 1.00 54.83  ? 91   GLU B CA  1 
ATOM   4862 C C   . GLU B 1 122 ? 4.173   -9.850  -54.583 1.00 52.89  ? 91   GLU B C   1 
ATOM   4863 O O   . GLU B 1 122 ? 4.182   -8.631  -54.766 1.00 51.77  ? 91   GLU B O   1 
ATOM   4864 C CB  . GLU B 1 122 ? 2.838   -11.043 -56.273 1.00 56.67  ? 91   GLU B CB  1 
ATOM   4865 C CG  . GLU B 1 122 ? 1.619   -11.873 -56.640 1.00 61.16  ? 91   GLU B CG  1 
ATOM   4866 C CD  . GLU B 1 122 ? 1.825   -13.354 -56.391 1.00 67.53  ? 91   GLU B CD  1 
ATOM   4867 O OE1 . GLU B 1 122 ? 1.327   -14.132 -57.235 1.00 72.93  ? 91   GLU B OE1 1 
ATOM   4868 O OE2 . GLU B 1 122 ? 2.471   -13.735 -55.370 1.00 68.35  ? 91   GLU B OE2 1 
ATOM   4869 N N   . LEU B 1 123 ? 5.207   -10.554 -54.163 1.00 51.98  ? 92   LEU B N   1 
ATOM   4870 C CA  . LEU B 1 123 ? 6.526   -10.008 -54.028 1.00 51.16  ? 92   LEU B CA  1 
ATOM   4871 C C   . LEU B 1 123 ? 7.196   -9.955  -55.384 1.00 51.17  ? 92   LEU B C   1 
ATOM   4872 O O   . LEU B 1 123 ? 7.108   -10.884 -56.164 1.00 52.27  ? 92   LEU B O   1 
ATOM   4873 C CB  . LEU B 1 123 ? 7.358   -10.907 -53.112 1.00 51.75  ? 92   LEU B CB  1 
ATOM   4874 C CG  . LEU B 1 123 ? 6.908   -11.102 -51.658 1.00 51.46  ? 92   LEU B CG  1 
ATOM   4875 C CD1 . LEU B 1 123 ? 7.919   -11.939 -50.921 1.00 51.06  ? 92   LEU B CD1 1 
ATOM   4876 C CD2 . LEU B 1 123 ? 6.768   -9.780  -50.986 1.00 51.44  ? 92   LEU B CD2 1 
ATOM   4877 N N   . SER B 1 124 ? 7.894   -8.872  -55.647 1.00 50.35  ? 93   SER B N   1 
ATOM   4878 C CA  . SER B 1 124 ? 8.658   -8.714  -56.866 1.00 49.84  ? 93   SER B CA  1 
ATOM   4879 C C   . SER B 1 124 ? 9.680   -7.625  -56.647 1.00 49.36  ? 93   SER B C   1 
ATOM   4880 O O   . SER B 1 124 ? 9.484   -6.728  -55.814 1.00 48.29  ? 93   SER B O   1 
ATOM   4881 C CB  . SER B 1 124 ? 7.707   -8.307  -57.983 1.00 49.56  ? 93   SER B CB  1 
ATOM   4882 O OG  . SER B 1 124 ? 8.402   -8.064  -59.171 1.00 48.47  ? 93   SER B OG  1 
ATOM   4883 N N   . GLU B 1 125 ? 10.766  -7.694  -57.397 1.00 49.64  ? 94   GLU B N   1 
ATOM   4884 C CA  . GLU B 1 125 ? 11.724  -6.600  -57.449 1.00 49.00  ? 94   GLU B CA  1 
ATOM   4885 C C   . GLU B 1 125 ? 11.176  -5.474  -58.297 1.00 48.48  ? 94   GLU B C   1 
ATOM   4886 O O   . GLU B 1 125 ? 11.634  -4.334  -58.193 1.00 48.50  ? 94   GLU B O   1 
ATOM   4887 C CB  . GLU B 1 125 ? 13.057  -7.085  -58.007 1.00 49.92  ? 94   GLU B CB  1 
ATOM   4888 C CG  . GLU B 1 125 ? 13.840  -7.919  -57.025 1.00 49.41  ? 94   GLU B CG  1 
ATOM   4889 C CD  . GLU B 1 125 ? 15.220  -8.260  -57.564 1.00 51.20  ? 94   GLU B CD  1 
ATOM   4890 O OE1 . GLU B 1 125 ? 16.115  -7.368  -57.515 1.00 48.66  ? 94   GLU B OE1 1 
ATOM   4891 O OE2 . GLU B 1 125 ? 15.393  -9.418  -58.040 1.00 49.59  ? 94   GLU B OE2 1 
ATOM   4892 N N   . ASP B 1 126 ? 10.200  -5.799  -59.138 1.00 48.42  ? 95   ASP B N   1 
ATOM   4893 C CA  . ASP B 1 126 ? 9.494   -4.806  -59.917 1.00 48.46  ? 95   ASP B CA  1 
ATOM   4894 C C   . ASP B 1 126 ? 8.355   -4.286  -59.043 1.00 47.47  ? 95   ASP B C   1 
ATOM   4895 O O   . ASP B 1 126 ? 7.254   -4.800  -59.065 1.00 47.23  ? 95   ASP B O   1 
ATOM   4896 C CB  . ASP B 1 126 ? 9.044   -5.465  -61.221 1.00 49.16  ? 95   ASP B CB  1 
ATOM   4897 C CG  . ASP B 1 126 ? 8.121   -4.613  -62.042 1.00 49.90  ? 95   ASP B CG  1 
ATOM   4898 O OD1 . ASP B 1 126 ? 7.762   -3.471  -61.652 1.00 48.09  ? 95   ASP B OD1 1 
ATOM   4899 O OD2 . ASP B 1 126 ? 7.691   -5.051  -63.126 1.00 51.85  ? 95   ASP B OD2 1 
ATOM   4900 N N   . CYS B 1 127 ? 8.647   -3.255  -58.251 1.00 47.19  ? 96   CYS B N   1 
ATOM   4901 C CA  . CYS B 1 127 ? 7.707   -2.779  -57.207 1.00 46.66  ? 96   CYS B CA  1 
ATOM   4902 C C   . CYS B 1 127 ? 7.561   -1.257  -57.019 1.00 45.61  ? 96   CYS B C   1 
ATOM   4903 O O   . CYS B 1 127 ? 6.871   -0.802  -56.085 1.00 45.16  ? 96   CYS B O   1 
ATOM   4904 C CB  . CYS B 1 127 ? 8.116   -3.393  -55.875 1.00 46.84  ? 96   CYS B CB  1 
ATOM   4905 S SG  . CYS B 1 127 ? 9.763   -2.882  -55.323 1.00 49.19  ? 96   CYS B SG  1 
ATOM   4906 N N   . LEU B 1 128 ? 8.178   -0.485  -57.910 1.00 44.80  ? 97   LEU B N   1 
ATOM   4907 C CA  . LEU B 1 128 ? 8.230   0.951   -57.773 1.00 44.16  ? 97   LEU B CA  1 
ATOM   4908 C C   . LEU B 1 128 ? 6.986   1.608   -58.358 1.00 44.22  ? 97   LEU B C   1 
ATOM   4909 O O   . LEU B 1 128 ? 6.995   2.169   -59.454 1.00 44.08  ? 97   LEU B O   1 
ATOM   4910 C CB  . LEU B 1 128 ? 9.520   1.503   -58.392 1.00 43.88  ? 97   LEU B CB  1 
ATOM   4911 C CG  . LEU B 1 128 ? 10.783  1.040   -57.650 1.00 44.76  ? 97   LEU B CG  1 
ATOM   4912 C CD1 . LEU B 1 128 ? 12.009  1.775   -58.137 1.00 44.85  ? 97   LEU B CD1 1 
ATOM   4913 C CD2 . LEU B 1 128 ? 10.661  1.204   -56.139 1.00 44.33  ? 97   LEU B CD2 1 
ATOM   4914 N N   . TYR B 1 129 ? 5.917   1.547   -57.570 1.00 44.52  ? 98   TYR B N   1 
ATOM   4915 C CA  . TYR B 1 129 ? 4.616   2.092   -57.933 1.00 44.51  ? 98   TYR B CA  1 
ATOM   4916 C C   . TYR B 1 129 ? 4.123   2.904   -56.754 1.00 44.17  ? 98   TYR B C   1 
ATOM   4917 O O   . TYR B 1 129 ? 4.520   2.654   -55.616 1.00 43.60  ? 98   TYR B O   1 
ATOM   4918 C CB  . TYR B 1 129 ? 3.609   0.971   -58.278 1.00 44.95  ? 98   TYR B CB  1 
ATOM   4919 C CG  . TYR B 1 129 ? 4.080   0.107   -59.429 1.00 46.48  ? 98   TYR B CG  1 
ATOM   4920 C CD1 . TYR B 1 129 ? 3.675   0.360   -60.751 1.00 47.47  ? 98   TYR B CD1 1 
ATOM   4921 C CD2 . TYR B 1 129 ? 4.964   -0.950  -59.207 1.00 46.89  ? 98   TYR B CD2 1 
ATOM   4922 C CE1 . TYR B 1 129 ? 4.146   -0.447  -61.823 1.00 47.44  ? 98   TYR B CE1 1 
ATOM   4923 C CE2 . TYR B 1 129 ? 5.442   -1.743  -60.260 1.00 47.53  ? 98   TYR B CE2 1 
ATOM   4924 C CZ  . TYR B 1 129 ? 5.041   -1.487  -61.560 1.00 47.68  ? 98   TYR B CZ  1 
ATOM   4925 O OH  . TYR B 1 129 ? 5.526   -2.281  -62.574 1.00 47.27  ? 98   TYR B OH  1 
ATOM   4926 N N   . LEU B 1 130 ? 3.244   3.867   -57.036 1.00 44.63  ? 99   LEU B N   1 
ATOM   4927 C CA  . LEU B 1 130 ? 2.626   4.696   -56.021 1.00 44.01  ? 99   LEU B CA  1 
ATOM   4928 C C   . LEU B 1 130 ? 1.120   4.780   -56.186 1.00 44.63  ? 99   LEU B C   1 
ATOM   4929 O O   . LEU B 1 130 ? 0.568   4.436   -57.228 1.00 45.44  ? 99   LEU B O   1 
ATOM   4930 C CB  . LEU B 1 130 ? 3.231   6.101   -56.019 1.00 43.45  ? 99   LEU B CB  1 
ATOM   4931 C CG  . LEU B 1 130 ? 3.223   6.961   -57.282 1.00 43.71  ? 99   LEU B CG  1 
ATOM   4932 C CD1 . LEU B 1 130 ? 1.890   7.651   -57.510 1.00 43.59  ? 99   LEU B CD1 1 
ATOM   4933 C CD2 . LEU B 1 130 ? 4.358   8.030   -57.240 1.00 43.02  ? 99   LEU B CD2 1 
ATOM   4934 N N   . ASN B 1 131 ? 0.465   5.258   -55.142 1.00 44.17  ? 100  ASN B N   1 
ATOM   4935 C CA  . ASN B 1 131 ? -0.973  5.249   -55.058 1.00 44.83  ? 100  ASN B CA  1 
ATOM   4936 C C   . ASN B 1 131 ? -1.454  6.662   -54.742 1.00 45.14  ? 100  ASN B C   1 
ATOM   4937 O O   . ASN B 1 131 ? -0.797  7.374   -53.982 1.00 44.91  ? 100  ASN B O   1 
ATOM   4938 C CB  . ASN B 1 131 ? -1.408  4.285   -53.965 1.00 43.97  ? 100  ASN B CB  1 
ATOM   4939 C CG  . ASN B 1 131 ? -0.725  2.978   -54.070 1.00 43.59  ? 100  ASN B CG  1 
ATOM   4940 O OD1 . ASN B 1 131 ? -0.939  2.277   -55.035 1.00 44.45  ? 100  ASN B OD1 1 
ATOM   4941 N ND2 . ASN B 1 131 ? 0.127   2.633   -53.095 1.00 43.22  ? 100  ASN B ND2 1 
ATOM   4942 N N   . VAL B 1 132 ? -2.595  7.050   -55.298 1.00 45.59  ? 101  VAL B N   1 
ATOM   4943 C CA  . VAL B 1 132 ? -3.183  8.355   -55.026 1.00 46.08  ? 101  VAL B CA  1 
ATOM   4944 C C   . VAL B 1 132 ? -4.660  8.160   -54.701 1.00 47.36  ? 101  VAL B C   1 
ATOM   4945 O O   . VAL B 1 132 ? -5.363  7.484   -55.433 1.00 47.99  ? 101  VAL B O   1 
ATOM   4946 C CB  . VAL B 1 132 ? -3.051  9.310   -56.240 1.00 46.34  ? 101  VAL B CB  1 
ATOM   4947 C CG1 . VAL B 1 132 ? -3.727  10.655  -55.981 1.00 46.87  ? 101  VAL B CG1 1 
ATOM   4948 C CG2 . VAL B 1 132 ? -1.598  9.543   -56.608 1.00 46.22  ? 101  VAL B CG2 1 
ATOM   4949 N N   . TRP B 1 133 ? -5.120  8.697   -53.578 1.00 48.06  ? 102  TRP B N   1 
ATOM   4950 C CA  . TRP B 1 133 ? -6.559  8.834   -53.316 1.00 49.32  ? 102  TRP B CA  1 
ATOM   4951 C C   . TRP B 1 133 ? -6.904  10.299  -53.355 1.00 50.79  ? 102  TRP B C   1 
ATOM   4952 O O   . TRP B 1 133 ? -6.145  11.148  -52.897 1.00 50.78  ? 102  TRP B O   1 
ATOM   4953 C CB  . TRP B 1 133 ? -6.939  8.307   -51.945 1.00 48.76  ? 102  TRP B CB  1 
ATOM   4954 C CG  . TRP B 1 133 ? -6.815  6.860   -51.779 1.00 47.51  ? 102  TRP B CG  1 
ATOM   4955 C CD1 . TRP B 1 133 ? -7.801  5.942   -51.922 1.00 49.73  ? 102  TRP B CD1 1 
ATOM   4956 C CD2 . TRP B 1 133 ? -5.639  6.130   -51.421 1.00 46.34  ? 102  TRP B CD2 1 
ATOM   4957 N NE1 . TRP B 1 133 ? -7.322  4.675   -51.684 1.00 49.30  ? 102  TRP B NE1 1 
ATOM   4958 C CE2 . TRP B 1 133 ? -5.994  4.762   -51.360 1.00 46.78  ? 102  TRP B CE2 1 
ATOM   4959 C CE3 . TRP B 1 133 ? -4.332  6.487   -51.122 1.00 44.98  ? 102  TRP B CE3 1 
ATOM   4960 C CZ2 . TRP B 1 133 ? -5.096  3.769   -51.015 1.00 44.53  ? 102  TRP B CZ2 1 
ATOM   4961 C CZ3 . TRP B 1 133 ? -3.426  5.485   -50.774 1.00 46.26  ? 102  TRP B CZ3 1 
ATOM   4962 C CH2 . TRP B 1 133 ? -3.815  4.150   -50.718 1.00 45.96  ? 102  TRP B CH2 1 
ATOM   4963 N N   . THR B 1 134 ? -8.063  10.597  -53.894 1.00 53.03  ? 103  THR B N   1 
ATOM   4964 C CA  . THR B 1 134 ? -8.502  11.965  -54.048 1.00 54.86  ? 103  THR B CA  1 
ATOM   4965 C C   . THR B 1 134 ? -10.011 11.960  -53.789 1.00 55.82  ? 103  THR B C   1 
ATOM   4966 O O   . THR B 1 134 ? -10.616 10.907  -53.883 1.00 55.77  ? 103  THR B O   1 
ATOM   4967 C CB  . THR B 1 134 ? -8.122  12.407  -55.497 1.00 55.93  ? 103  THR B CB  1 
ATOM   4968 O OG1 . THR B 1 134 ? -7.965  13.823  -55.556 1.00 60.47  ? 103  THR B OG1 1 
ATOM   4969 C CG2 . THR B 1 134 ? -9.254  12.154  -56.493 1.00 57.63  ? 103  THR B CG2 1 
ATOM   4970 N N   . PRO B 1 135 ? -10.615 13.082  -53.397 1.00 57.00  ? 104  PRO B N   1 
ATOM   4971 C CA  . PRO B 1 135 ? -12.082 13.190  -53.345 1.00 58.60  ? 104  PRO B CA  1 
ATOM   4972 C C   . PRO B 1 135 ? -12.741 12.961  -54.701 1.00 60.38  ? 104  PRO B C   1 
ATOM   4973 O O   . PRO B 1 135 ? -12.145 13.271  -55.727 1.00 60.86  ? 104  PRO B O   1 
ATOM   4974 C CB  . PRO B 1 135 ? -12.316 14.630  -52.900 1.00 58.58  ? 104  PRO B CB  1 
ATOM   4975 C CG  . PRO B 1 135 ? -11.093 15.008  -52.208 1.00 57.53  ? 104  PRO B CG  1 
ATOM   4976 C CD  . PRO B 1 135 ? -9.973  14.316  -52.915 1.00 57.20  ? 104  PRO B CD  1 
ATOM   4977 N N   . TYR B 1 136 ? -13.951 12.405  -54.681 1.00 62.30  ? 105  TYR B N   1 
ATOM   4978 C CA  . TYR B 1 136 ? -14.797 12.251  -55.858 1.00 64.11  ? 105  TYR B CA  1 
ATOM   4979 C C   . TYR B 1 136 ? -16.031 13.111  -55.596 1.00 66.47  ? 105  TYR B C   1 
ATOM   4980 O O   . TYR B 1 136 ? -16.782 12.819  -54.663 1.00 65.87  ? 105  TYR B O   1 
ATOM   4981 C CB  . TYR B 1 136 ? -15.207 10.778  -56.045 1.00 64.29  ? 105  TYR B CB  1 
ATOM   4982 C CG  . TYR B 1 136 ? -16.041 10.458  -57.281 1.00 64.98  ? 105  TYR B CG  1 
ATOM   4983 C CD1 . TYR B 1 136 ? -15.538 9.633   -58.276 1.00 64.42  ? 105  TYR B CD1 1 
ATOM   4984 C CD2 . TYR B 1 136 ? -17.356 10.954  -57.440 1.00 67.73  ? 105  TYR B CD2 1 
ATOM   4985 C CE1 . TYR B 1 136 ? -16.284 9.308   -59.390 1.00 65.45  ? 105  TYR B CE1 1 
ATOM   4986 C CE2 . TYR B 1 136 ? -18.123 10.640  -58.574 1.00 67.79  ? 105  TYR B CE2 1 
ATOM   4987 C CZ  . TYR B 1 136 ? -17.575 9.815   -59.546 1.00 68.28  ? 105  TYR B CZ  1 
ATOM   4988 O OH  . TYR B 1 136 ? -18.290 9.480   -60.685 1.00 68.71  ? 105  TYR B OH  1 
ATOM   4989 N N   . PRO B 1 137 ? -16.263 14.158  -56.395 1.00 69.21  ? 106  PRO B N   1 
ATOM   4990 C CA  . PRO B 1 137 ? -15.444 14.516  -57.563 1.00 70.13  ? 106  PRO B CA  1 
ATOM   4991 C C   . PRO B 1 137 ? -14.155 15.209  -57.160 1.00 70.42  ? 106  PRO B C   1 
ATOM   4992 O O   . PRO B 1 137 ? -14.079 15.744  -56.061 1.00 69.74  ? 106  PRO B O   1 
ATOM   4993 C CB  . PRO B 1 137 ? -16.339 15.526  -58.311 1.00 71.95  ? 106  PRO B CB  1 
ATOM   4994 C CG  . PRO B 1 137 ? -17.130 16.205  -57.221 1.00 71.74  ? 106  PRO B CG  1 
ATOM   4995 C CD  . PRO B 1 137 ? -17.358 15.130  -56.179 1.00 70.71  ? 106  PRO B CD  1 
ATOM   4996 N N   . ARG B 1 138 ? -13.171 15.207  -58.061 1.00 72.19  ? 107  ARG B N   1 
ATOM   4997 C CA  . ARG B 1 138 ? -11.865 15.823  -57.830 1.00 73.11  ? 107  ARG B CA  1 
ATOM   4998 C C   . ARG B 1 138 ? -12.013 17.280  -57.414 1.00 74.43  ? 107  ARG B C   1 
ATOM   4999 O O   . ARG B 1 138 ? -12.838 17.983  -57.952 1.00 76.20  ? 107  ARG B O   1 
ATOM   5000 C CB  . ARG B 1 138 ? -10.980 15.692  -59.088 1.00 73.50  ? 107  ARG B CB  1 
ATOM   5001 C CG  . ARG B 1 138 ? -10.695 14.190  -59.459 1.00 76.90  ? 107  ARG B CG  1 
ATOM   5002 C CD  . ARG B 1 138 ? -9.365  13.915  -60.190 1.00 79.29  ? 107  ARG B CD  1 
ATOM   5003 N NE  . ARG B 1 138 ? -9.186  14.836  -61.323 1.00 82.88  ? 107  ARG B NE  1 
ATOM   5004 C CZ  . ARG B 1 138 ? -9.367  14.532  -62.617 1.00 84.48  ? 107  ARG B CZ  1 
ATOM   5005 N NH1 . ARG B 1 138 ? -9.750  13.320  -63.010 1.00 84.51  ? 107  ARG B NH1 1 
ATOM   5006 N NH2 . ARG B 1 138 ? -9.155  15.464  -63.537 1.00 86.00  ? 107  ARG B NH2 1 
ATOM   5007 N N   . PRO B 1 139 ? -11.214 17.726  -56.453 1.00 74.92  ? 108  PRO B N   1 
ATOM   5008 C CA  . PRO B 1 139 ? -11.376 19.056  -55.856 1.00 76.13  ? 108  PRO B CA  1 
ATOM   5009 C C   . PRO B 1 139 ? -11.357 20.199  -56.871 1.00 77.82  ? 108  PRO B C   1 
ATOM   5010 O O   . PRO B 1 139 ? -10.518 20.164  -57.779 1.00 77.54  ? 108  PRO B O   1 
ATOM   5011 C CB  . PRO B 1 139 ? -10.137 19.175  -54.962 1.00 74.79  ? 108  PRO B CB  1 
ATOM   5012 C CG  . PRO B 1 139 ? -9.674  17.794  -54.720 1.00 73.35  ? 108  PRO B CG  1 
ATOM   5013 C CD  . PRO B 1 139 ? -10.062 16.996  -55.889 1.00 73.33  ? 108  PRO B CD  1 
ATOM   5014 N N   . ALA B 1 140 ? -12.242 21.188  -56.693 1.00 79.66  ? 109  ALA B N   1 
ATOM   5015 C CA  . ALA B 1 140 ? -12.305 22.384  -57.554 1.00 81.20  ? 109  ALA B CA  1 
ATOM   5016 C C   . ALA B 1 140 ? -11.006 23.194  -57.479 1.00 80.42  ? 109  ALA B C   1 
ATOM   5017 O O   . ALA B 1 140 ? -10.405 23.511  -58.508 1.00 80.76  ? 109  ALA B O   1 
ATOM   5018 C CB  . ALA B 1 140 ? -13.504 23.276  -57.153 1.00 82.56  ? 109  ALA B CB  1 
ATOM   5019 N N   . SER B 1 141 ? -10.587 23.513  -56.252 1.00 79.05  ? 110  SER B N   1 
ATOM   5020 C CA  . SER B 1 141 ? -9.337  24.237  -56.004 1.00 77.75  ? 110  SER B CA  1 
ATOM   5021 C C   . SER B 1 141 ? -8.218  23.311  -55.473 1.00 75.00  ? 110  SER B C   1 
ATOM   5022 O O   . SER B 1 141 ? -8.496  22.282  -54.847 1.00 73.88  ? 110  SER B O   1 
ATOM   5023 C CB  . SER B 1 141 ? -9.596  25.322  -54.992 1.00 78.29  ? 110  SER B CB  1 
ATOM   5024 O OG  . SER B 1 141 ? -10.320 24.746  -53.932 1.00 78.94  ? 110  SER B OG  1 
ATOM   5025 N N   . PRO B 1 142 ? -6.956  23.689  -55.693 1.00 73.04  ? 111  PRO B N   1 
ATOM   5026 C CA  . PRO B 1 142 ? -5.824  22.848  -55.277 1.00 70.58  ? 111  PRO B CA  1 
ATOM   5027 C C   . PRO B 1 142 ? -5.812  22.519  -53.766 1.00 68.27  ? 111  PRO B C   1 
ATOM   5028 O O   . PRO B 1 142 ? -5.940  23.397  -52.919 1.00 68.15  ? 111  PRO B O   1 
ATOM   5029 C CB  . PRO B 1 142 ? -4.599  23.687  -55.674 1.00 71.01  ? 111  PRO B CB  1 
ATOM   5030 C CG  . PRO B 1 142 ? -5.099  24.630  -56.729 1.00 72.39  ? 111  PRO B CG  1 
ATOM   5031 C CD  . PRO B 1 142 ? -6.499  24.940  -56.328 1.00 73.81  ? 111  PRO B CD  1 
ATOM   5032 N N   . THR B 1 143 ? -5.635  21.240  -53.459 1.00 65.66  ? 112  THR B N   1 
ATOM   5033 C CA  . THR B 1 143 ? -5.771  20.712  -52.110 1.00 63.80  ? 112  THR B CA  1 
ATOM   5034 C C   . THR B 1 143 ? -4.425  20.260  -51.517 1.00 60.44  ? 112  THR B C   1 
ATOM   5035 O O   . THR B 1 143 ? -3.612  19.709  -52.218 1.00 59.60  ? 112  THR B O   1 
ATOM   5036 C CB  . THR B 1 143 ? -6.709  19.515  -52.136 1.00 63.88  ? 112  THR B CB  1 
ATOM   5037 O OG1 . THR B 1 143 ? -7.966  19.906  -52.690 1.00 67.86  ? 112  THR B OG1 1 
ATOM   5038 C CG2 . THR B 1 143 ? -7.079  19.083  -50.722 1.00 64.33  ? 112  THR B CG2 1 
ATOM   5039 N N   . PRO B 1 144 ? -4.211  20.472  -50.222 1.00 58.05  ? 113  PRO B N   1 
ATOM   5040 C CA  . PRO B 1 144 ? -3.035  19.930  -49.548 1.00 55.67  ? 113  PRO B CA  1 
ATOM   5041 C C   . PRO B 1 144 ? -2.878  18.440  -49.756 1.00 53.14  ? 113  PRO B C   1 
ATOM   5042 O O   . PRO B 1 144 ? -3.849  17.694  -49.755 1.00 53.12  ? 113  PRO B O   1 
ATOM   5043 C CB  . PRO B 1 144 ? -3.289  20.252  -48.087 1.00 55.84  ? 113  PRO B CB  1 
ATOM   5044 C CG  . PRO B 1 144 ? -4.118  21.484  -48.137 1.00 57.62  ? 113  PRO B CG  1 
ATOM   5045 C CD  . PRO B 1 144 ? -5.029  21.280  -49.300 1.00 58.64  ? 113  PRO B CD  1 
ATOM   5046 N N   . VAL B 1 145 ? -1.632  18.055  -49.981 1.00 50.42  ? 114  VAL B N   1 
ATOM   5047 C CA  . VAL B 1 145 ? -1.226  16.705  -50.335 1.00 48.70  ? 114  VAL B CA  1 
ATOM   5048 C C   . VAL B 1 145 ? -0.510  16.120  -49.156 1.00 46.58  ? 114  VAL B C   1 
ATOM   5049 O O   . VAL B 1 145 ? 0.348   16.749  -48.613 1.00 45.60  ? 114  VAL B O   1 
ATOM   5050 C CB  . VAL B 1 145 ? -0.253  16.760  -51.513 1.00 48.38  ? 114  VAL B CB  1 
ATOM   5051 C CG1 . VAL B 1 145 ? 0.339   15.398  -51.821 1.00 49.01  ? 114  VAL B CG1 1 
ATOM   5052 C CG2 . VAL B 1 145 ? -0.964  17.298  -52.706 1.00 49.02  ? 114  VAL B CG2 1 
ATOM   5053 N N   . LEU B 1 146 ? -0.874  14.915  -48.763 1.00 46.26  ? 115  LEU B N   1 
ATOM   5054 C CA  . LEU B 1 146 ? -0.176  14.159  -47.718 1.00 45.67  ? 115  LEU B CA  1 
ATOM   5055 C C   . LEU B 1 146 ? 0.501   12.931  -48.341 1.00 44.63  ? 115  LEU B C   1 
ATOM   5056 O O   . LEU B 1 146 ? -0.129  12.178  -49.037 1.00 45.03  ? 115  LEU B O   1 
ATOM   5057 C CB  . LEU B 1 146 ? -1.168  13.693  -46.656 1.00 46.02  ? 115  LEU B CB  1 
ATOM   5058 C CG  . LEU B 1 146 ? -1.462  14.664  -45.516 1.00 46.95  ? 115  LEU B CG  1 
ATOM   5059 C CD1 . LEU B 1 146 ? -2.848  15.261  -45.669 1.00 51.88  ? 115  LEU B CD1 1 
ATOM   5060 C CD2 . LEU B 1 146 ? -1.395  13.978  -44.224 1.00 48.70  ? 115  LEU B CD2 1 
ATOM   5061 N N   . ILE B 1 147 ? 1.791   12.765  -48.124 1.00 43.55  ? 116  ILE B N   1 
ATOM   5062 C CA  . ILE B 1 147 ? 2.524   11.648  -48.680 1.00 42.81  ? 116  ILE B CA  1 
ATOM   5063 C C   . ILE B 1 147 ? 2.978   10.729  -47.546 1.00 42.31  ? 116  ILE B C   1 
ATOM   5064 O O   . ILE B 1 147 ? 3.775   11.132  -46.695 1.00 42.01  ? 116  ILE B O   1 
ATOM   5065 C CB  . ILE B 1 147 ? 3.735   12.136  -49.475 1.00 42.79  ? 116  ILE B CB  1 
ATOM   5066 C CG1 . ILE B 1 147 ? 3.317   13.094  -50.611 1.00 44.30  ? 116  ILE B CG1 1 
ATOM   5067 C CG2 . ILE B 1 147 ? 4.493   10.945  -50.098 1.00 43.32  ? 116  ILE B CG2 1 
ATOM   5068 C CD1 . ILE B 1 147 ? 4.513   13.658  -51.439 1.00 44.56  ? 116  ILE B CD1 1 
ATOM   5069 N N   . TRP B 1 148 ? 2.472   9.499   -47.552 1.00 41.41  ? 117  TRP B N   1 
ATOM   5070 C CA  . TRP B 1 148 ? 2.833   8.482   -46.584 1.00 41.19  ? 117  TRP B CA  1 
ATOM   5071 C C   . TRP B 1 148 ? 4.051   7.682   -47.004 1.00 40.94  ? 117  TRP B C   1 
ATOM   5072 O O   . TRP B 1 148 ? 4.174   7.218   -48.153 1.00 40.81  ? 117  TRP B O   1 
ATOM   5073 C CB  . TRP B 1 148 ? 1.670   7.502   -46.407 1.00 41.59  ? 117  TRP B CB  1 
ATOM   5074 C CG  . TRP B 1 148 ? 1.941   6.396   -45.472 1.00 41.90  ? 117  TRP B CG  1 
ATOM   5075 C CD1 . TRP B 1 148 ? 2.125   5.078   -45.782 1.00 45.07  ? 117  TRP B CD1 1 
ATOM   5076 C CD2 . TRP B 1 148 ? 2.039   6.490   -44.055 1.00 42.35  ? 117  TRP B CD2 1 
ATOM   5077 N NE1 . TRP B 1 148 ? 2.341   4.351   -44.637 1.00 45.54  ? 117  TRP B NE1 1 
ATOM   5078 C CE2 . TRP B 1 148 ? 2.278   5.198   -43.561 1.00 42.84  ? 117  TRP B CE2 1 
ATOM   5079 C CE3 . TRP B 1 148 ? 1.951   7.553   -43.138 1.00 42.01  ? 117  TRP B CE3 1 
ATOM   5080 C CZ2 . TRP B 1 148 ? 2.432   4.937   -42.199 1.00 43.36  ? 117  TRP B CZ2 1 
ATOM   5081 C CZ3 . TRP B 1 148 ? 2.098   7.294   -41.809 1.00 41.47  ? 117  TRP B CZ3 1 
ATOM   5082 C CH2 . TRP B 1 148 ? 2.365   5.995   -41.346 1.00 42.16  ? 117  TRP B CH2 1 
ATOM   5083 N N   . ILE B 1 149 ? 4.936   7.499   -46.041 1.00 40.74  ? 118  ILE B N   1 
ATOM   5084 C CA  . ILE B 1 149 ? 6.102   6.641   -46.173 1.00 40.75  ? 118  ILE B CA  1 
ATOM   5085 C C   . ILE B 1 149 ? 5.994   5.550   -45.092 1.00 41.01  ? 118  ILE B C   1 
ATOM   5086 O O   . ILE B 1 149 ? 6.076   5.818   -43.900 1.00 41.27  ? 118  ILE B O   1 
ATOM   5087 C CB  . ILE B 1 149 ? 7.369   7.471   -46.016 1.00 39.72  ? 118  ILE B CB  1 
ATOM   5088 C CG1 . ILE B 1 149 ? 7.327   8.677   -46.945 1.00 40.03  ? 118  ILE B CG1 1 
ATOM   5089 C CG2 . ILE B 1 149 ? 8.584   6.676   -46.371 1.00 40.18  ? 118  ILE B CG2 1 
ATOM   5090 C CD1 . ILE B 1 149 ? 8.598   9.527   -46.861 1.00 39.57  ? 118  ILE B CD1 1 
ATOM   5091 N N   . TYR B 1 150 ? 5.791   4.317   -45.514 1.00 41.89  ? 119  TYR B N   1 
ATOM   5092 C CA  . TYR B 1 150 ? 5.632   3.212   -44.558 1.00 42.33  ? 119  TYR B CA  1 
ATOM   5093 C C   . TYR B 1 150 ? 6.938   2.865   -43.862 1.00 41.82  ? 119  TYR B C   1 
ATOM   5094 O O   . TYR B 1 150 ? 8.015   3.175   -44.348 1.00 41.36  ? 119  TYR B O   1 
ATOM   5095 C CB  . TYR B 1 150 ? 5.024   1.954   -45.213 1.00 42.14  ? 119  TYR B CB  1 
ATOM   5096 C CG  . TYR B 1 150 ? 5.822   1.382   -46.377 1.00 44.43  ? 119  TYR B CG  1 
ATOM   5097 C CD1 . TYR B 1 150 ? 7.044   0.724   -46.167 1.00 44.31  ? 119  TYR B CD1 1 
ATOM   5098 C CD2 . TYR B 1 150 ? 5.348   1.471   -47.686 1.00 44.37  ? 119  TYR B CD2 1 
ATOM   5099 C CE1 . TYR B 1 150 ? 7.777   0.207   -47.217 1.00 44.40  ? 119  TYR B CE1 1 
ATOM   5100 C CE2 . TYR B 1 150 ? 6.080   0.931   -48.757 1.00 44.44  ? 119  TYR B CE2 1 
ATOM   5101 C CZ  . TYR B 1 150 ? 7.300   0.302   -48.518 1.00 45.42  ? 119  TYR B CZ  1 
ATOM   5102 O OH  . TYR B 1 150 ? 8.046   -0.254  -49.564 1.00 42.11  ? 119  TYR B OH  1 
ATOM   5103 N N   . GLY B 1 151 ? 6.779   2.239   -42.699 1.00 42.32  ? 120  GLY B N   1 
ATOM   5104 C CA  . GLY B 1 151 ? 7.854   1.658   -41.924 1.00 42.74  ? 120  GLY B CA  1 
ATOM   5105 C C   . GLY B 1 151 ? 7.965   0.165   -42.143 1.00 43.27  ? 120  GLY B C   1 
ATOM   5106 O O   . GLY B 1 151 ? 7.366   -0.377  -43.076 1.00 43.93  ? 120  GLY B O   1 
ATOM   5107 N N   . GLY B 1 152 ? 8.724   -0.481  -41.256 1.00 43.94  ? 121  GLY B N   1 
ATOM   5108 C CA  . GLY B 1 152 ? 9.134   -1.878  -41.389 1.00 44.29  ? 121  GLY B CA  1 
ATOM   5109 C C   . GLY B 1 152 ? 10.637  -2.083  -41.283 1.00 44.76  ? 121  GLY B C   1 
ATOM   5110 O O   . GLY B 1 152 ? 11.182  -3.023  -41.848 1.00 45.59  ? 121  GLY B O   1 
ATOM   5111 N N   . GLY B 1 153 ? 11.323  -1.188  -40.581 1.00 44.72  ? 122  GLY B N   1 
ATOM   5112 C CA  . GLY B 1 153 ? 12.736  -1.360  -40.298 1.00 45.49  ? 122  GLY B CA  1 
ATOM   5113 C C   . GLY B 1 153 ? 13.673  -1.287  -41.495 1.00 45.68  ? 122  GLY B C   1 
ATOM   5114 O O   . GLY B 1 153 ? 14.798  -1.757  -41.423 1.00 46.28  ? 122  GLY B O   1 
ATOM   5115 N N   . PHE B 1 154 ? 13.208  -0.669  -42.578 1.00 45.28  ? 123  PHE B N   1 
ATOM   5116 C CA  . PHE B 1 154 ? 13.925  -0.607  -43.853 1.00 45.02  ? 123  PHE B CA  1 
ATOM   5117 C C   . PHE B 1 154 ? 14.139  -1.969  -44.513 1.00 45.65  ? 123  PHE B C   1 
ATOM   5118 O O   . PHE B 1 154 ? 14.888  -2.059  -45.470 1.00 45.70  ? 123  PHE B O   1 
ATOM   5119 C CB  . PHE B 1 154 ? 15.270  0.108   -43.693 1.00 45.67  ? 123  PHE B CB  1 
ATOM   5120 C CG  . PHE B 1 154 ? 15.155  1.581   -43.300 1.00 45.81  ? 123  PHE B CG  1 
ATOM   5121 C CD1 . PHE B 1 154 ? 14.691  2.526   -44.211 1.00 45.06  ? 123  PHE B CD1 1 
ATOM   5122 C CD2 . PHE B 1 154 ? 15.533  2.007   -42.040 1.00 45.24  ? 123  PHE B CD2 1 
ATOM   5123 C CE1 . PHE B 1 154 ? 14.587  3.860   -43.870 1.00 43.94  ? 123  PHE B CE1 1 
ATOM   5124 C CE2 . PHE B 1 154 ? 15.432  3.335   -41.686 1.00 44.00  ? 123  PHE B CE2 1 
ATOM   5125 C CZ  . PHE B 1 154 ? 14.967  4.270   -42.608 1.00 44.80  ? 123  PHE B CZ  1 
ATOM   5126 N N   . TYR B 1 155 ? 13.476  -3.016  -44.004 1.00 46.06  ? 124  TYR B N   1 
ATOM   5127 C CA  . TYR B 1 155 ? 13.598  -4.394  -44.513 1.00 46.48  ? 124  TYR B CA  1 
ATOM   5128 C C   . TYR B 1 155 ? 12.228  -4.919  -44.975 1.00 46.30  ? 124  TYR B C   1 
ATOM   5129 O O   . TYR B 1 155 ? 12.136  -5.960  -45.611 1.00 46.34  ? 124  TYR B O   1 
ATOM   5130 C CB  . TYR B 1 155 ? 14.231  -5.337  -43.461 1.00 47.48  ? 124  TYR B CB  1 
ATOM   5131 C CG  . TYR B 1 155 ? 13.260  -5.946  -42.456 1.00 48.62  ? 124  TYR B CG  1 
ATOM   5132 C CD1 . TYR B 1 155 ? 12.500  -7.041  -42.792 1.00 51.33  ? 124  TYR B CD1 1 
ATOM   5133 C CD2 . TYR B 1 155 ? 13.123  -5.438  -41.170 1.00 50.70  ? 124  TYR B CD2 1 
ATOM   5134 C CE1 . TYR B 1 155 ? 11.597  -7.593  -41.915 1.00 53.49  ? 124  TYR B CE1 1 
ATOM   5135 C CE2 . TYR B 1 155 ? 12.205  -5.997  -40.258 1.00 51.79  ? 124  TYR B CE2 1 
ATOM   5136 C CZ  . TYR B 1 155 ? 11.438  -7.069  -40.659 1.00 54.59  ? 124  TYR B CZ  1 
ATOM   5137 O OH  . TYR B 1 155 ? 10.516  -7.690  -39.840 1.00 60.29  ? 124  TYR B OH  1 
ATOM   5138 N N   . SER B 1 156 ? 11.163  -4.174  -44.690 1.00 45.40  ? 125  SER B N   1 
ATOM   5139 C CA  . SER B 1 156 ? 9.818   -4.640  -44.995 1.00 44.88  ? 125  SER B CA  1 
ATOM   5140 C C   . SER B 1 156 ? 8.856   -3.476  -45.116 1.00 44.08  ? 125  SER B C   1 
ATOM   5141 O O   . SER B 1 156 ? 9.240   -2.290  -44.965 1.00 43.14  ? 125  SER B O   1 
ATOM   5142 C CB  . SER B 1 156 ? 9.345   -5.661  -43.943 1.00 45.28  ? 125  SER B CB  1 
ATOM   5143 O OG  . SER B 1 156 ? 9.303   -5.104  -42.641 1.00 44.15  ? 125  SER B OG  1 
ATOM   5144 N N   . GLY B 1 157 ? 7.614   -3.832  -45.444 1.00 43.89  ? 126  GLY B N   1 
ATOM   5145 C CA  . GLY B 1 157 ? 6.519   -2.900  -45.594 1.00 43.34  ? 126  GLY B CA  1 
ATOM   5146 C C   . GLY B 1 157 ? 5.980   -2.829  -46.996 1.00 42.99  ? 126  GLY B C   1 
ATOM   5147 O O   . GLY B 1 157 ? 6.554   -3.363  -47.926 1.00 43.15  ? 126  GLY B O   1 
ATOM   5148 N N   . ALA B 1 158 ? 4.870   -2.125  -47.126 1.00 42.66  ? 127  ALA B N   1 
ATOM   5149 C CA  . ALA B 1 158 ? 4.201   -1.936  -48.398 1.00 43.51  ? 127  ALA B CA  1 
ATOM   5150 C C   . ALA B 1 158 ? 3.133   -0.845  -48.270 1.00 43.35  ? 127  ALA B C   1 
ATOM   5151 O O   . ALA B 1 158 ? 2.558   -0.661  -47.206 1.00 43.74  ? 127  ALA B O   1 
ATOM   5152 C CB  . ALA B 1 158 ? 3.564   -3.234  -48.841 1.00 44.01  ? 127  ALA B CB  1 
ATOM   5153 N N   . ALA B 1 159 ? 2.886   -0.109  -49.340 1.00 43.20  ? 128  ALA B N   1 
ATOM   5154 C CA  . ALA B 1 159 ? 1.911   0.968   -49.308 1.00 43.61  ? 128  ALA B CA  1 
ATOM   5155 C C   . ALA B 1 159 ? 0.464   0.415   -49.399 1.00 44.90  ? 128  ALA B C   1 
ATOM   5156 O O   . ALA B 1 159 ? -0.497  1.144   -49.161 1.00 44.57  ? 128  ALA B O   1 
ATOM   5157 C CB  . ALA B 1 159 ? 2.193   1.950   -50.428 1.00 43.65  ? 128  ALA B CB  1 
ATOM   5158 N N   . SER B 1 160 ? 0.350   -0.890  -49.693 1.00 45.22  ? 129  SER B N   1 
ATOM   5159 C CA  . SER B 1 160 ? -0.913  -1.544  -49.946 1.00 46.22  ? 129  SER B CA  1 
ATOM   5160 C C   . SER B 1 160 ? -1.578  -2.130  -48.688 1.00 47.04  ? 129  SER B C   1 
ATOM   5161 O O   . SER B 1 160 ? -2.671  -2.672  -48.763 1.00 48.11  ? 129  SER B O   1 
ATOM   5162 C CB  . SER B 1 160 ? -0.684  -2.646  -50.991 1.00 46.99  ? 129  SER B CB  1 
ATOM   5163 O OG  . SER B 1 160 ? 0.243   -3.642  -50.530 1.00 46.44  ? 129  SER B OG  1 
ATOM   5164 N N   . LEU B 1 161 ? -0.934  -2.017  -47.534 1.00 47.00  ? 130  LEU B N   1 
ATOM   5165 C CA  . LEU B 1 161 ? -1.496  -2.576  -46.301 1.00 48.07  ? 130  LEU B CA  1 
ATOM   5166 C C   . LEU B 1 161 ? -2.783  -1.863  -45.926 1.00 48.54  ? 130  LEU B C   1 
ATOM   5167 O O   . LEU B 1 161 ? -2.959  -0.674  -46.230 1.00 47.89  ? 130  LEU B O   1 
ATOM   5168 C CB  . LEU B 1 161 ? -0.503  -2.475  -45.136 1.00 47.88  ? 130  LEU B CB  1 
ATOM   5169 C CG  . LEU B 1 161 ? 0.904   -3.089  -45.332 1.00 48.86  ? 130  LEU B CG  1 
ATOM   5170 C CD1 . LEU B 1 161 ? 1.753   -2.952  -44.054 1.00 47.88  ? 130  LEU B CD1 1 
ATOM   5171 C CD2 . LEU B 1 161 ? 0.818   -4.565  -45.748 1.00 50.63  ? 130  LEU B CD2 1 
ATOM   5172 N N   . ASP B 1 162 ? -3.703  -2.589  -45.299 1.00 49.91  ? 131  ASP B N   1 
ATOM   5173 C CA  . ASP B 1 162 ? -5.038  -2.016  -44.997 1.00 51.34  ? 131  ASP B CA  1 
ATOM   5174 C C   . ASP B 1 162 ? -4.946  -0.819  -44.063 1.00 50.29  ? 131  ASP B C   1 
ATOM   5175 O O   . ASP B 1 162 ? -5.771  0.088   -44.141 1.00 50.70  ? 131  ASP B O   1 
ATOM   5176 C CB  . ASP B 1 162 ? -5.966  -3.009  -44.315 1.00 52.78  ? 131  ASP B CB  1 
ATOM   5177 C CG  . ASP B 1 162 ? -6.305  -4.206  -45.165 1.00 57.23  ? 131  ASP B CG  1 
ATOM   5178 O OD1 . ASP B 1 162 ? -6.245  -4.163  -46.430 1.00 61.13  ? 131  ASP B OD1 1 
ATOM   5179 O OD2 . ASP B 1 162 ? -6.665  -5.259  -44.603 1.00 62.19  ? 131  ASP B OD2 1 
ATOM   5180 N N   . VAL B 1 163 ? -3.967  -0.825  -43.160 1.00 49.34  ? 132  VAL B N   1 
ATOM   5181 C CA  . VAL B 1 163 ? -3.812  0.297   -42.230 1.00 48.83  ? 132  VAL B CA  1 
ATOM   5182 C C   . VAL B 1 163 ? -3.354  1.606   -42.870 1.00 47.40  ? 132  VAL B C   1 
ATOM   5183 O O   . VAL B 1 163 ? -3.478  2.660   -42.234 1.00 47.74  ? 132  VAL B O   1 
ATOM   5184 C CB  . VAL B 1 163 ? -2.887  -0.042  -41.050 1.00 48.66  ? 132  VAL B CB  1 
ATOM   5185 C CG1 . VAL B 1 163 ? -3.612  -0.995  -40.090 1.00 50.23  ? 132  VAL B CG1 1 
ATOM   5186 C CG2 . VAL B 1 163 ? -1.571  -0.633  -41.532 1.00 48.23  ? 132  VAL B CG2 1 
ATOM   5187 N N   . TYR B 1 164 ? -2.847  1.540   -44.105 1.00 46.39  ? 133  TYR B N   1 
ATOM   5188 C CA  . TYR B 1 164 ? -2.453  2.727   -44.882 1.00 45.23  ? 133  TYR B CA  1 
ATOM   5189 C C   . TYR B 1 164 ? -3.499  3.166   -45.918 1.00 45.70  ? 133  TYR B C   1 
ATOM   5190 O O   . TYR B 1 164 ? -3.205  3.951   -46.823 1.00 45.44  ? 133  TYR B O   1 
ATOM   5191 C CB  . TYR B 1 164 ? -1.088  2.512   -45.570 1.00 44.28  ? 133  TYR B CB  1 
ATOM   5192 C CG  . TYR B 1 164 ? -0.001  1.941   -44.677 1.00 41.41  ? 133  TYR B CG  1 
ATOM   5193 C CD1 . TYR B 1 164 ? 0.084   2.275   -43.357 1.00 41.96  ? 133  TYR B CD1 1 
ATOM   5194 C CD2 . TYR B 1 164 ? 0.910   1.050   -45.167 1.00 40.59  ? 133  TYR B CD2 1 
ATOM   5195 C CE1 . TYR B 1 164 ? 1.077   1.737   -42.536 1.00 41.48  ? 133  TYR B CE1 1 
ATOM   5196 C CE2 . TYR B 1 164 ? 1.881   0.481   -44.360 1.00 41.54  ? 133  TYR B CE2 1 
ATOM   5197 C CZ  . TYR B 1 164 ? 1.964   0.849   -43.036 1.00 42.15  ? 133  TYR B CZ  1 
ATOM   5198 O OH  . TYR B 1 164 ? 2.926   0.307   -42.209 1.00 43.03  ? 133  TYR B OH  1 
ATOM   5199 N N   . ASP B 1 165 ? -4.723  2.680   -45.771 1.00 46.63  ? 134  ASP B N   1 
ATOM   5200 C CA  . ASP B 1 165 ? -5.813  2.968   -46.709 1.00 47.31  ? 134  ASP B CA  1 
ATOM   5201 C C   . ASP B 1 165 ? -6.128  4.447   -46.662 1.00 47.35  ? 134  ASP B C   1 
ATOM   5202 O O   . ASP B 1 165 ? -6.584  4.957   -45.633 1.00 47.23  ? 134  ASP B O   1 
ATOM   5203 C CB  . ASP B 1 165 ? -7.026  2.136   -46.294 1.00 48.53  ? 134  ASP B CB  1 
ATOM   5204 C CG  . ASP B 1 165 ? -8.114  2.095   -47.324 1.00 50.98  ? 134  ASP B CG  1 
ATOM   5205 O OD1 . ASP B 1 165 ? -8.238  3.009   -48.151 1.00 52.71  ? 134  ASP B OD1 1 
ATOM   5206 O OD2 . ASP B 1 165 ? -8.932  1.159   -47.353 1.00 55.75  ? 134  ASP B OD2 1 
ATOM   5207 N N   . GLY B 1 166 ? -5.875  5.136   -47.775 1.00 47.74  ? 135  GLY B N   1 
ATOM   5208 C CA  . GLY B 1 166 ? -6.093  6.574   -47.890 1.00 48.03  ? 135  GLY B CA  1 
ATOM   5209 C C   . GLY B 1 166 ? -7.530  7.050   -48.124 1.00 49.19  ? 135  GLY B C   1 
ATOM   5210 O O   . GLY B 1 166 ? -7.749  8.269   -48.201 1.00 48.98  ? 135  GLY B O   1 
ATOM   5211 N N   . ARG B 1 167 ? -8.505  6.145   -48.234 1.00 49.95  ? 136  ARG B N   1 
ATOM   5212 C CA  . ARG B 1 167 ? -9.860  6.595   -48.631 1.00 51.91  ? 136  ARG B CA  1 
ATOM   5213 C C   . ARG B 1 167 ? -10.591 7.479   -47.574 1.00 51.94  ? 136  ARG B C   1 
ATOM   5214 O O   . ARG B 1 167 ? -11.347 8.401   -47.917 1.00 52.03  ? 136  ARG B O   1 
ATOM   5215 C CB  . ARG B 1 167 ? -10.723 5.425   -49.123 1.00 53.51  ? 136  ARG B CB  1 
ATOM   5216 C CG  . ARG B 1 167 ? -11.516 4.632   -48.085 1.00 56.85  ? 136  ARG B CG  1 
ATOM   5217 C CD  . ARG B 1 167 ? -11.249 3.133   -48.127 1.00 60.31  ? 136  ARG B CD  1 
ATOM   5218 N NE  . ARG B 1 167 ? -12.301 2.378   -48.789 1.00 64.90  ? 136  ARG B NE  1 
ATOM   5219 C CZ  . ARG B 1 167 ? -12.093 1.335   -49.628 1.00 66.60  ? 136  ARG B CZ  1 
ATOM   5220 N NH1 . ARG B 1 167 ? -10.868 0.884   -49.916 1.00 64.93  ? 136  ARG B NH1 1 
ATOM   5221 N NH2 . ARG B 1 167 ? -13.133 0.730   -50.190 1.00 68.20  ? 136  ARG B NH2 1 
ATOM   5222 N N   . PHE B 1 168 ? -10.314 7.233   -46.299 1.00 50.98  ? 137  PHE B N   1 
ATOM   5223 C CA  . PHE B 1 168 ? -10.985 7.944   -45.229 1.00 51.25  ? 137  PHE B CA  1 
ATOM   5224 C C   . PHE B 1 168 ? -10.527 9.387   -45.168 1.00 50.83  ? 137  PHE B C   1 
ATOM   5225 O O   . PHE B 1 168 ? -11.353 10.300  -45.093 1.00 51.03  ? 137  PHE B O   1 
ATOM   5226 C CB  . PHE B 1 168 ? -10.705 7.247   -43.904 1.00 50.92  ? 137  PHE B CB  1 
ATOM   5227 C CG  . PHE B 1 168 ? -11.055 5.807   -43.920 1.00 52.13  ? 137  PHE B CG  1 
ATOM   5228 C CD1 . PHE B 1 168 ? -12.382 5.413   -43.865 1.00 55.01  ? 137  PHE B CD1 1 
ATOM   5229 C CD2 . PHE B 1 168 ? -10.078 4.837   -44.022 1.00 52.95  ? 137  PHE B CD2 1 
ATOM   5230 C CE1 . PHE B 1 168 ? -12.723 4.076   -43.908 1.00 55.39  ? 137  PHE B CE1 1 
ATOM   5231 C CE2 . PHE B 1 168 ? -10.425 3.486   -44.064 1.00 54.38  ? 137  PHE B CE2 1 
ATOM   5232 C CZ  . PHE B 1 168 ? -11.749 3.117   -44.012 1.00 54.74  ? 137  PHE B CZ  1 
ATOM   5233 N N   . LEU B 1 169 ? -9.209  9.597   -45.208 1.00 49.87  ? 138  LEU B N   1 
ATOM   5234 C CA  . LEU B 1 169 ? -8.656  10.952  -45.201 1.00 50.11  ? 138  LEU B CA  1 
ATOM   5235 C C   . LEU B 1 169 ? -9.115  11.698  -46.451 1.00 51.51  ? 138  LEU B C   1 
ATOM   5236 O O   . LEU B 1 169 ? -9.486  12.879  -46.384 1.00 52.83  ? 138  LEU B O   1 
ATOM   5237 C CB  . LEU B 1 169 ? -7.133  10.952  -45.116 1.00 48.59  ? 138  LEU B CB  1 
ATOM   5238 C CG  . LEU B 1 169 ? -6.574  10.648  -43.739 1.00 47.79  ? 138  LEU B CG  1 
ATOM   5239 C CD1 . LEU B 1 169 ? -5.096  10.248  -43.855 1.00 48.30  ? 138  LEU B CD1 1 
ATOM   5240 C CD2 . LEU B 1 169 ? -6.708  11.842  -42.811 1.00 47.65  ? 138  LEU B CD2 1 
ATOM   5241 N N   . ALA B 1 170 ? -9.122  11.022  -47.590 1.00 51.82  ? 139  ALA B N   1 
ATOM   5242 C CA  . ALA B 1 170 ? -9.580  11.661  -48.813 1.00 53.07  ? 139  ALA B CA  1 
ATOM   5243 C C   . ALA B 1 170 ? -11.050 12.084  -48.719 1.00 55.18  ? 139  ALA B C   1 
ATOM   5244 O O   . ALA B 1 170 ? -11.405 13.228  -49.039 1.00 56.38  ? 139  ALA B O   1 
ATOM   5245 C CB  . ALA B 1 170 ? -9.372  10.733  -49.992 1.00 53.28  ? 139  ALA B CB  1 
ATOM   5246 N N   . GLN B 1 171 ? -11.908 11.174  -48.268 1.00 56.01  ? 140  GLN B N   1 
ATOM   5247 C CA  . GLN B 1 171 ? -13.331 11.443  -48.268 1.00 57.33  ? 140  GLN B CA  1 
ATOM   5248 C C   . GLN B 1 171 ? -13.714 12.463  -47.214 1.00 58.14  ? 140  GLN B C   1 
ATOM   5249 O O   . GLN B 1 171 ? -14.437 13.415  -47.499 1.00 59.76  ? 140  GLN B O   1 
ATOM   5250 C CB  . GLN B 1 171 ? -14.116 10.156  -48.036 1.00 58.01  ? 140  GLN B CB  1 
ATOM   5251 C CG  . GLN B 1 171 ? -15.532 10.229  -48.566 1.00 58.35  ? 140  GLN B CG  1 
ATOM   5252 C CD  . GLN B 1 171 ? -16.491 10.940  -47.623 1.00 56.82  ? 140  GLN B CD  1 
ATOM   5253 O OE1 . GLN B 1 171 ? -16.395 10.808  -46.403 1.00 55.60  ? 140  GLN B OE1 1 
ATOM   5254 N NE2 . GLN B 1 171 ? -17.437 11.646  -48.190 1.00 56.16  ? 140  GLN B NE2 1 
ATOM   5255 N N   . VAL B 1 172 ? -13.258 12.255  -45.987 1.00 57.34  ? 141  VAL B N   1 
ATOM   5256 C CA  . VAL B 1 172 ? -13.749 13.052  -44.867 1.00 57.61  ? 141  VAL B CA  1 
ATOM   5257 C C   . VAL B 1 172 ? -13.089 14.421  -44.798 1.00 57.31  ? 141  VAL B C   1 
ATOM   5258 O O   . VAL B 1 172 ? -13.790 15.406  -44.518 1.00 58.44  ? 141  VAL B O   1 
ATOM   5259 C CB  . VAL B 1 172 ? -13.556 12.327  -43.530 1.00 57.51  ? 141  VAL B CB  1 
ATOM   5260 C CG1 . VAL B 1 172 ? -13.924 13.245  -42.346 1.00 57.14  ? 141  VAL B CG1 1 
ATOM   5261 C CG2 . VAL B 1 172 ? -14.387 11.036  -43.517 1.00 57.77  ? 141  VAL B CG2 1 
ATOM   5262 N N   . GLU B 1 173 ? -11.776 14.484  -45.055 1.00 55.49  ? 142  GLU B N   1 
ATOM   5263 C CA  . GLU B 1 173 ? -11.018 15.732  -44.973 1.00 55.31  ? 142  GLU B CA  1 
ATOM   5264 C C   . GLU B 1 173 ? -10.727 16.404  -46.314 1.00 55.12  ? 142  GLU B C   1 
ATOM   5265 O O   . GLU B 1 173 ? -10.185 17.512  -46.361 1.00 54.79  ? 142  GLU B O   1 
ATOM   5266 C CB  . GLU B 1 173 ? -9.696  15.495  -44.252 1.00 54.63  ? 142  GLU B CB  1 
ATOM   5267 C CG  . GLU B 1 173 ? -9.854  15.082  -42.807 1.00 56.53  ? 142  GLU B CG  1 
ATOM   5268 C CD  . GLU B 1 173 ? -10.629 16.102  -42.006 1.00 60.72  ? 142  GLU B CD  1 
ATOM   5269 O OE1 . GLU B 1 173 ? -10.490 17.319  -42.292 1.00 62.93  ? 142  GLU B OE1 1 
ATOM   5270 O OE2 . GLU B 1 173 ? -11.379 15.677  -41.092 1.00 65.04  ? 142  GLU B OE2 1 
ATOM   5271 N N   . GLY B 1 174 ? -11.083 15.740  -47.404 1.00 55.65  ? 143  GLY B N   1 
ATOM   5272 C CA  . GLY B 1 174 ? -10.835 16.270  -48.732 1.00 55.78  ? 143  GLY B CA  1 
ATOM   5273 C C   . GLY B 1 174 ? -9.364  16.296  -49.114 1.00 54.93  ? 143  GLY B C   1 
ATOM   5274 O O   . GLY B 1 174 ? -8.960  17.054  -49.983 1.00 55.76  ? 143  GLY B O   1 
ATOM   5275 N N   . ALA B 1 175 ? -8.551  15.468  -48.472 1.00 53.55  ? 144  ALA B N   1 
ATOM   5276 C CA  . ALA B 1 175 ? -7.131  15.457  -48.750 1.00 51.87  ? 144  ALA B CA  1 
ATOM   5277 C C   . ALA B 1 175 ? -6.794  14.619  -49.992 1.00 51.11  ? 144  ALA B C   1 
ATOM   5278 O O   . ALA B 1 175 ? -7.498  13.676  -50.329 1.00 50.76  ? 144  ALA B O   1 
ATOM   5279 C CB  . ALA B 1 175 ? -6.426  14.934  -47.573 1.00 51.78  ? 144  ALA B CB  1 
ATOM   5280 N N   . VAL B 1 176 ? -5.724  14.997  -50.680 1.00 50.15  ? 145  VAL B N   1 
ATOM   5281 C CA  . VAL B 1 176 ? -5.116  14.146  -51.686 1.00 49.82  ? 145  VAL B CA  1 
ATOM   5282 C C   . VAL B 1 176 ? -4.032  13.395  -50.930 1.00 48.77  ? 145  VAL B C   1 
ATOM   5283 O O   . VAL B 1 176 ? -3.162  13.983  -50.323 1.00 48.39  ? 145  VAL B O   1 
ATOM   5284 C CB  . VAL B 1 176 ? -4.545  14.940  -52.877 1.00 49.66  ? 145  VAL B CB  1 
ATOM   5285 C CG1 . VAL B 1 176 ? -3.678  14.062  -53.744 1.00 50.14  ? 145  VAL B CG1 1 
ATOM   5286 C CG2 . VAL B 1 176 ? -5.641  15.484  -53.708 1.00 51.14  ? 145  VAL B CG2 1 
ATOM   5287 N N   . LEU B 1 177 ? -4.127  12.086  -50.927 1.00 48.60  ? 146  LEU B N   1 
ATOM   5288 C CA  . LEU B 1 177 ? -3.199  11.259  -50.199 1.00 47.81  ? 146  LEU B CA  1 
ATOM   5289 C C   . LEU B 1 177 ? -2.414  10.359  -51.176 1.00 46.60  ? 146  LEU B C   1 
ATOM   5290 O O   . LEU B 1 177 ? -2.982  9.746   -52.084 1.00 46.76  ? 146  LEU B O   1 
ATOM   5291 C CB  . LEU B 1 177 ? -3.972  10.457  -49.159 1.00 48.24  ? 146  LEU B CB  1 
ATOM   5292 C CG  . LEU B 1 177 ? -3.004  9.882   -48.124 1.00 51.28  ? 146  LEU B CG  1 
ATOM   5293 C CD1 . LEU B 1 177 ? -3.530  10.040  -46.750 1.00 52.59  ? 146  LEU B CD1 1 
ATOM   5294 C CD2 . LEU B 1 177 ? -2.675  8.383   -48.440 1.00 54.12  ? 146  LEU B CD2 1 
ATOM   5295 N N   . VAL B 1 178 ? -1.097  10.342  -51.009 1.00 45.17  ? 147  VAL B N   1 
ATOM   5296 C CA  . VAL B 1 178 ? -0.193  9.635   -51.898 1.00 44.57  ? 147  VAL B CA  1 
ATOM   5297 C C   . VAL B 1 178 ? 0.627   8.707   -51.027 1.00 43.82  ? 147  VAL B C   1 
ATOM   5298 O O   . VAL B 1 178 ? 1.019   9.098   -49.938 1.00 43.07  ? 147  VAL B O   1 
ATOM   5299 C CB  . VAL B 1 178 ? 0.736   10.602  -52.616 1.00 44.28  ? 147  VAL B CB  1 
ATOM   5300 C CG1 . VAL B 1 178 ? 1.700   9.857   -53.528 1.00 45.53  ? 147  VAL B CG1 1 
ATOM   5301 C CG2 . VAL B 1 178 ? -0.065  11.594  -53.408 1.00 45.63  ? 147  VAL B CG2 1 
ATOM   5302 N N   . SER B 1 179 ? 0.831   7.472   -51.480 1.00 43.41  ? 148  SER B N   1 
ATOM   5303 C CA  . SER B 1 179 ? 1.773   6.565   -50.852 1.00 43.00  ? 148  SER B CA  1 
ATOM   5304 C C   . SER B 1 179 ? 2.583   5.844   -51.917 1.00 42.92  ? 148  SER B C   1 
ATOM   5305 O O   . SER B 1 179 ? 2.075   5.586   -53.001 1.00 43.79  ? 148  SER B O   1 
ATOM   5306 C CB  . SER B 1 179 ? 1.046   5.554   -49.966 1.00 42.89  ? 148  SER B CB  1 
ATOM   5307 O OG  . SER B 1 179 ? 0.171   4.738   -50.712 1.00 43.51  ? 148  SER B OG  1 
ATOM   5308 N N   . MET B 1 180 ? 3.832   5.515   -51.604 1.00 42.19  ? 149  MET B N   1 
ATOM   5309 C CA  . MET B 1 180 ? 4.714   4.878   -52.580 1.00 42.52  ? 149  MET B CA  1 
ATOM   5310 C C   . MET B 1 180 ? 5.357   3.638   -52.014 1.00 42.53  ? 149  MET B C   1 
ATOM   5311 O O   . MET B 1 180 ? 5.528   3.512   -50.797 1.00 41.99  ? 149  MET B O   1 
ATOM   5312 C CB  . MET B 1 180 ? 5.794   5.876   -53.036 1.00 42.62  ? 149  MET B CB  1 
ATOM   5313 C CG  . MET B 1 180 ? 7.055   5.906   -52.216 1.00 43.11  ? 149  MET B CG  1 
ATOM   5314 S SD  . MET B 1 180 ? 6.826   6.615   -50.597 1.00 43.61  ? 149  MET B SD  1 
ATOM   5315 C CE  . MET B 1 180 ? 6.832   8.303   -51.006 1.00 43.39  ? 149  MET B CE  1 
ATOM   5316 N N   . ASN B 1 181 ? 5.705   2.708   -52.896 1.00 43.07  ? 150  ASN B N   1 
ATOM   5317 C CA  . ASN B 1 181 ? 6.571   1.591   -52.518 1.00 42.69  ? 150  ASN B CA  1 
ATOM   5318 C C   . ASN B 1 181 ? 7.997   2.074   -52.716 1.00 42.45  ? 150  ASN B C   1 
ATOM   5319 O O   . ASN B 1 181 ? 8.271   2.836   -53.634 1.00 42.15  ? 150  ASN B O   1 
ATOM   5320 C CB  . ASN B 1 181 ? 6.292   0.364   -53.380 1.00 43.40  ? 150  ASN B CB  1 
ATOM   5321 C CG  . ASN B 1 181 ? 5.060   -0.428  -52.921 1.00 44.88  ? 150  ASN B CG  1 
ATOM   5322 O OD1 . ASN B 1 181 ? 4.449   -0.108  -51.911 1.00 44.08  ? 150  ASN B OD1 1 
ATOM   5323 N ND2 . ASN B 1 181 ? 4.711   -1.483  -53.668 1.00 45.37  ? 150  ASN B ND2 1 
ATOM   5324 N N   . TYR B 1 182 ? 8.892   1.695   -51.814 1.00 42.24  ? 151  TYR B N   1 
ATOM   5325 C CA  . TYR B 1 182 ? 10.308  1.904   -52.005 1.00 42.01  ? 151  TYR B CA  1 
ATOM   5326 C C   . TYR B 1 182 ? 11.030  0.596   -51.682 1.00 42.41  ? 151  TYR B C   1 
ATOM   5327 O O   . TYR B 1 182 ? 10.545  -0.227  -50.905 1.00 42.19  ? 151  TYR B O   1 
ATOM   5328 C CB  . TYR B 1 182 ? 10.802  3.063   -51.125 1.00 42.45  ? 151  TYR B CB  1 
ATOM   5329 C CG  . TYR B 1 182 ? 10.636  2.866   -49.631 1.00 42.50  ? 151  TYR B CG  1 
ATOM   5330 C CD1 . TYR B 1 182 ? 9.470   3.221   -48.997 1.00 44.37  ? 151  TYR B CD1 1 
ATOM   5331 C CD2 . TYR B 1 182 ? 11.651  2.299   -48.868 1.00 42.73  ? 151  TYR B CD2 1 
ATOM   5332 C CE1 . TYR B 1 182 ? 9.322   3.030   -47.626 1.00 46.09  ? 151  TYR B CE1 1 
ATOM   5333 C CE2 . TYR B 1 182 ? 11.504  2.083   -47.516 1.00 43.86  ? 151  TYR B CE2 1 
ATOM   5334 C CZ  . TYR B 1 182 ? 10.344  2.455   -46.897 1.00 45.10  ? 151  TYR B CZ  1 
ATOM   5335 O OH  . TYR B 1 182 ? 10.200  2.249   -45.552 1.00 44.85  ? 151  TYR B OH  1 
ATOM   5336 N N   . ARG B 1 183 ? 12.193  0.410   -52.276 1.00 42.43  ? 152  ARG B N   1 
ATOM   5337 C CA  . ARG B 1 183 ? 12.952  -0.799  -52.051 1.00 43.51  ? 152  ARG B CA  1 
ATOM   5338 C C   . ARG B 1 183 ? 13.447  -0.895  -50.624 1.00 42.88  ? 152  ARG B C   1 
ATOM   5339 O O   . ARG B 1 183 ? 13.897  0.068   -50.057 1.00 42.72  ? 152  ARG B O   1 
ATOM   5340 C CB  . ARG B 1 183 ? 14.134  -0.884  -53.014 1.00 44.29  ? 152  ARG B CB  1 
ATOM   5341 C CG  . ARG B 1 183 ? 13.721  -1.245  -54.419 1.00 45.34  ? 152  ARG B CG  1 
ATOM   5342 C CD  . ARG B 1 183 ? 14.844  -1.130  -55.400 1.00 46.16  ? 152  ARG B CD  1 
ATOM   5343 N NE  . ARG B 1 183 ? 15.084  0.261   -55.771 1.00 44.85  ? 152  ARG B NE  1 
ATOM   5344 C CZ  . ARG B 1 183 ? 16.124  0.662   -56.468 1.00 46.24  ? 152  ARG B CZ  1 
ATOM   5345 N NH1 . ARG B 1 183 ? 17.037  -0.213  -56.890 1.00 47.61  ? 152  ARG B NH1 1 
ATOM   5346 N NH2 . ARG B 1 183 ? 16.258  1.950   -56.748 1.00 46.06  ? 152  ARG B NH2 1 
ATOM   5347 N N   . VAL B 1 184 ? 13.350  -2.093  -50.084 1.00 43.47  ? 153  VAL B N   1 
ATOM   5348 C CA  . VAL B 1 184 ? 13.796  -2.413  -48.760 1.00 44.17  ? 153  VAL B CA  1 
ATOM   5349 C C   . VAL B 1 184 ? 14.840  -3.540  -48.791 1.00 45.35  ? 153  VAL B C   1 
ATOM   5350 O O   . VAL B 1 184 ? 15.101  -4.145  -49.829 1.00 45.78  ? 153  VAL B O   1 
ATOM   5351 C CB  . VAL B 1 184 ? 12.601  -2.832  -47.873 1.00 44.05  ? 153  VAL B CB  1 
ATOM   5352 C CG1 . VAL B 1 184 ? 11.633  -1.670  -47.726 1.00 43.11  ? 153  VAL B CG1 1 
ATOM   5353 C CG2 . VAL B 1 184 ? 11.871  -4.079  -48.410 1.00 44.24  ? 153  VAL B CG2 1 
ATOM   5354 N N   . GLY B 1 185 ? 15.440  -3.781  -47.629 1.00 45.74  ? 154  GLY B N   1 
ATOM   5355 C CA  . GLY B 1 185 ? 16.460  -4.797  -47.450 1.00 46.58  ? 154  GLY B CA  1 
ATOM   5356 C C   . GLY B 1 185 ? 17.679  -4.531  -48.294 1.00 46.74  ? 154  GLY B C   1 
ATOM   5357 O O   . GLY B 1 185 ? 18.055  -3.387  -48.546 1.00 46.48  ? 154  GLY B O   1 
ATOM   5358 N N   . THR B 1 186 ? 18.313  -5.600  -48.731 1.00 47.71  ? 155  THR B N   1 
ATOM   5359 C CA  . THR B 1 186 ? 19.463  -5.485  -49.649 1.00 48.34  ? 155  THR B CA  1 
ATOM   5360 C C   . THR B 1 186 ? 19.116  -4.664  -50.899 1.00 47.49  ? 155  THR B C   1 
ATOM   5361 O O   . THR B 1 186 ? 19.884  -3.794  -51.331 1.00 48.41  ? 155  THR B O   1 
ATOM   5362 C CB  . THR B 1 186 ? 19.921  -6.862  -50.084 1.00 48.84  ? 155  THR B CB  1 
ATOM   5363 O OG1 . THR B 1 186 ? 18.780  -7.603  -50.524 1.00 48.32  ? 155  THR B OG1 1 
ATOM   5364 C CG2 . THR B 1 186 ? 20.445  -7.646  -48.881 1.00 50.22  ? 155  THR B CG2 1 
ATOM   5365 N N   . PHE B 1 187 ? 17.938  -4.906  -51.441 1.00 46.37  ? 156  PHE B N   1 
ATOM   5366 C CA  . PHE B 1 187 ? 17.562  -4.272  -52.689 1.00 46.56  ? 156  PHE B CA  1 
ATOM   5367 C C   . PHE B 1 187 ? 17.538  -2.747  -52.535 1.00 46.04  ? 156  PHE B C   1 
ATOM   5368 O O   . PHE B 1 187 ? 17.830  -2.013  -53.475 1.00 46.00  ? 156  PHE B O   1 
ATOM   5369 C CB  . PHE B 1 187 ? 16.198  -4.812  -53.183 1.00 46.35  ? 156  PHE B CB  1 
ATOM   5370 C CG  . PHE B 1 187 ? 16.118  -6.304  -53.158 1.00 47.13  ? 156  PHE B CG  1 
ATOM   5371 C CD1 . PHE B 1 187 ? 16.686  -7.056  -54.181 1.00 49.65  ? 156  PHE B CD1 1 
ATOM   5372 C CD2 . PHE B 1 187 ? 15.539  -6.962  -52.082 1.00 46.82  ? 156  PHE B CD2 1 
ATOM   5373 C CE1 . PHE B 1 187 ? 16.639  -8.457  -54.151 1.00 51.10  ? 156  PHE B CE1 1 
ATOM   5374 C CE2 . PHE B 1 187 ? 15.509  -8.352  -52.027 1.00 48.03  ? 156  PHE B CE2 1 
ATOM   5375 C CZ  . PHE B 1 187 ? 16.057  -9.106  -53.071 1.00 50.52  ? 156  PHE B CZ  1 
ATOM   5376 N N   . GLY B 1 188 ? 17.193  -2.278  -51.347 1.00 45.65  ? 157  GLY B N   1 
ATOM   5377 C CA  . GLY B 1 188 ? 17.082  -0.854  -51.102 1.00 45.39  ? 157  GLY B CA  1 
ATOM   5378 C C   . GLY B 1 188 ? 18.288  -0.220  -50.454 1.00 45.48  ? 157  GLY B C   1 
ATOM   5379 O O   . GLY B 1 188 ? 18.535  0.964   -50.649 1.00 45.16  ? 157  GLY B O   1 
ATOM   5380 N N   . PHE B 1 189 ? 19.054  -0.994  -49.698 1.00 46.01  ? 158  PHE B N   1 
ATOM   5381 C CA  . PHE B 1 189 ? 20.056  -0.390  -48.833 1.00 46.48  ? 158  PHE B CA  1 
ATOM   5382 C C   . PHE B 1 189 ? 21.373  -1.090  -48.758 1.00 47.68  ? 158  PHE B C   1 
ATOM   5383 O O   . PHE B 1 189 ? 22.257  -0.597  -48.083 1.00 48.07  ? 158  PHE B O   1 
ATOM   5384 C CB  . PHE B 1 189 ? 19.480  -0.149  -47.429 1.00 46.41  ? 158  PHE B CB  1 
ATOM   5385 C CG  . PHE B 1 189 ? 18.282  0.763   -47.445 1.00 44.33  ? 158  PHE B CG  1 
ATOM   5386 C CD1 . PHE B 1 189 ? 18.441  2.112   -47.527 1.00 43.81  ? 158  PHE B CD1 1 
ATOM   5387 C CD2 . PHE B 1 189 ? 17.016  0.256   -47.474 1.00 43.55  ? 158  PHE B CD2 1 
ATOM   5388 C CE1 . PHE B 1 189 ? 17.348  2.944   -47.584 1.00 42.70  ? 158  PHE B CE1 1 
ATOM   5389 C CE2 . PHE B 1 189 ? 15.923  1.093   -47.547 1.00 43.85  ? 158  PHE B CE2 1 
ATOM   5390 C CZ  . PHE B 1 189 ? 16.096  2.422   -47.615 1.00 43.62  ? 158  PHE B CZ  1 
ATOM   5391 N N   . LEU B 1 190 ? 21.549  -2.193  -49.488 1.00 48.90  ? 159  LEU B N   1 
ATOM   5392 C CA  . LEU B 1 190 ? 22.877  -2.776  -49.595 1.00 50.28  ? 159  LEU B CA  1 
ATOM   5393 C C   . LEU B 1 190 ? 23.818  -1.730  -50.228 1.00 51.13  ? 159  LEU B C   1 
ATOM   5394 O O   . LEU B 1 190 ? 23.534  -1.169  -51.282 1.00 51.06  ? 159  LEU B O   1 
ATOM   5395 C CB  . LEU B 1 190 ? 22.866  -4.061  -50.407 1.00 50.26  ? 159  LEU B CB  1 
ATOM   5396 C CG  . LEU B 1 190 ? 24.214  -4.811  -50.454 1.00 51.14  ? 159  LEU B CG  1 
ATOM   5397 C CD1 . LEU B 1 190 ? 24.018  -6.333  -50.297 1.00 51.42  ? 159  LEU B CD1 1 
ATOM   5398 C CD2 . LEU B 1 190 ? 25.026  -4.520  -51.734 1.00 50.24  ? 159  LEU B CD2 1 
ATOM   5399 N N   . ALA B 1 191 ? 24.935  -1.461  -49.564 1.00 52.88  ? 160  ALA B N   1 
ATOM   5400 C CA  . ALA B 1 191 ? 25.886  -0.440  -50.023 1.00 53.81  ? 160  ALA B CA  1 
ATOM   5401 C C   . ALA B 1 191 ? 27.324  -0.942  -49.980 1.00 55.38  ? 160  ALA B C   1 
ATOM   5402 O O   . ALA B 1 191 ? 27.754  -1.574  -49.012 1.00 55.72  ? 160  ALA B O   1 
ATOM   5403 C CB  . ALA B 1 191 ? 25.766  0.809   -49.170 1.00 53.14  ? 160  ALA B CB  1 
ATOM   5404 N N   . LEU B 1 192 ? 28.038  -0.675  -51.062 1.00 56.78  ? 161  LEU B N   1 
ATOM   5405 C CA  . LEU B 1 192 ? 29.492  -0.659  -51.069 1.00 58.65  ? 161  LEU B CA  1 
ATOM   5406 C C   . LEU B 1 192 ? 29.886  0.790   -51.325 1.00 58.58  ? 161  LEU B C   1 
ATOM   5407 O O   . LEU B 1 192 ? 29.996  1.211   -52.463 1.00 58.13  ? 161  LEU B O   1 
ATOM   5408 C CB  . LEU B 1 192 ? 30.024  -1.617  -52.131 1.00 59.73  ? 161  LEU B CB  1 
ATOM   5409 C CG  . LEU B 1 192 ? 29.773  -3.041  -51.624 1.00 61.50  ? 161  LEU B CG  1 
ATOM   5410 C CD1 . LEU B 1 192 ? 29.607  -4.041  -52.728 1.00 63.73  ? 161  LEU B CD1 1 
ATOM   5411 C CD2 . LEU B 1 192 ? 30.879  -3.474  -50.697 1.00 62.87  ? 161  LEU B CD2 1 
ATOM   5412 N N   . PRO B 1 193 ? 30.025  1.569   -50.251 1.00 58.96  ? 162  PRO B N   1 
ATOM   5413 C CA  . PRO B 1 193 ? 30.151  3.027   -50.373 1.00 59.17  ? 162  PRO B CA  1 
ATOM   5414 C C   . PRO B 1 193 ? 31.332  3.451   -51.201 1.00 61.11  ? 162  PRO B C   1 
ATOM   5415 O O   . PRO B 1 193 ? 32.406  2.895   -51.023 1.00 61.97  ? 162  PRO B O   1 
ATOM   5416 C CB  . PRO B 1 193 ? 30.300  3.489   -48.929 1.00 58.99  ? 162  PRO B CB  1 
ATOM   5417 C CG  . PRO B 1 193 ? 29.622  2.406   -48.155 1.00 58.90  ? 162  PRO B CG  1 
ATOM   5418 C CD  . PRO B 1 193 ? 30.017  1.141   -48.843 1.00 58.88  ? 162  PRO B CD  1 
ATOM   5419 N N   . GLY B 1 194 ? 31.102  4.407   -52.097 1.00 61.95  ? 163  GLY B N   1 
ATOM   5420 C CA  . GLY B 1 194 ? 32.098  4.901   -53.023 1.00 63.95  ? 163  GLY B CA  1 
ATOM   5421 C C   . GLY B 1 194 ? 32.080  4.173   -54.354 1.00 65.29  ? 163  GLY B C   1 
ATOM   5422 O O   . GLY B 1 194 ? 32.720  4.611   -55.304 1.00 66.27  ? 163  GLY B O   1 
ATOM   5423 N N   . SER B 1 195 ? 31.370  3.047   -54.419 1.00 65.68  ? 164  SER B N   1 
ATOM   5424 C CA  . SER B 1 195 ? 31.198  2.302   -55.668 1.00 66.40  ? 164  SER B CA  1 
ATOM   5425 C C   . SER B 1 195 ? 30.177  2.965   -56.575 1.00 66.87  ? 164  SER B C   1 
ATOM   5426 O O   . SER B 1 195 ? 29.327  3.755   -56.138 1.00 66.50  ? 164  SER B O   1 
ATOM   5427 C CB  . SER B 1 195 ? 30.786  0.842   -55.396 1.00 66.19  ? 164  SER B CB  1 
ATOM   5428 O OG  . SER B 1 195 ? 29.418  0.697   -55.031 1.00 63.30  ? 164  SER B OG  1 
ATOM   5429 N N   . ARG B 1 196 ? 30.242  2.608   -57.839 1.00 68.67  ? 165  ARG B N   1 
ATOM   5430 C CA  . ARG B 1 196 ? 29.322  3.129   -58.835 1.00 69.36  ? 165  ARG B CA  1 
ATOM   5431 C C   . ARG B 1 196 ? 28.061  2.252   -58.899 1.00 67.05  ? 165  ARG B C   1 
ATOM   5432 O O   . ARG B 1 196 ? 26.989  2.739   -59.244 1.00 65.96  ? 165  ARG B O   1 
ATOM   5433 C CB  . ARG B 1 196 ? 30.060  3.140   -60.189 1.00 72.16  ? 165  ARG B CB  1 
ATOM   5434 C CG  . ARG B 1 196 ? 29.612  4.180   -61.232 1.00 76.83  ? 165  ARG B CG  1 
ATOM   5435 C CD  . ARG B 1 196 ? 29.743  3.675   -62.718 1.00 82.72  ? 165  ARG B CD  1 
ATOM   5436 N NE  . ARG B 1 196 ? 28.421  3.277   -63.253 1.00 86.29  ? 165  ARG B NE  1 
ATOM   5437 C CZ  . ARG B 1 196 ? 27.982  2.016   -63.452 1.00 88.44  ? 165  ARG B CZ  1 
ATOM   5438 N NH1 . ARG B 1 196 ? 28.749  0.956   -63.186 1.00 90.38  ? 165  ARG B NH1 1 
ATOM   5439 N NH2 . ARG B 1 196 ? 26.749  1.821   -63.925 1.00 87.61  ? 165  ARG B NH2 1 
ATOM   5440 N N   . GLU B 1 197 ? 28.188  0.972   -58.531 1.00 66.12  ? 166  GLU B N   1 
ATOM   5441 C CA  . GLU B 1 197 ? 27.113  -0.013  -58.768 1.00 65.37  ? 166  GLU B CA  1 
ATOM   5442 C C   . GLU B 1 197 ? 26.267  -0.424  -57.533 1.00 62.56  ? 166  GLU B C   1 
ATOM   5443 O O   . GLU B 1 197 ? 25.233  -1.103  -57.677 1.00 61.91  ? 166  GLU B O   1 
ATOM   5444 C CB  . GLU B 1 197 ? 27.604  -1.232  -59.581 1.00 67.47  ? 166  GLU B CB  1 
ATOM   5445 C CG  . GLU B 1 197 ? 29.019  -1.709  -59.301 1.00 73.07  ? 166  GLU B CG  1 
ATOM   5446 C CD  . GLU B 1 197 ? 30.089  -0.995  -60.111 1.00 78.16  ? 166  GLU B CD  1 
ATOM   5447 O OE1 . GLU B 1 197 ? 30.191  -1.257  -61.331 1.00 81.29  ? 166  GLU B OE1 1 
ATOM   5448 O OE2 . GLU B 1 197 ? 30.847  -0.196  -59.498 1.00 82.07  ? 166  GLU B OE2 1 
ATOM   5449 N N   . ALA B 1 198 ? 26.677  0.034   -56.351 1.00 60.41  ? 167  ALA B N   1 
ATOM   5450 C CA  . ALA B 1 198 ? 25.896  -0.074  -55.123 1.00 57.98  ? 167  ALA B CA  1 
ATOM   5451 C C   . ALA B 1 198 ? 26.243  1.082   -54.199 1.00 56.78  ? 167  ALA B C   1 
ATOM   5452 O O   . ALA B 1 198 ? 26.895  0.884   -53.185 1.00 56.70  ? 167  ALA B O   1 
ATOM   5453 C CB  . ALA B 1 198 ? 26.167  -1.356  -54.437 1.00 58.52  ? 167  ALA B CB  1 
ATOM   5454 N N   . PRO B 1 199 ? 25.815  2.296   -54.544 1.00 55.87  ? 168  PRO B N   1 
ATOM   5455 C CA  . PRO B 1 199 ? 26.189  3.503   -53.773 1.00 55.54  ? 168  PRO B CA  1 
ATOM   5456 C C   . PRO B 1 199 ? 25.441  3.693   -52.438 1.00 54.21  ? 168  PRO B C   1 
ATOM   5457 O O   . PRO B 1 199 ? 25.801  4.562   -51.652 1.00 54.92  ? 168  PRO B O   1 
ATOM   5458 C CB  . PRO B 1 199 ? 25.864  4.652   -54.744 1.00 55.08  ? 168  PRO B CB  1 
ATOM   5459 C CG  . PRO B 1 199 ? 24.734  4.113   -55.565 1.00 55.08  ? 168  PRO B CG  1 
ATOM   5460 C CD  . PRO B 1 199 ? 24.965  2.624   -55.703 1.00 55.32  ? 168  PRO B CD  1 
ATOM   5461 N N   . GLY B 1 200 ? 24.412  2.901   -52.181 1.00 52.96  ? 169  GLY B N   1 
ATOM   5462 C CA  . GLY B 1 200 ? 23.682  3.006   -50.931 1.00 51.53  ? 169  GLY B CA  1 
ATOM   5463 C C   . GLY B 1 200 ? 22.514  3.979   -51.033 1.00 49.85  ? 169  GLY B C   1 
ATOM   5464 O O   . GLY B 1 200 ? 22.415  4.787   -51.954 1.00 49.70  ? 169  GLY B O   1 
ATOM   5465 N N   . ASN B 1 201 ? 21.605  3.851   -50.080 1.00 48.47  ? 170  ASN B N   1 
ATOM   5466 C CA  . ASN B 1 201 ? 20.461  4.726   -49.955 1.00 47.16  ? 170  ASN B CA  1 
ATOM   5467 C C   . ASN B 1 201 ? 19.512  4.759   -51.154 1.00 46.07  ? 170  ASN B C   1 
ATOM   5468 O O   . ASN B 1 201 ? 18.761  5.691   -51.280 1.00 45.31  ? 170  ASN B O   1 
ATOM   5469 C CB  . ASN B 1 201 ? 20.947  6.142   -49.638 1.00 47.53  ? 170  ASN B CB  1 
ATOM   5470 C CG  . ASN B 1 201 ? 21.699  6.217   -48.328 1.00 48.02  ? 170  ASN B CG  1 
ATOM   5471 O OD1 . ASN B 1 201 ? 21.376  5.511   -47.374 1.00 47.54  ? 170  ASN B OD1 1 
ATOM   5472 N ND2 . ASN B 1 201 ? 22.719  7.074   -48.278 1.00 50.25  ? 170  ASN B ND2 1 
ATOM   5473 N N   . VAL B 1 202 ? 19.525  3.742   -52.016 1.00 46.05  ? 171  VAL B N   1 
ATOM   5474 C CA  . VAL B 1 202 ? 18.681  3.787   -53.213 1.00 45.77  ? 171  VAL B CA  1 
ATOM   5475 C C   . VAL B 1 202 ? 17.190  3.768   -52.854 1.00 44.98  ? 171  VAL B C   1 
ATOM   5476 O O   . VAL B 1 202 ? 16.375  4.413   -53.533 1.00 45.51  ? 171  VAL B O   1 
ATOM   5477 C CB  . VAL B 1 202 ? 19.036  2.698   -54.278 1.00 46.78  ? 171  VAL B CB  1 
ATOM   5478 C CG1 . VAL B 1 202 ? 20.519  2.742   -54.616 1.00 48.14  ? 171  VAL B CG1 1 
ATOM   5479 C CG2 . VAL B 1 202 ? 18.659  1.288   -53.836 1.00 46.63  ? 171  VAL B CG2 1 
ATOM   5480 N N   . GLY B 1 203 ? 16.835  3.103   -51.759 1.00 43.98  ? 172  GLY B N   1 
ATOM   5481 C CA  . GLY B 1 203 ? 15.453  3.108   -51.316 1.00 43.22  ? 172  GLY B CA  1 
ATOM   5482 C C   . GLY B 1 203 ? 14.985  4.497   -50.917 1.00 42.81  ? 172  GLY B C   1 
ATOM   5483 O O   . GLY B 1 203 ? 13.834  4.843   -51.056 1.00 41.75  ? 172  GLY B O   1 
ATOM   5484 N N   . LEU B 1 204 ? 15.889  5.305   -50.378 1.00 43.58  ? 173  LEU B N   1 
ATOM   5485 C CA  . LEU B 1 204 ? 15.557  6.687   -50.070 1.00 43.05  ? 173  LEU B CA  1 
ATOM   5486 C C   . LEU B 1 204 ? 15.421  7.475   -51.376 1.00 43.37  ? 173  LEU B C   1 
ATOM   5487 O O   . LEU B 1 204 ? 14.512  8.316   -51.497 1.00 42.99  ? 173  LEU B O   1 
ATOM   5488 C CB  . LEU B 1 204 ? 16.599  7.307   -49.138 1.00 43.54  ? 173  LEU B CB  1 
ATOM   5489 C CG  . LEU B 1 204 ? 16.639  6.814   -47.682 1.00 43.10  ? 173  LEU B CG  1 
ATOM   5490 C CD1 . LEU B 1 204 ? 17.788  7.454   -46.979 1.00 42.92  ? 173  LEU B CD1 1 
ATOM   5491 C CD2 . LEU B 1 204 ? 15.374  7.137   -46.958 1.00 44.21  ? 173  LEU B CD2 1 
ATOM   5492 N N   . LEU B 1 205 ? 16.276  7.187   -52.364 1.00 43.39  ? 174  LEU B N   1 
ATOM   5493 C CA  . LEU B 1 205 ? 16.113  7.820   -53.681 1.00 43.57  ? 174  LEU B CA  1 
ATOM   5494 C C   . LEU B 1 205 ? 14.780  7.415   -54.378 1.00 43.31  ? 174  LEU B C   1 
ATOM   5495 O O   . LEU B 1 205 ? 14.234  8.186   -55.149 1.00 43.22  ? 174  LEU B O   1 
ATOM   5496 C CB  . LEU B 1 205 ? 17.291  7.528   -54.585 1.00 43.86  ? 174  LEU B CB  1 
ATOM   5497 C CG  . LEU B 1 205 ? 18.658  8.083   -54.109 1.00 45.01  ? 174  LEU B CG  1 
ATOM   5498 C CD1 . LEU B 1 205 ? 19.823  7.511   -54.933 1.00 43.53  ? 174  LEU B CD1 1 
ATOM   5499 C CD2 . LEU B 1 205 ? 18.716  9.601   -54.142 1.00 45.38  ? 174  LEU B CD2 1 
ATOM   5500 N N   . ASP B 1 206 ? 14.269  6.212   -54.114 1.00 42.86  ? 175  ASP B N   1 
ATOM   5501 C CA  . ASP B 1 206 ? 12.961  5.815   -54.627 1.00 42.49  ? 175  ASP B CA  1 
ATOM   5502 C C   . ASP B 1 206 ? 11.926  6.750   -54.059 1.00 42.41  ? 175  ASP B C   1 
ATOM   5503 O O   . ASP B 1 206 ? 11.041  7.240   -54.777 1.00 42.72  ? 175  ASP B O   1 
ATOM   5504 C CB  . ASP B 1 206 ? 12.587  4.390   -54.197 1.00 42.13  ? 175  ASP B CB  1 
ATOM   5505 C CG  . ASP B 1 206 ? 13.478  3.326   -54.821 1.00 43.31  ? 175  ASP B CG  1 
ATOM   5506 O OD1 . ASP B 1 206 ? 14.243  3.617   -55.762 1.00 43.98  ? 175  ASP B OD1 1 
ATOM   5507 O OD2 . ASP B 1 206 ? 13.479  2.153   -54.431 1.00 44.50  ? 175  ASP B OD2 1 
ATOM   5508 N N   . GLN B 1 207 ? 12.014  6.988   -52.753 1.00 42.26  ? 176  GLN B N   1 
ATOM   5509 C CA  . GLN B 1 207 ? 11.064  7.869   -52.104 1.00 41.76  ? 176  GLN B CA  1 
ATOM   5510 C C   . GLN B 1 207 ? 11.181  9.237   -52.723 1.00 42.09  ? 176  GLN B C   1 
ATOM   5511 O O   . GLN B 1 207 ? 10.181  9.841   -53.100 1.00 42.53  ? 176  GLN B O   1 
ATOM   5512 C CB  . GLN B 1 207 ? 11.297  7.936   -50.612 1.00 41.45  ? 176  GLN B CB  1 
ATOM   5513 C CG  . GLN B 1 207 ? 11.228  6.542   -49.821 1.00 41.34  ? 176  GLN B CG  1 
ATOM   5514 C CD  . GLN B 1 207 ? 11.778  6.687   -48.391 1.00 39.88  ? 176  GLN B CD  1 
ATOM   5515 O OE1 . GLN B 1 207 ? 12.028  7.817   -47.946 1.00 41.85  ? 176  GLN B OE1 1 
ATOM   5516 N NE2 . GLN B 1 207 ? 11.942  5.577   -47.677 1.00 37.17  ? 176  GLN B NE2 1 
ATOM   5517 N N   . ARG B 1 208 ? 12.406  9.716   -52.875 1.00 42.62  ? 177  ARG B N   1 
ATOM   5518 C CA  . ARG B 1 208 ? 12.626  11.051  -53.401 1.00 42.89  ? 177  ARG B CA  1 
ATOM   5519 C C   . ARG B 1 208 ? 12.067  11.187  -54.811 1.00 43.04  ? 177  ARG B C   1 
ATOM   5520 O O   . ARG B 1 208 ? 11.489  12.218  -55.157 1.00 42.47  ? 177  ARG B O   1 
ATOM   5521 C CB  . ARG B 1 208 ? 14.101  11.380  -53.403 1.00 43.61  ? 177  ARG B CB  1 
ATOM   5522 C CG  . ARG B 1 208 ? 14.407  12.660  -54.109 1.00 45.81  ? 177  ARG B CG  1 
ATOM   5523 C CD  . ARG B 1 208 ? 15.856  13.009  -54.095 1.00 47.96  ? 177  ARG B CD  1 
ATOM   5524 N NE  . ARG B 1 208 ? 16.273  13.411  -52.755 1.00 49.85  ? 177  ARG B NE  1 
ATOM   5525 C CZ  . ARG B 1 208 ? 17.548  13.412  -52.361 1.00 50.78  ? 177  ARG B CZ  1 
ATOM   5526 N NH1 . ARG B 1 208 ? 18.499  13.042  -53.216 1.00 50.16  ? 177  ARG B NH1 1 
ATOM   5527 N NH2 . ARG B 1 208 ? 17.883  13.794  -51.131 1.00 49.23  ? 177  ARG B NH2 1 
ATOM   5528 N N   . LEU B 1 209 ? 12.238  10.144  -55.622 1.00 43.04  ? 178  LEU B N   1 
ATOM   5529 C CA  . LEU B 1 209 ? 11.683  10.144  -56.967 1.00 43.64  ? 178  LEU B CA  1 
ATOM   5530 C C   . LEU B 1 209 ? 10.149  10.205  -56.931 1.00 42.95  ? 178  LEU B C   1 
ATOM   5531 O O   . LEU B 1 209 ? 9.563   10.855  -57.771 1.00 43.14  ? 178  LEU B O   1 
ATOM   5532 C CB  . LEU B 1 209 ? 12.195  8.973   -57.811 1.00 43.64  ? 178  LEU B CB  1 
ATOM   5533 C CG  . LEU B 1 209 ? 11.785  8.991   -59.296 1.00 46.26  ? 178  LEU B CG  1 
ATOM   5534 C CD1 . LEU B 1 209 ? 12.300  10.228  -60.068 1.00 46.79  ? 178  LEU B CD1 1 
ATOM   5535 C CD2 . LEU B 1 209 ? 12.269  7.722   -59.962 1.00 48.82  ? 178  LEU B CD2 1 
ATOM   5536 N N   . ALA B 1 210 ? 9.503   9.543   -55.975 1.00 42.64  ? 179  ALA B N   1 
ATOM   5537 C CA  . ALA B 1 210 ? 8.038   9.627   -55.864 1.00 42.54  ? 179  ALA B CA  1 
ATOM   5538 C C   . ALA B 1 210 ? 7.632   11.028  -55.464 1.00 43.00  ? 179  ALA B C   1 
ATOM   5539 O O   . ALA B 1 210 ? 6.603   11.519  -55.873 1.00 43.70  ? 179  ALA B O   1 
ATOM   5540 C CB  . ALA B 1 210 ? 7.488   8.624   -54.893 1.00 41.50  ? 179  ALA B CB  1 
ATOM   5541 N N   . LEU B 1 211 ? 8.459   11.678  -54.674 1.00 43.46  ? 180  LEU B N   1 
ATOM   5542 C CA  . LEU B 1 211 ? 8.215   13.059  -54.287 1.00 44.22  ? 180  LEU B CA  1 
ATOM   5543 C C   . LEU B 1 211 ? 8.312   13.977  -55.502 1.00 45.31  ? 180  LEU B C   1 
ATOM   5544 O O   . LEU B 1 211 ? 7.483   14.883  -55.643 1.00 45.43  ? 180  LEU B O   1 
ATOM   5545 C CB  . LEU B 1 211 ? 9.193   13.477  -53.186 1.00 44.48  ? 180  LEU B CB  1 
ATOM   5546 C CG  . LEU B 1 211 ? 8.856   13.253  -51.687 1.00 44.73  ? 180  LEU B CG  1 
ATOM   5547 C CD1 . LEU B 1 211 ? 8.110   11.996  -51.330 1.00 44.38  ? 180  LEU B CD1 1 
ATOM   5548 C CD2 . LEU B 1 211 ? 10.141  13.324  -50.884 1.00 45.83  ? 180  LEU B CD2 1 
ATOM   5549 N N   . GLN B 1 212 ? 9.284   13.731  -56.389 1.00 46.33  ? 181  GLN B N   1 
ATOM   5550 C CA  . GLN B 1 212 ? 9.458   14.503  -57.633 1.00 47.86  ? 181  GLN B CA  1 
ATOM   5551 C C   . GLN B 1 212 ? 8.236   14.259  -58.502 1.00 47.45  ? 181  GLN B C   1 
ATOM   5552 O O   . GLN B 1 212 ? 7.700   15.176  -59.089 1.00 47.38  ? 181  GLN B O   1 
ATOM   5553 C CB  . GLN B 1 212 ? 10.738  14.095  -58.414 1.00 49.05  ? 181  GLN B CB  1 
ATOM   5554 C CG  . GLN B 1 212 ? 11.995  14.952  -58.080 1.00 55.95  ? 181  GLN B CG  1 
ATOM   5555 C CD  . GLN B 1 212 ? 13.394  14.181  -58.125 1.00 61.60  ? 181  GLN B CD  1 
ATOM   5556 O OE1 . GLN B 1 212 ? 13.504  13.051  -58.635 1.00 65.78  ? 181  GLN B OE1 1 
ATOM   5557 N NE2 . GLN B 1 212 ? 14.435  14.823  -57.586 1.00 63.19  ? 181  GLN B NE2 1 
ATOM   5558 N N   . TRP B 1 213 ? 7.778   13.016  -58.555 1.00 46.80  ? 182  TRP B N   1 
ATOM   5559 C CA  . TRP B 1 213 ? 6.604   12.678  -59.334 1.00 47.11  ? 182  TRP B CA  1 
ATOM   5560 C C   . TRP B 1 213 ? 5.415   13.507  -58.878 1.00 47.40  ? 182  TRP B C   1 
ATOM   5561 O O   . TRP B 1 213 ? 4.691   14.049  -59.712 1.00 48.47  ? 182  TRP B O   1 
ATOM   5562 C CB  . TRP B 1 213 ? 6.314   11.184  -59.236 1.00 47.33  ? 182  TRP B CB  1 
ATOM   5563 C CG  . TRP B 1 213 ? 5.203   10.709  -60.128 1.00 48.35  ? 182  TRP B CG  1 
ATOM   5564 C CD1 . TRP B 1 213 ? 5.326   10.119  -61.352 1.00 49.13  ? 182  TRP B CD1 1 
ATOM   5565 C CD2 . TRP B 1 213 ? 3.803   10.779  -59.857 1.00 47.14  ? 182  TRP B CD2 1 
ATOM   5566 N NE1 . TRP B 1 213 ? 4.083   9.831   -61.858 1.00 48.19  ? 182  TRP B NE1 1 
ATOM   5567 C CE2 . TRP B 1 213 ? 3.132   10.219  -60.962 1.00 46.93  ? 182  TRP B CE2 1 
ATOM   5568 C CE3 . TRP B 1 213 ? 3.048   11.259  -58.789 1.00 44.78  ? 182  TRP B CE3 1 
ATOM   5569 C CZ2 . TRP B 1 213 ? 1.753   10.128  -61.037 1.00 48.17  ? 182  TRP B CZ2 1 
ATOM   5570 C CZ3 . TRP B 1 213 ? 1.677   11.157  -58.857 1.00 46.94  ? 182  TRP B CZ3 1 
ATOM   5571 C CH2 . TRP B 1 213 ? 1.038   10.606  -59.978 1.00 48.13  ? 182  TRP B CH2 1 
ATOM   5572 N N   . VAL B 1 214 ? 5.249   13.647  -57.568 1.00 46.70  ? 183  VAL B N   1 
ATOM   5573 C CA  . VAL B 1 214 ? 4.162   14.410  -56.999 1.00 47.34  ? 183  VAL B CA  1 
ATOM   5574 C C   . VAL B 1 214 ? 4.270   15.902  -57.413 1.00 48.95  ? 183  VAL B C   1 
ATOM   5575 O O   . VAL B 1 214 ? 3.259   16.501  -57.808 1.00 49.48  ? 183  VAL B O   1 
ATOM   5576 C CB  . VAL B 1 214 ? 4.071   14.185  -55.443 1.00 46.83  ? 183  VAL B CB  1 
ATOM   5577 C CG1 . VAL B 1 214 ? 3.199   15.234  -54.755 1.00 46.91  ? 183  VAL B CG1 1 
ATOM   5578 C CG2 . VAL B 1 214 ? 3.525   12.787  -55.147 1.00 46.42  ? 183  VAL B CG2 1 
ATOM   5579 N N   . GLN B 1 215 ? 5.468   16.497  -57.364 1.00 49.30  ? 184  GLN B N   1 
ATOM   5580 C CA  . GLN B 1 215 ? 5.624   17.889  -57.808 1.00 50.72  ? 184  GLN B CA  1 
ATOM   5581 C C   . GLN B 1 215 ? 5.154   18.080  -59.243 1.00 51.68  ? 184  GLN B C   1 
ATOM   5582 O O   . GLN B 1 215 ? 4.421   19.030  -59.534 1.00 52.48  ? 184  GLN B O   1 
ATOM   5583 C CB  . GLN B 1 215 ? 7.067   18.391  -57.715 1.00 50.72  ? 184  GLN B CB  1 
ATOM   5584 C CG  . GLN B 1 215 ? 7.513   18.641  -56.328 1.00 52.89  ? 184  GLN B CG  1 
ATOM   5585 C CD  . GLN B 1 215 ? 6.651   19.672  -55.599 1.00 54.93  ? 184  GLN B CD  1 
ATOM   5586 O OE1 . GLN B 1 215 ? 5.836   19.332  -54.711 1.00 52.76  ? 184  GLN B OE1 1 
ATOM   5587 N NE2 . GLN B 1 215 ? 6.849   20.929  -55.950 1.00 56.31  ? 184  GLN B NE2 1 
ATOM   5588 N N   . GLU B 1 216 ? 5.576   17.190  -60.132 1.00 51.93  ? 185  GLU B N   1 
ATOM   5589 C CA  . GLU B 1 216 ? 5.288   17.320  -61.568 1.00 53.16  ? 185  GLU B CA  1 
ATOM   5590 C C   . GLU B 1 216 ? 3.855   16.924  -61.951 1.00 52.75  ? 185  GLU B C   1 
ATOM   5591 O O   . GLU B 1 216 ? 3.372   17.377  -62.981 1.00 54.00  ? 185  GLU B O   1 
ATOM   5592 C CB  . GLU B 1 216 ? 6.237   16.429  -62.390 1.00 53.30  ? 185  GLU B CB  1 
ATOM   5593 C CG  . GLU B 1 216 ? 7.726   16.761  -62.276 1.00 57.64  ? 185  GLU B CG  1 
ATOM   5594 C CD  . GLU B 1 216 ? 8.635   15.694  -62.900 1.00 62.41  ? 185  GLU B CD  1 
ATOM   5595 O OE1 . GLU B 1 216 ? 8.205   15.034  -63.885 1.00 67.64  ? 185  GLU B OE1 1 
ATOM   5596 O OE2 . GLU B 1 216 ? 9.780   15.511  -62.422 1.00 63.86  ? 185  GLU B OE2 1 
ATOM   5597 N N   . ASN B 1 217 ? 3.198   16.070  -61.159 1.00 51.38  ? 186  ASN B N   1 
ATOM   5598 C CA  . ASN B 1 217 ? 1.959   15.411  -61.597 1.00 51.39  ? 186  ASN B CA  1 
ATOM   5599 C C   . ASN B 1 217 ? 0.722   15.559  -60.728 1.00 50.55  ? 186  ASN B C   1 
ATOM   5600 O O   . ASN B 1 217 ? -0.351  15.239  -61.183 1.00 51.30  ? 186  ASN B O   1 
ATOM   5601 C CB  . ASN B 1 217 ? 2.209   13.904  -61.778 1.00 51.18  ? 186  ASN B CB  1 
ATOM   5602 C CG  . ASN B 1 217 ? 3.113   13.601  -62.938 1.00 53.07  ? 186  ASN B CG  1 
ATOM   5603 O OD1 . ASN B 1 217 ? 2.798   13.952  -64.066 1.00 56.97  ? 186  ASN B OD1 1 
ATOM   5604 N ND2 . ASN B 1 217 ? 4.248   12.951  -62.671 1.00 53.93  ? 186  ASN B ND2 1 
ATOM   5605 N N   . ILE B 1 218 ? 0.861   16.001  -59.481 1.00 50.10  ? 187  ILE B N   1 
ATOM   5606 C CA  . ILE B 1 218 ? -0.235  15.894  -58.515 1.00 49.37  ? 187  ILE B CA  1 
ATOM   5607 C C   . ILE B 1 218 ? -1.357  16.881  -58.798 1.00 50.37  ? 187  ILE B C   1 
ATOM   5608 O O   . ILE B 1 218 ? -2.520  16.598  -58.492 1.00 50.42  ? 187  ILE B O   1 
ATOM   5609 C CB  . ILE B 1 218 ? 0.310   15.999  -57.075 1.00 48.65  ? 187  ILE B CB  1 
ATOM   5610 C CG1 . ILE B 1 218 ? -0.649  15.339  -56.074 1.00 48.08  ? 187  ILE B CG1 1 
ATOM   5611 C CG2 . ILE B 1 218 ? 0.597   17.437  -56.699 1.00 50.08  ? 187  ILE B CG2 1 
ATOM   5612 C CD1 . ILE B 1 218 ? -0.873  13.846  -56.362 1.00 47.86  ? 187  ILE B CD1 1 
ATOM   5613 N N   . ALA B 1 219 ? -1.009  18.010  -59.424 1.00 51.15  ? 188  ALA B N   1 
ATOM   5614 C CA  . ALA B 1 219 ? -1.999  18.998  -59.886 1.00 52.33  ? 188  ALA B CA  1 
ATOM   5615 C C   . ALA B 1 219 ? -3.071  18.407  -60.814 1.00 52.98  ? 188  ALA B C   1 
ATOM   5616 O O   . ALA B 1 219 ? -4.201  18.860  -60.799 1.00 53.65  ? 188  ALA B O   1 
ATOM   5617 C CB  . ALA B 1 219 ? -1.305  20.207  -60.577 1.00 52.53  ? 188  ALA B CB  1 
ATOM   5618 N N   . ALA B 1 220 ? -2.723  17.394  -61.608 1.00 53.02  ? 189  ALA B N   1 
ATOM   5619 C CA  . ALA B 1 220 ? -3.705  16.752  -62.490 1.00 53.48  ? 189  ALA B CA  1 
ATOM   5620 C C   . ALA B 1 220 ? -4.818  16.050  -61.695 1.00 53.41  ? 189  ALA B C   1 
ATOM   5621 O O   . ALA B 1 220 ? -5.888  15.786  -62.233 1.00 54.25  ? 189  ALA B O   1 
ATOM   5622 C CB  . ALA B 1 220 ? -3.007  15.782  -63.416 1.00 53.57  ? 189  ALA B CB  1 
ATOM   5623 N N   . PHE B 1 221 ? -4.547  15.753  -60.422 1.00 52.56  ? 190  PHE B N   1 
ATOM   5624 C CA  . PHE B 1 221 ? -5.484  15.081  -59.528 1.00 52.48  ? 190  PHE B CA  1 
ATOM   5625 C C   . PHE B 1 221 ? -6.180  16.065  -58.588 1.00 53.19  ? 190  PHE B C   1 
ATOM   5626 O O   . PHE B 1 221 ? -6.951  15.648  -57.714 1.00 53.29  ? 190  PHE B O   1 
ATOM   5627 C CB  . PHE B 1 221 ? -4.746  14.063  -58.657 1.00 50.96  ? 190  PHE B CB  1 
ATOM   5628 C CG  . PHE B 1 221 ? -4.038  13.002  -59.427 1.00 51.31  ? 190  PHE B CG  1 
ATOM   5629 C CD1 . PHE B 1 221 ? -2.762  13.224  -59.931 1.00 50.60  ? 190  PHE B CD1 1 
ATOM   5630 C CD2 . PHE B 1 221 ? -4.622  11.765  -59.627 1.00 51.91  ? 190  PHE B CD2 1 
ATOM   5631 C CE1 . PHE B 1 221 ? -2.093  12.239  -60.619 1.00 50.42  ? 190  PHE B CE1 1 
ATOM   5632 C CE2 . PHE B 1 221 ? -3.940  10.769  -60.320 1.00 50.71  ? 190  PHE B CE2 1 
ATOM   5633 C CZ  . PHE B 1 221 ? -2.689  11.015  -60.831 1.00 49.00  ? 190  PHE B CZ  1 
ATOM   5634 N N   . GLY B 1 222 ? -5.893  17.357  -58.754 1.00 53.80  ? 191  GLY B N   1 
ATOM   5635 C CA  . GLY B 1 222 ? -6.373  18.382  -57.849 1.00 54.21  ? 191  GLY B CA  1 
ATOM   5636 C C   . GLY B 1 222 ? -5.505  18.652  -56.618 1.00 53.53  ? 191  GLY B C   1 
ATOM   5637 O O   . GLY B 1 222 ? -5.894  19.424  -55.754 1.00 53.62  ? 191  GLY B O   1 
ATOM   5638 N N   . GLY B 1 223 ? -4.333  18.028  -56.513 1.00 52.97  ? 192  GLY B N   1 
ATOM   5639 C CA  . GLY B 1 223 ? -3.416  18.339  -55.423 1.00 51.91  ? 192  GLY B CA  1 
ATOM   5640 C C   . GLY B 1 223 ? -2.619  19.625  -55.616 1.00 52.03  ? 192  GLY B C   1 
ATOM   5641 O O   . GLY B 1 223 ? -2.405  20.070  -56.725 1.00 52.96  ? 192  GLY B O   1 
ATOM   5642 N N   . ASP B 1 224 ? -2.156  20.197  -54.518 1.00 51.65  ? 193  ASP B N   1 
ATOM   5643 C CA  . ASP B 1 224 ? -1.369  21.429  -54.503 1.00 52.66  ? 193  ASP B CA  1 
ATOM   5644 C C   . ASP B 1 224 ? 0.096   21.074  -54.307 1.00 51.79  ? 193  ASP B C   1 
ATOM   5645 O O   . ASP B 1 224 ? 0.478   20.674  -53.223 1.00 51.07  ? 193  ASP B O   1 
ATOM   5646 C CB  . ASP B 1 224 ? -1.820  22.295  -53.319 1.00 53.03  ? 193  ASP B CB  1 
ATOM   5647 C CG  . ASP B 1 224 ? -1.246  23.711  -53.345 1.00 55.49  ? 193  ASP B CG  1 
ATOM   5648 O OD1 . ASP B 1 224 ? -0.423  24.006  -54.229 1.00 58.38  ? 193  ASP B OD1 1 
ATOM   5649 O OD2 . ASP B 1 224 ? -1.579  24.610  -52.514 1.00 58.80  ? 193  ASP B OD2 1 
ATOM   5650 N N   . PRO B 1 225 ? 0.931   21.203  -55.325 1.00 52.48  ? 194  PRO B N   1 
ATOM   5651 C CA  . PRO B 1 225 ? 2.348   20.848  -55.149 1.00 52.27  ? 194  PRO B CA  1 
ATOM   5652 C C   . PRO B 1 225 ? 3.051   21.818  -54.217 1.00 52.65  ? 194  PRO B C   1 
ATOM   5653 O O   . PRO B 1 225 ? 4.127   21.533  -53.737 1.00 52.07  ? 194  PRO B O   1 
ATOM   5654 C CB  . PRO B 1 225 ? 2.932   20.912  -56.570 1.00 52.86  ? 194  PRO B CB  1 
ATOM   5655 C CG  . PRO B 1 225 ? 1.964   21.803  -57.362 1.00 54.09  ? 194  PRO B CG  1 
ATOM   5656 C CD  . PRO B 1 225 ? 0.631   21.684  -56.685 1.00 53.45  ? 194  PRO B CD  1 
ATOM   5657 N N   . MET B 1 226 ? 2.424   22.954  -53.947 1.00 54.12  ? 195  MET B N   1 
ATOM   5658 C CA  . MET B 1 226 ? 2.964   23.938  -53.004 1.00 54.91  ? 195  MET B CA  1 
ATOM   5659 C C   . MET B 1 226 ? 2.619   23.674  -51.553 1.00 52.46  ? 195  MET B C   1 
ATOM   5660 O O   . MET B 1 226 ? 2.980   24.466  -50.692 1.00 52.57  ? 195  MET B O   1 
ATOM   5661 C CB  . MET B 1 226 ? 2.435   25.327  -53.352 1.00 57.35  ? 195  MET B CB  1 
ATOM   5662 C CG  . MET B 1 226 ? 2.645   25.693  -54.808 1.00 63.02  ? 195  MET B CG  1 
ATOM   5663 S SD  . MET B 1 226 ? 4.145   26.625  -54.953 1.00 74.59  ? 195  MET B SD  1 
ATOM   5664 C CE  . MET B 1 226 ? 5.604   25.450  -54.258 1.00 71.31  ? 195  MET B CE  1 
ATOM   5665 N N   . SER B 1 227 ? 1.914   22.581  -51.290 1.00 50.19  ? 196  SER B N   1 
ATOM   5666 C CA  . SER B 1 227 ? 1.561   22.203  -49.936 1.00 48.60  ? 196  SER B CA  1 
ATOM   5667 C C   . SER B 1 227 ? 1.592   20.670  -49.823 1.00 47.05  ? 196  SER B C   1 
ATOM   5668 O O   . SER B 1 227 ? 0.581   19.991  -49.938 1.00 46.08  ? 196  SER B O   1 
ATOM   5669 C CB  . SER B 1 227 ? 0.197   22.774  -49.555 1.00 48.66  ? 196  SER B CB  1 
ATOM   5670 O OG  . SER B 1 227 ? -0.158  22.386  -48.243 1.00 48.13  ? 196  SER B OG  1 
ATOM   5671 N N   . VAL B 1 228 ? 2.781   20.154  -49.565 1.00 46.02  ? 197  VAL B N   1 
ATOM   5672 C CA  . VAL B 1 228 ? 3.033   18.734  -49.502 1.00 45.26  ? 197  VAL B CA  1 
ATOM   5673 C C   . VAL B 1 228 ? 3.553   18.449  -48.135 1.00 44.02  ? 197  VAL B C   1 
ATOM   5674 O O   . VAL B 1 228 ? 4.586   18.983  -47.742 1.00 44.98  ? 197  VAL B O   1 
ATOM   5675 C CB  . VAL B 1 228 ? 4.074   18.305  -50.551 1.00 45.24  ? 197  VAL B CB  1 
ATOM   5676 C CG1 . VAL B 1 228 ? 4.560   16.884  -50.307 1.00 43.96  ? 197  VAL B CG1 1 
ATOM   5677 C CG2 . VAL B 1 228 ? 3.462   18.414  -51.930 1.00 46.62  ? 197  VAL B CG2 1 
ATOM   5678 N N   . THR B 1 229 ? 2.846   17.606  -47.410 1.00 43.10  ? 198  THR B N   1 
ATOM   5679 C CA  . THR B 1 229 ? 3.260   17.184  -46.098 1.00 42.61  ? 198  THR B CA  1 
ATOM   5680 C C   . THR B 1 229 ? 3.669   15.732  -46.153 1.00 42.08  ? 198  THR B C   1 
ATOM   5681 O O   . THR B 1 229 ? 2.855   14.888  -46.563 1.00 42.54  ? 198  THR B O   1 
ATOM   5682 C CB  . THR B 1 229 ? 2.099   17.315  -45.140 1.00 42.55  ? 198  THR B CB  1 
ATOM   5683 O OG1 . THR B 1 229 ? 1.642   18.669  -45.142 1.00 45.00  ? 198  THR B OG1 1 
ATOM   5684 C CG2 . THR B 1 229 ? 2.567   17.088  -43.706 1.00 42.17  ? 198  THR B CG2 1 
ATOM   5685 N N   . LEU B 1 230 ? 4.899   15.437  -45.740 1.00 40.90  ? 199  LEU B N   1 
ATOM   5686 C CA  . LEU B 1 230 ? 5.346   14.063  -45.590 1.00 40.66  ? 199  LEU B CA  1 
ATOM   5687 C C   . LEU B 1 230 ? 4.910   13.530  -44.257 1.00 40.29  ? 199  LEU B C   1 
ATOM   5688 O O   . LEU B 1 230 ? 4.995   14.224  -43.288 1.00 40.99  ? 199  LEU B O   1 
ATOM   5689 C CB  . LEU B 1 230 ? 6.865   13.983  -45.634 1.00 40.54  ? 199  LEU B CB  1 
ATOM   5690 C CG  . LEU B 1 230 ? 7.561   14.587  -46.844 1.00 41.99  ? 199  LEU B CG  1 
ATOM   5691 C CD1 . LEU B 1 230 ? 9.088   14.362  -46.733 1.00 42.06  ? 199  LEU B CD1 1 
ATOM   5692 C CD2 . LEU B 1 230 ? 6.997   13.995  -48.122 1.00 42.28  ? 199  LEU B CD2 1 
ATOM   5693 N N   . PHE B 1 231 ? 4.414   12.307  -44.202 1.00 40.14  ? 200  PHE B N   1 
ATOM   5694 C CA  . PHE B 1 231 ? 4.235   11.636  -42.926 1.00 39.55  ? 200  PHE B CA  1 
ATOM   5695 C C   . PHE B 1 231 ? 4.596   10.178  -42.990 1.00 39.37  ? 200  PHE B C   1 
ATOM   5696 O O   . PHE B 1 231 ? 4.536   9.566   -44.035 1.00 39.80  ? 200  PHE B O   1 
ATOM   5697 C CB  . PHE B 1 231 ? 2.871   11.890  -42.285 1.00 39.64  ? 200  PHE B CB  1 
ATOM   5698 C CG  . PHE B 1 231 ? 1.691   11.202  -42.906 1.00 40.97  ? 200  PHE B CG  1 
ATOM   5699 C CD1 . PHE B 1 231 ? 1.448   11.223  -44.267 1.00 42.76  ? 200  PHE B CD1 1 
ATOM   5700 C CD2 . PHE B 1 231 ? 0.710   10.666  -42.078 1.00 42.32  ? 200  PHE B CD2 1 
ATOM   5701 C CE1 . PHE B 1 231 ? 0.269   10.633  -44.804 1.00 42.85  ? 200  PHE B CE1 1 
ATOM   5702 C CE2 . PHE B 1 231 ? -0.478  10.099  -42.610 1.00 43.35  ? 200  PHE B CE2 1 
ATOM   5703 C CZ  . PHE B 1 231 ? -0.678  10.078  -43.979 1.00 42.21  ? 200  PHE B CZ  1 
ATOM   5704 N N   . GLY B 1 232 ? 5.023   9.640   -41.864 1.00 38.85  ? 201  GLY B N   1 
ATOM   5705 C CA  . GLY B 1 232 ? 5.504   8.275   -41.827 1.00 39.68  ? 201  GLY B CA  1 
ATOM   5706 C C   . GLY B 1 232 ? 5.653   7.780   -40.416 1.00 39.61  ? 201  GLY B C   1 
ATOM   5707 O O   . GLY B 1 232 ? 5.635   8.562   -39.480 1.00 39.17  ? 201  GLY B O   1 
ATOM   5708 N N   . GLU B 1 233 ? 5.769   6.470   -40.273 1.00 39.99  ? 202  GLU B N   1 
ATOM   5709 C CA  . GLU B 1 233 ? 5.920   5.847   -38.957 1.00 40.17  ? 202  GLU B CA  1 
ATOM   5710 C C   . GLU B 1 233 ? 7.100   4.893   -38.934 1.00 39.99  ? 202  GLU B C   1 
ATOM   5711 O O   . GLU B 1 233 ? 7.417   4.267   -39.931 1.00 39.80  ? 202  GLU B O   1 
ATOM   5712 C CB  . GLU B 1 233 ? 4.623   5.155   -38.540 1.00 40.31  ? 202  GLU B CB  1 
ATOM   5713 C CG  . GLU B 1 233 ? 4.579   4.595   -37.126 1.00 41.68  ? 202  GLU B CG  1 
ATOM   5714 C CD  . GLU B 1 233 ? 5.062   3.147   -37.037 1.00 45.12  ? 202  GLU B CD  1 
ATOM   5715 O OE1 . GLU B 1 233 ? 5.316   2.556   -38.119 1.00 40.98  ? 202  GLU B OE1 1 
ATOM   5716 O OE2 . GLU B 1 233 ? 5.213   2.615   -35.876 1.00 45.75  ? 202  GLU B OE2 1 
ATOM   5717 N N   . SER B 1 234 ? 7.769   4.833   -37.787 1.00 40.35  ? 203  SER B N   1 
ATOM   5718 C CA  . SER B 1 234 ? 8.927   3.977   -37.577 1.00 40.70  ? 203  SER B CA  1 
ATOM   5719 C C   . SER B 1 234 ? 10.009  4.277   -38.641 1.00 40.30  ? 203  SER B C   1 
ATOM   5720 O O   . SER B 1 234 ? 10.396  5.425   -38.774 1.00 40.05  ? 203  SER B O   1 
ATOM   5721 C CB  . SER B 1 234 ? 8.462   2.529   -37.514 1.00 40.84  ? 203  SER B CB  1 
ATOM   5722 O OG  . SER B 1 234 ? 9.480   1.691   -37.001 1.00 43.79  ? 203  SER B OG  1 
ATOM   5723 N N   . ALA B 1 235 ? 10.458  3.297   -39.426 1.00 40.57  ? 204  ALA B N   1 
ATOM   5724 C CA  . ALA B 1 235 ? 11.438  3.580   -40.479 1.00 40.86  ? 204  ALA B CA  1 
ATOM   5725 C C   . ALA B 1 235 ? 10.940  4.624   -41.490 1.00 40.57  ? 204  ALA B C   1 
ATOM   5726 O O   . ALA B 1 235 ? 11.741  5.313   -42.117 1.00 40.10  ? 204  ALA B O   1 
ATOM   5727 C CB  . ALA B 1 235 ? 11.826  2.307   -41.203 1.00 41.49  ? 204  ALA B CB  1 
ATOM   5728 N N   . GLY B 1 236 ? 9.624   4.705   -41.659 1.00 40.65  ? 205  GLY B N   1 
ATOM   5729 C CA  . GLY B 1 236 ? 9.002   5.706   -42.512 1.00 40.85  ? 205  GLY B CA  1 
ATOM   5730 C C   . GLY B 1 236 ? 9.188   7.117   -41.962 1.00 41.00  ? 205  GLY B C   1 
ATOM   5731 O O   . GLY B 1 236 ? 9.403   8.072   -42.709 1.00 41.04  ? 205  GLY B O   1 
ATOM   5732 N N   . ALA B 1 237 ? 9.126   7.228   -40.640 1.00 41.03  ? 206  ALA B N   1 
ATOM   5733 C CA  . ALA B 1 237 ? 9.433   8.453   -39.940 1.00 40.40  ? 206  ALA B CA  1 
ATOM   5734 C C   . ALA B 1 237 ? 10.901  8.802   -40.018 1.00 40.16  ? 206  ALA B C   1 
ATOM   5735 O O   . ALA B 1 237 ? 11.240  9.949   -40.233 1.00 40.18  ? 206  ALA B O   1 
ATOM   5736 C CB  . ALA B 1 237 ? 9.021   8.312   -38.504 1.00 41.62  ? 206  ALA B CB  1 
ATOM   5737 N N   . ALA B 1 238 ? 11.783  7.835   -39.838 1.00 39.96  ? 207  ALA B N   1 
ATOM   5738 C CA  . ALA B 1 238 ? 13.204  8.111   -39.994 1.00 40.32  ? 207  ALA B CA  1 
ATOM   5739 C C   . ALA B 1 238 ? 13.509  8.550   -41.427 1.00 40.69  ? 207  ALA B C   1 
ATOM   5740 O O   . ALA B 1 238 ? 14.374  9.405   -41.653 1.00 40.91  ? 207  ALA B O   1 
ATOM   5741 C CB  . ALA B 1 238 ? 14.011  6.899   -39.650 1.00 41.08  ? 207  ALA B CB  1 
ATOM   5742 N N   . SER B 1 239 ? 12.777  7.962   -42.391 1.00 40.36  ? 208  SER B N   1 
ATOM   5743 C CA  . SER B 1 239 ? 12.883  8.347   -43.798 1.00 40.31  ? 208  SER B CA  1 
ATOM   5744 C C   . SER B 1 239 ? 12.467  9.805   -43.964 1.00 40.31  ? 208  SER B C   1 
ATOM   5745 O O   . SER B 1 239 ? 13.207  10.575  -44.545 1.00 40.51  ? 208  SER B O   1 
ATOM   5746 C CB  . SER B 1 239 ? 12.042  7.454   -44.704 1.00 40.62  ? 208  SER B CB  1 
ATOM   5747 O OG  . SER B 1 239 ? 12.441  6.097   -44.632 1.00 39.55  ? 208  SER B OG  1 
ATOM   5748 N N   . VAL B 1 240 ? 11.335  10.207  -43.397 1.00 39.81  ? 209  VAL B N   1 
ATOM   5749 C CA  . VAL B 1 240 ? 10.920  11.616  -43.454 1.00 40.01  ? 209  VAL B CA  1 
ATOM   5750 C C   . VAL B 1 240 ? 12.034  12.505  -42.866 1.00 40.37  ? 209  VAL B C   1 
ATOM   5751 O O   . VAL B 1 240 ? 12.388  13.546  -43.417 1.00 40.88  ? 209  VAL B O   1 
ATOM   5752 C CB  . VAL B 1 240 ? 9.604   11.821  -42.681 1.00 39.44  ? 209  VAL B CB  1 
ATOM   5753 C CG1 . VAL B 1 240 ? 9.323   13.263  -42.464 1.00 38.55  ? 209  VAL B CG1 1 
ATOM   5754 C CG2 . VAL B 1 240 ? 8.453   11.156  -43.424 1.00 40.01  ? 209  VAL B CG2 1 
ATOM   5755 N N   . GLY B 1 241 ? 12.602  12.075  -41.752 1.00 40.58  ? 210  GLY B N   1 
ATOM   5756 C CA  . GLY B 1 241 ? 13.712  12.797  -41.146 1.00 41.55  ? 210  GLY B CA  1 
ATOM   5757 C C   . GLY B 1 241 ? 14.915  12.943  -42.063 1.00 41.99  ? 210  GLY B C   1 
ATOM   5758 O O   . GLY B 1 241 ? 15.521  13.995  -42.124 1.00 42.16  ? 210  GLY B O   1 
ATOM   5759 N N   . MET B 1 242 ? 15.229  11.888  -42.802 1.00 42.70  ? 211  MET B N   1 
ATOM   5760 C CA  . MET B 1 242 ? 16.334  11.931  -43.749 1.00 44.33  ? 211  MET B CA  1 
ATOM   5761 C C   . MET B 1 242 ? 16.095  12.853  -44.948 1.00 44.45  ? 211  MET B C   1 
ATOM   5762 O O   . MET B 1 242 ? 17.038  13.474  -45.465 1.00 45.19  ? 211  MET B O   1 
ATOM   5763 C CB  . MET B 1 242 ? 16.725  10.523  -44.166 1.00 45.08  ? 211  MET B CB  1 
ATOM   5764 C CG  . MET B 1 242 ? 17.670  9.946   -43.139 1.00 47.76  ? 211  MET B CG  1 
ATOM   5765 S SD  . MET B 1 242 ? 17.664  8.264   -43.225 1.00 56.09  ? 211  MET B SD  1 
ATOM   5766 C CE  . MET B 1 242 ? 17.700  7.797   -41.486 1.00 54.89  ? 211  MET B CE  1 
ATOM   5767 N N   . HIS B 1 243 ? 14.841  13.016  -45.335 1.00 43.89  ? 212  HIS B N   1 
ATOM   5768 C CA  . HIS B 1 243 ? 14.505  14.036  -46.317 1.00 44.56  ? 212  HIS B CA  1 
ATOM   5769 C C   . HIS B 1 243 ? 14.610  15.441  -45.748 1.00 45.52  ? 212  HIS B C   1 
ATOM   5770 O O   . HIS B 1 243 ? 14.906  16.364  -46.495 1.00 47.30  ? 212  HIS B O   1 
ATOM   5771 C CB  . HIS B 1 243 ? 13.123  13.791  -46.909 1.00 43.88  ? 212  HIS B CB  1 
ATOM   5772 C CG  . HIS B 1 243 ? 13.037  12.520  -47.689 1.00 43.19  ? 212  HIS B CG  1 
ATOM   5773 N ND1 . HIS B 1 243 ? 13.513  12.406  -48.974 1.00 41.43  ? 212  HIS B ND1 1 
ATOM   5774 C CD2 . HIS B 1 243 ? 12.579  11.296  -47.346 1.00 41.61  ? 212  HIS B CD2 1 
ATOM   5775 C CE1 . HIS B 1 243 ? 13.317  11.173  -49.399 1.00 43.34  ? 212  HIS B CE1 1 
ATOM   5776 N NE2 . HIS B 1 243 ? 12.757  10.478  -48.429 1.00 43.29  ? 212  HIS B NE2 1 
ATOM   5777 N N   . ILE B 1 244 ? 14.357  15.630  -44.457 1.00 45.68  ? 213  ILE B N   1 
ATOM   5778 C CA  . ILE B 1 244 ? 14.585  16.931  -43.828 1.00 46.45  ? 213  ILE B CA  1 
ATOM   5779 C C   . ILE B 1 244 ? 16.075  17.275  -43.880 1.00 47.01  ? 213  ILE B C   1 
ATOM   5780 O O   . ILE B 1 244 ? 16.451  18.397  -44.130 1.00 47.73  ? 213  ILE B O   1 
ATOM   5781 C CB  . ILE B 1 244 ? 14.091  16.926  -42.347 1.00 46.21  ? 213  ILE B CB  1 
ATOM   5782 C CG1 . ILE B 1 244 ? 12.564  16.929  -42.293 1.00 46.85  ? 213  ILE B CG1 1 
ATOM   5783 C CG2 . ILE B 1 244 ? 14.661  18.128  -41.560 1.00 45.87  ? 213  ILE B CG2 1 
ATOM   5784 C CD1 . ILE B 1 244 ? 11.970  16.342  -40.994 1.00 45.81  ? 213  ILE B CD1 1 
ATOM   5785 N N   . LEU B 1 245 ? 16.909  16.279  -43.654 1.00 47.53  ? 214  LEU B N   1 
ATOM   5786 C CA  . LEU B 1 245 ? 18.358  16.471  -43.550 1.00 48.25  ? 214  LEU B CA  1 
ATOM   5787 C C   . LEU B 1 245 ? 19.131  16.390  -44.872 1.00 49.28  ? 214  LEU B C   1 
ATOM   5788 O O   . LEU B 1 245 ? 20.337  16.592  -44.870 1.00 50.18  ? 214  LEU B O   1 
ATOM   5789 C CB  . LEU B 1 245 ? 18.923  15.441  -42.583 1.00 47.88  ? 214  LEU B CB  1 
ATOM   5790 C CG  . LEU B 1 245 ? 18.320  15.482  -41.171 1.00 47.70  ? 214  LEU B CG  1 
ATOM   5791 C CD1 . LEU B 1 245 ? 18.977  14.431  -40.280 1.00 48.63  ? 214  LEU B CD1 1 
ATOM   5792 C CD2 . LEU B 1 245 ? 18.465  16.852  -40.541 1.00 48.45  ? 214  LEU B CD2 1 
ATOM   5793 N N   . SER B 1 246 ? 18.448  16.160  -45.995 1.00 49.80  ? 215  SER B N   1 
ATOM   5794 C CA  . SER B 1 246 ? 19.103  16.060  -47.302 1.00 50.80  ? 215  SER B CA  1 
ATOM   5795 C C   . SER B 1 246 ? 18.590  17.129  -48.251 1.00 52.11  ? 215  SER B C   1 
ATOM   5796 O O   . SER B 1 246 ? 17.442  17.101  -48.648 1.00 51.86  ? 215  SER B O   1 
ATOM   5797 C CB  . SER B 1 246 ? 18.862  14.672  -47.913 1.00 50.82  ? 215  SER B CB  1 
ATOM   5798 O OG  . SER B 1 246 ? 19.661  14.458  -49.062 1.00 48.99  ? 215  SER B OG  1 
ATOM   5799 N N   . LEU B 1 247 ? 19.458  18.052  -48.645 1.00 54.15  ? 216  LEU B N   1 
ATOM   5800 C CA  . LEU B 1 247 ? 19.048  19.246  -49.381 1.00 55.54  ? 216  LEU B CA  1 
ATOM   5801 C C   . LEU B 1 247 ? 18.214  19.015  -50.654 1.00 55.07  ? 216  LEU B C   1 
ATOM   5802 O O   . LEU B 1 247 ? 17.218  19.727  -50.855 1.00 55.59  ? 216  LEU B O   1 
ATOM   5803 C CB  . LEU B 1 247 ? 20.258  20.134  -49.717 1.00 57.58  ? 216  LEU B CB  1 
ATOM   5804 C CG  . LEU B 1 247 ? 19.939  21.630  -49.922 1.00 61.45  ? 216  LEU B CG  1 
ATOM   5805 C CD1 . LEU B 1 247 ? 19.546  22.283  -48.579 1.00 63.22  ? 216  LEU B CD1 1 
ATOM   5806 C CD2 . LEU B 1 247 ? 21.130  22.401  -50.595 1.00 64.38  ? 216  LEU B CD2 1 
ATOM   5807 N N   . PRO B 1 248 ? 18.611  18.097  -51.544 1.00 54.51  ? 217  PRO B N   1 
ATOM   5808 C CA  . PRO B 1 248 ? 17.800  17.848  -52.748 1.00 54.27  ? 217  PRO B CA  1 
ATOM   5809 C C   . PRO B 1 248 ? 16.358  17.401  -52.459 1.00 53.40  ? 217  PRO B C   1 
ATOM   5810 O O   . PRO B 1 248 ? 15.524  17.643  -53.312 1.00 54.56  ? 217  PRO B O   1 
ATOM   5811 C CB  . PRO B 1 248 ? 18.593  16.773  -53.510 1.00 54.78  ? 217  PRO B CB  1 
ATOM   5812 C CG  . PRO B 1 248 ? 20.024  16.891  -52.965 1.00 54.83  ? 217  PRO B CG  1 
ATOM   5813 C CD  . PRO B 1 248 ? 19.836  17.271  -51.530 1.00 54.63  ? 217  PRO B CD  1 
ATOM   5814 N N   . SER B 1 249 ? 16.049  16.817  -51.297 1.00 52.35  ? 218  SER B N   1 
ATOM   5815 C CA  . SER B 1 249 ? 14.657  16.465  -50.951 1.00 50.84  ? 218  SER B CA  1 
ATOM   5816 C C   . SER B 1 249 ? 13.821  17.674  -50.490 1.00 51.63  ? 218  SER B C   1 
ATOM   5817 O O   . SER B 1 249 ? 12.591  17.639  -50.581 1.00 50.25  ? 218  SER B O   1 
ATOM   5818 C CB  . SER B 1 249 ? 14.609  15.376  -49.866 1.00 50.01  ? 218  SER B CB  1 
ATOM   5819 O OG  . SER B 1 249 ? 15.053  14.087  -50.294 1.00 47.02  ? 218  SER B OG  1 
ATOM   5820 N N   . ARG B 1 250 ? 14.491  18.733  -50.023 1.00 52.78  ? 219  ARG B N   1 
ATOM   5821 C CA  . ARG B 1 250 ? 13.840  19.854  -49.330 1.00 53.51  ? 219  ARG B CA  1 
ATOM   5822 C C   . ARG B 1 250 ? 12.931  20.729  -50.179 1.00 54.17  ? 219  ARG B C   1 
ATOM   5823 O O   . ARG B 1 250 ? 11.998  21.329  -49.657 1.00 55.18  ? 219  ARG B O   1 
ATOM   5824 C CB  . ARG B 1 250 ? 14.874  20.743  -48.611 1.00 54.65  ? 219  ARG B CB  1 
ATOM   5825 C CG  . ARG B 1 250 ? 15.375  20.146  -47.269 1.00 55.05  ? 219  ARG B CG  1 
ATOM   5826 C CD  . ARG B 1 250 ? 14.272  19.940  -46.214 1.00 55.67  ? 219  ARG B CD  1 
ATOM   5827 N NE  . ARG B 1 250 ? 13.912  21.199  -45.575 1.00 58.32  ? 219  ARG B NE  1 
ATOM   5828 C CZ  . ARG B 1 250 ? 14.639  21.781  -44.626 1.00 61.27  ? 219  ARG B CZ  1 
ATOM   5829 N NH1 . ARG B 1 250 ? 15.761  21.215  -44.187 1.00 61.35  ? 219  ARG B NH1 1 
ATOM   5830 N NH2 . ARG B 1 250 ? 14.246  22.937  -44.109 1.00 63.31  ? 219  ARG B NH2 1 
ATOM   5831 N N   . SER B 1 251 ? 13.181  20.797  -51.477 1.00 54.35  ? 220  SER B N   1 
ATOM   5832 C CA  . SER B 1 251 ? 12.300  21.523  -52.376 1.00 54.64  ? 220  SER B CA  1 
ATOM   5833 C C   . SER B 1 251 ? 11.058  20.718  -52.788 1.00 53.42  ? 220  SER B C   1 
ATOM   5834 O O   . SER B 1 251 ? 10.228  21.213  -53.548 1.00 54.36  ? 220  SER B O   1 
ATOM   5835 C CB  . SER B 1 251 ? 13.076  21.952  -53.624 1.00 55.76  ? 220  SER B CB  1 
ATOM   5836 O OG  . SER B 1 251 ? 13.702  20.832  -54.221 1.00 57.62  ? 220  SER B OG  1 
ATOM   5837 N N   . LEU B 1 252 ? 10.926  19.482  -52.296 1.00 51.28  ? 221  LEU B N   1 
ATOM   5838 C CA  . LEU B 1 252 ? 9.841   18.596  -52.702 1.00 49.37  ? 221  LEU B CA  1 
ATOM   5839 C C   . LEU B 1 252 ? 8.752   18.481  -51.653 1.00 48.19  ? 221  LEU B C   1 
ATOM   5840 O O   . LEU B 1 252 ? 7.775   17.773  -51.861 1.00 47.99  ? 221  LEU B O   1 
ATOM   5841 C CB  . LEU B 1 252 ? 10.391  17.200  -53.016 1.00 49.09  ? 221  LEU B CB  1 
ATOM   5842 C CG  . LEU B 1 252 ? 11.625  17.153  -53.935 1.00 49.04  ? 221  LEU B CG  1 
ATOM   5843 C CD1 . LEU B 1 252 ? 12.079  15.736  -54.163 1.00 48.12  ? 221  LEU B CD1 1 
ATOM   5844 C CD2 . LEU B 1 252 ? 11.373  17.826  -55.271 1.00 49.73  ? 221  LEU B CD2 1 
ATOM   5845 N N   . PHE B 1 253 ? 8.921   19.146  -50.515 1.00 47.55  ? 222  PHE B N   1 
ATOM   5846 C CA  . PHE B 1 253 ? 7.870   19.188  -49.496 1.00 47.17  ? 222  PHE B CA  1 
ATOM   5847 C C   . PHE B 1 253 ? 7.999   20.406  -48.596 1.00 48.01  ? 222  PHE B C   1 
ATOM   5848 O O   . PHE B 1 253 ? 9.022   21.074  -48.582 1.00 47.95  ? 222  PHE B O   1 
ATOM   5849 C CB  . PHE B 1 253 ? 7.860   17.897  -48.651 1.00 46.55  ? 222  PHE B CB  1 
ATOM   5850 C CG  . PHE B 1 253 ? 9.078   17.711  -47.798 1.00 44.56  ? 222  PHE B CG  1 
ATOM   5851 C CD1 . PHE B 1 253 ? 10.287  17.330  -48.364 1.00 43.80  ? 222  PHE B CD1 1 
ATOM   5852 C CD2 . PHE B 1 253 ? 9.018   17.933  -46.420 1.00 44.13  ? 222  PHE B CD2 1 
ATOM   5853 C CE1 . PHE B 1 253 ? 11.417  17.169  -47.571 1.00 44.70  ? 222  PHE B CE1 1 
ATOM   5854 C CE2 . PHE B 1 253 ? 10.148  17.779  -45.620 1.00 44.02  ? 222  PHE B CE2 1 
ATOM   5855 C CZ  . PHE B 1 253 ? 11.352  17.386  -46.198 1.00 43.37  ? 222  PHE B CZ  1 
ATOM   5856 N N   . HIS B 1 254 ? 6.946   20.685  -47.842 1.00 48.96  ? 223  HIS B N   1 
ATOM   5857 C CA  . HIS B 1 254 ? 6.880   21.896  -47.036 1.00 50.22  ? 223  HIS B CA  1 
ATOM   5858 C C   . HIS B 1 254 ? 6.751   21.613  -45.536 1.00 49.60  ? 223  HIS B C   1 
ATOM   5859 O O   . HIS B 1 254 ? 7.148   22.427  -44.757 1.00 49.84  ? 223  HIS B O   1 
ATOM   5860 C CB  . HIS B 1 254 ? 5.759   22.807  -47.575 1.00 51.10  ? 223  HIS B CB  1 
ATOM   5861 C CG  . HIS B 1 254 ? 5.749   22.884  -49.070 1.00 54.23  ? 223  HIS B CG  1 
ATOM   5862 N ND1 . HIS B 1 254 ? 6.572   23.739  -49.776 1.00 58.00  ? 223  HIS B ND1 1 
ATOM   5863 C CD2 . HIS B 1 254 ? 5.088   22.148  -50.001 1.00 54.42  ? 223  HIS B CD2 1 
ATOM   5864 C CE1 . HIS B 1 254 ? 6.397   23.544  -51.075 1.00 59.20  ? 223  HIS B CE1 1 
ATOM   5865 N NE2 . HIS B 1 254 ? 5.501   22.583  -51.236 1.00 57.49  ? 223  HIS B NE2 1 
ATOM   5866 N N   . ARG B 1 255 ? 6.219   20.452  -45.142 1.00 49.09  ? 224  ARG B N   1 
ATOM   5867 C CA  . ARG B 1 255 ? 6.003   20.112  -43.725 1.00 48.34  ? 224  ARG B CA  1 
ATOM   5868 C C   . ARG B 1 255 ? 6.250   18.634  -43.522 1.00 46.20  ? 224  ARG B C   1 
ATOM   5869 O O   . ARG B 1 255 ? 6.295   17.879  -44.477 1.00 46.20  ? 224  ARG B O   1 
ATOM   5870 C CB  . ARG B 1 255 ? 4.557   20.435  -43.316 1.00 48.92  ? 224  ARG B CB  1 
ATOM   5871 C CG  . ARG B 1 255 ? 4.312   21.892  -43.163 1.00 54.24  ? 224  ARG B CG  1 
ATOM   5872 C CD  . ARG B 1 255 ? 2.869   22.266  -42.926 1.00 57.40  ? 224  ARG B CD  1 
ATOM   5873 N NE  . ARG B 1 255 ? 2.197   22.400  -44.195 1.00 61.66  ? 224  ARG B NE  1 
ATOM   5874 C CZ  . ARG B 1 255 ? 2.389   23.396  -45.046 1.00 64.26  ? 224  ARG B CZ  1 
ATOM   5875 N NH1 . ARG B 1 255 ? 3.233   24.384  -44.774 1.00 64.15  ? 224  ARG B NH1 1 
ATOM   5876 N NH2 . ARG B 1 255 ? 1.742   23.376  -46.203 1.00 66.73  ? 224  ARG B NH2 1 
ATOM   5877 N N   . ALA B 1 256 ? 6.323   18.208  -42.271 1.00 44.38  ? 225  ALA B N   1 
ATOM   5878 C CA  . ALA B 1 256 ? 6.713   16.856  -41.970 1.00 42.52  ? 225  ALA B CA  1 
ATOM   5879 C C   . ALA B 1 256 ? 6.133   16.374  -40.659 1.00 41.74  ? 225  ALA B C   1 
ATOM   5880 O O   . ALA B 1 256 ? 6.005   17.131  -39.721 1.00 40.53  ? 225  ALA B O   1 
ATOM   5881 C CB  . ALA B 1 256 ? 8.226   16.761  -41.930 1.00 42.30  ? 225  ALA B CB  1 
ATOM   5882 N N   . VAL B 1 257 ? 5.828   15.080  -40.630 1.00 40.85  ? 226  VAL B N   1 
ATOM   5883 C CA  . VAL B 1 257 ? 5.324   14.360  -39.483 1.00 40.36  ? 226  VAL B CA  1 
ATOM   5884 C C   . VAL B 1 257 ? 6.126   13.076  -39.317 1.00 40.28  ? 226  VAL B C   1 
ATOM   5885 O O   . VAL B 1 257 ? 6.243   12.277  -40.244 1.00 39.63  ? 226  VAL B O   1 
ATOM   5886 C CB  . VAL B 1 257 ? 3.871   13.964  -39.692 1.00 39.90  ? 226  VAL B CB  1 
ATOM   5887 C CG1 . VAL B 1 257 ? 3.333   13.203  -38.513 1.00 38.66  ? 226  VAL B CG1 1 
ATOM   5888 C CG2 . VAL B 1 257 ? 3.034   15.205  -39.999 1.00 40.95  ? 226  VAL B CG2 1 
ATOM   5889 N N   . LEU B 1 258 ? 6.660   12.887  -38.115 1.00 40.48  ? 227  LEU B N   1 
ATOM   5890 C CA  . LEU B 1 258 ? 7.511   11.758  -37.790 1.00 40.26  ? 227  LEU B CA  1 
ATOM   5891 C C   . LEU B 1 258 ? 6.880   11.088  -36.610 1.00 40.28  ? 227  LEU B C   1 
ATOM   5892 O O   . LEU B 1 258 ? 6.951   11.605  -35.497 1.00 39.97  ? 227  LEU B O   1 
ATOM   5893 C CB  . LEU B 1 258 ? 8.897   12.217  -37.391 1.00 39.76  ? 227  LEU B CB  1 
ATOM   5894 C CG  . LEU B 1 258 ? 9.786   12.775  -38.495 1.00 40.58  ? 227  LEU B CG  1 
ATOM   5895 C CD1 . LEU B 1 258 ? 9.571   14.267  -38.718 1.00 41.38  ? 227  LEU B CD1 1 
ATOM   5896 C CD2 . LEU B 1 258 ? 11.250  12.543  -38.121 1.00 41.86  ? 227  LEU B CD2 1 
ATOM   5897 N N   . GLN B 1 259 ? 6.283   9.934   -36.857 1.00 40.12  ? 228  GLN B N   1 
ATOM   5898 C CA  . GLN B 1 259 ? 5.592   9.167   -35.839 1.00 40.65  ? 228  GLN B CA  1 
ATOM   5899 C C   . GLN B 1 259 ? 6.490   8.021   -35.381 1.00 41.02  ? 228  GLN B C   1 
ATOM   5900 O O   . GLN B 1 259 ? 6.809   7.121   -36.156 1.00 41.32  ? 228  GLN B O   1 
ATOM   5901 C CB  . GLN B 1 259 ? 4.281   8.599   -36.423 1.00 40.76  ? 228  GLN B CB  1 
ATOM   5902 C CG  . GLN B 1 259 ? 3.301   9.670   -36.985 1.00 40.93  ? 228  GLN B CG  1 
ATOM   5903 C CD  . GLN B 1 259 ? 2.064   9.080   -37.704 1.00 43.08  ? 228  GLN B CD  1 
ATOM   5904 O OE1 . GLN B 1 259 ? 1.518   9.729   -38.595 1.00 44.87  ? 228  GLN B OE1 1 
ATOM   5905 N NE2 . GLN B 1 259 ? 1.627   7.869   -37.314 1.00 38.92  ? 228  GLN B NE2 1 
ATOM   5906 N N   . SER B 1 260 ? 6.895   8.029   -34.120 1.00 41.08  ? 229  SER B N   1 
ATOM   5907 C CA  . SER B 1 260 ? 7.635   6.892   -33.546 1.00 41.44  ? 229  SER B CA  1 
ATOM   5908 C C   . SER B 1 260 ? 8.884   6.528   -34.354 1.00 41.42  ? 229  SER B C   1 
ATOM   5909 O O   . SER B 1 260 ? 9.196   5.362   -34.539 1.00 41.91  ? 229  SER B O   1 
ATOM   5910 C CB  . SER B 1 260 ? 6.735   5.653   -33.396 1.00 41.76  ? 229  SER B CB  1 
ATOM   5911 O OG  . SER B 1 260 ? 5.655   5.872   -32.499 1.00 40.68  ? 229  SER B OG  1 
ATOM   5912 N N   . GLY B 1 261 ? 9.607   7.527   -34.819 1.00 41.17  ? 230  GLY B N   1 
ATOM   5913 C CA  . GLY B 1 261 ? 10.834  7.272   -35.562 1.00 41.36  ? 230  GLY B CA  1 
ATOM   5914 C C   . GLY B 1 261 ? 11.612  8.538   -35.881 1.00 41.44  ? 230  GLY B C   1 
ATOM   5915 O O   . GLY B 1 261 ? 11.042  9.624   -36.028 1.00 41.32  ? 230  GLY B O   1 
ATOM   5916 N N   . THR B 1 262 ? 12.928  8.385   -35.992 1.00 41.83  ? 231  THR B N   1 
ATOM   5917 C CA  . THR B 1 262 ? 13.850  9.497   -36.210 1.00 42.37  ? 231  THR B CA  1 
ATOM   5918 C C   . THR B 1 262 ? 15.040  9.105   -37.054 1.00 41.93  ? 231  THR B C   1 
ATOM   5919 O O   . THR B 1 262 ? 15.448  7.978   -37.020 1.00 43.00  ? 231  THR B O   1 
ATOM   5920 C CB  . THR B 1 262 ? 14.440  9.975   -34.824 1.00 43.38  ? 231  THR B CB  1 
ATOM   5921 O OG1 . THR B 1 262 ? 15.045  8.859   -34.138 1.00 44.34  ? 231  THR B OG1 1 
ATOM   5922 C CG2 . THR B 1 262 ? 13.349  10.466  -33.905 1.00 43.43  ? 231  THR B CG2 1 
ATOM   5923 N N   . PRO B 1 263 ? 15.677  10.053  -37.719 1.00 42.25  ? 232  PRO B N   1 
ATOM   5924 C CA  . PRO B 1 263 ? 16.896  9.740   -38.466 1.00 42.87  ? 232  PRO B CA  1 
ATOM   5925 C C   . PRO B 1 263 ? 18.112  9.541   -37.534 1.00 44.18  ? 232  PRO B C   1 
ATOM   5926 O O   . PRO B 1 263 ? 19.006  8.789   -37.842 1.00 44.68  ? 232  PRO B O   1 
ATOM   5927 C CB  . PRO B 1 263 ? 17.067  10.952  -39.378 1.00 42.80  ? 232  PRO B CB  1 
ATOM   5928 C CG  . PRO B 1 263 ? 16.405  12.075  -38.661 1.00 43.01  ? 232  PRO B CG  1 
ATOM   5929 C CD  . PRO B 1 263 ? 15.310  11.484  -37.814 1.00 41.82  ? 232  PRO B CD  1 
ATOM   5930 N N   . ASN B 1 264 ? 18.128  10.250  -36.412 1.00 45.02  ? 233  ASN B N   1 
ATOM   5931 C CA  . ASN B 1 264 ? 19.125  10.069  -35.354 1.00 45.54  ? 233  ASN B CA  1 
ATOM   5932 C C   . ASN B 1 264 ? 18.760  8.821   -34.599 1.00 45.84  ? 233  ASN B C   1 
ATOM   5933 O O   . ASN B 1 264 ? 17.714  8.219   -34.859 1.00 46.15  ? 233  ASN B O   1 
ATOM   5934 C CB  . ASN B 1 264 ? 19.156  11.269  -34.377 1.00 45.41  ? 233  ASN B CB  1 
ATOM   5935 C CG  . ASN B 1 264 ? 17.748  11.664  -33.868 1.00 45.71  ? 233  ASN B CG  1 
ATOM   5936 O OD1 . ASN B 1 264 ? 16.901  12.094  -34.652 1.00 44.37  ? 233  ASN B OD1 1 
ATOM   5937 N ND2 . ASN B 1 264 ? 17.505  11.515  -32.564 1.00 45.65  ? 233  ASN B ND2 1 
ATOM   5938 N N   . GLY B 1 265 ? 19.610  8.429   -33.658 1.00 46.80  ? 234  GLY B N   1 
ATOM   5939 C CA  . GLY B 1 265 ? 19.364  7.224   -32.880 1.00 47.28  ? 234  GLY B CA  1 
ATOM   5940 C C   . GLY B 1 265 ? 20.091  6.000   -33.426 1.00 47.79  ? 234  GLY B C   1 
ATOM   5941 O O   . GLY B 1 265 ? 20.699  6.046   -34.498 1.00 48.06  ? 234  GLY B O   1 
ATOM   5942 N N   . PRO B 1 266 ? 19.982  4.890   -32.703 1.00 48.19  ? 235  PRO B N   1 
ATOM   5943 C CA  . PRO B 1 266 ? 20.907  3.757   -32.870 1.00 48.87  ? 235  PRO B CA  1 
ATOM   5944 C C   . PRO B 1 266 ? 20.641  2.806   -34.033 1.00 48.23  ? 235  PRO B C   1 
ATOM   5945 O O   . PRO B 1 266 ? 21.548  2.007   -34.342 1.00 48.91  ? 235  PRO B O   1 
ATOM   5946 C CB  . PRO B 1 266 ? 20.795  3.009   -31.538 1.00 49.70  ? 235  PRO B CB  1 
ATOM   5947 C CG  . PRO B 1 266 ? 19.446  3.426   -30.933 1.00 49.65  ? 235  PRO B CG  1 
ATOM   5948 C CD  . PRO B 1 266 ? 18.950  4.626   -31.683 1.00 48.48  ? 235  PRO B CD  1 
ATOM   5949 N N   . TRP B 1 267 ? 19.459  2.874   -34.663 1.00 46.58  ? 236  TRP B N   1 
ATOM   5950 C CA  . TRP B 1 267 ? 19.070  1.853   -35.652 1.00 45.70  ? 236  TRP B CA  1 
ATOM   5951 C C   . TRP B 1 267 ? 18.849  2.357   -37.070 1.00 45.44  ? 236  TRP B C   1 
ATOM   5952 O O   . TRP B 1 267 ? 18.851  1.558   -38.003 1.00 45.72  ? 236  TRP B O   1 
ATOM   5953 C CB  . TRP B 1 267 ? 17.838  1.124   -35.182 1.00 45.08  ? 236  TRP B CB  1 
ATOM   5954 C CG  . TRP B 1 267 ? 16.717  2.006   -34.964 1.00 44.81  ? 236  TRP B CG  1 
ATOM   5955 C CD1 . TRP B 1 267 ? 16.378  2.589   -33.799 1.00 45.72  ? 236  TRP B CD1 1 
ATOM   5956 C CD2 . TRP B 1 267 ? 15.768  2.446   -35.930 1.00 45.79  ? 236  TRP B CD2 1 
ATOM   5957 N NE1 . TRP B 1 267 ? 15.280  3.384   -33.967 1.00 44.68  ? 236  TRP B NE1 1 
ATOM   5958 C CE2 . TRP B 1 267 ? 14.866  3.300   -35.265 1.00 46.63  ? 236  TRP B CE2 1 
ATOM   5959 C CE3 . TRP B 1 267 ? 15.568  2.191   -37.299 1.00 47.44  ? 236  TRP B CE3 1 
ATOM   5960 C CZ2 . TRP B 1 267 ? 13.777  3.907   -35.913 1.00 46.28  ? 236  TRP B CZ2 1 
ATOM   5961 C CZ3 . TRP B 1 267 ? 14.508  2.805   -37.950 1.00 47.44  ? 236  TRP B CZ3 1 
ATOM   5962 C CH2 . TRP B 1 267 ? 13.618  3.654   -37.253 1.00 46.74  ? 236  TRP B CH2 1 
ATOM   5963 N N   . ALA B 1 268 ? 18.684  3.665   -37.256 1.00 45.00  ? 237  ALA B N   1 
ATOM   5964 C CA  . ALA B 1 268 ? 18.236  4.187   -38.547 1.00 44.53  ? 237  ALA B CA  1 
ATOM   5965 C C   . ALA B 1 268 ? 19.349  4.427   -39.543 1.00 44.91  ? 237  ALA B C   1 
ATOM   5966 O O   . ALA B 1 268 ? 19.058  4.568   -40.714 1.00 45.32  ? 237  ALA B O   1 
ATOM   5967 C CB  . ALA B 1 268 ? 17.385  5.470   -38.371 1.00 44.49  ? 237  ALA B CB  1 
ATOM   5968 N N   . THR B 1 269 ? 20.598  4.505   -39.105 1.00 45.51  ? 238  THR B N   1 
ATOM   5969 C CA  . THR B 1 269 ? 21.748  4.603   -40.019 1.00 46.31  ? 238  THR B CA  1 
ATOM   5970 C C   . THR B 1 269 ? 22.884  3.666   -39.638 1.00 47.66  ? 238  THR B C   1 
ATOM   5971 O O   . THR B 1 269 ? 22.968  3.203   -38.520 1.00 48.00  ? 238  THR B O   1 
ATOM   5972 C CB  . THR B 1 269 ? 22.348  6.018   -40.030 1.00 46.56  ? 238  THR B CB  1 
ATOM   5973 O OG1 . THR B 1 269 ? 22.729  6.396   -38.696 1.00 45.31  ? 238  THR B OG1 1 
ATOM   5974 C CG2 . THR B 1 269 ? 21.315  7.062   -40.466 1.00 46.43  ? 238  THR B CG2 1 
ATOM   5975 N N   . VAL B 1 270 ? 23.772  3.409   -40.588 1.00 48.43  ? 239  VAL B N   1 
ATOM   5976 C CA  . VAL B 1 270 ? 25.057  2.819   -40.290 1.00 49.66  ? 239  VAL B CA  1 
ATOM   5977 C C   . VAL B 1 270 ? 26.138  3.666   -40.926 1.00 50.69  ? 239  VAL B C   1 
ATOM   5978 O O   . VAL B 1 270 ? 25.880  4.443   -41.848 1.00 50.79  ? 239  VAL B O   1 
ATOM   5979 C CB  . VAL B 1 270 ? 25.160  1.369   -40.771 1.00 50.52  ? 239  VAL B CB  1 
ATOM   5980 C CG1 . VAL B 1 270 ? 24.193  0.489   -39.946 1.00 51.17  ? 239  VAL B CG1 1 
ATOM   5981 C CG2 . VAL B 1 270 ? 24.875  1.238   -42.288 1.00 49.67  ? 239  VAL B CG2 1 
ATOM   5982 N N   . SER B 1 271 ? 27.349  3.545   -40.415 1.00 51.80  ? 240  SER B N   1 
ATOM   5983 C CA  . SER B 1 271 ? 28.492  4.200   -41.049 1.00 53.21  ? 240  SER B CA  1 
ATOM   5984 C C   . SER B 1 271 ? 28.797  3.488   -42.366 1.00 53.94  ? 240  SER B C   1 
ATOM   5985 O O   . SER B 1 271 ? 28.302  2.387   -42.638 1.00 53.21  ? 240  SER B O   1 
ATOM   5986 C CB  . SER B 1 271 ? 29.715  4.104   -40.165 1.00 54.12  ? 240  SER B CB  1 
ATOM   5987 O OG  . SER B 1 271 ? 30.101  2.738   -40.133 1.00 55.53  ? 240  SER B OG  1 
ATOM   5988 N N   . ALA B 1 272 ? 29.644  4.120   -43.163 1.00 55.30  ? 241  ALA B N   1 
ATOM   5989 C CA  . ALA B 1 272 ? 30.039  3.567   -44.434 1.00 56.08  ? 241  ALA B CA  1 
ATOM   5990 C C   . ALA B 1 272 ? 30.837  2.298   -44.217 1.00 57.63  ? 241  ALA B C   1 
ATOM   5991 O O   . ALA B 1 272 ? 30.671  1.337   -44.963 1.00 57.94  ? 241  ALA B O   1 
ATOM   5992 C CB  . ALA B 1 272 ? 30.846  4.579   -45.230 1.00 57.14  ? 241  ALA B CB  1 
ATOM   5993 N N   . GLY B 1 273 ? 31.692  2.287   -43.192 1.00 58.71  ? 242  GLY B N   1 
ATOM   5994 C CA  . GLY B 1 273 ? 32.471  1.108   -42.857 1.00 59.76  ? 242  GLY B CA  1 
ATOM   5995 C C   . GLY B 1 273 ? 31.618  -0.087  -42.456 1.00 59.27  ? 242  GLY B C   1 
ATOM   5996 O O   . GLY B 1 273 ? 31.890  -1.206  -42.865 1.00 60.27  ? 242  GLY B O   1 
ATOM   5997 N N   . GLU B 1 274 ? 30.583  0.139   -41.663 1.00 57.95  ? 243  GLU B N   1 
ATOM   5998 C CA  . GLU B 1 274 ? 29.737  -0.964  -41.224 1.00 57.72  ? 243  GLU B CA  1 
ATOM   5999 C C   . GLU B 1 274 ? 28.833  -1.479  -42.348 1.00 57.04  ? 243  GLU B C   1 
ATOM   6000 O O   . GLU B 1 274 ? 28.536  -2.677  -42.400 1.00 57.32  ? 243  GLU B O   1 
ATOM   6001 C CB  . GLU B 1 274 ? 28.920  -0.583  -39.984 1.00 56.65  ? 243  GLU B CB  1 
ATOM   6002 C CG  . GLU B 1 274 ? 27.913  -1.639  -39.500 1.00 56.40  ? 243  GLU B CG  1 
ATOM   6003 C CD  . GLU B 1 274 ? 28.530  -2.902  -38.891 1.00 57.66  ? 243  GLU B CD  1 
ATOM   6004 O OE1 . GLU B 1 274 ? 27.717  -3.770  -38.471 1.00 53.69  ? 243  GLU B OE1 1 
ATOM   6005 O OE2 . GLU B 1 274 ? 29.794  -3.039  -38.820 1.00 58.88  ? 243  GLU B OE2 1 
ATOM   6006 N N   . ALA B 1 275 ? 28.412  -0.608  -43.258 1.00 56.20  ? 244  ALA B N   1 
ATOM   6007 C CA  . ALA B 1 275 ? 27.620  -1.081  -44.419 1.00 55.82  ? 244  ALA B CA  1 
ATOM   6008 C C   . ALA B 1 275 ? 28.501  -1.920  -45.351 1.00 56.83  ? 244  ALA B C   1 
ATOM   6009 O O   . ALA B 1 275 ? 28.107  -2.986  -45.808 1.00 56.77  ? 244  ALA B O   1 
ATOM   6010 C CB  . ALA B 1 275 ? 26.987  0.076   -45.189 1.00 54.67  ? 244  ALA B CB  1 
ATOM   6011 N N   . ARG B 1 276 ? 29.708  -1.442  -45.613 1.00 57.82  ? 245  ARG B N   1 
ATOM   6012 C CA  . ARG B 1 276 ? 30.657  -2.193  -46.429 1.00 59.26  ? 245  ARG B CA  1 
ATOM   6013 C C   . ARG B 1 276 ? 30.846  -3.589  -45.834 1.00 60.26  ? 245  ARG B C   1 
ATOM   6014 O O   . ARG B 1 276 ? 30.771  -4.577  -46.534 1.00 60.98  ? 245  ARG B O   1 
ATOM   6015 C CB  . ARG B 1 276 ? 32.000  -1.473  -46.498 1.00 60.21  ? 245  ARG B CB  1 
ATOM   6016 C CG  . ARG B 1 276 ? 33.039  -2.162  -47.383 1.00 61.58  ? 245  ARG B CG  1 
ATOM   6017 C CD  . ARG B 1 276 ? 34.192  -1.250  -47.758 1.00 62.62  ? 245  ARG B CD  1 
ATOM   6018 N NE  . ARG B 1 276 ? 33.879  -0.376  -48.880 1.00 62.13  ? 245  ARG B NE  1 
ATOM   6019 C CZ  . ARG B 1 276 ? 33.810  -0.771  -50.152 1.00 64.85  ? 245  ARG B CZ  1 
ATOM   6020 N NH1 . ARG B 1 276 ? 33.513  0.105   -51.108 1.00 65.61  ? 245  ARG B NH1 1 
ATOM   6021 N NH2 . ARG B 1 276 ? 34.018  -2.037  -50.485 1.00 64.78  ? 245  ARG B NH2 1 
ATOM   6022 N N   . ARG B 1 277 ? 31.057  -3.657  -44.529 1.00 60.51  ? 246  ARG B N   1 
ATOM   6023 C CA  . ARG B 1 277 ? 31.265  -4.920  -43.839 1.00 61.79  ? 246  ARG B CA  1 
ATOM   6024 C C   . ARG B 1 277 ? 30.060  -5.871  -44.007 1.00 60.85  ? 246  ARG B C   1 
ATOM   6025 O O   . ARG B 1 277 ? 30.232  -7.031  -44.348 1.00 61.38  ? 246  ARG B O   1 
ATOM   6026 C CB  . ARG B 1 277 ? 31.567  -4.588  -42.379 1.00 62.43  ? 246  ARG B CB  1 
ATOM   6027 C CG  . ARG B 1 277 ? 32.070  -5.687  -41.468 1.00 64.04  ? 246  ARG B CG  1 
ATOM   6028 C CD  . ARG B 1 277 ? 31.349  -5.674  -40.100 1.00 64.77  ? 246  ARG B CD  1 
ATOM   6029 N NE  . ARG B 1 277 ? 30.736  -6.973  -39.866 1.00 66.71  ? 246  ARG B NE  1 
ATOM   6030 C CZ  . ARG B 1 277 ? 29.503  -7.205  -39.435 1.00 66.69  ? 246  ARG B CZ  1 
ATOM   6031 N NH1 . ARG B 1 277 ? 28.681  -6.219  -39.139 1.00 62.64  ? 246  ARG B NH1 1 
ATOM   6032 N NH2 . ARG B 1 277 ? 29.101  -8.476  -39.292 1.00 69.99  ? 246  ARG B NH2 1 
ATOM   6033 N N   . ARG B 1 278 ? 28.841  -5.364  -43.826 1.00 59.21  ? 247  ARG B N   1 
ATOM   6034 C CA  . ARG B 1 278 ? 27.640  -6.192  -43.945 1.00 58.03  ? 247  ARG B CA  1 
ATOM   6035 C C   . ARG B 1 278 ? 27.402  -6.632  -45.381 1.00 58.14  ? 247  ARG B C   1 
ATOM   6036 O O   . ARG B 1 278 ? 26.911  -7.726  -45.629 1.00 58.59  ? 247  ARG B O   1 
ATOM   6037 C CB  . ARG B 1 278 ? 26.421  -5.425  -43.466 1.00 56.43  ? 247  ARG B CB  1 
ATOM   6038 C CG  . ARG B 1 278 ? 26.464  -5.086  -41.996 1.00 55.75  ? 247  ARG B CG  1 
ATOM   6039 C CD  . ARG B 1 278 ? 25.267  -4.301  -41.540 1.00 53.95  ? 247  ARG B CD  1 
ATOM   6040 N NE  . ARG B 1 278 ? 25.386  -3.869  -40.165 1.00 54.46  ? 247  ARG B NE  1 
ATOM   6041 C CZ  . ARG B 1 278 ? 24.393  -3.359  -39.452 1.00 53.23  ? 247  ARG B CZ  1 
ATOM   6042 N NH1 . ARG B 1 278 ? 23.162  -3.239  -39.964 1.00 51.83  ? 247  ARG B NH1 1 
ATOM   6043 N NH2 . ARG B 1 278 ? 24.623  -3.005  -38.199 1.00 51.25  ? 247  ARG B NH2 1 
ATOM   6044 N N   . ALA B 1 279 ? 27.721  -5.752  -46.325 1.00 57.78  ? 248  ALA B N   1 
ATOM   6045 C CA  . ALA B 1 279 ? 27.565  -6.043  -47.736 1.00 57.88  ? 248  ALA B CA  1 
ATOM   6046 C C   . ALA B 1 279 ? 28.526  -7.123  -48.154 1.00 59.42  ? 248  ALA B C   1 
ATOM   6047 O O   . ALA B 1 279 ? 28.148  -8.042  -48.870 1.00 59.51  ? 248  ALA B O   1 
ATOM   6048 C CB  . ALA B 1 279 ? 27.802  -4.798  -48.577 1.00 57.58  ? 248  ALA B CB  1 
ATOM   6049 N N   . THR B 1 280 ? 29.776  -7.026  -47.726 1.00 60.72  ? 249  THR B N   1 
ATOM   6050 C CA  . THR B 1 280 ? 30.719  -8.044  -48.153 1.00 62.83  ? 249  THR B CA  1 
ATOM   6051 C C   . THR B 1 280 ? 30.538  -9.354  -47.365 1.00 63.32  ? 249  THR B C   1 
ATOM   6052 O O   . THR B 1 280 ? 30.785  -10.427 -47.904 1.00 64.05  ? 249  THR B O   1 
ATOM   6053 C CB  . THR B 1 280 ? 32.218  -7.539  -48.322 1.00 64.48  ? 249  THR B CB  1 
ATOM   6054 O OG1 . THR B 1 280 ? 33.067  -8.143  -47.360 1.00 66.21  ? 249  THR B OG1 1 
ATOM   6055 C CG2 . THR B 1 280 ? 32.399  -6.036  -48.113 1.00 63.92  ? 249  THR B CG2 1 
ATOM   6056 N N   . LEU B 1 281 ? 29.999  -9.288  -46.152 1.00 63.16  ? 250  LEU B N   1 
ATOM   6057 C CA  . LEU B 1 281 ? 29.635  -10.515 -45.435 1.00 63.97  ? 250  LEU B CA  1 
ATOM   6058 C C   . LEU B 1 281 ? 28.480  -11.226 -46.133 1.00 63.73  ? 250  LEU B C   1 
ATOM   6059 O O   . LEU B 1 281 ? 28.531  -12.449 -46.340 1.00 64.71  ? 250  LEU B O   1 
ATOM   6060 C CB  . LEU B 1 281 ? 29.269  -10.234 -43.968 1.00 63.59  ? 250  LEU B CB  1 
ATOM   6061 C CG  . LEU B 1 281 ? 29.039  -11.484 -43.100 1.00 64.75  ? 250  LEU B CG  1 
ATOM   6062 C CD1 . LEU B 1 281 ? 30.218  -12.453 -43.228 1.00 67.39  ? 250  LEU B CD1 1 
ATOM   6063 C CD2 . LEU B 1 281 ? 28.803  -11.140 -41.645 1.00 63.81  ? 250  LEU B CD2 1 
ATOM   6064 N N   . LEU B 1 282 ? 27.439  -10.471 -46.492 1.00 62.29  ? 251  LEU B N   1 
ATOM   6065 C CA  . LEU B 1 282 ? 26.293  -11.072 -47.172 1.00 61.97  ? 251  LEU B CA  1 
ATOM   6066 C C   . LEU B 1 282 ? 26.702  -11.728 -48.483 1.00 62.90  ? 251  LEU B C   1 
ATOM   6067 O O   . LEU B 1 282 ? 26.244  -12.820 -48.819 1.00 63.51  ? 251  LEU B O   1 
ATOM   6068 C CB  . LEU B 1 282 ? 25.207  -10.051 -47.442 1.00 60.64  ? 251  LEU B CB  1 
ATOM   6069 C CG  . LEU B 1 282 ? 24.068  -10.738 -48.200 1.00 60.56  ? 251  LEU B CG  1 
ATOM   6070 C CD1 . LEU B 1 282 ? 22.984  -11.160 -47.248 1.00 60.28  ? 251  LEU B CD1 1 
ATOM   6071 C CD2 . LEU B 1 282 ? 23.590  -9.837  -49.294 1.00 61.03  ? 251  LEU B CD2 1 
ATOM   6072 N N   . ALA B 1 283 ? 27.547  -11.042 -49.238 1.00 63.67  ? 252  ALA B N   1 
ATOM   6073 C CA  . ALA B 1 283 ? 28.085  -11.590 -50.474 1.00 64.86  ? 252  ALA B CA  1 
ATOM   6074 C C   . ALA B 1 283 ? 28.808  -12.914 -50.193 1.00 66.91  ? 252  ALA B C   1 
ATOM   6075 O O   . ALA B 1 283 ? 28.526  -13.901 -50.833 1.00 67.27  ? 252  ALA B O   1 
ATOM   6076 C CB  . ALA B 1 283 ? 29.003  -10.603 -51.135 1.00 64.97  ? 252  ALA B CB  1 
ATOM   6077 N N   . ARG B 1 284 ? 29.678  -12.958 -49.198 1.00 68.58  ? 253  ARG B N   1 
ATOM   6078 C CA  . ARG B 1 284 ? 30.327  -14.222 -48.820 1.00 71.62  ? 253  ARG B CA  1 
ATOM   6079 C C   . ARG B 1 284 ? 29.286  -15.325 -48.559 1.00 71.67  ? 253  ARG B C   1 
ATOM   6080 O O   . ARG B 1 284 ? 29.446  -16.438 -49.033 1.00 73.02  ? 253  ARG B O   1 
ATOM   6081 C CB  . ARG B 1 284 ? 31.260  -14.030 -47.599 1.00 72.86  ? 253  ARG B CB  1 
ATOM   6082 C CG  . ARG B 1 284 ? 32.509  -14.918 -47.571 1.00 78.31  ? 253  ARG B CG  1 
ATOM   6083 C CD  . ARG B 1 284 ? 33.136  -15.133 -46.153 1.00 84.22  ? 253  ARG B CD  1 
ATOM   6084 N NE  . ARG B 1 284 ? 32.358  -16.075 -45.319 1.00 88.40  ? 253  ARG B NE  1 
ATOM   6085 C CZ  . ARG B 1 284 ? 32.054  -15.928 -44.007 1.00 90.40  ? 253  ARG B CZ  1 
ATOM   6086 N NH1 . ARG B 1 284 ? 32.467  -14.869 -43.293 1.00 90.64  ? 253  ARG B NH1 1 
ATOM   6087 N NH2 . ARG B 1 284 ? 31.320  -16.865 -43.400 1.00 90.37  ? 253  ARG B NH2 1 
ATOM   6088 N N   . LEU B 1 285 ? 28.196  -15.011 -47.861 1.00 70.68  ? 254  LEU B N   1 
ATOM   6089 C CA  . LEU B 1 285 ? 27.226  -16.037 -47.472 1.00 71.26  ? 254  LEU B CA  1 
ATOM   6090 C C   . LEU B 1 285 ? 26.488  -16.666 -48.642 1.00 71.94  ? 254  LEU B C   1 
ATOM   6091 O O   . LEU B 1 285 ? 26.045  -17.808 -48.542 1.00 72.29  ? 254  LEU B O   1 
ATOM   6092 C CB  . LEU B 1 285 ? 26.230  -15.472 -46.467 1.00 70.06  ? 254  LEU B CB  1 
ATOM   6093 C CG  . LEU B 1 285 ? 26.802  -15.154 -45.078 1.00 70.05  ? 254  LEU B CG  1 
ATOM   6094 C CD1 . LEU B 1 285 ? 25.742  -14.433 -44.245 1.00 68.53  ? 254  LEU B CD1 1 
ATOM   6095 C CD2 . LEU B 1 285 ? 27.278  -16.432 -44.375 1.00 70.21  ? 254  LEU B CD2 1 
ATOM   6096 N N   . VAL B 1 286 ? 26.368  -15.932 -49.747 1.00 72.34  ? 255  VAL B N   1 
ATOM   6097 C CA  . VAL B 1 286 ? 25.706  -16.451 -50.953 1.00 73.49  ? 255  VAL B CA  1 
ATOM   6098 C C   . VAL B 1 286 ? 26.691  -16.904 -52.043 1.00 75.98  ? 255  VAL B C   1 
ATOM   6099 O O   . VAL B 1 286 ? 26.283  -17.185 -53.152 1.00 76.69  ? 255  VAL B O   1 
ATOM   6100 C CB  . VAL B 1 286 ? 24.692  -15.430 -51.564 1.00 71.76  ? 255  VAL B CB  1 
ATOM   6101 C CG1 . VAL B 1 286 ? 23.549  -15.168 -50.599 1.00 70.55  ? 255  VAL B CG1 1 
ATOM   6102 C CG2 . VAL B 1 286 ? 25.372  -14.119 -51.971 1.00 71.73  ? 255  VAL B CG2 1 
ATOM   6103 N N   . GLY B 1 287 ? 27.978  -16.945 -51.739 1.00 78.33  ? 256  GLY B N   1 
ATOM   6104 C CA  . GLY B 1 287 ? 28.967  -17.471 -52.665 1.00 81.06  ? 256  GLY B CA  1 
ATOM   6105 C C   . GLY B 1 287 ? 29.646  -16.486 -53.612 1.00 81.90  ? 256  GLY B C   1 
ATOM   6106 O O   . GLY B 1 287 ? 30.131  -16.902 -54.642 1.00 83.62  ? 256  GLY B O   1 
ATOM   6107 N N   . CYS B 1 288 ? 29.736  -15.215 -53.247 1.00 82.08  ? 257  CYS B N   1 
ATOM   6108 C CA  . CYS B 1 288 ? 30.313  -14.155 -54.085 1.00 83.26  ? 257  CYS B CA  1 
ATOM   6109 C C   . CYS B 1 288 ? 31.509  -13.494 -53.383 1.00 85.30  ? 257  CYS B C   1 
ATOM   6110 O O   . CYS B 1 288 ? 31.383  -13.095 -52.226 1.00 85.17  ? 257  CYS B O   1 
ATOM   6111 C CB  . CYS B 1 288 ? 29.271  -13.043 -54.307 1.00 81.29  ? 257  CYS B CB  1 
ATOM   6112 S SG  . CYS B 1 288 ? 27.853  -13.468 -55.348 1.00 81.01  ? 257  CYS B SG  1 
ATOM   6113 N N   . PRO B 1 289 ? 32.631  -13.270 -54.067 1.00 88.08  ? 258  PRO B N   1 
ATOM   6114 C CA  . PRO B 1 289 ? 32.769  -13.401 -55.535 1.00 89.24  ? 258  PRO B CA  1 
ATOM   6115 C C   . PRO B 1 289 ? 33.060  -14.825 -56.093 1.00 90.87  ? 258  PRO B C   1 
ATOM   6116 O O   . PRO B 1 289 ? 33.386  -15.751 -55.351 1.00 91.44  ? 258  PRO B O   1 
ATOM   6117 C CB  . PRO B 1 289 ? 33.944  -12.436 -55.855 1.00 90.12  ? 258  PRO B CB  1 
ATOM   6118 C CG  . PRO B 1 289 ? 34.391  -11.824 -54.461 1.00 89.97  ? 258  PRO B CG  1 
ATOM   6119 C CD  . PRO B 1 289 ? 33.879  -12.798 -53.428 1.00 89.32  ? 258  PRO B CD  1 
ATOM   6120 N N   . ASN B 1 296 ? 37.508  -6.584  -56.056 1.00 91.65  ? 265  ASN B N   1 
ATOM   6121 C CA  . ASN B 1 296 ? 36.961  -5.236  -56.213 1.00 89.60  ? 265  ASN B CA  1 
ATOM   6122 C C   . ASN B 1 296 ? 35.411  -5.190  -56.238 1.00 86.30  ? 265  ASN B C   1 
ATOM   6123 O O   . ASN B 1 296 ? 34.740  -6.220  -56.372 1.00 85.57  ? 265  ASN B O   1 
ATOM   6124 C CB  . ASN B 1 296 ? 37.616  -4.489  -57.421 1.00 90.66  ? 265  ASN B CB  1 
ATOM   6125 C CG  . ASN B 1 296 ? 37.109  -4.951  -58.814 1.00 91.48  ? 265  ASN B CG  1 
ATOM   6126 O OD1 . ASN B 1 296 ? 36.056  -5.576  -58.952 1.00 89.96  ? 265  ASN B OD1 1 
ATOM   6127 N ND2 . ASN B 1 296 ? 37.880  -4.608  -59.859 1.00 94.48  ? 265  ASN B ND2 1 
ATOM   6128 N N   . ASP B 1 297 ? 34.863  -3.986  -56.096 1.00 83.20  ? 266  ASP B N   1 
ATOM   6129 C CA  . ASP B 1 297 ? 33.421  -3.798  -55.909 1.00 80.18  ? 266  ASP B CA  1 
ATOM   6130 C C   . ASP B 1 297 ? 32.579  -4.277  -57.084 1.00 78.75  ? 266  ASP B C   1 
ATOM   6131 O O   . ASP B 1 297 ? 31.554  -4.940  -56.905 1.00 77.42  ? 266  ASP B O   1 
ATOM   6132 C CB  . ASP B 1 297 ? 33.117  -2.313  -55.664 1.00 79.06  ? 266  ASP B CB  1 
ATOM   6133 C CG  . ASP B 1 297 ? 33.568  -1.840  -54.294 1.00 78.59  ? 266  ASP B CG  1 
ATOM   6134 O OD1 . ASP B 1 297 ? 33.819  -2.693  -53.412 1.00 76.21  ? 266  ASP B OD1 1 
ATOM   6135 O OD2 . ASP B 1 297 ? 33.679  -0.626  -54.014 1.00 77.75  ? 266  ASP B OD2 1 
ATOM   6136 N N   . THR B 1 298 ? 33.035  -3.917  -58.278 1.00 78.46  ? 267  THR B N   1 
ATOM   6137 C CA  . THR B 1 298 ? 32.366  -4.242  -59.534 1.00 77.55  ? 267  THR B CA  1 
ATOM   6138 C C   . THR B 1 298 ? 32.073  -5.740  -59.667 1.00 77.32  ? 267  THR B C   1 
ATOM   6139 O O   . THR B 1 298 ? 30.960  -6.141  -60.009 1.00 75.92  ? 267  THR B O   1 
ATOM   6140 C CB  . THR B 1 298 ? 33.253  -3.723  -60.718 1.00 79.04  ? 267  THR B CB  1 
ATOM   6141 O OG1 . THR B 1 298 ? 33.398  -2.300  -60.613 1.00 79.18  ? 267  THR B OG1 1 
ATOM   6142 C CG2 . THR B 1 298 ? 32.598  -3.925  -62.114 1.00 78.76  ? 267  THR B CG2 1 
ATOM   6143 N N   . GLU B 1 299 ? 33.083  -6.559  -59.386 1.00 78.59  ? 268  GLU B N   1 
ATOM   6144 C CA  . GLU B 1 299 ? 32.974  -8.015  -59.533 1.00 79.06  ? 268  GLU B CA  1 
ATOM   6145 C C   . GLU B 1 299 ? 31.983  -8.573  -58.491 1.00 76.48  ? 268  GLU B C   1 
ATOM   6146 O O   . GLU B 1 299 ? 31.154  -9.426  -58.792 1.00 75.52  ? 268  GLU B O   1 
ATOM   6147 C CB  . GLU B 1 299 ? 34.359  -8.698  -59.392 1.00 81.28  ? 268  GLU B CB  1 
ATOM   6148 C CG  . GLU B 1 299 ? 35.267  -8.675  -60.639 1.00 85.24  ? 268  GLU B CG  1 
ATOM   6149 C CD  . GLU B 1 299 ? 36.750  -9.072  -60.342 1.00 89.49  ? 268  GLU B CD  1 
ATOM   6150 O OE1 . GLU B 1 299 ? 37.272  -10.023 -60.969 1.00 91.67  ? 268  GLU B OE1 1 
ATOM   6151 O OE2 . GLU B 1 299 ? 37.420  -8.438  -59.485 1.00 89.94  ? 268  GLU B OE2 1 
ATOM   6152 N N   . LEU B 1 300 ? 32.079  -8.064  -57.269 1.00 74.64  ? 269  LEU B N   1 
ATOM   6153 C CA  . LEU B 1 300 ? 31.275  -8.548  -56.154 1.00 72.78  ? 269  LEU B CA  1 
ATOM   6154 C C   . LEU B 1 300 ? 29.785  -8.265  -56.381 1.00 69.94  ? 269  LEU B C   1 
ATOM   6155 O O   . LEU B 1 300 ? 28.923  -9.119  -56.138 1.00 68.81  ? 269  LEU B O   1 
ATOM   6156 C CB  . LEU B 1 300 ? 31.780  -7.888  -54.868 1.00 72.90  ? 269  LEU B CB  1 
ATOM   6157 C CG  . LEU B 1 300 ? 31.273  -8.394  -53.513 1.00 73.75  ? 269  LEU B CG  1 
ATOM   6158 C CD1 . LEU B 1 300 ? 32.371  -8.354  -52.444 1.00 74.63  ? 269  LEU B CD1 1 
ATOM   6159 C CD2 . LEU B 1 300 ? 30.085  -7.537  -53.074 1.00 72.94  ? 269  LEU B CD2 1 
ATOM   6160 N N   . ILE B 1 301 ? 29.496  -7.067  -56.873 1.00 67.95  ? 270  ILE B N   1 
ATOM   6161 C CA  . ILE B 1 301 ? 28.128  -6.646  -57.107 1.00 65.81  ? 270  ILE B CA  1 
ATOM   6162 C C   . ILE B 1 301 ? 27.552  -7.308  -58.353 1.00 65.60  ? 270  ILE B C   1 
ATOM   6163 O O   . ILE B 1 301 ? 26.353  -7.632  -58.392 1.00 64.93  ? 270  ILE B O   1 
ATOM   6164 C CB  . ILE B 1 301 ? 28.054  -5.122  -57.223 1.00 65.17  ? 270  ILE B CB  1 
ATOM   6165 C CG1 . ILE B 1 301 ? 28.500  -4.477  -55.910 1.00 65.88  ? 270  ILE B CG1 1 
ATOM   6166 C CG2 . ILE B 1 301 ? 26.630  -4.654  -57.573 1.00 63.08  ? 270  ILE B CG2 1 
ATOM   6167 C CD1 . ILE B 1 301 ? 29.067  -3.089  -56.106 1.00 67.13  ? 270  ILE B CD1 1 
ATOM   6168 N N   . ALA B 1 302 ? 28.379  -7.514  -59.372 1.00 65.85  ? 271  ALA B N   1 
ATOM   6169 C CA  . ALA B 1 302 ? 27.917  -8.230  -60.547 1.00 66.16  ? 271  ALA B CA  1 
ATOM   6170 C C   . ALA B 1 302 ? 27.483  -9.640  -60.162 1.00 66.27  ? 271  ALA B C   1 
ATOM   6171 O O   . ALA B 1 302 ? 26.504  -10.150 -60.681 1.00 66.21  ? 271  ALA B O   1 
ATOM   6172 C CB  . ALA B 1 302 ? 28.977  -8.274  -61.605 1.00 67.54  ? 271  ALA B CB  1 
ATOM   6173 N N   . CYS B 1 303 ? 28.193  -10.267 -59.236 1.00 66.90  ? 272  CYS B N   1 
ATOM   6174 C CA  . CYS B 1 303 ? 27.825  -11.617 -58.819 1.00 67.91  ? 272  CYS B CA  1 
ATOM   6175 C C   . CYS B 1 303 ? 26.551  -11.616 -57.971 1.00 65.47  ? 272  CYS B C   1 
ATOM   6176 O O   . CYS B 1 303 ? 25.707  -12.501 -58.120 1.00 65.12  ? 272  CYS B O   1 
ATOM   6177 C CB  . CYS B 1 303 ? 28.987  -12.355 -58.119 1.00 69.39  ? 272  CYS B CB  1 
ATOM   6178 S SG  . CYS B 1 303 ? 28.474  -13.915 -57.320 1.00 73.66  ? 272  CYS B SG  1 
ATOM   6179 N N   . LEU B 1 304 ? 26.416  -10.625 -57.093 1.00 64.03  ? 273  LEU B N   1 
ATOM   6180 C CA  . LEU B 1 304 ? 25.199  -10.458 -56.305 1.00 62.34  ? 273  LEU B CA  1 
ATOM   6181 C C   . LEU B 1 304 ? 23.991  -10.246 -57.214 1.00 61.23  ? 273  LEU B C   1 
ATOM   6182 O O   . LEU B 1 304 ? 22.915  -10.742 -56.927 1.00 60.28  ? 273  LEU B O   1 
ATOM   6183 C CB  . LEU B 1 304 ? 25.330  -9.289  -55.322 1.00 61.51  ? 273  LEU B CB  1 
ATOM   6184 C CG  . LEU B 1 304 ? 26.123  -9.558  -54.050 1.00 61.65  ? 273  LEU B CG  1 
ATOM   6185 C CD1 . LEU B 1 304 ? 26.214  -8.295  -53.223 1.00 60.06  ? 273  LEU B CD1 1 
ATOM   6186 C CD2 . LEU B 1 304 ? 25.521  -10.697 -53.224 1.00 62.28  ? 273  LEU B CD2 1 
ATOM   6187 N N   . ARG B 1 305 ? 24.188  -9.549  -58.327 1.00 61.24  ? 274  ARG B N   1 
ATOM   6188 C CA  . ARG B 1 305 ? 23.106  -9.295  -59.290 1.00 60.86  ? 274  ARG B CA  1 
ATOM   6189 C C   . ARG B 1 305 ? 22.612  -10.553 -60.003 1.00 61.09  ? 274  ARG B C   1 
ATOM   6190 O O   . ARG B 1 305 ? 21.461  -10.586 -60.446 1.00 60.48  ? 274  ARG B O   1 
ATOM   6191 C CB  . ARG B 1 305 ? 23.495  -8.205  -60.307 1.00 60.90  ? 274  ARG B CB  1 
ATOM   6192 C CG  . ARG B 1 305 ? 23.315  -6.795  -59.717 1.00 62.15  ? 274  ARG B CG  1 
ATOM   6193 C CD  . ARG B 1 305 ? 23.415  -5.649  -60.690 1.00 65.17  ? 274  ARG B CD  1 
ATOM   6194 N NE  . ARG B 1 305 ? 24.471  -5.904  -61.663 1.00 70.15  ? 274  ARG B NE  1 
ATOM   6195 C CZ  . ARG B 1 305 ? 25.532  -5.122  -61.870 1.00 74.47  ? 274  ARG B CZ  1 
ATOM   6196 N NH1 . ARG B 1 305 ? 25.704  -3.989  -61.175 1.00 75.47  ? 274  ARG B NH1 1 
ATOM   6197 N NH2 . ARG B 1 305 ? 26.434  -5.481  -62.789 1.00 76.33  ? 274  ARG B NH2 1 
ATOM   6198 N N   . THR B 1 306 ? 23.450  -11.590 -60.077 1.00 61.87  ? 275  THR B N   1 
ATOM   6199 C CA  . THR B 1 306 ? 23.013  -12.870 -60.631 1.00 62.48  ? 275  THR B CA  1 
ATOM   6200 C C   . THR B 1 306 ? 22.166  -13.683 -59.673 1.00 62.36  ? 275  THR B C   1 
ATOM   6201 O O   . THR B 1 306 ? 21.521  -14.619 -60.102 1.00 63.56  ? 275  THR B O   1 
ATOM   6202 C CB  . THR B 1 306 ? 24.207  -13.752 -61.083 1.00 64.23  ? 275  THR B CB  1 
ATOM   6203 O OG1 . THR B 1 306 ? 24.965  -14.174 -59.934 1.00 63.40  ? 275  THR B OG1 1 
ATOM   6204 C CG2 . THR B 1 306 ? 25.166  -12.966 -62.010 1.00 63.85  ? 275  THR B CG2 1 
ATOM   6205 N N   . ARG B 1 307 ? 22.177  -13.371 -58.386 1.00 61.89  ? 276  ARG B N   1 
ATOM   6206 C CA  . ARG B 1 307 ? 21.463  -14.209 -57.431 1.00 62.31  ? 276  ARG B CA  1 
ATOM   6207 C C   . ARG B 1 307 ? 19.952  -13.970 -57.420 1.00 61.02  ? 276  ARG B C   1 
ATOM   6208 O O   . ARG B 1 307 ? 19.518  -12.840 -57.387 1.00 60.42  ? 276  ARG B O   1 
ATOM   6209 C CB  . ARG B 1 307 ? 22.045  -13.998 -56.037 1.00 62.49  ? 276  ARG B CB  1 
ATOM   6210 C CG  . ARG B 1 307 ? 23.462  -14.532 -55.941 1.00 65.42  ? 276  ARG B CG  1 
ATOM   6211 C CD  . ARG B 1 307 ? 23.551  -16.047 -56.048 1.00 68.88  ? 276  ARG B CD  1 
ATOM   6212 N NE  . ARG B 1 307 ? 24.903  -16.461 -55.727 1.00 73.06  ? 276  ARG B NE  1 
ATOM   6213 C CZ  . ARG B 1 307 ? 25.839  -16.739 -56.615 1.00 75.50  ? 276  ARG B CZ  1 
ATOM   6214 N NH1 . ARG B 1 307 ? 25.587  -16.678 -57.917 1.00 77.35  ? 276  ARG B NH1 1 
ATOM   6215 N NH2 . ARG B 1 307 ? 27.046  -17.080 -56.195 1.00 77.07  ? 276  ARG B NH2 1 
ATOM   6216 N N   . PRO B 1 308 ? 19.149  -15.024 -57.433 1.00 60.81  ? 277  PRO B N   1 
ATOM   6217 C CA  . PRO B 1 308 ? 17.730  -14.865 -57.173 1.00 59.39  ? 277  PRO B CA  1 
ATOM   6218 C C   . PRO B 1 308 ? 17.476  -14.036 -55.923 1.00 58.28  ? 277  PRO B C   1 
ATOM   6219 O O   . PRO B 1 308 ? 18.209  -14.119 -54.943 1.00 58.28  ? 277  PRO B O   1 
ATOM   6220 C CB  . PRO B 1 308 ? 17.227  -16.295 -56.987 1.00 60.42  ? 277  PRO B CB  1 
ATOM   6221 C CG  . PRO B 1 308 ? 18.204  -17.159 -57.726 1.00 62.52  ? 277  PRO B CG  1 
ATOM   6222 C CD  . PRO B 1 308 ? 19.512  -16.423 -57.717 1.00 62.28  ? 277  PRO B CD  1 
ATOM   6223 N N   . ALA B 1 309 ? 16.424  -13.230 -55.984 1.00 57.00  ? 278  ALA B N   1 
ATOM   6224 C CA  . ALA B 1 309 ? 16.023  -12.372 -54.893 1.00 56.14  ? 278  ALA B CA  1 
ATOM   6225 C C   . ALA B 1 309 ? 15.940  -13.093 -53.551 1.00 56.50  ? 278  ALA B C   1 
ATOM   6226 O O   . ALA B 1 309 ? 16.401  -12.577 -52.546 1.00 55.94  ? 278  ALA B O   1 
ATOM   6227 C CB  . ALA B 1 309 ? 14.673  -11.692 -55.230 1.00 54.79  ? 278  ALA B CB  1 
ATOM   6228 N N   . GLN B 1 310 ? 15.341  -14.278 -53.524 1.00 57.88  ? 279  GLN B N   1 
ATOM   6229 C CA  . GLN B 1 310 ? 15.085  -14.947 -52.242 1.00 58.51  ? 279  GLN B CA  1 
ATOM   6230 C C   . GLN B 1 310 ? 16.379  -15.386 -51.606 1.00 59.89  ? 279  GLN B C   1 
ATOM   6231 O O   . GLN B 1 310 ? 16.431  -15.480 -50.394 1.00 60.54  ? 279  GLN B O   1 
ATOM   6232 C CB  . GLN B 1 310 ? 14.162  -16.171 -52.348 1.00 59.32  ? 279  GLN B CB  1 
ATOM   6233 C CG  . GLN B 1 310 ? 13.793  -16.803 -50.988 1.00 59.00  ? 279  GLN B CG  1 
ATOM   6234 C CD  . GLN B 1 310 ? 13.084  -15.837 -50.037 1.00 58.11  ? 279  GLN B CD  1 
ATOM   6235 O OE1 . GLN B 1 310 ? 12.246  -15.062 -50.455 1.00 58.12  ? 279  GLN B OE1 1 
ATOM   6236 N NE2 . GLN B 1 310 ? 13.419  -15.895 -48.765 1.00 59.51  ? 279  GLN B NE2 1 
ATOM   6237 N N   . ASP B 1 311 ? 17.409  -15.689 -52.405 1.00 61.02  ? 280  ASP B N   1 
ATOM   6238 C CA  . ASP B 1 311 ? 18.734  -16.020 -51.839 1.00 62.38  ? 280  ASP B CA  1 
ATOM   6239 C C   . ASP B 1 311 ? 19.325  -14.880 -51.013 1.00 61.44  ? 280  ASP B C   1 
ATOM   6240 O O   . ASP B 1 311 ? 19.973  -15.128 -49.994 1.00 62.01  ? 280  ASP B O   1 
ATOM   6241 C CB  . ASP B 1 311 ? 19.769  -16.383 -52.915 1.00 63.97  ? 280  ASP B CB  1 
ATOM   6242 C CG  . ASP B 1 311 ? 19.434  -17.656 -53.670 1.00 66.44  ? 280  ASP B CG  1 
ATOM   6243 O OD1 . ASP B 1 311 ? 18.380  -18.293 -53.397 1.00 70.54  ? 280  ASP B OD1 1 
ATOM   6244 O OD2 . ASP B 1 311 ? 20.175  -18.076 -54.582 1.00 69.90  ? 280  ASP B OD2 1 
ATOM   6245 N N   . LEU B 1 312 ? 19.104  -13.639 -51.453 1.00 60.09  ? 281  LEU B N   1 
ATOM   6246 C CA  . LEU B 1 312 ? 19.554  -12.472 -50.720 1.00 58.94  ? 281  LEU B CA  1 
ATOM   6247 C C   . LEU B 1 312 ? 18.793  -12.329 -49.390 1.00 58.40  ? 281  LEU B C   1 
ATOM   6248 O O   . LEU B 1 312 ? 19.407  -12.118 -48.345 1.00 58.58  ? 281  LEU B O   1 
ATOM   6249 C CB  . LEU B 1 312 ? 19.409  -11.241 -51.622 1.00 58.17  ? 281  LEU B CB  1 
ATOM   6250 C CG  . LEU B 1 312 ? 20.640  -10.766 -52.419 1.00 58.49  ? 281  LEU B CG  1 
ATOM   6251 C CD1 . LEU B 1 312 ? 21.550  -11.880 -52.887 1.00 59.61  ? 281  LEU B CD1 1 
ATOM   6252 C CD2 . LEU B 1 312 ? 20.202  -9.911  -53.574 1.00 57.00  ? 281  LEU B CD2 1 
ATOM   6253 N N   . VAL B 1 313 ? 17.470  -12.480 -49.431 1.00 57.96  ? 282  VAL B N   1 
ATOM   6254 C CA  . VAL B 1 313 ? 16.629  -12.418 -48.240 1.00 57.55  ? 282  VAL B CA  1 
ATOM   6255 C C   . VAL B 1 313 ? 16.988  -13.522 -47.201 1.00 59.11  ? 282  VAL B C   1 
ATOM   6256 O O   . VAL B 1 313 ? 17.033  -13.268 -46.003 1.00 58.36  ? 282  VAL B O   1 
ATOM   6257 C CB  . VAL B 1 313 ? 15.147  -12.474 -48.640 1.00 57.14  ? 282  VAL B CB  1 
ATOM   6258 C CG1 . VAL B 1 313 ? 14.240  -12.786 -47.454 1.00 56.93  ? 282  VAL B CG1 1 
ATOM   6259 C CG2 . VAL B 1 313 ? 14.745  -11.155 -49.293 1.00 56.10  ? 282  VAL B CG2 1 
ATOM   6260 N N   . ASP B 1 314 ? 17.252  -14.736 -47.668 1.00 60.94  ? 283  ASP B N   1 
ATOM   6261 C CA  . ASP B 1 314 ? 17.648  -15.880 -46.806 1.00 62.86  ? 283  ASP B CA  1 
ATOM   6262 C C   . ASP B 1 314 ? 18.845  -15.649 -45.876 1.00 63.47  ? 283  ASP B C   1 
ATOM   6263 O O   . ASP B 1 314 ? 18.986  -16.332 -44.852 1.00 64.17  ? 283  ASP B O   1 
ATOM   6264 C CB  . ASP B 1 314 ? 18.118  -17.063 -47.669 1.00 64.28  ? 283  ASP B CB  1 
ATOM   6265 C CG  . ASP B 1 314 ? 16.998  -17.893 -48.216 1.00 65.68  ? 283  ASP B CG  1 
ATOM   6266 O OD1 . ASP B 1 314 ? 15.796  -17.648 -47.912 1.00 65.13  ? 283  ASP B OD1 1 
ATOM   6267 O OD2 . ASP B 1 314 ? 17.272  -18.846 -48.977 1.00 68.64  ? 283  ASP B OD2 1 
ATOM   6268 N N   . HIS B 1 315 ? 19.748  -14.760 -46.281 1.00 63.41  ? 284  HIS B N   1 
ATOM   6269 C CA  . HIS B 1 315 ? 20.973  -14.507 -45.523 1.00 64.19  ? 284  HIS B CA  1 
ATOM   6270 C C   . HIS B 1 315 ? 21.049  -13.085 -44.948 1.00 62.93  ? 284  HIS B C   1 
ATOM   6271 O O   . HIS B 1 315 ? 22.016  -12.743 -44.252 1.00 62.57  ? 284  HIS B O   1 
ATOM   6272 C CB  . HIS B 1 315 ? 22.212  -14.799 -46.392 1.00 65.45  ? 284  HIS B CB  1 
ATOM   6273 C CG  . HIS B 1 315 ? 22.555  -16.264 -46.498 1.00 69.99  ? 284  HIS B CG  1 
ATOM   6274 N ND1 . HIS B 1 315 ? 22.648  -17.099 -45.396 1.00 73.15  ? 284  HIS B ND1 1 
ATOM   6275 C CD2 . HIS B 1 315 ? 22.851  -17.034 -47.576 1.00 71.24  ? 284  HIS B CD2 1 
ATOM   6276 C CE1 . HIS B 1 315 ? 22.969  -18.317 -45.797 1.00 74.86  ? 284  HIS B CE1 1 
ATOM   6277 N NE2 . HIS B 1 315 ? 23.103  -18.302 -47.114 1.00 73.86  ? 284  HIS B NE2 1 
ATOM   6278 N N   . GLU B 1 316 ? 20.028  -12.280 -45.231 1.00 61.99  ? 285  GLU B N   1 
ATOM   6279 C CA  . GLU B 1 316 ? 19.916  -10.896 -44.763 1.00 61.38  ? 285  GLU B CA  1 
ATOM   6280 C C   . GLU B 1 316 ? 20.167  -10.751 -43.258 1.00 61.75  ? 285  GLU B C   1 
ATOM   6281 O O   . GLU B 1 316 ? 20.914  -9.881  -42.798 1.00 60.54  ? 285  GLU B O   1 
ATOM   6282 C CB  . GLU B 1 316 ? 18.487  -10.411 -45.078 1.00 60.33  ? 285  GLU B CB  1 
ATOM   6283 C CG  . GLU B 1 316 ? 18.300  -8.918  -45.048 1.00 60.60  ? 285  GLU B CG  1 
ATOM   6284 C CD  . GLU B 1 316 ? 16.869  -8.492  -45.304 1.00 60.85  ? 285  GLU B CD  1 
ATOM   6285 O OE1 . GLU B 1 316 ? 16.211  -9.090  -46.188 1.00 59.47  ? 285  GLU B OE1 1 
ATOM   6286 O OE2 . GLU B 1 316 ? 16.430  -7.543  -44.606 1.00 61.82  ? 285  GLU B OE2 1 
ATOM   6287 N N   . TRP B 1 317 ? 19.501  -11.609 -42.502 1.00 63.05  ? 286  TRP B N   1 
ATOM   6288 C CA  . TRP B 1 317 ? 19.507  -11.533 -41.058 1.00 64.28  ? 286  TRP B CA  1 
ATOM   6289 C C   . TRP B 1 317 ? 20.789  -12.034 -40.448 1.00 65.48  ? 286  TRP B C   1 
ATOM   6290 O O   . TRP B 1 317 ? 21.057  -11.759 -39.299 1.00 66.35  ? 286  TRP B O   1 
ATOM   6291 C CB  . TRP B 1 317 ? 18.306  -12.290 -40.492 1.00 64.72  ? 286  TRP B CB  1 
ATOM   6292 C CG  . TRP B 1 317 ? 17.037  -11.493 -40.718 1.00 68.59  ? 286  TRP B CG  1 
ATOM   6293 C CD1 . TRP B 1 317 ? 15.962  -11.804 -41.546 1.00 70.80  ? 286  TRP B CD1 1 
ATOM   6294 C CD2 . TRP B 1 317 ? 16.730  -10.218 -40.140 1.00 71.18  ? 286  TRP B CD2 1 
ATOM   6295 N NE1 . TRP B 1 317 ? 15.025  -10.798 -41.492 1.00 69.93  ? 286  TRP B NE1 1 
ATOM   6296 C CE2 . TRP B 1 317 ? 15.467  -9.814  -40.647 1.00 70.31  ? 286  TRP B CE2 1 
ATOM   6297 C CE3 . TRP B 1 317 ? 17.405  -9.366  -39.240 1.00 72.21  ? 286  TRP B CE3 1 
ATOM   6298 C CZ2 . TRP B 1 317 ? 14.863  -8.614  -40.277 1.00 71.46  ? 286  TRP B CZ2 1 
ATOM   6299 C CZ3 . TRP B 1 317 ? 16.805  -8.160  -38.876 1.00 72.34  ? 286  TRP B CZ3 1 
ATOM   6300 C CH2 . TRP B 1 317 ? 15.543  -7.799  -39.395 1.00 72.14  ? 286  TRP B CH2 1 
ATOM   6301 N N   . HIS B 1 318 ? 21.599  -12.755 -41.198 1.00 66.93  ? 287  HIS B N   1 
ATOM   6302 C CA  . HIS B 1 318 ? 22.831  -13.294 -40.622 1.00 68.59  ? 287  HIS B CA  1 
ATOM   6303 C C   . HIS B 1 318 ? 24.014  -12.312 -40.608 1.00 67.87  ? 287  HIS B C   1 
ATOM   6304 O O   . HIS B 1 318 ? 25.110  -12.729 -40.291 1.00 68.89  ? 287  HIS B O   1 
ATOM   6305 C CB  . HIS B 1 318 ? 23.242  -14.614 -41.303 1.00 70.06  ? 287  HIS B CB  1 
ATOM   6306 C CG  . HIS B 1 318 ? 22.159  -15.650 -41.312 1.00 73.17  ? 287  HIS B CG  1 
ATOM   6307 N ND1 . HIS B 1 318 ? 22.022  -16.579 -42.325 1.00 76.95  ? 287  HIS B ND1 1 
ATOM   6308 C CD2 . HIS B 1 318 ? 21.145  -15.888 -40.444 1.00 75.17  ? 287  HIS B CD2 1 
ATOM   6309 C CE1 . HIS B 1 318 ? 20.974  -17.349 -42.075 1.00 78.05  ? 287  HIS B CE1 1 
ATOM   6310 N NE2 . HIS B 1 318 ? 20.422  -16.948 -40.942 1.00 77.45  ? 287  HIS B NE2 1 
ATOM   6311 N N   . VAL B 1 319 ? 23.838  -11.031 -40.953 1.00 66.13  ? 288  VAL B N   1 
ATOM   6312 C CA  . VAL B 1 319 ? 25.011  -10.127 -40.988 1.00 66.00  ? 288  VAL B CA  1 
ATOM   6313 C C   . VAL B 1 319 ? 25.075  -9.134  -39.838 1.00 65.69  ? 288  VAL B C   1 
ATOM   6314 O O   . VAL B 1 319 ? 25.984  -8.302  -39.788 1.00 65.09  ? 288  VAL B O   1 
ATOM   6315 C CB  . VAL B 1 319 ? 25.167  -9.310  -42.318 1.00 65.22  ? 288  VAL B CB  1 
ATOM   6316 C CG1 . VAL B 1 319 ? 25.221  -10.217 -43.535 1.00 66.08  ? 288  VAL B CG1 1 
ATOM   6317 C CG2 . VAL B 1 319 ? 24.089  -8.252  -42.466 1.00 63.38  ? 288  VAL B CG2 1 
ATOM   6318 N N   . LEU B 1 320 ? 24.116  -9.209  -38.921 1.00 65.88  ? 289  LEU B N   1 
ATOM   6319 C CA  . LEU B 1 320 ? 24.099  -8.295  -37.790 1.00 66.18  ? 289  LEU B CA  1 
ATOM   6320 C C   . LEU B 1 320 ? 25.237  -8.667  -36.839 1.00 68.33  ? 289  LEU B C   1 
ATOM   6321 O O   . LEU B 1 320 ? 25.465  -9.855  -36.617 1.00 69.44  ? 289  LEU B O   1 
ATOM   6322 C CB  . LEU B 1 320 ? 22.757  -8.353  -37.063 1.00 64.96  ? 289  LEU B CB  1 
ATOM   6323 C CG  . LEU B 1 320 ? 21.652  -7.527  -37.705 1.00 63.29  ? 289  LEU B CG  1 
ATOM   6324 C CD1 . LEU B 1 320 ? 20.287  -7.832  -37.046 1.00 62.25  ? 289  LEU B CD1 1 
ATOM   6325 C CD2 . LEU B 1 320 ? 21.972  -6.035  -37.666 1.00 61.15  ? 289  LEU B CD2 1 
ATOM   6326 N N   . PRO B 1 321 ? 25.936  -7.666  -36.277 1.00 69.52  ? 290  PRO B N   1 
ATOM   6327 C CA  . PRO B 1 321 ? 27.148  -7.911  -35.454 1.00 71.53  ? 290  PRO B CA  1 
ATOM   6328 C C   . PRO B 1 321 ? 26.914  -8.534  -34.067 1.00 72.69  ? 290  PRO B C   1 
ATOM   6329 O O   . PRO B 1 321 ? 27.857  -9.097  -33.513 1.00 74.37  ? 290  PRO B O   1 
ATOM   6330 C CB  . PRO B 1 321 ? 27.780  -6.505  -35.302 1.00 70.83  ? 290  PRO B CB  1 
ATOM   6331 C CG  . PRO B 1 321 ? 26.648  -5.540  -35.452 1.00 69.15  ? 290  PRO B CG  1 
ATOM   6332 C CD  . PRO B 1 321 ? 25.629  -6.225  -36.379 1.00 68.12  ? 290  PRO B CD  1 
ATOM   6333 N N   . GLN B 1 322 ? 25.705  -8.425  -33.523 1.00 72.42  ? 291  GLN B N   1 
ATOM   6334 C CA  . GLN B 1 322 ? 25.362  -9.038  -32.236 1.00 73.72  ? 291  GLN B CA  1 
ATOM   6335 C C   . GLN B 1 322 ? 23.957  -9.646  -32.265 1.00 73.04  ? 291  GLN B C   1 
ATOM   6336 O O   . GLN B 1 322 ? 23.185  -9.421  -33.204 1.00 72.47  ? 291  GLN B O   1 
ATOM   6337 C CB  . GLN B 1 322 ? 25.422  -7.995  -31.090 1.00 73.78  ? 291  GLN B CB  1 
ATOM   6338 C CG  . GLN B 1 322 ? 26.823  -7.346  -30.839 1.00 75.42  ? 291  GLN B CG  1 
ATOM   6339 C CD  . GLN B 1 322 ? 26.962  -5.969  -31.498 1.00 75.75  ? 291  GLN B CD  1 
ATOM   6340 O OE1 . GLN B 1 322 ? 28.069  -5.446  -31.651 1.00 76.25  ? 291  GLN B OE1 1 
ATOM   6341 N NE2 . GLN B 1 322 ? 25.835  -5.389  -31.894 1.00 76.48  ? 291  GLN B NE2 1 
ATOM   6342 N N   . GLU B 1 323 ? 23.654  -10.434 -31.233 1.00 73.56  ? 292  GLU B N   1 
ATOM   6343 C CA  . GLU B 1 323 ? 22.284  -10.822 -30.892 1.00 72.97  ? 292  GLU B CA  1 
ATOM   6344 C C   . GLU B 1 323 ? 21.597  -9.522  -30.480 1.00 70.14  ? 292  GLU B C   1 
ATOM   6345 O O   . GLU B 1 323 ? 22.109  -8.819  -29.604 1.00 70.92  ? 292  GLU B O   1 
ATOM   6346 C CB  . GLU B 1 323 ? 22.301  -11.822 -29.714 1.00 74.92  ? 292  GLU B CB  1 
ATOM   6347 C CG  . GLU B 1 323 ? 21.020  -12.624 -29.434 1.00 77.42  ? 292  GLU B CG  1 
ATOM   6348 C CD  . GLU B 1 323 ? 21.155  -13.518 -28.184 1.00 83.05  ? 292  GLU B CD  1 
ATOM   6349 O OE1 . GLU B 1 323 ? 22.266  -13.593 -27.603 1.00 83.88  ? 292  GLU B OE1 1 
ATOM   6350 O OE2 . GLU B 1 323 ? 20.154  -14.158 -27.762 1.00 87.05  ? 292  GLU B OE2 1 
ATOM   6351 N N   . SER B 1 324 ? 20.469  -9.184  -31.099 1.00 66.98  ? 293  SER B N   1 
ATOM   6352 C CA  . SER B 1 324 ? 19.825  -7.897  -30.830 1.00 64.06  ? 293  SER B CA  1 
ATOM   6353 C C   . SER B 1 324 ? 18.356  -7.827  -31.205 1.00 62.03  ? 293  SER B C   1 
ATOM   6354 O O   . SER B 1 324 ? 17.818  -8.699  -31.876 1.00 62.50  ? 293  SER B O   1 
ATOM   6355 C CB  . SER B 1 324 ? 20.598  -6.742  -31.484 1.00 63.22  ? 293  SER B CB  1 
ATOM   6356 O OG  . SER B 1 324 ? 20.755  -6.886  -32.883 1.00 63.31  ? 293  SER B OG  1 
ATOM   6357 N N   . ILE B 1 325 ? 17.688  -6.799  -30.705 1.00 60.11  ? 294  ILE B N   1 
ATOM   6358 C CA  . ILE B 1 325 ? 16.351  -6.431  -31.210 1.00 58.10  ? 294  ILE B CA  1 
ATOM   6359 C C   . ILE B 1 325 ? 16.372  -4.981  -31.590 1.00 55.28  ? 294  ILE B C   1 
ATOM   6360 O O   . ILE B 1 325 ? 17.249  -4.243  -31.173 1.00 54.39  ? 294  ILE B O   1 
ATOM   6361 C CB  . ILE B 1 325 ? 15.223  -6.685  -30.176 1.00 58.69  ? 294  ILE B CB  1 
ATOM   6362 C CG1 . ILE B 1 325 ? 15.605  -6.107  -28.812 1.00 58.96  ? 294  ILE B CG1 1 
ATOM   6363 C CG2 . ILE B 1 325 ? 14.911  -8.188  -30.064 1.00 60.45  ? 294  ILE B CG2 1 
ATOM   6364 C CD1 . ILE B 1 325 ? 14.430  -6.016  -27.901 1.00 60.52  ? 294  ILE B CD1 1 
ATOM   6365 N N   . PHE B 1 326 ? 15.396  -4.590  -32.402 1.00 53.54  ? 295  PHE B N   1 
ATOM   6366 C CA  . PHE B 1 326 ? 15.336  -3.240  -32.951 1.00 51.34  ? 295  PHE B CA  1 
ATOM   6367 C C   . PHE B 1 326 ? 16.645  -2.893  -33.661 1.00 50.52  ? 295  PHE B C   1 
ATOM   6368 O O   . PHE B 1 326 ? 17.134  -1.784  -33.563 1.00 49.15  ? 295  PHE B O   1 
ATOM   6369 C CB  . PHE B 1 326 ? 15.019  -2.229  -31.846 1.00 51.15  ? 295  PHE B CB  1 
ATOM   6370 C CG  . PHE B 1 326 ? 14.032  -1.157  -32.258 1.00 50.71  ? 295  PHE B CG  1 
ATOM   6371 C CD1 . PHE B 1 326 ? 14.163  -0.496  -33.470 1.00 48.39  ? 295  PHE B CD1 1 
ATOM   6372 C CD2 . PHE B 1 326 ? 12.955  -0.832  -31.430 1.00 49.61  ? 295  PHE B CD2 1 
ATOM   6373 C CE1 . PHE B 1 326 ? 13.278  0.457   -33.828 1.00 47.37  ? 295  PHE B CE1 1 
ATOM   6374 C CE2 . PHE B 1 326 ? 12.080  0.122   -31.786 1.00 48.72  ? 295  PHE B CE2 1 
ATOM   6375 C CZ  . PHE B 1 326 ? 12.234  0.770   -32.993 1.00 48.57  ? 295  PHE B CZ  1 
ATOM   6376 N N   . ARG B 1 327 ? 17.212  -3.870  -34.363 1.00 50.51  ? 296  ARG B N   1 
ATOM   6377 C CA  . ARG B 1 327 ? 18.315  -3.620  -35.270 1.00 50.54  ? 296  ARG B CA  1 
ATOM   6378 C C   . ARG B 1 327 ? 18.016  -4.297  -36.602 1.00 50.71  ? 296  ARG B C   1 
ATOM   6379 O O   . ARG B 1 327 ? 17.398  -5.356  -36.648 1.00 51.61  ? 296  ARG B O   1 
ATOM   6380 C CB  . ARG B 1 327 ? 19.607  -4.134  -34.685 1.00 51.46  ? 296  ARG B CB  1 
ATOM   6381 C CG  . ARG B 1 327 ? 20.047  -3.404  -33.443 1.00 51.08  ? 296  ARG B CG  1 
ATOM   6382 C CD  . ARG B 1 327 ? 20.624  -2.052  -33.709 1.00 50.41  ? 296  ARG B CD  1 
ATOM   6383 N NE  . ARG B 1 327 ? 20.960  -1.356  -32.470 1.00 53.54  ? 296  ARG B NE  1 
ATOM   6384 C CZ  . ARG B 1 327 ? 20.069  -0.791  -31.637 1.00 51.76  ? 296  ARG B CZ  1 
ATOM   6385 N NH1 . ARG B 1 327 ? 18.768  -0.830  -31.896 1.00 49.09  ? 296  ARG B NH1 1 
ATOM   6386 N NH2 . ARG B 1 327 ? 20.487  -0.189  -30.530 1.00 50.75  ? 296  ARG B NH2 1 
ATOM   6387 N N   . PHE B 1 328 ? 18.439  -3.647  -37.680 1.00 50.02  ? 297  PHE B N   1 
ATOM   6388 C CA  . PHE B 1 328 ? 18.130  -4.066  -39.029 1.00 49.41  ? 297  PHE B CA  1 
ATOM   6389 C C   . PHE B 1 328 ? 19.404  -4.068  -39.862 1.00 49.87  ? 297  PHE B C   1 
ATOM   6390 O O   . PHE B 1 328 ? 20.231  -3.182  -39.716 1.00 49.82  ? 297  PHE B O   1 
ATOM   6391 C CB  . PHE B 1 328 ? 17.081  -3.114  -39.572 1.00 48.32  ? 297  PHE B CB  1 
ATOM   6392 C CG  . PHE B 1 328 ? 15.942  -2.886  -38.607 1.00 47.68  ? 297  PHE B CG  1 
ATOM   6393 C CD1 . PHE B 1 328 ? 15.069  -3.925  -38.289 1.00 48.90  ? 297  PHE B CD1 1 
ATOM   6394 C CD2 . PHE B 1 328 ? 15.778  -1.673  -37.967 1.00 45.82  ? 297  PHE B CD2 1 
ATOM   6395 C CE1 . PHE B 1 328 ? 14.009  -3.725  -37.371 1.00 48.82  ? 297  PHE B CE1 1 
ATOM   6396 C CE2 . PHE B 1 328 ? 14.737  -1.470  -37.048 1.00 44.95  ? 297  PHE B CE2 1 
ATOM   6397 C CZ  . PHE B 1 328 ? 13.849  -2.486  -36.763 1.00 45.73  ? 297  PHE B CZ  1 
ATOM   6398 N N   . SER B 1 329 ? 19.557  -5.076  -40.723 1.00 50.47  ? 298  SER B N   1 
ATOM   6399 C CA  . SER B 1 329 ? 20.818  -5.300  -41.445 1.00 51.52  ? 298  SER B CA  1 
ATOM   6400 C C   . SER B 1 329 ? 21.163  -4.247  -42.512 1.00 50.75  ? 298  SER B C   1 
ATOM   6401 O O   . SER B 1 329 ? 22.316  -3.803  -42.624 1.00 51.40  ? 298  SER B O   1 
ATOM   6402 C CB  . SER B 1 329 ? 20.800  -6.678  -42.093 1.00 52.90  ? 298  SER B CB  1 
ATOM   6403 O OG  . SER B 1 329 ? 20.530  -7.683  -41.125 1.00 54.77  ? 298  SER B OG  1 
ATOM   6404 N N   . PHE B 1 330 ? 20.173  -3.842  -43.296 1.00 49.34  ? 299  PHE B N   1 
ATOM   6405 C CA  . PHE B 1 330 ? 20.417  -2.919  -44.407 1.00 48.28  ? 299  PHE B CA  1 
ATOM   6406 C C   . PHE B 1 330 ? 19.509  -1.700  -44.305 1.00 46.95  ? 299  PHE B C   1 
ATOM   6407 O O   . PHE B 1 330 ? 18.301  -1.782  -44.572 1.00 45.80  ? 299  PHE B O   1 
ATOM   6408 C CB  . PHE B 1 330 ? 20.274  -3.653  -45.746 1.00 48.82  ? 299  PHE B CB  1 
ATOM   6409 C CG  . PHE B 1 330 ? 21.311  -4.695  -45.929 1.00 48.93  ? 299  PHE B CG  1 
ATOM   6410 C CD1 . PHE B 1 330 ? 22.598  -4.336  -46.319 1.00 49.52  ? 299  PHE B CD1 1 
ATOM   6411 C CD2 . PHE B 1 330 ? 21.041  -6.021  -45.612 1.00 47.97  ? 299  PHE B CD2 1 
ATOM   6412 C CE1 . PHE B 1 330 ? 23.602  -5.298  -46.420 1.00 49.93  ? 299  PHE B CE1 1 
ATOM   6413 C CE2 . PHE B 1 330 ? 22.022  -6.973  -45.705 1.00 49.16  ? 299  PHE B CE2 1 
ATOM   6414 C CZ  . PHE B 1 330 ? 23.307  -6.619  -46.109 1.00 49.73  ? 299  PHE B CZ  1 
ATOM   6415 N N   . VAL B 1 331 ? 20.142  -0.593  -43.902 1.00 46.24  ? 300  VAL B N   1 
ATOM   6416 C CA  . VAL B 1 331 ? 19.495  0.677   -43.596 1.00 45.69  ? 300  VAL B CA  1 
ATOM   6417 C C   . VAL B 1 331 ? 20.265  1.851   -44.245 1.00 45.57  ? 300  VAL B C   1 
ATOM   6418 O O   . VAL B 1 331 ? 21.360  1.668   -44.782 1.00 46.34  ? 300  VAL B O   1 
ATOM   6419 C CB  . VAL B 1 331 ? 19.418  0.887   -42.045 1.00 45.53  ? 300  VAL B CB  1 
ATOM   6420 C CG1 . VAL B 1 331 ? 18.733  -0.283  -41.387 1.00 45.35  ? 300  VAL B CG1 1 
ATOM   6421 C CG2 . VAL B 1 331 ? 20.802  1.081   -41.465 1.00 47.39  ? 300  VAL B CG2 1 
ATOM   6422 N N   . PRO B 1 332 ? 19.707  3.059   -44.236 1.00 45.10  ? 301  PRO B N   1 
ATOM   6423 C CA  . PRO B 1 332 ? 20.413  4.187   -44.845 1.00 45.71  ? 301  PRO B CA  1 
ATOM   6424 C C   . PRO B 1 332 ? 21.843  4.257   -44.318 1.00 47.28  ? 301  PRO B C   1 
ATOM   6425 O O   . PRO B 1 332 ? 22.095  3.974   -43.143 1.00 47.43  ? 301  PRO B O   1 
ATOM   6426 C CB  . PRO B 1 332 ? 19.605  5.375   -44.386 1.00 45.35  ? 301  PRO B CB  1 
ATOM   6427 C CG  . PRO B 1 332 ? 18.217  4.836   -44.328 1.00 44.58  ? 301  PRO B CG  1 
ATOM   6428 C CD  . PRO B 1 332 ? 18.383  3.459   -43.738 1.00 44.33  ? 301  PRO B CD  1 
ATOM   6429 N N   . VAL B 1 333 ? 22.776  4.572   -45.205 1.00 48.41  ? 302  VAL B N   1 
ATOM   6430 C CA  . VAL B 1 333 ? 24.186  4.638   -44.867 1.00 49.62  ? 302  VAL B CA  1 
ATOM   6431 C C   . VAL B 1 333 ? 24.635  6.094   -44.918 1.00 50.13  ? 302  VAL B C   1 
ATOM   6432 O O   . VAL B 1 333 ? 24.153  6.858   -45.753 1.00 50.01  ? 302  VAL B O   1 
ATOM   6433 C CB  . VAL B 1 333 ? 24.997  3.739   -45.828 1.00 50.38  ? 302  VAL B CB  1 
ATOM   6434 C CG1 . VAL B 1 333 ? 24.823  4.183   -47.285 1.00 51.00  ? 302  VAL B CG1 1 
ATOM   6435 C CG2 . VAL B 1 333 ? 26.471  3.710   -45.455 1.00 52.61  ? 302  VAL B CG2 1 
ATOM   6436 N N   . VAL B 1 334 ? 25.522  6.475   -44.003 1.00 51.10  ? 303  VAL B N   1 
ATOM   6437 C CA  . VAL B 1 334 ? 26.112  7.810   -43.984 1.00 52.03  ? 303  VAL B CA  1 
ATOM   6438 C C   . VAL B 1 334 ? 27.157  7.787   -45.088 1.00 53.82  ? 303  VAL B C   1 
ATOM   6439 O O   . VAL B 1 334 ? 28.290  7.359   -44.887 1.00 54.96  ? 303  VAL B O   1 
ATOM   6440 C CB  . VAL B 1 334 ? 26.727  8.180   -42.596 1.00 52.33  ? 303  VAL B CB  1 
ATOM   6441 C CG1 . VAL B 1 334 ? 27.294  9.617   -42.576 1.00 52.26  ? 303  VAL B CG1 1 
ATOM   6442 C CG2 . VAL B 1 334 ? 25.684  8.040   -41.517 1.00 51.30  ? 303  VAL B CG2 1 
ATOM   6443 N N   . ASP B 1 335 ? 26.721  8.206   -46.277 1.00 54.60  ? 304  ASP B N   1 
ATOM   6444 C CA  . ASP B 1 335 ? 27.513  8.130   -47.507 1.00 55.37  ? 304  ASP B CA  1 
ATOM   6445 C C   . ASP B 1 335 ? 28.324  9.377   -47.839 1.00 56.31  ? 304  ASP B C   1 
ATOM   6446 O O   . ASP B 1 335 ? 29.158  9.336   -48.727 1.00 57.33  ? 304  ASP B O   1 
ATOM   6447 C CB  . ASP B 1 335 ? 26.611  7.780   -48.704 1.00 54.50  ? 304  ASP B CB  1 
ATOM   6448 C CG  . ASP B 1 335 ? 25.424  8.740   -48.887 1.00 54.16  ? 304  ASP B CG  1 
ATOM   6449 O OD1 . ASP B 1 335 ? 25.161  9.570   -47.995 1.00 49.76  ? 304  ASP B OD1 1 
ATOM   6450 O OD2 . ASP B 1 335 ? 24.685  8.718   -49.918 1.00 52.59  ? 304  ASP B OD2 1 
ATOM   6451 N N   . GLY B 1 336 ? 28.095  10.471  -47.127 1.00 56.38  ? 305  GLY B N   1 
ATOM   6452 C CA  . GLY B 1 336 ? 28.640  11.764  -47.515 1.00 57.70  ? 305  GLY B CA  1 
ATOM   6453 C C   . GLY B 1 336 ? 28.001  12.383  -48.765 1.00 58.17  ? 305  GLY B C   1 
ATOM   6454 O O   . GLY B 1 336 ? 28.522  13.360  -49.303 1.00 58.66  ? 305  GLY B O   1 
ATOM   6455 N N   . ASP B 1 337 ? 26.850  11.850  -49.194 1.00 57.57  ? 306  ASP B N   1 
ATOM   6456 C CA  . ASP B 1 337 ? 26.140  12.311  -50.406 1.00 57.68  ? 306  ASP B CA  1 
ATOM   6457 C C   . ASP B 1 337 ? 24.657  12.618  -50.045 1.00 55.87  ? 306  ASP B C   1 
ATOM   6458 O O   . ASP B 1 337 ? 24.328  13.783  -49.770 1.00 55.57  ? 306  ASP B O   1 
ATOM   6459 C CB  . ASP B 1 337 ? 26.305  11.269  -51.536 1.00 58.13  ? 306  ASP B CB  1 
ATOM   6460 C CG  . ASP B 1 337 ? 25.532  11.622  -52.808 1.00 60.38  ? 306  ASP B CG  1 
ATOM   6461 O OD1 . ASP B 1 337 ? 25.149  12.794  -52.990 1.00 63.99  ? 306  ASP B OD1 1 
ATOM   6462 O OD2 . ASP B 1 337 ? 25.272  10.784  -53.702 1.00 62.10  ? 306  ASP B OD2 1 
ATOM   6463 N N   . PHE B 1 338 ? 23.789  11.591  -50.000 1.00 54.05  ? 307  PHE B N   1 
ATOM   6464 C CA  . PHE B 1 338 ? 22.407  11.777  -49.531 1.00 52.46  ? 307  PHE B CA  1 
ATOM   6465 C C   . PHE B 1 338 ? 22.419  12.334  -48.119 1.00 52.11  ? 307  PHE B C   1 
ATOM   6466 O O   . PHE B 1 338 ? 21.735  13.319  -47.832 1.00 51.56  ? 307  PHE B O   1 
ATOM   6467 C CB  . PHE B 1 338 ? 21.594  10.469  -49.587 1.00 51.68  ? 307  PHE B CB  1 
ATOM   6468 C CG  . PHE B 1 338 ? 20.115  10.666  -49.416 1.00 49.34  ? 307  PHE B CG  1 
ATOM   6469 C CD1 . PHE B 1 338 ? 19.581  10.996  -48.182 1.00 47.41  ? 307  PHE B CD1 1 
ATOM   6470 C CD2 . PHE B 1 338 ? 19.250  10.513  -50.493 1.00 49.31  ? 307  PHE B CD2 1 
ATOM   6471 C CE1 . PHE B 1 338 ? 18.213  11.198  -48.035 1.00 47.62  ? 307  PHE B CE1 1 
ATOM   6472 C CE2 . PHE B 1 338 ? 17.884  10.694  -50.347 1.00 47.47  ? 307  PHE B CE2 1 
ATOM   6473 C CZ  . PHE B 1 338 ? 17.360  11.019  -49.112 1.00 46.90  ? 307  PHE B CZ  1 
ATOM   6474 N N   . LEU B 1 339 ? 23.189  11.684  -47.247 1.00 52.59  ? 308  LEU B N   1 
ATOM   6475 C CA  . LEU B 1 339 ? 23.494  12.196  -45.918 1.00 52.88  ? 308  LEU B CA  1 
ATOM   6476 C C   . LEU B 1 339 ? 24.938  12.690  -45.852 1.00 54.48  ? 308  LEU B C   1 
ATOM   6477 O O   . LEU B 1 339 ? 25.873  11.886  -45.725 1.00 54.76  ? 308  LEU B O   1 
ATOM   6478 C CB  . LEU B 1 339 ? 23.287  11.098  -44.876 1.00 52.37  ? 308  LEU B CB  1 
ATOM   6479 C CG  . LEU B 1 339 ? 21.892  10.511  -44.741 1.00 51.30  ? 308  LEU B CG  1 
ATOM   6480 C CD1 . LEU B 1 339 ? 21.941  9.347   -43.779 1.00 52.04  ? 308  LEU B CD1 1 
ATOM   6481 C CD2 . LEU B 1 339 ? 20.865  11.555  -44.277 1.00 50.94  ? 308  LEU B CD2 1 
ATOM   6482 N N   . SER B 1 340 ? 25.112  14.008  -45.888 1.00 55.38  ? 309  SER B N   1 
ATOM   6483 C CA  . SER B 1 340 ? 26.450  14.625  -45.889 1.00 57.41  ? 309  SER B CA  1 
ATOM   6484 C C   . SER B 1 340 ? 27.235  14.399  -44.591 1.00 57.86  ? 309  SER B C   1 
ATOM   6485 O O   . SER B 1 340 ? 28.424  14.625  -44.547 1.00 59.39  ? 309  SER B O   1 
ATOM   6486 C CB  . SER B 1 340 ? 26.359  16.142  -46.145 1.00 57.72  ? 309  SER B CB  1 
ATOM   6487 O OG  . SER B 1 340 ? 25.564  16.795  -45.153 1.00 58.64  ? 309  SER B OG  1 
ATOM   6488 N N   . ASP B 1 341 ? 26.553  13.995  -43.532 1.00 57.12  ? 310  ASP B N   1 
ATOM   6489 C CA  . ASP B 1 341 ? 27.190  13.711  -42.243 1.00 57.38  ? 310  ASP B CA  1 
ATOM   6490 C C   . ASP B 1 341 ? 26.230  12.835  -41.443 1.00 55.88  ? 310  ASP B C   1 
ATOM   6491 O O   . ASP B 1 341 ? 25.116  12.585  -41.904 1.00 55.11  ? 310  ASP B O   1 
ATOM   6492 C CB  . ASP B 1 341 ? 27.471  15.025  -41.513 1.00 57.68  ? 310  ASP B CB  1 
ATOM   6493 C CG  . ASP B 1 341 ? 28.711  14.968  -40.596 1.00 60.09  ? 310  ASP B CG  1 
ATOM   6494 O OD1 . ASP B 1 341 ? 29.167  13.862  -40.201 1.00 59.32  ? 310  ASP B OD1 1 
ATOM   6495 O OD2 . ASP B 1 341 ? 29.270  16.020  -40.204 1.00 60.25  ? 310  ASP B OD2 1 
ATOM   6496 N N   . THR B 1 342 ? 26.610  12.390  -40.252 1.00 56.16  ? 311  THR B N   1 
ATOM   6497 C CA  . THR B 1 342 ? 25.668  11.621  -39.441 1.00 55.43  ? 311  THR B CA  1 
ATOM   6498 C C   . THR B 1 342 ? 24.438  12.480  -39.173 1.00 55.21  ? 311  THR B C   1 
ATOM   6499 O O   . THR B 1 342 ? 24.535  13.713  -39.117 1.00 54.86  ? 311  THR B O   1 
ATOM   6500 C CB  . THR B 1 342 ? 26.262  11.175  -38.100 1.00 55.68  ? 311  THR B CB  1 
ATOM   6501 O OG1 . THR B 1 342 ? 26.533  12.317  -37.287 1.00 54.67  ? 311  THR B OG1 1 
ATOM   6502 C CG2 . THR B 1 342 ? 27.607  10.467  -38.270 1.00 55.59  ? 311  THR B CG2 1 
ATOM   6503 N N   . PRO B 1 343 ? 23.278  11.855  -39.024 1.00 55.00  ? 312  PRO B N   1 
ATOM   6504 C CA  . PRO B 1 343 ? 22.072  12.598  -38.631 1.00 55.34  ? 312  PRO B CA  1 
ATOM   6505 C C   . PRO B 1 343 ? 22.264  13.370  -37.334 1.00 56.44  ? 312  PRO B C   1 
ATOM   6506 O O   . PRO B 1 343 ? 21.749  14.472  -37.247 1.00 56.20  ? 312  PRO B O   1 
ATOM   6507 C CB  . PRO B 1 343 ? 20.996  11.505  -38.503 1.00 55.05  ? 312  PRO B CB  1 
ATOM   6508 C CG  . PRO B 1 343 ? 21.495  10.404  -39.399 1.00 54.78  ? 312  PRO B CG  1 
ATOM   6509 C CD  . PRO B 1 343 ? 23.003  10.437  -39.266 1.00 54.67  ? 312  PRO B CD  1 
ATOM   6510 N N   . GLU B 1 344 ? 23.028  12.829  -36.382 1.00 58.62  ? 313  GLU B N   1 
ATOM   6511 C CA  . GLU B 1 344 ? 23.346  13.540  -35.140 1.00 60.44  ? 313  GLU B CA  1 
ATOM   6512 C C   . GLU B 1 344 ? 24.028  14.866  -35.485 1.00 60.36  ? 313  GLU B C   1 
ATOM   6513 O O   . GLU B 1 344 ? 23.620  15.915  -35.002 1.00 60.42  ? 313  GLU B O   1 
ATOM   6514 C CB  . GLU B 1 344 ? 24.244  12.680  -34.214 1.00 62.25  ? 313  GLU B CB  1 
ATOM   6515 C CG  . GLU B 1 344 ? 24.464  13.226  -32.777 1.00 66.90  ? 313  GLU B CG  1 
ATOM   6516 C CD  . GLU B 1 344 ? 25.962  13.324  -32.305 1.00 73.38  ? 313  GLU B CD  1 
ATOM   6517 O OE1 . GLU B 1 344 ? 26.906  12.887  -33.023 1.00 75.68  ? 313  GLU B OE1 1 
ATOM   6518 O OE2 . GLU B 1 344 ? 26.211  13.871  -31.186 1.00 75.45  ? 313  GLU B OE2 1 
ATOM   6519 N N   . ALA B 1 345 ? 25.042  14.832  -36.337 1.00 60.63  ? 314  ALA B N   1 
ATOM   6520 C CA  . ALA B 1 345 ? 25.780  16.050  -36.665 1.00 61.69  ? 314  ALA B CA  1 
ATOM   6521 C C   . ALA B 1 345 ? 24.885  17.065  -37.395 1.00 61.71  ? 314  ALA B C   1 
ATOM   6522 O O   . ALA B 1 345 ? 25.014  18.269  -37.184 1.00 62.35  ? 314  ALA B O   1 
ATOM   6523 C CB  . ALA B 1 345 ? 27.040  15.734  -37.490 1.00 62.39  ? 314  ALA B CB  1 
ATOM   6524 N N   . LEU B 1 346 ? 23.962  16.573  -38.222 1.00 61.29  ? 315  LEU B N   1 
ATOM   6525 C CA  . LEU B 1 346 ? 23.139  17.432  -39.059 1.00 60.97  ? 315  LEU B CA  1 
ATOM   6526 C C   . LEU B 1 346 ? 22.011  18.095  -38.292 1.00 61.09  ? 315  LEU B C   1 
ATOM   6527 O O   . LEU B 1 346 ? 21.647  19.214  -38.620 1.00 61.07  ? 315  LEU B O   1 
ATOM   6528 C CB  . LEU B 1 346 ? 22.554  16.634  -40.225 1.00 60.52  ? 315  LEU B CB  1 
ATOM   6529 C CG  . LEU B 1 346 ? 23.536  16.051  -41.242 1.00 60.24  ? 315  LEU B CG  1 
ATOM   6530 C CD1 . LEU B 1 346 ? 22.766  15.435  -42.383 1.00 59.21  ? 315  LEU B CD1 1 
ATOM   6531 C CD2 . LEU B 1 346 ? 24.525  17.108  -41.753 1.00 61.45  ? 315  LEU B CD2 1 
ATOM   6532 N N   . ILE B 1 347 ? 21.437  17.412  -37.303 1.00 61.37  ? 316  ILE B N   1 
ATOM   6533 C CA  . ILE B 1 347 ? 20.393  18.034  -36.488 1.00 62.00  ? 316  ILE B CA  1 
ATOM   6534 C C   . ILE B 1 347 ? 21.015  19.056  -35.535 1.00 63.50  ? 316  ILE B C   1 
ATOM   6535 O O   . ILE B 1 347 ? 20.368  20.061  -35.208 1.00 63.62  ? 316  ILE B O   1 
ATOM   6536 C CB  . ILE B 1 347 ? 19.502  16.992  -35.736 1.00 61.04  ? 316  ILE B CB  1 
ATOM   6537 C CG1 . ILE B 1 347 ? 20.279  16.244  -34.657 1.00 62.44  ? 316  ILE B CG1 1 
ATOM   6538 C CG2 . ILE B 1 347 ? 18.901  15.990  -36.712 1.00 60.82  ? 316  ILE B CG2 1 
ATOM   6539 C CD1 . ILE B 1 347 ? 19.420  15.295  -33.785 1.00 62.26  ? 316  ILE B CD1 1 
ATOM   6540 N N   . ASN B 1 348 ? 22.262  18.813  -35.111 1.00 64.92  ? 317  ASN B N   1 
ATOM   6541 C CA  . ASN B 1 348 ? 22.946  19.711  -34.178 1.00 66.20  ? 317  ASN B CA  1 
ATOM   6542 C C   . ASN B 1 348 ? 23.308  21.036  -34.846 1.00 67.06  ? 317  ASN B C   1 
ATOM   6543 O O   . ASN B 1 348 ? 23.253  22.064  -34.188 1.00 67.62  ? 317  ASN B O   1 
ATOM   6544 C CB  . ASN B 1 348 ? 24.192  19.053  -33.551 1.00 66.81  ? 317  ASN B CB  1 
ATOM   6545 C CG  . ASN B 1 348 ? 23.841  17.960  -32.514 1.00 67.67  ? 317  ASN B CG  1 
ATOM   6546 O OD1 . ASN B 1 348 ? 22.722  17.901  -31.990 1.00 68.75  ? 317  ASN B OD1 1 
ATOM   6547 N ND2 . ASN B 1 348 ? 24.812  17.080  -32.223 1.00 69.20  ? 317  ASN B ND2 1 
ATOM   6548 N N   . THR B 1 349 ? 23.641  21.024  -36.138 1.00 67.40  ? 318  THR B N   1 
ATOM   6549 C CA  . THR B 1 349 ? 24.104  22.237  -36.838 1.00 68.81  ? 318  THR B CA  1 
ATOM   6550 C C   . THR B 1 349 ? 23.175  22.752  -37.914 1.00 68.83  ? 318  THR B C   1 
ATOM   6551 O O   . THR B 1 349 ? 23.535  23.679  -38.637 1.00 69.59  ? 318  THR B O   1 
ATOM   6552 C CB  . THR B 1 349 ? 25.472  22.013  -37.564 1.00 70.18  ? 318  THR B CB  1 
ATOM   6553 O OG1 . THR B 1 349 ? 25.308  21.092  -38.672 1.00 68.09  ? 318  THR B OG1 1 
ATOM   6554 C CG2 . THR B 1 349 ? 26.544  21.412  -36.619 1.00 70.88  ? 318  THR B CG2 1 
ATOM   6555 N N   . GLY B 1 350 ? 22.014  22.138  -38.073 1.00 67.92  ? 319  GLY B N   1 
ATOM   6556 C CA  . GLY B 1 350 ? 21.106  22.534  -39.126 1.00 67.94  ? 319  GLY B CA  1 
ATOM   6557 C C   . GLY B 1 350 ? 20.359  23.824  -38.810 1.00 68.46  ? 319  GLY B C   1 
ATOM   6558 O O   . GLY B 1 350 ? 20.150  24.198  -37.655 1.00 68.12  ? 319  GLY B O   1 
ATOM   6559 N N   . ASP B 1 351 ? 19.969  24.510  -39.871 1.00 69.21  ? 320  ASP B N   1 
ATOM   6560 C CA  . ASP B 1 351 ? 19.095  25.653  -39.770 1.00 69.95  ? 320  ASP B CA  1 
ATOM   6561 C C   . ASP B 1 351 ? 17.712  25.204  -40.224 1.00 68.74  ? 320  ASP B C   1 
ATOM   6562 O O   . ASP B 1 351 ? 17.514  24.884  -41.395 1.00 68.25  ? 320  ASP B O   1 
ATOM   6563 C CB  . ASP B 1 351 ? 19.580  26.794  -40.672 1.00 71.49  ? 320  ASP B CB  1 
ATOM   6564 C CG  . ASP B 1 351 ? 18.688  28.043  -40.563 1.00 73.43  ? 320  ASP B CG  1 
ATOM   6565 O OD1 . ASP B 1 351 ? 18.045  28.213  -39.492 1.00 73.63  ? 320  ASP B OD1 1 
ATOM   6566 O OD2 . ASP B 1 351 ? 18.582  28.908  -41.474 1.00 75.84  ? 320  ASP B OD2 1 
ATOM   6567 N N   . PHE B 1 352 ? 16.759  25.195  -39.292 1.00 68.17  ? 321  PHE B N   1 
ATOM   6568 C CA  . PHE B 1 352 ? 15.417  24.685  -39.561 1.00 67.32  ? 321  PHE B CA  1 
ATOM   6569 C C   . PHE B 1 352 ? 14.341  25.756  -39.433 1.00 68.41  ? 321  PHE B C   1 
ATOM   6570 O O   . PHE B 1 352 ? 13.192  25.442  -39.116 1.00 67.81  ? 321  PHE B O   1 
ATOM   6571 C CB  . PHE B 1 352 ? 15.116  23.509  -38.627 1.00 65.90  ? 321  PHE B CB  1 
ATOM   6572 C CG  . PHE B 1 352 ? 16.075  22.372  -38.766 1.00 62.88  ? 321  PHE B CG  1 
ATOM   6573 C CD1 . PHE B 1 352 ? 16.083  21.597  -39.917 1.00 61.03  ? 321  PHE B CD1 1 
ATOM   6574 C CD2 . PHE B 1 352 ? 16.979  22.073  -37.750 1.00 61.25  ? 321  PHE B CD2 1 
ATOM   6575 C CE1 . PHE B 1 352 ? 16.979  20.527  -40.059 1.00 60.69  ? 321  PHE B CE1 1 
ATOM   6576 C CE2 . PHE B 1 352 ? 17.871  21.003  -37.878 1.00 60.30  ? 321  PHE B CE2 1 
ATOM   6577 C CZ  . PHE B 1 352 ? 17.870  20.231  -39.042 1.00 59.53  ? 321  PHE B CZ  1 
ATOM   6578 N N   . GLN B 1 353 ? 14.713  27.005  -39.736 1.00 70.58  ? 322  GLN B N   1 
ATOM   6579 C CA  . GLN B 1 353 ? 13.853  28.176  -39.539 1.00 71.91  ? 322  GLN B CA  1 
ATOM   6580 C C   . GLN B 1 353 ? 12.495  28.079  -40.250 1.00 71.40  ? 322  GLN B C   1 
ATOM   6581 O O   . GLN B 1 353 ? 11.467  28.409  -39.652 1.00 71.85  ? 322  GLN B O   1 
ATOM   6582 C CB  . GLN B 1 353 ? 14.570  29.483  -39.937 1.00 73.78  ? 322  GLN B CB  1 
ATOM   6583 C CG  . GLN B 1 353 ? 15.583  30.009  -38.865 1.00 76.94  ? 322  GLN B CG  1 
ATOM   6584 C CD  . GLN B 1 353 ? 15.156  31.309  -38.146 1.00 80.26  ? 322  GLN B CD  1 
ATOM   6585 O OE1 . GLN B 1 353 ? 15.461  32.405  -38.618 1.00 82.32  ? 322  GLN B OE1 1 
ATOM   6586 N NE2 . GLN B 1 353 ? 14.490  31.178  -36.993 1.00 80.17  ? 322  GLN B NE2 1 
ATOM   6587 N N   . ASP B 1 354 ? 12.444  27.602  -41.489 1.00 70.71  ? 323  ASP B N   1 
ATOM   6588 C CA  . ASP B 1 354 ? 11.146  27.641  -42.205 1.00 70.51  ? 323  ASP B CA  1 
ATOM   6589 C C   . ASP B 1 354 ? 10.406  26.286  -42.219 1.00 67.34  ? 323  ASP B C   1 
ATOM   6590 O O   . ASP B 1 354 ? 9.673   25.986  -43.159 1.00 66.88  ? 323  ASP B O   1 
ATOM   6591 C CB  . ASP B 1 354 ? 11.285  28.273  -43.620 1.00 72.44  ? 323  ASP B CB  1 
ATOM   6592 C CG  . ASP B 1 354 ? 11.263  29.865  -43.598 1.00 76.58  ? 323  ASP B CG  1 
ATOM   6593 O OD1 . ASP B 1 354 ? 10.727  30.511  -42.648 1.00 78.68  ? 323  ASP B OD1 1 
ATOM   6594 O OD2 . ASP B 1 354 ? 11.773  30.552  -44.517 1.00 81.31  ? 323  ASP B OD2 1 
ATOM   6595 N N   . LEU B 1 355 ? 10.561  25.513  -41.135 1.00 64.11  ? 324  LEU B N   1 
ATOM   6596 C CA  . LEU B 1 355 ? 10.099  24.123  -41.074 1.00 60.79  ? 324  LEU B CA  1 
ATOM   6597 C C   . LEU B 1 355 ? 9.098   23.910  -39.947 1.00 57.87  ? 324  LEU B C   1 
ATOM   6598 O O   . LEU B 1 355 ? 9.327   24.299  -38.832 1.00 57.42  ? 324  LEU B O   1 
ATOM   6599 C CB  . LEU B 1 355 ? 11.296  23.193  -40.889 1.00 60.38  ? 324  LEU B CB  1 
ATOM   6600 C CG  . LEU B 1 355 ? 11.062  21.678  -40.969 1.00 59.87  ? 324  LEU B CG  1 
ATOM   6601 C CD1 . LEU B 1 355 ? 10.867  21.228  -42.420 1.00 60.66  ? 324  LEU B CD1 1 
ATOM   6602 C CD2 . LEU B 1 355 ? 12.221  20.940  -40.332 1.00 59.79  ? 324  LEU B CD2 1 
ATOM   6603 N N   . GLN B 1 356 ? 7.980   23.298  -40.274 1.00 55.32  ? 325  GLN B N   1 
ATOM   6604 C CA  . GLN B 1 356 ? 7.018   22.843  -39.298 1.00 53.44  ? 325  GLN B CA  1 
ATOM   6605 C C   . GLN B 1 356 ? 7.047   21.323  -39.240 1.00 51.35  ? 325  GLN B C   1 
ATOM   6606 O O   . GLN B 1 356 ? 7.023   20.660  -40.275 1.00 50.48  ? 325  GLN B O   1 
ATOM   6607 C CB  . GLN B 1 356 ? 5.617   23.296  -39.651 1.00 53.46  ? 325  GLN B CB  1 
ATOM   6608 C CG  . GLN B 1 356 ? 5.436   24.792  -39.703 1.00 54.93  ? 325  GLN B CG  1 
ATOM   6609 C CD  . GLN B 1 356 ? 5.480   25.312  -41.104 1.00 56.95  ? 325  GLN B CD  1 
ATOM   6610 O OE1 . GLN B 1 356 ? 4.805   24.790  -41.986 1.00 57.21  ? 325  GLN B OE1 1 
ATOM   6611 N NE2 . GLN B 1 356 ? 6.325   26.298  -41.335 1.00 60.31  ? 325  GLN B NE2 1 
ATOM   6612 N N   . VAL B 1 357 ? 7.112   20.793  -38.024 1.00 49.60  ? 326  VAL B N   1 
ATOM   6613 C CA  . VAL B 1 357 ? 7.188   19.377  -37.782 1.00 48.91  ? 326  VAL B CA  1 
ATOM   6614 C C   . VAL B 1 357 ? 6.261   18.970  -36.664 1.00 47.84  ? 326  VAL B C   1 
ATOM   6615 O O   . VAL B 1 357 ? 6.158   19.675  -35.669 1.00 48.12  ? 326  VAL B O   1 
ATOM   6616 C CB  . VAL B 1 357 ? 8.631   18.965  -37.374 1.00 48.92  ? 326  VAL B CB  1 
ATOM   6617 C CG1 . VAL B 1 357 ? 8.743   17.499  -37.333 1.00 50.57  ? 326  VAL B CG1 1 
ATOM   6618 C CG2 . VAL B 1 357 ? 9.628   19.454  -38.359 1.00 49.32  ? 326  VAL B CG2 1 
ATOM   6619 N N   . LEU B 1 358 ? 5.588   17.832  -36.843 1.00 46.52  ? 327  LEU B N   1 
ATOM   6620 C CA  . LEU B 1 358 ? 4.782   17.186  -35.811 1.00 45.74  ? 327  LEU B CA  1 
ATOM   6621 C C   . LEU B 1 358 ? 5.453   15.852  -35.487 1.00 44.16  ? 327  LEU B C   1 
ATOM   6622 O O   . LEU B 1 358 ? 5.734   15.087  -36.391 1.00 43.20  ? 327  LEU B O   1 
ATOM   6623 C CB  . LEU B 1 358 ? 3.372   16.981  -36.333 1.00 46.21  ? 327  LEU B CB  1 
ATOM   6624 C CG  . LEU B 1 358 ? 2.406   16.108  -35.531 1.00 49.21  ? 327  LEU B CG  1 
ATOM   6625 C CD1 . LEU B 1 358 ? 1.999   16.802  -34.273 1.00 52.08  ? 327  LEU B CD1 1 
ATOM   6626 C CD2 . LEU B 1 358 ? 1.156   15.816  -36.347 1.00 52.34  ? 327  LEU B CD2 1 
ATOM   6627 N N   . VAL B 1 359 ? 5.745   15.584  -34.218 1.00 43.08  ? 328  VAL B N   1 
ATOM   6628 C CA  . VAL B 1 359 ? 6.403   14.342  -33.830 1.00 42.97  ? 328  VAL B CA  1 
ATOM   6629 C C   . VAL B 1 359 ? 5.753   13.698  -32.624 1.00 42.38  ? 328  VAL B C   1 
ATOM   6630 O O   . VAL B 1 359 ? 5.148   14.362  -31.807 1.00 42.16  ? 328  VAL B O   1 
ATOM   6631 C CB  . VAL B 1 359 ? 7.902   14.547  -33.485 1.00 43.00  ? 328  VAL B CB  1 
ATOM   6632 C CG1 . VAL B 1 359 ? 8.606   15.188  -34.605 1.00 44.94  ? 328  VAL B CG1 1 
ATOM   6633 C CG2 . VAL B 1 359 ? 8.075   15.402  -32.266 1.00 44.53  ? 328  VAL B CG2 1 
ATOM   6634 N N   . GLY B 1 360 ? 5.909   12.393  -32.487 1.00 41.68  ? 329  GLY B N   1 
ATOM   6635 C CA  . GLY B 1 360 ? 5.489   11.775  -31.261 1.00 41.92  ? 329  GLY B CA  1 
ATOM   6636 C C   . GLY B 1 360 ? 5.697   10.309  -31.159 1.00 41.84  ? 329  GLY B C   1 
ATOM   6637 O O   . GLY B 1 360 ? 6.278   9.698   -32.005 1.00 41.66  ? 329  GLY B O   1 
ATOM   6638 N N   . VAL B 1 361 ? 5.174   9.748   -30.087 1.00 42.43  ? 330  VAL B N   1 
ATOM   6639 C CA  . VAL B 1 361 ? 5.423   8.373   -29.738 1.00 42.68  ? 330  VAL B CA  1 
ATOM   6640 C C   . VAL B 1 361 ? 4.137   7.760   -29.201 1.00 43.78  ? 330  VAL B C   1 
ATOM   6641 O O   . VAL B 1 361 ? 3.191   8.477   -28.876 1.00 43.85  ? 330  VAL B O   1 
ATOM   6642 C CB  . VAL B 1 361 ? 6.537   8.267   -28.675 1.00 42.49  ? 330  VAL B CB  1 
ATOM   6643 C CG1 . VAL B 1 361 ? 7.863   8.757   -29.210 1.00 43.51  ? 330  VAL B CG1 1 
ATOM   6644 C CG2 . VAL B 1 361 ? 6.181   9.010   -27.404 1.00 43.08  ? 330  VAL B CG2 1 
ATOM   6645 N N   . VAL B 1 362 ? 4.105   6.435   -29.125 1.00 44.48  ? 331  VAL B N   1 
ATOM   6646 C CA  . VAL B 1 362 ? 3.023   5.707   -28.464 1.00 45.43  ? 331  VAL B CA  1 
ATOM   6647 C C   . VAL B 1 362 ? 3.465   5.309   -27.042 1.00 46.44  ? 331  VAL B C   1 
ATOM   6648 O O   . VAL B 1 362 ? 4.655   5.345   -26.712 1.00 45.81  ? 331  VAL B O   1 
ATOM   6649 C CB  . VAL B 1 362 ? 2.603   4.452   -29.261 1.00 45.47  ? 331  VAL B CB  1 
ATOM   6650 C CG1 . VAL B 1 362 ? 2.051   4.847   -30.601 1.00 45.37  ? 331  VAL B CG1 1 
ATOM   6651 C CG2 . VAL B 1 362 ? 3.771   3.473   -29.438 1.00 45.15  ? 331  VAL B CG2 1 
ATOM   6652 N N   . LYS B 1 363 ? 2.496   4.906   -26.217 1.00 47.77  ? 332  LYS B N   1 
ATOM   6653 C CA  . LYS B 1 363 ? 2.742   4.680   -24.801 1.00 48.96  ? 332  LYS B CA  1 
ATOM   6654 C C   . LYS B 1 363 ? 3.726   3.524   -24.578 1.00 48.76  ? 332  LYS B C   1 
ATOM   6655 O O   . LYS B 1 363 ? 4.447   3.516   -23.596 1.00 48.65  ? 332  LYS B O   1 
ATOM   6656 C CB  . LYS B 1 363 ? 1.416   4.433   -24.053 1.00 50.41  ? 332  LYS B CB  1 
ATOM   6657 C CG  . LYS B 1 363 ? 1.479   4.410   -22.471 1.00 53.39  ? 332  LYS B CG  1 
ATOM   6658 C CD  . LYS B 1 363 ? 0.094   3.939   -21.821 1.00 59.37  ? 332  LYS B CD  1 
ATOM   6659 C CE  . LYS B 1 363 ? 0.208   2.729   -20.800 1.00 62.78  ? 332  LYS B CE  1 
ATOM   6660 N NZ  . LYS B 1 363 ? 0.060   1.327   -21.433 1.00 61.65  ? 332  LYS B NZ  1 
ATOM   6661 N N   . ASP B 1 364 ? 3.772   2.560   -25.479 1.00 48.60  ? 333  ASP B N   1 
ATOM   6662 C CA  . ASP B 1 364 ? 4.623   1.374   -25.259 1.00 49.26  ? 333  ASP B CA  1 
ATOM   6663 C C   . ASP B 1 364 ? 5.440   0.974   -26.474 1.00 48.00  ? 333  ASP B C   1 
ATOM   6664 O O   . ASP B 1 364 ? 5.273   -0.096  -27.033 1.00 48.44  ? 333  ASP B O   1 
ATOM   6665 C CB  . ASP B 1 364 ? 3.748   0.218   -24.772 1.00 50.57  ? 333  ASP B CB  1 
ATOM   6666 C CG  . ASP B 1 364 ? 3.061   0.551   -23.476 1.00 52.01  ? 333  ASP B CG  1 
ATOM   6667 O OD1 . ASP B 1 364 ? 1.828   0.834   -23.488 1.00 51.54  ? 333  ASP B OD1 1 
ATOM   6668 O OD2 . ASP B 1 364 ? 3.710   0.605   -22.403 1.00 53.47  ? 333  ASP B OD2 1 
ATOM   6669 N N   . GLU B 1 365 ? 6.330   1.858   -26.860 1.00 47.14  ? 334  GLU B N   1 
ATOM   6670 C CA  . GLU B 1 365 ? 7.167   1.693   -28.047 1.00 46.69  ? 334  GLU B CA  1 
ATOM   6671 C C   . GLU B 1 365 ? 7.925   0.379   -28.098 1.00 47.10  ? 334  GLU B C   1 
ATOM   6672 O O   . GLU B 1 365 ? 7.984   -0.244  -29.147 1.00 48.20  ? 334  GLU B O   1 
ATOM   6673 C CB  . GLU B 1 365 ? 8.158   2.841   -28.115 1.00 46.06  ? 334  GLU B CB  1 
ATOM   6674 C CG  . GLU B 1 365 ? 7.519   4.189   -28.437 1.00 46.95  ? 334  GLU B CG  1 
ATOM   6675 C CD  . GLU B 1 365 ? 7.064   4.287   -29.880 1.00 46.54  ? 334  GLU B CD  1 
ATOM   6676 O OE1 . GLU B 1 365 ? 7.310   3.336   -30.637 1.00 45.63  ? 334  GLU B OE1 1 
ATOM   6677 O OE2 . GLU B 1 365 ? 6.460   5.319   -30.258 1.00 46.55  ? 334  GLU B OE2 1 
ATOM   6678 N N   . GLY B 1 366 ? 8.487   -0.067  -26.988 1.00 47.46  ? 335  GLY B N   1 
ATOM   6679 C CA  . GLY B 1 366 ? 9.345   -1.238  -27.007 1.00 48.49  ? 335  GLY B CA  1 
ATOM   6680 C C   . GLY B 1 366 ? 8.683   -2.583  -26.766 1.00 49.66  ? 335  GLY B C   1 
ATOM   6681 O O   . GLY B 1 366 ? 9.331   -3.610  -26.907 1.00 50.74  ? 335  GLY B O   1 
ATOM   6682 N N   . SER B 1 367 ? 7.410   -2.605  -26.411 1.00 50.09  ? 336  SER B N   1 
ATOM   6683 C CA  . SER B 1 367 ? 6.781   -3.839  -25.967 1.00 51.27  ? 336  SER B CA  1 
ATOM   6684 C C   . SER B 1 367 ? 6.860   -5.015  -26.959 1.00 52.25  ? 336  SER B C   1 
ATOM   6685 O O   . SER B 1 367 ? 7.216   -6.117  -26.574 1.00 53.63  ? 336  SER B O   1 
ATOM   6686 C CB  . SER B 1 367 ? 5.313   -3.580  -25.587 1.00 51.46  ? 336  SER B CB  1 
ATOM   6687 O OG  . SER B 1 367 ? 4.530   -3.290  -26.730 1.00 50.36  ? 336  SER B OG  1 
ATOM   6688 N N   . TYR B 1 368 ? 6.532   -4.804  -28.226 1.00 52.06  ? 337  TYR B N   1 
ATOM   6689 C CA  . TYR B 1 368 ? 6.378   -5.945  -29.130 1.00 52.84  ? 337  TYR B CA  1 
ATOM   6690 C C   . TYR B 1 368 ? 7.716   -6.526  -29.527 1.00 53.20  ? 337  TYR B C   1 
ATOM   6691 O O   . TYR B 1 368 ? 7.829   -7.734  -29.725 1.00 54.04  ? 337  TYR B O   1 
ATOM   6692 C CB  . TYR B 1 368 ? 5.507   -5.613  -30.350 1.00 52.38  ? 337  TYR B CB  1 
ATOM   6693 C CG  . TYR B 1 368 ? 6.208   -5.101  -31.582 1.00 52.14  ? 337  TYR B CG  1 
ATOM   6694 C CD1 . TYR B 1 368 ? 6.987   -5.935  -32.359 1.00 54.45  ? 337  TYR B CD1 1 
ATOM   6695 C CD2 . TYR B 1 368 ? 6.053   -3.788  -31.996 1.00 52.45  ? 337  TYR B CD2 1 
ATOM   6696 C CE1 . TYR B 1 368 ? 7.632   -5.473  -33.517 1.00 55.27  ? 337  TYR B CE1 1 
ATOM   6697 C CE2 . TYR B 1 368 ? 6.689   -3.310  -33.143 1.00 54.48  ? 337  TYR B CE2 1 
ATOM   6698 C CZ  . TYR B 1 368 ? 7.477   -4.162  -33.912 1.00 56.00  ? 337  TYR B CZ  1 
ATOM   6699 O OH  . TYR B 1 368 ? 8.099   -3.699  -35.061 1.00 54.08  ? 337  TYR B OH  1 
ATOM   6700 N N   . PHE B 1 369 ? 8.727   -5.673  -29.607 1.00 52.54  ? 338  PHE B N   1 
ATOM   6701 C CA  . PHE B 1 369 ? 10.060  -6.098  -30.006 1.00 53.34  ? 338  PHE B CA  1 
ATOM   6702 C C   . PHE B 1 369 ? 10.577  -7.214  -29.120 1.00 54.27  ? 338  PHE B C   1 
ATOM   6703 O O   . PHE B 1 369 ? 11.357  -8.040  -29.552 1.00 54.57  ? 338  PHE B O   1 
ATOM   6704 C CB  . PHE B 1 369 ? 11.030  -4.901  -29.993 1.00 52.82  ? 338  PHE B CB  1 
ATOM   6705 C CG  . PHE B 1 369 ? 10.757  -3.915  -31.084 1.00 52.16  ? 338  PHE B CG  1 
ATOM   6706 C CD1 . PHE B 1 369 ? 10.033  -2.766  -30.832 1.00 51.36  ? 338  PHE B CD1 1 
ATOM   6707 C CD2 . PHE B 1 369 ? 11.165  -4.183  -32.382 1.00 52.79  ? 338  PHE B CD2 1 
ATOM   6708 C CE1 . PHE B 1 369 ? 9.744   -1.896  -31.831 1.00 50.92  ? 338  PHE B CE1 1 
ATOM   6709 C CE2 . PHE B 1 369 ? 10.874  -3.306  -33.403 1.00 52.09  ? 338  PHE B CE2 1 
ATOM   6710 C CZ  . PHE B 1 369 ? 10.160  -2.155  -33.120 1.00 52.15  ? 338  PHE B CZ  1 
ATOM   6711 N N   . LEU B 1 370 ? 10.111  -7.237  -27.885 1.00 54.65  ? 339  LEU B N   1 
ATOM   6712 C CA  . LEU B 1 370 ? 10.604  -8.184  -26.911 1.00 56.07  ? 339  LEU B CA  1 
ATOM   6713 C C   . LEU B 1 370 ? 10.334  -9.644  -27.298 1.00 57.14  ? 339  LEU B C   1 
ATOM   6714 O O   . LEU B 1 370 ? 11.150  -10.506 -26.997 1.00 57.47  ? 339  LEU B O   1 
ATOM   6715 C CB  . LEU B 1 370 ? 10.013  -7.871  -25.531 1.00 56.34  ? 339  LEU B CB  1 
ATOM   6716 C CG  . LEU B 1 370 ? 10.292  -6.453  -25.032 1.00 56.22  ? 339  LEU B CG  1 
ATOM   6717 C CD1 . LEU B 1 370 ? 9.738   -6.231  -23.643 1.00 56.61  ? 339  LEU B CD1 1 
ATOM   6718 C CD2 . LEU B 1 370 ? 11.783  -6.195  -25.076 1.00 57.04  ? 339  LEU B CD2 1 
ATOM   6719 N N   . VAL B 1 371 ? 9.201   -9.923  -27.946 1.00 57.62  ? 340  VAL B N   1 
ATOM   6720 C CA  . VAL B 1 371 ? 8.847   -11.314 -28.286 1.00 59.25  ? 340  VAL B CA  1 
ATOM   6721 C C   . VAL B 1 371 ? 9.592   -11.815 -29.517 1.00 59.66  ? 340  VAL B C   1 
ATOM   6722 O O   . VAL B 1 371 ? 9.593   -13.002 -29.802 1.00 60.08  ? 340  VAL B O   1 
ATOM   6723 C CB  . VAL B 1 371 ? 7.329   -11.517 -28.471 1.00 59.66  ? 340  VAL B CB  1 
ATOM   6724 C CG1 . VAL B 1 371 ? 6.563   -10.888 -27.316 1.00 60.61  ? 340  VAL B CG1 1 
ATOM   6725 C CG2 . VAL B 1 371 ? 6.838   -10.949 -29.782 1.00 59.33  ? 340  VAL B CG2 1 
ATOM   6726 N N   . TYR B 1 372 ? 10.236  -10.888 -30.229 1.00 59.91  ? 341  TYR B N   1 
ATOM   6727 C CA  . TYR B 1 372 ? 11.072  -11.211 -31.379 1.00 60.69  ? 341  TYR B CA  1 
ATOM   6728 C C   . TYR B 1 372 ? 12.528  -11.473 -31.004 1.00 62.10  ? 341  TYR B C   1 
ATOM   6729 O O   . TYR B 1 372 ? 13.413  -11.288 -31.839 1.00 63.14  ? 341  TYR B O   1 
ATOM   6730 C CB  . TYR B 1 372 ? 11.016  -10.068 -32.392 1.00 58.85  ? 341  TYR B CB  1 
ATOM   6731 C CG  . TYR B 1 372 ? 9.739   -10.052 -33.196 1.00 58.97  ? 341  TYR B CG  1 
ATOM   6732 C CD1 . TYR B 1 372 ? 8.642   -9.346  -32.768 1.00 59.24  ? 341  TYR B CD1 1 
ATOM   6733 C CD2 . TYR B 1 372 ? 9.638   -10.745 -34.390 1.00 58.49  ? 341  TYR B CD2 1 
ATOM   6734 C CE1 . TYR B 1 372 ? 7.474   -9.336  -33.505 1.00 59.85  ? 341  TYR B CE1 1 
ATOM   6735 C CE2 . TYR B 1 372 ? 8.484   -10.738 -35.122 1.00 58.19  ? 341  TYR B CE2 1 
ATOM   6736 C CZ  . TYR B 1 372 ? 7.402   -10.046 -34.682 1.00 58.46  ? 341  TYR B CZ  1 
ATOM   6737 O OH  . TYR B 1 372 ? 6.248   -10.022 -35.419 1.00 57.64  ? 341  TYR B OH  1 
ATOM   6738 N N   . GLY B 1 373 ? 12.806  -11.882 -29.768 1.00 63.49  ? 342  GLY B N   1 
ATOM   6739 C CA  . GLY B 1 373 ? 14.163  -12.292 -29.433 1.00 64.35  ? 342  GLY B CA  1 
ATOM   6740 C C   . GLY B 1 373 ? 14.678  -12.210 -28.003 1.00 64.77  ? 342  GLY B C   1 
ATOM   6741 O O   . GLY B 1 373 ? 15.818  -12.607 -27.755 1.00 66.29  ? 342  GLY B O   1 
ATOM   6742 N N   . VAL B 1 374 ? 13.891  -11.702 -27.064 1.00 63.56  ? 343  VAL B N   1 
ATOM   6743 C CA  . VAL B 1 374 ? 14.340  -11.648 -25.676 1.00 63.57  ? 343  VAL B CA  1 
ATOM   6744 C C   . VAL B 1 374 ? 13.796  -12.862 -24.935 1.00 64.28  ? 343  VAL B C   1 
ATOM   6745 O O   . VAL B 1 374 ? 12.589  -13.001 -24.806 1.00 63.81  ? 343  VAL B O   1 
ATOM   6746 C CB  . VAL B 1 374 ? 13.860  -10.366 -24.952 1.00 62.58  ? 343  VAL B CB  1 
ATOM   6747 C CG1 . VAL B 1 374 ? 14.517  -10.253 -23.561 1.00 62.37  ? 343  VAL B CG1 1 
ATOM   6748 C CG2 . VAL B 1 374 ? 14.133  -9.137  -25.810 1.00 61.65  ? 343  VAL B CG2 1 
ATOM   6749 N N   . PRO B 1 375 ? 14.662  -13.726 -24.422 1.00 65.25  ? 344  PRO B N   1 
ATOM   6750 C CA  . PRO B 1 375 ? 14.167  -14.907 -23.707 1.00 66.98  ? 344  PRO B CA  1 
ATOM   6751 C C   . PRO B 1 375 ? 13.220  -14.472 -22.587 1.00 66.76  ? 344  PRO B C   1 
ATOM   6752 O O   . PRO B 1 375 ? 13.531  -13.493 -21.904 1.00 66.07  ? 344  PRO B O   1 
ATOM   6753 C CB  . PRO B 1 375 ? 15.445  -15.553 -23.130 1.00 68.50  ? 344  PRO B CB  1 
ATOM   6754 C CG  . PRO B 1 375 ? 16.598  -15.000 -23.962 1.00 67.71  ? 344  PRO B CG  1 
ATOM   6755 C CD  . PRO B 1 375 ? 16.136  -13.647 -24.438 1.00 65.74  ? 344  PRO B CD  1 
ATOM   6756 N N   . GLY B 1 376 ? 12.088  -15.166 -22.444 1.00 67.18  ? 345  GLY B N   1 
ATOM   6757 C CA  . GLY B 1 376 ? 11.138  -14.935 -21.374 1.00 67.11  ? 345  GLY B CA  1 
ATOM   6758 C C   . GLY B 1 376 ? 9.876   -14.247 -21.850 1.00 66.26  ? 345  GLY B C   1 
ATOM   6759 O O   . GLY B 1 376 ? 8.885   -14.171 -21.119 1.00 66.78  ? 345  GLY B O   1 
ATOM   6760 N N   . PHE B 1 377 ? 9.902   -13.726 -23.071 1.00 64.95  ? 346  PHE B N   1 
ATOM   6761 C CA  . PHE B 1 377 ? 8.786   -12.943 -23.580 1.00 63.90  ? 346  PHE B CA  1 
ATOM   6762 C C   . PHE B 1 377 ? 8.062   -13.695 -24.674 1.00 65.15  ? 346  PHE B C   1 
ATOM   6763 O O   . PHE B 1 377 ? 8.695   -14.295 -25.542 1.00 65.69  ? 346  PHE B O   1 
ATOM   6764 C CB  . PHE B 1 377 ? 9.275   -11.588 -24.100 1.00 62.18  ? 346  PHE B CB  1 
ATOM   6765 C CG  . PHE B 1 377 ? 9.722   -10.661 -23.012 1.00 59.84  ? 346  PHE B CG  1 
ATOM   6766 C CD1 . PHE B 1 377 ? 10.978  -10.788 -22.459 1.00 59.51  ? 346  PHE B CD1 1 
ATOM   6767 C CD2 . PHE B 1 377 ? 8.864   -9.690  -22.515 1.00 58.03  ? 346  PHE B CD2 1 
ATOM   6768 C CE1 . PHE B 1 377 ? 11.389  -9.942  -21.445 1.00 59.30  ? 346  PHE B CE1 1 
ATOM   6769 C CE2 . PHE B 1 377 ? 9.257   -8.850  -21.512 1.00 56.94  ? 346  PHE B CE2 1 
ATOM   6770 C CZ  . PHE B 1 377 ? 10.529  -8.967  -20.974 1.00 58.45  ? 346  PHE B CZ  1 
ATOM   6771 N N   . SER B 1 378 ? 6.728   -13.660 -24.593 1.00 66.16  ? 347  SER B N   1 
ATOM   6772 C CA  . SER B 1 378 ? 5.818   -14.307 -25.534 1.00 66.68  ? 347  SER B CA  1 
ATOM   6773 C C   . SER B 1 378 ? 4.499   -13.553 -25.553 1.00 66.34  ? 347  SER B C   1 
ATOM   6774 O O   . SER B 1 378 ? 4.135   -12.898 -24.569 1.00 67.04  ? 347  SER B O   1 
ATOM   6775 C CB  . SER B 1 378 ? 5.571   -15.749 -25.095 1.00 69.19  ? 347  SER B CB  1 
ATOM   6776 O OG  . SER B 1 378 ? 4.522   -16.376 -25.832 1.00 70.59  ? 347  SER B OG  1 
ATOM   6777 N N   . LYS B 1 379 ? 3.784   -13.633 -26.671 1.00 66.03  ? 348  LYS B N   1 
ATOM   6778 C CA  . LYS B 1 379 ? 2.463   -13.015 -26.788 1.00 65.67  ? 348  LYS B CA  1 
ATOM   6779 C C   . LYS B 1 379 ? 1.392   -13.829 -26.047 1.00 67.36  ? 348  LYS B C   1 
ATOM   6780 O O   . LYS B 1 379 ? 0.339   -13.307 -25.699 1.00 66.96  ? 348  LYS B O   1 
ATOM   6781 C CB  . LYS B 1 379 ? 2.081   -12.847 -28.264 1.00 64.90  ? 348  LYS B CB  1 
ATOM   6782 C CG  . LYS B 1 379 ? 1.208   -13.945 -28.829 1.00 65.97  ? 348  LYS B CG  1 
ATOM   6783 C CD  . LYS B 1 379 ? 0.751   -13.637 -30.236 1.00 64.71  ? 348  LYS B CD  1 
ATOM   6784 C CE  . LYS B 1 379 ? 0.108   -14.851 -30.883 1.00 65.16  ? 348  LYS B CE  1 
ATOM   6785 N NZ  . LYS B 1 379 ? -1.116  -15.278 -30.151 1.00 65.95  ? 348  LYS B NZ  1 
ATOM   6786 N N   . ASP B 1 380 ? 1.675   -15.105 -25.810 1.00 69.43  ? 349  ASP B N   1 
ATOM   6787 C CA  . ASP B 1 380 ? 0.679   -16.062 -25.305 1.00 71.89  ? 349  ASP B CA  1 
ATOM   6788 C C   . ASP B 1 380 ? 0.641   -16.240 -23.774 1.00 73.32  ? 349  ASP B C   1 
ATOM   6789 O O   . ASP B 1 380 ? -0.177  -17.009 -23.267 1.00 74.98  ? 349  ASP B O   1 
ATOM   6790 C CB  . ASP B 1 380 ? 0.869   -17.435 -26.001 1.00 73.09  ? 349  ASP B CB  1 
ATOM   6791 C CG  . ASP B 1 380 ? 0.713   -17.352 -27.521 1.00 72.70  ? 349  ASP B CG  1 
ATOM   6792 O OD1 . ASP B 1 380 ? -0.136  -16.552 -27.981 1.00 71.45  ? 349  ASP B OD1 1 
ATOM   6793 O OD2 . ASP B 1 380 ? 1.391   -18.034 -28.331 1.00 73.21  ? 349  ASP B OD2 1 
ATOM   6794 N N   . ASN B 1 381 ? 1.522   -15.547 -23.051 1.00 73.08  ? 350  ASN B N   1 
ATOM   6795 C CA  . ASN B 1 381 ? 1.480   -15.487 -21.579 1.00 73.76  ? 350  ASN B CA  1 
ATOM   6796 C C   . ASN B 1 381 ? 1.826   -14.060 -21.111 1.00 71.79  ? 350  ASN B C   1 
ATOM   6797 O O   . ASN B 1 381 ? 2.068   -13.170 -21.939 1.00 70.17  ? 350  ASN B O   1 
ATOM   6798 C CB  . ASN B 1 381 ? 2.380   -16.589 -20.931 1.00 74.83  ? 350  ASN B CB  1 
ATOM   6799 C CG  . ASN B 1 381 ? 3.890   -16.422 -21.240 1.00 75.13  ? 350  ASN B CG  1 
ATOM   6800 O OD1 . ASN B 1 381 ? 4.436   -15.297 -21.239 1.00 73.91  ? 350  ASN B OD1 1 
ATOM   6801 N ND2 . ASN B 1 381 ? 4.572   -17.541 -21.487 1.00 73.83  ? 350  ASN B ND2 1 
ATOM   6802 N N   . GLU B 1 382 ? 1.847   -13.843 -19.796 1.00 71.84  ? 351  GLU B N   1 
ATOM   6803 C CA  . GLU B 1 382 ? 2.020   -12.499 -19.218 1.00 70.30  ? 351  GLU B CA  1 
ATOM   6804 C C   . GLU B 1 382 ? 3.488   -12.020 -19.171 1.00 67.75  ? 351  GLU B C   1 
ATOM   6805 O O   . GLU B 1 382 ? 3.759   -10.886 -18.782 1.00 66.14  ? 351  GLU B O   1 
ATOM   6806 C CB  . GLU B 1 382 ? 1.390   -12.445 -17.816 1.00 72.05  ? 351  GLU B CB  1 
ATOM   6807 C CG  . GLU B 1 382 ? -0.136  -12.351 -17.784 1.00 75.59  ? 351  GLU B CG  1 
ATOM   6808 C CD  . GLU B 1 382 ? -0.631  -11.327 -16.766 1.00 80.73  ? 351  GLU B CD  1 
ATOM   6809 O OE1 . GLU B 1 382 ? -0.668  -10.109 -17.133 1.00 84.12  ? 351  GLU B OE1 1 
ATOM   6810 O OE2 . GLU B 1 382 ? -0.947  -11.717 -15.603 1.00 81.08  ? 351  GLU B OE2 1 
ATOM   6811 N N   . SER B 1 383 ? 4.415   -12.893 -19.546 1.00 67.02  ? 352  SER B N   1 
ATOM   6812 C CA  . SER B 1 383 ? 5.831   -12.560 -19.700 1.00 65.89  ? 352  SER B CA  1 
ATOM   6813 C C   . SER B 1 383 ? 6.446   -11.950 -18.433 1.00 65.84  ? 352  SER B C   1 
ATOM   6814 O O   . SER B 1 383 ? 7.209   -10.981 -18.481 1.00 64.82  ? 352  SER B O   1 
ATOM   6815 C CB  . SER B 1 383 ? 6.026   -11.667 -20.913 1.00 64.27  ? 352  SER B CB  1 
ATOM   6816 O OG  . SER B 1 383 ? 5.396   -12.226 -22.042 1.00 63.99  ? 352  SER B OG  1 
ATOM   6817 N N   . LEU B 1 384 ? 6.093   -12.533 -17.296 1.00 67.09  ? 353  LEU B N   1 
ATOM   6818 C CA  . LEU B 1 384 ? 6.662   -12.142 -16.015 1.00 67.40  ? 353  LEU B CA  1 
ATOM   6819 C C   . LEU B 1 384 ? 8.075   -12.699 -15.964 1.00 67.49  ? 353  LEU B C   1 
ATOM   6820 O O   . LEU B 1 384 ? 8.258   -13.881 -16.034 1.00 69.58  ? 353  LEU B O   1 
ATOM   6821 C CB  . LEU B 1 384 ? 5.795   -12.679 -14.875 1.00 68.74  ? 353  LEU B CB  1 
ATOM   6822 C CG  . LEU B 1 384 ? 4.340   -12.172 -14.890 1.00 69.37  ? 353  LEU B CG  1 
ATOM   6823 C CD1 . LEU B 1 384 ? 3.453   -12.931 -13.907 1.00 72.53  ? 353  LEU B CD1 1 
ATOM   6824 C CD2 . LEU B 1 384 ? 4.271   -10.672 -14.587 1.00 68.53  ? 353  LEU B CD2 1 
ATOM   6825 N N   . ILE B 1 385 ? 9.077   -11.839 -15.881 1.00 66.05  ? 354  ILE B N   1 
ATOM   6826 C CA  . ILE B 1 385 ? 10.460  -12.280 -15.984 1.00 66.08  ? 354  ILE B CA  1 
ATOM   6827 C C   . ILE B 1 385 ? 11.244  -12.068 -14.682 1.00 66.69  ? 354  ILE B C   1 
ATOM   6828 O O   . ILE B 1 385 ? 10.898  -11.235 -13.835 1.00 65.38  ? 354  ILE B O   1 
ATOM   6829 C CB  . ILE B 1 385 ? 11.155  -11.576 -17.162 1.00 64.84  ? 354  ILE B CB  1 
ATOM   6830 C CG1 . ILE B 1 385 ? 11.028  -10.046 -17.076 1.00 64.41  ? 354  ILE B CG1 1 
ATOM   6831 C CG2 . ILE B 1 385 ? 10.549  -12.045 -18.463 1.00 66.18  ? 354  ILE B CG2 1 
ATOM   6832 C CD1 . ILE B 1 385 ? 12.233  -9.299  -17.643 1.00 63.99  ? 354  ILE B CD1 1 
ATOM   6833 N N   . SER B 1 386 ? 12.313  -12.844 -14.547 1.00 68.29  ? 355  SER B N   1 
ATOM   6834 C CA  . SER B 1 386 ? 13.240  -12.734 -13.427 1.00 69.53  ? 355  SER B CA  1 
ATOM   6835 C C   . SER B 1 386 ? 14.228  -11.595 -13.674 1.00 68.46  ? 355  SER B C   1 
ATOM   6836 O O   . SER B 1 386 ? 14.373  -11.096 -14.810 1.00 66.79  ? 355  SER B O   1 
ATOM   6837 C CB  . SER B 1 386 ? 14.039  -14.026 -13.304 1.00 71.56  ? 355  SER B CB  1 
ATOM   6838 O OG  . SER B 1 386 ? 14.961  -14.098 -14.391 1.00 71.96  ? 355  SER B OG  1 
ATOM   6839 N N   . ARG B 1 387 ? 14.927  -11.233 -12.604 1.00 69.37  ? 356  ARG B N   1 
ATOM   6840 C CA  . ARG B 1 387 ? 16.033  -10.293 -12.666 1.00 69.28  ? 356  ARG B CA  1 
ATOM   6841 C C   . ARG B 1 387 ? 17.103  -10.731 -13.672 1.00 69.10  ? 356  ARG B C   1 
ATOM   6842 O O   . ARG B 1 387 ? 17.555  -9.925  -14.485 1.00 67.83  ? 356  ARG B O   1 
ATOM   6843 C CB  . ARG B 1 387 ? 16.659  -10.147 -11.283 1.00 70.71  ? 356  ARG B CB  1 
ATOM   6844 C CG  . ARG B 1 387 ? 17.664  -9.012  -11.202 1.00 72.29  ? 356  ARG B CG  1 
ATOM   6845 C CD  . ARG B 1 387 ? 17.575  -8.158  -9.936  1.00 74.19  ? 356  ARG B CD  1 
ATOM   6846 N NE  . ARG B 1 387 ? 18.565  -7.092  -10.022 1.00 75.72  ? 356  ARG B NE  1 
ATOM   6847 C CZ  . ARG B 1 387 ? 18.330  -5.858  -10.477 1.00 76.16  ? 356  ARG B CZ  1 
ATOM   6848 N NH1 . ARG B 1 387 ? 17.109  -5.492  -10.862 1.00 74.90  ? 356  ARG B NH1 1 
ATOM   6849 N NH2 . ARG B 1 387 ? 19.328  -4.972  -10.523 1.00 77.04  ? 356  ARG B NH2 1 
ATOM   6850 N N   . ALA B 1 388 ? 17.493  -12.006 -13.624 1.00 70.29  ? 357  ALA B N   1 
ATOM   6851 C CA  . ALA B 1 388 ? 18.534  -12.523 -14.513 1.00 70.41  ? 357  ALA B CA  1 
ATOM   6852 C C   . ALA B 1 388 ? 18.141  -12.315 -15.973 1.00 68.37  ? 357  ALA B C   1 
ATOM   6853 O O   . ALA B 1 388 ? 18.971  -11.926 -16.787 1.00 67.61  ? 357  ALA B O   1 
ATOM   6854 C CB  . ALA B 1 388 ? 18.814  -14.040 -14.209 1.00 72.49  ? 357  ALA B CB  1 
ATOM   6855 N N   . GLN B 1 389 ? 16.864  -12.557 -16.268 1.00 67.84  ? 358  GLN B N   1 
ATOM   6856 C CA  . GLN B 1 389 ? 16.300  -12.404 -17.605 1.00 66.44  ? 358  GLN B CA  1 
ATOM   6857 C C   . GLN B 1 389 ? 16.293  -10.929 -18.019 1.00 64.26  ? 358  GLN B C   1 
ATOM   6858 O O   . GLN B 1 389 ? 16.447  -10.603 -19.200 1.00 62.49  ? 358  GLN B O   1 
ATOM   6859 C CB  . GLN B 1 389 ? 14.875  -12.982 -17.642 1.00 66.87  ? 358  GLN B CB  1 
ATOM   6860 C CG  . GLN B 1 389 ? 14.808  -14.529 -17.621 1.00 69.30  ? 358  GLN B CG  1 
ATOM   6861 C CD  . GLN B 1 389 ? 13.363  -15.058 -17.468 1.00 71.42  ? 358  GLN B CD  1 
ATOM   6862 O OE1 . GLN B 1 389 ? 12.635  -14.609 -16.579 1.00 70.98  ? 358  GLN B OE1 1 
ATOM   6863 N NE2 . GLN B 1 389 ? 12.956  -16.005 -18.337 1.00 69.87  ? 358  GLN B NE2 1 
ATOM   6864 N N   . PHE B 1 390 ? 16.124  -10.040 -17.038 1.00 63.67  ? 359  PHE B N   1 
ATOM   6865 C CA  . PHE B 1 390 ? 16.166  -8.602  -17.289 1.00 61.76  ? 359  PHE B CA  1 
ATOM   6866 C C   . PHE B 1 390 ? 17.572  -8.162  -17.689 1.00 61.66  ? 359  PHE B C   1 
ATOM   6867 O O   . PHE B 1 390 ? 17.714  -7.459  -18.692 1.00 59.70  ? 359  PHE B O   1 
ATOM   6868 C CB  . PHE B 1 390 ? 15.631  -7.821  -16.085 1.00 62.00  ? 359  PHE B CB  1 
ATOM   6869 C CG  . PHE B 1 390 ? 15.701  -6.318  -16.232 1.00 60.54  ? 359  PHE B CG  1 
ATOM   6870 C CD1 . PHE B 1 390 ? 16.325  -5.542  -15.266 1.00 60.77  ? 359  PHE B CD1 1 
ATOM   6871 C CD2 . PHE B 1 390 ? 15.150  -5.677  -17.329 1.00 60.04  ? 359  PHE B CD2 1 
ATOM   6872 C CE1 . PHE B 1 390 ? 16.412  -4.151  -15.406 1.00 58.98  ? 359  PHE B CE1 1 
ATOM   6873 C CE2 . PHE B 1 390 ? 15.242  -4.281  -17.464 1.00 58.02  ? 359  PHE B CE2 1 
ATOM   6874 C CZ  . PHE B 1 390 ? 15.863  -3.534  -16.496 1.00 57.05  ? 359  PHE B CZ  1 
ATOM   6875 N N   . LEU B 1 391 ? 18.606  -8.602  -16.964 1.00 63.41  ? 360  LEU B N   1 
ATOM   6876 C CA  . LEU B 1 391 ? 19.993  -8.241  -17.316 1.00 64.55  ? 360  LEU B CA  1 
ATOM   6877 C C   . LEU B 1 391 ? 20.360  -8.738  -18.700 1.00 64.05  ? 360  LEU B C   1 
ATOM   6878 O O   . LEU B 1 391 ? 21.046  -8.049  -19.446 1.00 63.56  ? 360  LEU B O   1 
ATOM   6879 C CB  . LEU B 1 391 ? 21.021  -8.842  -16.353 1.00 66.71  ? 360  LEU B CB  1 
ATOM   6880 C CG  . LEU B 1 391 ? 21.045  -8.524  -14.846 1.00 70.40  ? 360  LEU B CG  1 
ATOM   6881 C CD1 . LEU B 1 391 ? 22.508  -8.395  -14.350 1.00 73.51  ? 360  LEU B CD1 1 
ATOM   6882 C CD2 . LEU B 1 391 ? 20.228  -7.278  -14.449 1.00 70.78  ? 360  LEU B CD2 1 
ATOM   6883 N N   . ALA B 1 392 ? 19.910  -9.946  -19.022 1.00 64.35  ? 361  ALA B N   1 
ATOM   6884 C CA  . ALA B 1 392 ? 20.193  -10.571 -20.309 1.00 64.23  ? 361  ALA B CA  1 
ATOM   6885 C C   . ALA B 1 392 ? 19.418  -9.880  -21.413 1.00 62.27  ? 361  ALA B C   1 
ATOM   6886 O O   . ALA B 1 392 ? 19.926  -9.700  -22.521 1.00 61.80  ? 361  ALA B O   1 
ATOM   6887 C CB  . ALA B 1 392 ? 19.865  -12.112 -20.263 1.00 65.47  ? 361  ALA B CB  1 
ATOM   6888 N N   . GLY B 1 393 ? 18.195  -9.466  -21.102 1.00 61.49  ? 362  GLY B N   1 
ATOM   6889 C CA  . GLY B 1 393 ? 17.389  -8.711  -22.042 1.00 60.17  ? 362  GLY B CA  1 
ATOM   6890 C C   . GLY B 1 393 ? 18.016  -7.369  -22.397 1.00 59.04  ? 362  GLY B C   1 
ATOM   6891 O O   . GLY B 1 393 ? 17.916  -6.928  -23.529 1.00 58.01  ? 362  GLY B O   1 
ATOM   6892 N N   . VAL B 1 394 ? 18.686  -6.741  -21.433 1.00 59.70  ? 363  VAL B N   1 
ATOM   6893 C CA  . VAL B 1 394 ? 19.319  -5.432  -21.641 1.00 59.30  ? 363  VAL B CA  1 
ATOM   6894 C C   . VAL B 1 394 ? 20.521  -5.528  -22.586 1.00 60.51  ? 363  VAL B C   1 
ATOM   6895 O O   . VAL B 1 394 ? 20.694  -4.643  -23.413 1.00 59.70  ? 363  VAL B O   1 
ATOM   6896 C CB  . VAL B 1 394 ? 19.671  -4.748  -20.288 1.00 59.52  ? 363  VAL B CB  1 
ATOM   6897 C CG1 . VAL B 1 394 ? 20.647  -3.564  -20.453 1.00 58.28  ? 363  VAL B CG1 1 
ATOM   6898 C CG2 . VAL B 1 394 ? 18.373  -4.301  -19.595 1.00 58.34  ? 363  VAL B CG2 1 
ATOM   6899 N N   . ARG B 1 395 ? 21.309  -6.601  -22.499 1.00 62.76  ? 364  ARG B N   1 
ATOM   6900 C CA  . ARG B 1 395 ? 22.432  -6.799  -23.414 1.00 64.16  ? 364  ARG B CA  1 
ATOM   6901 C C   . ARG B 1 395 ? 21.955  -6.930  -24.852 1.00 64.13  ? 364  ARG B C   1 
ATOM   6902 O O   . ARG B 1 395 ? 22.630  -6.503  -25.772 1.00 63.91  ? 364  ARG B O   1 
ATOM   6903 C CB  . ARG B 1 395 ? 23.231  -8.047  -23.062 1.00 65.88  ? 364  ARG B CB  1 
ATOM   6904 C CG  . ARG B 1 395 ? 23.707  -8.134  -21.612 1.00 68.34  ? 364  ARG B CG  1 
ATOM   6905 C CD  . ARG B 1 395 ? 24.211  -6.824  -21.004 1.00 68.96  ? 364  ARG B CD  1 
ATOM   6906 N NE  . ARG B 1 395 ? 25.319  -6.239  -21.770 1.00 69.60  ? 364  ARG B NE  1 
ATOM   6907 C CZ  . ARG B 1 395 ? 26.621  -6.478  -21.552 1.00 72.30  ? 364  ARG B CZ  1 
ATOM   6908 N NH1 . ARG B 1 395 ? 27.032  -7.310  -20.589 1.00 72.24  ? 364  ARG B NH1 1 
ATOM   6909 N NH2 . ARG B 1 395 ? 27.525  -5.871  -22.312 1.00 72.77  ? 364  ARG B NH2 1 
ATOM   6910 N N   . ILE B 1 396 ? 20.779  -7.524  -25.023 1.00 64.83  ? 365  ILE B N   1 
ATOM   6911 C CA  . ILE B 1 396 ? 20.170  -7.745  -26.329 1.00 64.60  ? 365  ILE B CA  1 
ATOM   6912 C C   . ILE B 1 396 ? 19.492  -6.470  -26.848 1.00 62.92  ? 365  ILE B C   1 
ATOM   6913 O O   . ILE B 1 396 ? 19.567  -6.146  -28.040 1.00 62.18  ? 365  ILE B O   1 
ATOM   6914 C CB  . ILE B 1 396 ? 19.144  -8.921  -26.198 1.00 65.52  ? 365  ILE B CB  1 
ATOM   6915 C CG1 . ILE B 1 396 ? 19.896  -10.223 -25.950 1.00 67.92  ? 365  ILE B CG1 1 
ATOM   6916 C CG2 . ILE B 1 396 ? 18.244  -9.058  -27.435 1.00 65.33  ? 365  ILE B CG2 1 
ATOM   6917 C CD1 . ILE B 1 396 ? 18.976  -11.424 -25.821 1.00 70.45  ? 365  ILE B CD1 1 
ATOM   6918 N N   . GLY B 1 397 ? 18.821  -5.763  -25.946 1.00 62.33  ? 366  GLY B N   1 
ATOM   6919 C CA  . GLY B 1 397 ? 18.115  -4.540  -26.286 1.00 61.26  ? 366  GLY B CA  1 
ATOM   6920 C C   . GLY B 1 397 ? 19.010  -3.311  -26.396 1.00 60.41  ? 366  GLY B C   1 
ATOM   6921 O O   . GLY B 1 397 ? 18.596  -2.309  -26.963 1.00 60.08  ? 366  GLY B O   1 
ATOM   6922 N N   . VAL B 1 398 ? 20.221  -3.398  -25.856 1.00 60.59  ? 367  VAL B N   1 
ATOM   6923 C CA  . VAL B 1 398 ? 21.205  -2.342  -25.972 1.00 60.50  ? 367  VAL B CA  1 
ATOM   6924 C C   . VAL B 1 398 ? 22.497  -3.023  -26.391 1.00 62.24  ? 367  VAL B C   1 
ATOM   6925 O O   . VAL B 1 398 ? 23.474  -3.042  -25.657 1.00 63.00  ? 367  VAL B O   1 
ATOM   6926 C CB  . VAL B 1 398 ? 21.397  -1.523  -24.664 1.00 60.12  ? 367  VAL B CB  1 
ATOM   6927 C CG1 . VAL B 1 398 ? 22.100  -0.224  -24.962 1.00 58.27  ? 367  VAL B CG1 1 
ATOM   6928 C CG2 . VAL B 1 398 ? 20.075  -1.245  -23.981 1.00 58.97  ? 367  VAL B CG2 1 
ATOM   6929 N N   . PRO B 1 399 ? 22.494  -3.578  -27.595 1.00 63.71  ? 368  PRO B N   1 
ATOM   6930 C CA  . PRO B 1 399 ? 23.565  -4.477  -28.043 1.00 65.48  ? 368  PRO B CA  1 
ATOM   6931 C C   . PRO B 1 399 ? 24.917  -3.825  -28.181 1.00 66.97  ? 368  PRO B C   1 
ATOM   6932 O O   . PRO B 1 399 ? 25.919  -4.516  -28.114 1.00 68.07  ? 368  PRO B O   1 
ATOM   6933 C CB  . PRO B 1 399 ? 23.060  -4.945  -29.408 1.00 65.14  ? 368  PRO B CB  1 
ATOM   6934 C CG  . PRO B 1 399 ? 22.187  -3.855  -29.880 1.00 63.31  ? 368  PRO B CG  1 
ATOM   6935 C CD  . PRO B 1 399 ? 21.474  -3.383  -28.649 1.00 62.80  ? 368  PRO B CD  1 
ATOM   6936 N N   . GLN B 1 400 ? 24.943  -2.512  -28.367 1.00 68.05  ? 369  GLN B N   1 
ATOM   6937 C CA  . GLN B 1 400 ? 26.196  -1.781  -28.563 1.00 69.86  ? 369  GLN B CA  1 
ATOM   6938 C C   . GLN B 1 400 ? 26.846  -1.389  -27.231 1.00 71.04  ? 369  GLN B C   1 
ATOM   6939 O O   . GLN B 1 400 ? 27.966  -0.868  -27.212 1.00 72.07  ? 369  GLN B O   1 
ATOM   6940 C CB  . GLN B 1 400 ? 25.949  -0.561  -29.476 1.00 69.32  ? 369  GLN B CB  1 
ATOM   6941 C CG  . GLN B 1 400 ? 25.647  0.803   -28.791 1.00 71.48  ? 369  GLN B CG  1 
ATOM   6942 C CD  . GLN B 1 400 ? 24.207  0.985   -28.244 1.00 73.37  ? 369  GLN B CD  1 
ATOM   6943 O OE1 . GLN B 1 400 ? 24.002  1.866   -27.391 1.00 74.89  ? 369  GLN B OE1 1 
ATOM   6944 N NE2 . GLN B 1 400 ? 23.231  0.172   -28.715 1.00 69.99  ? 369  GLN B NE2 1 
ATOM   6945 N N   . ALA B 1 401 ? 26.159  -1.681  -26.126 1.00 71.28  ? 370  ALA B N   1 
ATOM   6946 C CA  . ALA B 1 401 ? 26.565  -1.229  -24.790 1.00 72.22  ? 370  ALA B CA  1 
ATOM   6947 C C   . ALA B 1 401 ? 27.605  -2.086  -24.122 1.00 73.67  ? 370  ALA B C   1 
ATOM   6948 O O   . ALA B 1 401 ? 27.471  -3.304  -24.083 1.00 74.21  ? 370  ALA B O   1 
ATOM   6949 C CB  . ALA B 1 401 ? 25.334  -1.169  -23.859 1.00 71.90  ? 370  ALA B CB  1 
ATOM   6950 N N   . SER B 1 402 ? 28.603  -1.437  -23.531 1.00 74.50  ? 371  SER B N   1 
ATOM   6951 C CA  . SER B 1 402 ? 29.624  -2.138  -22.745 1.00 76.21  ? 371  SER B CA  1 
ATOM   6952 C C   . SER B 1 402 ? 29.035  -2.730  -21.462 1.00 76.34  ? 371  SER B C   1 
ATOM   6953 O O   . SER B 1 402 ? 27.855  -2.552  -21.177 1.00 75.59  ? 371  SER B O   1 
ATOM   6954 C CB  . SER B 1 402 ? 30.767  -1.186  -22.386 1.00 77.02  ? 371  SER B CB  1 
ATOM   6955 O OG  . SER B 1 402 ? 30.375  -0.278  -21.377 1.00 77.22  ? 371  SER B OG  1 
ATOM   6956 N N   . ASP B 1 403 ? 29.858  -3.427  -20.686 1.00 77.64  ? 372  ASP B N   1 
ATOM   6957 C CA  . ASP B 1 403 ? 29.400  -4.015  -19.418 1.00 77.97  ? 372  ASP B CA  1 
ATOM   6958 C C   . ASP B 1 403 ? 28.938  -2.910  -18.471 1.00 76.44  ? 372  ASP B C   1 
ATOM   6959 O O   . ASP B 1 403 ? 27.853  -2.991  -17.889 1.00 75.68  ? 372  ASP B O   1 
ATOM   6960 C CB  . ASP B 1 403 ? 30.518  -4.813  -18.718 1.00 79.96  ? 372  ASP B CB  1 
ATOM   6961 C CG  . ASP B 1 403 ? 30.802  -6.159  -19.378 1.00 81.72  ? 372  ASP B CG  1 
ATOM   6962 O OD1 . ASP B 1 403 ? 30.249  -6.442  -20.462 1.00 81.47  ? 372  ASP B OD1 1 
ATOM   6963 O OD2 . ASP B 1 403 ? 31.583  -6.997  -18.878 1.00 83.06  ? 372  ASP B OD2 1 
ATOM   6964 N N   . LEU B 1 404 ? 29.782  -1.886  -18.327 1.00 75.36  ? 373  LEU B N   1 
ATOM   6965 C CA  . LEU B 1 404 ? 29.500  -0.764  -17.439 1.00 73.80  ? 373  LEU B CA  1 
ATOM   6966 C C   . LEU B 1 404 ? 28.215  -0.006  -17.832 1.00 71.37  ? 373  LEU B C   1 
ATOM   6967 O O   . LEU B 1 404 ? 27.390  0.314   -16.978 1.00 70.68  ? 373  LEU B O   1 
ATOM   6968 C CB  . LEU B 1 404 ? 30.687  0.188   -17.409 1.00 74.07  ? 373  LEU B CB  1 
ATOM   6969 C CG  . LEU B 1 404 ? 30.555  1.425   -16.517 1.00 73.16  ? 373  LEU B CG  1 
ATOM   6970 C CD1 . LEU B 1 404 ? 30.182  1.053   -15.088 1.00 73.19  ? 373  LEU B CD1 1 
ATOM   6971 C CD2 . LEU B 1 404 ? 31.867  2.203   -16.572 1.00 73.60  ? 373  LEU B CD2 1 
ATOM   6972 N N   . ALA B 1 405 ? 28.065  0.270   -19.125 1.00 69.46  ? 374  ALA B N   1 
ATOM   6973 C CA  . ALA B 1 405 ? 26.906  0.966   -19.644 1.00 67.40  ? 374  ALA B CA  1 
ATOM   6974 C C   . ALA B 1 405 ? 25.618  0.173   -19.437 1.00 66.29  ? 374  ALA B C   1 
ATOM   6975 O O   . ALA B 1 405 ? 24.584  0.758   -19.140 1.00 65.17  ? 374  ALA B O   1 
ATOM   6976 C CB  . ALA B 1 405 ? 27.110  1.300   -21.118 1.00 66.80  ? 374  ALA B CB  1 
ATOM   6977 N N   . ALA B 1 406 ? 25.690  -1.146  -19.569 1.00 66.44  ? 375  ALA B N   1 
ATOM   6978 C CA  . ALA B 1 406 ? 24.529  -2.007  -19.372 1.00 66.16  ? 375  ALA B CA  1 
ATOM   6979 C C   . ALA B 1 406 ? 24.189  -2.108  -17.898 1.00 66.70  ? 375  ALA B C   1 
ATOM   6980 O O   . ALA B 1 406 ? 23.036  -2.275  -17.537 1.00 66.47  ? 375  ALA B O   1 
ATOM   6981 C CB  . ALA B 1 406 ? 24.780  -3.388  -19.948 1.00 66.93  ? 375  ALA B CB  1 
ATOM   6982 N N   . GLU B 1 407 ? 25.194  -1.984  -17.041 1.00 67.39  ? 376  GLU B N   1 
ATOM   6983 C CA  . GLU B 1 407 ? 24.944  -1.944  -15.608 1.00 67.59  ? 376  GLU B CA  1 
ATOM   6984 C C   . GLU B 1 407 ? 24.252  -0.608  -15.256 1.00 64.46  ? 376  GLU B C   1 
ATOM   6985 O O   . GLU B 1 407 ? 23.327  -0.577  -14.459 1.00 63.34  ? 376  GLU B O   1 
ATOM   6986 C CB  . GLU B 1 407 ? 26.258  -2.171  -14.836 1.00 69.55  ? 376  GLU B CB  1 
ATOM   6987 C CG  . GLU B 1 407 ? 26.112  -2.487  -13.346 1.00 74.29  ? 376  GLU B CG  1 
ATOM   6988 C CD  . GLU B 1 407 ? 25.277  -3.737  -13.054 1.00 79.17  ? 376  GLU B CD  1 
ATOM   6989 O OE1 . GLU B 1 407 ? 25.402  -4.731  -13.817 1.00 81.63  ? 376  GLU B OE1 1 
ATOM   6990 O OE2 . GLU B 1 407 ? 24.490  -3.724  -12.063 1.00 80.86  ? 376  GLU B OE2 1 
ATOM   6991 N N   . ALA B 1 408 ? 24.659  0.482   -15.897 1.00 62.02  ? 377  ALA B N   1 
ATOM   6992 C CA  . ALA B 1 408 ? 23.974  1.757   -15.686 1.00 59.95  ? 377  ALA B CA  1 
ATOM   6993 C C   . ALA B 1 408 ? 22.512  1.693   -16.144 1.00 58.07  ? 377  ALA B C   1 
ATOM   6994 O O   . ALA B 1 408 ? 21.656  2.272   -15.508 1.00 57.29  ? 377  ALA B O   1 
ATOM   6995 C CB  . ALA B 1 408 ? 24.692  2.918   -16.372 1.00 59.14  ? 377  ALA B CB  1 
ATOM   6996 N N   . VAL B 1 409 ? 22.223  0.998   -17.241 1.00 56.93  ? 378  VAL B N   1 
ATOM   6997 C CA  . VAL B 1 409 ? 20.856  0.882   -17.702 1.00 55.69  ? 378  VAL B CA  1 
ATOM   6998 C C   . VAL B 1 409 ? 20.053  0.086   -16.685 1.00 55.85  ? 378  VAL B C   1 
ATOM   6999 O O   . VAL B 1 409 ? 18.964  0.504   -16.292 1.00 54.98  ? 378  VAL B O   1 
ATOM   7000 C CB  . VAL B 1 409 ? 20.759  0.214   -19.074 1.00 55.44  ? 378  VAL B CB  1 
ATOM   7001 C CG1 . VAL B 1 409 ? 19.311  -0.069  -19.443 1.00 54.72  ? 378  VAL B CG1 1 
ATOM   7002 C CG2 . VAL B 1 409 ? 21.363  1.100   -20.129 1.00 55.56  ? 378  VAL B CG2 1 
ATOM   7003 N N   . VAL B 1 410 ? 20.590  -1.042  -16.251 1.00 56.36  ? 379  VAL B N   1 
ATOM   7004 C CA  . VAL B 1 410 ? 19.911  -1.880  -15.274 1.00 57.24  ? 379  VAL B CA  1 
ATOM   7005 C C   . VAL B 1 410 ? 19.661  -1.119  -13.958 1.00 57.65  ? 379  VAL B C   1 
ATOM   7006 O O   . VAL B 1 410 ? 18.554  -1.151  -13.398 1.00 56.72  ? 379  VAL B O   1 
ATOM   7007 C CB  . VAL B 1 410 ? 20.720  -3.172  -14.971 1.00 58.76  ? 379  VAL B CB  1 
ATOM   7008 C CG1 . VAL B 1 410 ? 20.157  -3.921  -13.751 1.00 58.93  ? 379  VAL B CG1 1 
ATOM   7009 C CG2 . VAL B 1 410 ? 20.735  -4.079  -16.175 1.00 58.83  ? 379  VAL B CG2 1 
ATOM   7010 N N   . LEU B 1 411 ? 20.678  -0.415  -13.479 1.00 58.29  ? 380  LEU B N   1 
ATOM   7011 C CA  . LEU B 1 411 ? 20.536  0.350   -12.241 1.00 59.11  ? 380  LEU B CA  1 
ATOM   7012 C C   . LEU B 1 411 ? 19.540  1.494   -12.380 1.00 57.59  ? 380  LEU B C   1 
ATOM   7013 O O   . LEU B 1 411 ? 18.827  1.795   -11.449 1.00 58.30  ? 380  LEU B O   1 
ATOM   7014 C CB  . LEU B 1 411 ? 21.889  0.848   -11.729 1.00 59.72  ? 380  LEU B CB  1 
ATOM   7015 C CG  . LEU B 1 411 ? 22.907  -0.246  -11.318 1.00 62.90  ? 380  LEU B CG  1 
ATOM   7016 C CD1 . LEU B 1 411 ? 24.042  0.342   -10.494 1.00 65.93  ? 380  LEU B CD1 1 
ATOM   7017 C CD2 . LEU B 1 411 ? 22.310  -1.417  -10.538 1.00 64.66  ? 380  LEU B CD2 1 
ATOM   7018 N N   . HIS B 1 412 ? 19.449  2.106   -13.544 1.00 56.57  ? 381  HIS B N   1 
ATOM   7019 C CA  . HIS B 1 412 ? 18.505  3.225   -13.764 1.00 55.55  ? 381  HIS B CA  1 
ATOM   7020 C C   . HIS B 1 412 ? 17.054  2.769   -13.819 1.00 54.80  ? 381  HIS B C   1 
ATOM   7021 O O   . HIS B 1 412 ? 16.166  3.467   -13.387 1.00 54.37  ? 381  HIS B O   1 
ATOM   7022 C CB  . HIS B 1 412 ? 18.855  3.965   -15.074 1.00 54.76  ? 381  HIS B CB  1 
ATOM   7023 C CG  . HIS B 1 412 ? 17.957  5.122   -15.386 1.00 54.77  ? 381  HIS B CG  1 
ATOM   7024 N ND1 . HIS B 1 412 ? 18.143  6.375   -14.840 1.00 55.24  ? 381  HIS B ND1 1 
ATOM   7025 C CD2 . HIS B 1 412 ? 16.874  5.215   -16.200 1.00 54.47  ? 381  HIS B CD2 1 
ATOM   7026 C CE1 . HIS B 1 412 ? 17.192  7.179   -15.287 1.00 57.15  ? 381  HIS B CE1 1 
ATOM   7027 N NE2 . HIS B 1 412 ? 16.414  6.502   -16.118 1.00 54.42  ? 381  HIS B NE2 1 
ATOM   7028 N N   . TYR B 1 413 ? 16.819  1.593   -14.377 1.00 55.32  ? 382  TYR B N   1 
ATOM   7029 C CA  . TYR B 1 413 ? 15.458  1.138   -14.677 1.00 54.85  ? 382  TYR B CA  1 
ATOM   7030 C C   . TYR B 1 413 ? 14.900  0.158   -13.638 1.00 56.39  ? 382  TYR B C   1 
ATOM   7031 O O   . TYR B 1 413 ? 13.695  -0.124  -13.639 1.00 56.14  ? 382  TYR B O   1 
ATOM   7032 C CB  . TYR B 1 413 ? 15.407  0.489   -16.061 1.00 54.16  ? 382  TYR B CB  1 
ATOM   7033 C CG  . TYR B 1 413 ? 15.250  1.468   -17.199 1.00 51.12  ? 382  TYR B CG  1 
ATOM   7034 C CD1 . TYR B 1 413 ? 16.370  1.992   -17.862 1.00 48.33  ? 382  TYR B CD1 1 
ATOM   7035 C CD2 . TYR B 1 413 ? 13.991  1.856   -17.617 1.00 47.55  ? 382  TYR B CD2 1 
ATOM   7036 C CE1 . TYR B 1 413 ? 16.228  2.860   -18.923 1.00 48.40  ? 382  TYR B CE1 1 
ATOM   7037 C CE2 . TYR B 1 413 ? 13.834  2.729   -18.667 1.00 48.04  ? 382  TYR B CE2 1 
ATOM   7038 C CZ  . TYR B 1 413 ? 14.948  3.229   -19.332 1.00 48.06  ? 382  TYR B CZ  1 
ATOM   7039 O OH  . TYR B 1 413 ? 14.769  4.116   -20.378 1.00 46.61  ? 382  TYR B OH  1 
ATOM   7040 N N   . THR B 1 414 ? 15.769  -0.351  -12.765 1.00 57.76  ? 383  THR B N   1 
ATOM   7041 C CA  . THR B 1 414 ? 15.326  -1.121  -11.625 1.00 59.11  ? 383  THR B CA  1 
ATOM   7042 C C   . THR B 1 414 ? 14.547  -0.196  -10.706 1.00 60.17  ? 383  THR B C   1 
ATOM   7043 O O   . THR B 1 414 ? 14.910  0.967   -10.506 1.00 60.30  ? 383  THR B O   1 
ATOM   7044 C CB  . THR B 1 414 ? 16.518  -1.676  -10.902 1.00 59.90  ? 383  THR B CB  1 
ATOM   7045 O OG1 . THR B 1 414 ? 17.135  -2.660  -11.723 1.00 60.82  ? 383  THR B OG1 1 
ATOM   7046 C CG2 . THR B 1 414 ? 16.112  -2.426  -9.672  1.00 60.80  ? 383  THR B CG2 1 
ATOM   7047 N N   . ASP B 1 415 ? 13.454  -0.712  -10.171 1.00 62.07  ? 384  ASP B N   1 
ATOM   7048 C CA  . ASP B 1 415 ? 12.712  -0.058  -9.086  1.00 63.57  ? 384  ASP B CA  1 
ATOM   7049 C C   . ASP B 1 415 ? 13.232  -0.644  -7.762  1.00 64.81  ? 384  ASP B C   1 
ATOM   7050 O O   . ASP B 1 415 ? 12.969  -1.806  -7.453  1.00 65.00  ? 384  ASP B O   1 
ATOM   7051 C CB  . ASP B 1 415 ? 11.199  -0.308  -9.256  1.00 63.99  ? 384  ASP B CB  1 
ATOM   7052 C CG  . ASP B 1 415 ? 10.331  0.566   -8.338  1.00 66.92  ? 384  ASP B CG  1 
ATOM   7053 O OD1 . ASP B 1 415 ? 10.759  0.882   -7.193  1.00 70.24  ? 384  ASP B OD1 1 
ATOM   7054 O OD2 . ASP B 1 415 ? 9.194   0.971   -8.688  1.00 69.86  ? 384  ASP B OD2 1 
ATOM   7055 N N   . TRP B 1 416 ? 13.970  0.169   -7.003  1.00 65.14  ? 385  TRP B N   1 
ATOM   7056 C CA  . TRP B 1 416 ? 14.771  -0.340  -5.884  1.00 66.98  ? 385  TRP B CA  1 
ATOM   7057 C C   . TRP B 1 416 ? 13.946  -0.695  -4.642  1.00 69.22  ? 385  TRP B C   1 
ATOM   7058 O O   . TRP B 1 416 ? 14.444  -1.345  -3.695  1.00 71.14  ? 385  TRP B O   1 
ATOM   7059 C CB  . TRP B 1 416 ? 15.934  0.631   -5.604  1.00 66.33  ? 385  TRP B CB  1 
ATOM   7060 C CG  . TRP B 1 416 ? 16.898  0.488   -6.695  1.00 63.20  ? 385  TRP B CG  1 
ATOM   7061 C CD1 . TRP B 1 416 ? 17.084  1.324   -7.749  1.00 58.89  ? 385  TRP B CD1 1 
ATOM   7062 C CD2 . TRP B 1 416 ? 17.733  -0.640  -6.922  1.00 62.55  ? 385  TRP B CD2 1 
ATOM   7063 N NE1 . TRP B 1 416 ? 18.034  0.813   -8.596  1.00 58.23  ? 385  TRP B NE1 1 
ATOM   7064 C CE2 . TRP B 1 416 ? 18.451  -0.398  -8.107  1.00 60.97  ? 385  TRP B CE2 1 
ATOM   7065 C CE3 . TRP B 1 416 ? 17.968  -1.828  -6.223  1.00 64.68  ? 385  TRP B CE3 1 
ATOM   7066 C CZ2 . TRP B 1 416 ? 19.386  -1.300  -8.615  1.00 62.01  ? 385  TRP B CZ2 1 
ATOM   7067 C CZ3 . TRP B 1 416 ? 18.885  -2.739  -6.735  1.00 66.28  ? 385  TRP B CZ3 1 
ATOM   7068 C CH2 . TRP B 1 416 ? 19.583  -2.467  -7.920  1.00 65.04  ? 385  TRP B CH2 1 
ATOM   7069 N N   . LEU B 1 417 ? 12.681  -0.288  -4.682  1.00 69.86  ? 386  LEU B N   1 
ATOM   7070 C CA  . LEU B 1 417 ? 11.643  -0.764  -3.761  1.00 72.10  ? 386  LEU B CA  1 
ATOM   7071 C C   . LEU B 1 417 ? 11.131  -2.178  -4.058  1.00 73.00  ? 386  LEU B C   1 
ATOM   7072 O O   . LEU B 1 417 ? 10.707  -2.893  -3.153  1.00 74.84  ? 386  LEU B O   1 
ATOM   7073 C CB  . LEU B 1 417 ? 10.444  0.181   -3.841  1.00 71.74  ? 386  LEU B CB  1 
ATOM   7074 C CG  . LEU B 1 417 ? 10.583  1.384   -2.927  1.00 74.13  ? 386  LEU B CG  1 
ATOM   7075 C CD1 . LEU B 1 417 ? 9.954   2.681   -3.527  1.00 74.10  ? 386  LEU B CD1 1 
ATOM   7076 C CD2 . LEU B 1 417 ? 9.984   0.977   -1.584  1.00 76.83  ? 386  LEU B CD2 1 
ATOM   7077 N N   . HIS B 1 418 ? 11.125  -2.544  -5.336  1.00 72.49  ? 387  HIS B N   1 
ATOM   7078 C CA  . HIS B 1 418 ? 10.639  -3.845  -5.799  1.00 73.33  ? 387  HIS B CA  1 
ATOM   7079 C C   . HIS B 1 418 ? 11.641  -4.436  -6.805  1.00 72.27  ? 387  HIS B C   1 
ATOM   7080 O O   . HIS B 1 418 ? 11.276  -4.775  -7.927  1.00 71.43  ? 387  HIS B O   1 
ATOM   7081 C CB  . HIS B 1 418 ? 9.252   -3.701  -6.497  1.00 72.94  ? 387  HIS B CB  1 
ATOM   7082 C CG  . HIS B 1 418 ? 8.237   -2.883  -5.740  1.00 74.83  ? 387  HIS B CG  1 
ATOM   7083 N ND1 . HIS B 1 418 ? 7.850   -1.613  -6.141  1.00 75.12  ? 387  HIS B ND1 1 
ATOM   7084 C CD2 . HIS B 1 418 ? 7.507   -3.166  -4.631  1.00 76.79  ? 387  HIS B CD2 1 
ATOM   7085 C CE1 . HIS B 1 418 ? 6.945   -1.141  -5.298  1.00 74.99  ? 387  HIS B CE1 1 
ATOM   7086 N NE2 . HIS B 1 418 ? 6.716   -2.065  -4.376  1.00 77.33  ? 387  HIS B NE2 1 
ATOM   7087 N N   . PRO B 1 419 ? 12.898  -4.586  -6.405  1.00 72.32  ? 388  PRO B N   1 
ATOM   7088 C CA  . PRO B 1 419 ? 13.976  -4.900  -7.360  1.00 71.44  ? 388  PRO B CA  1 
ATOM   7089 C C   . PRO B 1 419 ? 13.792  -6.217  -8.105  1.00 71.46  ? 388  PRO B C   1 
ATOM   7090 O O   . PRO B 1 419 ? 14.416  -6.404  -9.152  1.00 70.83  ? 388  PRO B O   1 
ATOM   7091 C CB  . PRO B 1 419 ? 15.226  -4.964  -6.460  1.00 72.81  ? 388  PRO B CB  1 
ATOM   7092 C CG  . PRO B 1 419 ? 14.689  -5.207  -5.061  1.00 73.86  ? 388  PRO B CG  1 
ATOM   7093 C CD  . PRO B 1 419 ? 13.383  -4.509  -5.011  1.00 73.16  ? 388  PRO B CD  1 
ATOM   7094 N N   . GLU B 1 420 ? 12.973  -7.117  -7.562  1.00 72.41  ? 389  GLU B N   1 
ATOM   7095 C CA  . GLU B 1 420 ? 12.838  -8.467  -8.096  1.00 73.06  ? 389  GLU B CA  1 
ATOM   7096 C C   . GLU B 1 420 ? 11.413  -8.773  -8.562  1.00 71.43  ? 389  GLU B C   1 
ATOM   7097 O O   . GLU B 1 420 ? 11.125  -9.902  -8.970  1.00 72.25  ? 389  GLU B O   1 
ATOM   7098 C CB  . GLU B 1 420 ? 13.302  -9.479  -7.041  1.00 75.77  ? 389  GLU B CB  1 
ATOM   7099 C CG  . GLU B 1 420 ? 14.606  -9.082  -6.324  1.00 79.46  ? 389  GLU B CG  1 
ATOM   7100 C CD  . GLU B 1 420 ? 15.660  -10.188 -6.298  1.00 85.07  ? 389  GLU B CD  1 
ATOM   7101 O OE1 . GLU B 1 420 ? 16.299  -10.467 -7.358  1.00 87.53  ? 389  GLU B OE1 1 
ATOM   7102 O OE2 . GLU B 1 420 ? 15.851  -10.778 -5.205  1.00 89.47  ? 389  GLU B OE2 1 
ATOM   7103 N N   . ASP B 1 421 ? 10.528  -7.775  -8.531  1.00 69.00  ? 390  ASP B N   1 
ATOM   7104 C CA  . ASP B 1 421 ? 9.134   -7.972  -8.926  1.00 68.22  ? 390  ASP B CA  1 
ATOM   7105 C C   . ASP B 1 421 ? 9.031   -8.200  -10.436 1.00 66.68  ? 390  ASP B C   1 
ATOM   7106 O O   . ASP B 1 421 ? 9.463   -7.375  -11.220 1.00 64.58  ? 390  ASP B O   1 
ATOM   7107 C CB  . ASP B 1 421 ? 8.254   -6.788  -8.510  1.00 67.47  ? 390  ASP B CB  1 
ATOM   7108 C CG  . ASP B 1 421 ? 6.799   -6.947  -8.972  1.00 68.52  ? 390  ASP B CG  1 
ATOM   7109 O OD1 . ASP B 1 421 ? 6.140   -7.930  -8.539  1.00 72.18  ? 390  ASP B OD1 1 
ATOM   7110 O OD2 . ASP B 1 421 ? 6.243   -6.156  -9.773  1.00 66.84  ? 390  ASP B OD2 1 
ATOM   7111 N N   . PRO B 1 422 ? 8.454   -9.320  -10.849 1.00 67.43  ? 391  PRO B N   1 
ATOM   7112 C CA  . PRO B 1 422 ? 8.493   -9.706  -12.267 1.00 66.41  ? 391  PRO B CA  1 
ATOM   7113 C C   . PRO B 1 422 ? 7.670   -8.791  -13.175 1.00 64.94  ? 391  PRO B C   1 
ATOM   7114 O O   . PRO B 1 422 ? 8.036   -8.587  -14.328 1.00 63.69  ? 391  PRO B O   1 
ATOM   7115 C CB  . PRO B 1 422 ? 7.916   -11.128 -12.252 1.00 68.07  ? 391  PRO B CB  1 
ATOM   7116 C CG  . PRO B 1 422 ? 8.014   -11.568 -10.837 1.00 69.87  ? 391  PRO B CG  1 
ATOM   7117 C CD  . PRO B 1 422 ? 7.735   -10.317 -10.031 1.00 69.01  ? 391  PRO B CD  1 
ATOM   7118 N N   . THR B 1 423 ? 6.576   -8.242  -12.661 1.00 65.05  ? 392  THR B N   1 
ATOM   7119 C CA  . THR B 1 423 ? 5.780   -7.269  -13.418 1.00 63.56  ? 392  THR B CA  1 
ATOM   7120 C C   . THR B 1 423 ? 6.593   -6.002  -13.706 1.00 62.19  ? 392  THR B C   1 
ATOM   7121 O O   . THR B 1 423 ? 6.523   -5.450  -14.815 1.00 60.45  ? 392  THR B O   1 
ATOM   7122 C CB  . THR B 1 423 ? 4.452   -6.910  -12.655 1.00 63.95  ? 392  THR B CB  1 
ATOM   7123 O OG1 . THR B 1 423 ? 3.589   -8.051  -12.612 1.00 67.14  ? 392  THR B OG1 1 
ATOM   7124 C CG2 . THR B 1 423 ? 3.604   -5.863  -13.396 1.00 62.80  ? 392  THR B CG2 1 
ATOM   7125 N N   . HIS B 1 424 ? 7.341   -5.523  -12.707 1.00 62.91  ? 393  HIS B N   1 
ATOM   7126 C CA  . HIS B 1 424 ? 8.153   -4.304  -12.875 1.00 62.12  ? 393  HIS B CA  1 
ATOM   7127 C C   . HIS B 1 424 ? 9.293   -4.545  -13.835 1.00 60.40  ? 393  HIS B C   1 
ATOM   7128 O O   . HIS B 1 424 ? 9.572   -3.682  -14.668 1.00 58.97  ? 393  HIS B O   1 
ATOM   7129 C CB  . HIS B 1 424 ? 8.723   -3.791  -11.554 1.00 63.25  ? 393  HIS B CB  1 
ATOM   7130 C CG  . HIS B 1 424 ? 7.748   -2.991  -10.739 1.00 68.19  ? 393  HIS B CG  1 
ATOM   7131 N ND1 . HIS B 1 424 ? 6.550   -3.512  -10.278 1.00 73.93  ? 393  HIS B ND1 1 
ATOM   7132 C CD2 . HIS B 1 424 ? 7.809   -1.717  -10.275 1.00 70.83  ? 393  HIS B CD2 1 
ATOM   7133 C CE1 . HIS B 1 424 ? 5.916   -2.589  -9.570  1.00 74.68  ? 393  HIS B CE1 1 
ATOM   7134 N NE2 . HIS B 1 424 ? 6.659   -1.492  -9.551  1.00 73.02  ? 393  HIS B NE2 1 
ATOM   7135 N N   . LEU B 1 425 ? 9.914   -5.724  -13.749 1.00 60.36  ? 394  LEU B N   1 
ATOM   7136 C CA  . LEU B 1 425 ? 11.036  -6.061  -14.618 1.00 59.94  ? 394  LEU B CA  1 
ATOM   7137 C C   . LEU B 1 425 ? 10.622  -6.190  -16.085 1.00 58.39  ? 394  LEU B C   1 
ATOM   7138 O O   . LEU B 1 425 ? 11.343  -5.754  -16.960 1.00 56.98  ? 394  LEU B O   1 
ATOM   7139 C CB  . LEU B 1 425 ? 11.727  -7.328  -14.113 1.00 61.82  ? 394  LEU B CB  1 
ATOM   7140 C CG  . LEU B 1 425 ? 12.378  -7.090  -12.744 1.00 63.58  ? 394  LEU B CG  1 
ATOM   7141 C CD1 . LEU B 1 425 ? 12.645  -8.410  -12.021 1.00 66.92  ? 394  LEU B CD1 1 
ATOM   7142 C CD2 . LEU B 1 425 ? 13.661  -6.275  -12.895 1.00 63.48  ? 394  LEU B CD2 1 
ATOM   7143 N N   . ARG B 1 426 ? 9.448   -6.764  -16.329 1.00 58.69  ? 395  ARG B N   1 
ATOM   7144 C CA  . ARG B 1 426 ? 8.898   -6.923  -17.679 1.00 58.06  ? 395  ARG B CA  1 
ATOM   7145 C C   . ARG B 1 426 ? 8.627   -5.538  -18.299 1.00 56.57  ? 395  ARG B C   1 
ATOM   7146 O O   . ARG B 1 426 ? 9.093   -5.248  -19.398 1.00 55.71  ? 395  ARG B O   1 
ATOM   7147 C CB  . ARG B 1 426 ? 7.627   -7.782  -17.605 1.00 59.17  ? 395  ARG B CB  1 
ATOM   7148 C CG  . ARG B 1 426 ? 6.807   -7.876  -18.885 1.00 59.88  ? 395  ARG B CG  1 
ATOM   7149 C CD  . ARG B 1 426 ? 5.537   -7.065  -18.842 1.00 60.47  ? 395  ARG B CD  1 
ATOM   7150 N NE  . ARG B 1 426 ? 4.418   -7.880  -18.432 1.00 62.75  ? 395  ARG B NE  1 
ATOM   7151 C CZ  . ARG B 1 426 ? 3.358   -7.456  -17.737 1.00 64.59  ? 395  ARG B CZ  1 
ATOM   7152 N NH1 . ARG B 1 426 ? 3.222   -6.200  -17.363 1.00 61.84  ? 395  ARG B NH1 1 
ATOM   7153 N NH2 . ARG B 1 426 ? 2.395   -8.329  -17.422 1.00 69.67  ? 395  ARG B NH2 1 
ATOM   7154 N N   . ASP B 1 427 ? 7.907   -4.680  -17.575 1.00 55.87  ? 396  ASP B N   1 
ATOM   7155 C CA  . ASP B 1 427 ? 7.621   -3.327  -18.040 1.00 54.86  ? 396  ASP B CA  1 
ATOM   7156 C C   . ASP B 1 427 ? 8.892   -2.484  -18.216 1.00 53.94  ? 396  ASP B C   1 
ATOM   7157 O O   . ASP B 1 427 ? 8.939   -1.593  -19.068 1.00 53.27  ? 396  ASP B O   1 
ATOM   7158 C CB  . ASP B 1 427 ? 6.630   -2.608  -17.101 1.00 54.98  ? 396  ASP B CB  1 
ATOM   7159 C CG  . ASP B 1 427 ? 5.237   -3.280  -17.083 1.00 57.20  ? 396  ASP B CG  1 
ATOM   7160 O OD1 . ASP B 1 427 ? 4.871   -3.933  -18.083 1.00 55.67  ? 396  ASP B OD1 1 
ATOM   7161 O OD2 . ASP B 1 427 ? 4.451   -3.225  -16.110 1.00 59.78  ? 396  ASP B OD2 1 
ATOM   7162 N N   . ALA B 1 428 ? 9.924   -2.776  -17.434 1.00 54.09  ? 397  ALA B N   1 
ATOM   7163 C CA  . ALA B 1 428 ? 11.148  -1.994  -17.488 1.00 53.23  ? 397  ALA B CA  1 
ATOM   7164 C C   . ALA B 1 428 ? 11.933  -2.404  -18.708 1.00 52.43  ? 397  ALA B C   1 
ATOM   7165 O O   . ALA B 1 428 ? 12.557  -1.561  -19.335 1.00 51.59  ? 397  ALA B O   1 
ATOM   7166 C CB  . ALA B 1 428 ? 11.977  -2.180  -16.223 1.00 53.76  ? 397  ALA B CB  1 
ATOM   7167 N N   . MET B 1 429 ? 11.901  -3.693  -19.040 1.00 52.64  ? 398  MET B N   1 
ATOM   7168 C CA  . MET B 1 429 ? 12.553  -4.204  -20.244 1.00 52.47  ? 398  MET B CA  1 
ATOM   7169 C C   . MET B 1 429 ? 11.925  -3.537  -21.484 1.00 51.04  ? 398  MET B C   1 
ATOM   7170 O O   . MET B 1 429 ? 12.624  -3.132  -22.401 1.00 50.06  ? 398  MET B O   1 
ATOM   7171 C CB  . MET B 1 429 ? 12.402  -5.730  -20.303 1.00 53.81  ? 398  MET B CB  1 
ATOM   7172 C CG  . MET B 1 429 ? 13.214  -6.413  -21.387 1.00 55.53  ? 398  MET B CG  1 
ATOM   7173 S SD  . MET B 1 429 ? 14.989  -6.161  -21.184 1.00 59.60  ? 398  MET B SD  1 
ATOM   7174 C CE  . MET B 1 429 ? 15.331  -4.983  -22.494 1.00 59.50  ? 398  MET B CE  1 
ATOM   7175 N N   . SER B 1 430 ? 10.602  -3.404  -21.481 1.00 50.49  ? 399  SER B N   1 
ATOM   7176 C CA  . SER B 1 430 ? 9.902   -2.761  -22.566 1.00 49.50  ? 399  SER B CA  1 
ATOM   7177 C C   . SER B 1 430 ? 10.321  -1.323  -22.654 1.00 48.35  ? 399  SER B C   1 
ATOM   7178 O O   . SER B 1 430 ? 10.612  -0.829  -23.735 1.00 47.76  ? 399  SER B O   1 
ATOM   7179 C CB  . SER B 1 430 ? 8.379   -2.848  -22.379 1.00 50.23  ? 399  SER B CB  1 
ATOM   7180 O OG  . SER B 1 430 ? 7.706   -1.934  -23.244 1.00 49.13  ? 399  SER B OG  1 
ATOM   7181 N N   . ALA B 1 431 ? 10.369  -0.656  -21.508 1.00 48.14  ? 400  ALA B N   1 
ATOM   7182 C CA  . ALA B 1 431 ? 10.754  0.750   -21.456 1.00 47.26  ? 400  ALA B CA  1 
ATOM   7183 C C   . ALA B 1 431 ? 12.186  1.003   -21.941 1.00 46.99  ? 400  ALA B C   1 
ATOM   7184 O O   . ALA B 1 431 ? 12.453  1.989   -22.637 1.00 46.64  ? 400  ALA B O   1 
ATOM   7185 C CB  . ALA B 1 431 ? 10.577  1.274   -20.050 1.00 47.46  ? 400  ALA B CB  1 
ATOM   7186 N N   . VAL B 1 432 ? 13.108  0.127   -21.575 1.00 47.96  ? 401  VAL B N   1 
ATOM   7187 C CA  . VAL B 1 432 ? 14.505  0.263   -22.002 1.00 48.39  ? 401  VAL B CA  1 
ATOM   7188 C C   . VAL B 1 432 ? 14.566  0.324   -23.523 1.00 48.04  ? 401  VAL B C   1 
ATOM   7189 O O   . VAL B 1 432 ? 15.186  1.217   -24.096 1.00 47.59  ? 401  VAL B O   1 
ATOM   7190 C CB  . VAL B 1 432 ? 15.368  -0.908  -21.480 1.00 49.26  ? 401  VAL B CB  1 
ATOM   7191 C CG1 . VAL B 1 432 ? 16.674  -0.998  -22.211 1.00 49.45  ? 401  VAL B CG1 1 
ATOM   7192 C CG2 . VAL B 1 432 ? 15.614  -0.751  -19.976 1.00 50.46  ? 401  VAL B CG2 1 
ATOM   7193 N N   . VAL B 1 433 ? 13.872  -0.609  -24.160 1.00 48.62  ? 402  VAL B N   1 
ATOM   7194 C CA  . VAL B 1 433 ? 13.936  -0.770  -25.597 1.00 48.72  ? 402  VAL B CA  1 
ATOM   7195 C C   . VAL B 1 433 ? 13.204  0.380   -26.277 1.00 47.37  ? 402  VAL B C   1 
ATOM   7196 O O   . VAL B 1 433 ? 13.687  0.932   -27.238 1.00 46.91  ? 402  VAL B O   1 
ATOM   7197 C CB  . VAL B 1 433 ? 13.398  -2.178  -26.027 1.00 49.53  ? 402  VAL B CB  1 
ATOM   7198 C CG1 . VAL B 1 433 ? 13.120  -2.237  -27.543 1.00 50.19  ? 402  VAL B CG1 1 
ATOM   7199 C CG2 . VAL B 1 433 ? 14.396  -3.238  -25.651 1.00 49.60  ? 402  VAL B CG2 1 
ATOM   7200 N N   . GLY B 1 434 ? 12.045  0.745   -25.751 1.00 47.23  ? 403  GLY B N   1 
ATOM   7201 C CA  . GLY B 1 434 ? 11.281  1.851   -26.288 1.00 46.19  ? 403  GLY B CA  1 
ATOM   7202 C C   . GLY B 1 434 ? 11.997  3.199   -26.141 1.00 45.71  ? 403  GLY B C   1 
ATOM   7203 O O   . GLY B 1 434 ? 11.969  4.002   -27.067 1.00 44.85  ? 403  GLY B O   1 
ATOM   7204 N N   . ASP B 1 435 ? 12.635  3.440   -24.994 1.00 45.61  ? 404  ASP B N   1 
ATOM   7205 C CA  . ASP B 1 435 ? 13.291  4.712   -24.728 1.00 45.43  ? 404  ASP B CA  1 
ATOM   7206 C C   . ASP B 1 435 ? 14.579  4.874   -25.550 1.00 45.24  ? 404  ASP B C   1 
ATOM   7207 O O   . ASP B 1 435 ? 14.844  5.903   -26.136 1.00 44.75  ? 404  ASP B O   1 
ATOM   7208 C CB  . ASP B 1 435 ? 13.619  4.830   -23.224 1.00 46.64  ? 404  ASP B CB  1 
ATOM   7209 C CG  . ASP B 1 435 ? 12.375  4.940   -22.351 1.00 46.10  ? 404  ASP B CG  1 
ATOM   7210 O OD1 . ASP B 1 435 ? 11.316  5.251   -22.923 1.00 47.15  ? 404  ASP B OD1 1 
ATOM   7211 O OD2 . ASP B 1 435 ? 12.361  4.772   -21.096 1.00 46.12  ? 404  ASP B OD2 1 
ATOM   7212 N N   . HIS B 1 436 ? 15.386  3.833   -25.575 1.00 46.00  ? 405  HIS B N   1 
ATOM   7213 C CA  . HIS B 1 436 ? 16.657  3.827   -26.277 1.00 45.77  ? 405  HIS B CA  1 
ATOM   7214 C C   . HIS B 1 436 ? 16.454  4.032   -27.797 1.00 45.18  ? 405  HIS B C   1 
ATOM   7215 O O   . HIS B 1 436 ? 17.198  4.761   -28.445 1.00 45.39  ? 405  HIS B O   1 
ATOM   7216 C CB  . HIS B 1 436 ? 17.322  2.483   -25.997 1.00 46.19  ? 405  HIS B CB  1 
ATOM   7217 C CG  . HIS B 1 436 ? 18.572  2.248   -26.776 1.00 47.72  ? 405  HIS B CG  1 
ATOM   7218 N ND1 . HIS B 1 436 ? 19.624  3.141   -26.778 1.00 47.13  ? 405  HIS B ND1 1 
ATOM   7219 C CD2 . HIS B 1 436 ? 18.925  1.236   -27.610 1.00 46.95  ? 405  HIS B CD2 1 
ATOM   7220 C CE1 . HIS B 1 436 ? 20.588  2.671   -27.555 1.00 48.83  ? 405  HIS B CE1 1 
ATOM   7221 N NE2 . HIS B 1 436 ? 20.182  1.525   -28.081 1.00 49.25  ? 405  HIS B NE2 1 
ATOM   7222 N N   . ASN B 1 437 ? 15.441  3.392   -28.348 1.00 44.90  ? 406  ASN B N   1 
ATOM   7223 C CA  . ASN B 1 437 ? 15.237  3.353   -29.795 1.00 44.87  ? 406  ASN B CA  1 
ATOM   7224 C C   . ASN B 1 437 ? 14.296  4.403   -30.333 1.00 44.55  ? 406  ASN B C   1 
ATOM   7225 O O   . ASN B 1 437 ? 14.474  4.840   -31.457 1.00 45.13  ? 406  ASN B O   1 
ATOM   7226 C CB  . ASN B 1 437 ? 14.708  1.985   -30.203 1.00 44.49  ? 406  ASN B CB  1 
ATOM   7227 C CG  . ASN B 1 437 ? 15.746  0.898   -30.022 1.00 44.17  ? 406  ASN B CG  1 
ATOM   7228 O OD1 . ASN B 1 437 ? 16.859  0.981   -30.564 1.00 39.75  ? 406  ASN B OD1 1 
ATOM   7229 N ND2 . ASN B 1 437 ? 15.400  -0.111  -29.238 1.00 42.07  ? 406  ASN B ND2 1 
ATOM   7230 N N   . VAL B 1 438 ? 13.316  4.820   -29.539 1.00 44.12  ? 407  VAL B N   1 
ATOM   7231 C CA  . VAL B 1 438 ? 12.296  5.726   -30.041 1.00 44.29  ? 407  VAL B CA  1 
ATOM   7232 C C   . VAL B 1 438 ? 12.103  6.989   -29.202 1.00 44.07  ? 407  VAL B C   1 
ATOM   7233 O O   . VAL B 1 438 ? 12.375  8.068   -29.687 1.00 43.89  ? 407  VAL B O   1 
ATOM   7234 C CB  . VAL B 1 438 ? 10.970  5.008   -30.218 1.00 44.67  ? 407  VAL B CB  1 
ATOM   7235 C CG1 . VAL B 1 438 ? 9.925   5.963   -30.771 1.00 46.42  ? 407  VAL B CG1 1 
ATOM   7236 C CG2 . VAL B 1 438 ? 11.131  3.826   -31.140 1.00 45.66  ? 407  VAL B CG2 1 
ATOM   7237 N N   . VAL B 1 439 ? 11.663  6.856   -27.952 1.00 44.28  ? 408  VAL B N   1 
ATOM   7238 C CA  . VAL B 1 439 ? 11.234  8.017   -27.169 1.00 44.21  ? 408  VAL B CA  1 
ATOM   7239 C C   . VAL B 1 439 ? 12.365  9.004   -26.983 1.00 44.41  ? 408  VAL B C   1 
ATOM   7240 O O   . VAL B 1 439 ? 12.183  10.209  -27.142 1.00 43.91  ? 408  VAL B O   1 
ATOM   7241 C CB  . VAL B 1 439 ? 10.646  7.646   -25.761 1.00 44.80  ? 408  VAL B CB  1 
ATOM   7242 C CG1 . VAL B 1 439 ? 10.163  8.886   -25.031 1.00 43.50  ? 408  VAL B CG1 1 
ATOM   7243 C CG2 . VAL B 1 439 ? 9.502   6.601   -25.871 1.00 45.38  ? 408  VAL B CG2 1 
ATOM   7244 N N   . CYS B 1 440 ? 13.544  8.516   -26.657 1.00 44.97  ? 409  CYS B N   1 
ATOM   7245 C CA  . CYS B 1 440 ? 14.627  9.438   -26.397 1.00 45.56  ? 409  CYS B CA  1 
ATOM   7246 C C   . CYS B 1 440 ? 15.226  10.059  -27.662 1.00 45.66  ? 409  CYS B C   1 
ATOM   7247 O O   . CYS B 1 440 ? 15.487  11.264  -27.667 1.00 46.46  ? 409  CYS B O   1 
ATOM   7248 C CB  . CYS B 1 440 ? 15.655  8.830   -25.430 1.00 46.88  ? 409  CYS B CB  1 
ATOM   7249 S SG  . CYS B 1 440 ? 14.928  8.677   -23.752 1.00 46.84  ? 409  CYS B SG  1 
ATOM   7250 N N   . PRO B 1 441 ? 15.480  9.300   -28.721 1.00 45.44  ? 410  PRO B N   1 
ATOM   7251 C CA  . PRO B 1 441 ? 15.780  9.917   -30.023 1.00 45.28  ? 410  PRO B CA  1 
ATOM   7252 C C   . PRO B 1 441 ? 14.734  10.938  -30.479 1.00 44.78  ? 410  PRO B C   1 
ATOM   7253 O O   . PRO B 1 441 ? 15.137  11.966  -31.008 1.00 45.09  ? 410  PRO B O   1 
ATOM   7254 C CB  . PRO B 1 441 ? 15.863  8.720   -30.964 1.00 45.36  ? 410  PRO B CB  1 
ATOM   7255 C CG  . PRO B 1 441 ? 16.357  7.624   -30.086 1.00 46.00  ? 410  PRO B CG  1 
ATOM   7256 C CD  . PRO B 1 441 ? 15.654  7.842   -28.759 1.00 46.21  ? 410  PRO B CD  1 
ATOM   7257 N N   . VAL B 1 442 ? 13.449  10.693  -30.256 1.00 44.14  ? 411  VAL B N   1 
ATOM   7258 C CA  . VAL B 1 442 ? 12.418  11.674  -30.595 1.00 44.32  ? 411  VAL B CA  1 
ATOM   7259 C C   . VAL B 1 442 ? 12.551  12.966  -29.754 1.00 44.96  ? 411  VAL B C   1 
ATOM   7260 O O   . VAL B 1 442 ? 12.377  14.054  -30.276 1.00 44.62  ? 411  VAL B O   1 
ATOM   7261 C CB  . VAL B 1 442 ? 11.001  11.084  -30.444 1.00 43.40  ? 411  VAL B CB  1 
ATOM   7262 C CG1 . VAL B 1 442 ? 9.987   12.142  -30.319 1.00 42.01  ? 411  VAL B CG1 1 
ATOM   7263 C CG2 . VAL B 1 442 ? 10.689  10.212  -31.619 1.00 44.60  ? 411  VAL B CG2 1 
ATOM   7264 N N   . ALA B 1 443 ? 12.804  12.830  -28.457 1.00 45.54  ? 412  ALA B N   1 
ATOM   7265 C CA  . ALA B 1 443 ? 12.935  13.988  -27.572 1.00 45.99  ? 412  ALA B CA  1 
ATOM   7266 C C   . ALA B 1 443 ? 14.158  14.809  -27.957 1.00 46.08  ? 412  ALA B C   1 
ATOM   7267 O O   . ALA B 1 443 ? 14.152  16.021  -27.901 1.00 46.53  ? 412  ALA B O   1 
ATOM   7268 C CB  . ALA B 1 443 ? 13.039  13.540  -26.118 1.00 46.49  ? 412  ALA B CB  1 
ATOM   7269 N N   . GLN B 1 444 ? 15.205  14.134  -28.370 1.00 46.55  ? 413  GLN B N   1 
ATOM   7270 C CA  . GLN B 1 444 ? 16.407  14.804  -28.834 1.00 47.37  ? 413  GLN B CA  1 
ATOM   7271 C C   . GLN B 1 444 ? 16.180  15.571  -30.151 1.00 46.42  ? 413  GLN B C   1 
ATOM   7272 O O   . GLN B 1 444 ? 16.664  16.711  -30.326 1.00 45.96  ? 413  GLN B O   1 
ATOM   7273 C CB  . GLN B 1 444 ? 17.493  13.762  -29.007 1.00 48.63  ? 413  GLN B CB  1 
ATOM   7274 C CG  . GLN B 1 444 ? 18.652  14.233  -29.811 1.00 53.89  ? 413  GLN B CG  1 
ATOM   7275 C CD  . GLN B 1 444 ? 19.909  14.133  -29.042 1.00 61.56  ? 413  GLN B CD  1 
ATOM   7276 O OE1 . GLN B 1 444 ? 20.182  14.978  -28.143 1.00 66.99  ? 413  GLN B OE1 1 
ATOM   7277 N NE2 . GLN B 1 444 ? 20.686  13.085  -29.333 1.00 62.89  ? 413  GLN B NE2 1 
ATOM   7278 N N   . LEU B 1 445 ? 15.461  14.942  -31.079 1.00 45.28  ? 414  LEU B N   1 
ATOM   7279 C CA  . LEU B 1 445 ? 15.146  15.568  -32.342 1.00 44.78  ? 414  LEU B CA  1 
ATOM   7280 C C   . LEU B 1 445 ? 14.271  16.795  -32.106 1.00 44.53  ? 414  LEU B C   1 
ATOM   7281 O O   . LEU B 1 445 ? 14.574  17.873  -32.584 1.00 44.26  ? 414  LEU B O   1 
ATOM   7282 C CB  . LEU B 1 445 ? 14.479  14.579  -33.295 1.00 44.81  ? 414  LEU B CB  1 
ATOM   7283 C CG  . LEU B 1 445 ? 14.021  15.224  -34.617 1.00 45.34  ? 414  LEU B CG  1 
ATOM   7284 C CD1 . LEU B 1 445 ? 15.227  15.595  -35.486 1.00 47.00  ? 414  LEU B CD1 1 
ATOM   7285 C CD2 . LEU B 1 445 ? 13.102  14.329  -35.361 1.00 45.04  ? 414  LEU B CD2 1 
ATOM   7286 N N   . ALA B 1 446 ? 13.218  16.646  -31.327 1.00 44.27  ? 415  ALA B N   1 
ATOM   7287 C CA  . ALA B 1 446 ? 12.309  17.744  -31.052 1.00 45.10  ? 415  ALA B CA  1 
ATOM   7288 C C   . ALA B 1 446 ? 13.049  18.923  -30.444 1.00 46.45  ? 415  ALA B C   1 
ATOM   7289 O O   . ALA B 1 446 ? 12.833  20.072  -30.827 1.00 46.53  ? 415  ALA B O   1 
ATOM   7290 C CB  . ALA B 1 446 ? 11.197  17.290  -30.108 1.00 44.84  ? 415  ALA B CB  1 
ATOM   7291 N N   . GLY B 1 447 ? 13.908  18.629  -29.481 1.00 47.27  ? 416  GLY B N   1 
ATOM   7292 C CA  . GLY B 1 447 ? 14.691  19.649  -28.838 1.00 48.40  ? 416  GLY B CA  1 
ATOM   7293 C C   . GLY B 1 447 ? 15.607  20.394  -29.788 1.00 49.27  ? 416  GLY B C   1 
ATOM   7294 O O   . GLY B 1 447 ? 15.655  21.615  -29.735 1.00 49.96  ? 416  GLY B O   1 
ATOM   7295 N N   . ARG B 1 448 ? 16.341  19.686  -30.637 1.00 49.56  ? 417  ARG B N   1 
ATOM   7296 C CA  . ARG B 1 448 ? 17.267  20.342  -31.545 1.00 50.73  ? 417  ARG B CA  1 
ATOM   7297 C C   . ARG B 1 448 ? 16.490  21.138  -32.598 1.00 50.76  ? 417  ARG B C   1 
ATOM   7298 O O   . ARG B 1 448 ? 16.837  22.283  -32.908 1.00 51.41  ? 417  ARG B O   1 
ATOM   7299 C CB  . ARG B 1 448 ? 18.189  19.348  -32.261 1.00 51.32  ? 417  ARG B CB  1 
ATOM   7300 C CG  . ARG B 1 448 ? 19.254  18.628  -31.418 1.00 54.89  ? 417  ARG B CG  1 
ATOM   7301 C CD  . ARG B 1 448 ? 19.988  19.437  -30.368 1.00 59.97  ? 417  ARG B CD  1 
ATOM   7302 N NE  . ARG B 1 448 ? 20.773  20.519  -30.964 1.00 66.90  ? 417  ARG B NE  1 
ATOM   7303 C CZ  . ARG B 1 448 ? 22.000  20.917  -30.560 1.00 71.61  ? 417  ARG B CZ  1 
ATOM   7304 N NH1 . ARG B 1 448 ? 22.640  20.324  -29.546 1.00 73.26  ? 417  ARG B NH1 1 
ATOM   7305 N NH2 . ARG B 1 448 ? 22.614  21.904  -31.208 1.00 72.46  ? 417  ARG B NH2 1 
ATOM   7306 N N   . LEU B 1 449 ? 15.450  20.547  -33.173 1.00 50.33  ? 418  LEU B N   1 
ATOM   7307 C CA  . LEU B 1 449 ? 14.662  21.269  -34.175 1.00 50.58  ? 418  LEU B CA  1 
ATOM   7308 C C   . LEU B 1 449 ? 14.078  22.552  -33.577 1.00 51.44  ? 418  LEU B C   1 
ATOM   7309 O O   . LEU B 1 449 ? 14.104  23.592  -34.215 1.00 52.27  ? 418  LEU B O   1 
ATOM   7310 C CB  . LEU B 1 449 ? 13.551  20.409  -34.774 1.00 49.85  ? 418  LEU B CB  1 
ATOM   7311 C CG  . LEU B 1 449 ? 13.922  19.166  -35.588 1.00 49.54  ? 418  LEU B CG  1 
ATOM   7312 C CD1 . LEU B 1 449 ? 12.715  18.338  -35.917 1.00 48.00  ? 418  LEU B CD1 1 
ATOM   7313 C CD2 . LEU B 1 449 ? 14.633  19.545  -36.851 1.00 50.10  ? 418  LEU B CD2 1 
ATOM   7314 N N   . ALA B 1 450 ? 13.575  22.495  -32.349 1.00 51.54  ? 419  ALA B N   1 
ATOM   7315 C CA  . ALA B 1 450 ? 12.952  23.667  -31.734 1.00 52.35  ? 419  ALA B CA  1 
ATOM   7316 C C   . ALA B 1 450 ? 13.983  24.775  -31.436 1.00 53.87  ? 419  ALA B C   1 
ATOM   7317 O O   . ALA B 1 450 ? 13.722  25.951  -31.682 1.00 55.16  ? 419  ALA B O   1 
ATOM   7318 C CB  . ALA B 1 450 ? 12.221  23.266  -30.460 1.00 51.65  ? 419  ALA B CB  1 
ATOM   7319 N N   . ALA B 1 451 ? 15.142  24.384  -30.917 1.00 54.08  ? 420  ALA B N   1 
ATOM   7320 C CA  . ALA B 1 451 ? 16.218  25.304  -30.577 1.00 55.15  ? 420  ALA B CA  1 
ATOM   7321 C C   . ALA B 1 451 ? 16.729  26.004  -31.827 1.00 56.22  ? 420  ALA B C   1 
ATOM   7322 O O   . ALA B 1 451 ? 17.256  27.103  -31.761 1.00 57.50  ? 420  ALA B O   1 
ATOM   7323 C CB  . ALA B 1 451 ? 17.363  24.545  -29.921 1.00 54.87  ? 420  ALA B CB  1 
ATOM   7324 N N   . GLN B 1 452 ? 16.572  25.358  -32.973 1.00 56.22  ? 421  GLN B N   1 
ATOM   7325 C CA  . GLN B 1 452 ? 17.177  25.837  -34.193 1.00 56.88  ? 421  GLN B CA  1 
ATOM   7326 C C   . GLN B 1 452 ? 16.168  26.317  -35.216 1.00 56.34  ? 421  GLN B C   1 
ATOM   7327 O O   . GLN B 1 452 ? 16.427  26.248  -36.414 1.00 56.34  ? 421  GLN B O   1 
ATOM   7328 C CB  . GLN B 1 452 ? 18.114  24.787  -34.772 1.00 57.09  ? 421  GLN B CB  1 
ATOM   7329 C CG  . GLN B 1 452 ? 19.457  24.789  -34.023 1.00 60.39  ? 421  GLN B CG  1 
ATOM   7330 C CD  . GLN B 1 452 ? 20.041  23.406  -33.907 1.00 63.86  ? 421  GLN B CD  1 
ATOM   7331 O OE1 . GLN B 1 452 ? 20.166  22.856  -32.790 1.00 66.50  ? 421  GLN B OE1 1 
ATOM   7332 N NE2 . GLN B 1 452 ? 20.383  22.820  -35.052 1.00 63.18  ? 421  GLN B NE2 1 
ATOM   7333 N N   . GLY B 1 453 ? 15.041  26.835  -34.720 1.00 55.76  ? 422  GLY B N   1 
ATOM   7334 C CA  . GLY B 1 453 ? 14.128  27.636  -35.516 1.00 55.72  ? 422  GLY B CA  1 
ATOM   7335 C C   . GLY B 1 453 ? 12.881  26.956  -36.061 1.00 54.82  ? 422  GLY B C   1 
ATOM   7336 O O   . GLY B 1 453 ? 12.062  27.635  -36.681 1.00 55.16  ? 422  GLY B O   1 
ATOM   7337 N N   . ALA B 1 454 ? 12.728  25.642  -35.861 1.00 53.29  ? 423  ALA B N   1 
ATOM   7338 C CA  . ALA B 1 454 ? 11.524  24.949  -36.324 1.00 52.01  ? 423  ALA B CA  1 
ATOM   7339 C C   . ALA B 1 454 ? 10.336  25.156  -35.382 1.00 51.41  ? 423  ALA B C   1 
ATOM   7340 O O   . ALA B 1 454 ? 10.482  25.293  -34.182 1.00 51.21  ? 423  ALA B O   1 
ATOM   7341 C CB  . ALA B 1 454 ? 11.787  23.500  -36.471 1.00 51.18  ? 423  ALA B CB  1 
ATOM   7342 N N   . ARG B 1 455 ? 9.156   25.173  -35.965 1.00 50.96  ? 424  ARG B N   1 
ATOM   7343 C CA  . ARG B 1 455 ? 7.900   25.072  -35.246 1.00 50.83  ? 424  ARG B CA  1 
ATOM   7344 C C   . ARG B 1 455 ? 7.643   23.558  -35.024 1.00 47.90  ? 424  ARG B C   1 
ATOM   7345 O O   . ARG B 1 455 ? 7.607   22.794  -35.965 1.00 46.23  ? 424  ARG B O   1 
ATOM   7346 C CB  . ARG B 1 455 ? 6.869   25.750  -36.151 1.00 52.52  ? 424  ARG B CB  1 
ATOM   7347 C CG  . ARG B 1 455 ? 5.394   25.682  -35.763 1.00 57.72  ? 424  ARG B CG  1 
ATOM   7348 C CD  . ARG B 1 455 ? 4.510   26.731  -36.551 1.00 62.94  ? 424  ARG B CD  1 
ATOM   7349 N NE  . ARG B 1 455 ? 3.641   27.487  -35.655 1.00 66.92  ? 424  ARG B NE  1 
ATOM   7350 C CZ  . ARG B 1 455 ? 4.050   28.200  -34.614 1.00 66.85  ? 424  ARG B CZ  1 
ATOM   7351 N NH1 . ARG B 1 455 ? 5.327   28.318  -34.285 1.00 69.03  ? 424  ARG B NH1 1 
ATOM   7352 N NH2 . ARG B 1 455 ? 3.160   28.791  -33.887 1.00 67.66  ? 424  ARG B NH2 1 
ATOM   7353 N N   . VAL B 1 456 ? 7.544   23.127  -33.775 1.00 45.58  ? 425  VAL B N   1 
ATOM   7354 C CA  . VAL B 1 456 ? 7.470   21.707  -33.443 1.00 43.60  ? 425  VAL B CA  1 
ATOM   7355 C C   . VAL B 1 456 ? 6.221   21.450  -32.599 1.00 42.77  ? 425  VAL B C   1 
ATOM   7356 O O   . VAL B 1 456 ? 5.946   22.183  -31.677 1.00 43.28  ? 425  VAL B O   1 
ATOM   7357 C CB  . VAL B 1 456 ? 8.713   21.245  -32.657 1.00 43.10  ? 425  VAL B CB  1 
ATOM   7358 C CG1 . VAL B 1 456 ? 8.675   19.714  -32.390 1.00 41.78  ? 425  VAL B CG1 1 
ATOM   7359 C CG2 . VAL B 1 456 ? 9.991   21.651  -33.379 1.00 42.30  ? 425  VAL B CG2 1 
ATOM   7360 N N   . TYR B 1 457 ? 5.460   20.427  -32.918 1.00 41.51  ? 426  TYR B N   1 
ATOM   7361 C CA  . TYR B 1 457 ? 4.360   20.000  -32.058 1.00 41.41  ? 426  TYR B CA  1 
ATOM   7362 C C   . TYR B 1 457 ? 4.587   18.525  -31.737 1.00 41.53  ? 426  TYR B C   1 
ATOM   7363 O O   . TYR B 1 457 ? 4.943   17.764  -32.619 1.00 41.40  ? 426  TYR B O   1 
ATOM   7364 C CB  . TYR B 1 457 ? 3.013   20.169  -32.768 1.00 41.16  ? 426  TYR B CB  1 
ATOM   7365 C CG  . TYR B 1 457 ? 2.613   21.590  -33.086 1.00 39.26  ? 426  TYR B CG  1 
ATOM   7366 C CD1 . TYR B 1 457 ? 3.013   22.208  -34.268 1.00 38.19  ? 426  TYR B CD1 1 
ATOM   7367 C CD2 . TYR B 1 457 ? 1.804   22.323  -32.215 1.00 37.74  ? 426  TYR B CD2 1 
ATOM   7368 C CE1 . TYR B 1 457 ? 2.618   23.524  -34.570 1.00 35.97  ? 426  TYR B CE1 1 
ATOM   7369 C CE2 . TYR B 1 457 ? 1.430   23.629  -32.511 1.00 37.90  ? 426  TYR B CE2 1 
ATOM   7370 C CZ  . TYR B 1 457 ? 1.824   24.217  -33.693 1.00 36.66  ? 426  TYR B CZ  1 
ATOM   7371 O OH  . TYR B 1 457 ? 1.434   25.516  -33.969 1.00 38.40  ? 426  TYR B OH  1 
ATOM   7372 N N   . ALA B 1 458 ? 4.392   18.133  -30.483 1.00 41.94  ? 427  ALA B N   1 
ATOM   7373 C CA  . ALA B 1 458 ? 4.713   16.790  -30.033 1.00 41.80  ? 427  ALA B CA  1 
ATOM   7374 C C   . ALA B 1 458 ? 3.546   16.163  -29.295 1.00 42.61  ? 427  ALA B C   1 
ATOM   7375 O O   . ALA B 1 458 ? 2.757   16.856  -28.646 1.00 42.64  ? 427  ALA B O   1 
ATOM   7376 C CB  . ALA B 1 458 ? 5.925   16.813  -29.127 1.00 41.73  ? 427  ALA B CB  1 
ATOM   7377 N N   . TYR B 1 459 ? 3.504   14.835  -29.334 1.00 42.51  ? 428  TYR B N   1 
ATOM   7378 C CA  . TYR B 1 459 ? 2.446   14.055  -28.721 1.00 42.54  ? 428  TYR B CA  1 
ATOM   7379 C C   . TYR B 1 459 ? 2.940   12.737  -28.134 1.00 43.08  ? 428  TYR B C   1 
ATOM   7380 O O   . TYR B 1 459 ? 4.034   12.248  -28.419 1.00 41.95  ? 428  TYR B O   1 
ATOM   7381 C CB  . TYR B 1 459 ? 1.342   13.729  -29.739 1.00 42.81  ? 428  TYR B CB  1 
ATOM   7382 C CG  . TYR B 1 459 ? 1.745   12.747  -30.823 1.00 41.96  ? 428  TYR B CG  1 
ATOM   7383 C CD1 . TYR B 1 459 ? 1.696   11.379  -30.617 1.00 43.06  ? 428  TYR B CD1 1 
ATOM   7384 C CD2 . TYR B 1 459 ? 2.188   13.189  -32.042 1.00 41.04  ? 428  TYR B CD2 1 
ATOM   7385 C CE1 . TYR B 1 459 ? 2.095   10.485  -31.608 1.00 42.02  ? 428  TYR B CE1 1 
ATOM   7386 C CE2 . TYR B 1 459 ? 2.577   12.312  -33.033 1.00 39.94  ? 428  TYR B CE2 1 
ATOM   7387 C CZ  . TYR B 1 459 ? 2.536   10.973  -32.815 1.00 41.86  ? 428  TYR B CZ  1 
ATOM   7388 O OH  . TYR B 1 459 ? 2.931   10.116  -33.819 1.00 42.30  ? 428  TYR B OH  1 
ATOM   7389 N N   . ILE B 1 460 ? 2.082   12.177  -27.292 1.00 44.22  ? 429  ILE B N   1 
ATOM   7390 C CA  . ILE B 1 460 ? 2.157   10.796  -26.883 1.00 44.76  ? 429  ILE B CA  1 
ATOM   7391 C C   . ILE B 1 460 ? 0.760   10.216  -27.071 1.00 45.48  ? 429  ILE B C   1 
ATOM   7392 O O   . ILE B 1 460 ? -0.237  10.785  -26.608 1.00 46.58  ? 429  ILE B O   1 
ATOM   7393 C CB  . ILE B 1 460 ? 2.662   10.658  -25.447 1.00 45.48  ? 429  ILE B CB  1 
ATOM   7394 C CG1 . ILE B 1 460 ? 2.720   9.179   -25.026 1.00 46.56  ? 429  ILE B CG1 1 
ATOM   7395 C CG2 . ILE B 1 460 ? 1.786   11.428  -24.479 1.00 46.69  ? 429  ILE B CG2 1 
ATOM   7396 C CD1 . ILE B 1 460 ? 3.562   8.913   -23.726 1.00 48.43  ? 429  ILE B CD1 1 
ATOM   7397 N N   . PHE B 1 461 ? 0.701   9.116   -27.805 1.00 45.26  ? 430  PHE B N   1 
ATOM   7398 C CA  . PHE B 1 461 ? -0.529  8.448   -28.140 1.00 46.20  ? 430  PHE B CA  1 
ATOM   7399 C C   . PHE B 1 461 ? -0.755  7.319   -27.134 1.00 46.99  ? 430  PHE B C   1 
ATOM   7400 O O   . PHE B 1 461 ? 0.075   6.424   -27.046 1.00 46.86  ? 430  PHE B O   1 
ATOM   7401 C CB  . PHE B 1 461 ? -0.379  7.863   -29.545 1.00 46.20  ? 430  PHE B CB  1 
ATOM   7402 C CG  . PHE B 1 461 ? -1.629  7.321   -30.091 1.00 46.42  ? 430  PHE B CG  1 
ATOM   7403 C CD1 . PHE B 1 461 ? -1.969  6.000   -29.872 1.00 47.09  ? 430  PHE B CD1 1 
ATOM   7404 C CD2 . PHE B 1 461 ? -2.481  8.138   -30.819 1.00 47.40  ? 430  PHE B CD2 1 
ATOM   7405 C CE1 . PHE B 1 461 ? -3.136  5.500   -30.366 1.00 48.70  ? 430  PHE B CE1 1 
ATOM   7406 C CE2 . PHE B 1 461 ? -3.673  7.645   -31.313 1.00 48.46  ? 430  PHE B CE2 1 
ATOM   7407 C CZ  . PHE B 1 461 ? -3.996  6.321   -31.094 1.00 49.52  ? 430  PHE B CZ  1 
ATOM   7408 N N   . GLU B 1 462 ? -1.858  7.349   -26.393 1.00 48.29  ? 431  GLU B N   1 
ATOM   7409 C CA  . GLU B 1 462 ? -2.060  6.436   -25.264 1.00 49.99  ? 431  GLU B CA  1 
ATOM   7410 C C   . GLU B 1 462 ? -3.331  5.604   -25.346 1.00 51.18  ? 431  GLU B C   1 
ATOM   7411 O O   . GLU B 1 462 ? -3.698  4.963   -24.360 1.00 52.24  ? 431  GLU B O   1 
ATOM   7412 C CB  . GLU B 1 462 ? -2.121  7.208   -23.928 1.00 50.45  ? 431  GLU B CB  1 
ATOM   7413 C CG  . GLU B 1 462 ? -0.980  8.181   -23.680 1.00 51.11  ? 431  GLU B CG  1 
ATOM   7414 C CD  . GLU B 1 462 ? -1.066  8.862   -22.329 1.00 52.93  ? 431  GLU B CD  1 
ATOM   7415 O OE1 . GLU B 1 462 ? -2.108  9.520   -22.054 1.00 55.39  ? 431  GLU B OE1 1 
ATOM   7416 O OE2 . GLU B 1 462 ? -0.087  8.744   -21.550 1.00 53.66  ? 431  GLU B OE2 1 
ATOM   7417 N N   . HIS B 1 463 ? -4.021  5.615   -26.480 1.00 51.10  ? 432  HIS B N   1 
ATOM   7418 C CA  . HIS B 1 463 ? -5.222  4.800   -26.598 1.00 51.96  ? 432  HIS B CA  1 
ATOM   7419 C C   . HIS B 1 463 ? -4.894  3.455   -27.219 1.00 52.00  ? 432  HIS B C   1 
ATOM   7420 O O   . HIS B 1 463 ? -4.352  3.389   -28.321 1.00 51.20  ? 432  HIS B O   1 
ATOM   7421 C CB  . HIS B 1 463 ? -6.312  5.477   -27.423 1.00 52.08  ? 432  HIS B CB  1 
ATOM   7422 C CG  . HIS B 1 463 ? -7.500  4.595   -27.642 1.00 54.46  ? 432  HIS B CG  1 
ATOM   7423 N ND1 . HIS B 1 463 ? -8.295  4.156   -26.603 1.00 55.35  ? 432  HIS B ND1 1 
ATOM   7424 C CD2 . HIS B 1 463 ? -7.979  4.002   -28.763 1.00 54.67  ? 432  HIS B CD2 1 
ATOM   7425 C CE1 . HIS B 1 463 ? -9.234  3.360   -27.082 1.00 58.05  ? 432  HIS B CE1 1 
ATOM   7426 N NE2 . HIS B 1 463 ? -9.064  3.249   -28.388 1.00 57.46  ? 432  HIS B NE2 1 
ATOM   7427 N N   . ARG B 1 464 ? -5.250  2.390   -26.507 1.00 53.20  ? 433  ARG B N   1 
ATOM   7428 C CA  . ARG B 1 464 ? -5.145  1.030   -27.007 1.00 54.04  ? 433  ARG B CA  1 
ATOM   7429 C C   . ARG B 1 464 ? -6.415  0.638   -27.760 1.00 55.13  ? 433  ARG B C   1 
ATOM   7430 O O   . ARG B 1 464 ? -7.502  0.666   -27.196 1.00 56.16  ? 433  ARG B O   1 
ATOM   7431 C CB  . ARG B 1 464 ? -4.960  0.085   -25.834 1.00 54.86  ? 433  ARG B CB  1 
ATOM   7432 C CG  . ARG B 1 464 ? -4.776  -1.380  -26.230 1.00 56.64  ? 433  ARG B CG  1 
ATOM   7433 C CD  . ARG B 1 464 ? -4.584  -2.269  -25.036 1.00 56.76  ? 433  ARG B CD  1 
ATOM   7434 N NE  . ARG B 1 464 ? -4.950  -3.653  -25.304 1.00 58.80  ? 433  ARG B NE  1 
ATOM   7435 C CZ  . ARG B 1 464 ? -4.085  -4.636  -25.538 1.00 58.50  ? 433  ARG B CZ  1 
ATOM   7436 N NH1 . ARG B 1 464 ? -2.768  -4.407  -25.570 1.00 56.67  ? 433  ARG B NH1 1 
ATOM   7437 N NH2 . ARG B 1 464 ? -4.544  -5.861  -25.731 1.00 57.79  ? 433  ARG B NH2 1 
ATOM   7438 N N   . ALA B 1 465 ? -6.277  0.234   -29.018 1.00 55.15  ? 434  ALA B N   1 
ATOM   7439 C CA  . ALA B 1 465 ? -7.432  -0.153  -29.824 1.00 56.06  ? 434  ALA B CA  1 
ATOM   7440 C C   . ALA B 1 465 ? -8.189  -1.299  -29.162 1.00 57.78  ? 434  ALA B C   1 
ATOM   7441 O O   . ALA B 1 465 ? -7.579  -2.261  -28.710 1.00 57.72  ? 434  ALA B O   1 
ATOM   7442 C CB  . ALA B 1 465 ? -6.986  -0.580  -31.205 1.00 55.67  ? 434  ALA B CB  1 
ATOM   7443 N N   . SER B 1 466 ? -9.514  -1.190  -29.126 1.00 59.18  ? 435  SER B N   1 
ATOM   7444 C CA  . SER B 1 466 ? -10.383 -2.243  -28.619 1.00 61.15  ? 435  SER B CA  1 
ATOM   7445 C C   . SER B 1 466 ? -10.211 -3.546  -29.390 1.00 61.86  ? 435  SER B C   1 
ATOM   7446 O O   . SER B 1 466 ? -10.407 -4.616  -28.837 1.00 62.95  ? 435  SER B O   1 
ATOM   7447 C CB  . SER B 1 466 ? -11.847 -1.805  -28.716 1.00 62.12  ? 435  SER B CB  1 
ATOM   7448 O OG  . SER B 1 466 ? -12.238 -1.665  -30.076 1.00 62.87  ? 435  SER B OG  1 
ATOM   7449 N N   . THR B 1 467 ? -9.837  -3.449  -30.669 1.00 61.78  ? 436  THR B N   1 
ATOM   7450 C CA  . THR B 1 467 ? -9.659  -4.629  -31.543 1.00 62.41  ? 436  THR B CA  1 
ATOM   7451 C C   . THR B 1 467 ? -8.274  -5.279  -31.505 1.00 61.89  ? 436  THR B C   1 
ATOM   7452 O O   . THR B 1 467 ? -8.034  -6.248  -32.229 1.00 62.68  ? 436  THR B O   1 
ATOM   7453 C CB  . THR B 1 467 ? -9.925  -4.250  -33.002 1.00 62.05  ? 436  THR B CB  1 
ATOM   7454 O OG1 . THR B 1 467 ? -9.077  -3.146  -33.384 1.00 61.84  ? 436  THR B OG1 1 
ATOM   7455 C CG2 . THR B 1 467 ? -11.358 -3.737  -33.172 1.00 63.14  ? 436  THR B CG2 1 
ATOM   7456 N N   . LEU B 1 468 ? -7.362  -4.749  -30.697 1.00 60.98  ? 437  LEU B N   1 
ATOM   7457 C CA  . LEU B 1 468 ? -6.006  -5.257  -30.623 1.00 60.30  ? 437  LEU B CA  1 
ATOM   7458 C C   . LEU B 1 468 ? -6.011  -6.741  -30.235 1.00 61.79  ? 437  LEU B C   1 
ATOM   7459 O O   . LEU B 1 468 ? -6.786  -7.156  -29.368 1.00 62.99  ? 437  LEU B O   1 
ATOM   7460 C CB  . LEU B 1 468 ? -5.197  -4.444  -29.603 1.00 59.58  ? 437  LEU B CB  1 
ATOM   7461 C CG  . LEU B 1 468 ? -3.683  -4.383  -29.835 1.00 58.99  ? 437  LEU B CG  1 
ATOM   7462 C CD1 . LEU B 1 468 ? -3.337  -3.960  -31.235 1.00 58.89  ? 437  LEU B CD1 1 
ATOM   7463 C CD2 . LEU B 1 468 ? -3.041  -3.445  -28.865 1.00 59.47  ? 437  LEU B CD2 1 
ATOM   7464 N N   . THR B 1 469 ? -5.156  -7.530  -30.891 1.00 61.26  ? 438  THR B N   1 
ATOM   7465 C CA  . THR B 1 469 ? -5.060  -8.976  -30.642 1.00 62.28  ? 438  THR B CA  1 
ATOM   7466 C C   . THR B 1 469 ? -3.785  -9.349  -29.869 1.00 61.62  ? 438  THR B C   1 
ATOM   7467 O O   . THR B 1 469 ? -3.649  -10.492 -29.409 1.00 62.75  ? 438  THR B O   1 
ATOM   7468 C CB  . THR B 1 469 ? -5.093  -9.769  -31.971 1.00 62.69  ? 438  THR B CB  1 
ATOM   7469 O OG1 . THR B 1 469 ? -4.310  -9.101  -32.986 1.00 61.27  ? 438  THR B OG1 1 
ATOM   7470 C CG2 . THR B 1 469 ? -6.502  -9.818  -32.529 1.00 63.70  ? 438  THR B CG2 1 
ATOM   7471 N N   . TRP B 1 470 ? -2.856  -8.399  -29.748 1.00 59.33  ? 439  TRP B N   1 
ATOM   7472 C CA  . TRP B 1 470 ? -1.695  -8.567  -28.889 1.00 58.37  ? 439  TRP B CA  1 
ATOM   7473 C C   . TRP B 1 470 ? -2.194  -8.492  -27.455 1.00 58.99  ? 439  TRP B C   1 
ATOM   7474 O O   . TRP B 1 470 ? -3.239  -7.904  -27.189 1.00 59.13  ? 439  TRP B O   1 
ATOM   7475 C CB  . TRP B 1 470 ? -0.651  -7.483  -29.161 1.00 56.92  ? 439  TRP B CB  1 
ATOM   7476 C CG  . TRP B 1 470 ? -0.040  -7.612  -30.479 1.00 54.62  ? 439  TRP B CG  1 
ATOM   7477 C CD1 . TRP B 1 470 ? -0.359  -6.909  -31.578 1.00 53.60  ? 439  TRP B CD1 1 
ATOM   7478 C CD2 . TRP B 1 470 ? 0.985   -8.534  -30.869 1.00 54.21  ? 439  TRP B CD2 1 
ATOM   7479 N NE1 . TRP B 1 470 ? 0.410   -7.318  -32.638 1.00 52.84  ? 439  TRP B NE1 1 
ATOM   7480 C CE2 . TRP B 1 470 ? 1.240   -8.321  -32.229 1.00 52.45  ? 439  TRP B CE2 1 
ATOM   7481 C CE3 . TRP B 1 470 ? 1.702   -9.535  -30.205 1.00 55.81  ? 439  TRP B CE3 1 
ATOM   7482 C CZ2 . TRP B 1 470 ? 2.170   -9.058  -32.945 1.00 53.49  ? 439  TRP B CZ2 1 
ATOM   7483 C CZ3 . TRP B 1 470 ? 2.640   -10.265 -30.908 1.00 55.17  ? 439  TRP B CZ3 1 
ATOM   7484 C CH2 . TRP B 1 470 ? 2.869   -10.020 -32.267 1.00 55.62  ? 439  TRP B CH2 1 
ATOM   7485 N N   . PRO B 1 471 ? -1.479  -9.099  -26.526 1.00 59.46  ? 440  PRO B N   1 
ATOM   7486 C CA  . PRO B 1 471 ? -1.954  -9.162  -25.139 1.00 60.36  ? 440  PRO B CA  1 
ATOM   7487 C C   . PRO B 1 471 ? -1.862  -7.828  -24.406 1.00 59.68  ? 440  PRO B C   1 
ATOM   7488 O O   . PRO B 1 471 ? -1.106  -6.939  -24.813 1.00 58.36  ? 440  PRO B O   1 
ATOM   7489 C CB  . PRO B 1 471 ? -1.030  -10.192 -24.507 1.00 61.01  ? 440  PRO B CB  1 
ATOM   7490 C CG  . PRO B 1 471 ? 0.215   -10.066 -25.283 1.00 60.33  ? 440  PRO B CG  1 
ATOM   7491 C CD  . PRO B 1 471 ? -0.184  -9.769  -26.703 1.00 59.51  ? 440  PRO B CD  1 
ATOM   7492 N N   . LEU B 1 472 ? -2.627  -7.712  -23.329 1.00 60.82  ? 441  LEU B N   1 
ATOM   7493 C CA  . LEU B 1 472 ? -2.676  -6.501  -22.501 1.00 61.07  ? 441  LEU B CA  1 
ATOM   7494 C C   . LEU B 1 472 ? -1.325  -5.943  -22.056 1.00 59.13  ? 441  LEU B C   1 
ATOM   7495 O O   . LEU B 1 472 ? -1.151  -4.717  -21.930 1.00 57.90  ? 441  LEU B O   1 
ATOM   7496 C CB  . LEU B 1 472 ? -3.528  -6.744  -21.240 1.00 62.64  ? 441  LEU B CB  1 
ATOM   7497 C CG  . LEU B 1 472 ? -5.040  -6.862  -21.511 1.00 66.97  ? 441  LEU B CG  1 
ATOM   7498 C CD1 . LEU B 1 472 ? -5.845  -7.320  -20.239 1.00 69.06  ? 441  LEU B CD1 1 
ATOM   7499 C CD2 . LEU B 1 472 ? -5.605  -5.529  -22.106 1.00 67.71  ? 441  LEU B CD2 1 
ATOM   7500 N N   . TRP B 1 473 ? -0.374  -6.824  -21.793 1.00 58.45  ? 442  TRP B N   1 
ATOM   7501 C CA  . TRP B 1 473 ? 0.878   -6.346  -21.227 1.00 57.58  ? 442  TRP B CA  1 
ATOM   7502 C C   . TRP B 1 473 ? 1.682   -5.488  -22.204 1.00 55.61  ? 442  TRP B C   1 
ATOM   7503 O O   . TRP B 1 473 ? 2.508   -4.708  -21.771 1.00 54.63  ? 442  TRP B O   1 
ATOM   7504 C CB  . TRP B 1 473 ? 1.725   -7.491  -20.661 1.00 58.45  ? 442  TRP B CB  1 
ATOM   7505 C CG  . TRP B 1 473 ? 2.376   -8.402  -21.657 1.00 59.54  ? 442  TRP B CG  1 
ATOM   7506 C CD1 . TRP B 1 473 ? 1.951   -9.652  -22.032 1.00 60.85  ? 442  TRP B CD1 1 
ATOM   7507 C CD2 . TRP B 1 473 ? 3.594   -8.163  -22.375 1.00 59.50  ? 442  TRP B CD2 1 
ATOM   7508 N NE1 . TRP B 1 473 ? 2.823   -10.188 -22.948 1.00 60.42  ? 442  TRP B NE1 1 
ATOM   7509 C CE2 . TRP B 1 473 ? 3.841   -9.296  -23.174 1.00 59.50  ? 442  TRP B CE2 1 
ATOM   7510 C CE3 . TRP B 1 473 ? 4.495   -7.086  -22.447 1.00 57.94  ? 442  TRP B CE3 1 
ATOM   7511 C CZ2 . TRP B 1 473 ? 4.952   -9.390  -24.023 1.00 59.38  ? 442  TRP B CZ2 1 
ATOM   7512 C CZ3 . TRP B 1 473 ? 5.597   -7.190  -23.288 1.00 57.61  ? 442  TRP B CZ3 1 
ATOM   7513 C CH2 . TRP B 1 473 ? 5.811   -8.334  -24.068 1.00 56.97  ? 442  TRP B CH2 1 
ATOM   7514 N N   . MET B 1 474 ? 1.454   -5.655  -23.511 1.00 54.60  ? 443  MET B N   1 
ATOM   7515 C CA  . MET B 1 474 ? 2.132   -4.855  -24.528 1.00 52.64  ? 443  MET B CA  1 
ATOM   7516 C C   . MET B 1 474 ? 1.569   -3.441  -24.619 1.00 51.50  ? 443  MET B C   1 
ATOM   7517 O O   . MET B 1 474 ? 2.166   -2.576  -25.269 1.00 50.10  ? 443  MET B O   1 
ATOM   7518 C CB  . MET B 1 474 ? 2.044   -5.523  -25.901 1.00 52.39  ? 443  MET B CB  1 
ATOM   7519 C CG  . MET B 1 474 ? 2.830   -6.813  -26.024 1.00 52.87  ? 443  MET B CG  1 
ATOM   7520 S SD  . MET B 1 474 ? 2.883   -7.499  -27.697 1.00 52.02  ? 443  MET B SD  1 
ATOM   7521 C CE  . MET B 1 474 ? 3.884   -8.946  -27.340 1.00 52.77  ? 443  MET B CE  1 
ATOM   7522 N N   . GLY B 1 475 ? 0.413   -3.207  -23.998 1.00 51.47  ? 444  GLY B N   1 
ATOM   7523 C CA  . GLY B 1 475 ? -0.120  -1.865  -23.909 1.00 50.82  ? 444  GLY B CA  1 
ATOM   7524 C C   . GLY B 1 475 ? -0.517  -1.293  -25.252 1.00 49.87  ? 444  GLY B C   1 
ATOM   7525 O O   . GLY B 1 475 ? -1.359  -1.869  -25.932 1.00 51.13  ? 444  GLY B O   1 
ATOM   7526 N N   . VAL B 1 476 ? 0.062   -0.157  -25.624 1.00 48.40  ? 445  VAL B N   1 
ATOM   7527 C CA  . VAL B 1 476 ? -0.150  0.450   -26.937 1.00 47.25  ? 445  VAL B CA  1 
ATOM   7528 C C   . VAL B 1 476 ? 1.156   0.282   -27.694 1.00 46.80  ? 445  VAL B C   1 
ATOM   7529 O O   . VAL B 1 476 ? 2.099   1.047   -27.468 1.00 45.34  ? 445  VAL B O   1 
ATOM   7530 C CB  . VAL B 1 476 ? -0.450  1.946   -26.816 1.00 46.50  ? 445  VAL B CB  1 
ATOM   7531 C CG1 . VAL B 1 476 ? -0.894  2.510   -28.144 1.00 46.12  ? 445  VAL B CG1 1 
ATOM   7532 C CG2 . VAL B 1 476 ? -1.493  2.197   -25.760 1.00 47.56  ? 445  VAL B CG2 1 
ATOM   7533 N N   . PRO B 1 477 ? 1.245   -0.743  -28.543 1.00 46.93  ? 446  PRO B N   1 
ATOM   7534 C CA  . PRO B 1 477 ? 2.509   -1.081  -29.171 1.00 46.32  ? 446  PRO B CA  1 
ATOM   7535 C C   . PRO B 1 477 ? 2.813   -0.188  -30.363 1.00 45.63  ? 446  PRO B C   1 
ATOM   7536 O O   . PRO B 1 477 ? 1.945   0.493   -30.906 1.00 44.63  ? 446  PRO B O   1 
ATOM   7537 C CB  . PRO B 1 477 ? 2.307   -2.540  -29.602 1.00 47.38  ? 446  PRO B CB  1 
ATOM   7538 C CG  . PRO B 1 477 ? 0.992   -2.951  -29.053 1.00 48.43  ? 446  PRO B CG  1 
ATOM   7539 C CD  . PRO B 1 477 ? 0.186   -1.677  -28.966 1.00 48.44  ? 446  PRO B CD  1 
ATOM   7540 N N   . HIS B 1 478 ? 4.091   -0.198  -30.717 1.00 45.63  ? 447  HIS B N   1 
ATOM   7541 C CA  . HIS B 1 478 ? 4.666   0.457   -31.891 1.00 45.12  ? 447  HIS B CA  1 
ATOM   7542 C C   . HIS B 1 478 ? 3.836   0.093   -33.142 1.00 45.24  ? 447  HIS B C   1 
ATOM   7543 O O   . HIS B 1 478 ? 3.670   -1.067  -33.472 1.00 45.21  ? 447  HIS B O   1 
ATOM   7544 C CB  . HIS B 1 478 ? 6.129   -0.028  -31.948 1.00 44.95  ? 447  HIS B CB  1 
ATOM   7545 C CG  . HIS B 1 478 ? 6.980   0.627   -32.980 1.00 45.29  ? 447  HIS B CG  1 
ATOM   7546 N ND1 . HIS B 1 478 ? 7.328   1.959   -32.925 1.00 45.50  ? 447  HIS B ND1 1 
ATOM   7547 C CD2 . HIS B 1 478 ? 7.621   0.110   -34.056 1.00 45.03  ? 447  HIS B CD2 1 
ATOM   7548 C CE1 . HIS B 1 478 ? 8.113   2.239   -33.950 1.00 45.39  ? 447  HIS B CE1 1 
ATOM   7549 N NE2 . HIS B 1 478 ? 8.299   1.134   -34.653 1.00 43.50  ? 447  HIS B NE2 1 
ATOM   7550 N N   . GLY B 1 479 ? 3.238   1.100   -33.781 1.00 45.23  ? 448  GLY B N   1 
ATOM   7551 C CA  . GLY B 1 479 ? 2.438   0.892   -34.981 1.00 44.75  ? 448  GLY B CA  1 
ATOM   7552 C C   . GLY B 1 479 ? 0.933   1.035   -34.796 1.00 45.34  ? 448  GLY B C   1 
ATOM   7553 O O   . GLY B 1 479 ? 0.223   1.206   -35.800 1.00 45.88  ? 448  GLY B O   1 
ATOM   7554 N N   . TYR B 1 480 ? 0.419   0.993   -33.562 1.00 45.05  ? 449  TYR B N   1 
ATOM   7555 C CA  . TYR B 1 480 ? -1.041  0.909   -33.382 1.00 45.82  ? 449  TYR B CA  1 
ATOM   7556 C C   . TYR B 1 480 ? -1.786  2.238   -33.195 1.00 45.97  ? 449  TYR B C   1 
ATOM   7557 O O   . TYR B 1 480 ? -2.968  2.257   -32.851 1.00 46.38  ? 449  TYR B O   1 
ATOM   7558 C CB  . TYR B 1 480 ? -1.406  -0.135  -32.313 1.00 46.76  ? 449  TYR B CB  1 
ATOM   7559 C CG  . TYR B 1 480 ? -1.160  -1.484  -32.856 1.00 45.72  ? 449  TYR B CG  1 
ATOM   7560 C CD1 . TYR B 1 480 ? 0.069   -2.094  -32.716 1.00 46.08  ? 449  TYR B CD1 1 
ATOM   7561 C CD2 . TYR B 1 480 ? -2.125  -2.104  -33.640 1.00 48.34  ? 449  TYR B CD2 1 
ATOM   7562 C CE1 . TYR B 1 480 ? 0.304   -3.347  -33.282 1.00 48.97  ? 449  TYR B CE1 1 
ATOM   7563 C CE2 . TYR B 1 480 ? -1.919  -3.348  -34.191 1.00 48.28  ? 449  TYR B CE2 1 
ATOM   7564 C CZ  . TYR B 1 480 ? -0.705  -3.966  -34.018 1.00 49.89  ? 449  TYR B CZ  1 
ATOM   7565 O OH  . TYR B 1 480 ? -0.505  -5.187  -34.607 1.00 52.49  ? 449  TYR B OH  1 
ATOM   7566 N N   . GLU B 1 481 ? -1.098  3.338   -33.484 1.00 45.53  ? 450  GLU B N   1 
ATOM   7567 C CA  . GLU B 1 481 ? -1.739  4.625   -33.690 1.00 45.24  ? 450  GLU B CA  1 
ATOM   7568 C C   . GLU B 1 481 ? -2.132  4.826   -35.153 1.00 45.19  ? 450  GLU B C   1 
ATOM   7569 O O   . GLU B 1 481 ? -3.029  5.600   -35.460 1.00 45.46  ? 450  GLU B O   1 
ATOM   7570 C CB  . GLU B 1 481 ? -0.792  5.738   -33.234 1.00 44.88  ? 450  GLU B CB  1 
ATOM   7571 C CG  . GLU B 1 481 ? 0.182   6.273   -34.287 1.00 43.68  ? 450  GLU B CG  1 
ATOM   7572 C CD  . GLU B 1 481 ? 1.435   5.434   -34.502 1.00 42.14  ? 450  GLU B CD  1 
ATOM   7573 O OE1 . GLU B 1 481 ? 1.491   4.194   -34.208 1.00 42.57  ? 450  GLU B OE1 1 
ATOM   7574 O OE2 . GLU B 1 481 ? 2.377   6.043   -35.021 1.00 39.09  ? 450  GLU B OE2 1 
ATOM   7575 N N   . ILE B 1 482 ? -1.470  4.128   -36.061 1.00 45.23  ? 451  ILE B N   1 
ATOM   7576 C CA  . ILE B 1 482 ? -1.634  4.404   -37.487 1.00 45.07  ? 451  ILE B CA  1 
ATOM   7577 C C   . ILE B 1 482 ? -3.068  4.246   -37.953 1.00 45.25  ? 451  ILE B C   1 
ATOM   7578 O O   . ILE B 1 482 ? -3.593  5.104   -38.641 1.00 46.00  ? 451  ILE B O   1 
ATOM   7579 C CB  . ILE B 1 482 ? -0.733  3.500   -38.332 1.00 45.11  ? 451  ILE B CB  1 
ATOM   7580 C CG1 . ILE B 1 482 ? 0.742   3.803   -38.058 1.00 45.14  ? 451  ILE B CG1 1 
ATOM   7581 C CG2 . ILE B 1 482 ? -1.040  3.715   -39.825 1.00 45.26  ? 451  ILE B CG2 1 
ATOM   7582 C CD1 . ILE B 1 482 ? 1.673   2.754   -38.642 1.00 46.97  ? 451  ILE B CD1 1 
ATOM   7583 N N   . GLU B 1 483 ? -3.699  3.149   -37.582 1.00 45.66  ? 452  GLU B N   1 
ATOM   7584 C CA  . GLU B 1 483 ? -5.080  2.880   -37.995 1.00 46.39  ? 452  GLU B CA  1 
ATOM   7585 C C   . GLU B 1 483 ? -6.034  4.014   -37.588 1.00 46.63  ? 452  GLU B C   1 
ATOM   7586 O O   . GLU B 1 483 ? -7.043  4.247   -38.259 1.00 47.29  ? 452  GLU B O   1 
ATOM   7587 C CB  . GLU B 1 483 ? -5.557  1.513   -37.446 1.00 47.61  ? 452  GLU B CB  1 
ATOM   7588 C CG  . GLU B 1 483 ? -5.321  1.234   -35.950 1.00 50.06  ? 452  GLU B CG  1 
ATOM   7589 C CD  . GLU B 1 483 ? -5.513  -0.241  -35.565 1.00 53.82  ? 452  GLU B CD  1 
ATOM   7590 O OE1 . GLU B 1 483 ? -6.499  -0.563  -34.862 1.00 59.61  ? 452  GLU B OE1 1 
ATOM   7591 O OE2 . GLU B 1 483 ? -4.709  -1.106  -35.968 1.00 56.07  ? 452  GLU B OE2 1 
ATOM   7592 N N   . PHE B 1 484 ? -5.709  4.745   -36.514 1.00 45.80  ? 453  PHE B N   1 
ATOM   7593 C CA  . PHE B 1 484 ? -6.536  5.874   -36.078 1.00 45.96  ? 453  PHE B CA  1 
ATOM   7594 C C   . PHE B 1 484 ? -6.345  7.116   -36.923 1.00 45.69  ? 453  PHE B C   1 
ATOM   7595 O O   . PHE B 1 484 ? -7.315  7.748   -37.317 1.00 45.75  ? 453  PHE B O   1 
ATOM   7596 C CB  . PHE B 1 484 ? -6.317  6.169   -34.579 1.00 45.77  ? 453  PHE B CB  1 
ATOM   7597 C CG  . PHE B 1 484 ? -6.880  5.102   -33.698 1.00 46.10  ? 453  PHE B CG  1 
ATOM   7598 C CD1 . PHE B 1 484 ? -8.218  5.094   -33.383 1.00 47.15  ? 453  PHE B CD1 1 
ATOM   7599 C CD2 . PHE B 1 484 ? -6.095  4.055   -33.275 1.00 46.37  ? 453  PHE B CD2 1 
ATOM   7600 C CE1 . PHE B 1 484 ? -8.758  4.085   -32.586 1.00 50.14  ? 453  PHE B CE1 1 
ATOM   7601 C CE2 . PHE B 1 484 ? -6.618  3.027   -32.493 1.00 47.98  ? 453  PHE B CE2 1 
ATOM   7602 C CZ  . PHE B 1 484 ? -7.955  3.040   -32.147 1.00 49.81  ? 453  PHE B CZ  1 
ATOM   7603 N N   . ILE B 1 485 ? -5.088  7.462   -37.200 1.00 45.59  ? 454  ILE B N   1 
ATOM   7604 C CA  . ILE B 1 485 ? -4.749  8.620   -38.038 1.00 45.16  ? 454  ILE B CA  1 
ATOM   7605 C C   . ILE B 1 485 ? -5.344  8.433   -39.447 1.00 45.36  ? 454  ILE B C   1 
ATOM   7606 O O   . ILE B 1 485 ? -5.833  9.381   -40.028 1.00 45.17  ? 454  ILE B O   1 
ATOM   7607 C CB  . ILE B 1 485 ? -3.221  8.767   -38.161 1.00 44.74  ? 454  ILE B CB  1 
ATOM   7608 C CG1 . ILE B 1 485 ? -2.517  8.834   -36.795 1.00 45.90  ? 454  ILE B CG1 1 
ATOM   7609 C CG2 . ILE B 1 485 ? -2.875  9.954   -39.022 1.00 44.53  ? 454  ILE B CG2 1 
ATOM   7610 C CD1 . ILE B 1 485 ? -2.974  9.984   -35.929 1.00 50.36  ? 454  ILE B CD1 1 
ATOM   7611 N N   . PHE B 1 486 ? -5.285  7.212   -39.997 1.00 45.56  ? 455  PHE B N   1 
ATOM   7612 C CA  . PHE B 1 486 ? -5.853  6.940   -41.330 1.00 46.65  ? 455  PHE B CA  1 
ATOM   7613 C C   . PHE B 1 486 ? -7.394  6.825   -41.350 1.00 47.67  ? 455  PHE B C   1 
ATOM   7614 O O   . PHE B 1 486 ? -7.998  6.786   -42.414 1.00 46.83  ? 455  PHE B O   1 
ATOM   7615 C CB  . PHE B 1 486 ? -5.224  5.693   -41.962 1.00 47.02  ? 455  PHE B CB  1 
ATOM   7616 C CG  . PHE B 1 486 ? -3.947  5.973   -42.712 1.00 46.64  ? 455  PHE B CG  1 
ATOM   7617 C CD1 . PHE B 1 486 ? -2.739  5.999   -42.055 1.00 46.48  ? 455  PHE B CD1 1 
ATOM   7618 C CD2 . PHE B 1 486 ? -3.962  6.189   -44.073 1.00 47.49  ? 455  PHE B CD2 1 
ATOM   7619 C CE1 . PHE B 1 486 ? -1.566  6.265   -42.739 1.00 46.26  ? 455  PHE B CE1 1 
ATOM   7620 C CE2 . PHE B 1 486 ? -2.788  6.434   -44.766 1.00 46.93  ? 455  PHE B CE2 1 
ATOM   7621 C CZ  . PHE B 1 486 ? -1.593  6.490   -44.095 1.00 45.68  ? 455  PHE B CZ  1 
ATOM   7622 N N   . GLY B 1 487 ? -7.998  6.770   -40.169 1.00 48.39  ? 456  GLY B N   1 
ATOM   7623 C CA  . GLY B 1 487 ? -9.438  6.828   -40.034 1.00 49.90  ? 456  GLY B CA  1 
ATOM   7624 C C   . GLY B 1 487 ? -10.191 5.517   -40.175 1.00 50.96  ? 456  GLY B C   1 
ATOM   7625 O O   . GLY B 1 487 ? -11.397 5.547   -40.399 1.00 52.14  ? 456  GLY B O   1 
ATOM   7626 N N   . LEU B 1 488 ? -9.506  4.383   -40.024 1.00 51.03  ? 457  LEU B N   1 
ATOM   7627 C CA  . LEU B 1 488 ? -10.148 3.070   -40.122 1.00 52.69  ? 457  LEU B CA  1 
ATOM   7628 C C   . LEU B 1 488 ? -11.382 2.870   -39.229 1.00 54.49  ? 457  LEU B C   1 
ATOM   7629 O O   . LEU B 1 488 ? -12.341 2.273   -39.675 1.00 55.65  ? 457  LEU B O   1 
ATOM   7630 C CB  . LEU B 1 488 ? -9.149  1.934   -39.860 1.00 52.40  ? 457  LEU B CB  1 
ATOM   7631 C CG  . LEU B 1 488 ? -8.474  1.386   -41.119 1.00 52.53  ? 457  LEU B CG  1 
ATOM   7632 C CD1 . LEU B 1 488 ? -7.513  2.448   -41.733 1.00 50.84  ? 457  LEU B CD1 1 
ATOM   7633 C CD2 . LEU B 1 488 ? -7.711  0.097   -40.785 1.00 53.11  ? 457  LEU B CD2 1 
ATOM   7634 N N   . PRO B 1 489 ? -11.373 3.323   -37.976 1.00 55.18  ? 458  PRO B N   1 
ATOM   7635 C CA  . PRO B 1 489 ? -12.562 3.180   -37.121 1.00 57.10  ? 458  PRO B CA  1 
ATOM   7636 C C   . PRO B 1 489 ? -13.866 3.729   -37.698 1.00 59.17  ? 458  PRO B C   1 
ATOM   7637 O O   . PRO B 1 489 ? -14.945 3.365   -37.207 1.00 60.19  ? 458  PRO B O   1 
ATOM   7638 C CB  . PRO B 1 489 ? -12.163 3.918   -35.846 1.00 56.88  ? 458  PRO B CB  1 
ATOM   7639 C CG  . PRO B 1 489 ? -10.654 3.800   -35.818 1.00 54.36  ? 458  PRO B CG  1 
ATOM   7640 C CD  . PRO B 1 489 ? -10.244 3.906   -37.238 1.00 53.84  ? 458  PRO B CD  1 
ATOM   7641 N N   . LEU B 1 490 ? -13.786 4.579   -38.722 1.00 60.01  ? 459  LEU B N   1 
ATOM   7642 C CA  . LEU B 1 490 ? -14.997 5.068   -39.408 1.00 61.97  ? 459  LEU B CA  1 
ATOM   7643 C C   . LEU B 1 490 ? -15.688 4.002   -40.273 1.00 63.80  ? 459  LEU B C   1 
ATOM   7644 O O   . LEU B 1 490 ? -16.842 4.168   -40.658 1.00 65.36  ? 459  LEU B O   1 
ATOM   7645 C CB  . LEU B 1 490 ? -14.676 6.284   -40.272 1.00 61.23  ? 459  LEU B CB  1 
ATOM   7646 C CG  . LEU B 1 490 ? -14.463 7.650   -39.623 1.00 61.48  ? 459  LEU B CG  1 
ATOM   7647 C CD1 . LEU B 1 490 ? -13.358 7.684   -38.548 1.00 61.28  ? 459  LEU B CD1 1 
ATOM   7648 C CD2 . LEU B 1 490 ? -14.138 8.625   -40.744 1.00 61.41  ? 459  LEU B CD2 1 
ATOM   7649 N N   . ASP B 1 491 ? -14.982 2.929   -40.596 1.00 64.79  ? 460  ASP B N   1 
ATOM   7650 C CA  . ASP B 1 491 ? -15.572 1.797   -41.319 1.00 67.19  ? 460  ASP B CA  1 
ATOM   7651 C C   . ASP B 1 491 ? -16.321 0.957   -40.294 1.00 69.22  ? 460  ASP B C   1 
ATOM   7652 O O   . ASP B 1 491 ? -15.672 0.387   -39.412 1.00 68.93  ? 460  ASP B O   1 
ATOM   7653 C CB  . ASP B 1 491 ? -14.478 0.961   -42.005 1.00 66.41  ? 460  ASP B CB  1 
ATOM   7654 C CG  . ASP B 1 491 ? -15.045 -0.117  -42.917 1.00 67.80  ? 460  ASP B CG  1 
ATOM   7655 O OD1 . ASP B 1 491 ? -16.254 -0.399  -42.823 1.00 66.66  ? 460  ASP B OD1 1 
ATOM   7656 O OD2 . ASP B 1 491 ? -14.338 -0.741  -43.749 1.00 68.15  ? 460  ASP B OD2 1 
ATOM   7657 N N   . PRO B 1 492 ? -17.660 0.873   -40.382 1.00 71.85  ? 461  PRO B N   1 
ATOM   7658 C CA  . PRO B 1 492 ? -18.422 0.224   -39.304 1.00 73.65  ? 461  PRO B CA  1 
ATOM   7659 C C   . PRO B 1 492 ? -18.272 -1.305  -39.315 1.00 74.07  ? 461  PRO B C   1 
ATOM   7660 O O   . PRO B 1 492 ? -18.505 -1.942  -38.293 1.00 75.45  ? 461  PRO B O   1 
ATOM   7661 C CB  . PRO B 1 492 ? -19.891 0.691   -39.535 1.00 75.43  ? 461  PRO B CB  1 
ATOM   7662 C CG  . PRO B 1 492 ? -19.884 1.535   -40.835 1.00 74.85  ? 461  PRO B CG  1 
ATOM   7663 C CD  . PRO B 1 492 ? -18.546 1.302   -41.491 1.00 72.70  ? 461  PRO B CD  1 
ATOM   7664 N N   . SER B 1 493 ? -17.876 -1.875  -40.443 1.00 73.74  ? 462  SER B N   1 
ATOM   7665 C CA  . SER B 1 493 ? -17.586 -3.305  -40.526 1.00 74.21  ? 462  SER B CA  1 
ATOM   7666 C C   . SER B 1 493 ? -16.357 -3.744  -39.698 1.00 73.29  ? 462  SER B C   1 
ATOM   7667 O O   . SER B 1 493 ? -16.183 -4.937  -39.465 1.00 73.55  ? 462  SER B O   1 
ATOM   7668 C CB  . SER B 1 493 ? -17.436 -3.730  -42.003 1.00 74.12  ? 462  SER B CB  1 
ATOM   7669 O OG  . SER B 1 493 ? -16.093 -3.663  -42.469 1.00 72.26  ? 462  SER B OG  1 
ATOM   7670 N N   . LEU B 1 494 ? -15.505 -2.802  -39.264 1.00 71.70  ? 463  LEU B N   1 
ATOM   7671 C CA  . LEU B 1 494 ? -14.301 -3.165  -38.511 1.00 70.50  ? 463  LEU B CA  1 
ATOM   7672 C C   . LEU B 1 494 ? -14.497 -3.238  -36.984 1.00 70.98  ? 463  LEU B C   1 
ATOM   7673 O O   . LEU B 1 494 ? -13.574 -3.642  -36.270 1.00 70.27  ? 463  LEU B O   1 
ATOM   7674 C CB  . LEU B 1 494 ? -13.124 -2.252  -38.865 1.00 68.96  ? 463  LEU B CB  1 
ATOM   7675 C CG  . LEU B 1 494 ? -12.569 -2.336  -40.292 1.00 67.91  ? 463  LEU B CG  1 
ATOM   7676 C CD1 . LEU B 1 494 ? -11.480 -1.276  -40.455 1.00 64.77  ? 463  LEU B CD1 1 
ATOM   7677 C CD2 . LEU B 1 494 ? -12.034 -3.732  -40.637 1.00 67.26  ? 463  LEU B CD2 1 
ATOM   7678 N N   . ASN B 1 495 ? -15.676 -2.863  -36.490 1.00 72.05  ? 464  ASN B N   1 
ATOM   7679 C CA  . ASN B 1 495 ? -16.080 -3.124  -35.091 1.00 73.34  ? 464  ASN B CA  1 
ATOM   7680 C C   . ASN B 1 495 ? -15.286 -2.358  -34.018 1.00 71.16  ? 464  ASN B C   1 
ATOM   7681 O O   . ASN B 1 495 ? -15.065 -2.857  -32.906 1.00 71.23  ? 464  ASN B O   1 
ATOM   7682 C CB  . ASN B 1 495 ? -16.087 -4.649  -34.768 1.00 75.03  ? 464  ASN B CB  1 
ATOM   7683 C CG  . ASN B 1 495 ? -17.111 -5.433  -35.583 1.00 78.04  ? 464  ASN B CG  1 
ATOM   7684 O OD1 . ASN B 1 495 ? -18.156 -4.908  -35.970 1.00 80.25  ? 464  ASN B OD1 1 
ATOM   7685 N ND2 . ASN B 1 495 ? -16.809 -6.707  -35.842 1.00 82.07  ? 464  ASN B ND2 1 
ATOM   7686 N N   . TYR B 1 496 ? -14.870 -1.142  -34.348 1.00 68.96  ? 465  TYR B N   1 
ATOM   7687 C CA  . TYR B 1 496 ? -14.350 -0.223  -33.344 1.00 67.11  ? 465  TYR B CA  1 
ATOM   7688 C C   . TYR B 1 496 ? -15.549 0.364   -32.605 1.00 67.96  ? 465  TYR B C   1 
ATOM   7689 O O   . TYR B 1 496 ? -16.664 0.336   -33.126 1.00 68.95  ? 465  TYR B O   1 
ATOM   7690 C CB  . TYR B 1 496 ? -13.541 0.884   -34.016 1.00 65.44  ? 465  TYR B CB  1 
ATOM   7691 C CG  . TYR B 1 496 ? -12.193 0.482   -34.593 1.00 62.20  ? 465  TYR B CG  1 
ATOM   7692 C CD1 . TYR B 1 496 ? -11.035 0.546   -33.829 1.00 60.60  ? 465  TYR B CD1 1 
ATOM   7693 C CD2 . TYR B 1 496 ? -12.072 0.089   -35.913 1.00 62.03  ? 465  TYR B CD2 1 
ATOM   7694 C CE1 . TYR B 1 496 ? -9.785  0.208   -34.364 1.00 60.68  ? 465  TYR B CE1 1 
ATOM   7695 C CE2 . TYR B 1 496 ? -10.835 -0.252  -36.466 1.00 61.11  ? 465  TYR B CE2 1 
ATOM   7696 C CZ  . TYR B 1 496 ? -9.690  -0.192  -35.693 1.00 60.49  ? 465  TYR B CZ  1 
ATOM   7697 O OH  . TYR B 1 496 ? -8.470  -0.511  -36.255 1.00 56.69  ? 465  TYR B OH  1 
ATOM   7698 N N   . THR B 1 497 ? -15.328 0.893   -31.400 1.00 67.59  ? 466  THR B N   1 
ATOM   7699 C CA  . THR B 1 497 ? -16.397 1.561   -30.647 1.00 68.31  ? 466  THR B CA  1 
ATOM   7700 C C   . THR B 1 497 ? -16.712 2.928   -31.231 1.00 68.11  ? 466  THR B C   1 
ATOM   7701 O O   . THR B 1 497 ? -15.980 3.456   -32.043 1.00 67.36  ? 466  THR B O   1 
ATOM   7702 C CB  . THR B 1 497 ? -16.032 1.764   -29.167 1.00 67.92  ? 466  THR B CB  1 
ATOM   7703 O OG1 . THR B 1 497 ? -14.976 2.721   -29.059 1.00 67.07  ? 466  THR B OG1 1 
ATOM   7704 C CG2 . THR B 1 497 ? -15.492 0.492   -28.527 1.00 67.44  ? 466  THR B CG2 1 
ATOM   7705 N N   . THR B 1 498 ? -17.820 3.492   -30.792 1.00 69.49  ? 467  THR B N   1 
ATOM   7706 C CA  . THR B 1 498 ? -18.246 4.818   -31.195 1.00 69.58  ? 467  THR B CA  1 
ATOM   7707 C C   . THR B 1 498 ? -17.242 5.886   -30.760 1.00 68.20  ? 467  THR B C   1 
ATOM   7708 O O   . THR B 1 498 ? -16.955 6.833   -31.505 1.00 67.45  ? 467  THR B O   1 
ATOM   7709 C CB  . THR B 1 498 ? -19.617 5.087   -30.540 1.00 71.32  ? 467  THR B CB  1 
ATOM   7710 O OG1 . THR B 1 498 ? -20.570 4.196   -31.113 1.00 72.93  ? 467  THR B OG1 1 
ATOM   7711 C CG2 . THR B 1 498 ? -20.147 6.487   -30.848 1.00 71.50  ? 467  THR B CG2 1 
ATOM   7712 N N   . GLU B 1 499 ? -16.752 5.735   -29.534 1.00 67.75  ? 468  GLU B N   1 
ATOM   7713 C CA  . GLU B 1 499 ? -15.770 6.632   -28.950 1.00 66.67  ? 468  GLU B CA  1 
ATOM   7714 C C   . GLU B 1 499 ? -14.503 6.661   -29.834 1.00 64.02  ? 468  GLU B C   1 
ATOM   7715 O O   . GLU B 1 499 ? -13.962 7.720   -30.122 1.00 62.10  ? 468  GLU B O   1 
ATOM   7716 C CB  . GLU B 1 499 ? -15.437 6.156   -27.517 1.00 67.36  ? 468  GLU B CB  1 
ATOM   7717 C CG  . GLU B 1 499 ? -16.552 6.363   -26.482 1.00 72.37  ? 468  GLU B CG  1 
ATOM   7718 C CD  . GLU B 1 499 ? -17.470 5.133   -26.229 1.00 78.20  ? 468  GLU B CD  1 
ATOM   7719 O OE1 . GLU B 1 499 ? -17.883 4.417   -27.191 1.00 78.68  ? 468  GLU B OE1 1 
ATOM   7720 O OE2 . GLU B 1 499 ? -17.813 4.884   -25.034 1.00 82.38  ? 468  GLU B OE2 1 
ATOM   7721 N N   . GLU B 1 500 ? -14.080 5.474   -30.279 1.00 62.97  ? 469  GLU B N   1 
ATOM   7722 C CA  . GLU B 1 500 ? -12.943 5.295   -31.176 1.00 61.28  ? 469  GLU B CA  1 
ATOM   7723 C C   . GLU B 1 500 ? -13.116 5.956   -32.538 1.00 60.73  ? 469  GLU B C   1 
ATOM   7724 O O   . GLU B 1 500 ? -12.147 6.440   -33.121 1.00 59.02  ? 469  GLU B O   1 
ATOM   7725 C CB  . GLU B 1 500 ? -12.640 3.797   -31.354 1.00 61.23  ? 469  GLU B CB  1 
ATOM   7726 C CG  . GLU B 1 500 ? -11.861 3.248   -30.176 1.00 60.63  ? 469  GLU B CG  1 
ATOM   7727 C CD  . GLU B 1 500 ? -11.568 1.766   -30.249 1.00 60.04  ? 469  GLU B CD  1 
ATOM   7728 O OE1 . GLU B 1 500 ? -12.384 0.981   -30.774 1.00 61.57  ? 469  GLU B OE1 1 
ATOM   7729 O OE2 . GLU B 1 500 ? -10.520 1.376   -29.716 1.00 58.67  ? 469  GLU B OE2 1 
ATOM   7730 N N   . ARG B 1 501 ? -14.345 5.942   -33.041 1.00 61.83  ? 470  ARG B N   1 
ATOM   7731 C CA  . ARG B 1 501 ? -14.690 6.614   -34.284 1.00 62.10  ? 470  ARG B CA  1 
ATOM   7732 C C   . ARG B 1 501 ? -14.516 8.123   -34.137 1.00 60.35  ? 470  ARG B C   1 
ATOM   7733 O O   . ARG B 1 501 ? -13.994 8.776   -35.017 1.00 59.61  ? 470  ARG B O   1 
ATOM   7734 C CB  . ARG B 1 501 ? -16.131 6.298   -34.675 1.00 64.31  ? 470  ARG B CB  1 
ATOM   7735 C CG  . ARG B 1 501 ? -16.372 6.160   -36.157 1.00 67.82  ? 470  ARG B CG  1 
ATOM   7736 C CD  . ARG B 1 501 ? -17.532 7.018   -36.704 1.00 73.64  ? 470  ARG B CD  1 
ATOM   7737 N NE  . ARG B 1 501 ? -18.786 6.784   -35.981 1.00 78.54  ? 470  ARG B NE  1 
ATOM   7738 C CZ  . ARG B 1 501 ? -19.480 7.711   -35.308 1.00 81.44  ? 470  ARG B CZ  1 
ATOM   7739 N NH1 . ARG B 1 501 ? -19.071 8.988   -35.253 1.00 81.44  ? 470  ARG B NH1 1 
ATOM   7740 N NH2 . ARG B 1 501 ? -20.594 7.349   -34.674 1.00 82.78  ? 470  ARG B NH2 1 
ATOM   7741 N N   . ILE B 1 502 ? -14.968 8.664   -33.021 1.00 60.13  ? 471  ILE B N   1 
ATOM   7742 C CA  . ILE B 1 502 ? -14.916 10.113  -32.754 1.00 59.08  ? 471  ILE B CA  1 
ATOM   7743 C C   . ILE B 1 502 ? -13.469 10.542  -32.487 1.00 56.70  ? 471  ILE B C   1 
ATOM   7744 O O   . ILE B 1 502 ? -13.060 11.625  -32.878 1.00 56.22  ? 471  ILE B O   1 
ATOM   7745 C CB  . ILE B 1 502 ? -15.837 10.461  -31.553 1.00 60.29  ? 471  ILE B CB  1 
ATOM   7746 C CG1 . ILE B 1 502 ? -17.301 10.439  -32.009 1.00 62.95  ? 471  ILE B CG1 1 
ATOM   7747 C CG2 . ILE B 1 502 ? -15.483 11.818  -30.911 1.00 58.95  ? 471  ILE B CG2 1 
ATOM   7748 C CD1 . ILE B 1 502 ? -18.266 10.259  -30.874 1.00 65.74  ? 471  ILE B CD1 1 
ATOM   7749 N N   . PHE B 1 503 ? -12.717 9.678   -31.817 1.00 54.76  ? 472  PHE B N   1 
ATOM   7750 C CA  . PHE B 1 503 ? -11.307 9.883   -31.588 1.00 52.87  ? 472  PHE B CA  1 
ATOM   7751 C C   . PHE B 1 503 ? -10.536 9.931   -32.918 1.00 51.79  ? 472  PHE B C   1 
ATOM   7752 O O   . PHE B 1 503 ? -9.728  10.832  -33.127 1.00 50.43  ? 472  PHE B O   1 
ATOM   7753 C CB  . PHE B 1 503 ? -10.788 8.770   -30.681 1.00 52.24  ? 472  PHE B CB  1 
ATOM   7754 C CG  . PHE B 1 503 ? -9.308  8.846   -30.382 1.00 50.22  ? 472  PHE B CG  1 
ATOM   7755 C CD1 . PHE B 1 503 ? -8.710  10.042  -30.035 1.00 47.03  ? 472  PHE B CD1 1 
ATOM   7756 C CD2 . PHE B 1 503 ? -8.529  7.700   -30.433 1.00 48.29  ? 472  PHE B CD2 1 
ATOM   7757 C CE1 . PHE B 1 503 ? -7.382  10.102  -29.753 1.00 48.05  ? 472  PHE B CE1 1 
ATOM   7758 C CE2 . PHE B 1 503 ? -7.194  7.745   -30.137 1.00 48.45  ? 472  PHE B CE2 1 
ATOM   7759 C CZ  . PHE B 1 503 ? -6.611  8.952   -29.792 1.00 48.50  ? 472  PHE B CZ  1 
ATOM   7760 N N   . ALA B 1 504 ? -10.797 8.980   -33.817 1.00 51.77  ? 473  ALA B N   1 
ATOM   7761 C CA  . ALA B 1 504 ? -10.134 8.974   -35.111 1.00 51.27  ? 473  ALA B CA  1 
ATOM   7762 C C   . ALA B 1 504 ? -10.498 10.218  -35.898 1.00 52.14  ? 473  ALA B C   1 
ATOM   7763 O O   . ALA B 1 504 ? -9.647  10.790  -36.551 1.00 51.88  ? 473  ALA B O   1 
ATOM   7764 C CB  . ALA B 1 504 ? -10.468 7.771   -35.883 1.00 51.99  ? 473  ALA B CB  1 
ATOM   7765 N N   . GLN B 1 505 ? -11.747 10.661  -35.827 1.00 53.89  ? 474  GLN B N   1 
ATOM   7766 C CA  . GLN B 1 505 ? -12.136 11.905  -36.498 1.00 54.78  ? 474  GLN B CA  1 
ATOM   7767 C C   . GLN B 1 505 ? -11.297 13.092  -36.005 1.00 53.91  ? 474  GLN B C   1 
ATOM   7768 O O   . GLN B 1 505 ? -10.878 13.930  -36.811 1.00 53.62  ? 474  GLN B O   1 
ATOM   7769 C CB  . GLN B 1 505 ? -13.651 12.160  -36.351 1.00 56.26  ? 474  GLN B CB  1 
ATOM   7770 C CG  . GLN B 1 505 ? -14.465 11.285  -37.311 1.00 58.54  ? 474  GLN B CG  1 
ATOM   7771 C CD  . GLN B 1 505 ? -15.993 11.362  -37.142 1.00 63.23  ? 474  GLN B CD  1 
ATOM   7772 O OE1 . GLN B 1 505 ? -16.516 11.191  -36.050 1.00 65.25  ? 474  GLN B OE1 1 
ATOM   7773 N NE2 . GLN B 1 505 ? -16.702 11.561  -38.248 1.00 66.26  ? 474  GLN B NE2 1 
ATOM   7774 N N   . ARG B 1 506 ? -11.049 13.138  -34.695 1.00 53.47  ? 475  ARG B N   1 
ATOM   7775 C CA  . ARG B 1 506 ? -10.260 14.192  -34.083 1.00 53.25  ? 475  ARG B CA  1 
ATOM   7776 C C   . ARG B 1 506 ? -8.822  14.152  -34.626 1.00 51.38  ? 475  ARG B C   1 
ATOM   7777 O O   . ARG B 1 506 ? -8.250  15.192  -34.937 1.00 50.47  ? 475  ARG B O   1 
ATOM   7778 C CB  . ARG B 1 506 ? -10.185 14.057  -32.544 1.00 53.84  ? 475  ARG B CB  1 
ATOM   7779 C CG  . ARG B 1 506 ? -11.362 14.575  -31.707 1.00 58.63  ? 475  ARG B CG  1 
ATOM   7780 C CD  . ARG B 1 506 ? -11.233 14.272  -30.134 1.00 59.80  ? 475  ARG B CD  1 
ATOM   7781 N NE  . ARG B 1 506 ? -9.964  14.832  -29.655 1.00 58.33  ? 475  ARG B NE  1 
ATOM   7782 C CZ  . ARG B 1 506 ? -9.109  14.271  -28.804 1.00 55.14  ? 475  ARG B CZ  1 
ATOM   7783 N NH1 . ARG B 1 506 ? -9.336  13.103  -28.237 1.00 53.47  ? 475  ARG B NH1 1 
ATOM   7784 N NH2 . ARG B 1 506 ? -7.991  14.923  -28.514 1.00 54.63  ? 475  ARG B NH2 1 
ATOM   7785 N N   . LEU B 1 507 ? -8.235  12.962  -34.695 1.00 49.91  ? 476  LEU B N   1 
ATOM   7786 C CA  . LEU B 1 507 ? -6.855  12.838  -35.132 1.00 49.41  ? 476  LEU B CA  1 
ATOM   7787 C C   . LEU B 1 507 ? -6.701  13.191  -36.606 1.00 48.90  ? 476  LEU B C   1 
ATOM   7788 O O   . LEU B 1 507 ? -5.756  13.878  -36.995 1.00 48.21  ? 476  LEU B O   1 
ATOM   7789 C CB  . LEU B 1 507 ? -6.345  11.428  -34.891 1.00 49.44  ? 476  LEU B CB  1 
ATOM   7790 C CG  . LEU B 1 507 ? -6.293  11.067  -33.414 1.00 50.99  ? 476  LEU B CG  1 
ATOM   7791 C CD1 . LEU B 1 507 ? -5.955  9.608   -33.280 1.00 52.02  ? 476  LEU B CD1 1 
ATOM   7792 C CD2 . LEU B 1 507 ? -5.275  11.940  -32.682 1.00 51.34  ? 476  LEU B CD2 1 
ATOM   7793 N N   . MET B 1 508 ? -7.646  12.744  -37.417 1.00 49.50  ? 477  MET B N   1 
ATOM   7794 C CA  . MET B 1 508 ? -7.625  13.053  -38.829 1.00 49.98  ? 477  MET B CA  1 
ATOM   7795 C C   . MET B 1 508 ? -7.633  14.555  -39.033 1.00 50.04  ? 477  MET B C   1 
ATOM   7796 O O   . MET B 1 508 ? -7.005  15.065  -39.954 1.00 49.54  ? 477  MET B O   1 
ATOM   7797 C CB  . MET B 1 508 ? -8.828  12.432  -39.534 1.00 51.54  ? 477  MET B CB  1 
ATOM   7798 C CG  . MET B 1 508 ? -8.708  10.925  -39.856 1.00 52.60  ? 477  MET B CG  1 
ATOM   7799 S SD  . MET B 1 508 ? -10.343 10.267  -40.301 1.00 58.94  ? 477  MET B SD  1 
ATOM   7800 C CE  . MET B 1 508 ? -10.175 10.164  -41.966 1.00 58.57  ? 477  MET B CE  1 
ATOM   7801 N N   . LYS B 1 509 ? -8.343  15.256  -38.151 1.00 50.98  ? 478  LYS B N   1 
ATOM   7802 C CA  . LYS B 1 509 ? -8.409  16.719  -38.176 1.00 51.52  ? 478  LYS B CA  1 
ATOM   7803 C C   . LYS B 1 509 ? -7.086  17.344  -37.765 1.00 49.30  ? 478  LYS B C   1 
ATOM   7804 O O   . LYS B 1 509 ? -6.635  18.293  -38.397 1.00 48.99  ? 478  LYS B O   1 
ATOM   7805 C CB  . LYS B 1 509 ? -9.497  17.261  -37.252 1.00 53.19  ? 478  LYS B CB  1 
ATOM   7806 C CG  . LYS B 1 509 ? -10.795 17.522  -37.906 1.00 59.24  ? 478  LYS B CG  1 
ATOM   7807 C CD  . LYS B 1 509 ? -11.013 19.012  -38.248 1.00 64.07  ? 478  LYS B CD  1 
ATOM   7808 C CE  . LYS B 1 509 ? -12.400 19.194  -38.955 1.00 67.15  ? 478  LYS B CE  1 
ATOM   7809 N NZ  . LYS B 1 509 ? -12.587 18.259  -40.124 1.00 65.98  ? 478  LYS B NZ  1 
ATOM   7810 N N   . TYR B 1 510 ? -6.480  16.836  -36.699 1.00 47.37  ? 479  TYR B N   1 
ATOM   7811 C CA  . TYR B 1 510 ? -5.200  17.355  -36.266 1.00 46.27  ? 479  TYR B CA  1 
ATOM   7812 C C   . TYR B 1 510 ? -4.187  17.225  -37.383 1.00 45.38  ? 479  TYR B C   1 
ATOM   7813 O O   . TYR B 1 510 ? -3.495  18.176  -37.707 1.00 44.74  ? 479  TYR B O   1 
ATOM   7814 C CB  . TYR B 1 510 ? -4.664  16.583  -35.075 1.00 46.02  ? 479  TYR B CB  1 
ATOM   7815 C CG  . TYR B 1 510 ? -5.353  16.811  -33.757 1.00 46.13  ? 479  TYR B CG  1 
ATOM   7816 C CD1 . TYR B 1 510 ? -5.849  18.060  -33.382 1.00 47.88  ? 479  TYR B CD1 1 
ATOM   7817 C CD2 . TYR B 1 510 ? -5.485  15.778  -32.871 1.00 46.28  ? 479  TYR B CD2 1 
ATOM   7818 C CE1 . TYR B 1 510 ? -6.495  18.237  -32.164 1.00 45.93  ? 479  TYR B CE1 1 
ATOM   7819 C CE2 . TYR B 1 510 ? -6.105  15.952  -31.663 1.00 47.79  ? 479  TYR B CE2 1 
ATOM   7820 C CZ  . TYR B 1 510 ? -6.603  17.172  -31.318 1.00 47.37  ? 479  TYR B CZ  1 
ATOM   7821 O OH  . TYR B 1 510 ? -7.211  17.275  -30.105 1.00 51.17  ? 479  TYR B OH  1 
ATOM   7822 N N   . TRP B 1 511 ? -4.105  16.039  -37.977 1.00 45.28  ? 480  TRP B N   1 
ATOM   7823 C CA  . TRP B 1 511 ? -3.102  15.771  -39.013 1.00 44.75  ? 480  TRP B CA  1 
ATOM   7824 C C   . TRP B 1 511 ? -3.310  16.618  -40.288 1.00 45.49  ? 480  TRP B C   1 
ATOM   7825 O O   . TRP B 1 511 ? -2.358  17.167  -40.833 1.00 45.13  ? 480  TRP B O   1 
ATOM   7826 C CB  . TRP B 1 511 ? -3.077  14.281  -39.360 1.00 44.80  ? 480  TRP B CB  1 
ATOM   7827 C CG  . TRP B 1 511 ? -1.997  13.513  -38.707 1.00 41.09  ? 480  TRP B CG  1 
ATOM   7828 C CD1 . TRP B 1 511 ? -1.031  12.849  -39.323 1.00 39.59  ? 480  TRP B CD1 1 
ATOM   7829 C CD2 . TRP B 1 511 ? -1.791  13.325  -37.299 1.00 41.79  ? 480  TRP B CD2 1 
ATOM   7830 N NE1 . TRP B 1 511 ? -0.184  12.266  -38.412 1.00 41.48  ? 480  TRP B NE1 1 
ATOM   7831 C CE2 . TRP B 1 511 ? -0.636  12.537  -37.152 1.00 40.21  ? 480  TRP B CE2 1 
ATOM   7832 C CE3 . TRP B 1 511 ? -2.453  13.765  -36.144 1.00 42.20  ? 480  TRP B CE3 1 
ATOM   7833 C CZ2 . TRP B 1 511 ? -0.129  12.153  -35.911 1.00 39.87  ? 480  TRP B CZ2 1 
ATOM   7834 C CZ3 . TRP B 1 511 ? -1.957  13.382  -34.898 1.00 42.48  ? 480  TRP B CZ3 1 
ATOM   7835 C CH2 . TRP B 1 511 ? -0.792  12.579  -34.797 1.00 42.60  ? 480  TRP B CH2 1 
ATOM   7836 N N   . THR B 1 512 ? -4.551  16.739  -40.747 1.00 46.32  ? 481  THR B N   1 
ATOM   7837 C CA  . THR B 1 512 ? -4.830  17.498  -41.956 1.00 46.81  ? 481  THR B CA  1 
ATOM   7838 C C   . THR B 1 512 ? -4.815  18.994  -41.692 1.00 47.29  ? 481  THR B C   1 
ATOM   7839 O O   . THR B 1 512 ? -4.526  19.768  -42.578 1.00 48.00  ? 481  THR B O   1 
ATOM   7840 C CB  . THR B 1 512 ? -6.191  17.082  -42.594 1.00 47.74  ? 481  THR B CB  1 
ATOM   7841 O OG1 . THR B 1 512 ? -7.218  17.081  -41.598 1.00 49.30  ? 481  THR B OG1 1 
ATOM   7842 C CG2 . THR B 1 512 ? -6.176  15.644  -43.112 1.00 47.03  ? 481  THR B CG2 1 
ATOM   7843 N N   . ASN B 1 513 ? -5.134  19.415  -40.481 1.00 48.33  ? 482  ASN B N   1 
ATOM   7844 C CA  . ASN B 1 513 ? -4.961  20.827  -40.107 1.00 49.29  ? 482  ASN B CA  1 
ATOM   7845 C C   . ASN B 1 513 ? -3.499  21.192  -40.163 1.00 48.61  ? 482  ASN B C   1 
ATOM   7846 O O   . ASN B 1 513 ? -3.122  22.263  -40.655 1.00 48.82  ? 482  ASN B O   1 
ATOM   7847 C CB  . ASN B 1 513 ? -5.499  21.121  -38.706 1.00 49.85  ? 482  ASN B CB  1 
ATOM   7848 C CG  . ASN B 1 513 ? -7.023  21.278  -38.681 1.00 51.73  ? 482  ASN B CG  1 
ATOM   7849 O OD1 . ASN B 1 513 ? -7.624  21.741  -39.639 1.00 52.49  ? 482  ASN B OD1 1 
ATOM   7850 N ND2 . ASN B 1 513 ? -7.640  20.894  -37.563 1.00 55.34  ? 482  ASN B ND2 1 
ATOM   7851 N N   . PHE B 1 514 ? -2.686  20.286  -39.652 1.00 47.76  ? 483  PHE B N   1 
ATOM   7852 C CA  . PHE B 1 514 ? -1.259  20.450  -39.704 1.00 47.79  ? 483  PHE B CA  1 
ATOM   7853 C C   . PHE B 1 514 ? -0.782  20.513  -41.169 1.00 48.86  ? 483  PHE B C   1 
ATOM   7854 O O   . PHE B 1 514 ? 0.050   21.344  -41.518 1.00 48.69  ? 483  PHE B O   1 
ATOM   7855 C CB  . PHE B 1 514 ? -0.557  19.305  -38.968 1.00 46.63  ? 483  PHE B CB  1 
ATOM   7856 C CG  . PHE B 1 514 ? 0.915   19.399  -39.039 1.00 44.12  ? 483  PHE B CG  1 
ATOM   7857 C CD1 . PHE B 1 514 ? 1.582   20.383  -38.332 1.00 42.94  ? 483  PHE B CD1 1 
ATOM   7858 C CD2 . PHE B 1 514 ? 1.631   18.567  -39.855 1.00 42.40  ? 483  PHE B CD2 1 
ATOM   7859 C CE1 . PHE B 1 514 ? 2.967   20.495  -38.409 1.00 42.34  ? 483  PHE B CE1 1 
ATOM   7860 C CE2 . PHE B 1 514 ? 3.007   18.690  -39.946 1.00 42.41  ? 483  PHE B CE2 1 
ATOM   7861 C CZ  . PHE B 1 514 ? 3.667   19.658  -39.214 1.00 40.83  ? 483  PHE B CZ  1 
ATOM   7862 N N   . ALA B 1 515 ? -1.311  19.654  -42.034 1.00 49.67  ? 484  ALA B N   1 
ATOM   7863 C CA  . ALA B 1 515 ? -0.885  19.683  -43.444 1.00 50.42  ? 484  ALA B CA  1 
ATOM   7864 C C   . ALA B 1 515 ? -1.277  20.997  -44.104 1.00 51.61  ? 484  ALA B C   1 
ATOM   7865 O O   . ALA B 1 515 ? -0.536  21.554  -44.905 1.00 51.60  ? 484  ALA B O   1 
ATOM   7866 C CB  . ALA B 1 515 ? -1.452  18.493  -44.232 1.00 50.36  ? 484  ALA B CB  1 
ATOM   7867 N N   . ARG B 1 516 ? -2.453  21.490  -43.757 1.00 53.14  ? 485  ARG B N   1 
ATOM   7868 C CA  . ARG B 1 516 ? -2.988  22.710  -44.355 1.00 55.04  ? 485  ARG B CA  1 
ATOM   7869 C C   . ARG B 1 516 ? -2.202  23.939  -43.917 1.00 54.19  ? 485  ARG B C   1 
ATOM   7870 O O   . ARG B 1 516 ? -1.954  24.805  -44.720 1.00 54.79  ? 485  ARG B O   1 
ATOM   7871 C CB  . ARG B 1 516 ? -4.450  22.924  -43.942 1.00 56.78  ? 485  ARG B CB  1 
ATOM   7872 C CG  . ARG B 1 516 ? -5.510  22.567  -44.962 1.00 62.64  ? 485  ARG B CG  1 
ATOM   7873 C CD  . ARG B 1 516 ? -6.953  22.863  -44.480 1.00 67.72  ? 485  ARG B CD  1 
ATOM   7874 N NE  . ARG B 1 516 ? -7.338  21.912  -43.418 1.00 71.20  ? 485  ARG B NE  1 
ATOM   7875 C CZ  . ARG B 1 516 ? -7.878  20.686  -43.599 1.00 72.93  ? 485  ARG B CZ  1 
ATOM   7876 N NH1 . ARG B 1 516 ? -8.152  20.218  -44.824 1.00 73.77  ? 485  ARG B NH1 1 
ATOM   7877 N NH2 . ARG B 1 516 ? -8.164  19.923  -42.528 1.00 72.37  ? 485  ARG B NH2 1 
ATOM   7878 N N   . THR B 1 517 ? -1.848  24.025  -42.636 1.00 52.93  ? 486  THR B N   1 
ATOM   7879 C CA  . THR B 1 517 ? -1.375  25.286  -42.049 1.00 52.99  ? 486  THR B CA  1 
ATOM   7880 C C   . THR B 1 517 ? -0.060  25.218  -41.278 1.00 51.92  ? 486  THR B C   1 
ATOM   7881 O O   . THR B 1 517 ? 0.474   26.257  -40.877 1.00 52.81  ? 486  THR B O   1 
ATOM   7882 C CB  . THR B 1 517 ? -2.400  25.809  -41.054 1.00 53.70  ? 486  THR B CB  1 
ATOM   7883 O OG1 . THR B 1 517 ? -2.441  24.925  -39.923 1.00 52.66  ? 486  THR B OG1 1 
ATOM   7884 C CG2 . THR B 1 517 ? -3.809  25.798  -41.637 1.00 54.68  ? 486  THR B CG2 1 
ATOM   7885 N N   . GLY B 1 518 ? 0.434   24.018  -41.012 1.00 50.16  ? 487  GLY B N   1 
ATOM   7886 C CA  . GLY B 1 518 ? 1.569   23.836  -40.116 1.00 49.55  ? 487  GLY B CA  1 
ATOM   7887 C C   . GLY B 1 518 ? 1.241   23.827  -38.627 1.00 49.69  ? 487  GLY B C   1 
ATOM   7888 O O   . GLY B 1 518 ? 2.162   23.795  -37.814 1.00 49.28  ? 487  GLY B O   1 
ATOM   7889 N N   . ASP B 1 519 ? -0.063  23.833  -38.303 1.00 50.52  ? 488  ASP B N   1 
ATOM   7890 C CA  . ASP B 1 519 ? -0.618  23.989  -36.965 1.00 50.70  ? 488  ASP B CA  1 
ATOM   7891 C C   . ASP B 1 519 ? -1.777  22.971  -36.854 1.00 51.10  ? 488  ASP B C   1 
ATOM   7892 O O   . ASP B 1 519 ? -2.734  23.049  -37.614 1.00 51.26  ? 488  ASP B O   1 
ATOM   7893 C CB  . ASP B 1 519 ? -1.119  25.440  -36.827 1.00 51.86  ? 488  ASP B CB  1 
ATOM   7894 C CG  . ASP B 1 519 ? -1.511  25.818  -35.411 1.00 52.14  ? 488  ASP B CG  1 
ATOM   7895 O OD1 . ASP B 1 519 ? -1.728  24.918  -34.586 1.00 51.51  ? 488  ASP B OD1 1 
ATOM   7896 O OD2 . ASP B 1 519 ? -1.652  27.004  -35.030 1.00 54.83  ? 488  ASP B OD2 1 
ATOM   7897 N N   . PRO B 1 520 ? -1.706  22.029  -35.919 1.00 51.62  ? 489  PRO B N   1 
ATOM   7898 C CA  . PRO B 1 520 ? -2.770  21.031  -35.766 1.00 52.57  ? 489  PRO B CA  1 
ATOM   7899 C C   . PRO B 1 520 ? -4.056  21.555  -35.133 1.00 55.61  ? 489  PRO B C   1 
ATOM   7900 O O   . PRO B 1 520 ? -5.072  20.863  -35.203 1.00 57.09  ? 489  PRO B O   1 
ATOM   7901 C CB  . PRO B 1 520 ? -2.129  19.949  -34.897 1.00 51.41  ? 489  PRO B CB  1 
ATOM   7902 C CG  . PRO B 1 520 ? -0.997  20.588  -34.176 1.00 50.37  ? 489  PRO B CG  1 
ATOM   7903 C CD  . PRO B 1 520 ? -0.618  21.844  -34.939 1.00 51.01  ? 489  PRO B CD  1 
ATOM   7904 N N   . ASN B 1 521 ? -4.047  22.742  -34.548 1.00 57.96  ? 490  ASN B N   1 
ATOM   7905 C CA  . ASN B 1 521 ? -5.243  23.277  -33.919 1.00 60.80  ? 490  ASN B CA  1 
ATOM   7906 C C   . ASN B 1 521 ? -6.278  23.709  -34.936 1.00 64.17  ? 490  ASN B C   1 
ATOM   7907 O O   . ASN B 1 521 ? -5.952  24.353  -35.926 1.00 64.46  ? 490  ASN B O   1 
ATOM   7908 C CB  . ASN B 1 521 ? -4.881  24.443  -33.016 1.00 60.38  ? 490  ASN B CB  1 
ATOM   7909 C CG  . ASN B 1 521 ? -3.980  24.030  -31.897 1.00 58.32  ? 490  ASN B CG  1 
ATOM   7910 O OD1 . ASN B 1 521 ? -4.443  23.442  -30.924 1.00 58.57  ? 490  ASN B OD1 1 
ATOM   7911 N ND2 . ASN B 1 521 ? -2.680  24.316  -32.024 1.00 50.17  ? 490  ASN B ND2 1 
ATOM   7912 N N   . ASP B 1 522 ? -7.520  23.306  -34.683 1.00 68.02  ? 491  ASP B N   1 
ATOM   7913 C CA  . ASP B 1 522 ? -8.669  23.683  -35.514 1.00 71.70  ? 491  ASP B CA  1 
ATOM   7914 C C   . ASP B 1 522 ? -8.811  25.202  -35.416 1.00 73.65  ? 491  ASP B C   1 
ATOM   7915 O O   . ASP B 1 522 ? -9.038  25.707  -34.315 1.00 74.58  ? 491  ASP B O   1 
ATOM   7916 C CB  . ASP B 1 522 ? -9.960  22.968  -35.028 1.00 72.87  ? 491  ASP B CB  1 
ATOM   7917 C CG  . ASP B 1 522 ? -11.006 22.771  -36.148 1.00 76.61  ? 491  ASP B CG  1 
ATOM   7918 O OD1 . ASP B 1 522 ? -11.455 23.778  -36.758 1.00 80.08  ? 491  ASP B OD1 1 
ATOM   7919 O OD2 . ASP B 1 522 ? -11.453 21.642  -36.482 1.00 80.19  ? 491  ASP B OD2 1 
ATOM   7920 N N   . PRO B 1 523 ? -8.682  25.933  -36.534 1.00 75.79  ? 492  PRO B N   1 
ATOM   7921 C CA  . PRO B 1 523 ? -8.834  27.394  -36.490 1.00 78.25  ? 492  PRO B CA  1 
ATOM   7922 C C   . PRO B 1 523 ? -10.305 27.829  -36.252 1.00 80.66  ? 492  PRO B C   1 
ATOM   7923 O O   . PRO B 1 523 ? -10.517 29.029  -36.149 1.00 81.50  ? 492  PRO B O   1 
ATOM   7924 C CB  . PRO B 1 523 ? -8.325  27.854  -37.875 1.00 78.39  ? 492  PRO B CB  1 
ATOM   7925 C CG  . PRO B 1 523 ? -8.601  26.679  -38.803 1.00 77.06  ? 492  PRO B CG  1 
ATOM   7926 C CD  . PRO B 1 523 ? -8.464  25.457  -37.921 1.00 75.81  ? 492  PRO B CD  1 
ATOM   7927 N N   . ARG B 1 524 ? -11.254 26.877  -36.176 1.00 81.85  ? 493  ARG B N   1 
ATOM   7928 C CA  . ARG B 1 524 ? -12.678 27.144  -35.904 1.00 84.53  ? 493  ARG B CA  1 
ATOM   7929 C C   . ARG B 1 524 ? -13.024 27.002  -34.411 1.00 85.31  ? 493  ARG B C   1 
ATOM   7930 O O   . ARG B 1 524 ? -13.668 27.895  -33.824 1.00 86.16  ? 493  ARG B O   1 
ATOM   7931 C CB  . ARG B 1 524 ? -13.607 26.203  -36.785 1.00 85.00  ? 493  ARG B CB  1 
ATOM   7932 N N   . ASP B 1 525 ? -12.607 25.875  -33.822 1.00 84.82  ? 494  ASP B N   1 
ATOM   7933 C CA  . ASP B 1 525 ? -12.724 25.630  -32.374 1.00 85.43  ? 494  ASP B CA  1 
ATOM   7934 C C   . ASP B 1 525 ? -12.042 26.780  -31.578 1.00 85.26  ? 494  ASP B C   1 
ATOM   7935 O O   . ASP B 1 525 ? -10.807 26.878  -31.496 1.00 84.06  ? 494  ASP B O   1 
ATOM   7936 C CB  . ASP B 1 525 ? -12.139 24.238  -32.017 1.00 84.58  ? 494  ASP B CB  1 
ATOM   7937 C CG  . ASP B 1 525 ? -12.049 23.977  -30.495 1.00 86.47  ? 494  ASP B CG  1 
ATOM   7938 O OD1 . ASP B 1 525 ? -13.069 24.152  -29.782 1.00 89.45  ? 494  ASP B OD1 1 
ATOM   7939 O OD2 . ASP B 1 525 ? -10.997 23.571  -29.931 1.00 85.50  ? 494  ASP B OD2 1 
ATOM   7940 N N   . SER B 1 526 ? -12.889 27.648  -31.026 1.00 86.31  ? 495  SER B N   1 
ATOM   7941 C CA  . SER B 1 526 ? -12.489 28.763  -30.171 1.00 86.31  ? 495  SER B CA  1 
ATOM   7942 C C   . SER B 1 526 ? -12.491 28.383  -28.670 1.00 86.01  ? 495  SER B C   1 
ATOM   7943 O O   . SER B 1 526 ? -12.360 29.250  -27.798 1.00 86.51  ? 495  SER B O   1 
ATOM   7944 C CB  . SER B 1 526 ? -13.417 29.974  -30.435 1.00 87.78  ? 495  SER B CB  1 
ATOM   7945 N N   . LYS B 1 527 ? -12.670 27.097  -28.365 1.00 85.20  ? 496  LYS B N   1 
ATOM   7946 C CA  . LYS B 1 527 ? -12.503 26.600  -26.996 1.00 84.70  ? 496  LYS B CA  1 
ATOM   7947 C C   . LYS B 1 527 ? -11.079 26.073  -26.903 1.00 82.75  ? 496  LYS B C   1 
ATOM   7948 O O   . LYS B 1 527 ? -10.433 25.783  -27.938 1.00 82.41  ? 496  LYS B O   1 
ATOM   7949 C CB  . LYS B 1 527 ? -13.538 25.487  -26.656 1.00 85.04  ? 496  LYS B CB  1 
ATOM   7950 N N   . SER B 1 528 ? -10.582 25.964  -25.674 1.00 81.40  ? 497  SER B N   1 
ATOM   7951 C CA  . SER B 1 528 ? -9.268  25.350  -25.403 1.00 78.96  ? 497  SER B CA  1 
ATOM   7952 C C   . SER B 1 528 ? -9.215  23.794  -25.841 1.00 76.53  ? 497  SER B C   1 
ATOM   7953 O O   . SER B 1 528 ? -9.687  23.414  -26.945 1.00 75.94  ? 497  SER B O   1 
ATOM   7954 C CB  . SER B 1 528 ? -8.913  25.626  -23.907 1.00 79.39  ? 497  SER B CB  1 
ATOM   7955 O OG  . SER B 1 528 ? -9.254  24.525  -23.060 1.00 80.27  ? 497  SER B OG  1 
ATOM   7956 N N   . PRO B 1 529 ? -8.486  22.937  -25.114 1.00 73.13  ? 498  PRO B N   1 
ATOM   7957 C CA  . PRO B 1 529 ? -7.139  23.289  -24.659 1.00 69.56  ? 498  PRO B CA  1 
ATOM   7958 C C   . PRO B 1 529 ? -6.465  23.246  -26.013 1.00 65.09  ? 498  PRO B C   1 
ATOM   7959 O O   . PRO B 1 529 ? -6.760  22.360  -26.834 1.00 63.90  ? 498  PRO B O   1 
ATOM   7960 C CB  . PRO B 1 529 ? -6.748  22.143  -23.707 1.00 69.71  ? 498  PRO B CB  1 
ATOM   7961 C CG  . PRO B 1 529 ? -8.086  21.433  -23.411 1.00 72.01  ? 498  PRO B CG  1 
ATOM   7962 C CD  . PRO B 1 529 ? -8.877  21.565  -24.714 1.00 73.11  ? 498  PRO B CD  1 
ATOM   7963 N N   . GLN B 1 530 ? -5.681  24.265  -26.295 1.00 60.77  ? 499  GLN B N   1 
ATOM   7964 C CA  . GLN B 1 530 ? -4.961  24.299  -27.530 1.00 56.81  ? 499  GLN B CA  1 
ATOM   7965 C C   . GLN B 1 530 ? -3.722  23.427  -27.345 1.00 52.50  ? 499  GLN B C   1 
ATOM   7966 O O   . GLN B 1 530 ? -3.220  23.271  -26.255 1.00 50.19  ? 499  GLN B O   1 
ATOM   7967 C CB  . GLN B 1 530 ? -4.626  25.751  -27.919 1.00 57.69  ? 499  GLN B CB  1 
ATOM   7968 C CG  . GLN B 1 530 ? -5.857  26.622  -28.210 1.00 58.08  ? 499  GLN B CG  1 
ATOM   7969 C CD  . GLN B 1 530 ? -6.416  26.437  -29.623 1.00 58.48  ? 499  GLN B CD  1 
ATOM   7970 O OE1 . GLN B 1 530 ? -5.717  26.713  -30.610 1.00 59.09  ? 499  GLN B OE1 1 
ATOM   7971 N NE2 . GLN B 1 530 ? -7.679  26.014  -29.722 1.00 56.19  ? 499  GLN B NE2 1 
ATOM   7972 N N   . TRP B 1 531 ? -3.297  22.813  -28.439 1.00 49.16  ? 500  TRP B N   1 
ATOM   7973 C CA  . TRP B 1 531 ? -2.037  22.093  -28.522 1.00 46.78  ? 500  TRP B CA  1 
ATOM   7974 C C   . TRP B 1 531 ? -0.884  23.124  -28.701 1.00 45.26  ? 500  TRP B C   1 
ATOM   7975 O O   . TRP B 1 531 ? -0.767  23.761  -29.742 1.00 44.47  ? 500  TRP B O   1 
ATOM   7976 C CB  . TRP B 1 531 ? -2.135  21.149  -29.722 1.00 45.49  ? 500  TRP B CB  1 
ATOM   7977 C CG  . TRP B 1 531 ? -1.036  20.170  -29.886 1.00 44.11  ? 500  TRP B CG  1 
ATOM   7978 C CD1 . TRP B 1 531 ? 0.238   20.253  -29.394 1.00 43.74  ? 500  TRP B CD1 1 
ATOM   7979 C CD2 . TRP B 1 531 ? -1.088  18.958  -30.659 1.00 42.86  ? 500  TRP B CD2 1 
ATOM   7980 N NE1 . TRP B 1 531 ? 0.973   19.166  -29.812 1.00 43.17  ? 500  TRP B NE1 1 
ATOM   7981 C CE2 . TRP B 1 531 ? 0.186   18.359  -30.590 1.00 42.98  ? 500  TRP B CE2 1 
ATOM   7982 C CE3 . TRP B 1 531 ? -2.087  18.319  -31.411 1.00 41.81  ? 500  TRP B CE3 1 
ATOM   7983 C CZ2 . TRP B 1 531 ? 0.474   17.143  -31.209 1.00 42.95  ? 500  TRP B CZ2 1 
ATOM   7984 C CZ3 . TRP B 1 531 ? -1.799  17.116  -32.031 1.00 42.08  ? 500  TRP B CZ3 1 
ATOM   7985 C CH2 . TRP B 1 531 ? -0.529  16.537  -31.927 1.00 40.91  ? 500  TRP B CH2 1 
ATOM   7986 N N   . PRO B 1 532 ? -0.068  23.332  -27.688 1.00 43.98  ? 501  PRO B N   1 
ATOM   7987 C CA  . PRO B 1 532 ? 1.035   24.287  -27.832 1.00 44.08  ? 501  PRO B CA  1 
ATOM   7988 C C   . PRO B 1 532 ? 2.260   23.683  -28.523 1.00 43.44  ? 501  PRO B C   1 
ATOM   7989 O O   . PRO B 1 532 ? 2.538   22.487  -28.409 1.00 42.84  ? 501  PRO B O   1 
ATOM   7990 C CB  . PRO B 1 532 ? 1.371   24.686  -26.397 1.00 43.46  ? 501  PRO B CB  1 
ATOM   7991 C CG  . PRO B 1 532 ? 0.888   23.550  -25.550 1.00 44.86  ? 501  PRO B CG  1 
ATOM   7992 C CD  . PRO B 1 532 ? -0.106  22.726  -26.353 1.00 44.29  ? 501  PRO B CD  1 
ATOM   7993 N N   . PRO B 1 533 ? 3.039   24.534  -29.169 1.00 43.77  ? 502  PRO B N   1 
ATOM   7994 C CA  . PRO B 1 533 ? 4.308   24.085  -29.764 1.00 43.44  ? 502  PRO B CA  1 
ATOM   7995 C C   . PRO B 1 533 ? 5.257   23.561  -28.694 1.00 42.86  ? 502  PRO B C   1 
ATOM   7996 O O   . PRO B 1 533 ? 5.269   24.044  -27.574 1.00 41.98  ? 502  PRO B O   1 
ATOM   7997 C CB  . PRO B 1 533 ? 4.896   25.358  -30.383 1.00 43.69  ? 502  PRO B CB  1 
ATOM   7998 C CG  . PRO B 1 533 ? 3.828   26.373  -30.344 1.00 44.60  ? 502  PRO B CG  1 
ATOM   7999 C CD  . PRO B 1 533 ? 2.839   25.985  -29.290 1.00 44.03  ? 502  PRO B CD  1 
ATOM   8000 N N   . TYR B 1 534 ? 6.027   22.546  -29.046 1.00 42.92  ? 503  TYR B N   1 
ATOM   8001 C CA  . TYR B 1 534 ? 7.131   22.105  -28.219 1.00 43.06  ? 503  TYR B CA  1 
ATOM   8002 C C   . TYR B 1 534 ? 8.277   23.094  -28.319 1.00 44.00  ? 503  TYR B C   1 
ATOM   8003 O O   . TYR B 1 534 ? 8.630   23.510  -29.404 1.00 44.05  ? 503  TYR B O   1 
ATOM   8004 C CB  . TYR B 1 534 ? 7.586   20.741  -28.703 1.00 43.13  ? 503  TYR B CB  1 
ATOM   8005 C CG  . TYR B 1 534 ? 8.656   20.108  -27.859 1.00 43.26  ? 503  TYR B CG  1 
ATOM   8006 C CD1 . TYR B 1 534 ? 9.990   20.336  -28.125 1.00 42.70  ? 503  TYR B CD1 1 
ATOM   8007 C CD2 . TYR B 1 534 ? 8.318   19.285  -26.798 1.00 41.98  ? 503  TYR B CD2 1 
ATOM   8008 C CE1 . TYR B 1 534 ? 10.950  19.751  -27.364 1.00 44.97  ? 503  TYR B CE1 1 
ATOM   8009 C CE2 . TYR B 1 534 ? 9.269   18.716  -26.032 1.00 44.24  ? 503  TYR B CE2 1 
ATOM   8010 C CZ  . TYR B 1 534 ? 10.583  18.944  -26.311 1.00 43.98  ? 503  TYR B CZ  1 
ATOM   8011 O OH  . TYR B 1 534 ? 11.535  18.352  -25.530 1.00 47.60  ? 503  TYR B OH  1 
ATOM   8012 N N   . THR B 1 535 ? 8.844   23.458  -27.176 1.00 45.61  ? 504  THR B N   1 
ATOM   8013 C CA  . THR B 1 535 ? 10.017  24.337  -27.069 1.00 47.02  ? 504  THR B CA  1 
ATOM   8014 C C   . THR B 1 535 ? 11.004  23.733  -26.059 1.00 48.37  ? 504  THR B C   1 
ATOM   8015 O O   . THR B 1 535 ? 10.637  22.947  -25.219 1.00 47.52  ? 504  THR B O   1 
ATOM   8016 C CB  . THR B 1 535 ? 9.615   25.732  -26.536 1.00 47.66  ? 504  THR B CB  1 
ATOM   8017 O OG1 . THR B 1 535 ? 9.042   25.587  -25.226 1.00 46.64  ? 504  THR B OG1 1 
ATOM   8018 C CG2 . THR B 1 535 ? 8.527   26.402  -27.378 1.00 46.79  ? 504  THR B CG2 1 
ATOM   8019 N N   . THR B 1 536 ? 12.258  24.144  -26.113 1.00 51.09  ? 505  THR B N   1 
ATOM   8020 C CA  . THR B 1 536 ? 13.258  23.629  -25.164 1.00 52.84  ? 505  THR B CA  1 
ATOM   8021 C C   . THR B 1 536 ? 13.050  24.153  -23.752 1.00 54.19  ? 505  THR B C   1 
ATOM   8022 O O   . THR B 1 536 ? 13.318  23.438  -22.812 1.00 54.84  ? 505  THR B O   1 
ATOM   8023 C CB  . THR B 1 536 ? 14.699  23.928  -25.644 1.00 53.66  ? 505  THR B CB  1 
ATOM   8024 O OG1 . THR B 1 536 ? 14.824  25.315  -26.009 1.00 55.35  ? 505  THR B OG1 1 
ATOM   8025 C CG2 . THR B 1 536 ? 15.008  23.135  -26.937 1.00 51.94  ? 505  THR B CG2 1 
ATOM   8026 N N   . ALA B 1 537 ? 12.573  25.386  -23.606 1.00 55.52  ? 506  ALA B N   1 
ATOM   8027 C CA  . ALA B 1 537 ? 12.208  25.902  -22.284 1.00 56.63  ? 506  ALA B CA  1 
ATOM   8028 C C   . ALA B 1 537 ? 11.048  25.093  -21.684 1.00 56.35  ? 506  ALA B C   1 
ATOM   8029 O O   . ALA B 1 537 ? 11.264  24.287  -20.777 1.00 57.99  ? 506  ALA B O   1 
ATOM   8030 C CB  . ALA B 1 537 ? 11.829  27.380  -22.372 1.00 57.67  ? 506  ALA B CB  1 
ATOM   8031 N N   . ALA B 1 538 ? 9.835   25.283  -22.218 1.00 54.84  ? 507  ALA B N   1 
ATOM   8032 C CA  . ALA B 1 538 ? 8.628   24.682  -21.656 1.00 53.17  ? 507  ALA B CA  1 
ATOM   8033 C C   . ALA B 1 538 ? 8.467   23.188  -21.892 1.00 50.90  ? 507  ALA B C   1 
ATOM   8034 O O   . ALA B 1 538 ? 7.859   22.542  -21.102 1.00 51.11  ? 507  ALA B O   1 
ATOM   8035 C CB  . ALA B 1 538 ? 7.380   25.440  -22.161 1.00 53.70  ? 507  ALA B CB  1 
ATOM   8036 N N   . GLN B 1 539 ? 8.986   22.660  -22.989 1.00 49.62  ? 508  GLN B N   1 
ATOM   8037 C CA  . GLN B 1 539 ? 8.940   21.226  -23.329 1.00 48.47  ? 508  GLN B CA  1 
ATOM   8038 C C   . GLN B 1 539 ? 7.531   20.606  -23.332 1.00 47.61  ? 508  GLN B C   1 
ATOM   8039 O O   . GLN B 1 539 ? 7.345   19.448  -22.967 1.00 46.66  ? 508  GLN B O   1 
ATOM   8040 C CB  . GLN B 1 539 ? 9.857   20.416  -22.420 1.00 48.74  ? 508  GLN B CB  1 
ATOM   8041 C CG  . GLN B 1 539 ? 11.346  20.797  -22.500 1.00 50.36  ? 508  GLN B CG  1 
ATOM   8042 C CD  . GLN B 1 539 ? 12.221  19.988  -21.537 1.00 51.49  ? 508  GLN B CD  1 
ATOM   8043 O OE1 . GLN B 1 539 ? 12.245  18.746  -21.592 1.00 51.94  ? 508  GLN B OE1 1 
ATOM   8044 N NE2 . GLN B 1 539 ? 12.920  20.681  -20.652 1.00 49.45  ? 508  GLN B NE2 1 
ATOM   8045 N N   . GLN B 1 540 ? 6.553   21.381  -23.789 1.00 46.83  ? 509  GLN B N   1 
ATOM   8046 C CA  . GLN B 1 540 ? 5.180   20.934  -23.825 1.00 46.24  ? 509  GLN B CA  1 
ATOM   8047 C C   . GLN B 1 540 ? 4.837   19.986  -24.967 1.00 45.11  ? 509  GLN B C   1 
ATOM   8048 O O   . GLN B 1 540 ? 5.202   20.189  -26.126 1.00 43.71  ? 509  GLN B O   1 
ATOM   8049 C CB  . GLN B 1 540 ? 4.246   22.127  -23.918 1.00 46.35  ? 509  GLN B CB  1 
ATOM   8050 C CG  . GLN B 1 540 ? 4.293   22.995  -22.705 1.00 48.19  ? 509  GLN B CG  1 
ATOM   8051 C CD  . GLN B 1 540 ? 3.654   24.344  -22.939 1.00 48.00  ? 509  GLN B CD  1 
ATOM   8052 O OE1 . GLN B 1 540 ? 4.059   25.090  -23.836 1.00 50.67  ? 509  GLN B OE1 1 
ATOM   8053 N NE2 . GLN B 1 540 ? 2.684   24.664  -22.140 1.00 43.90  ? 509  GLN B NE2 1 
ATOM   8054 N N   . TYR B 1 541 ? 4.049   18.990  -24.608 1.00 45.10  ? 510  TYR B N   1 
ATOM   8055 C CA  . TYR B 1 541 ? 3.502   18.009  -25.536 1.00 45.26  ? 510  TYR B CA  1 
ATOM   8056 C C   . TYR B 1 541 ? 2.112   17.603  -25.066 1.00 45.82  ? 510  TYR B C   1 
ATOM   8057 O O   . TYR B 1 541 ? 1.711   17.986  -23.971 1.00 47.13  ? 510  TYR B O   1 
ATOM   8058 C CB  . TYR B 1 541 ? 4.435   16.801  -25.612 1.00 44.53  ? 510  TYR B CB  1 
ATOM   8059 C CG  . TYR B 1 541 ? 4.527   15.988  -24.353 1.00 44.17  ? 510  TYR B CG  1 
ATOM   8060 C CD1 . TYR B 1 541 ? 5.326   16.392  -23.299 1.00 43.14  ? 510  TYR B CD1 1 
ATOM   8061 C CD2 . TYR B 1 541 ? 3.844   14.780  -24.237 1.00 45.10  ? 510  TYR B CD2 1 
ATOM   8062 C CE1 . TYR B 1 541 ? 5.409   15.647  -22.159 1.00 44.13  ? 510  TYR B CE1 1 
ATOM   8063 C CE2 . TYR B 1 541 ? 3.924   14.022  -23.083 1.00 43.98  ? 510  TYR B CE2 1 
ATOM   8064 C CZ  . TYR B 1 541 ? 4.720   14.454  -22.059 1.00 44.16  ? 510  TYR B CZ  1 
ATOM   8065 O OH  . TYR B 1 541 ? 4.816   13.689  -20.924 1.00 45.25  ? 510  TYR B OH  1 
ATOM   8066 N N   . VAL B 1 542 ? 1.363   16.859  -25.870 1.00 45.63  ? 511  VAL B N   1 
ATOM   8067 C CA  . VAL B 1 542 ? -0.008  16.542  -25.505 1.00 46.31  ? 511  VAL B CA  1 
ATOM   8068 C C   . VAL B 1 542 ? -0.281  15.044  -25.532 1.00 46.34  ? 511  VAL B C   1 
ATOM   8069 O O   . VAL B 1 542 ? 0.377   14.292  -26.241 1.00 44.92  ? 511  VAL B O   1 
ATOM   8070 C CB  . VAL B 1 542 ? -1.027  17.254  -26.408 1.00 46.88  ? 511  VAL B CB  1 
ATOM   8071 C CG1 . VAL B 1 542 ? -0.856  18.746  -26.365 1.00 46.44  ? 511  VAL B CG1 1 
ATOM   8072 C CG2 . VAL B 1 542 ? -0.940  16.757  -27.839 1.00 47.94  ? 511  VAL B CG2 1 
ATOM   8073 N N   . SER B 1 543 ? -1.265  14.620  -24.744 1.00 47.08  ? 512  SER B N   1 
ATOM   8074 C CA  . SER B 1 543 ? -1.698  13.227  -24.743 1.00 47.54  ? 512  SER B CA  1 
ATOM   8075 C C   . SER B 1 543 ? -2.833  13.059  -25.745 1.00 47.58  ? 512  SER B C   1 
ATOM   8076 O O   . SER B 1 543 ? -3.785  13.809  -25.733 1.00 48.20  ? 512  SER B O   1 
ATOM   8077 C CB  . SER B 1 543 ? -2.131  12.776  -23.356 1.00 48.08  ? 512  SER B CB  1 
ATOM   8078 O OG  . SER B 1 543 ? -3.021  13.704  -22.790 1.00 50.25  ? 512  SER B OG  1 
ATOM   8079 N N   . LEU B 1 544 ? -2.688  12.099  -26.651 1.00 47.51  ? 513  LEU B N   1 
ATOM   8080 C CA  . LEU B 1 544 ? -3.744  11.755  -27.576 1.00 47.78  ? 513  LEU B CA  1 
ATOM   8081 C C   . LEU B 1 544 ? -4.359  10.499  -27.008 1.00 48.60  ? 513  LEU B C   1 
ATOM   8082 O O   . LEU B 1 544 ? -3.719  9.435   -26.985 1.00 47.84  ? 513  LEU B O   1 
ATOM   8083 C CB  . LEU B 1 544 ? -3.200  11.551  -29.000 1.00 46.84  ? 513  LEU B CB  1 
ATOM   8084 C CG  . LEU B 1 544 ? -2.535  12.785  -29.619 1.00 45.90  ? 513  LEU B CG  1 
ATOM   8085 C CD1 . LEU B 1 544 ? -1.922  12.510  -30.994 1.00 45.33  ? 513  LEU B CD1 1 
ATOM   8086 C CD2 . LEU B 1 544 ? -3.519  13.953  -29.686 1.00 44.46  ? 513  LEU B CD2 1 
ATOM   8087 N N   . ASN B 1 545 ? -5.567  10.649  -26.478 1.00 49.75  ? 514  ASN B N   1 
ATOM   8088 C CA  . ASN B 1 545 ? -6.374  9.511   -26.032 1.00 51.12  ? 514  ASN B CA  1 
ATOM   8089 C C   . ASN B 1 545 ? -7.855  9.887   -26.133 1.00 52.66  ? 514  ASN B C   1 
ATOM   8090 O O   . ASN B 1 545 ? -8.170  10.915  -26.743 1.00 52.10  ? 514  ASN B O   1 
ATOM   8091 C CB  . ASN B 1 545 ? -5.940  9.047   -24.631 1.00 50.79  ? 514  ASN B CB  1 
ATOM   8092 C CG  . ASN B 1 545 ? -6.021  10.141  -23.602 1.00 52.43  ? 514  ASN B CG  1 
ATOM   8093 O OD1 . ASN B 1 545 ? -6.940  10.962  -23.622 1.00 57.19  ? 514  ASN B OD1 1 
ATOM   8094 N ND2 . ASN B 1 545 ? -5.059  10.176  -22.696 1.00 53.97  ? 514  ASN B ND2 1 
ATOM   8095 N N   . LEU B 1 546 ? -8.757  9.077   -25.564 1.00 54.78  ? 515  LEU B N   1 
ATOM   8096 C CA  . LEU B 1 546 ? -10.203 9.334   -25.684 1.00 56.93  ? 515  LEU B CA  1 
ATOM   8097 C C   . LEU B 1 546 ? -10.631 10.595  -24.944 1.00 57.64  ? 515  LEU B C   1 
ATOM   8098 O O   . LEU B 1 546 ? -11.605 11.204  -25.311 1.00 58.40  ? 515  LEU B O   1 
ATOM   8099 C CB  . LEU B 1 546 ? -11.021 8.142   -25.187 1.00 58.17  ? 515  LEU B CB  1 
ATOM   8100 C CG  . LEU B 1 546 ? -10.804 6.848   -25.971 1.00 60.40  ? 515  LEU B CG  1 
ATOM   8101 C CD1 . LEU B 1 546 ? -11.474 5.658   -25.271 1.00 62.78  ? 515  LEU B CD1 1 
ATOM   8102 C CD2 . LEU B 1 546 ? -11.318 6.991   -27.407 1.00 61.04  ? 515  LEU B CD2 1 
ATOM   8103 N N   . LYS B 1 547 ? -9.892  10.988  -23.914 1.00 58.28  ? 516  LYS B N   1 
ATOM   8104 C CA  . LYS B 1 547 ? -10.166 12.242  -23.182 1.00 59.60  ? 516  LYS B CA  1 
ATOM   8105 C C   . LYS B 1 547 ? -9.716  13.447  -24.006 1.00 58.18  ? 516  LYS B C   1 
ATOM   8106 O O   . LYS B 1 547 ? -8.884  13.299  -24.906 1.00 57.37  ? 516  LYS B O   1 
ATOM   8107 C CB  . LYS B 1 547 ? -9.481  12.210  -21.799 1.00 59.84  ? 516  LYS B CB  1 
ATOM   8108 C CG  . LYS B 1 547 ? -9.866  10.936  -20.976 1.00 64.59  ? 516  LYS B CG  1 
ATOM   8109 C CD  . LYS B 1 547 ? -9.447  10.988  -19.476 1.00 70.42  ? 516  LYS B CD  1 
ATOM   8110 C CE  . LYS B 1 547 ? -7.894  10.866  -19.267 1.00 71.94  ? 516  LYS B CE  1 
ATOM   8111 N NZ  . LYS B 1 547 ? -7.442  11.027  -17.812 1.00 73.54  ? 516  LYS B NZ  1 
ATOM   8112 N N   . PRO B 1 548 ? -10.252 14.628  -23.723 1.00 58.41  ? 517  PRO B N   1 
ATOM   8113 C CA  . PRO B 1 548 ? -9.778  15.856  -24.386 1.00 57.86  ? 517  PRO B CA  1 
ATOM   8114 C C   . PRO B 1 548 ? -8.267  16.047  -24.205 1.00 56.13  ? 517  PRO B C   1 
ATOM   8115 O O   . PRO B 1 548 ? -7.714  15.536  -23.232 1.00 55.17  ? 517  PRO B O   1 
ATOM   8116 C CB  . PRO B 1 548 ? -10.535 16.990  -23.648 1.00 59.26  ? 517  PRO B CB  1 
ATOM   8117 C CG  . PRO B 1 548 ? -11.696 16.346  -22.954 1.00 60.09  ? 517  PRO B CG  1 
ATOM   8118 C CD  . PRO B 1 548 ? -11.314 14.900  -22.740 1.00 60.00  ? 517  PRO B CD  1 
ATOM   8119 N N   . LEU B 1 549 ? -7.629  16.767  -25.124 1.00 55.57  ? 518  LEU B N   1 
ATOM   8120 C CA  . LEU B 1 549 ? -6.189  17.065  -25.029 1.00 54.93  ? 518  LEU B CA  1 
ATOM   8121 C C   . LEU B 1 549 ? -5.769  17.505  -23.623 1.00 55.01  ? 518  LEU B C   1 
ATOM   8122 O O   . LEU B 1 549 ? -6.378  18.369  -23.025 1.00 55.98  ? 518  LEU B O   1 
ATOM   8123 C CB  . LEU B 1 549 ? -5.782  18.204  -25.976 1.00 54.31  ? 518  LEU B CB  1 
ATOM   8124 C CG  . LEU B 1 549 ? -5.535  18.028  -27.462 1.00 54.10  ? 518  LEU B CG  1 
ATOM   8125 C CD1 . LEU B 1 549 ? -4.833  19.292  -27.986 1.00 53.57  ? 518  LEU B CD1 1 
ATOM   8126 C CD2 . LEU B 1 549 ? -4.731  16.791  -27.799 1.00 53.11  ? 518  LEU B CD2 1 
ATOM   8127 N N   . GLU B 1 550 ? -4.697  16.920  -23.132 1.00 54.81  ? 519  GLU B N   1 
ATOM   8128 C CA  . GLU B 1 550 ? -4.064  17.372  -21.909 1.00 55.59  ? 519  GLU B CA  1 
ATOM   8129 C C   . GLU B 1 550 ? -2.616  17.769  -22.266 1.00 53.44  ? 519  GLU B C   1 
ATOM   8130 O O   . GLU B 1 550 ? -1.952  17.099  -23.040 1.00 52.59  ? 519  GLU B O   1 
ATOM   8131 C CB  . GLU B 1 550 ? -4.166  16.250  -20.849 1.00 56.31  ? 519  GLU B CB  1 
ATOM   8132 C CG  . GLU B 1 550 ? -3.185  16.277  -19.670 1.00 59.61  ? 519  GLU B CG  1 
ATOM   8133 C CD  . GLU B 1 550 ? -3.306  15.015  -18.794 1.00 64.90  ? 519  GLU B CD  1 
ATOM   8134 O OE1 . GLU B 1 550 ? -4.468  14.691  -18.419 1.00 69.59  ? 519  GLU B OE1 1 
ATOM   8135 O OE2 . GLU B 1 550 ? -2.270  14.338  -18.494 1.00 61.72  ? 519  GLU B OE2 1 
ATOM   8136 N N   . VAL B 1 551 ? -2.158  18.882  -21.715 1.00 52.55  ? 520  VAL B N   1 
ATOM   8137 C CA  . VAL B 1 551 ? -0.807  19.375  -21.940 1.00 51.17  ? 520  VAL B CA  1 
ATOM   8138 C C   . VAL B 1 551 ? 0.092   18.903  -20.802 1.00 50.66  ? 520  VAL B C   1 
ATOM   8139 O O   . VAL B 1 551 ? -0.247  19.070  -19.654 1.00 51.98  ? 520  VAL B O   1 
ATOM   8140 C CB  . VAL B 1 551 ? -0.804  20.913  -22.059 1.00 51.09  ? 520  VAL B CB  1 
ATOM   8141 C CG1 . VAL B 1 551 ? 0.611   21.450  -22.271 1.00 49.45  ? 520  VAL B CG1 1 
ATOM   8142 C CG2 . VAL B 1 551 ? -1.724  21.352  -23.200 1.00 50.41  ? 520  VAL B CG2 1 
ATOM   8143 N N   . ARG B 1 552 ? 1.196   18.253  -21.129 1.00 49.58  ? 521  ARG B N   1 
ATOM   8144 C CA  . ARG B 1 552 ? 2.200   17.832  -20.159 1.00 49.43  ? 521  ARG B CA  1 
ATOM   8145 C C   . ARG B 1 552 ? 3.524   18.490  -20.515 1.00 49.19  ? 521  ARG B C   1 
ATOM   8146 O O   . ARG B 1 552 ? 3.693   19.045  -21.603 1.00 48.43  ? 521  ARG B O   1 
ATOM   8147 C CB  . ARG B 1 552 ? 2.374   16.321  -20.184 1.00 49.22  ? 521  ARG B CB  1 
ATOM   8148 C CG  . ARG B 1 552 ? 1.093   15.577  -19.847 1.00 49.85  ? 521  ARG B CG  1 
ATOM   8149 C CD  . ARG B 1 552 ? 1.204   14.059  -19.930 1.00 50.69  ? 521  ARG B CD  1 
ATOM   8150 N NE  . ARG B 1 552 ? -0.126  13.446  -19.851 1.00 52.63  ? 521  ARG B NE  1 
ATOM   8151 C CZ  . ARG B 1 552 ? -0.410  12.188  -20.193 1.00 51.69  ? 521  ARG B CZ  1 
ATOM   8152 N NH1 . ARG B 1 552 ? 0.515   11.373  -20.662 1.00 49.73  ? 521  ARG B NH1 1 
ATOM   8153 N NH2 . ARG B 1 552 ? -1.649  11.755  -20.094 1.00 53.36  ? 521  ARG B NH2 1 
ATOM   8154 N N   . ARG B 1 553 ? 4.475   18.424  -19.605 1.00 49.47  ? 522  ARG B N   1 
ATOM   8155 C CA  . ARG B 1 553 ? 5.769   19.048  -19.832 1.00 50.04  ? 522  ARG B CA  1 
ATOM   8156 C C   . ARG B 1 553 ? 6.851   18.029  -19.596 1.00 49.99  ? 522  ARG B C   1 
ATOM   8157 O O   . ARG B 1 553 ? 6.776   17.260  -18.657 1.00 50.32  ? 522  ARG B O   1 
ATOM   8158 C CB  . ARG B 1 553 ? 5.955   20.269  -18.930 1.00 50.36  ? 522  ARG B CB  1 
ATOM   8159 C CG  . ARG B 1 553 ? 5.015   21.401  -19.254 1.00 52.16  ? 522  ARG B CG  1 
ATOM   8160 C CD  . ARG B 1 553 ? 5.095   22.613  -18.318 1.00 54.50  ? 522  ARG B CD  1 
ATOM   8161 N NE  . ARG B 1 553 ? 6.404   23.272  -18.368 1.00 56.88  ? 522  ARG B NE  1 
ATOM   8162 C CZ  . ARG B 1 553 ? 6.671   24.481  -17.865 1.00 59.38  ? 522  ARG B CZ  1 
ATOM   8163 N NH1 . ARG B 1 553 ? 5.712   25.200  -17.269 1.00 59.71  ? 522  ARG B NH1 1 
ATOM   8164 N NH2 . ARG B 1 553 ? 7.908   24.977  -17.962 1.00 57.76  ? 522  ARG B NH2 1 
ATOM   8165 N N   . GLY B 1 554 ? 7.853   18.018  -20.456 1.00 49.89  ? 523  GLY B N   1 
ATOM   8166 C CA  . GLY B 1 554 ? 8.997   17.147  -20.270 1.00 50.58  ? 523  GLY B CA  1 
ATOM   8167 C C   . GLY B 1 554 ? 8.700   15.748  -20.747 1.00 50.99  ? 523  GLY B C   1 
ATOM   8168 O O   . GLY B 1 554 ? 7.993   14.998  -20.103 1.00 51.40  ? 523  GLY B O   1 
ATOM   8169 N N   . LEU B 1 555 ? 9.244   15.417  -21.900 1.00 51.59  ? 524  LEU B N   1 
ATOM   8170 C CA  . LEU B 1 555 ? 9.045   14.124  -22.517 1.00 52.53  ? 524  LEU B CA  1 
ATOM   8171 C C   . LEU B 1 555 ? 10.077  13.150  -21.962 1.00 52.33  ? 524  LEU B C   1 
ATOM   8172 O O   . LEU B 1 555 ? 11.198  13.089  -22.468 1.00 52.54  ? 524  LEU B O   1 
ATOM   8173 C CB  . LEU B 1 555 ? 9.241   14.294  -24.026 1.00 52.84  ? 524  LEU B CB  1 
ATOM   8174 C CG  . LEU B 1 555 ? 8.897   13.142  -24.940 1.00 55.71  ? 524  LEU B CG  1 
ATOM   8175 C CD1 . LEU B 1 555 ? 7.473   12.645  -24.685 1.00 58.33  ? 524  LEU B CD1 1 
ATOM   8176 C CD2 . LEU B 1 555 ? 9.057   13.639  -26.372 1.00 58.14  ? 524  LEU B CD2 1 
ATOM   8177 N N   . ARG B 1 556 ? 9.707   12.411  -20.919 1.00 52.32  ? 525  ARG B N   1 
ATOM   8178 C CA  . ARG B 1 556 ? 10.628  11.501  -20.245 1.00 52.95  ? 525  ARG B CA  1 
ATOM   8179 C C   . ARG B 1 556 ? 11.964  12.170  -19.971 1.00 52.07  ? 525  ARG B C   1 
ATOM   8180 O O   . ARG B 1 556 ? 13.004  11.615  -20.287 1.00 51.51  ? 525  ARG B O   1 
ATOM   8181 C CB  . ARG B 1 556 ? 10.897  10.270  -21.108 1.00 53.19  ? 525  ARG B CB  1 
ATOM   8182 C CG  . ARG B 1 556 ? 9.779   9.346   -21.158 1.00 55.46  ? 525  ARG B CG  1 
ATOM   8183 C CD  . ARG B 1 556 ? 9.920   8.184   -20.256 1.00 60.34  ? 525  ARG B CD  1 
ATOM   8184 N NE  . ARG B 1 556 ? 9.612   6.953   -20.962 1.00 65.24  ? 525  ARG B NE  1 
ATOM   8185 C CZ  . ARG B 1 556 ? 8.420   6.640   -21.483 1.00 66.98  ? 525  ARG B CZ  1 
ATOM   8186 N NH1 . ARG B 1 556 ? 7.380   7.468   -21.387 1.00 68.50  ? 525  ARG B NH1 1 
ATOM   8187 N NH2 . ARG B 1 556 ? 8.272   5.470   -22.095 1.00 67.13  ? 525  ARG B NH2 1 
ATOM   8188 N N   . ALA B 1 557 ? 11.914  13.360  -19.389 1.00 51.78  ? 526  ALA B N   1 
ATOM   8189 C CA  . ALA B 1 557 ? 13.062  14.260  -19.339 1.00 51.34  ? 526  ALA B CA  1 
ATOM   8190 C C   . ALA B 1 557 ? 14.239  13.721  -18.564 1.00 51.16  ? 526  ALA B C   1 
ATOM   8191 O O   . ALA B 1 557 ? 15.351  13.795  -19.055 1.00 51.27  ? 526  ALA B O   1 
ATOM   8192 C CB  . ALA B 1 557 ? 12.647  15.604  -18.785 1.00 51.72  ? 526  ALA B CB  1 
ATOM   8193 N N   . GLN B 1 558 ? 14.017  13.186  -17.367 1.00 51.47  ? 527  GLN B N   1 
ATOM   8194 C CA  . GLN B 1 558 ? 15.146  12.660  -16.555 1.00 52.40  ? 527  GLN B CA  1 
ATOM   8195 C C   . GLN B 1 558 ? 15.817  11.485  -17.255 1.00 51.55  ? 527  GLN B C   1 
ATOM   8196 O O   . GLN B 1 558 ? 17.042  11.399  -17.344 1.00 51.31  ? 527  GLN B O   1 
ATOM   8197 C CB  . GLN B 1 558 ? 14.705  12.181  -15.152 1.00 53.54  ? 527  GLN B CB  1 
ATOM   8198 C CG  . GLN B 1 558 ? 14.391  13.243  -14.104 1.00 57.10  ? 527  GLN B CG  1 
ATOM   8199 C CD  . GLN B 1 558 ? 15.409  14.386  -14.062 1.00 62.29  ? 527  GLN B CD  1 
ATOM   8200 O OE1 . GLN B 1 558 ? 15.170  15.461  -14.651 1.00 64.07  ? 527  GLN B OE1 1 
ATOM   8201 N NE2 . GLN B 1 558 ? 16.537  14.169  -13.361 1.00 64.64  ? 527  GLN B NE2 1 
ATOM   8202 N N   . THR B 1 559 ? 14.982  10.569  -17.726 1.00 50.87  ? 528  THR B N   1 
ATOM   8203 C CA  . THR B 1 559 ? 15.430  9.334   -18.344 1.00 51.26  ? 528  THR B CA  1 
ATOM   8204 C C   . THR B 1 559 ? 16.106  9.610   -19.679 1.00 51.04  ? 528  THR B C   1 
ATOM   8205 O O   . THR B 1 559 ? 17.049  8.929   -20.030 1.00 51.70  ? 528  THR B O   1 
ATOM   8206 C CB  . THR B 1 559 ? 14.208  8.361   -18.478 1.00 51.38  ? 528  THR B CB  1 
ATOM   8207 O OG1 . THR B 1 559 ? 13.987  7.697   -17.224 1.00 52.97  ? 528  THR B OG1 1 
ATOM   8208 C CG2 . THR B 1 559 ? 14.462  7.207   -19.460 1.00 51.64  ? 528  THR B CG2 1 
ATOM   8209 N N   . CYS B 1 560 ? 15.646  10.616  -20.421 1.00 50.70  ? 529  CYS B N   1 
ATOM   8210 C CA  . CYS B 1 560 ? 16.279  10.951  -21.704 1.00 50.87  ? 529  CYS B CA  1 
ATOM   8211 C C   . CYS B 1 560 ? 17.567  11.694  -21.487 1.00 50.62  ? 529  CYS B C   1 
ATOM   8212 O O   . CYS B 1 560 ? 18.431  11.649  -22.326 1.00 50.86  ? 529  CYS B O   1 
ATOM   8213 C CB  . CYS B 1 560 ? 15.334  11.720  -22.649 1.00 50.18  ? 529  CYS B CB  1 
ATOM   8214 S SG  . CYS B 1 560 ? 14.114  10.560  -23.329 1.00 53.78  ? 529  CYS B SG  1 
ATOM   8215 N N   . ALA B 1 561 ? 17.721  12.356  -20.350 1.00 50.53  ? 530  ALA B N   1 
ATOM   8216 C CA  . ALA B 1 561 ? 19.027  12.902  -20.007 1.00 51.11  ? 530  ALA B CA  1 
ATOM   8217 C C   . ALA B 1 561 ? 20.001  11.754  -19.827 1.00 51.44  ? 530  ALA B C   1 
ATOM   8218 O O   . ALA B 1 561 ? 21.129  11.861  -20.226 1.00 52.19  ? 530  ALA B O   1 
ATOM   8219 C CB  . ALA B 1 561 ? 18.959  13.772  -18.736 1.00 51.74  ? 530  ALA B CB  1 
ATOM   8220 N N   . PHE B 1 562 ? 19.541  10.644  -19.250 1.00 51.48  ? 531  PHE B N   1 
ATOM   8221 C CA  . PHE B 1 562 ? 20.361  9.450   -19.104 1.00 51.94  ? 531  PHE B CA  1 
ATOM   8222 C C   . PHE B 1 562 ? 20.878  8.953   -20.446 1.00 51.82  ? 531  PHE B C   1 
ATOM   8223 O O   . PHE B 1 562 ? 22.087  8.782   -20.610 1.00 52.59  ? 531  PHE B O   1 
ATOM   8224 C CB  . PHE B 1 562 ? 19.576  8.330   -18.389 1.00 51.67  ? 531  PHE B CB  1 
ATOM   8225 C CG  . PHE B 1 562 ? 20.305  7.033   -18.334 1.00 52.34  ? 531  PHE B CG  1 
ATOM   8226 C CD1 . PHE B 1 562 ? 21.436  6.896   -17.551 1.00 54.87  ? 531  PHE B CD1 1 
ATOM   8227 C CD2 . PHE B 1 562 ? 19.873  5.958   -19.056 1.00 52.10  ? 531  PHE B CD2 1 
ATOM   8228 C CE1 . PHE B 1 562 ? 22.106  5.702   -17.486 1.00 56.85  ? 531  PHE B CE1 1 
ATOM   8229 C CE2 . PHE B 1 562 ? 20.549  4.750   -19.006 1.00 55.19  ? 531  PHE B CE2 1 
ATOM   8230 C CZ  . PHE B 1 562 ? 21.668  4.623   -18.224 1.00 56.78  ? 531  PHE B CZ  1 
ATOM   8231 N N   . TRP B 1 563 ? 19.968  8.721   -21.389 1.00 51.28  ? 532  TRP B N   1 
ATOM   8232 C CA  . TRP B 1 563 ? 20.336  8.158   -22.692 1.00 51.53  ? 532  TRP B CA  1 
ATOM   8233 C C   . TRP B 1 563 ? 21.075  9.153   -23.588 1.00 52.34  ? 532  TRP B C   1 
ATOM   8234 O O   . TRP B 1 563 ? 21.990  8.764   -24.289 1.00 53.64  ? 532  TRP B O   1 
ATOM   8235 C CB  . TRP B 1 563 ? 19.107  7.688   -23.444 1.00 50.33  ? 532  TRP B CB  1 
ATOM   8236 C CG  . TRP B 1 563 ? 18.496  6.467   -22.889 1.00 49.44  ? 532  TRP B CG  1 
ATOM   8237 C CD1 . TRP B 1 563 ? 17.353  6.385   -22.169 1.00 47.96  ? 532  TRP B CD1 1 
ATOM   8238 C CD2 . TRP B 1 563 ? 18.975  5.126   -23.044 1.00 47.66  ? 532  TRP B CD2 1 
ATOM   8239 N NE1 . TRP B 1 563 ? 17.090  5.071   -21.864 1.00 49.56  ? 532  TRP B NE1 1 
ATOM   8240 C CE2 . TRP B 1 563 ? 18.079  4.283   -22.382 1.00 46.24  ? 532  TRP B CE2 1 
ATOM   8241 C CE3 . TRP B 1 563 ? 20.089  4.557   -23.678 1.00 50.01  ? 532  TRP B CE3 1 
ATOM   8242 C CZ2 . TRP B 1 563 ? 18.235  2.913   -22.334 1.00 48.61  ? 532  TRP B CZ2 1 
ATOM   8243 C CZ3 . TRP B 1 563 ? 20.257  3.177   -23.625 1.00 50.92  ? 532  TRP B CZ3 1 
ATOM   8244 C CH2 . TRP B 1 563 ? 19.329  2.373   -22.955 1.00 50.80  ? 532  TRP B CH2 1 
ATOM   8245 N N   . ASN B 1 564 ? 20.696  10.420  -23.536 1.00 52.63  ? 533  ASN B N   1 
ATOM   8246 C CA  . ASN B 1 564 ? 21.162  11.418  -24.495 1.00 53.40  ? 533  ASN B CA  1 
ATOM   8247 C C   . ASN B 1 564 ? 22.389  12.207  -24.075 1.00 55.01  ? 533  ASN B C   1 
ATOM   8248 O O   . ASN B 1 564 ? 23.099  12.733  -24.924 1.00 54.93  ? 533  ASN B O   1 
ATOM   8249 C CB  . ASN B 1 564 ? 20.027  12.396  -24.836 1.00 52.17  ? 533  ASN B CB  1 
ATOM   8250 C CG  . ASN B 1 564 ? 18.959  11.738  -25.629 1.00 50.90  ? 533  ASN B CG  1 
ATOM   8251 O OD1 . ASN B 1 564 ? 19.226  10.724  -26.246 1.00 54.22  ? 533  ASN B OD1 1 
ATOM   8252 N ND2 . ASN B 1 564 ? 17.741  12.283  -25.618 1.00 47.34  ? 533  ASN B ND2 1 
ATOM   8253 N N   . ARG B 1 565 ? 22.628  12.292  -22.770 1.00 57.03  ? 534  ARG B N   1 
ATOM   8254 C CA  . ARG B 1 565 ? 23.739  13.081  -22.235 1.00 58.87  ? 534  ARG B CA  1 
ATOM   8255 C C   . ARG B 1 565 ? 24.724  12.223  -21.475 1.00 60.35  ? 534  ARG B C   1 
ATOM   8256 O O   . ARG B 1 565 ? 25.934  12.420  -21.601 1.00 61.81  ? 534  ARG B O   1 
ATOM   8257 C CB  . ARG B 1 565 ? 23.240  14.187  -21.310 1.00 59.25  ? 534  ARG B CB  1 
ATOM   8258 C CG  . ARG B 1 565 ? 22.578  15.352  -22.013 1.00 60.60  ? 534  ARG B CG  1 
ATOM   8259 C CD  . ARG B 1 565 ? 21.935  16.322  -21.072 1.00 62.94  ? 534  ARG B CD  1 
ATOM   8260 N NE  . ARG B 1 565 ? 20.644  16.792  -21.559 1.00 65.86  ? 534  ARG B NE  1 
ATOM   8261 C CZ  . ARG B 1 565 ? 20.384  18.031  -22.011 1.00 67.75  ? 534  ARG B CZ  1 
ATOM   8262 N NH1 . ARG B 1 565 ? 21.333  18.963  -22.053 1.00 66.17  ? 534  ARG B NH1 1 
ATOM   8263 N NH2 . ARG B 1 565 ? 19.142  18.337  -22.421 1.00 67.49  ? 534  ARG B NH2 1 
ATOM   8264 N N   . PHE B 1 566 ? 24.240  11.276  -20.675 1.00 61.07  ? 535  PHE B N   1 
ATOM   8265 C CA  . PHE B 1 566 ? 25.173  10.490  -19.862 1.00 62.49  ? 535  PHE B CA  1 
ATOM   8266 C C   . PHE B 1 566 ? 25.790  9.328   -20.618 1.00 64.29  ? 535  PHE B C   1 
ATOM   8267 O O   . PHE B 1 566 ? 27.003  9.228   -20.687 1.00 65.09  ? 535  PHE B O   1 
ATOM   8268 C CB  . PHE B 1 566 ? 24.555  9.981   -18.558 1.00 61.91  ? 535  PHE B CB  1 
ATOM   8269 C CG  . PHE B 1 566 ? 25.507  9.172   -17.747 1.00 59.65  ? 535  PHE B CG  1 
ATOM   8270 C CD1 . PHE B 1 566 ? 26.655  9.753   -17.240 1.00 58.64  ? 535  PHE B CD1 1 
ATOM   8271 C CD2 . PHE B 1 566 ? 25.307  7.822   -17.551 1.00 57.27  ? 535  PHE B CD2 1 
ATOM   8272 C CE1 . PHE B 1 566 ? 27.555  9.032   -16.512 1.00 57.41  ? 535  PHE B CE1 1 
ATOM   8273 C CE2 . PHE B 1 566 ? 26.220  7.098   -16.840 1.00 58.72  ? 535  PHE B CE2 1 
ATOM   8274 C CZ  . PHE B 1 566 ? 27.350  7.720   -16.309 1.00 58.36  ? 535  PHE B CZ  1 
ATOM   8275 N N   . LEU B 1 567 ? 24.977  8.449   -21.184 1.00 65.68  ? 536  LEU B N   1 
ATOM   8276 C CA  . LEU B 1 567 ? 25.523  7.252   -21.829 1.00 68.22  ? 536  LEU B CA  1 
ATOM   8277 C C   . LEU B 1 567 ? 26.572  7.508   -22.925 1.00 70.76  ? 536  LEU B C   1 
ATOM   8278 O O   . LEU B 1 567 ? 27.567  6.808   -22.950 1.00 72.14  ? 536  LEU B O   1 
ATOM   8279 C CB  . LEU B 1 567 ? 24.418  6.349   -22.372 1.00 67.33  ? 536  LEU B CB  1 
ATOM   8280 C CG  . LEU B 1 567 ? 23.916  5.199   -21.501 1.00 67.59  ? 536  LEU B CG  1 
ATOM   8281 C CD1 . LEU B 1 567 ? 23.508  4.042   -22.415 1.00 67.75  ? 536  LEU B CD1 1 
ATOM   8282 C CD2 . LEU B 1 567 ? 24.921  4.712   -20.452 1.00 68.01  ? 536  LEU B CD2 1 
ATOM   8283 N N   . PRO B 1 568 ? 26.371  8.471   -23.824 1.00 73.05  ? 537  PRO B N   1 
ATOM   8284 C CA  . PRO B 1 568 ? 27.427  8.846   -24.782 1.00 75.55  ? 537  PRO B CA  1 
ATOM   8285 C C   . PRO B 1 568 ? 28.791  9.081   -24.114 1.00 78.98  ? 537  PRO B C   1 
ATOM   8286 O O   . PRO B 1 568 ? 29.804  8.551   -24.594 1.00 80.52  ? 537  PRO B O   1 
ATOM   8287 C CB  . PRO B 1 568 ? 26.887  10.140  -25.403 1.00 74.50  ? 537  PRO B CB  1 
ATOM   8288 C CG  . PRO B 1 568 ? 25.391  9.961   -25.340 1.00 72.37  ? 537  PRO B CG  1 
ATOM   8289 C CD  . PRO B 1 568 ? 25.141  9.259   -24.037 1.00 71.81  ? 537  PRO B CD  1 
ATOM   8290 N N   . LYS B 1 569 ? 28.806  9.840   -23.012 1.00 81.64  ? 538  LYS B N   1 
ATOM   8291 C CA  . LYS B 1 569 ? 30.028  10.063  -22.200 1.00 84.45  ? 538  LYS B CA  1 
ATOM   8292 C C   . LYS B 1 569 ? 30.637  8.782   -21.642 1.00 86.62  ? 538  LYS B C   1 
ATOM   8293 O O   . LYS B 1 569 ? 31.787  8.780   -21.248 1.00 88.40  ? 538  LYS B O   1 
ATOM   8294 C CB  . LYS B 1 569 ? 29.780  11.046  -21.036 1.00 84.45  ? 538  LYS B CB  1 
ATOM   8295 C CG  . LYS B 1 569 ? 29.691  12.525  -21.437 1.00 85.57  ? 538  LYS B CG  1 
ATOM   8296 C CD  . LYS B 1 569 ? 30.281  13.469  -20.366 1.00 88.57  ? 538  LYS B CD  1 
ATOM   8297 C CE  . LYS B 1 569 ? 31.847  13.620  -20.488 1.00 91.07  ? 538  LYS B CE  1 
ATOM   8298 N NZ  . LYS B 1 569 ? 32.515  14.117  -19.219 1.00 91.28  ? 538  LYS B NZ  1 
ATOM   8299 N N   . LEU B 1 570 ? 29.865  7.705   -21.615 1.00 87.98  ? 539  LEU B N   1 
ATOM   8300 C CA  . LEU B 1 570 ? 30.355  6.359   -21.278 1.00 90.35  ? 539  LEU B CA  1 
ATOM   8301 C C   . LEU B 1 570 ? 30.871  5.545   -22.498 1.00 92.52  ? 539  LEU B C   1 
ATOM   8302 O O   . LEU B 1 570 ? 30.459  4.392   -22.753 1.00 92.50  ? 539  LEU B O   1 
ATOM   8303 C CB  . LEU B 1 570 ? 29.231  5.606   -20.578 1.00 89.59  ? 539  LEU B CB  1 
ATOM   8304 C CG  . LEU B 1 570 ? 29.590  4.621   -19.494 1.00 89.89  ? 539  LEU B CG  1 
ATOM   8305 C CD1 . LEU B 1 570 ? 30.525  5.265   -18.498 1.00 90.76  ? 539  LEU B CD1 1 
ATOM   8306 C CD2 . LEU B 1 570 ? 28.305  4.176   -18.838 1.00 88.56  ? 539  LEU B CD2 1 
ATOM   8307 N N   . LEU B 1 571 ? 31.816  6.175   -23.205 1.00 94.65  ? 540  LEU B N   1 
ATOM   8308 C CA  . LEU B 1 571 ? 32.541  5.632   -24.377 1.00 96.11  ? 540  LEU B CA  1 
ATOM   8309 C C   . LEU B 1 571 ? 33.757  4.748   -23.959 1.00 98.27  ? 540  LEU B C   1 
ATOM   8310 O O   . LEU B 1 571 ? 33.834  3.548   -24.281 1.00 98.93  ? 540  LEU B O   1 
ATOM   8311 C CB  . LEU B 1 571 ? 33.014  6.791   -25.311 1.00 96.23  ? 540  LEU B CB  1 
ATOM   8312 C CG  . LEU B 1 571 ? 33.562  8.144   -24.743 1.00 97.65  ? 540  LEU B CG  1 
ATOM   8313 C CD1 . LEU B 1 571 ? 35.078  8.109   -24.356 1.00 99.46  ? 540  LEU B CD1 1 
ATOM   8314 C CD2 . LEU B 1 571 ? 33.266  9.351   -25.680 1.00 97.10  ? 540  LEU B CD2 1 
HETATM 8315 C C1  . NAG C 2 .   ? 24.941  35.629  -0.965  1.00 79.98  ? 1501 NAG A C1  1 
HETATM 8316 C C2  . NAG C 2 .   ? 25.077  35.946  -2.495  1.00 86.83  ? 1501 NAG A C2  1 
HETATM 8317 C C3  . NAG C 2 .   ? 26.403  35.396  -3.073  1.00 87.01  ? 1501 NAG A C3  1 
HETATM 8318 C C4  . NAG C 2 .   ? 27.609  35.829  -2.238  1.00 87.10  ? 1501 NAG A C4  1 
HETATM 8319 C C5  . NAG C 2 .   ? 27.397  35.373  -0.785  1.00 85.89  ? 1501 NAG A C5  1 
HETATM 8320 C C6  . NAG C 2 .   ? 28.618  35.611  0.146   1.00 86.33  ? 1501 NAG A C6  1 
HETATM 8321 C C7  . NAG C 2 .   ? 23.006  36.279  -3.913  1.00 93.75  ? 1501 NAG A C7  1 
HETATM 8322 C C8  . NAG C 2 .   ? 22.238  35.708  -5.092  1.00 94.12  ? 1501 NAG A C8  1 
HETATM 8323 N N2  . NAG C 2 .   ? 23.925  35.481  -3.302  1.00 90.27  ? 1501 NAG A N2  1 
HETATM 8324 O O3  . NAG C 2 .   ? 26.616  35.765  -4.420  1.00 87.03  ? 1501 NAG A O3  1 
HETATM 8325 O O4  . NAG C 2 .   ? 28.809  35.326  -2.809  1.00 87.92  ? 1501 NAG A O4  1 
HETATM 8326 O O5  . NAG C 2 .   ? 26.180  35.948  -0.296  1.00 82.16  ? 1501 NAG A O5  1 
HETATM 8327 O O6  . NAG C 2 .   ? 28.624  36.869  0.809   1.00 86.26  ? 1501 NAG A O6  1 
HETATM 8328 O O7  . NAG C 2 .   ? 22.749  37.437  -3.549  1.00 94.80  ? 1501 NAG A O7  1 
HETATM 8329 C C1  . NAG D 2 .   ? 12.257  33.993  25.466  1.00 86.07  ? 1701 NAG A C1  1 
HETATM 8330 C C2  . NAG D 2 .   ? 13.600  34.749  25.335  1.00 93.41  ? 1701 NAG A C2  1 
HETATM 8331 C C3  . NAG D 2 .   ? 13.705  35.939  26.316  1.00 95.87  ? 1701 NAG A C3  1 
HETATM 8332 C C4  . NAG D 2 .   ? 12.415  36.773  26.242  1.00 97.03  ? 1701 NAG A C4  1 
HETATM 8333 C C5  . NAG D 2 .   ? 11.293  35.817  26.708  1.00 96.90  ? 1701 NAG A C5  1 
HETATM 8334 C C6  . NAG D 2 .   ? 9.955   36.444  27.167  1.00 98.25  ? 1701 NAG A C6  1 
HETATM 8335 C C7  . NAG D 2 .   ? 15.319  33.167  24.513  1.00 95.43  ? 1701 NAG A C7  1 
HETATM 8336 C C8  . NAG D 2 .   ? 16.104  31.927  24.863  1.00 95.88  ? 1701 NAG A C8  1 
HETATM 8337 N N2  . NAG D 2 .   ? 14.737  33.839  25.514  1.00 93.97  ? 1701 NAG A N2  1 
HETATM 8338 O O3  . NAG D 2 .   ? 14.850  36.739  26.074  1.00 96.81  ? 1701 NAG A O3  1 
HETATM 8339 O O4  . NAG D 2 .   ? 12.521  37.998  26.961  1.00 98.05  ? 1701 NAG A O4  1 
HETATM 8340 O O5  . NAG D 2 .   ? 11.131  34.859  25.656  1.00 91.27  ? 1701 NAG A O5  1 
HETATM 8341 O O6  . NAG D 2 .   ? 9.478   37.465  26.310  1.00 99.44  ? 1701 NAG A O6  1 
HETATM 8342 O O7  . NAG D 2 .   ? 15.247  33.519  23.337  1.00 96.46  ? 1701 NAG A O7  1 
HETATM 8343 O O1  . P6G E 3 .   ? 15.610  7.677   -12.211 1.00 86.24  ? 901  P6G A O1  1 
HETATM 8344 C C2  . P6G E 3 .   ? 16.463  6.660   -11.622 1.00 83.11  ? 901  P6G A C2  1 
HETATM 8345 C C3  . P6G E 3 .   ? 18.005  6.495   -11.667 1.00 79.64  ? 901  P6G A C3  1 
HETATM 8346 O O4  . P6G E 3 .   ? 18.746  6.203   -10.325 1.00 76.68  ? 901  P6G A O4  1 
HETATM 8347 C C5  . P6G E 3 .   ? 19.291  4.880   -10.240 1.00 74.90  ? 901  P6G A C5  1 
HETATM 8348 C C6  . P6G E 3 .   ? 20.711  4.966   -10.400 1.00 74.14  ? 901  P6G A C6  1 
HETATM 8349 O O7  . P6G E 3 .   ? 21.287  5.119   -11.818 1.00 73.56  ? 901  P6G A O7  1 
HETATM 8350 C C8  . P6G E 3 .   ? 22.541  4.444   -11.969 1.00 68.85  ? 901  P6G A C8  1 
HETATM 8351 C C9  . P6G E 3 .   ? 23.184  4.966   -13.256 1.00 65.12  ? 901  P6G A C9  1 
HETATM 8352 O O10 . P6G E 3 .   ? 23.201  6.555   -13.317 1.00 61.65  ? 901  P6G A O10 1 
HETATM 8353 C C11 . P6G E 3 .   ? 23.952  7.180   -14.346 1.00 61.61  ? 901  P6G A C11 1 
HETATM 8354 C C12 . P6G E 3 .   ? 23.858  8.627   -14.217 1.00 63.78  ? 901  P6G A C12 1 
HETATM 8355 O O13 . P6G E 3 .   ? 22.455  9.328   -14.405 1.00 68.14  ? 901  P6G A O13 1 
HETATM 8356 C C14 . P6G E 3 .   ? 22.330  10.255  -15.518 1.00 69.55  ? 901  P6G A C14 1 
HETATM 8357 C C15 . P6G E 3 .   ? 21.266  11.217  -15.314 1.00 72.35  ? 901  P6G A C15 1 
HETATM 8358 O O16 . P6G E 3 .   ? 19.854  10.566  -15.112 1.00 74.44  ? 901  P6G A O16 1 
HETATM 8359 C C17 . P6G E 3 .   ? 18.905  11.172  -14.215 1.00 73.46  ? 901  P6G A C17 1 
HETATM 8360 C C18 . P6G E 3 .   ? 18.544  10.116  -13.347 1.00 73.07  ? 901  P6G A C18 1 
HETATM 8361 O O19 . P6G E 3 .   ? 17.397  10.468  -12.311 1.00 72.90  ? 901  P6G A O19 1 
HETATM 8362 N N3  . TZ4 F 4 .   ? 41.010  28.300  9.879   1.00 65.62  ? 951  TZ4 A N3  1 
HETATM 8363 C C19 . TZ4 F 4 .   ? 40.745  27.415  8.853   1.00 66.50  ? 951  TZ4 A C19 1 
HETATM 8364 C C18 . TZ4 F 4 .   ? 41.709  27.088  7.854   1.00 67.14  ? 951  TZ4 A C18 1 
HETATM 8365 C C17 . TZ4 F 4 .   ? 41.436  26.196  6.824   1.00 66.60  ? 951  TZ4 A C17 1 
HETATM 8366 C C16 . TZ4 F 4 .   ? 40.185  25.507  6.657   1.00 65.24  ? 951  TZ4 A C16 1 
HETATM 8367 C C14 . TZ4 F 4 .   ? 39.197  25.828  7.658   1.00 65.70  ? 951  TZ4 A C14 1 
HETATM 8368 C C15 . TZ4 F 4 .   ? 39.522  26.770  8.712   1.00 65.98  ? 951  TZ4 A C15 1 
HETATM 8369 C C7  . TZ4 F 4 .   ? 37.886  25.302  7.530   1.00 65.31  ? 951  TZ4 A C7  1 
HETATM 8370 C C8  . TZ4 F 4 .   ? 36.863  25.583  8.590   1.00 64.45  ? 951  TZ4 A C8  1 
HETATM 8371 C C9  . TZ4 F 4 .   ? 36.678  24.548  9.519   1.00 62.43  ? 951  TZ4 A C9  1 
HETATM 8372 C C10 . TZ4 F 4 .   ? 35.753  24.677  10.552  1.00 64.22  ? 951  TZ4 A C10 1 
HETATM 8373 C C11 . TZ4 F 4 .   ? 34.989  25.847  10.699  1.00 64.08  ? 951  TZ4 A C11 1 
HETATM 8374 C C12 . TZ4 F 4 .   ? 35.159  26.894  9.790   1.00 64.56  ? 951  TZ4 A C12 1 
HETATM 8375 C C13 . TZ4 F 4 .   ? 36.091  26.756  8.751   1.00 64.71  ? 951  TZ4 A C13 1 
HETATM 8376 C C4  . TZ4 F 4 .   ? 39.835  24.626  5.549   1.00 65.40  ? 951  TZ4 A C4  1 
HETATM 8377 C C3  . TZ4 F 4 .   ? 40.777  24.055  4.606   1.00 66.12  ? 951  TZ4 A C3  1 
HETATM 8378 C C2  . TZ4 F 4 .   ? 40.456  23.074  3.675   1.00 64.89  ? 951  TZ4 A C2  1 
HETATM 8379 C C1  . TZ4 F 4 .   ? 39.132  22.534  3.594   1.00 64.39  ? 951  TZ4 A C1  1 
HETATM 8380 N N1  . TZ4 F 4 .   ? 38.767  21.550  2.694   1.00 61.15  ? 951  TZ4 A N1  1 
HETATM 8381 C C6  . TZ4 F 4 .   ? 38.493  24.094  5.467   1.00 64.70  ? 951  TZ4 A C6  1 
HETATM 8382 C C5  . TZ4 F 4 .   ? 38.216  23.062  4.509   1.00 63.90  ? 951  TZ4 A C5  1 
HETATM 8383 N N2  . TZ4 F 4 .   ? 37.600  24.475  6.488   1.00 65.78  ? 951  TZ4 A N2  1 
HETATM 8384 C C20 . TZ4 F 4 .   ? 36.196  23.967  6.397   1.00 67.73  ? 951  TZ4 A C20 1 
HETATM 8385 C C21 . TZ4 F 4 .   ? 35.767  22.651  7.058   1.00 67.08  ? 951  TZ4 A C21 1 
HETATM 8386 C C22 . TZ4 F 4 .   ? 34.372  22.333  6.488   1.00 66.70  ? 951  TZ4 A C22 1 
HETATM 8387 C C23 . TZ4 F 4 .   ? 33.774  21.061  7.067   1.00 64.76  ? 951  TZ4 A C23 1 
HETATM 8388 C C24 . TZ4 F 4 .   ? 33.345  21.352  8.496   1.00 62.90  ? 951  TZ4 A C24 1 
HETATM 8389 C C25 . TZ4 F 4 .   ? 31.935  21.942  8.524   1.00 60.98  ? 951  TZ4 A C25 1 
HETATM 8390 C C26 . TZ4 F 4 .   ? 31.602  21.911  9.950   1.00 56.75  ? 951  TZ4 A C26 1 
HETATM 8391 N N4  . TZ4 F 4 .   ? 31.313  20.786  10.582  1.00 56.96  ? 951  TZ4 A N4  1 
HETATM 8392 N N5  . TZ4 F 4 .   ? 31.112  21.129  11.852  1.00 56.54  ? 951  TZ4 A N5  1 
HETATM 8393 N N6  . TZ4 F 4 .   ? 31.274  22.431  12.006  1.00 56.28  ? 951  TZ4 A N6  1 
HETATM 8394 C C27 . TZ4 F 4 .   ? 31.601  22.933  10.822  1.00 56.46  ? 951  TZ4 A C27 1 
HETATM 8395 C C28 . TZ4 F 4 .   ? 31.169  23.293  13.172  1.00 56.46  ? 951  TZ4 A C28 1 
HETATM 8396 C C29 . TZ4 F 4 .   ? 30.572  22.452  14.294  1.00 56.24  ? 951  TZ4 A C29 1 
HETATM 8397 N N7  . TZ4 F 4 .   ? 29.173  22.800  14.378  1.00 53.10  ? 951  TZ4 A N7  1 
HETATM 8398 C C30 . TZ4 F 4 .   ? 28.100  22.012  14.105  1.00 48.51  ? 951  TZ4 A C30 1 
HETATM 8399 C C31 . TZ4 F 4 .   ? 27.103  22.715  13.346  1.00 48.07  ? 951  TZ4 A C31 1 
HETATM 8400 C C32 . TZ4 F 4 .   ? 27.245  24.046  12.798  1.00 45.86  ? 951  TZ4 A C32 1 
HETATM 8401 C C33 . TZ4 F 4 .   ? 25.888  22.044  13.061  1.00 45.69  ? 951  TZ4 A C33 1 
HETATM 8402 C C34 . TZ4 F 4 .   ? 24.870  22.757  12.357  1.00 45.44  ? 951  TZ4 A C34 1 
HETATM 8403 C C35 . TZ4 F 4 .   ? 25.040  24.011  11.877  1.00 45.26  ? 951  TZ4 A C35 1 
HETATM 8404 C C36 . TZ4 F 4 .   ? 26.254  24.672  12.120  1.00 46.75  ? 951  TZ4 A C36 1 
HETATM 8405 N N8  . TZ4 F 4 .   ? 25.684  20.752  13.411  1.00 45.49  ? 951  TZ4 A N8  1 
HETATM 8406 C C37 . TZ4 F 4 .   ? 26.611  20.082  14.112  1.00 45.49  ? 951  TZ4 A C37 1 
HETATM 8407 C C38 . TZ4 F 4 .   ? 26.290  18.746  14.580  1.00 44.35  ? 951  TZ4 A C38 1 
HETATM 8408 C C39 . TZ4 F 4 .   ? 27.851  20.696  14.523  1.00 45.38  ? 951  TZ4 A C39 1 
HETATM 8409 C C40 . TZ4 F 4 .   ? 28.625  19.909  15.446  1.00 45.51  ? 951  TZ4 A C40 1 
HETATM 8410 C C41 . TZ4 F 4 .   ? 28.218  18.667  15.857  1.00 44.64  ? 951  TZ4 A C41 1 
HETATM 8411 C C42 . TZ4 F 4 .   ? 27.288  17.933  15.068  1.00 44.72  ? 951  TZ4 A C42 1 
HETATM 8412 N N3  . TZ4 G 4 .   ? 14.762  -16.357 -39.944 1.00 75.57  ? 952  TZ4 B N3  1 
HETATM 8413 C C19 . TZ4 G 4 .   ? 15.534  -15.528 -39.161 1.00 76.84  ? 952  TZ4 B C19 1 
HETATM 8414 C C18 . TZ4 G 4 .   ? 16.940  -15.722 -39.002 1.00 77.18  ? 952  TZ4 B C18 1 
HETATM 8415 C C17 . TZ4 G 4 .   ? 17.725  -14.889 -38.218 1.00 77.20  ? 952  TZ4 B C17 1 
HETATM 8416 C C16 . TZ4 G 4 .   ? 17.226  -13.747 -37.498 1.00 76.55  ? 952  TZ4 B C16 1 
HETATM 8417 C C14 . TZ4 G 4 .   ? 15.800  -13.530 -37.647 1.00 77.43  ? 952  TZ4 B C14 1 
HETATM 8418 C C15 . TZ4 G 4 .   ? 15.010  -14.434 -38.482 1.00 76.95  ? 952  TZ4 B C15 1 
HETATM 8419 C C7  . TZ4 G 4 .   ? 15.169  -12.532 -36.851 1.00 76.79  ? 952  TZ4 B C7  1 
HETATM 8420 C C8  . TZ4 G 4 .   ? 13.704  -12.315 -37.071 1.00 74.20  ? 952  TZ4 B C8  1 
HETATM 8421 C C9  . TZ4 G 4 .   ? 13.378  -11.276 -37.984 1.00 70.64  ? 952  TZ4 B C9  1 
HETATM 8422 C C10 . TZ4 G 4 .   ? 12.062  -10.971 -38.295 1.00 70.87  ? 952  TZ4 B C10 1 
HETATM 8423 C C11 . TZ4 G 4 .   ? 11.030  -11.721 -37.714 1.00 71.95  ? 952  TZ4 B C11 1 
HETATM 8424 C C12 . TZ4 G 4 .   ? 11.340  -12.760 -36.808 1.00 73.57  ? 952  TZ4 B C12 1 
HETATM 8425 C C13 . TZ4 G 4 .   ? 12.670  -13.064 -36.485 1.00 73.20  ? 952  TZ4 B C13 1 
HETATM 8426 C C4  . TZ4 G 4 .   ? 17.985  -12.931 -36.567 1.00 76.61  ? 952  TZ4 B C4  1 
HETATM 8427 C C3  . TZ4 G 4 .   ? 19.403  -13.029 -36.350 1.00 77.73  ? 952  TZ4 B C3  1 
HETATM 8428 C C2  . TZ4 G 4 .   ? 20.134  -12.214 -35.506 1.00 77.36  ? 952  TZ4 B C2  1 
HETATM 8429 C C1  . TZ4 G 4 .   ? 19.502  -11.172 -34.760 1.00 77.07  ? 952  TZ4 B C1  1 
HETATM 8430 N N1  . TZ4 G 4 .   ? 20.209  -10.340 -33.912 1.00 73.98  ? 952  TZ4 B N1  1 
HETATM 8431 C C6  . TZ4 G 4 .   ? 17.326  -11.901 -35.807 1.00 77.10  ? 952  TZ4 B C6  1 
HETATM 8432 C C5  . TZ4 G 4 .   ? 18.123  -11.054 -34.957 1.00 75.34  ? 952  TZ4 B C5  1 
HETATM 8433 N N2  . TZ4 G 4 .   ? 15.916  -11.774 -35.994 1.00 78.10  ? 952  TZ4 B N2  1 
HETATM 8434 C C20 . TZ4 G 4 .   ? 15.188  -10.735 -35.191 1.00 78.10  ? 952  TZ4 B C20 1 
HETATM 8435 C C21 . TZ4 G 4 .   ? 15.333  -9.295  -35.688 1.00 77.87  ? 952  TZ4 B C21 1 
HETATM 8436 C C22 . TZ4 G 4 .   ? 14.675  -8.308  -34.706 1.00 77.29  ? 952  TZ4 B C22 1 
HETATM 8437 C C23 . TZ4 G 4 .   ? 14.106  -7.133  -35.507 1.00 75.94  ? 952  TZ4 B C23 1 
HETATM 8438 C C24 . TZ4 G 4 .   ? 12.718  -7.451  -36.059 1.00 74.31  ? 952  TZ4 B C24 1 
HETATM 8439 C C25 . TZ4 G 4 .   ? 11.617  -6.934  -35.121 1.00 73.18  ? 952  TZ4 B C25 1 
HETATM 8440 C C26 . TZ4 G 4 .   ? 10.467  -6.646  -36.006 1.00 70.93  ? 952  TZ4 B C26 1 
HETATM 8441 N N4  . TZ4 G 4 .   ? 10.171  -5.409  -36.385 1.00 71.86  ? 952  TZ4 B N4  1 
HETATM 8442 N N5  . TZ4 G 4 .   ? 9.106   -5.522  -37.171 1.00 71.71  ? 952  TZ4 B N5  1 
HETATM 8443 N N6  . TZ4 G 4 .   ? 8.744   -6.796  -37.303 1.00 70.83  ? 952  TZ4 B N6  1 
HETATM 8444 C C27 . TZ4 G 4 .   ? 9.598   -7.523  -36.583 1.00 70.24  ? 952  TZ4 B C27 1 
HETATM 8445 C C28 . TZ4 G 4 .   ? 7.662   -7.394  -38.081 1.00 68.63  ? 952  TZ4 B C28 1 
HETATM 8446 C C29 . TZ4 G 4 .   ? 6.907   -6.295  -38.836 1.00 66.00  ? 952  TZ4 B C29 1 
HETATM 8447 N N7  . TZ4 G 4 .   ? 5.747   -6.027  -37.999 1.00 61.63  ? 952  TZ4 B N7  1 
HETATM 8448 C C30 . TZ4 G 4 .   ? 5.437   -4.850  -37.357 1.00 57.94  ? 952  TZ4 B C30 1 
HETATM 8449 C C31 . TZ4 G 4 .   ? 4.760   -5.089  -36.125 1.00 56.23  ? 952  TZ4 B C31 1 
HETATM 8450 C C32 . TZ4 G 4 .   ? 4.608   -6.386  -35.485 1.00 54.25  ? 952  TZ4 B C32 1 
HETATM 8451 C C33 . TZ4 G 4 .   ? 4.278   -3.960  -35.390 1.00 55.29  ? 952  TZ4 B C33 1 
HETATM 8452 C C34 . TZ4 G 4 .   ? 3.609   -4.198  -34.139 1.00 56.11  ? 952  TZ4 B C34 1 
HETATM 8453 C C35 . TZ4 G 4 .   ? 3.470   -5.445  -33.594 1.00 56.32  ? 952  TZ4 B C35 1 
HETATM 8454 C C36 . TZ4 G 4 .   ? 3.986   -6.568  -34.292 1.00 54.23  ? 952  TZ4 B C36 1 
HETATM 8455 N N8  . TZ4 G 4 .   ? 4.504   -2.686  -35.764 1.00 55.12  ? 952  TZ4 B N8  1 
HETATM 8456 C C37 . TZ4 G 4 .   ? 5.175   -2.431  -36.902 1.00 55.38  ? 952  TZ4 B C37 1 
HETATM 8457 C C38 . TZ4 G 4 .   ? 5.166   -1.062  -37.369 1.00 53.54  ? 952  TZ4 B C38 1 
HETATM 8458 C C39 . TZ4 G 4 .   ? 5.650   -3.493  -37.755 1.00 55.36  ? 952  TZ4 B C39 1 
HETATM 8459 C C40 . TZ4 G 4 .   ? 6.052   -3.019  -39.039 1.00 55.01  ? 952  TZ4 B C40 1 
HETATM 8460 C C41 . TZ4 G 4 .   ? 5.995   -1.706  -39.418 1.00 55.47  ? 952  TZ4 B C41 1 
HETATM 8461 C C42 . TZ4 G 4 .   ? 5.873   -0.656  -38.469 1.00 54.24  ? 952  TZ4 B C42 1 
HETATM 8462 O O   . HOH H 5 .   ? 21.492  15.236  12.788  1.00 41.76  ? 1702 HOH A O   1 
HETATM 8463 O O   . HOH H 5 .   ? 19.213  12.302  13.191  1.00 35.90  ? 1703 HOH A O   1 
HETATM 8464 O O   . HOH H 5 .   ? 22.610  20.564  7.359   1.00 37.15  ? 1704 HOH A O   1 
HETATM 8465 O O   . HOH H 5 .   ? 31.378  8.181   6.450   1.00 43.67  ? 1705 HOH A O   1 
HETATM 8466 O O   . HOH H 5 .   ? 46.936  10.789  10.900  1.00 38.31  ? 1706 HOH A O   1 
HETATM 8467 O O   . HOH H 5 .   ? 38.661  15.333  12.542  1.00 41.17  ? 1707 HOH A O   1 
HETATM 8468 O O   . HOH H 5 .   ? 26.378  15.713  18.292  1.00 35.79  ? 1708 HOH A O   1 
HETATM 8469 O O   . HOH H 5 .   ? 19.722  20.402  18.419  1.00 38.90  ? 1709 HOH A O   1 
HETATM 8470 O O   . HOH H 5 .   ? 53.663  25.926  8.461   1.00 40.07  ? 1710 HOH A O   1 
HETATM 8471 O O   . HOH H 5 .   ? 17.921  15.359  28.777  1.00 39.89  ? 1711 HOH A O   1 
HETATM 8472 O O   . HOH H 5 .   ? 47.676  7.695   17.896  1.00 31.96  ? 1712 HOH A O   1 
HETATM 8473 O O   . HOH H 5 .   ? 24.396  23.854  23.038  1.00 46.20  ? 1713 HOH A O   1 
HETATM 8474 O O   . HOH H 5 .   ? 40.250  20.372  16.270  1.00 37.75  ? 1714 HOH A O   1 
HETATM 8475 O O   . HOH H 5 .   ? 29.531  18.123  19.762  1.00 33.79  ? 1715 HOH A O   1 
HETATM 8476 O O   . HOH H 5 .   ? 32.344  17.166  29.563  1.00 39.68  ? 1716 HOH A O   1 
HETATM 8477 O O   . HOH H 5 .   ? 35.576  17.669  24.284  1.00 34.89  ? 1717 HOH A O   1 
HETATM 8478 O O   . HOH H 5 .   ? 33.529  14.725  17.051  1.00 34.99  ? 1718 HOH A O   1 
HETATM 8479 O O   . HOH H 5 .   ? 29.413  2.755   45.818  1.00 45.11  ? 1719 HOH A O   1 
HETATM 8480 O O   . HOH H 5 .   ? 43.093  7.709   13.934  1.00 44.50  ? 1720 HOH A O   1 
HETATM 8481 O O   . HOH H 5 .   ? 39.491  29.091  32.295  1.00 45.78  ? 1721 HOH A O   1 
HETATM 8482 O O   . HOH H 5 .   ? 42.452  1.110   45.167  1.00 44.72  ? 1722 HOH A O   1 
HETATM 8483 O O   . HOH H 5 .   ? 41.468  7.100   2.952   1.00 45.31  ? 1723 HOH A O   1 
HETATM 8484 O O   . HOH H 5 .   ? 28.021  -1.032  37.342  1.00 42.98  ? 1724 HOH A O   1 
HETATM 8485 O O   . HOH H 5 .   ? 29.697  12.422  24.472  1.00 32.29  ? 1725 HOH A O   1 
HETATM 8486 O O   . HOH H 5 .   ? 34.028  11.736  -2.648  1.00 47.35  ? 1726 HOH A O   1 
HETATM 8487 O O   . HOH H 5 .   ? 36.719  1.832   36.894  1.00 47.13  ? 1727 HOH A O   1 
HETATM 8488 O O   . HOH H 5 .   ? 37.119  12.870  6.674   1.00 43.13  ? 1728 HOH A O   1 
HETATM 8489 O O   . HOH H 5 .   ? 32.806  17.042  32.359  1.00 38.50  ? 1729 HOH A O   1 
HETATM 8490 O O   . HOH H 5 .   ? 14.771  21.233  14.209  1.00 43.25  ? 1730 HOH A O   1 
HETATM 8491 O O   . HOH H 5 .   ? 44.572  11.302  9.369   1.00 44.51  ? 1731 HOH A O   1 
HETATM 8492 O O   . HOH H 5 .   ? 36.919  -4.562  14.019  1.00 50.56  ? 1732 HOH A O   1 
HETATM 8493 O O   . HOH H 5 .   ? 24.489  9.069   48.034  1.00 46.47  ? 1733 HOH A O   1 
HETATM 8494 O O   . HOH H 5 .   ? 41.529  16.784  21.546  1.00 39.08  ? 1734 HOH A O   1 
HETATM 8495 O O   . HOH H 5 .   ? 30.335  20.645  18.750  1.00 33.23  ? 1735 HOH A O   1 
HETATM 8496 O O   . HOH H 5 .   ? 41.143  27.398  17.056  1.00 49.06  ? 1736 HOH A O   1 
HETATM 8497 O O   . HOH H 5 .   ? 39.044  16.210  0.986   1.00 47.92  ? 1737 HOH A O   1 
HETATM 8498 O O   . HOH H 5 .   ? 44.152  19.137  16.275  1.00 47.86  ? 1738 HOH A O   1 
HETATM 8499 O O   . HOH H 5 .   ? 45.758  8.420   29.659  1.00 43.84  ? 1739 HOH A O   1 
HETATM 8500 O O   . HOH H 5 .   ? 19.584  0.947   27.882  1.00 40.17  ? 1740 HOH A O   1 
HETATM 8501 O O   . HOH H 5 .   ? 46.530  12.905  22.636  1.00 40.37  ? 1741 HOH A O   1 
HETATM 8502 O O   . HOH H 5 .   ? 42.130  14.041  31.538  1.00 41.24  ? 1742 HOH A O   1 
HETATM 8503 O O   . HOH H 5 .   ? 25.583  22.787  29.555  1.00 44.31  ? 1743 HOH A O   1 
HETATM 8504 O O   . HOH H 5 .   ? 38.657  12.118  4.796   1.00 44.13  ? 1744 HOH A O   1 
HETATM 8505 O O   . HOH H 5 .   ? 33.556  19.490  28.808  1.00 42.26  ? 1745 HOH A O   1 
HETATM 8506 O O   . HOH H 5 .   ? 37.677  9.776   4.277   1.00 39.95  ? 1746 HOH A O   1 
HETATM 8507 O O   . HOH H 5 .   ? 28.155  4.868   47.002  1.00 41.70  ? 1747 HOH A O   1 
HETATM 8508 O O   . HOH H 5 .   ? 40.979  12.694  33.554  1.00 40.43  ? 1748 HOH A O   1 
HETATM 8509 O O   . HOH H 5 .   ? 38.458  9.360   47.455  1.00 52.41  ? 1749 HOH A O   1 
HETATM 8510 O O   . HOH H 5 .   ? 11.433  17.870  33.883  1.00 41.99  ? 1750 HOH A O   1 
HETATM 8511 O O   . HOH H 5 .   ? 10.053  -2.667  6.653   1.00 48.43  ? 1751 HOH A O   1 
HETATM 8512 O O   . HOH H 5 .   ? 35.336  16.201  -7.638  1.00 61.84  ? 1752 HOH A O   1 
HETATM 8513 O O   . HOH H 5 .   ? 9.683   6.968   0.817   1.00 47.52  ? 1753 HOH A O   1 
HETATM 8514 O O   . HOH H 5 .   ? 18.545  15.095  4.043   1.00 37.42  ? 1754 HOH A O   1 
HETATM 8515 O O   . HOH H 5 .   ? 31.655  21.364  16.496  1.00 42.11  ? 1755 HOH A O   1 
HETATM 8516 O O   . HOH H 5 .   ? 8.552   11.940  27.703  1.00 46.48  ? 1756 HOH A O   1 
HETATM 8517 O O   . HOH H 5 .   ? 31.544  25.588  -12.924 1.00 45.34  ? 1757 HOH A O   1 
HETATM 8518 O O   . HOH H 5 .   ? 20.321  17.779  2.388   1.00 38.21  ? 1758 HOH A O   1 
HETATM 8519 O O   . HOH H 5 .   ? 43.841  0.741   6.041   1.00 39.60  ? 1759 HOH A O   1 
HETATM 8520 O O   . HOH H 5 .   ? 17.159  -2.445  34.014  1.00 55.03  ? 1760 HOH A O   1 
HETATM 8521 O O   . HOH H 5 .   ? 43.618  9.689   11.352  1.00 41.41  ? 1761 HOH A O   1 
HETATM 8522 O O   . HOH H 5 .   ? 25.515  19.048  28.527  1.00 43.15  ? 1762 HOH A O   1 
HETATM 8523 O O   . HOH H 5 .   ? 26.399  19.555  45.923  1.00 58.17  ? 1763 HOH A O   1 
HETATM 8524 O O   . HOH H 5 .   ? 43.928  15.566  25.096  1.00 45.77  ? 1764 HOH A O   1 
HETATM 8525 O O   . HOH H 5 .   ? 29.974  27.386  -6.185  1.00 47.10  ? 1765 HOH A O   1 
HETATM 8526 O O   . HOH H 5 .   ? 41.727  26.458  19.493  1.00 42.84  ? 1766 HOH A O   1 
HETATM 8527 O O   . HOH H 5 .   ? 46.569  2.001   2.992   1.00 54.24  ? 1767 HOH A O   1 
HETATM 8528 O O   . HOH H 5 .   ? 34.993  -2.491  33.308  1.00 47.44  ? 1768 HOH A O   1 
HETATM 8529 O O   . HOH H 5 .   ? 29.107  0.071   29.455  1.00 37.33  ? 1769 HOH A O   1 
HETATM 8530 O O   . HOH H 5 .   ? 48.569  1.200   14.377  1.00 43.17  ? 1770 HOH A O   1 
HETATM 8531 O O   . HOH H 5 .   ? 42.146  19.261  17.993  1.00 39.23  ? 1771 HOH A O   1 
HETATM 8532 O O   . HOH H 5 .   ? 37.587  7.248   37.797  1.00 48.64  ? 1772 HOH A O   1 
HETATM 8533 O O   . HOH H 5 .   ? 27.599  32.124  -11.886 1.00 52.42  ? 1773 HOH A O   1 
HETATM 8534 O O   . HOH H 5 .   ? 52.695  13.738  3.700   1.00 47.06  ? 1774 HOH A O   1 
HETATM 8535 O O   . HOH H 5 .   ? 4.314   12.173  10.759  1.00 44.63  ? 1775 HOH A O   1 
HETATM 8536 O O   . HOH H 5 .   ? 40.173  2.079   25.851  1.00 45.83  ? 1776 HOH A O   1 
HETATM 8537 O O   . HOH H 5 .   ? 46.495  14.850  24.321  1.00 41.13  ? 1777 HOH A O   1 
HETATM 8538 O O   . HOH H 5 .   ? 18.287  21.375  1.471   1.00 50.13  ? 1778 HOH A O   1 
HETATM 8539 O O   . HOH H 5 .   ? 20.209  14.968  1.888   1.00 47.11  ? 1779 HOH A O   1 
HETATM 8540 O O   . HOH H 5 .   ? 12.893  23.013  -9.661  1.00 61.37  ? 1780 HOH A O   1 
HETATM 8541 O O   . HOH H 5 .   ? 50.169  25.118  4.902   1.00 50.75  ? 1781 HOH A O   1 
HETATM 8542 O O   . HOH H 5 .   ? 50.427  0.696   16.077  1.00 58.55  ? 1782 HOH A O   1 
HETATM 8543 O O   . HOH H 5 .   ? 45.671  1.314   16.277  1.00 54.63  ? 1783 HOH A O   1 
HETATM 8544 O O   . HOH H 5 .   ? 47.695  -0.134  12.244  1.00 51.69  ? 1784 HOH A O   1 
HETATM 8545 O O   . HOH H 5 .   ? 32.474  24.019  16.655  1.00 42.38  ? 1785 HOH A O   1 
HETATM 8546 O O   . HOH H 5 .   ? 40.098  24.624  34.528  1.00 59.67  ? 1786 HOH A O   1 
HETATM 8547 O O   . HOH H 5 .   ? 41.901  0.183   4.480   1.00 52.64  ? 1787 HOH A O   1 
HETATM 8548 O O   . HOH H 5 .   ? 25.621  -4.742  39.104  1.00 56.69  ? 1788 HOH A O   1 
HETATM 8549 O O   . HOH H 5 .   ? 37.352  2.174   34.308  1.00 49.46  ? 1789 HOH A O   1 
HETATM 8550 O O   . HOH H 5 .   ? 39.809  15.674  38.960  1.00 47.78  ? 1790 HOH A O   1 
HETATM 8551 O O   . HOH H 5 .   ? 12.018  22.805  6.781   1.00 53.23  ? 1791 HOH A O   1 
HETATM 8552 O O   . HOH H 5 .   ? 48.759  21.346  26.383  1.00 45.78  ? 1792 HOH A O   1 
HETATM 8553 O O   . HOH H 5 .   ? 43.344  27.659  15.306  1.00 53.96  ? 1793 HOH A O   1 
HETATM 8554 O O   . HOH H 5 .   ? 53.376  9.572   21.963  1.00 48.44  ? 1794 HOH A O   1 
HETATM 8555 O O   . HOH H 5 .   ? 43.923  16.154  36.034  1.00 49.43  ? 1795 HOH A O   1 
HETATM 8556 O O   . HOH H 5 .   ? 2.456   8.840   16.913  1.00 59.26  ? 1796 HOH A O   1 
HETATM 8557 O O   . HOH H 5 .   ? 6.356   6.265   0.920   1.00 60.86  ? 1797 HOH A O   1 
HETATM 8558 O O   . HOH H 5 .   ? 36.561  5.817   2.676   1.00 56.11  ? 1798 HOH A O   1 
HETATM 8559 O O   . HOH H 5 .   ? 10.587  10.881  3.310   1.00 47.82  ? 1799 HOH A O   1 
HETATM 8560 O O   . HOH H 5 .   ? 17.507  19.651  -0.720  1.00 43.90  ? 1800 HOH A O   1 
HETATM 8561 O O   . HOH H 5 .   ? 14.331  5.227   36.859  1.00 54.72  ? 1801 HOH A O   1 
HETATM 8562 O O   . HOH H 5 .   ? 13.572  8.547   -14.009 1.00 65.32  ? 1802 HOH A O   1 
HETATM 8563 O O   . HOH H 5 .   ? 51.400  7.200   3.356   1.00 59.02  ? 1803 HOH A O   1 
HETATM 8564 O O   . HOH H 5 .   ? 46.790  -1.049  16.891  1.00 53.16  ? 1804 HOH A O   1 
HETATM 8565 O O   . HOH H 5 .   ? 44.660  1.747   18.593  1.00 47.82  ? 1805 HOH A O   1 
HETATM 8566 O O   . HOH H 5 .   ? 15.186  8.553   -4.515  1.00 50.41  ? 1806 HOH A O   1 
HETATM 8567 O O   . HOH H 5 .   ? 40.608  -1.707  24.027  1.00 57.10  ? 1807 HOH A O   1 
HETATM 8568 O O   . HOH H 5 .   ? 51.026  28.487  8.530   1.00 61.38  ? 1808 HOH A O   1 
HETATM 8569 O O   . HOH H 5 .   ? 38.693  4.697   34.717  1.00 56.21  ? 1809 HOH A O   1 
HETATM 8570 O O   . HOH H 5 .   ? 12.205  27.961  12.228  1.00 51.38  ? 1810 HOH A O   1 
HETATM 8571 O O   . HOH H 5 .   ? 37.222  -6.190  16.181  1.00 46.10  ? 1811 HOH A O   1 
HETATM 8572 O O   . HOH H 5 .   ? 50.809  17.799  25.935  1.00 49.65  ? 1812 HOH A O   1 
HETATM 8573 O O   . HOH H 5 .   ? 56.597  14.575  25.811  1.00 50.42  ? 1813 HOH A O   1 
HETATM 8574 O O   . HOH H 5 .   ? 50.090  6.039   27.871  1.00 57.71  ? 1814 HOH A O   1 
HETATM 8575 O O   . HOH H 5 .   ? 9.937   8.707   36.135  1.00 60.48  ? 1815 HOH A O   1 
HETATM 8576 O O   . HOH H 5 .   ? 13.897  11.515  -2.766  1.00 72.15  ? 1816 HOH A O   1 
HETATM 8577 O O   . HOH H 5 .   ? 16.874  25.875  17.982  1.00 58.84  ? 1817 HOH A O   1 
HETATM 8578 O O   . HOH H 5 .   ? 20.098  27.915  15.967  1.00 60.57  ? 1818 HOH A O   1 
HETATM 8579 O O   . HOH H 5 .   ? 16.411  23.450  32.825  1.00 60.05  ? 1819 HOH A O   1 
HETATM 8580 O O   . HOH H 5 .   ? 35.124  -1.045  44.174  1.00 41.67  ? 1820 HOH A O   1 
HETATM 8581 O O   . HOH H 5 .   ? 38.023  31.479  20.289  1.00 56.59  ? 1821 HOH A O   1 
HETATM 8582 O O   . HOH H 5 .   ? 25.366  22.324  34.770  1.00 52.78  ? 1822 HOH A O   1 
HETATM 8583 O O   . HOH H 5 .   ? 41.724  1.508   39.836  1.00 58.00  ? 1823 HOH A O   1 
HETATM 8584 O O   . HOH H 5 .   ? 6.884   20.590  11.988  1.00 57.71  ? 1824 HOH A O   1 
HETATM 8585 O O   . HOH H 5 .   ? 50.400  23.216  25.067  1.00 54.18  ? 1825 HOH A O   1 
HETATM 8586 O O   . HOH H 5 .   ? 21.792  25.521  31.948  1.00 65.05  ? 1826 HOH A O   1 
HETATM 8587 O O   . HOH H 5 .   ? 37.230  16.927  38.182  1.00 46.47  ? 1827 HOH A O   1 
HETATM 8588 O O   . HOH H 5 .   ? 31.967  0.683   -2.415  1.00 58.76  ? 1828 HOH A O   1 
HETATM 8589 O O   . HOH H 5 .   ? 6.814   25.251  14.849  1.00 60.79  ? 1829 HOH A O   1 
HETATM 8590 O O   . HOH H 5 .   ? 32.154  2.469   3.087   1.00 52.07  ? 1830 HOH A O   1 
HETATM 8591 O O   . HOH H 5 .   ? 51.128  3.274   7.500   1.00 57.79  ? 1831 HOH A O   1 
HETATM 8592 O O   . HOH H 5 .   ? 2.973   -1.525  20.850  1.00 66.45  ? 1832 HOH A O   1 
HETATM 8593 O O   . HOH H 5 .   ? 11.527  3.405   -10.893 1.00 56.15  ? 1833 HOH A O   1 
HETATM 8594 O O   . HOH H 5 .   ? 26.815  25.125  39.053  1.00 72.16  ? 1834 HOH A O   1 
HETATM 8595 O O   . HOH H 5 .   ? 19.715  24.001  38.628  1.00 52.67  ? 1835 HOH A O   1 
HETATM 8596 O O   . HOH H 5 .   ? 20.939  19.100  52.499  1.00 56.02  ? 1836 HOH A O   1 
HETATM 8597 O O   . HOH H 5 .   ? 15.837  31.511  3.445   1.00 58.19  ? 1837 HOH A O   1 
HETATM 8598 O O   . HOH H 5 .   ? 10.550  25.708  25.893  1.00 47.97  ? 1838 HOH A O   1 
HETATM 8599 O O   . HOH H 5 .   ? 5.106   29.069  24.788  1.00 61.37  ? 1839 HOH A O   1 
HETATM 8600 O O   . HOH H 5 .   ? 8.452   -3.283  16.306  1.00 57.25  ? 1840 HOH A O   1 
HETATM 8601 O O   . HOH H 5 .   ? 27.305  8.969   7.536   1.00 43.98  ? 1841 HOH A O   1 
HETATM 8602 O O   . HOH H 5 .   ? 53.018  9.034   3.824   1.00 51.65  ? 1842 HOH A O   1 
HETATM 8603 O O   . HOH H 5 .   ? 44.097  24.411  11.087  1.00 48.79  ? 1843 HOH A O   1 
HETATM 8604 O O   . HOH H 5 .   ? 28.615  26.286  23.407  1.00 50.44  ? 1844 HOH A O   1 
HETATM 8605 O O   . HOH H 5 .   ? 24.215  20.864  30.593  1.00 50.90  ? 1845 HOH A O   1 
HETATM 8606 O O   . HOH H 5 .   ? 34.851  23.589  18.482  1.00 39.63  ? 1846 HOH A O   1 
HETATM 8607 O O   . HOH H 5 .   ? 39.817  22.392  35.510  1.00 61.65  ? 1847 HOH A O   1 
HETATM 8608 O O   . HOH H 5 .   ? 32.348  0.872   41.655  1.00 50.03  ? 1848 HOH A O   1 
HETATM 8609 O O   . HOH H 5 .   ? 27.444  0.917   45.108  1.00 42.32  ? 1849 HOH A O   1 
HETATM 8610 O O   . HOH H 5 .   ? 27.754  -3.800  38.785  1.00 47.05  ? 1850 HOH A O   1 
HETATM 8611 O O   . HOH H 5 .   ? 34.409  -1.221  41.701  1.00 44.81  ? 1851 HOH A O   1 
HETATM 8612 O O   . HOH H 5 .   ? 40.578  27.794  26.417  1.00 47.16  ? 1852 HOH A O   1 
HETATM 8613 O O   . HOH H 5 .   ? 44.797  -1.263  40.300  1.00 48.35  ? 1853 HOH A O   1 
HETATM 8614 O O   . HOH H 5 .   ? 38.180  3.603   38.008  1.00 53.42  ? 1854 HOH A O   1 
HETATM 8615 O O   . HOH H 5 .   ? 36.682  5.364   39.016  1.00 54.05  ? 1855 HOH A O   1 
HETATM 8616 O O   . HOH H 5 .   ? 5.367   18.861  11.279  1.00 56.62  ? 1856 HOH A O   1 
HETATM 8617 O O   . HOH H 5 .   ? 39.248  -5.114  17.563  1.00 57.85  ? 1857 HOH A O   1 
HETATM 8618 O O   . HOH H 5 .   ? 23.541  26.399  34.367  1.00 60.00  ? 1858 HOH A O   1 
HETATM 8619 O O   . HOH H 5 .   ? 11.744  1.357   10.609  1.00 43.17  ? 1859 HOH A O   1 
HETATM 8620 O O   . HOH H 5 .   ? 35.928  19.677  4.400   1.00 50.88  ? 1860 HOH A O   1 
HETATM 8621 O O   . HOH H 5 .   ? 14.328  23.699  35.131  1.00 63.58  ? 1861 HOH A O   1 
HETATM 8622 O O   . HOH H 5 .   ? 26.108  29.224  -15.125 1.00 50.41  ? 1862 HOH A O   1 
HETATM 8623 O O   . HOH H 5 .   ? 18.002  23.939  0.590   1.00 44.87  ? 1863 HOH A O   1 
HETATM 8624 O O   . HOH H 5 .   ? 57.161  3.252   16.424  1.00 57.45  ? 1864 HOH A O   1 
HETATM 8625 O O   . HOH H 5 .   ? 26.846  5.685   0.601   1.00 56.07  ? 1865 HOH A O   1 
HETATM 8626 O O   . HOH H 5 .   ? 20.795  33.242  10.105  1.00 48.18  ? 1866 HOH A O   1 
HETATM 8627 O O   . HOH H 5 .   ? 29.973  15.576  12.845  1.00 46.92  ? 1867 HOH A O   1 
HETATM 8628 O O   . HOH H 5 .   ? 34.140  5.070   6.500   1.00 46.59  ? 1868 HOH A O   1 
HETATM 8629 O O   . HOH H 5 .   ? 32.001  6.659   0.152   1.00 63.56  ? 1869 HOH A O   1 
HETATM 8630 O O   . HOH H 5 .   ? 34.135  1.918   4.429   1.00 56.38  ? 1870 HOH A O   1 
HETATM 8631 O O   . HOH H 5 .   ? 40.891  16.932  12.439  1.00 48.70  ? 1871 HOH A O   1 
HETATM 8632 O O   . HOH H 5 .   ? 51.001  3.200   4.985   1.00 65.46  ? 1872 HOH A O   1 
HETATM 8633 O O   . HOH H 5 .   ? 48.532  25.474  23.342  1.00 48.66  ? 1873 HOH A O   1 
HETATM 8634 O O   . HOH H 5 .   ? 41.248  19.904  35.476  1.00 60.75  ? 1874 HOH A O   1 
HETATM 8635 O O   . HOH H 5 .   ? 42.958  17.502  23.686  1.00 49.31  ? 1875 HOH A O   1 
HETATM 8636 O O   . HOH H 5 .   ? 24.797  1.423   47.537  1.00 53.89  ? 1876 HOH A O   1 
HETATM 8637 O O   . HOH H 5 .   ? 39.800  8.926   2.655   1.00 46.35  ? 1877 HOH A O   1 
HETATM 8638 O O   . HOH H 5 .   ? 39.487  29.873  7.290   1.00 69.47  ? 1878 HOH A O   1 
HETATM 8639 O O   . HOH H 5 .   ? 43.516  21.505  3.114   1.00 60.24  ? 1879 HOH A O   1 
HETATM 8640 O O   . HOH H 5 .   ? 16.461  -3.086  29.698  1.00 51.57  ? 1880 HOH A O   1 
HETATM 8641 O O   . HOH H 5 .   ? 42.259  13.660  35.905  1.00 54.53  ? 1881 HOH A O   1 
HETATM 8642 O O   . HOH H 5 .   ? 33.229  1.598   44.031  1.00 44.95  ? 1882 HOH A O   1 
HETATM 8643 O O   . HOH H 5 .   ? 45.399  10.692  38.227  1.00 56.44  ? 1883 HOH A O   1 
HETATM 8644 O O   . HOH H 5 .   ? 15.452  -7.773  6.361   1.00 62.44  ? 1884 HOH A O   1 
HETATM 8645 O O   . HOH H 5 .   ? 15.091  -5.106  11.199  1.00 46.90  ? 1885 HOH A O   1 
HETATM 8646 O O   . HOH H 5 .   ? 18.887  18.325  51.837  1.00 57.01  ? 1886 HOH A O   1 
HETATM 8647 O O   . HOH H 5 .   ? 36.725  3.528   45.956  1.00 53.23  ? 1887 HOH A O   1 
HETATM 8648 O O   . HOH H 5 .   ? 13.087  9.905   41.811  1.00 55.67  ? 1888 HOH A O   1 
HETATM 8649 O O   . HOH H 5 .   ? 58.920  4.276   10.258  1.00 61.40  ? 1889 HOH A O   1 
HETATM 8650 O O   . HOH H 5 .   ? 9.171   30.546  14.097  1.00 63.78  ? 1890 HOH A O   1 
HETATM 8651 O O   . HOH H 5 .   ? 15.352  32.866  6.349   1.00 58.58  ? 1891 HOH A O   1 
HETATM 8652 O O   . HOH H 5 .   ? 20.465  22.548  28.538  1.00 56.69  ? 1892 HOH A O   1 
HETATM 8653 O O   . HOH H 5 .   ? 50.416  2.010   21.646  1.00 54.75  ? 1893 HOH A O   1 
HETATM 8654 O O   . HOH H 5 .   ? 41.799  28.271  21.078  1.00 54.60  ? 1894 HOH A O   1 
HETATM 8655 O O   . HOH H 5 .   ? 25.691  4.614   45.928  1.00 52.61  ? 1895 HOH A O   1 
HETATM 8656 O O   . HOH H 5 .   ? 43.771  0.750   41.331  1.00 50.36  ? 1896 HOH A O   1 
HETATM 8657 O O   . HOH H 5 .   ? 40.402  5.967   46.190  1.00 59.77  ? 1897 HOH A O   1 
HETATM 8658 O O   . HOH H 5 .   ? 36.005  9.745   0.694   1.00 51.87  ? 1898 HOH A O   1 
HETATM 8659 O O   . HOH H 5 .   ? 35.366  -3.299  31.011  1.00 60.51  ? 1899 HOH A O   1 
HETATM 8660 O O   . HOH H 5 .   ? 9.699   29.740  19.365  1.00 55.14  ? 1900 HOH A O   1 
HETATM 8661 O O   . HOH H 5 .   ? 15.405  29.411  22.514  1.00 61.64  ? 1901 HOH A O   1 
HETATM 8662 O O   . HOH H 5 .   ? 22.967  3.664   47.242  1.00 49.54  ? 1902 HOH A O   1 
HETATM 8663 O O   . HOH H 5 .   ? 46.504  21.347  27.693  1.00 49.35  ? 1903 HOH A O   1 
HETATM 8664 O O   . HOH H 5 .   ? 35.830  32.683  20.751  1.00 55.76  ? 1904 HOH A O   1 
HETATM 8665 O O   . HOH H 5 .   ? 33.832  31.090  20.243  1.00 56.64  ? 1905 HOH A O   1 
HETATM 8666 O O   . HOH H 5 .   ? 47.217  8.417   27.142  1.00 58.15  ? 1906 HOH A O   1 
HETATM 8667 O O   . HOH H 5 .   ? 30.534  25.341  -15.412 1.00 57.94  ? 1907 HOH A O   1 
HETATM 8668 O O   . HOH H 5 .   ? 34.861  23.523  -7.716  1.00 58.92  ? 1908 HOH A O   1 
HETATM 8669 O O   . HOH H 5 .   ? 12.321  12.873  2.664   1.00 61.25  ? 1909 HOH A O   1 
HETATM 8670 O O   . HOH H 5 .   ? 32.820  -5.688  30.617  1.00 56.65  ? 1910 HOH A O   1 
HETATM 8671 O O   . HOH H 5 .   ? 36.406  27.486  25.657  1.00 45.28  ? 1911 HOH A O   1 
HETATM 8672 O O   . HOH H 5 .   ? 34.924  24.069  -10.220 1.00 57.00  ? 1912 HOH A O   1 
HETATM 8673 O O   . HOH H 5 .   ? 1.392   5.635   8.224   1.00 62.86  ? 1913 HOH A O   1 
HETATM 8674 O O   . HOH H 5 .   ? 53.251  -1.441  19.221  1.00 67.90  ? 1914 HOH A O   1 
HETATM 8675 O O   . HOH H 5 .   ? 43.174  -0.464  19.124  1.00 53.32  ? 1915 HOH A O   1 
HETATM 8676 O O   . HOH I 5 .   ? 3.454   7.535   -33.074 1.00 36.25  ? 953  HOH B O   1 
HETATM 8677 O O   . HOH I 5 .   ? 4.145   4.010   -33.876 1.00 41.81  ? 954  HOH B O   1 
HETATM 8678 O O   . HOH I 5 .   ? 13.773  6.542   -33.653 1.00 42.32  ? 955  HOH B O   1 
HETATM 8679 O O   . HOH I 5 .   ? 13.677  -7.893  -46.327 1.00 39.14  ? 956  HOH B O   1 
HETATM 8680 O O   . HOH I 5 .   ? 12.974  15.155  -22.825 1.00 41.89  ? 957  HOH B O   1 
HETATM 8681 O O   . HOH I 5 .   ? 6.163   16.542  -53.785 1.00 44.80  ? 958  HOH B O   1 
HETATM 8682 O O   . HOH I 5 .   ? 10.765  0.007   -43.931 1.00 39.30  ? 959  HOH B O   1 
HETATM 8683 O O   . HOH I 5 .   ? 4.578   2.120   -40.810 1.00 43.19  ? 960  HOH B O   1 
HETATM 8684 O O   . HOH I 5 .   ? 6.685   24.126  -25.106 1.00 38.50  ? 961  HOH B O   1 
HETATM 8685 O O   . HOH I 5 .   ? -0.935  3.744   -48.667 1.00 43.97  ? 962  HOH B O   1 
HETATM 8686 O O   . HOH I 5 .   ? 8.307   24.931  -31.713 1.00 42.89  ? 963  HOH B O   1 
HETATM 8687 O O   . HOH I 5 .   ? 10.051  -6.129  -64.387 1.00 40.59  ? 964  HOH B O   1 
HETATM 8688 O O   . HOH I 5 .   ? 0.279   19.480  -47.252 1.00 42.33  ? 965  HOH B O   1 
HETATM 8689 O O   . HOH I 5 .   ? 16.785  -3.041  -42.977 1.00 51.07  ? 966  HOH B O   1 
HETATM 8690 O O   . HOH I 5 .   ? 22.703  1.222   -36.564 1.00 49.04  ? 967  HOH B O   1 
HETATM 8691 O O   . HOH I 5 .   ? 5.661   -2.083  -29.270 1.00 44.41  ? 968  HOH B O   1 
HETATM 8692 O O   . HOH I 5 .   ? 17.660  -2.830  -56.038 1.00 44.43  ? 969  HOH B O   1 
HETATM 8693 O O   . HOH I 5 .   ? 25.464  -2.758  -46.867 1.00 46.63  ? 970  HOH B O   1 
HETATM 8694 O O   . HOH I 5 .   ? 4.770   -13.331 -53.446 1.00 56.88  ? 971  HOH B O   1 
HETATM 8695 O O   . HOH I 5 .   ? 17.178  -8.500  -48.602 1.00 44.73  ? 972  HOH B O   1 
HETATM 8696 O O   . HOH I 5 .   ? 6.920   4.379   -25.031 1.00 44.77  ? 973  HOH B O   1 
HETATM 8697 O O   . HOH I 5 .   ? 11.432  17.011  -23.211 1.00 43.72  ? 974  HOH B O   1 
HETATM 8698 O O   . HOH I 5 .   ? 17.532  5.421   -34.958 1.00 41.62  ? 975  HOH B O   1 
HETATM 8699 O O   . HOH I 5 .   ? 4.696   4.593   -48.404 1.00 39.06  ? 976  HOH B O   1 
HETATM 8700 O O   . HOH I 5 .   ? 5.635   14.857  -18.753 1.00 42.26  ? 977  HOH B O   1 
HETATM 8701 O O   . HOH I 5 .   ? 16.763  -8.169  -60.276 1.00 49.53  ? 978  HOH B O   1 
HETATM 8702 O O   . HOH I 5 .   ? 4.649   -3.875  -42.619 1.00 44.98  ? 979  HOH B O   1 
HETATM 8703 O O   . HOH I 5 .   ? 22.277  16.990  -48.348 1.00 61.52  ? 980  HOH B O   1 
HETATM 8704 O O   . HOH I 5 .   ? -3.303  0.999   -48.428 1.00 49.33  ? 981  HOH B O   1 
HETATM 8705 O O   . HOH I 5 .   ? -6.453  13.519  -26.353 1.00 43.82  ? 982  HOH B O   1 
HETATM 8706 O O   . HOH I 5 .   ? 19.607  -0.983  -37.722 1.00 43.77  ? 983  HOH B O   1 
HETATM 8707 O O   . HOH I 5 .   ? 7.823   0.839   -24.126 1.00 49.91  ? 984  HOH B O   1 
HETATM 8708 O O   . HOH I 5 .   ? -3.924  1.315   -30.338 1.00 49.76  ? 985  HOH B O   1 
HETATM 8709 O O   . HOH I 5 .   ? 1.606   -0.244  -52.860 1.00 43.19  ? 986  HOH B O   1 
HETATM 8710 O O   . HOH I 5 .   ? 11.208  12.913  -16.066 1.00 46.13  ? 987  HOH B O   1 
HETATM 8711 O O   . HOH I 5 .   ? 4.860   8.132   -64.150 1.00 44.59  ? 988  HOH B O   1 
HETATM 8712 O O   . HOH I 5 .   ? 22.132  2.072   -47.749 1.00 42.64  ? 989  HOH B O   1 
HETATM 8713 O O   . HOH I 5 .   ? 8.928   -1.194  -60.766 1.00 44.83  ? 990  HOH B O   1 
HETATM 8714 O O   . HOH I 5 .   ? 15.881  -4.618  -57.021 1.00 41.75  ? 991  HOH B O   1 
HETATM 8715 O O   . HOH I 5 .   ? 18.984  6.537   -27.287 1.00 51.09  ? 992  HOH B O   1 
HETATM 8716 O O   . HOH I 5 .   ? 1.971   -2.770  -53.079 1.00 44.24  ? 993  HOH B O   1 
HETATM 8717 O O   . HOH I 5 .   ? 24.445  -2.238  -44.353 1.00 50.57  ? 994  HOH B O   1 
HETATM 8718 O O   . HOH I 5 .   ? 6.927   -2.536  -50.708 1.00 45.49  ? 995  HOH B O   1 
HETATM 8719 O O   . HOH I 5 .   ? 7.077   -0.121  -19.736 1.00 54.17  ? 996  HOH B O   1 
HETATM 8720 O O   . HOH I 5 .   ? 20.947  7.204   -37.047 1.00 44.77  ? 997  HOH B O   1 
HETATM 8721 O O   . HOH I 5 .   ? 12.722  26.465  -28.262 1.00 51.09  ? 998  HOH B O   1 
HETATM 8722 O O   . HOH I 5 .   ? 12.292  27.545  -25.921 1.00 61.59  ? 999  HOH B O   1 
HETATM 8723 O O   . HOH I 5 .   ? -5.375  -2.640  -48.579 1.00 42.20  ? 1000 HOH B O   1 
HETATM 8724 O O   . HOH I 5 .   ? -3.081  -5.528  -44.810 1.00 52.43  ? 1001 HOH B O   1 
HETATM 8725 O O   . HOH I 5 .   ? 23.583  1.478   -32.250 1.00 60.52  ? 1002 HOH B O   1 
HETATM 8726 O O   . HOH I 5 .   ? 23.322  -5.743  -33.729 1.00 55.72  ? 1003 HOH B O   1 
HETATM 8727 O O   . HOH I 5 .   ? 22.014  6.722   -30.656 1.00 59.59  ? 1004 HOH B O   1 
HETATM 8728 O O   . HOH I 5 .   ? 5.471   -1.605  -22.089 1.00 49.82  ? 1005 HOH B O   1 
HETATM 8729 O O   . HOH I 5 .   ? 9.292   3.415   -24.168 1.00 47.88  ? 1006 HOH B O   1 
HETATM 8730 O O   . HOH I 5 .   ? 13.275  -4.089  -56.042 1.00 43.73  ? 1007 HOH B O   1 
HETATM 8731 O O   . HOH I 5 .   ? 23.180  0.787   -53.554 1.00 50.28  ? 1008 HOH B O   1 
HETATM 8732 O O   . HOH I 5 .   ? -1.213  -7.501  -44.660 1.00 48.85  ? 1009 HOH B O   1 
HETATM 8733 O O   . HOH I 5 .   ? 2.847   -12.227 -46.733 1.00 52.73  ? 1010 HOH B O   1 
HETATM 8734 O O   . HOH I 5 .   ? 2.991   -11.879 -51.168 1.00 64.22  ? 1011 HOH B O   1 
HETATM 8735 O O   . HOH I 5 .   ? 0.370   -12.510 -50.551 1.00 69.75  ? 1012 HOH B O   1 
HETATM 8736 O O   . HOH I 5 .   ? 22.196  9.931   -33.463 1.00 59.08  ? 1013 HOH B O   1 
HETATM 8737 O O   . HOH I 5 .   ? 22.503  15.528  -50.321 1.00 52.85  ? 1014 HOH B O   1 
HETATM 8738 O O   . HOH I 5 .   ? -8.320  7.128   -23.298 1.00 57.58  ? 1015 HOH B O   1 
HETATM 8739 O O   . HOH I 5 .   ? 4.134   10.435  -65.179 1.00 47.57  ? 1016 HOH B O   1 
HETATM 8740 O O   . HOH I 5 .   ? 1.615   19.137  -60.066 1.00 49.74  ? 1017 HOH B O   1 
HETATM 8741 O O   . HOH I 5 .   ? 2.022   21.355  -61.270 1.00 55.31  ? 1018 HOH B O   1 
HETATM 8742 O O   . HOH I 5 .   ? -8.438  -0.511  -45.157 1.00 57.09  ? 1019 HOH B O   1 
HETATM 8743 O O   . HOH I 5 .   ? 1.454   -0.845  -64.032 1.00 61.63  ? 1020 HOH B O   1 
HETATM 8744 O O   . HOH I 5 .   ? -1.640  -10.961 -45.412 1.00 58.83  ? 1021 HOH B O   1 
HETATM 8745 O O   . HOH I 5 .   ? 16.459  0.664   -65.970 1.00 69.48  ? 1022 HOH B O   1 
HETATM 8746 O O   . HOH I 5 .   ? -9.698  -2.804  -47.843 1.00 63.52  ? 1023 HOH B O   1 
HETATM 8747 O O   . HOH I 5 .   ? 24.211  -1.540  -31.813 1.00 59.39  ? 1024 HOH B O   1 
HETATM 8748 O O   . HOH I 5 .   ? 0.864   16.650  -65.650 1.00 54.66  ? 1025 HOH B O   1 
HETATM 8749 O O   . HOH I 5 .   ? 11.320  21.576  -47.012 1.00 51.60  ? 1026 HOH B O   1 
HETATM 8750 O O   . HOH I 5 .   ? -6.525  13.957  -19.165 1.00 63.03  ? 1027 HOH B O   1 
HETATM 8751 O O   . HOH I 5 .   ? -7.959  -1.854  -52.870 1.00 61.12  ? 1028 HOH B O   1 
HETATM 8752 O O   . HOH I 5 .   ? 32.698  6.533   -42.860 1.00 52.02  ? 1029 HOH B O   1 
HETATM 8753 O O   . HOH I 5 .   ? -2.476  0.684   -36.704 1.00 47.58  ? 1030 HOH B O   1 
HETATM 8754 O O   . HOH I 5 .   ? 17.580  -5.349  -43.965 1.00 49.47  ? 1031 HOH B O   1 
HETATM 8755 O O   . HOH I 5 .   ? 7.274   -8.460  -44.642 1.00 55.23  ? 1032 HOH B O   1 
HETATM 8756 O O   . HOH I 5 .   ? 10.421  -13.701 -48.819 1.00 55.36  ? 1033 HOH B O   1 
HETATM 8757 O O   . HOH I 5 .   ? 4.988   8.912   -20.624 1.00 49.08  ? 1034 HOH B O   1 
HETATM 8758 O O   . HOH I 5 .   ? -1.380  26.553  -29.832 1.00 46.06  ? 1035 HOH B O   1 
HETATM 8759 O O   . HOH I 5 .   ? 7.375   27.877  -31.206 1.00 58.07  ? 1036 HOH B O   1 
HETATM 8760 O O   . HOH I 5 .   ? -0.777  7.119   -72.624 1.00 42.64  ? 1037 HOH B O   1 
HETATM 8761 O O   . HOH I 5 .   ? -2.444  0.719   -22.451 1.00 55.59  ? 1038 HOH B O   1 
HETATM 8762 O O   . HOH I 5 .   ? 11.934  10.676  -17.050 1.00 46.72  ? 1039 HOH B O   1 
HETATM 8763 O O   . HOH I 5 .   ? -7.836  5.091   -23.992 1.00 55.92  ? 1040 HOH B O   1 
HETATM 8764 O O   . HOH I 5 .   ? 6.470   12.454  -64.356 1.00 61.47  ? 1041 HOH B O   1 
HETATM 8765 O O   . HOH I 5 .   ? -3.755  20.867  -20.295 1.00 43.42  ? 1042 HOH B O   1 
HETATM 8766 O O   . HOH I 5 .   ? 23.953  -8.590  -27.259 1.00 62.52  ? 1043 HOH B O   1 
HETATM 8767 O O   . HOH I 5 .   ? -7.371  7.437   -44.884 1.00 43.98  ? 1044 HOH B O   1 
HETATM 8768 O O   . HOH I 5 .   ? 0.269   16.197  -68.135 1.00 63.30  ? 1045 HOH B O   1 
HETATM 8769 O O   . HOH I 5 .   ? -3.987  -6.610  -33.651 1.00 57.94  ? 1046 HOH B O   1 
HETATM 8770 O O   . HOH I 5 .   ? 10.067  5.002   -9.943  1.00 64.20  ? 1047 HOH B O   1 
HETATM 8771 O O   . HOH I 5 .   ? 12.739  3.863   -12.607 1.00 61.91  ? 1048 HOH B O   1 
HETATM 8772 O O   . HOH I 5 .   ? 21.288  16.414  -26.111 1.00 64.72  ? 1049 HOH B O   1 
HETATM 8773 O O   . HOH I 5 .   ? -5.805  -0.102  -48.715 1.00 53.85  ? 1050 HOH B O   1 
HETATM 8774 O O   . HOH I 5 .   ? 27.424  1.804   -37.810 1.00 48.23  ? 1051 HOH B O   1 
HETATM 8775 O O   . HOH I 5 .   ? 17.290  1.270   -60.717 1.00 46.36  ? 1052 HOH B O   1 
HETATM 8776 O O   . HOH I 5 .   ? 15.037  2.237   -62.244 1.00 43.31  ? 1053 HOH B O   1 
HETATM 8777 O O   . HOH I 5 .   ? 22.594  15.632  -46.121 1.00 53.27  ? 1054 HOH B O   1 
HETATM 8778 O O   . HOH I 5 .   ? 22.557  9.896   -53.153 1.00 57.29  ? 1055 HOH B O   1 
HETATM 8779 O O   . HOH I 5 .   ? -5.962  -3.798  -55.371 1.00 56.66  ? 1056 HOH B O   1 
HETATM 8780 O O   . HOH I 5 .   ? 15.693  9.817   -56.769 1.00 47.38  ? 1057 HOH B O   1 
HETATM 8781 O O   . HOH I 5 .   ? 4.961   -2.229  -13.595 1.00 61.81  ? 1058 HOH B O   1 
HETATM 8782 O O   . HOH I 5 .   ? 32.917  4.427   -41.603 1.00 50.96  ? 1059 HOH B O   1 
HETATM 8783 O O   . HOH I 5 .   ? 34.430  -2.124  -43.534 1.00 57.25  ? 1060 HOH B O   1 
HETATM 8784 O O   . HOH I 5 .   ? -1.012  6.704   -76.902 1.00 54.82  ? 1061 HOH B O   1 
HETATM 8785 O O   . HOH I 5 .   ? 12.787  -4.749  -51.725 1.00 46.01  ? 1062 HOH B O   1 
HETATM 8786 O O   . HOH I 5 .   ? 12.581  -5.344  -54.430 1.00 47.98  ? 1063 HOH B O   1 
HETATM 8787 O O   . HOH I 5 .   ? 4.654   -0.991  -43.341 1.00 49.93  ? 1064 HOH B O   1 
HETATM 8788 O O   . HOH I 5 .   ? 3.920   20.176  -28.435 1.00 43.53  ? 1065 HOH B O   1 
HETATM 8789 O O   . HOH I 5 .   ? -8.106  1.803   -50.781 1.00 65.12  ? 1066 HOH B O   1 
HETATM 8790 O O   . HOH I 5 .   ? 11.515  26.913  -32.636 1.00 57.54  ? 1067 HOH B O   1 
HETATM 8791 O O   . HOH I 5 .   ? 23.522  -3.134  -34.875 1.00 62.59  ? 1068 HOH B O   1 
HETATM 8792 O O   . HOH I 5 .   ? 24.754  5.411   -34.635 1.00 64.33  ? 1069 HOH B O   1 
HETATM 8793 O O   . HOH I 5 .   ? 23.142  10.099  -35.877 1.00 59.11  ? 1070 HOH B O   1 
HETATM 8794 O O   . HOH I 5 .   ? 25.556  0.744   -36.327 1.00 49.59  ? 1071 HOH B O   1 
HETATM 8795 O O   . HOH I 5 .   ? -5.167  -3.805  -35.054 1.00 65.28  ? 1072 HOH B O   1 
HETATM 8796 O O   . HOH I 5 .   ? 0.343   0.064   -55.631 1.00 47.65  ? 1073 HOH B O   1 
HETATM 8797 O O   . HOH I 5 .   ? -4.992  26.725  -24.881 1.00 55.31  ? 1074 HOH B O   1 
HETATM 8798 O O   . HOH I 5 .   ? 24.135  18.303  -20.905 1.00 62.84  ? 1075 HOH B O   1 
HETATM 8799 O O   . HOH I 5 .   ? -0.131  26.953  -51.919 1.00 62.68  ? 1076 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -30 ?   ?   ?   A . n 
A 1 2   ARG 2   -29 ?   ?   ?   A . n 
A 1 3   PRO 3   -28 ?   ?   ?   A . n 
A 1 4   PRO 4   -27 ?   ?   ?   A . n 
A 1 5   TRP 5   -26 ?   ?   ?   A . n 
A 1 6   TYR 6   -25 ?   ?   ?   A . n 
A 1 7   PRO 7   -24 ?   ?   ?   A . n 
A 1 8   LEU 8   -23 ?   ?   ?   A . n 
A 1 9   HIS 9   -22 ?   ?   ?   A . n 
A 1 10  THR 10  -21 ?   ?   ?   A . n 
A 1 11  PRO 11  -20 ?   ?   ?   A . n 
A 1 12  SER 12  -19 ?   ?   ?   A . n 
A 1 13  LEU 13  -18 ?   ?   ?   A . n 
A 1 14  ALA 14  -17 ?   ?   ?   A . n 
A 1 15  PHE 15  -16 ?   ?   ?   A . n 
A 1 16  PRO 16  -15 ?   ?   ?   A . n 
A 1 17  LEU 17  -14 ?   ?   ?   A . n 
A 1 18  LEU 18  -13 ?   ?   ?   A . n 
A 1 19  PHE 19  -12 ?   ?   ?   A . n 
A 1 20  LEU 20  -11 ?   ?   ?   A . n 
A 1 21  LEU 21  -10 ?   ?   ?   A . n 
A 1 22  LEU 22  -9  ?   ?   ?   A . n 
A 1 23  SER 23  -8  ?   ?   ?   A . n 
A 1 24  LEU 24  -7  ?   ?   ?   A . n 
A 1 25  LEU 25  -6  ?   ?   ?   A . n 
A 1 26  GLY 26  -5  ?   ?   ?   A . n 
A 1 27  GLY 27  -4  ?   ?   ?   A . n 
A 1 28  GLY 28  -3  ?   ?   ?   A . n 
A 1 29  ALA 29  -2  ?   ?   ?   A . n 
A 1 30  ARG 30  -1  ?   ?   ?   A . n 
A 1 31  ALA 31  0   ?   ?   ?   A . n 
A 1 32  GLU 32  1   1   GLU GLU A . n 
A 1 33  GLY 33  2   2   GLY GLY A . n 
A 1 34  ARG 34  3   3   ARG ARG A . n 
A 1 35  GLU 35  4   4   GLU GLU A . n 
A 1 36  ASP 36  5   5   ASP ASP A . n 
A 1 37  PRO 37  6   6   PRO PRO A . n 
A 1 38  GLN 38  7   7   GLN GLN A . n 
A 1 39  LEU 39  8   8   LEU LEU A . n 
A 1 40  LEU 40  9   9   LEU LEU A . n 
A 1 41  VAL 41  10  10  VAL VAL A . n 
A 1 42  ARG 42  11  11  ARG ARG A . n 
A 1 43  VAL 43  12  12  VAL VAL A . n 
A 1 44  ARG 44  13  13  ARG ARG A . n 
A 1 45  GLY 45  14  14  GLY GLY A . n 
A 1 46  GLY 46  15  15  GLY GLY A . n 
A 1 47  GLN 47  16  16  GLN GLN A . n 
A 1 48  LEU 48  17  17  LEU LEU A . n 
A 1 49  ARG 49  18  18  ARG ARG A . n 
A 1 50  GLY 50  19  19  GLY GLY A . n 
A 1 51  ILE 51  20  20  ILE ILE A . n 
A 1 52  ARG 52  21  21  ARG ARG A . n 
A 1 53  LEU 53  22  22  LEU LEU A . n 
A 1 54  LYS 54  23  23  LYS LYS A . n 
A 1 55  ALA 55  24  24  ALA ALA A . n 
A 1 56  PRO 56  25  25  PRO PRO A . n 
A 1 57  GLY 57  26  26  GLY GLY A . n 
A 1 58  GLY 58  27  27  GLY GLY A . n 
A 1 59  PRO 59  28  28  PRO PRO A . n 
A 1 60  VAL 60  29  29  VAL VAL A . n 
A 1 61  SER 61  30  30  SER SER A . n 
A 1 62  ALA 62  31  31  ALA ALA A . n 
A 1 63  PHE 63  32  32  PHE PHE A . n 
A 1 64  LEU 64  33  33  LEU LEU A . n 
A 1 65  GLY 65  34  34  GLY GLY A . n 
A 1 66  ILE 66  35  35  ILE ILE A . n 
A 1 67  PRO 67  36  36  PRO PRO A . n 
A 1 68  PHE 68  37  37  PHE PHE A . n 
A 1 69  ALA 69  38  38  ALA ALA A . n 
A 1 70  GLU 70  39  39  GLU GLU A . n 
A 1 71  PRO 71  40  40  PRO PRO A . n 
A 1 72  PRO 72  41  41  PRO PRO A . n 
A 1 73  VAL 73  42  42  VAL VAL A . n 
A 1 74  GLY 74  43  43  GLY GLY A . n 
A 1 75  SER 75  44  44  SER SER A . n 
A 1 76  ARG 76  45  45  ARG ARG A . n 
A 1 77  ARG 77  46  46  ARG ARG A . n 
A 1 78  PHE 78  47  47  PHE PHE A . n 
A 1 79  MET 79  48  48  MET MET A . n 
A 1 80  PRO 80  49  49  PRO PRO A . n 
A 1 81  PRO 81  50  50  PRO PRO A . n 
A 1 82  GLU 82  51  51  GLU GLU A . n 
A 1 83  PRO 83  52  52  PRO PRO A . n 
A 1 84  LYS 84  53  53  LYS LYS A . n 
A 1 85  ARG 85  54  54  ARG ARG A . n 
A 1 86  PRO 86  55  55  PRO PRO A . n 
A 1 87  TRP 87  56  56  TRP TRP A . n 
A 1 88  SER 88  57  57  SER SER A . n 
A 1 89  GLY 89  58  58  GLY GLY A . n 
A 1 90  VAL 90  59  59  VAL VAL A . n 
A 1 91  LEU 91  60  60  LEU LEU A . n 
A 1 92  ASP 92  61  61  ASP ASP A . n 
A 1 93  ALA 93  62  62  ALA ALA A . n 
A 1 94  THR 94  63  63  THR THR A . n 
A 1 95  THR 95  64  64  THR THR A . n 
A 1 96  PHE 96  65  65  PHE PHE A . n 
A 1 97  GLN 97  66  66  GLN GLN A . n 
A 1 98  ASN 98  67  67  ASN ASN A . n 
A 1 99  VAL 99  68  68  VAL VAL A . n 
A 1 100 CYS 100 69  69  CYS CYS A . n 
A 1 101 TYR 101 70  70  TYR TYR A . n 
A 1 102 GLN 102 71  71  GLN GLN A . n 
A 1 103 TYR 103 72  72  TYR TYR A . n 
A 1 104 VAL 104 73  73  VAL VAL A . n 
A 1 105 ASP 105 74  74  ASP ASP A . n 
A 1 106 THR 106 75  75  THR THR A . n 
A 1 107 LEU 107 76  76  LEU LEU A . n 
A 1 108 TYR 108 77  77  TYR TYR A . n 
A 1 109 PRO 109 78  78  PRO PRO A . n 
A 1 110 GLY 110 79  79  GLY GLY A . n 
A 1 111 PHE 111 80  80  PHE PHE A . n 
A 1 112 GLU 112 81  81  GLU GLU A . n 
A 1 113 GLY 113 82  82  GLY GLY A . n 
A 1 114 THR 114 83  83  THR THR A . n 
A 1 115 GLU 115 84  84  GLU GLU A . n 
A 1 116 MET 116 85  85  MET MET A . n 
A 1 117 TRP 117 86  86  TRP TRP A . n 
A 1 118 ASN 118 87  87  ASN ASN A . n 
A 1 119 PRO 119 88  88  PRO PRO A . n 
A 1 120 ASN 120 89  89  ASN ASN A . n 
A 1 121 ARG 121 90  90  ARG ARG A . n 
A 1 122 GLU 122 91  91  GLU GLU A . n 
A 1 123 LEU 123 92  92  LEU LEU A . n 
A 1 124 SER 124 93  93  SER SER A . n 
A 1 125 GLU 125 94  94  GLU GLU A . n 
A 1 126 ASP 126 95  95  ASP ASP A . n 
A 1 127 CYS 127 96  96  CYS CYS A . n 
A 1 128 LEU 128 97  97  LEU LEU A . n 
A 1 129 TYR 129 98  98  TYR TYR A . n 
A 1 130 LEU 130 99  99  LEU LEU A . n 
A 1 131 ASN 131 100 100 ASN ASN A . n 
A 1 132 VAL 132 101 101 VAL VAL A . n 
A 1 133 TRP 133 102 102 TRP TRP A . n 
A 1 134 THR 134 103 103 THR THR A . n 
A 1 135 PRO 135 104 104 PRO PRO A . n 
A 1 136 TYR 136 105 105 TYR TYR A . n 
A 1 137 PRO 137 106 106 PRO PRO A . n 
A 1 138 ARG 138 107 107 ARG ARG A . n 
A 1 139 PRO 139 108 108 PRO PRO A . n 
A 1 140 ALA 140 109 109 ALA ALA A . n 
A 1 141 SER 141 110 110 SER SER A . n 
A 1 142 PRO 142 111 111 PRO PRO A . n 
A 1 143 THR 143 112 112 THR THR A . n 
A 1 144 PRO 144 113 113 PRO PRO A . n 
A 1 145 VAL 145 114 114 VAL VAL A . n 
A 1 146 LEU 146 115 115 LEU LEU A . n 
A 1 147 ILE 147 116 116 ILE ILE A . n 
A 1 148 TRP 148 117 117 TRP TRP A . n 
A 1 149 ILE 149 118 118 ILE ILE A . n 
A 1 150 TYR 150 119 119 TYR TYR A . n 
A 1 151 GLY 151 120 120 GLY GLY A . n 
A 1 152 GLY 152 121 121 GLY GLY A . n 
A 1 153 GLY 153 122 122 GLY GLY A . n 
A 1 154 PHE 154 123 123 PHE PHE A . n 
A 1 155 TYR 155 124 124 TYR TYR A . n 
A 1 156 SER 156 125 125 SER SER A . n 
A 1 157 GLY 157 126 126 GLY GLY A . n 
A 1 158 ALA 158 127 127 ALA ALA A . n 
A 1 159 ALA 159 128 128 ALA ALA A . n 
A 1 160 SER 160 129 129 SER SER A . n 
A 1 161 LEU 161 130 130 LEU LEU A . n 
A 1 162 ASP 162 131 131 ASP ASP A . n 
A 1 163 VAL 163 132 132 VAL VAL A . n 
A 1 164 TYR 164 133 133 TYR TYR A . n 
A 1 165 ASP 165 134 134 ASP ASP A . n 
A 1 166 GLY 166 135 135 GLY GLY A . n 
A 1 167 ARG 167 136 136 ARG ARG A . n 
A 1 168 PHE 168 137 137 PHE PHE A . n 
A 1 169 LEU 169 138 138 LEU LEU A . n 
A 1 170 ALA 170 139 139 ALA ALA A . n 
A 1 171 GLN 171 140 140 GLN GLN A . n 
A 1 172 VAL 172 141 141 VAL VAL A . n 
A 1 173 GLU 173 142 142 GLU GLU A . n 
A 1 174 GLY 174 143 143 GLY GLY A . n 
A 1 175 ALA 175 144 144 ALA ALA A . n 
A 1 176 VAL 176 145 145 VAL VAL A . n 
A 1 177 LEU 177 146 146 LEU LEU A . n 
A 1 178 VAL 178 147 147 VAL VAL A . n 
A 1 179 SER 179 148 148 SER SER A . n 
A 1 180 MET 180 149 149 MET MET A . n 
A 1 181 ASN 181 150 150 ASN ASN A . n 
A 1 182 TYR 182 151 151 TYR TYR A . n 
A 1 183 ARG 183 152 152 ARG ARG A . n 
A 1 184 VAL 184 153 153 VAL VAL A . n 
A 1 185 GLY 185 154 154 GLY GLY A . n 
A 1 186 THR 186 155 155 THR THR A . n 
A 1 187 PHE 187 156 156 PHE PHE A . n 
A 1 188 GLY 188 157 157 GLY GLY A . n 
A 1 189 PHE 189 158 158 PHE PHE A . n 
A 1 190 LEU 190 159 159 LEU LEU A . n 
A 1 191 ALA 191 160 160 ALA ALA A . n 
A 1 192 LEU 192 161 161 LEU LEU A . n 
A 1 193 PRO 193 162 162 PRO PRO A . n 
A 1 194 GLY 194 163 163 GLY GLY A . n 
A 1 195 SER 195 164 164 SER SER A . n 
A 1 196 ARG 196 165 165 ARG ARG A . n 
A 1 197 GLU 197 166 166 GLU GLU A . n 
A 1 198 ALA 198 167 167 ALA ALA A . n 
A 1 199 PRO 199 168 168 PRO PRO A . n 
A 1 200 GLY 200 169 169 GLY GLY A . n 
A 1 201 ASN 201 170 170 ASN ASN A . n 
A 1 202 VAL 202 171 171 VAL VAL A . n 
A 1 203 GLY 203 172 172 GLY GLY A . n 
A 1 204 LEU 204 173 173 LEU LEU A . n 
A 1 205 LEU 205 174 174 LEU LEU A . n 
A 1 206 ASP 206 175 175 ASP ASP A . n 
A 1 207 GLN 207 176 176 GLN GLN A . n 
A 1 208 ARG 208 177 177 ARG ARG A . n 
A 1 209 LEU 209 178 178 LEU LEU A . n 
A 1 210 ALA 210 179 179 ALA ALA A . n 
A 1 211 LEU 211 180 180 LEU LEU A . n 
A 1 212 GLN 212 181 181 GLN GLN A . n 
A 1 213 TRP 213 182 182 TRP TRP A . n 
A 1 214 VAL 214 183 183 VAL VAL A . n 
A 1 215 GLN 215 184 184 GLN GLN A . n 
A 1 216 GLU 216 185 185 GLU GLU A . n 
A 1 217 ASN 217 186 186 ASN ASN A . n 
A 1 218 ILE 218 187 187 ILE ILE A . n 
A 1 219 ALA 219 188 188 ALA ALA A . n 
A 1 220 ALA 220 189 189 ALA ALA A . n 
A 1 221 PHE 221 190 190 PHE PHE A . n 
A 1 222 GLY 222 191 191 GLY GLY A . n 
A 1 223 GLY 223 192 192 GLY GLY A . n 
A 1 224 ASP 224 193 193 ASP ASP A . n 
A 1 225 PRO 225 194 194 PRO PRO A . n 
A 1 226 MET 226 195 195 MET MET A . n 
A 1 227 SER 227 196 196 SER SER A . n 
A 1 228 VAL 228 197 197 VAL VAL A . n 
A 1 229 THR 229 198 198 THR THR A . n 
A 1 230 LEU 230 199 199 LEU LEU A . n 
A 1 231 PHE 231 200 200 PHE PHE A . n 
A 1 232 GLY 232 201 201 GLY GLY A . n 
A 1 233 GLU 233 202 202 GLU GLU A . n 
A 1 234 SER 234 203 203 SER SER A . n 
A 1 235 ALA 235 204 204 ALA ALA A . n 
A 1 236 GLY 236 205 205 GLY GLY A . n 
A 1 237 ALA 237 206 206 ALA ALA A . n 
A 1 238 ALA 238 207 207 ALA ALA A . n 
A 1 239 SER 239 208 208 SER SER A . n 
A 1 240 VAL 240 209 209 VAL VAL A . n 
A 1 241 GLY 241 210 210 GLY GLY A . n 
A 1 242 MET 242 211 211 MET MET A . n 
A 1 243 HIS 243 212 212 HIS HIS A . n 
A 1 244 ILE 244 213 213 ILE ILE A . n 
A 1 245 LEU 245 214 214 LEU LEU A . n 
A 1 246 SER 246 215 215 SER SER A . n 
A 1 247 LEU 247 216 216 LEU LEU A . n 
A 1 248 PRO 248 217 217 PRO PRO A . n 
A 1 249 SER 249 218 218 SER SER A . n 
A 1 250 ARG 250 219 219 ARG ARG A . n 
A 1 251 SER 251 220 220 SER SER A . n 
A 1 252 LEU 252 221 221 LEU LEU A . n 
A 1 253 PHE 253 222 222 PHE PHE A . n 
A 1 254 HIS 254 223 223 HIS HIS A . n 
A 1 255 ARG 255 224 224 ARG ARG A . n 
A 1 256 ALA 256 225 225 ALA ALA A . n 
A 1 257 VAL 257 226 226 VAL VAL A . n 
A 1 258 LEU 258 227 227 LEU LEU A . n 
A 1 259 GLN 259 228 228 GLN GLN A . n 
A 1 260 SER 260 229 229 SER SER A . n 
A 1 261 GLY 261 230 230 GLY GLY A . n 
A 1 262 THR 262 231 231 THR THR A . n 
A 1 263 PRO 263 232 232 PRO PRO A . n 
A 1 264 ASN 264 233 233 ASN ASN A . n 
A 1 265 GLY 265 234 234 GLY GLY A . n 
A 1 266 PRO 266 235 235 PRO PRO A . n 
A 1 267 TRP 267 236 236 TRP TRP A . n 
A 1 268 ALA 268 237 237 ALA ALA A . n 
A 1 269 THR 269 238 238 THR THR A . n 
A 1 270 VAL 270 239 239 VAL VAL A . n 
A 1 271 SER 271 240 240 SER SER A . n 
A 1 272 ALA 272 241 241 ALA ALA A . n 
A 1 273 GLY 273 242 242 GLY GLY A . n 
A 1 274 GLU 274 243 243 GLU GLU A . n 
A 1 275 ALA 275 244 244 ALA ALA A . n 
A 1 276 ARG 276 245 245 ARG ARG A . n 
A 1 277 ARG 277 246 246 ARG ARG A . n 
A 1 278 ARG 278 247 247 ARG ARG A . n 
A 1 279 ALA 279 248 248 ALA ALA A . n 
A 1 280 THR 280 249 249 THR THR A . n 
A 1 281 LEU 281 250 250 LEU LEU A . n 
A 1 282 LEU 282 251 251 LEU LEU A . n 
A 1 283 ALA 283 252 252 ALA ALA A . n 
A 1 284 ARG 284 253 253 ARG ARG A . n 
A 1 285 LEU 285 254 254 LEU LEU A . n 
A 1 286 VAL 286 255 255 VAL VAL A . n 
A 1 287 GLY 287 256 256 GLY GLY A . n 
A 1 288 CYS 288 257 257 CYS CYS A . n 
A 1 289 PRO 289 258 258 PRO PRO A . n 
A 1 290 PRO 290 259 ?   ?   ?   A . n 
A 1 291 GLY 291 260 ?   ?   ?   A . n 
A 1 292 GLY 292 261 ?   ?   ?   A . n 
A 1 293 ALA 293 262 ?   ?   ?   A . n 
A 1 294 GLY 294 263 ?   ?   ?   A . n 
A 1 295 GLY 295 264 264 GLY GLY A . n 
A 1 296 ASN 296 265 265 ASN ASN A . n 
A 1 297 ASP 297 266 266 ASP ASP A . n 
A 1 298 THR 298 267 267 THR THR A . n 
A 1 299 GLU 299 268 268 GLU GLU A . n 
A 1 300 LEU 300 269 269 LEU LEU A . n 
A 1 301 ILE 301 270 270 ILE ILE A . n 
A 1 302 ALA 302 271 271 ALA ALA A . n 
A 1 303 CYS 303 272 272 CYS CYS A . n 
A 1 304 LEU 304 273 273 LEU LEU A . n 
A 1 305 ARG 305 274 274 ARG ARG A . n 
A 1 306 THR 306 275 275 THR THR A . n 
A 1 307 ARG 307 276 276 ARG ARG A . n 
A 1 308 PRO 308 277 277 PRO PRO A . n 
A 1 309 ALA 309 278 278 ALA ALA A . n 
A 1 310 GLN 310 279 279 GLN GLN A . n 
A 1 311 ASP 311 280 280 ASP ASP A . n 
A 1 312 LEU 312 281 281 LEU LEU A . n 
A 1 313 VAL 313 282 282 VAL VAL A . n 
A 1 314 ASP 314 283 283 ASP ASP A . n 
A 1 315 HIS 315 284 284 HIS HIS A . n 
A 1 316 GLU 316 285 285 GLU GLU A . n 
A 1 317 TRP 317 286 286 TRP TRP A . n 
A 1 318 HIS 318 287 287 HIS HIS A . n 
A 1 319 VAL 319 288 288 VAL VAL A . n 
A 1 320 LEU 320 289 289 LEU LEU A . n 
A 1 321 PRO 321 290 290 PRO PRO A . n 
A 1 322 GLN 322 291 291 GLN GLN A . n 
A 1 323 GLU 323 292 292 GLU GLU A . n 
A 1 324 SER 324 293 293 SER SER A . n 
A 1 325 ILE 325 294 294 ILE ILE A . n 
A 1 326 PHE 326 295 295 PHE PHE A . n 
A 1 327 ARG 327 296 296 ARG ARG A . n 
A 1 328 PHE 328 297 297 PHE PHE A . n 
A 1 329 SER 329 298 298 SER SER A . n 
A 1 330 PHE 330 299 299 PHE PHE A . n 
A 1 331 VAL 331 300 300 VAL VAL A . n 
A 1 332 PRO 332 301 301 PRO PRO A . n 
A 1 333 VAL 333 302 302 VAL VAL A . n 
A 1 334 VAL 334 303 303 VAL VAL A . n 
A 1 335 ASP 335 304 304 ASP ASP A . n 
A 1 336 GLY 336 305 305 GLY GLY A . n 
A 1 337 ASP 337 306 306 ASP ASP A . n 
A 1 338 PHE 338 307 307 PHE PHE A . n 
A 1 339 LEU 339 308 308 LEU LEU A . n 
A 1 340 SER 340 309 309 SER SER A . n 
A 1 341 ASP 341 310 310 ASP ASP A . n 
A 1 342 THR 342 311 311 THR THR A . n 
A 1 343 PRO 343 312 312 PRO PRO A . n 
A 1 344 GLU 344 313 313 GLU GLU A . n 
A 1 345 ALA 345 314 314 ALA ALA A . n 
A 1 346 LEU 346 315 315 LEU LEU A . n 
A 1 347 ILE 347 316 316 ILE ILE A . n 
A 1 348 ASN 348 317 317 ASN ASN A . n 
A 1 349 THR 349 318 318 THR THR A . n 
A 1 350 GLY 350 319 319 GLY GLY A . n 
A 1 351 ASP 351 320 320 ASP ASP A . n 
A 1 352 PHE 352 321 321 PHE PHE A . n 
A 1 353 GLN 353 322 322 GLN GLN A . n 
A 1 354 ASP 354 323 323 ASP ASP A . n 
A 1 355 LEU 355 324 324 LEU LEU A . n 
A 1 356 GLN 356 325 325 GLN GLN A . n 
A 1 357 VAL 357 326 326 VAL VAL A . n 
A 1 358 LEU 358 327 327 LEU LEU A . n 
A 1 359 VAL 359 328 328 VAL VAL A . n 
A 1 360 GLY 360 329 329 GLY GLY A . n 
A 1 361 VAL 361 330 330 VAL VAL A . n 
A 1 362 VAL 362 331 331 VAL VAL A . n 
A 1 363 LYS 363 332 332 LYS LYS A . n 
A 1 364 ASP 364 333 333 ASP ASP A . n 
A 1 365 GLU 365 334 334 GLU GLU A . n 
A 1 366 GLY 366 335 335 GLY GLY A . n 
A 1 367 SER 367 336 336 SER SER A . n 
A 1 368 TYR 368 337 337 TYR TYR A . n 
A 1 369 PHE 369 338 338 PHE PHE A . n 
A 1 370 LEU 370 339 339 LEU LEU A . n 
A 1 371 VAL 371 340 340 VAL VAL A . n 
A 1 372 TYR 372 341 341 TYR TYR A . n 
A 1 373 GLY 373 342 342 GLY GLY A . n 
A 1 374 VAL 374 343 343 VAL VAL A . n 
A 1 375 PRO 375 344 344 PRO PRO A . n 
A 1 376 GLY 376 345 345 GLY GLY A . n 
A 1 377 PHE 377 346 346 PHE PHE A . n 
A 1 378 SER 378 347 347 SER SER A . n 
A 1 379 LYS 379 348 348 LYS LYS A . n 
A 1 380 ASP 380 349 349 ASP ASP A . n 
A 1 381 ASN 381 350 350 ASN ASN A . n 
A 1 382 GLU 382 351 351 GLU GLU A . n 
A 1 383 SER 383 352 352 SER SER A . n 
A 1 384 LEU 384 353 353 LEU LEU A . n 
A 1 385 ILE 385 354 354 ILE ILE A . n 
A 1 386 SER 386 355 355 SER SER A . n 
A 1 387 ARG 387 356 356 ARG ARG A . n 
A 1 388 ALA 388 357 357 ALA ALA A . n 
A 1 389 GLN 389 358 358 GLN GLN A . n 
A 1 390 PHE 390 359 359 PHE PHE A . n 
A 1 391 LEU 391 360 360 LEU LEU A . n 
A 1 392 ALA 392 361 361 ALA ALA A . n 
A 1 393 GLY 393 362 362 GLY GLY A . n 
A 1 394 VAL 394 363 363 VAL VAL A . n 
A 1 395 ARG 395 364 364 ARG ARG A . n 
A 1 396 ILE 396 365 365 ILE ILE A . n 
A 1 397 GLY 397 366 366 GLY GLY A . n 
A 1 398 VAL 398 367 367 VAL VAL A . n 
A 1 399 PRO 399 368 368 PRO PRO A . n 
A 1 400 GLN 400 369 369 GLN GLN A . n 
A 1 401 ALA 401 370 370 ALA ALA A . n 
A 1 402 SER 402 371 371 SER SER A . n 
A 1 403 ASP 403 372 372 ASP ASP A . n 
A 1 404 LEU 404 373 373 LEU LEU A . n 
A 1 405 ALA 405 374 374 ALA ALA A . n 
A 1 406 ALA 406 375 375 ALA ALA A . n 
A 1 407 GLU 407 376 376 GLU GLU A . n 
A 1 408 ALA 408 377 377 ALA ALA A . n 
A 1 409 VAL 409 378 378 VAL VAL A . n 
A 1 410 VAL 410 379 379 VAL VAL A . n 
A 1 411 LEU 411 380 380 LEU LEU A . n 
A 1 412 HIS 412 381 381 HIS HIS A . n 
A 1 413 TYR 413 382 382 TYR TYR A . n 
A 1 414 THR 414 383 383 THR THR A . n 
A 1 415 ASP 415 384 384 ASP ASP A . n 
A 1 416 TRP 416 385 385 TRP TRP A . n 
A 1 417 LEU 417 386 386 LEU LEU A . n 
A 1 418 HIS 418 387 387 HIS HIS A . n 
A 1 419 PRO 419 388 388 PRO PRO A . n 
A 1 420 GLU 420 389 389 GLU GLU A . n 
A 1 421 ASP 421 390 390 ASP ASP A . n 
A 1 422 PRO 422 391 391 PRO PRO A . n 
A 1 423 THR 423 392 392 THR THR A . n 
A 1 424 HIS 424 393 393 HIS HIS A . n 
A 1 425 LEU 425 394 394 LEU LEU A . n 
A 1 426 ARG 426 395 395 ARG ARG A . n 
A 1 427 ASP 427 396 396 ASP ASP A . n 
A 1 428 ALA 428 397 397 ALA ALA A . n 
A 1 429 MET 429 398 398 MET MET A . n 
A 1 430 SER 430 399 399 SER SER A . n 
A 1 431 ALA 431 400 400 ALA ALA A . n 
A 1 432 VAL 432 401 401 VAL VAL A . n 
A 1 433 VAL 433 402 402 VAL VAL A . n 
A 1 434 GLY 434 403 403 GLY GLY A . n 
A 1 435 ASP 435 404 404 ASP ASP A . n 
A 1 436 HIS 436 405 405 HIS HIS A . n 
A 1 437 ASN 437 406 406 ASN ASN A . n 
A 1 438 VAL 438 407 407 VAL VAL A . n 
A 1 439 VAL 439 408 408 VAL VAL A . n 
A 1 440 CYS 440 409 409 CYS CYS A . n 
A 1 441 PRO 441 410 410 PRO PRO A . n 
A 1 442 VAL 442 411 411 VAL VAL A . n 
A 1 443 ALA 443 412 412 ALA ALA A . n 
A 1 444 GLN 444 413 413 GLN GLN A . n 
A 1 445 LEU 445 414 414 LEU LEU A . n 
A 1 446 ALA 446 415 415 ALA ALA A . n 
A 1 447 GLY 447 416 416 GLY GLY A . n 
A 1 448 ARG 448 417 417 ARG ARG A . n 
A 1 449 LEU 449 418 418 LEU LEU A . n 
A 1 450 ALA 450 419 419 ALA ALA A . n 
A 1 451 ALA 451 420 420 ALA ALA A . n 
A 1 452 GLN 452 421 421 GLN GLN A . n 
A 1 453 GLY 453 422 422 GLY GLY A . n 
A 1 454 ALA 454 423 423 ALA ALA A . n 
A 1 455 ARG 455 424 424 ARG ARG A . n 
A 1 456 VAL 456 425 425 VAL VAL A . n 
A 1 457 TYR 457 426 426 TYR TYR A . n 
A 1 458 ALA 458 427 427 ALA ALA A . n 
A 1 459 TYR 459 428 428 TYR TYR A . n 
A 1 460 ILE 460 429 429 ILE ILE A . n 
A 1 461 PHE 461 430 430 PHE PHE A . n 
A 1 462 GLU 462 431 431 GLU GLU A . n 
A 1 463 HIS 463 432 432 HIS HIS A . n 
A 1 464 ARG 464 433 433 ARG ARG A . n 
A 1 465 ALA 465 434 434 ALA ALA A . n 
A 1 466 SER 466 435 435 SER SER A . n 
A 1 467 THR 467 436 436 THR THR A . n 
A 1 468 LEU 468 437 437 LEU LEU A . n 
A 1 469 THR 469 438 438 THR THR A . n 
A 1 470 TRP 470 439 439 TRP TRP A . n 
A 1 471 PRO 471 440 440 PRO PRO A . n 
A 1 472 LEU 472 441 441 LEU LEU A . n 
A 1 473 TRP 473 442 442 TRP TRP A . n 
A 1 474 MET 474 443 443 MET MET A . n 
A 1 475 GLY 475 444 444 GLY GLY A . n 
A 1 476 VAL 476 445 445 VAL VAL A . n 
A 1 477 PRO 477 446 446 PRO PRO A . n 
A 1 478 HIS 478 447 447 HIS HIS A . n 
A 1 479 GLY 479 448 448 GLY GLY A . n 
A 1 480 TYR 480 449 449 TYR TYR A . n 
A 1 481 GLU 481 450 450 GLU GLU A . n 
A 1 482 ILE 482 451 451 ILE ILE A . n 
A 1 483 GLU 483 452 452 GLU GLU A . n 
A 1 484 PHE 484 453 453 PHE PHE A . n 
A 1 485 ILE 485 454 454 ILE ILE A . n 
A 1 486 PHE 486 455 455 PHE PHE A . n 
A 1 487 GLY 487 456 456 GLY GLY A . n 
A 1 488 LEU 488 457 457 LEU LEU A . n 
A 1 489 PRO 489 458 458 PRO PRO A . n 
A 1 490 LEU 490 459 459 LEU LEU A . n 
A 1 491 ASP 491 460 460 ASP ASP A . n 
A 1 492 PRO 492 461 461 PRO PRO A . n 
A 1 493 SER 493 462 462 SER SER A . n 
A 1 494 LEU 494 463 463 LEU LEU A . n 
A 1 495 ASN 495 464 464 ASN ASN A . n 
A 1 496 TYR 496 465 465 TYR TYR A . n 
A 1 497 THR 497 466 466 THR THR A . n 
A 1 498 THR 498 467 467 THR THR A . n 
A 1 499 GLU 499 468 468 GLU GLU A . n 
A 1 500 GLU 500 469 469 GLU GLU A . n 
A 1 501 ARG 501 470 470 ARG ARG A . n 
A 1 502 ILE 502 471 471 ILE ILE A . n 
A 1 503 PHE 503 472 472 PHE PHE A . n 
A 1 504 ALA 504 473 473 ALA ALA A . n 
A 1 505 GLN 505 474 474 GLN GLN A . n 
A 1 506 ARG 506 475 475 ARG ARG A . n 
A 1 507 LEU 507 476 476 LEU LEU A . n 
A 1 508 MET 508 477 477 MET MET A . n 
A 1 509 LYS 509 478 478 LYS LYS A . n 
A 1 510 TYR 510 479 479 TYR TYR A . n 
A 1 511 TRP 511 480 480 TRP TRP A . n 
A 1 512 THR 512 481 481 THR THR A . n 
A 1 513 ASN 513 482 482 ASN ASN A . n 
A 1 514 PHE 514 483 483 PHE PHE A . n 
A 1 515 ALA 515 484 484 ALA ALA A . n 
A 1 516 ARG 516 485 485 ARG ARG A . n 
A 1 517 THR 517 486 486 THR THR A . n 
A 1 518 GLY 518 487 487 GLY GLY A . n 
A 1 519 ASP 519 488 488 ASP ASP A . n 
A 1 520 PRO 520 489 489 PRO PRO A . n 
A 1 521 ASN 521 490 490 ASN ASN A . n 
A 1 522 ASP 522 491 491 ASP ASP A . n 
A 1 523 PRO 523 492 492 PRO PRO A . n 
A 1 524 ARG 524 493 493 ARG ARG A . n 
A 1 525 ASP 525 494 494 ASP ASP A . n 
A 1 526 SER 526 495 495 SER SER A . n 
A 1 527 LYS 527 496 496 LYS LYS A . n 
A 1 528 SER 528 497 497 SER SER A . n 
A 1 529 PRO 529 498 498 PRO PRO A . n 
A 1 530 GLN 530 499 499 GLN GLN A . n 
A 1 531 TRP 531 500 500 TRP TRP A . n 
A 1 532 PRO 532 501 501 PRO PRO A . n 
A 1 533 PRO 533 502 502 PRO PRO A . n 
A 1 534 TYR 534 503 503 TYR TYR A . n 
A 1 535 THR 535 504 504 THR THR A . n 
A 1 536 THR 536 505 505 THR THR A . n 
A 1 537 ALA 537 506 506 ALA ALA A . n 
A 1 538 ALA 538 507 507 ALA ALA A . n 
A 1 539 GLN 539 508 508 GLN GLN A . n 
A 1 540 GLN 540 509 509 GLN GLN A . n 
A 1 541 TYR 541 510 510 TYR TYR A . n 
A 1 542 VAL 542 511 511 VAL VAL A . n 
A 1 543 SER 543 512 512 SER SER A . n 
A 1 544 LEU 544 513 513 LEU LEU A . n 
A 1 545 ASN 545 514 514 ASN ASN A . n 
A 1 546 LEU 546 515 515 LEU LEU A . n 
A 1 547 LYS 547 516 516 LYS LYS A . n 
A 1 548 PRO 548 517 517 PRO PRO A . n 
A 1 549 LEU 549 518 518 LEU LEU A . n 
A 1 550 GLU 550 519 519 GLU GLU A . n 
A 1 551 VAL 551 520 520 VAL VAL A . n 
A 1 552 ARG 552 521 521 ARG ARG A . n 
A 1 553 ARG 553 522 522 ARG ARG A . n 
A 1 554 GLY 554 523 523 GLY GLY A . n 
A 1 555 LEU 555 524 524 LEU LEU A . n 
A 1 556 ARG 556 525 525 ARG ARG A . n 
A 1 557 ALA 557 526 526 ALA ALA A . n 
A 1 558 GLN 558 527 527 GLN GLN A . n 
A 1 559 THR 559 528 528 THR THR A . n 
A 1 560 CYS 560 529 529 CYS CYS A . n 
A 1 561 ALA 561 530 530 ALA ALA A . n 
A 1 562 PHE 562 531 531 PHE PHE A . n 
A 1 563 TRP 563 532 532 TRP TRP A . n 
A 1 564 ASN 564 533 533 ASN ASN A . n 
A 1 565 ARG 565 534 534 ARG ARG A . n 
A 1 566 PHE 566 535 535 PHE PHE A . n 
A 1 567 LEU 567 536 536 LEU LEU A . n 
A 1 568 PRO 568 537 537 PRO PRO A . n 
A 1 569 LYS 569 538 538 LYS LYS A . n 
A 1 570 LEU 570 539 539 LEU LEU A . n 
A 1 571 LEU 571 540 540 LEU LEU A . n 
A 1 572 SER 572 541 541 SER SER A . n 
A 1 573 ALA 573 542 ?   ?   ?   A . n 
A 1 574 THR 574 543 ?   ?   ?   A . n 
A 1 575 ASP 575 544 ?   ?   ?   A . n 
A 1 576 THR 576 545 ?   ?   ?   A . n 
A 1 577 LEU 577 546 ?   ?   ?   A . n 
A 1 578 ASP 578 547 ?   ?   ?   A . n 
A 1 579 GLU 579 548 ?   ?   ?   A . n 
A 1 580 ALA 580 549 ?   ?   ?   A . n 
B 1 1   MET 1   -30 ?   ?   ?   B . n 
B 1 2   ARG 2   -29 ?   ?   ?   B . n 
B 1 3   PRO 3   -28 ?   ?   ?   B . n 
B 1 4   PRO 4   -27 ?   ?   ?   B . n 
B 1 5   TRP 5   -26 ?   ?   ?   B . n 
B 1 6   TYR 6   -25 ?   ?   ?   B . n 
B 1 7   PRO 7   -24 ?   ?   ?   B . n 
B 1 8   LEU 8   -23 ?   ?   ?   B . n 
B 1 9   HIS 9   -22 ?   ?   ?   B . n 
B 1 10  THR 10  -21 ?   ?   ?   B . n 
B 1 11  PRO 11  -20 ?   ?   ?   B . n 
B 1 12  SER 12  -19 ?   ?   ?   B . n 
B 1 13  LEU 13  -18 ?   ?   ?   B . n 
B 1 14  ALA 14  -17 ?   ?   ?   B . n 
B 1 15  PHE 15  -16 ?   ?   ?   B . n 
B 1 16  PRO 16  -15 ?   ?   ?   B . n 
B 1 17  LEU 17  -14 ?   ?   ?   B . n 
B 1 18  LEU 18  -13 ?   ?   ?   B . n 
B 1 19  PHE 19  -12 ?   ?   ?   B . n 
B 1 20  LEU 20  -11 ?   ?   ?   B . n 
B 1 21  LEU 21  -10 ?   ?   ?   B . n 
B 1 22  LEU 22  -9  ?   ?   ?   B . n 
B 1 23  SER 23  -8  ?   ?   ?   B . n 
B 1 24  LEU 24  -7  ?   ?   ?   B . n 
B 1 25  LEU 25  -6  ?   ?   ?   B . n 
B 1 26  GLY 26  -5  ?   ?   ?   B . n 
B 1 27  GLY 27  -4  ?   ?   ?   B . n 
B 1 28  GLY 28  -3  ?   ?   ?   B . n 
B 1 29  ALA 29  -2  ?   ?   ?   B . n 
B 1 30  ARG 30  -1  ?   ?   ?   B . n 
B 1 31  ALA 31  0   ?   ?   ?   B . n 
B 1 32  GLU 32  1   ?   ?   ?   B . n 
B 1 33  GLY 33  2   ?   ?   ?   B . n 
B 1 34  ARG 34  3   ?   ?   ?   B . n 
B 1 35  GLU 35  4   4   GLU GLU B . n 
B 1 36  ASP 36  5   5   ASP ASP B . n 
B 1 37  PRO 37  6   6   PRO PRO B . n 
B 1 38  GLN 38  7   7   GLN GLN B . n 
B 1 39  LEU 39  8   8   LEU LEU B . n 
B 1 40  LEU 40  9   9   LEU LEU B . n 
B 1 41  VAL 41  10  10  VAL VAL B . n 
B 1 42  ARG 42  11  11  ARG ARG B . n 
B 1 43  VAL 43  12  12  VAL VAL B . n 
B 1 44  ARG 44  13  13  ARG ARG B . n 
B 1 45  GLY 45  14  14  GLY GLY B . n 
B 1 46  GLY 46  15  15  GLY GLY B . n 
B 1 47  GLN 47  16  16  GLN GLN B . n 
B 1 48  LEU 48  17  17  LEU LEU B . n 
B 1 49  ARG 49  18  18  ARG ARG B . n 
B 1 50  GLY 50  19  19  GLY GLY B . n 
B 1 51  ILE 51  20  20  ILE ILE B . n 
B 1 52  ARG 52  21  21  ARG ARG B . n 
B 1 53  LEU 53  22  22  LEU LEU B . n 
B 1 54  LYS 54  23  23  LYS LYS B . n 
B 1 55  ALA 55  24  24  ALA ALA B . n 
B 1 56  PRO 56  25  25  PRO PRO B . n 
B 1 57  GLY 57  26  26  GLY GLY B . n 
B 1 58  GLY 58  27  27  GLY GLY B . n 
B 1 59  PRO 59  28  28  PRO PRO B . n 
B 1 60  VAL 60  29  29  VAL VAL B . n 
B 1 61  SER 61  30  30  SER SER B . n 
B 1 62  ALA 62  31  31  ALA ALA B . n 
B 1 63  PHE 63  32  32  PHE PHE B . n 
B 1 64  LEU 64  33  33  LEU LEU B . n 
B 1 65  GLY 65  34  34  GLY GLY B . n 
B 1 66  ILE 66  35  35  ILE ILE B . n 
B 1 67  PRO 67  36  36  PRO PRO B . n 
B 1 68  PHE 68  37  37  PHE PHE B . n 
B 1 69  ALA 69  38  38  ALA ALA B . n 
B 1 70  GLU 70  39  39  GLU GLU B . n 
B 1 71  PRO 71  40  40  PRO PRO B . n 
B 1 72  PRO 72  41  41  PRO PRO B . n 
B 1 73  VAL 73  42  42  VAL VAL B . n 
B 1 74  GLY 74  43  43  GLY GLY B . n 
B 1 75  SER 75  44  44  SER SER B . n 
B 1 76  ARG 76  45  45  ARG ARG B . n 
B 1 77  ARG 77  46  46  ARG ARG B . n 
B 1 78  PHE 78  47  47  PHE PHE B . n 
B 1 79  MET 79  48  48  MET MET B . n 
B 1 80  PRO 80  49  49  PRO PRO B . n 
B 1 81  PRO 81  50  50  PRO PRO B . n 
B 1 82  GLU 82  51  51  GLU GLU B . n 
B 1 83  PRO 83  52  52  PRO PRO B . n 
B 1 84  LYS 84  53  53  LYS LYS B . n 
B 1 85  ARG 85  54  54  ARG ARG B . n 
B 1 86  PRO 86  55  55  PRO PRO B . n 
B 1 87  TRP 87  56  56  TRP TRP B . n 
B 1 88  SER 88  57  57  SER SER B . n 
B 1 89  GLY 89  58  58  GLY GLY B . n 
B 1 90  VAL 90  59  59  VAL VAL B . n 
B 1 91  LEU 91  60  60  LEU LEU B . n 
B 1 92  ASP 92  61  61  ASP ASP B . n 
B 1 93  ALA 93  62  62  ALA ALA B . n 
B 1 94  THR 94  63  63  THR THR B . n 
B 1 95  THR 95  64  64  THR THR B . n 
B 1 96  PHE 96  65  65  PHE PHE B . n 
B 1 97  GLN 97  66  66  GLN GLN B . n 
B 1 98  ASN 98  67  67  ASN ASN B . n 
B 1 99  VAL 99  68  68  VAL VAL B . n 
B 1 100 CYS 100 69  69  CYS CYS B . n 
B 1 101 TYR 101 70  70  TYR TYR B . n 
B 1 102 GLN 102 71  71  GLN GLN B . n 
B 1 103 TYR 103 72  72  TYR TYR B . n 
B 1 104 VAL 104 73  73  VAL VAL B . n 
B 1 105 ASP 105 74  74  ASP ASP B . n 
B 1 106 THR 106 75  75  THR THR B . n 
B 1 107 LEU 107 76  76  LEU LEU B . n 
B 1 108 TYR 108 77  77  TYR TYR B . n 
B 1 109 PRO 109 78  78  PRO PRO B . n 
B 1 110 GLY 110 79  79  GLY GLY B . n 
B 1 111 PHE 111 80  80  PHE PHE B . n 
B 1 112 GLU 112 81  81  GLU GLU B . n 
B 1 113 GLY 113 82  82  GLY GLY B . n 
B 1 114 THR 114 83  83  THR THR B . n 
B 1 115 GLU 115 84  84  GLU GLU B . n 
B 1 116 MET 116 85  85  MET MET B . n 
B 1 117 TRP 117 86  86  TRP TRP B . n 
B 1 118 ASN 118 87  87  ASN ASN B . n 
B 1 119 PRO 119 88  88  PRO PRO B . n 
B 1 120 ASN 120 89  89  ASN ASN B . n 
B 1 121 ARG 121 90  90  ARG ARG B . n 
B 1 122 GLU 122 91  91  GLU GLU B . n 
B 1 123 LEU 123 92  92  LEU LEU B . n 
B 1 124 SER 124 93  93  SER SER B . n 
B 1 125 GLU 125 94  94  GLU GLU B . n 
B 1 126 ASP 126 95  95  ASP ASP B . n 
B 1 127 CYS 127 96  96  CYS CYS B . n 
B 1 128 LEU 128 97  97  LEU LEU B . n 
B 1 129 TYR 129 98  98  TYR TYR B . n 
B 1 130 LEU 130 99  99  LEU LEU B . n 
B 1 131 ASN 131 100 100 ASN ASN B . n 
B 1 132 VAL 132 101 101 VAL VAL B . n 
B 1 133 TRP 133 102 102 TRP TRP B . n 
B 1 134 THR 134 103 103 THR THR B . n 
B 1 135 PRO 135 104 104 PRO PRO B . n 
B 1 136 TYR 136 105 105 TYR TYR B . n 
B 1 137 PRO 137 106 106 PRO PRO B . n 
B 1 138 ARG 138 107 107 ARG ARG B . n 
B 1 139 PRO 139 108 108 PRO PRO B . n 
B 1 140 ALA 140 109 109 ALA ALA B . n 
B 1 141 SER 141 110 110 SER SER B . n 
B 1 142 PRO 142 111 111 PRO PRO B . n 
B 1 143 THR 143 112 112 THR THR B . n 
B 1 144 PRO 144 113 113 PRO PRO B . n 
B 1 145 VAL 145 114 114 VAL VAL B . n 
B 1 146 LEU 146 115 115 LEU LEU B . n 
B 1 147 ILE 147 116 116 ILE ILE B . n 
B 1 148 TRP 148 117 117 TRP TRP B . n 
B 1 149 ILE 149 118 118 ILE ILE B . n 
B 1 150 TYR 150 119 119 TYR TYR B . n 
B 1 151 GLY 151 120 120 GLY GLY B . n 
B 1 152 GLY 152 121 121 GLY GLY B . n 
B 1 153 GLY 153 122 122 GLY GLY B . n 
B 1 154 PHE 154 123 123 PHE PHE B . n 
B 1 155 TYR 155 124 124 TYR TYR B . n 
B 1 156 SER 156 125 125 SER SER B . n 
B 1 157 GLY 157 126 126 GLY GLY B . n 
B 1 158 ALA 158 127 127 ALA ALA B . n 
B 1 159 ALA 159 128 128 ALA ALA B . n 
B 1 160 SER 160 129 129 SER SER B . n 
B 1 161 LEU 161 130 130 LEU LEU B . n 
B 1 162 ASP 162 131 131 ASP ASP B . n 
B 1 163 VAL 163 132 132 VAL VAL B . n 
B 1 164 TYR 164 133 133 TYR TYR B . n 
B 1 165 ASP 165 134 134 ASP ASP B . n 
B 1 166 GLY 166 135 135 GLY GLY B . n 
B 1 167 ARG 167 136 136 ARG ARG B . n 
B 1 168 PHE 168 137 137 PHE PHE B . n 
B 1 169 LEU 169 138 138 LEU LEU B . n 
B 1 170 ALA 170 139 139 ALA ALA B . n 
B 1 171 GLN 171 140 140 GLN GLN B . n 
B 1 172 VAL 172 141 141 VAL VAL B . n 
B 1 173 GLU 173 142 142 GLU GLU B . n 
B 1 174 GLY 174 143 143 GLY GLY B . n 
B 1 175 ALA 175 144 144 ALA ALA B . n 
B 1 176 VAL 176 145 145 VAL VAL B . n 
B 1 177 LEU 177 146 146 LEU LEU B . n 
B 1 178 VAL 178 147 147 VAL VAL B . n 
B 1 179 SER 179 148 148 SER SER B . n 
B 1 180 MET 180 149 149 MET MET B . n 
B 1 181 ASN 181 150 150 ASN ASN B . n 
B 1 182 TYR 182 151 151 TYR TYR B . n 
B 1 183 ARG 183 152 152 ARG ARG B . n 
B 1 184 VAL 184 153 153 VAL VAL B . n 
B 1 185 GLY 185 154 154 GLY GLY B . n 
B 1 186 THR 186 155 155 THR THR B . n 
B 1 187 PHE 187 156 156 PHE PHE B . n 
B 1 188 GLY 188 157 157 GLY GLY B . n 
B 1 189 PHE 189 158 158 PHE PHE B . n 
B 1 190 LEU 190 159 159 LEU LEU B . n 
B 1 191 ALA 191 160 160 ALA ALA B . n 
B 1 192 LEU 192 161 161 LEU LEU B . n 
B 1 193 PRO 193 162 162 PRO PRO B . n 
B 1 194 GLY 194 163 163 GLY GLY B . n 
B 1 195 SER 195 164 164 SER SER B . n 
B 1 196 ARG 196 165 165 ARG ARG B . n 
B 1 197 GLU 197 166 166 GLU GLU B . n 
B 1 198 ALA 198 167 167 ALA ALA B . n 
B 1 199 PRO 199 168 168 PRO PRO B . n 
B 1 200 GLY 200 169 169 GLY GLY B . n 
B 1 201 ASN 201 170 170 ASN ASN B . n 
B 1 202 VAL 202 171 171 VAL VAL B . n 
B 1 203 GLY 203 172 172 GLY GLY B . n 
B 1 204 LEU 204 173 173 LEU LEU B . n 
B 1 205 LEU 205 174 174 LEU LEU B . n 
B 1 206 ASP 206 175 175 ASP ASP B . n 
B 1 207 GLN 207 176 176 GLN GLN B . n 
B 1 208 ARG 208 177 177 ARG ARG B . n 
B 1 209 LEU 209 178 178 LEU LEU B . n 
B 1 210 ALA 210 179 179 ALA ALA B . n 
B 1 211 LEU 211 180 180 LEU LEU B . n 
B 1 212 GLN 212 181 181 GLN GLN B . n 
B 1 213 TRP 213 182 182 TRP TRP B . n 
B 1 214 VAL 214 183 183 VAL VAL B . n 
B 1 215 GLN 215 184 184 GLN GLN B . n 
B 1 216 GLU 216 185 185 GLU GLU B . n 
B 1 217 ASN 217 186 186 ASN ASN B . n 
B 1 218 ILE 218 187 187 ILE ILE B . n 
B 1 219 ALA 219 188 188 ALA ALA B . n 
B 1 220 ALA 220 189 189 ALA ALA B . n 
B 1 221 PHE 221 190 190 PHE PHE B . n 
B 1 222 GLY 222 191 191 GLY GLY B . n 
B 1 223 GLY 223 192 192 GLY GLY B . n 
B 1 224 ASP 224 193 193 ASP ASP B . n 
B 1 225 PRO 225 194 194 PRO PRO B . n 
B 1 226 MET 226 195 195 MET MET B . n 
B 1 227 SER 227 196 196 SER SER B . n 
B 1 228 VAL 228 197 197 VAL VAL B . n 
B 1 229 THR 229 198 198 THR THR B . n 
B 1 230 LEU 230 199 199 LEU LEU B . n 
B 1 231 PHE 231 200 200 PHE PHE B . n 
B 1 232 GLY 232 201 201 GLY GLY B . n 
B 1 233 GLU 233 202 202 GLU GLU B . n 
B 1 234 SER 234 203 203 SER SER B . n 
B 1 235 ALA 235 204 204 ALA ALA B . n 
B 1 236 GLY 236 205 205 GLY GLY B . n 
B 1 237 ALA 237 206 206 ALA ALA B . n 
B 1 238 ALA 238 207 207 ALA ALA B . n 
B 1 239 SER 239 208 208 SER SER B . n 
B 1 240 VAL 240 209 209 VAL VAL B . n 
B 1 241 GLY 241 210 210 GLY GLY B . n 
B 1 242 MET 242 211 211 MET MET B . n 
B 1 243 HIS 243 212 212 HIS HIS B . n 
B 1 244 ILE 244 213 213 ILE ILE B . n 
B 1 245 LEU 245 214 214 LEU LEU B . n 
B 1 246 SER 246 215 215 SER SER B . n 
B 1 247 LEU 247 216 216 LEU LEU B . n 
B 1 248 PRO 248 217 217 PRO PRO B . n 
B 1 249 SER 249 218 218 SER SER B . n 
B 1 250 ARG 250 219 219 ARG ARG B . n 
B 1 251 SER 251 220 220 SER SER B . n 
B 1 252 LEU 252 221 221 LEU LEU B . n 
B 1 253 PHE 253 222 222 PHE PHE B . n 
B 1 254 HIS 254 223 223 HIS HIS B . n 
B 1 255 ARG 255 224 224 ARG ARG B . n 
B 1 256 ALA 256 225 225 ALA ALA B . n 
B 1 257 VAL 257 226 226 VAL VAL B . n 
B 1 258 LEU 258 227 227 LEU LEU B . n 
B 1 259 GLN 259 228 228 GLN GLN B . n 
B 1 260 SER 260 229 229 SER SER B . n 
B 1 261 GLY 261 230 230 GLY GLY B . n 
B 1 262 THR 262 231 231 THR THR B . n 
B 1 263 PRO 263 232 232 PRO PRO B . n 
B 1 264 ASN 264 233 233 ASN ASN B . n 
B 1 265 GLY 265 234 234 GLY GLY B . n 
B 1 266 PRO 266 235 235 PRO PRO B . n 
B 1 267 TRP 267 236 236 TRP TRP B . n 
B 1 268 ALA 268 237 237 ALA ALA B . n 
B 1 269 THR 269 238 238 THR THR B . n 
B 1 270 VAL 270 239 239 VAL VAL B . n 
B 1 271 SER 271 240 240 SER SER B . n 
B 1 272 ALA 272 241 241 ALA ALA B . n 
B 1 273 GLY 273 242 242 GLY GLY B . n 
B 1 274 GLU 274 243 243 GLU GLU B . n 
B 1 275 ALA 275 244 244 ALA ALA B . n 
B 1 276 ARG 276 245 245 ARG ARG B . n 
B 1 277 ARG 277 246 246 ARG ARG B . n 
B 1 278 ARG 278 247 247 ARG ARG B . n 
B 1 279 ALA 279 248 248 ALA ALA B . n 
B 1 280 THR 280 249 249 THR THR B . n 
B 1 281 LEU 281 250 250 LEU LEU B . n 
B 1 282 LEU 282 251 251 LEU LEU B . n 
B 1 283 ALA 283 252 252 ALA ALA B . n 
B 1 284 ARG 284 253 253 ARG ARG B . n 
B 1 285 LEU 285 254 254 LEU LEU B . n 
B 1 286 VAL 286 255 255 VAL VAL B . n 
B 1 287 GLY 287 256 256 GLY GLY B . n 
B 1 288 CYS 288 257 257 CYS CYS B . n 
B 1 289 PRO 289 258 258 PRO PRO B . n 
B 1 290 PRO 290 259 ?   ?   ?   B . n 
B 1 291 GLY 291 260 ?   ?   ?   B . n 
B 1 292 GLY 292 261 ?   ?   ?   B . n 
B 1 293 ALA 293 262 ?   ?   ?   B . n 
B 1 294 GLY 294 263 ?   ?   ?   B . n 
B 1 295 GLY 295 264 ?   ?   ?   B . n 
B 1 296 ASN 296 265 265 ASN ASN B . n 
B 1 297 ASP 297 266 266 ASP ASP B . n 
B 1 298 THR 298 267 267 THR THR B . n 
B 1 299 GLU 299 268 268 GLU GLU B . n 
B 1 300 LEU 300 269 269 LEU LEU B . n 
B 1 301 ILE 301 270 270 ILE ILE B . n 
B 1 302 ALA 302 271 271 ALA ALA B . n 
B 1 303 CYS 303 272 272 CYS CYS B . n 
B 1 304 LEU 304 273 273 LEU LEU B . n 
B 1 305 ARG 305 274 274 ARG ARG B . n 
B 1 306 THR 306 275 275 THR THR B . n 
B 1 307 ARG 307 276 276 ARG ARG B . n 
B 1 308 PRO 308 277 277 PRO PRO B . n 
B 1 309 ALA 309 278 278 ALA ALA B . n 
B 1 310 GLN 310 279 279 GLN GLN B . n 
B 1 311 ASP 311 280 280 ASP ASP B . n 
B 1 312 LEU 312 281 281 LEU LEU B . n 
B 1 313 VAL 313 282 282 VAL VAL B . n 
B 1 314 ASP 314 283 283 ASP ASP B . n 
B 1 315 HIS 315 284 284 HIS HIS B . n 
B 1 316 GLU 316 285 285 GLU GLU B . n 
B 1 317 TRP 317 286 286 TRP TRP B . n 
B 1 318 HIS 318 287 287 HIS HIS B . n 
B 1 319 VAL 319 288 288 VAL VAL B . n 
B 1 320 LEU 320 289 289 LEU LEU B . n 
B 1 321 PRO 321 290 290 PRO PRO B . n 
B 1 322 GLN 322 291 291 GLN GLN B . n 
B 1 323 GLU 323 292 292 GLU GLU B . n 
B 1 324 SER 324 293 293 SER SER B . n 
B 1 325 ILE 325 294 294 ILE ILE B . n 
B 1 326 PHE 326 295 295 PHE PHE B . n 
B 1 327 ARG 327 296 296 ARG ARG B . n 
B 1 328 PHE 328 297 297 PHE PHE B . n 
B 1 329 SER 329 298 298 SER SER B . n 
B 1 330 PHE 330 299 299 PHE PHE B . n 
B 1 331 VAL 331 300 300 VAL VAL B . n 
B 1 332 PRO 332 301 301 PRO PRO B . n 
B 1 333 VAL 333 302 302 VAL VAL B . n 
B 1 334 VAL 334 303 303 VAL VAL B . n 
B 1 335 ASP 335 304 304 ASP ASP B . n 
B 1 336 GLY 336 305 305 GLY GLY B . n 
B 1 337 ASP 337 306 306 ASP ASP B . n 
B 1 338 PHE 338 307 307 PHE PHE B . n 
B 1 339 LEU 339 308 308 LEU LEU B . n 
B 1 340 SER 340 309 309 SER SER B . n 
B 1 341 ASP 341 310 310 ASP ASP B . n 
B 1 342 THR 342 311 311 THR THR B . n 
B 1 343 PRO 343 312 312 PRO PRO B . n 
B 1 344 GLU 344 313 313 GLU GLU B . n 
B 1 345 ALA 345 314 314 ALA ALA B . n 
B 1 346 LEU 346 315 315 LEU LEU B . n 
B 1 347 ILE 347 316 316 ILE ILE B . n 
B 1 348 ASN 348 317 317 ASN ASN B . n 
B 1 349 THR 349 318 318 THR THR B . n 
B 1 350 GLY 350 319 319 GLY GLY B . n 
B 1 351 ASP 351 320 320 ASP ASP B . n 
B 1 352 PHE 352 321 321 PHE PHE B . n 
B 1 353 GLN 353 322 322 GLN GLN B . n 
B 1 354 ASP 354 323 323 ASP ASP B . n 
B 1 355 LEU 355 324 324 LEU LEU B . n 
B 1 356 GLN 356 325 325 GLN GLN B . n 
B 1 357 VAL 357 326 326 VAL VAL B . n 
B 1 358 LEU 358 327 327 LEU LEU B . n 
B 1 359 VAL 359 328 328 VAL VAL B . n 
B 1 360 GLY 360 329 329 GLY GLY B . n 
B 1 361 VAL 361 330 330 VAL VAL B . n 
B 1 362 VAL 362 331 331 VAL VAL B . n 
B 1 363 LYS 363 332 332 LYS LYS B . n 
B 1 364 ASP 364 333 333 ASP ASP B . n 
B 1 365 GLU 365 334 334 GLU GLU B . n 
B 1 366 GLY 366 335 335 GLY GLY B . n 
B 1 367 SER 367 336 336 SER SER B . n 
B 1 368 TYR 368 337 337 TYR TYR B . n 
B 1 369 PHE 369 338 338 PHE PHE B . n 
B 1 370 LEU 370 339 339 LEU LEU B . n 
B 1 371 VAL 371 340 340 VAL VAL B . n 
B 1 372 TYR 372 341 341 TYR TYR B . n 
B 1 373 GLY 373 342 342 GLY GLY B . n 
B 1 374 VAL 374 343 343 VAL VAL B . n 
B 1 375 PRO 375 344 344 PRO PRO B . n 
B 1 376 GLY 376 345 345 GLY GLY B . n 
B 1 377 PHE 377 346 346 PHE PHE B . n 
B 1 378 SER 378 347 347 SER SER B . n 
B 1 379 LYS 379 348 348 LYS LYS B . n 
B 1 380 ASP 380 349 349 ASP ASP B . n 
B 1 381 ASN 381 350 350 ASN ASN B . n 
B 1 382 GLU 382 351 351 GLU GLU B . n 
B 1 383 SER 383 352 352 SER SER B . n 
B 1 384 LEU 384 353 353 LEU LEU B . n 
B 1 385 ILE 385 354 354 ILE ILE B . n 
B 1 386 SER 386 355 355 SER SER B . n 
B 1 387 ARG 387 356 356 ARG ARG B . n 
B 1 388 ALA 388 357 357 ALA ALA B . n 
B 1 389 GLN 389 358 358 GLN GLN B . n 
B 1 390 PHE 390 359 359 PHE PHE B . n 
B 1 391 LEU 391 360 360 LEU LEU B . n 
B 1 392 ALA 392 361 361 ALA ALA B . n 
B 1 393 GLY 393 362 362 GLY GLY B . n 
B 1 394 VAL 394 363 363 VAL VAL B . n 
B 1 395 ARG 395 364 364 ARG ARG B . n 
B 1 396 ILE 396 365 365 ILE ILE B . n 
B 1 397 GLY 397 366 366 GLY GLY B . n 
B 1 398 VAL 398 367 367 VAL VAL B . n 
B 1 399 PRO 399 368 368 PRO PRO B . n 
B 1 400 GLN 400 369 369 GLN GLN B . n 
B 1 401 ALA 401 370 370 ALA ALA B . n 
B 1 402 SER 402 371 371 SER SER B . n 
B 1 403 ASP 403 372 372 ASP ASP B . n 
B 1 404 LEU 404 373 373 LEU LEU B . n 
B 1 405 ALA 405 374 374 ALA ALA B . n 
B 1 406 ALA 406 375 375 ALA ALA B . n 
B 1 407 GLU 407 376 376 GLU GLU B . n 
B 1 408 ALA 408 377 377 ALA ALA B . n 
B 1 409 VAL 409 378 378 VAL VAL B . n 
B 1 410 VAL 410 379 379 VAL VAL B . n 
B 1 411 LEU 411 380 380 LEU LEU B . n 
B 1 412 HIS 412 381 381 HIS HIS B . n 
B 1 413 TYR 413 382 382 TYR TYR B . n 
B 1 414 THR 414 383 383 THR THR B . n 
B 1 415 ASP 415 384 384 ASP ASP B . n 
B 1 416 TRP 416 385 385 TRP TRP B . n 
B 1 417 LEU 417 386 386 LEU LEU B . n 
B 1 418 HIS 418 387 387 HIS HIS B . n 
B 1 419 PRO 419 388 388 PRO PRO B . n 
B 1 420 GLU 420 389 389 GLU GLU B . n 
B 1 421 ASP 421 390 390 ASP ASP B . n 
B 1 422 PRO 422 391 391 PRO PRO B . n 
B 1 423 THR 423 392 392 THR THR B . n 
B 1 424 HIS 424 393 393 HIS HIS B . n 
B 1 425 LEU 425 394 394 LEU LEU B . n 
B 1 426 ARG 426 395 395 ARG ARG B . n 
B 1 427 ASP 427 396 396 ASP ASP B . n 
B 1 428 ALA 428 397 397 ALA ALA B . n 
B 1 429 MET 429 398 398 MET MET B . n 
B 1 430 SER 430 399 399 SER SER B . n 
B 1 431 ALA 431 400 400 ALA ALA B . n 
B 1 432 VAL 432 401 401 VAL VAL B . n 
B 1 433 VAL 433 402 402 VAL VAL B . n 
B 1 434 GLY 434 403 403 GLY GLY B . n 
B 1 435 ASP 435 404 404 ASP ASP B . n 
B 1 436 HIS 436 405 405 HIS HIS B . n 
B 1 437 ASN 437 406 406 ASN ASN B . n 
B 1 438 VAL 438 407 407 VAL VAL B . n 
B 1 439 VAL 439 408 408 VAL VAL B . n 
B 1 440 CYS 440 409 409 CYS CYS B . n 
B 1 441 PRO 441 410 410 PRO PRO B . n 
B 1 442 VAL 442 411 411 VAL VAL B . n 
B 1 443 ALA 443 412 412 ALA ALA B . n 
B 1 444 GLN 444 413 413 GLN GLN B . n 
B 1 445 LEU 445 414 414 LEU LEU B . n 
B 1 446 ALA 446 415 415 ALA ALA B . n 
B 1 447 GLY 447 416 416 GLY GLY B . n 
B 1 448 ARG 448 417 417 ARG ARG B . n 
B 1 449 LEU 449 418 418 LEU LEU B . n 
B 1 450 ALA 450 419 419 ALA ALA B . n 
B 1 451 ALA 451 420 420 ALA ALA B . n 
B 1 452 GLN 452 421 421 GLN GLN B . n 
B 1 453 GLY 453 422 422 GLY GLY B . n 
B 1 454 ALA 454 423 423 ALA ALA B . n 
B 1 455 ARG 455 424 424 ARG ARG B . n 
B 1 456 VAL 456 425 425 VAL VAL B . n 
B 1 457 TYR 457 426 426 TYR TYR B . n 
B 1 458 ALA 458 427 427 ALA ALA B . n 
B 1 459 TYR 459 428 428 TYR TYR B . n 
B 1 460 ILE 460 429 429 ILE ILE B . n 
B 1 461 PHE 461 430 430 PHE PHE B . n 
B 1 462 GLU 462 431 431 GLU GLU B . n 
B 1 463 HIS 463 432 432 HIS HIS B . n 
B 1 464 ARG 464 433 433 ARG ARG B . n 
B 1 465 ALA 465 434 434 ALA ALA B . n 
B 1 466 SER 466 435 435 SER SER B . n 
B 1 467 THR 467 436 436 THR THR B . n 
B 1 468 LEU 468 437 437 LEU LEU B . n 
B 1 469 THR 469 438 438 THR THR B . n 
B 1 470 TRP 470 439 439 TRP TRP B . n 
B 1 471 PRO 471 440 440 PRO PRO B . n 
B 1 472 LEU 472 441 441 LEU LEU B . n 
B 1 473 TRP 473 442 442 TRP TRP B . n 
B 1 474 MET 474 443 443 MET MET B . n 
B 1 475 GLY 475 444 444 GLY GLY B . n 
B 1 476 VAL 476 445 445 VAL VAL B . n 
B 1 477 PRO 477 446 446 PRO PRO B . n 
B 1 478 HIS 478 447 447 HIS HIS B . n 
B 1 479 GLY 479 448 448 GLY GLY B . n 
B 1 480 TYR 480 449 449 TYR TYR B . n 
B 1 481 GLU 481 450 450 GLU GLU B . n 
B 1 482 ILE 482 451 451 ILE ILE B . n 
B 1 483 GLU 483 452 452 GLU GLU B . n 
B 1 484 PHE 484 453 453 PHE PHE B . n 
B 1 485 ILE 485 454 454 ILE ILE B . n 
B 1 486 PHE 486 455 455 PHE PHE B . n 
B 1 487 GLY 487 456 456 GLY GLY B . n 
B 1 488 LEU 488 457 457 LEU LEU B . n 
B 1 489 PRO 489 458 458 PRO PRO B . n 
B 1 490 LEU 490 459 459 LEU LEU B . n 
B 1 491 ASP 491 460 460 ASP ASP B . n 
B 1 492 PRO 492 461 461 PRO PRO B . n 
B 1 493 SER 493 462 462 SER SER B . n 
B 1 494 LEU 494 463 463 LEU LEU B . n 
B 1 495 ASN 495 464 464 ASN ASN B . n 
B 1 496 TYR 496 465 465 TYR TYR B . n 
B 1 497 THR 497 466 466 THR THR B . n 
B 1 498 THR 498 467 467 THR THR B . n 
B 1 499 GLU 499 468 468 GLU GLU B . n 
B 1 500 GLU 500 469 469 GLU GLU B . n 
B 1 501 ARG 501 470 470 ARG ARG B . n 
B 1 502 ILE 502 471 471 ILE ILE B . n 
B 1 503 PHE 503 472 472 PHE PHE B . n 
B 1 504 ALA 504 473 473 ALA ALA B . n 
B 1 505 GLN 505 474 474 GLN GLN B . n 
B 1 506 ARG 506 475 475 ARG ARG B . n 
B 1 507 LEU 507 476 476 LEU LEU B . n 
B 1 508 MET 508 477 477 MET MET B . n 
B 1 509 LYS 509 478 478 LYS LYS B . n 
B 1 510 TYR 510 479 479 TYR TYR B . n 
B 1 511 TRP 511 480 480 TRP TRP B . n 
B 1 512 THR 512 481 481 THR THR B . n 
B 1 513 ASN 513 482 482 ASN ASN B . n 
B 1 514 PHE 514 483 483 PHE PHE B . n 
B 1 515 ALA 515 484 484 ALA ALA B . n 
B 1 516 ARG 516 485 485 ARG ARG B . n 
B 1 517 THR 517 486 486 THR THR B . n 
B 1 518 GLY 518 487 487 GLY GLY B . n 
B 1 519 ASP 519 488 488 ASP ASP B . n 
B 1 520 PRO 520 489 489 PRO PRO B . n 
B 1 521 ASN 521 490 490 ASN ASN B . n 
B 1 522 ASP 522 491 491 ASP ASP B . n 
B 1 523 PRO 523 492 492 PRO PRO B . n 
B 1 524 ARG 524 493 493 ARG ARG B . n 
B 1 525 ASP 525 494 494 ASP ASP B . n 
B 1 526 SER 526 495 495 SER SER B . n 
B 1 527 LYS 527 496 496 LYS LYS B . n 
B 1 528 SER 528 497 497 SER SER B . n 
B 1 529 PRO 529 498 498 PRO PRO B . n 
B 1 530 GLN 530 499 499 GLN GLN B . n 
B 1 531 TRP 531 500 500 TRP TRP B . n 
B 1 532 PRO 532 501 501 PRO PRO B . n 
B 1 533 PRO 533 502 502 PRO PRO B . n 
B 1 534 TYR 534 503 503 TYR TYR B . n 
B 1 535 THR 535 504 504 THR THR B . n 
B 1 536 THR 536 505 505 THR THR B . n 
B 1 537 ALA 537 506 506 ALA ALA B . n 
B 1 538 ALA 538 507 507 ALA ALA B . n 
B 1 539 GLN 539 508 508 GLN GLN B . n 
B 1 540 GLN 540 509 509 GLN GLN B . n 
B 1 541 TYR 541 510 510 TYR TYR B . n 
B 1 542 VAL 542 511 511 VAL VAL B . n 
B 1 543 SER 543 512 512 SER SER B . n 
B 1 544 LEU 544 513 513 LEU LEU B . n 
B 1 545 ASN 545 514 514 ASN ASN B . n 
B 1 546 LEU 546 515 515 LEU LEU B . n 
B 1 547 LYS 547 516 516 LYS LYS B . n 
B 1 548 PRO 548 517 517 PRO PRO B . n 
B 1 549 LEU 549 518 518 LEU LEU B . n 
B 1 550 GLU 550 519 519 GLU GLU B . n 
B 1 551 VAL 551 520 520 VAL VAL B . n 
B 1 552 ARG 552 521 521 ARG ARG B . n 
B 1 553 ARG 553 522 522 ARG ARG B . n 
B 1 554 GLY 554 523 523 GLY GLY B . n 
B 1 555 LEU 555 524 524 LEU LEU B . n 
B 1 556 ARG 556 525 525 ARG ARG B . n 
B 1 557 ALA 557 526 526 ALA ALA B . n 
B 1 558 GLN 558 527 527 GLN GLN B . n 
B 1 559 THR 559 528 528 THR THR B . n 
B 1 560 CYS 560 529 529 CYS CYS B . n 
B 1 561 ALA 561 530 530 ALA ALA B . n 
B 1 562 PHE 562 531 531 PHE PHE B . n 
B 1 563 TRP 563 532 532 TRP TRP B . n 
B 1 564 ASN 564 533 533 ASN ASN B . n 
B 1 565 ARG 565 534 534 ARG ARG B . n 
B 1 566 PHE 566 535 535 PHE PHE B . n 
B 1 567 LEU 567 536 536 LEU LEU B . n 
B 1 568 PRO 568 537 537 PRO PRO B . n 
B 1 569 LYS 569 538 538 LYS LYS B . n 
B 1 570 LEU 570 539 539 LEU LEU B . n 
B 1 571 LEU 571 540 540 LEU LEU B . n 
B 1 572 SER 572 541 ?   ?   ?   B . n 
B 1 573 ALA 573 542 ?   ?   ?   B . n 
B 1 574 THR 574 543 ?   ?   ?   B . n 
B 1 575 ASP 575 544 ?   ?   ?   B . n 
B 1 576 THR 576 545 ?   ?   ?   B . n 
B 1 577 LEU 577 546 ?   ?   ?   B . n 
B 1 578 ASP 578 547 ?   ?   ?   B . n 
B 1 579 GLU 579 548 ?   ?   ?   B . n 
B 1 580 ALA 580 549 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAG 1   1501 1501 NAG NAG A . 
D 2 NAG 1   1701 1701 NAG NAG A . 
E 3 P6G 1   901  901  P6G P6G A . 
F 4 TZ4 1   951  951  TZ4 TZ4 A . 
G 4 TZ4 1   952  952  TZ4 TZ4 B . 
H 5 HOH 1   1702 501  HOH HOH A . 
H 5 HOH 2   1703 502  HOH HOH A . 
H 5 HOH 3   1704 503  HOH HOH A . 
H 5 HOH 4   1705 505  HOH HOH A . 
H 5 HOH 5   1706 507  HOH HOH A . 
H 5 HOH 6   1707 508  HOH HOH A . 
H 5 HOH 7   1708 509  HOH HOH A . 
H 5 HOH 8   1709 510  HOH HOH A . 
H 5 HOH 9   1710 511  HOH HOH A . 
H 5 HOH 10  1711 512  HOH HOH A . 
H 5 HOH 11  1712 513  HOH HOH A . 
H 5 HOH 12  1713 515  HOH HOH A . 
H 5 HOH 13  1714 516  HOH HOH A . 
H 5 HOH 14  1715 517  HOH HOH A . 
H 5 HOH 15  1716 518  HOH HOH A . 
H 5 HOH 16  1717 523  HOH HOH A . 
H 5 HOH 17  1718 524  HOH HOH A . 
H 5 HOH 18  1719 525  HOH HOH A . 
H 5 HOH 19  1720 527  HOH HOH A . 
H 5 HOH 20  1721 529  HOH HOH A . 
H 5 HOH 21  1722 533  HOH HOH A . 
H 5 HOH 22  1723 537  HOH HOH A . 
H 5 HOH 23  1724 539  HOH HOH A . 
H 5 HOH 24  1725 540  HOH HOH A . 
H 5 HOH 25  1726 541  HOH HOH A . 
H 5 HOH 26  1727 542  HOH HOH A . 
H 5 HOH 27  1728 543  HOH HOH A . 
H 5 HOH 28  1729 545  HOH HOH A . 
H 5 HOH 29  1730 547  HOH HOH A . 
H 5 HOH 30  1731 548  HOH HOH A . 
H 5 HOH 31  1732 549  HOH HOH A . 
H 5 HOH 32  1733 550  HOH HOH A . 
H 5 HOH 33  1734 551  HOH HOH A . 
H 5 HOH 34  1735 552  HOH HOH A . 
H 5 HOH 35  1736 553  HOH HOH A . 
H 5 HOH 36  1737 554  HOH HOH A . 
H 5 HOH 37  1738 556  HOH HOH A . 
H 5 HOH 38  1739 557  HOH HOH A . 
H 5 HOH 39  1740 560  HOH HOH A . 
H 5 HOH 40  1741 561  HOH HOH A . 
H 5 HOH 41  1742 563  HOH HOH A . 
H 5 HOH 42  1743 564  HOH HOH A . 
H 5 HOH 43  1744 568  HOH HOH A . 
H 5 HOH 44  1745 572  HOH HOH A . 
H 5 HOH 45  1746 575  HOH HOH A . 
H 5 HOH 46  1747 576  HOH HOH A . 
H 5 HOH 47  1748 578  HOH HOH A . 
H 5 HOH 48  1749 579  HOH HOH A . 
H 5 HOH 49  1750 580  HOH HOH A . 
H 5 HOH 50  1751 581  HOH HOH A . 
H 5 HOH 51  1752 583  HOH HOH A . 
H 5 HOH 52  1753 584  HOH HOH A . 
H 5 HOH 53  1754 586  HOH HOH A . 
H 5 HOH 54  1755 587  HOH HOH A . 
H 5 HOH 55  1756 588  HOH HOH A . 
H 5 HOH 56  1757 589  HOH HOH A . 
H 5 HOH 57  1758 592  HOH HOH A . 
H 5 HOH 58  1759 595  HOH HOH A . 
H 5 HOH 59  1760 596  HOH HOH A . 
H 5 HOH 60  1761 597  HOH HOH A . 
H 5 HOH 61  1762 598  HOH HOH A . 
H 5 HOH 62  1763 599  HOH HOH A . 
H 5 HOH 63  1764 601  HOH HOH A . 
H 5 HOH 64  1765 603  HOH HOH A . 
H 5 HOH 65  1766 604  HOH HOH A . 
H 5 HOH 66  1767 605  HOH HOH A . 
H 5 HOH 67  1768 606  HOH HOH A . 
H 5 HOH 68  1769 607  HOH HOH A . 
H 5 HOH 69  1770 609  HOH HOH A . 
H 5 HOH 70  1771 613  HOH HOH A . 
H 5 HOH 71  1772 614  HOH HOH A . 
H 5 HOH 72  1773 616  HOH HOH A . 
H 5 HOH 73  1774 617  HOH HOH A . 
H 5 HOH 74  1775 618  HOH HOH A . 
H 5 HOH 75  1776 620  HOH HOH A . 
H 5 HOH 76  1777 624  HOH HOH A . 
H 5 HOH 77  1778 626  HOH HOH A . 
H 5 HOH 78  1779 627  HOH HOH A . 
H 5 HOH 79  1780 628  HOH HOH A . 
H 5 HOH 80  1781 629  HOH HOH A . 
H 5 HOH 81  1782 630  HOH HOH A . 
H 5 HOH 82  1783 631  HOH HOH A . 
H 5 HOH 83  1784 632  HOH HOH A . 
H 5 HOH 84  1785 634  HOH HOH A . 
H 5 HOH 85  1786 638  HOH HOH A . 
H 5 HOH 86  1787 640  HOH HOH A . 
H 5 HOH 87  1788 645  HOH HOH A . 
H 5 HOH 88  1789 646  HOH HOH A . 
H 5 HOH 89  1790 649  HOH HOH A . 
H 5 HOH 90  1791 652  HOH HOH A . 
H 5 HOH 91  1792 656  HOH HOH A . 
H 5 HOH 92  1793 658  HOH HOH A . 
H 5 HOH 93  1794 660  HOH HOH A . 
H 5 HOH 94  1795 661  HOH HOH A . 
H 5 HOH 95  1796 662  HOH HOH A . 
H 5 HOH 96  1797 663  HOH HOH A . 
H 5 HOH 97  1798 666  HOH HOH A . 
H 5 HOH 98  1799 669  HOH HOH A . 
H 5 HOH 99  1800 671  HOH HOH A . 
H 5 HOH 100 1801 672  HOH HOH A . 
H 5 HOH 101 1802 673  HOH HOH A . 
H 5 HOH 102 1803 675  HOH HOH A . 
H 5 HOH 103 1804 676  HOH HOH A . 
H 5 HOH 104 1805 677  HOH HOH A . 
H 5 HOH 105 1806 678  HOH HOH A . 
H 5 HOH 106 1807 679  HOH HOH A . 
H 5 HOH 107 1808 680  HOH HOH A . 
H 5 HOH 108 1809 686  HOH HOH A . 
H 5 HOH 109 1810 687  HOH HOH A . 
H 5 HOH 110 1811 689  HOH HOH A . 
H 5 HOH 111 1812 691  HOH HOH A . 
H 5 HOH 112 1813 692  HOH HOH A . 
H 5 HOH 113 1814 693  HOH HOH A . 
H 5 HOH 114 1815 696  HOH HOH A . 
H 5 HOH 115 1816 698  HOH HOH A . 
H 5 HOH 116 1817 699  HOH HOH A . 
H 5 HOH 117 1818 700  HOH HOH A . 
H 5 HOH 118 1819 701  HOH HOH A . 
H 5 HOH 119 1820 703  HOH HOH A . 
H 5 HOH 120 1821 704  HOH HOH A . 
H 5 HOH 121 1822 705  HOH HOH A . 
H 5 HOH 122 1823 706  HOH HOH A . 
H 5 HOH 123 1824 707  HOH HOH A . 
H 5 HOH 124 1825 708  HOH HOH A . 
H 5 HOH 125 1826 709  HOH HOH A . 
H 5 HOH 126 1827 711  HOH HOH A . 
H 5 HOH 127 1828 712  HOH HOH A . 
H 5 HOH 128 1829 714  HOH HOH A . 
H 5 HOH 129 1830 716  HOH HOH A . 
H 5 HOH 130 1831 717  HOH HOH A . 
H 5 HOH 131 1832 721  HOH HOH A . 
H 5 HOH 132 1833 722  HOH HOH A . 
H 5 HOH 133 1834 724  HOH HOH A . 
H 5 HOH 134 1835 725  HOH HOH A . 
H 5 HOH 135 1836 726  HOH HOH A . 
H 5 HOH 136 1837 728  HOH HOH A . 
H 5 HOH 137 1838 729  HOH HOH A . 
H 5 HOH 138 1839 730  HOH HOH A . 
H 5 HOH 139 1840 731  HOH HOH A . 
H 5 HOH 140 1841 732  HOH HOH A . 
H 5 HOH 141 1842 734  HOH HOH A . 
H 5 HOH 142 1843 735  HOH HOH A . 
H 5 HOH 143 1844 736  HOH HOH A . 
H 5 HOH 144 1845 737  HOH HOH A . 
H 5 HOH 145 1846 738  HOH HOH A . 
H 5 HOH 146 1847 739  HOH HOH A . 
H 5 HOH 147 1848 745  HOH HOH A . 
H 5 HOH 148 1849 746  HOH HOH A . 
H 5 HOH 149 1850 747  HOH HOH A . 
H 5 HOH 150 1851 748  HOH HOH A . 
H 5 HOH 151 1852 750  HOH HOH A . 
H 5 HOH 152 1853 753  HOH HOH A . 
H 5 HOH 153 1854 754  HOH HOH A . 
H 5 HOH 154 1855 758  HOH HOH A . 
H 5 HOH 155 1856 759  HOH HOH A . 
H 5 HOH 156 1857 760  HOH HOH A . 
H 5 HOH 157 1858 762  HOH HOH A . 
H 5 HOH 158 1859 763  HOH HOH A . 
H 5 HOH 159 1860 764  HOH HOH A . 
H 5 HOH 160 1861 767  HOH HOH A . 
H 5 HOH 161 1862 769  HOH HOH A . 
H 5 HOH 162 1863 770  HOH HOH A . 
H 5 HOH 163 1864 773  HOH HOH A . 
H 5 HOH 164 1865 777  HOH HOH A . 
H 5 HOH 165 1866 779  HOH HOH A . 
H 5 HOH 166 1867 785  HOH HOH A . 
H 5 HOH 167 1868 786  HOH HOH A . 
H 5 HOH 168 1869 789  HOH HOH A . 
H 5 HOH 169 1870 790  HOH HOH A . 
H 5 HOH 170 1871 791  HOH HOH A . 
H 5 HOH 171 1872 792  HOH HOH A . 
H 5 HOH 172 1873 793  HOH HOH A . 
H 5 HOH 173 1874 794  HOH HOH A . 
H 5 HOH 174 1875 796  HOH HOH A . 
H 5 HOH 175 1876 797  HOH HOH A . 
H 5 HOH 176 1877 799  HOH HOH A . 
H 5 HOH 177 1878 803  HOH HOH A . 
H 5 HOH 178 1879 804  HOH HOH A . 
H 5 HOH 179 1880 805  HOH HOH A . 
H 5 HOH 180 1881 806  HOH HOH A . 
H 5 HOH 181 1882 807  HOH HOH A . 
H 5 HOH 182 1883 810  HOH HOH A . 
H 5 HOH 183 1884 811  HOH HOH A . 
H 5 HOH 184 1885 812  HOH HOH A . 
H 5 HOH 185 1886 813  HOH HOH A . 
H 5 HOH 186 1887 814  HOH HOH A . 
H 5 HOH 187 1888 818  HOH HOH A . 
H 5 HOH 188 1889 819  HOH HOH A . 
H 5 HOH 189 1890 820  HOH HOH A . 
H 5 HOH 190 1891 824  HOH HOH A . 
H 5 HOH 191 1892 828  HOH HOH A . 
H 5 HOH 192 1893 829  HOH HOH A . 
H 5 HOH 193 1894 830  HOH HOH A . 
H 5 HOH 194 1895 834  HOH HOH A . 
H 5 HOH 195 1896 838  HOH HOH A . 
H 5 HOH 196 1897 839  HOH HOH A . 
H 5 HOH 197 1898 844  HOH HOH A . 
H 5 HOH 198 1899 845  HOH HOH A . 
H 5 HOH 199 1900 846  HOH HOH A . 
H 5 HOH 200 1901 847  HOH HOH A . 
H 5 HOH 201 1902 848  HOH HOH A . 
H 5 HOH 202 1903 849  HOH HOH A . 
H 5 HOH 203 1904 850  HOH HOH A . 
H 5 HOH 204 1905 851  HOH HOH A . 
H 5 HOH 205 1906 852  HOH HOH A . 
H 5 HOH 206 1907 854  HOH HOH A . 
H 5 HOH 207 1908 855  HOH HOH A . 
H 5 HOH 208 1909 859  HOH HOH A . 
H 5 HOH 209 1910 861  HOH HOH A . 
H 5 HOH 210 1911 862  HOH HOH A . 
H 5 HOH 211 1912 863  HOH HOH A . 
H 5 HOH 212 1913 864  HOH HOH A . 
H 5 HOH 213 1914 865  HOH HOH A . 
H 5 HOH 214 1915 866  HOH HOH A . 
I 5 HOH 1   953  504  HOH HOH B . 
I 5 HOH 2   954  506  HOH HOH B . 
I 5 HOH 3   955  514  HOH HOH B . 
I 5 HOH 4   956  519  HOH HOH B . 
I 5 HOH 5   957  520  HOH HOH B . 
I 5 HOH 6   958  521  HOH HOH B . 
I 5 HOH 7   959  522  HOH HOH B . 
I 5 HOH 8   960  526  HOH HOH B . 
I 5 HOH 9   961  528  HOH HOH B . 
I 5 HOH 10  962  530  HOH HOH B . 
I 5 HOH 11  963  532  HOH HOH B . 
I 5 HOH 12  964  534  HOH HOH B . 
I 5 HOH 13  965  535  HOH HOH B . 
I 5 HOH 14  966  536  HOH HOH B . 
I 5 HOH 15  967  538  HOH HOH B . 
I 5 HOH 16  968  544  HOH HOH B . 
I 5 HOH 17  969  546  HOH HOH B . 
I 5 HOH 18  970  555  HOH HOH B . 
I 5 HOH 19  971  558  HOH HOH B . 
I 5 HOH 20  972  559  HOH HOH B . 
I 5 HOH 21  973  562  HOH HOH B . 
I 5 HOH 22  974  567  HOH HOH B . 
I 5 HOH 23  975  569  HOH HOH B . 
I 5 HOH 24  976  570  HOH HOH B . 
I 5 HOH 25  977  571  HOH HOH B . 
I 5 HOH 26  978  573  HOH HOH B . 
I 5 HOH 27  979  574  HOH HOH B . 
I 5 HOH 28  980  577  HOH HOH B . 
I 5 HOH 29  981  582  HOH HOH B . 
I 5 HOH 30  982  585  HOH HOH B . 
I 5 HOH 31  983  590  HOH HOH B . 
I 5 HOH 32  984  591  HOH HOH B . 
I 5 HOH 33  985  593  HOH HOH B . 
I 5 HOH 34  986  594  HOH HOH B . 
I 5 HOH 35  987  600  HOH HOH B . 
I 5 HOH 36  988  602  HOH HOH B . 
I 5 HOH 37  989  608  HOH HOH B . 
I 5 HOH 38  990  610  HOH HOH B . 
I 5 HOH 39  991  611  HOH HOH B . 
I 5 HOH 40  992  612  HOH HOH B . 
I 5 HOH 41  993  615  HOH HOH B . 
I 5 HOH 42  994  622  HOH HOH B . 
I 5 HOH 43  995  623  HOH HOH B . 
I 5 HOH 44  996  625  HOH HOH B . 
I 5 HOH 45  997  633  HOH HOH B . 
I 5 HOH 46  998  635  HOH HOH B . 
I 5 HOH 47  999  636  HOH HOH B . 
I 5 HOH 48  1000 639  HOH HOH B . 
I 5 HOH 49  1001 641  HOH HOH B . 
I 5 HOH 50  1002 642  HOH HOH B . 
I 5 HOH 51  1003 643  HOH HOH B . 
I 5 HOH 52  1004 644  HOH HOH B . 
I 5 HOH 53  1005 647  HOH HOH B . 
I 5 HOH 54  1006 648  HOH HOH B . 
I 5 HOH 55  1007 650  HOH HOH B . 
I 5 HOH 56  1008 651  HOH HOH B . 
I 5 HOH 57  1009 653  HOH HOH B . 
I 5 HOH 58  1010 654  HOH HOH B . 
I 5 HOH 59  1011 655  HOH HOH B . 
I 5 HOH 60  1012 659  HOH HOH B . 
I 5 HOH 61  1013 664  HOH HOH B . 
I 5 HOH 62  1014 665  HOH HOH B . 
I 5 HOH 63  1015 670  HOH HOH B . 
I 5 HOH 64  1016 674  HOH HOH B . 
I 5 HOH 65  1017 681  HOH HOH B . 
I 5 HOH 66  1018 682  HOH HOH B . 
I 5 HOH 67  1019 683  HOH HOH B . 
I 5 HOH 68  1020 684  HOH HOH B . 
I 5 HOH 69  1021 688  HOH HOH B . 
I 5 HOH 70  1022 694  HOH HOH B . 
I 5 HOH 71  1023 697  HOH HOH B . 
I 5 HOH 72  1024 710  HOH HOH B . 
I 5 HOH 73  1025 713  HOH HOH B . 
I 5 HOH 74  1026 718  HOH HOH B . 
I 5 HOH 75  1027 719  HOH HOH B . 
I 5 HOH 76  1028 720  HOH HOH B . 
I 5 HOH 77  1029 727  HOH HOH B . 
I 5 HOH 78  1030 733  HOH HOH B . 
I 5 HOH 79  1031 740  HOH HOH B . 
I 5 HOH 80  1032 741  HOH HOH B . 
I 5 HOH 81  1033 742  HOH HOH B . 
I 5 HOH 82  1034 744  HOH HOH B . 
I 5 HOH 83  1035 751  HOH HOH B . 
I 5 HOH 84  1036 752  HOH HOH B . 
I 5 HOH 85  1037 755  HOH HOH B . 
I 5 HOH 86  1038 761  HOH HOH B . 
I 5 HOH 87  1039 765  HOH HOH B . 
I 5 HOH 88  1040 771  HOH HOH B . 
I 5 HOH 89  1041 772  HOH HOH B . 
I 5 HOH 90  1042 774  HOH HOH B . 
I 5 HOH 91  1043 776  HOH HOH B . 
I 5 HOH 92  1044 778  HOH HOH B . 
I 5 HOH 93  1045 780  HOH HOH B . 
I 5 HOH 94  1046 781  HOH HOH B . 
I 5 HOH 95  1047 782  HOH HOH B . 
I 5 HOH 96  1048 783  HOH HOH B . 
I 5 HOH 97  1049 795  HOH HOH B . 
I 5 HOH 98  1050 798  HOH HOH B . 
I 5 HOH 99  1051 800  HOH HOH B . 
I 5 HOH 100 1052 801  HOH HOH B . 
I 5 HOH 101 1053 802  HOH HOH B . 
I 5 HOH 102 1054 808  HOH HOH B . 
I 5 HOH 103 1055 809  HOH HOH B . 
I 5 HOH 104 1056 815  HOH HOH B . 
I 5 HOH 105 1057 816  HOH HOH B . 
I 5 HOH 106 1058 817  HOH HOH B . 
I 5 HOH 107 1059 821  HOH HOH B . 
I 5 HOH 108 1060 822  HOH HOH B . 
I 5 HOH 109 1061 823  HOH HOH B . 
I 5 HOH 110 1062 831  HOH HOH B . 
I 5 HOH 111 1063 832  HOH HOH B . 
I 5 HOH 112 1064 833  HOH HOH B . 
I 5 HOH 113 1065 835  HOH HOH B . 
I 5 HOH 114 1066 836  HOH HOH B . 
I 5 HOH 115 1067 837  HOH HOH B . 
I 5 HOH 116 1068 840  HOH HOH B . 
I 5 HOH 117 1069 841  HOH HOH B . 
I 5 HOH 118 1070 842  HOH HOH B . 
I 5 HOH 119 1071 843  HOH HOH B . 
I 5 HOH 120 1072 856  HOH HOH B . 
I 5 HOH 121 1073 857  HOH HOH B . 
I 5 HOH 122 1074 860  HOH HOH B . 
I 5 HOH 123 1075 867  HOH HOH B . 
I 5 HOH 124 1076 868  HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 381 A ASN 350 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 495 A ASN 464 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-02-10 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Derived calculations'      
6 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' chem_comp                 
2 4 'Structure model' entity                    
3 4 'Structure model' pdbx_chem_comp_identifier 
4 4 'Structure model' pdbx_entity_nonpoly       
5 4 'Structure model' struct_conn               
6 4 'Structure model' struct_site               
7 4 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_chem_comp.name'                     
2 4 'Structure model' '_chem_comp.type'                     
3 4 'Structure model' '_entity.pdbx_description'            
4 4 'Structure model' '_pdbx_entity_nonpoly.name'           
5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
6 4 'Structure model' '_struct_conn.pdbx_role'              
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 27.8961 12.1817 16.5564  0.0406 0.0149 0.1069 0.0085  0.0064  0.0386  0.8644 0.6311 1.4504 -0.1744 0.1132 -0.3439 
-0.0566 -0.0184 -0.0325 -0.0097 0.0184  0.0297 0.2033 -0.0821 0.0382  'X-RAY DIFFRACTION' 
2 ? refined 7.9482  4.5817  -40.6097 0.0939 0.0937 0.1321 -0.0007 -0.0229 -0.0624 0.5770 0.8190 1.9912 -0.0613 0.0866 0.5009  
0.1036  0.0857  -0.0749 0.0758  -0.0982 0.0565 0.1460 0.0281  -0.0054 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 32 1 A 572 541 ? A A 'X-RAY DIFFRACTION' ? 
2 2 B 35 4 B 571 540 ? B B 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.1.24    ? 1 
DENZO  'data reduction' .         ? 2 
CCP4   'data scaling'   '(SCALA)' ? 3 
CNS    phasing          .         ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 1833 ? ? O B HOH 1048 ? ? 2.15 
2 1 O B HOH 1007 ? ? O B HOH 1063 ? ? 2.16 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 390 ? ? CG A ASP 390 ? ? OD2 A ASP 390 ? ? 124.14 118.30 5.84 0.90 N 
2 1 CB A ASP 396 ? ? CG A ASP 396 ? ? OD2 A ASP 396 ? ? 124.50 118.30 6.20 0.90 N 
3 1 CB A ASP 491 ? ? CG A ASP 491 ? ? OD2 A ASP 491 ? ? 124.25 118.30 5.95 0.90 N 
4 1 CB B ASP 5   ? ? CG B ASP 5   ? ? OD2 B ASP 5   ? ? 123.82 118.30 5.52 0.90 N 
5 1 CB B ASP 74  ? ? CG B ASP 74  ? ? OD2 B ASP 74  ? ? 124.48 118.30 6.18 0.90 N 
6 1 CB B ASP 349 ? ? CG B ASP 349 ? ? OD2 B ASP 349 ? ? 123.75 118.30 5.45 0.90 N 
7 1 CB B ASP 396 ? ? CG B ASP 396 ? ? OD2 B ASP 396 ? ? 123.73 118.30 5.43 0.90 N 
8 1 CB B ASP 404 ? ? CG B ASP 404 ? ? OD2 B ASP 404 ? ? 124.56 118.30 6.26 0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 71.16   -2.62   
2  1 ALA A 167 ? ? -151.03 69.44   
3  1 SER A 203 ? ? 58.28   -122.79 
4  1 ASP A 306 ? ? -129.75 -83.08  
5  1 SER A 371 ? ? -66.12  -178.99 
6  1 VAL A 407 ? ? -131.51 -64.45  
7  1 ALA B 167 ? ? -151.07 71.36   
8  1 SER B 203 ? ? 55.87   -123.06 
9  1 ASP B 306 ? ? -127.97 -82.36  
10 1 VAL B 407 ? ? -126.86 -64.03  
11 1 ASP B 494 ? ? -55.05  103.97  
12 1 SER B 497 ? ? -62.30  -145.46 
13 1 ALA B 506 ? ? -63.53  -72.88  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   SER 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    497 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    498 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -44.31 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 1   ? CG  ? A GLU 32  CG  
2  1 Y 1 A GLU 1   ? CD  ? A GLU 32  CD  
3  1 Y 1 A GLU 1   ? OE1 ? A GLU 32  OE1 
4  1 Y 1 A GLU 1   ? OE2 ? A GLU 32  OE2 
5  1 Y 1 A ARG 493 ? CG  ? A ARG 524 CG  
6  1 Y 1 A ARG 493 ? CD  ? A ARG 524 CD  
7  1 Y 1 A ARG 493 ? NE  ? A ARG 524 NE  
8  1 Y 1 A ARG 493 ? CZ  ? A ARG 524 CZ  
9  1 Y 1 A ARG 493 ? NH1 ? A ARG 524 NH1 
10 1 Y 1 A ARG 493 ? NH2 ? A ARG 524 NH2 
11 1 Y 1 A SER 495 ? OG  ? A SER 526 OG  
12 1 Y 1 A LYS 496 ? CG  ? A LYS 527 CG  
13 1 Y 1 A LYS 496 ? CD  ? A LYS 527 CD  
14 1 Y 1 A LYS 496 ? CE  ? A LYS 527 CE  
15 1 Y 1 A LYS 496 ? NZ  ? A LYS 527 NZ  
16 1 Y 1 B ARG 493 ? CG  ? B ARG 524 CG  
17 1 Y 1 B ARG 493 ? CD  ? B ARG 524 CD  
18 1 Y 1 B ARG 493 ? NE  ? B ARG 524 NE  
19 1 Y 1 B ARG 493 ? CZ  ? B ARG 524 CZ  
20 1 Y 1 B ARG 493 ? NH1 ? B ARG 524 NH1 
21 1 Y 1 B ARG 493 ? NH2 ? B ARG 524 NH2 
22 1 Y 1 B SER 495 ? OG  ? B SER 526 OG  
23 1 Y 1 B LYS 496 ? CG  ? B LYS 527 CG  
24 1 Y 1 B LYS 496 ? CD  ? B LYS 527 CD  
25 1 Y 1 B LYS 496 ? CE  ? B LYS 527 CE  
26 1 Y 1 B LYS 496 ? NZ  ? B LYS 527 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -30 ? A MET 1   
2  1 Y 1 A ARG -29 ? A ARG 2   
3  1 Y 1 A PRO -28 ? A PRO 3   
4  1 Y 1 A PRO -27 ? A PRO 4   
5  1 Y 1 A TRP -26 ? A TRP 5   
6  1 Y 1 A TYR -25 ? A TYR 6   
7  1 Y 1 A PRO -24 ? A PRO 7   
8  1 Y 1 A LEU -23 ? A LEU 8   
9  1 Y 1 A HIS -22 ? A HIS 9   
10 1 Y 1 A THR -21 ? A THR 10  
11 1 Y 1 A PRO -20 ? A PRO 11  
12 1 Y 1 A SER -19 ? A SER 12  
13 1 Y 1 A LEU -18 ? A LEU 13  
14 1 Y 1 A ALA -17 ? A ALA 14  
15 1 Y 1 A PHE -16 ? A PHE 15  
16 1 Y 1 A PRO -15 ? A PRO 16  
17 1 Y 1 A LEU -14 ? A LEU 17  
18 1 Y 1 A LEU -13 ? A LEU 18  
19 1 Y 1 A PHE -12 ? A PHE 19  
20 1 Y 1 A LEU -11 ? A LEU 20  
21 1 Y 1 A LEU -10 ? A LEU 21  
22 1 Y 1 A LEU -9  ? A LEU 22  
23 1 Y 1 A SER -8  ? A SER 23  
24 1 Y 1 A LEU -7  ? A LEU 24  
25 1 Y 1 A LEU -6  ? A LEU 25  
26 1 Y 1 A GLY -5  ? A GLY 26  
27 1 Y 1 A GLY -4  ? A GLY 27  
28 1 Y 1 A GLY -3  ? A GLY 28  
29 1 Y 1 A ALA -2  ? A ALA 29  
30 1 Y 1 A ARG -1  ? A ARG 30  
31 1 Y 1 A ALA 0   ? A ALA 31  
32 1 Y 1 A PRO 259 ? A PRO 290 
33 1 Y 1 A GLY 260 ? A GLY 291 
34 1 Y 1 A GLY 261 ? A GLY 292 
35 1 Y 1 A ALA 262 ? A ALA 293 
36 1 Y 1 A GLY 263 ? A GLY 294 
37 1 Y 1 A ALA 542 ? A ALA 573 
38 1 Y 1 A THR 543 ? A THR 574 
39 1 Y 1 A ASP 544 ? A ASP 575 
40 1 Y 1 A THR 545 ? A THR 576 
41 1 Y 1 A LEU 546 ? A LEU 577 
42 1 Y 1 A ASP 547 ? A ASP 578 
43 1 Y 1 A GLU 548 ? A GLU 579 
44 1 Y 1 A ALA 549 ? A ALA 580 
45 1 Y 1 B MET -30 ? B MET 1   
46 1 Y 1 B ARG -29 ? B ARG 2   
47 1 Y 1 B PRO -28 ? B PRO 3   
48 1 Y 1 B PRO -27 ? B PRO 4   
49 1 Y 1 B TRP -26 ? B TRP 5   
50 1 Y 1 B TYR -25 ? B TYR 6   
51 1 Y 1 B PRO -24 ? B PRO 7   
52 1 Y 1 B LEU -23 ? B LEU 8   
53 1 Y 1 B HIS -22 ? B HIS 9   
54 1 Y 1 B THR -21 ? B THR 10  
55 1 Y 1 B PRO -20 ? B PRO 11  
56 1 Y 1 B SER -19 ? B SER 12  
57 1 Y 1 B LEU -18 ? B LEU 13  
58 1 Y 1 B ALA -17 ? B ALA 14  
59 1 Y 1 B PHE -16 ? B PHE 15  
60 1 Y 1 B PRO -15 ? B PRO 16  
61 1 Y 1 B LEU -14 ? B LEU 17  
62 1 Y 1 B LEU -13 ? B LEU 18  
63 1 Y 1 B PHE -12 ? B PHE 19  
64 1 Y 1 B LEU -11 ? B LEU 20  
65 1 Y 1 B LEU -10 ? B LEU 21  
66 1 Y 1 B LEU -9  ? B LEU 22  
67 1 Y 1 B SER -8  ? B SER 23  
68 1 Y 1 B LEU -7  ? B LEU 24  
69 1 Y 1 B LEU -6  ? B LEU 25  
70 1 Y 1 B GLY -5  ? B GLY 26  
71 1 Y 1 B GLY -4  ? B GLY 27  
72 1 Y 1 B GLY -3  ? B GLY 28  
73 1 Y 1 B ALA -2  ? B ALA 29  
74 1 Y 1 B ARG -1  ? B ARG 30  
75 1 Y 1 B ALA 0   ? B ALA 31  
76 1 Y 1 B GLU 1   ? B GLU 32  
77 1 Y 1 B GLY 2   ? B GLY 33  
78 1 Y 1 B ARG 3   ? B ARG 34  
79 1 Y 1 B PRO 259 ? B PRO 290 
80 1 Y 1 B GLY 260 ? B GLY 291 
81 1 Y 1 B GLY 261 ? B GLY 292 
82 1 Y 1 B ALA 262 ? B ALA 293 
83 1 Y 1 B GLY 263 ? B GLY 294 
84 1 Y 1 B GLY 264 ? B GLY 295 
85 1 Y 1 B SER 541 ? B SER 572 
86 1 Y 1 B ALA 542 ? B ALA 573 
87 1 Y 1 B THR 543 ? B THR 574 
88 1 Y 1 B ASP 544 ? B ASP 575 
89 1 Y 1 B THR 545 ? B THR 576 
90 1 Y 1 B LEU 546 ? B LEU 577 
91 1 Y 1 B ASP 547 ? B ASP 578 
92 1 Y 1 B GLU 548 ? B GLU 579 
93 1 Y 1 B ALA 549 ? B ALA 580 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose                                                                                      
NAG 
3 'HEXAETHYLENE GLYCOL'                                                                                                         
P6G 
4 '3,8-DIAMINO-6-PHENYL-5-[6-[1-[2-[(1,2,3,4-TETRAHYDRO-9-ACRIDINYL)AMINO]ETHYL]-1H-1,2,3-TRIAZOL-4-YL]HEXYL]-PHENANTHRIDINIUM' 
TZ4 
5 water                                                                                                                         
HOH 
#