data_1Q9S
# 
_entry.id   1Q9S 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1Q9S         
RCSB  RCSB020095   
WWPDB D_1000020095 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1NB9 . unspecified 
PDB 1NBG . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1Q9S 
_pdbx_database_status.recvd_initial_deposition_date   2003-08-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Karthikeyan, S.' 1 
'Zhou, Q.'        2 
'Osterman, A.L.'  3 
'Zhang, H.'       4 
# 
_citation.id                        primary 
_citation.title                     
'Ligand binding-induced conformational changes in riboflavin kinase: structural basis for the ordered mechanism.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            42 
_citation.page_first                12532 
_citation.page_last                 12538 
_citation.year                      2003 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14580199 
_citation.pdbx_database_id_DOI      10.1021/bi035450t 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Karthikeyan, S.' 1 
primary 'Zhou, Q.'        2 
primary 'Osterman, A.L.'  3 
primary 'Zhang, H.'       4 
# 
_cell.entry_id           1Q9S 
_cell.length_a           76.312 
_cell.length_b           118.789 
_cell.length_c           37.979 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1Q9S 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'hypothetical protein FLJ11149' 17016.439 1  2.7.1.26 ? ? ? 
2 non-polymer syn 'MAGNESIUM ION'                 24.305    1  ?        ? ? ? 
3 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"      427.201   1  ?        ? ? ? 
4 non-polymer syn 'FLAVIN MONONUCLEOTIDE'         456.344   1  ?        ? ? ? 
5 water       nat water                           18.015    86 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;IMRHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYGWASVGSGDVHKMVVSIGWNPYYKNTKKSME
THIMHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKRLELPEYLKIKEDNFFQVSK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;IMRHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYGWASVGSGDVHKMVVSIGWNPYYKNTKKSME
THIMHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKRLELPEYLKIKEDNFFQVSK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   MET n 
1 3   ARG n 
1 4   HIS n 
1 5   LEU n 
1 6   PRO n 
1 7   TYR n 
1 8   PHE n 
1 9   CYS n 
1 10  ARG n 
1 11  GLY n 
1 12  GLN n 
1 13  VAL n 
1 14  VAL n 
1 15  ARG n 
1 16  GLY n 
1 17  PHE n 
1 18  GLY n 
1 19  ARG n 
1 20  GLY n 
1 21  SER n 
1 22  LYS n 
1 23  GLN n 
1 24  LEU n 
1 25  GLY n 
1 26  ILE n 
1 27  PRO n 
1 28  THR n 
1 29  ALA n 
1 30  ASN n 
1 31  PHE n 
1 32  PRO n 
1 33  GLU n 
1 34  GLN n 
1 35  VAL n 
1 36  VAL n 
1 37  ASP n 
1 38  ASN n 
1 39  LEU n 
1 40  PRO n 
1 41  ALA n 
1 42  ASP n 
1 43  ILE n 
1 44  SER n 
1 45  THR n 
1 46  GLY n 
1 47  ILE n 
1 48  TYR n 
1 49  TYR n 
1 50  GLY n 
1 51  TRP n 
1 52  ALA n 
1 53  SER n 
1 54  VAL n 
1 55  GLY n 
1 56  SER n 
1 57  GLY n 
1 58  ASP n 
1 59  VAL n 
1 60  HIS n 
1 61  LYS n 
1 62  MET n 
1 63  VAL n 
1 64  VAL n 
1 65  SER n 
1 66  ILE n 
1 67  GLY n 
1 68  TRP n 
1 69  ASN n 
1 70  PRO n 
1 71  TYR n 
1 72  TYR n 
1 73  LYS n 
1 74  ASN n 
1 75  THR n 
1 76  LYS n 
1 77  LYS n 
1 78  SER n 
1 79  MET n 
1 80  GLU n 
1 81  THR n 
1 82  HIS n 
1 83  ILE n 
1 84  MET n 
1 85  HIS n 
1 86  THR n 
1 87  PHE n 
1 88  LYS n 
1 89  GLU n 
1 90  ASP n 
1 91  PHE n 
1 92  TYR n 
1 93  GLY n 
1 94  GLU n 
1 95  ILE n 
1 96  LEU n 
1 97  ASN n 
1 98  VAL n 
1 99  ALA n 
1 100 ILE n 
1 101 VAL n 
1 102 GLY n 
1 103 TYR n 
1 104 LEU n 
1 105 ARG n 
1 106 PRO n 
1 107 GLU n 
1 108 LYS n 
1 109 ASN n 
1 110 PHE n 
1 111 ASP n 
1 112 SER n 
1 113 LEU n 
1 114 GLU n 
1 115 SER n 
1 116 LEU n 
1 117 ILE n 
1 118 SER n 
1 119 ALA n 
1 120 ILE n 
1 121 GLN n 
1 122 GLY n 
1 123 ASP n 
1 124 ILE n 
1 125 GLU n 
1 126 GLU n 
1 127 ALA n 
1 128 LYS n 
1 129 LYS n 
1 130 ARG n 
1 131 LEU n 
1 132 GLU n 
1 133 LEU n 
1 134 PRO n 
1 135 GLU n 
1 136 TYR n 
1 137 LEU n 
1 138 LYS n 
1 139 ILE n 
1 140 LYS n 
1 141 GLU n 
1 142 ASP n 
1 143 ASN n 
1 144 PHE n 
1 145 PHE n 
1 146 GLN n 
1 147 VAL n 
1 148 SER n 
1 149 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 FLJ11149 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PPROEX-HTA 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RIFK_HUMAN 
_struct_ref.pdbx_db_accession          Q969G6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;IMRHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYGWASVGSGDVHKMVVSIGWNPYYKNTKKSME
THIMHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKRLELPEHLKIKEDNFFQVSK
;
_struct_ref.pdbx_align_begin           7 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1Q9S 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 149 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q969G6 
_struct_ref_seq.db_align_beg                  7 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  155 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       7 
_struct_ref_seq.pdbx_auth_seq_align_end       155 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1Q9S 
_struct_ref_seq_dif.mon_id                       TYR 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      136 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q969G6 
_struct_ref_seq_dif.db_mon_id                    HIS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          142 
_struct_ref_seq_dif.details                      CONFLICT 
_struct_ref_seq_dif.pdbx_auth_seq_num            142 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE" ?                          'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                    ?                          'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ?                          'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ?                          'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ?                          'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ?                          'C3 H7 N O2 S'      121.158 
FMN non-polymer         . 'FLAVIN MONONUCLEOTIDE'    'RIBOFLAVIN MONOPHOSPHATE' 'C17 H21 N4 O9 P'   456.344 
GLN 'L-peptide linking' y GLUTAMINE                  ?                          'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ?                          'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ?                          'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ?                          'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ?                          'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ?                          'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ?                          'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ?                          'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ?                          'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ?                          'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ?                          'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ?                          'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ?                          'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ?                          'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ?                          'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ?                          'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ?                          'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1Q9S 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.34 
_exptl_crystal.density_percent_sol   47.4 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.7 
_exptl_crystal_grow.pdbx_details    
'PEG MME 5000, ammonium sulphate, sodium acetate, pH 4.7, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2003-05-05 
_diffrn_detector.details                'OSMIC MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    MIRRORS 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1Q9S 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.42 
_reflns.number_obs                   6905 
_reflns.number_all                   6905 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.061 
_reflns.pdbx_netI_over_sigmaI        35.5 
_reflns.B_iso_Wilson_estimate        28.5 
_reflns.pdbx_redundancy              6.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.42 
_reflns_shell.d_res_low              2.51 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.241 
_reflns_shell.meanI_over_sigI_obs    7.2 
_reflns_shell.pdbx_redundancy        5.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      656 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1Q9S 
_refine.ls_number_reflns_obs                     6896 
_refine.ls_number_reflns_all                     6905 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               1023651.21 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             35.15 
_refine.ls_d_res_high                            2.42 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_obs                          0.199 
_refine.ls_R_factor_all                          0.222 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.26 
_refine.ls_R_factor_R_free_error                 0.014 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  330 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               32.2 
_refine.aniso_B[1][1]                            -5.92 
_refine.aniso_B[2][2]                            4.07 
_refine.aniso_B[3][3]                            1.85 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.380922 
_refine.solvent_model_param_bsol                 42.0074 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1NB9' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1Q9S 
_refine_analyze.Luzzati_coordinate_error_obs    0.26 
_refine_analyze.Luzzati_sigma_a_obs             0.24 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.36 
_refine_analyze.Luzzati_sigma_a_free            0.35 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1192 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         59 
_refine_hist.number_atoms_solvent             86 
_refine_hist.number_atoms_total               1337 
_refine_hist.d_res_high                       2.42 
_refine_hist.d_res_low                        35.15 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.012 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.6   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.11  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.36  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.24  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.06  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.05  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.42 
_refine_ls_shell.d_res_low                        2.57 
_refine_ls_shell.number_reflns_R_work             1063 
_refine_ls_shell.R_factor_R_work                  0.236 
_refine_ls_shell.percent_reflns_obs               98.7 
_refine_ls_shell.R_factor_R_free                  0.313 
_refine_ls_shell.R_factor_R_free_error            0.047 
_refine_ls_shell.percent_reflns_R_free            4.1 
_refine_ls_shell.number_reflns_R_free             45 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
3 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
4 ADP.PAR           ADP.TOP     'X-RAY DIFFRACTION' 
5 FMN.PAR           FMN.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1Q9S 
_struct.title                     'Crystal structure of riboflavin kinase with ternary product complex' 
_struct.pdbx_descriptor           'hypothetical protein FLJ11149 (E.C.2.7.1.26)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1Q9S 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRANSFERASE, BETA BARREL, RIBOFLAVIN, RIBOFLAVIN KINASE, FMN binding protein, complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 19  ? GLY A 25  ? ARG A 25  GLY A 31  1 ? 7  
HELX_P HELX_P2 2 PRO A 32  ? ASN A 38  ? PRO A 38  ASN A 44  1 ? 7  
HELX_P HELX_P3 3 SER A 112 ? LEU A 131 ? SER A 118 LEU A 137 1 ? 20 
HELX_P HELX_P4 4 LEU A 133 ? LYS A 140 ? LEU A 139 LYS A 146 1 ? 8  
HELX_P HELX_P5 5 ASP A 142 ? VAL A 147 ? ASP A 148 VAL A 153 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A THR 28 OG1 ? ? ? 1_555 B MG  . MG    ? ? A THR 34  A MG  201 1_555 ? ? ? ? ? ? ? 2.399 ? 
metalc2 metalc ? ? A ASN 30 OD1 ? ? ? 1_555 B MG  . MG    ? ? A ASN 36  A MG  201 1_555 ? ? ? ? ? ? ? 2.334 ? 
metalc3 metalc ? ? A THR 28 O   ? ? ? 1_555 B MG  . MG    ? ? A THR 34  A MG  201 1_555 ? ? ? ? ? ? ? 2.240 ? 
metalc4 metalc ? ? B MG  .  MG  ? ? ? 1_555 C ADP . O1B   ? ? A MG  201 A ADP 301 1_555 ? ? ? ? ? ? ? 2.092 ? 
metalc5 metalc ? ? B MG  .  MG  ? ? ? 1_555 C ADP . O2A   ? ? A MG  201 A ADP 301 1_555 ? ? ? ? ? ? ? 2.363 ? 
metalc6 metalc ? ? B MG  .  MG  ? ? ? 1_555 D FMN . O1P   ? ? A MG  201 A FMN 401 1_555 ? ? ? ? ? ? ? 1.991 ? 
covale1 covale ? ? A GLU 80 OE1 ? ? ? 1_555 D FMN . "O3'" ? ? A GLU 86  A FMN 401 1_555 ? ? ? ? ? ? ? 2.408 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LEU 
_struct_mon_prot_cis.label_seq_id           5 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LEU 
_struct_mon_prot_cis.auth_seq_id            11 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    6 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     12 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.01 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 7  ? GLN A 12  ? TYR A 13  GLN A 18  
A 2 ILE A 95 ? ARG A 105 ? ILE A 101 ARG A 111 
A 3 GLY A 46 ? VAL A 54  ? GLY A 52  VAL A 60  
A 4 HIS A 60 ? GLY A 67  ? HIS A 66  GLY A 73  
A 5 SER A 78 ? ILE A 83  ? SER A 84  ILE A 89  
A 6 ALA A 29 ? ASN A 30  ? ALA A 35  ASN A 36  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY A 11  ? N GLY A 17  O LEU A 96 ? O LEU A 102 
A 2 3 O ARG A 105 ? O ARG A 111 N ILE A 47 ? N ILE A 53  
A 3 4 N TYR A 48  ? N TYR A 54  O VAL A 64 ? O VAL A 70  
A 4 5 N VAL A 63  ? N VAL A 69  O HIS A 82 ? O HIS A 88  
A 5 6 O THR A 81  ? O THR A 87  N ALA A 29 ? N ALA A 35  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 201'  
AC2 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE ADP A 301' 
AC3 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE FMN A 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  THR A 28  ? THR A 34  . ? 1_555 ? 
2  AC1 4  ASN A 30  ? ASN A 36  . ? 1_555 ? 
3  AC1 4  ADP C .   ? ADP A 301 . ? 1_555 ? 
4  AC1 4  FMN D .   ? FMN A 401 . ? 1_555 ? 
5  AC2 22 VAL A 13  ? VAL A 19  . ? 1_555 ? 
6  AC2 22 GLY A 16  ? GLY A 22  . ? 1_555 ? 
7  AC2 22 PHE A 17  ? PHE A 23  . ? 1_555 ? 
8  AC2 22 GLY A 18  ? GLY A 24  . ? 1_555 ? 
9  AC2 22 GLY A 20  ? GLY A 26  . ? 1_555 ? 
10 AC2 22 SER A 21  ? SER A 27  . ? 1_555 ? 
11 AC2 22 PRO A 27  ? PRO A 33  . ? 1_555 ? 
12 AC2 22 THR A 28  ? THR A 34  . ? 1_555 ? 
13 AC2 22 ALA A 29  ? ALA A 35  . ? 1_555 ? 
14 AC2 22 ASN A 30  ? ASN A 36  . ? 1_555 ? 
15 AC2 22 THR A 81  ? THR A 87  . ? 1_555 ? 
16 AC2 22 ILE A 83  ? ILE A 89  . ? 1_555 ? 
17 AC2 22 HIS A 85  ? HIS A 91  . ? 1_555 ? 
18 AC2 22 ASP A 90  ? ASP A 96  . ? 1_555 ? 
19 AC2 22 PHE A 91  ? PHE A 97  . ? 1_555 ? 
20 AC2 22 TYR A 92  ? TYR A 98  . ? 1_555 ? 
21 AC2 22 MG  B .   ? MG  A 201 . ? 1_555 ? 
22 AC2 22 FMN D .   ? FMN A 401 . ? 1_555 ? 
23 AC2 22 HOH E .   ? HOH A 502 . ? 1_555 ? 
24 AC2 22 HOH E .   ? HOH A 514 . ? 1_555 ? 
25 AC2 22 HOH E .   ? HOH A 516 . ? 1_555 ? 
26 AC2 22 HOH E .   ? HOH A 529 . ? 1_555 ? 
27 AC3 25 GLY A 16  ? GLY A 22  . ? 1_555 ? 
28 AC3 25 PHE A 17  ? PHE A 23  . ? 1_555 ? 
29 AC3 25 GLY A 18  ? GLY A 24  . ? 1_555 ? 
30 AC3 25 ARG A 19  ? ARG A 25  . ? 1_555 ? 
31 AC3 25 GLY A 20  ? GLY A 26  . ? 1_555 ? 
32 AC3 25 THR A 28  ? THR A 34  . ? 1_555 ? 
33 AC3 25 ASN A 30  ? ASN A 36  . ? 1_555 ? 
34 AC3 25 ILE A 47  ? ILE A 53  . ? 1_555 ? 
35 AC3 25 VAL A 63  ? VAL A 69  . ? 1_555 ? 
36 AC3 25 SER A 65  ? SER A 71  . ? 1_555 ? 
37 AC3 25 ASN A 69  ? ASN A 75  . ? 1_555 ? 
38 AC3 25 PRO A 70  ? PRO A 76  . ? 1_555 ? 
39 AC3 25 TYR A 71  ? TYR A 77  . ? 1_555 ? 
40 AC3 25 TYR A 72  ? TYR A 78  . ? 1_555 ? 
41 AC3 25 GLU A 80  ? GLU A 86  . ? 1_555 ? 
42 AC3 25 ARG A 105 ? ARG A 111 . ? 1_555 ? 
43 AC3 25 LYS A 108 ? LYS A 114 . ? 1_555 ? 
44 AC3 25 PHE A 110 ? PHE A 116 . ? 1_555 ? 
45 AC3 25 ILE A 120 ? ILE A 126 . ? 1_555 ? 
46 AC3 25 ASP A 123 ? ASP A 129 . ? 1_555 ? 
47 AC3 25 MG  B .   ? MG  A 201 . ? 1_555 ? 
48 AC3 25 ADP C .   ? ADP A 301 . ? 1_555 ? 
49 AC3 25 HOH E .   ? HOH A 503 . ? 1_555 ? 
50 AC3 25 HOH E .   ? HOH A 505 . ? 1_555 ? 
51 AC3 25 HOH E .   ? HOH A 568 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1Q9S 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1Q9S 
_atom_sites.fract_transf_matrix[1][1]   0.013104 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008418 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.026330 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ILE A 1 1   ? 4.564  38.496 1.795  1.00 64.04 ? 7   ILE A N     1 
ATOM   2    C  CA    . ILE A 1 1   ? 3.068  38.619 1.899  1.00 65.36 ? 7   ILE A CA    1 
ATOM   3    C  C     . ILE A 1 1   ? 2.661  38.958 3.320  1.00 65.87 ? 7   ILE A C     1 
ATOM   4    O  O     . ILE A 1 1   ? 1.553  39.437 3.575  1.00 65.16 ? 7   ILE A O     1 
ATOM   5    N  N     . MET A 1 2   ? 3.579  38.674 4.243  1.00 66.85 ? 8   MET A N     1 
ATOM   6    C  CA    . MET A 1 2   ? 3.385  38.952 5.654  1.00 66.91 ? 8   MET A CA    1 
ATOM   7    C  C     . MET A 1 2   ? 4.121  40.245 5.951  1.00 67.60 ? 8   MET A C     1 
ATOM   8    O  O     . MET A 1 2   ? 4.492  40.552 7.099  1.00 67.46 ? 8   MET A O     1 
ATOM   9    N  N     . ARG A 1 3   ? 4.359  40.990 4.872  1.00 66.86 ? 9   ARG A N     1 
ATOM   10   C  CA    . ARG A 1 3   ? 4.994  42.296 4.939  1.00 66.28 ? 9   ARG A CA    1 
ATOM   11   C  C     . ARG A 1 3   ? 3.976  43.191 5.662  1.00 66.05 ? 9   ARG A C     1 
ATOM   12   O  O     . ARG A 1 3   ? 3.774  44.358 5.286  1.00 65.73 ? 9   ARG A O     1 
ATOM   13   C  CB    . ARG A 1 3   ? 5.205  42.862 3.543  1.00 66.18 ? 9   ARG A CB    1 
ATOM   14   C  CG    . ARG A 1 3   ? 5.892  41.951 2.563  1.00 65.63 ? 9   ARG A CG    1 
ATOM   15   C  CD    . ARG A 1 3   ? 7.375  42.093 2.690  1.00 64.10 ? 9   ARG A CD    1 
ATOM   16   N  NE    . ARG A 1 3   ? 7.913  41.156 3.660  1.00 63.00 ? 9   ARG A NE    1 
ATOM   17   C  CZ    . ARG A 1 3   ? 9.205  41.048 3.933  1.00 61.91 ? 9   ARG A CZ    1 
ATOM   18   N  NH1   . ARG A 1 3   ? 10.080 41.826 3.311  1.00 62.11 ? 9   ARG A NH1   1 
ATOM   19   N  NH2   . ARG A 1 3   ? 9.622  40.149 4.808  1.00 61.89 ? 9   ARG A NH2   1 
ATOM   20   N  N     . HIS A 1 4   ? 3.296  42.604 6.651  1.00 64.27 ? 10  HIS A N     1 
ATOM   21   C  CA    . HIS A 1 4   ? 2.313  43.300 7.487  1.00 61.41 ? 10  HIS A CA    1 
ATOM   22   C  C     . HIS A 1 4   ? 3.036  43.520 8.821  1.00 58.06 ? 10  HIS A C     1 
ATOM   23   O  O     . HIS A 1 4   ? 2.533  43.188 9.896  1.00 58.94 ? 10  HIS A O     1 
ATOM   24   C  CB    . HIS A 1 4   ? 1.046  42.441 7.704  1.00 63.02 ? 10  HIS A CB    1 
ATOM   25   C  CG    . HIS A 1 4   ? 0.042  42.538 6.592  1.00 65.56 ? 10  HIS A CG    1 
ATOM   26   N  ND1   . HIS A 1 4   ? -0.707 43.674 6.358  1.00 65.84 ? 10  HIS A ND1   1 
ATOM   27   C  CD2   . HIS A 1 4   ? -0.310 41.651 5.627  1.00 66.50 ? 10  HIS A CD2   1 
ATOM   28   C  CE1   . HIS A 1 4   ? -1.472 43.485 5.297  1.00 65.69 ? 10  HIS A CE1   1 
ATOM   29   N  NE2   . HIS A 1 4   ? -1.250 42.266 4.833  1.00 65.93 ? 10  HIS A NE2   1 
ATOM   30   N  N     . LEU A 1 5   ? 4.250  44.045 8.735  1.00 52.60 ? 11  LEU A N     1 
ATOM   31   C  CA    . LEU A 1 5   ? 5.020  44.329 9.921  1.00 47.07 ? 11  LEU A CA    1 
ATOM   32   C  C     . LEU A 1 5   ? 4.159  45.337 10.691 1.00 44.92 ? 11  LEU A C     1 
ATOM   33   O  O     . LEU A 1 5   ? 3.140  45.805 10.189 1.00 45.88 ? 11  LEU A O     1 
ATOM   34   C  CB    . LEU A 1 5   ? 6.359  44.918 9.500  1.00 44.32 ? 11  LEU A CB    1 
ATOM   35   C  CG    . LEU A 1 5   ? 7.090  44.050 8.464  1.00 42.74 ? 11  LEU A CG    1 
ATOM   36   C  CD1   . LEU A 1 5   ? 8.326  44.801 7.941  1.00 40.35 ? 11  LEU A CD1   1 
ATOM   37   C  CD2   . LEU A 1 5   ? 7.470  42.714 9.099  1.00 40.15 ? 11  LEU A CD2   1 
ATOM   38   N  N     . PRO A 1 6   ? 4.536  45.675 11.920 1.00 41.25 ? 12  PRO A N     1 
ATOM   39   C  CA    . PRO A 1 6   ? 5.711  45.156 12.591 1.00 39.60 ? 12  PRO A CA    1 
ATOM   40   C  C     . PRO A 1 6   ? 5.471  43.720 13.005 1.00 38.40 ? 12  PRO A C     1 
ATOM   41   O  O     . PRO A 1 6   ? 4.324  43.281 13.158 1.00 36.76 ? 12  PRO A O     1 
ATOM   42   C  CB    . PRO A 1 6   ? 5.833  46.077 13.789 1.00 40.56 ? 12  PRO A CB    1 
ATOM   43   C  CG    . PRO A 1 6   ? 4.388  46.243 14.176 1.00 40.71 ? 12  PRO A CG    1 
ATOM   44   C  CD    . PRO A 1 6   ? 3.721  46.488 12.841 1.00 40.25 ? 12  PRO A CD    1 
ATOM   45   N  N     . TYR A 1 7   ? 6.568  42.993 13.161 1.00 36.19 ? 13  TYR A N     1 
ATOM   46   C  CA    . TYR A 1 7   ? 6.522  41.619 13.619 1.00 34.33 ? 13  TYR A CA    1 
ATOM   47   C  C     . TYR A 1 7   ? 7.238  41.648 14.971 1.00 33.38 ? 13  TYR A C     1 
ATOM   48   O  O     . TYR A 1 7   ? 8.345  42.174 15.076 1.00 32.89 ? 13  TYR A O     1 
ATOM   49   C  CB    . TYR A 1 7   ? 7.257  40.700 12.651 1.00 33.77 ? 13  TYR A CB    1 
ATOM   50   C  CG    . TYR A 1 7   ? 7.441  39.303 13.204 1.00 35.17 ? 13  TYR A CG    1 
ATOM   51   C  CD1   . TYR A 1 7   ? 6.344  38.475 13.435 1.00 35.91 ? 13  TYR A CD1   1 
ATOM   52   C  CD2   . TYR A 1 7   ? 8.703  38.843 13.583 1.00 34.49 ? 13  TYR A CD2   1 
ATOM   53   C  CE1   . TYR A 1 7   ? 6.498  37.236 14.032 1.00 35.24 ? 13  TYR A CE1   1 
ATOM   54   C  CE2   . TYR A 1 7   ? 8.866  37.608 14.182 1.00 35.23 ? 13  TYR A CE2   1 
ATOM   55   C  CZ    . TYR A 1 7   ? 7.761  36.812 14.405 1.00 35.78 ? 13  TYR A CZ    1 
ATOM   56   O  OH    . TYR A 1 7   ? 7.913  35.592 15.013 1.00 38.28 ? 13  TYR A OH    1 
ATOM   57   N  N     . PHE A 1 8   ? 6.610  41.107 16.007 1.00 32.10 ? 14  PHE A N     1 
ATOM   58   C  CA    . PHE A 1 8   ? 7.238  41.102 17.326 1.00 31.57 ? 14  PHE A CA    1 
ATOM   59   C  C     . PHE A 1 8   ? 7.711  39.712 17.713 1.00 32.16 ? 14  PHE A C     1 
ATOM   60   O  O     . PHE A 1 8   ? 7.133  38.715 17.277 1.00 32.50 ? 14  PHE A O     1 
ATOM   61   C  CB    . PHE A 1 8   ? 6.274  41.578 18.410 1.00 30.24 ? 14  PHE A CB    1 
ATOM   62   C  CG    . PHE A 1 8   ? 5.678  42.919 18.149 1.00 32.15 ? 14  PHE A CG    1 
ATOM   63   C  CD1   . PHE A 1 8   ? 4.577  43.054 17.290 1.00 30.98 ? 14  PHE A CD1   1 
ATOM   64   C  CD2   . PHE A 1 8   ? 6.192  44.053 18.777 1.00 30.85 ? 14  PHE A CD2   1 
ATOM   65   C  CE1   . PHE A 1 8   ? 3.992  44.298 17.063 1.00 30.51 ? 14  PHE A CE1   1 
ATOM   66   C  CE2   . PHE A 1 8   ? 5.614  45.302 18.557 1.00 31.45 ? 14  PHE A CE2   1 
ATOM   67   C  CZ    . PHE A 1 8   ? 4.508  45.426 17.697 1.00 30.92 ? 14  PHE A CZ    1 
ATOM   68   N  N     . CYS A 1 9   ? 8.761  39.657 18.530 1.00 30.05 ? 15  CYS A N     1 
ATOM   69   C  CA    . CYS A 1 9   ? 9.298  38.398 19.021 1.00 29.58 ? 15  CYS A CA    1 
ATOM   70   C  C     . CYS A 1 9   ? 10.368 38.726 20.031 1.00 29.33 ? 15  CYS A C     1 
ATOM   71   O  O     . CYS A 1 9   ? 10.931 39.820 20.017 1.00 29.21 ? 15  CYS A O     1 
ATOM   72   C  CB    . CYS A 1 9   ? 9.888  37.548 17.886 1.00 29.35 ? 15  CYS A CB    1 
ATOM   73   S  SG    . CYS A 1 9   ? 11.329 38.273 17.102 1.00 31.47 ? 15  CYS A SG    1 
ATOM   74   N  N     . ARG A 1 10  ? 10.624 37.780 20.921 1.00 29.90 ? 16  ARG A N     1 
ATOM   75   C  CA    . ARG A 1 10  ? 11.640 37.936 21.966 1.00 32.49 ? 16  ARG A CA    1 
ATOM   76   C  C     . ARG A 1 10  ? 12.625 36.795 21.787 1.00 30.74 ? 16  ARG A C     1 
ATOM   77   O  O     . ARG A 1 10  ? 12.258 35.740 21.291 1.00 31.64 ? 16  ARG A O     1 
ATOM   78   C  CB    . ARG A 1 10  ? 11.012 37.812 23.349 1.00 34.25 ? 16  ARG A CB    1 
ATOM   79   C  CG    . ARG A 1 10  ? 9.739  38.569 23.515 1.00 38.54 ? 16  ARG A CG    1 
ATOM   80   C  CD    . ARG A 1 10  ? 9.152  38.275 24.886 1.00 43.87 ? 16  ARG A CD    1 
ATOM   81   N  NE    . ARG A 1 10  ? 7.886  38.974 25.092 1.00 49.11 ? 16  ARG A NE    1 
ATOM   82   C  CZ    . ARG A 1 10  ? 7.740  40.300 25.017 1.00 51.88 ? 16  ARG A CZ    1 
ATOM   83   N  NH1   . ARG A 1 10  ? 8.781  41.082 24.739 1.00 52.31 ? 16  ARG A NH1   1 
ATOM   84   N  NH2   . ARG A 1 10  ? 6.550  40.853 25.226 1.00 53.16 ? 16  ARG A NH2   1 
ATOM   85   N  N     . GLY A 1 11  ? 13.870 36.994 22.180 1.00 29.43 ? 17  GLY A N     1 
ATOM   86   C  CA    . GLY A 1 11  ? 14.834 35.921 22.035 1.00 27.69 ? 17  GLY A CA    1 
ATOM   87   C  C     . GLY A 1 11  ? 15.921 36.089 23.066 1.00 26.50 ? 17  GLY A C     1 
ATOM   88   O  O     . GLY A 1 11  ? 16.195 37.215 23.463 1.00 26.35 ? 17  GLY A O     1 
ATOM   89   N  N     . GLN A 1 12  ? 16.518 34.992 23.530 1.00 25.17 ? 18  GLN A N     1 
ATOM   90   C  CA    . GLN A 1 12  ? 17.600 35.101 24.499 1.00 24.37 ? 18  GLN A CA    1 
ATOM   91   C  C     . GLN A 1 12  ? 18.859 35.472 23.716 1.00 24.53 ? 18  GLN A C     1 
ATOM   92   O  O     . GLN A 1 12  ? 19.102 34.937 22.639 1.00 25.56 ? 18  GLN A O     1 
ATOM   93   C  CB    . GLN A 1 12  ? 17.806 33.781 25.230 1.00 24.30 ? 18  GLN A CB    1 
ATOM   94   C  CG    . GLN A 1 12  ? 18.800 33.865 26.375 1.00 23.15 ? 18  GLN A CG    1 
ATOM   95   C  CD    . GLN A 1 12  ? 18.685 32.689 27.338 1.00 24.30 ? 18  GLN A CD    1 
ATOM   96   O  OE1   . GLN A 1 12  ? 19.070 32.795 28.511 1.00 23.43 ? 18  GLN A OE1   1 
ATOM   97   N  NE2   . GLN A 1 12  ? 18.157 31.565 26.849 1.00 21.54 ? 18  GLN A NE2   1 
ATOM   98   N  N     . VAL A 1 13  ? 19.647 36.398 24.239 1.00 24.35 ? 19  VAL A N     1 
ATOM   99   C  CA    . VAL A 1 13  ? 20.856 36.811 23.547 1.00 23.28 ? 19  VAL A CA    1 
ATOM   100  C  C     . VAL A 1 13  ? 21.953 35.787 23.771 1.00 23.68 ? 19  VAL A C     1 
ATOM   101  O  O     . VAL A 1 13  ? 22.370 35.560 24.904 1.00 27.62 ? 19  VAL A O     1 
ATOM   102  C  CB    . VAL A 1 13  ? 21.269 38.213 24.029 1.00 23.57 ? 19  VAL A CB    1 
ATOM   103  C  CG1   . VAL A 1 13  ? 22.553 38.660 23.357 1.00 24.03 ? 19  VAL A CG1   1 
ATOM   104  C  CG2   . VAL A 1 13  ? 20.148 39.197 23.701 1.00 20.80 ? 19  VAL A CG2   1 
ATOM   105  N  N     . VAL A 1 14  ? 22.414 35.164 22.690 1.00 22.70 ? 20  VAL A N     1 
ATOM   106  C  CA    . VAL A 1 14  ? 23.434 34.121 22.763 1.00 21.08 ? 20  VAL A CA    1 
ATOM   107  C  C     . VAL A 1 14  ? 24.703 34.455 21.963 1.00 22.97 ? 20  VAL A C     1 
ATOM   108  O  O     . VAL A 1 14  ? 24.728 35.409 21.186 1.00 23.67 ? 20  VAL A O     1 
ATOM   109  C  CB    . VAL A 1 14  ? 22.875 32.759 22.223 1.00 21.08 ? 20  VAL A CB    1 
ATOM   110  C  CG1   . VAL A 1 14  ? 21.566 32.356 22.978 1.00 17.21 ? 20  VAL A CG1   1 
ATOM   111  C  CG2   . VAL A 1 14  ? 22.615 32.876 20.713 1.00 15.42 ? 20  VAL A CG2   1 
ATOM   112  N  N     . ARG A 1 15  ? 25.746 33.645 22.146 1.00 23.00 ? 21  ARG A N     1 
ATOM   113  C  CA    . ARG A 1 15  ? 27.013 33.844 21.439 1.00 23.42 ? 21  ARG A CA    1 
ATOM   114  C  C     . ARG A 1 15  ? 26.938 33.611 19.928 1.00 21.83 ? 21  ARG A C     1 
ATOM   115  O  O     . ARG A 1 15  ? 26.284 32.675 19.455 1.00 19.71 ? 21  ARG A O     1 
ATOM   116  C  CB    . ARG A 1 15  ? 28.082 32.919 22.022 1.00 24.01 ? 21  ARG A CB    1 
ATOM   117  C  CG    . ARG A 1 15  ? 28.522 33.289 23.412 1.00 24.57 ? 21  ARG A CG    1 
ATOM   118  C  CD    . ARG A 1 15  ? 29.438 34.504 23.391 1.00 28.78 ? 21  ARG A CD    1 
ATOM   119  N  NE    . ARG A 1 15  ? 29.671 35.053 24.733 1.00 30.65 ? 21  ARG A NE    1 
ATOM   120  C  CZ    . ARG A 1 15  ? 30.542 36.026 24.990 1.00 32.77 ? 21  ARG A CZ    1 
ATOM   121  N  NH1   . ARG A 1 15  ? 31.264 36.546 24.008 1.00 32.26 ? 21  ARG A NH1   1 
ATOM   122  N  NH2   . ARG A 1 15  ? 30.676 36.503 26.217 1.00 33.70 ? 21  ARG A NH2   1 
ATOM   123  N  N     . GLY A 1 16  ? 27.627 34.471 19.183 1.00 20.77 ? 22  GLY A N     1 
ATOM   124  C  CA    . GLY A 1 16  ? 27.683 34.367 17.729 1.00 19.69 ? 22  GLY A CA    1 
ATOM   125  C  C     . GLY A 1 16  ? 29.098 33.916 17.358 1.00 20.50 ? 22  GLY A C     1 
ATOM   126  O  O     . GLY A 1 16  ? 29.746 33.214 18.116 1.00 20.58 ? 22  GLY A O     1 
ATOM   127  N  N     . PHE A 1 17  ? 29.601 34.310 16.204 1.00 21.03 ? 23  PHE A N     1 
ATOM   128  C  CA    . PHE A 1 17  ? 30.944 33.905 15.803 1.00 21.05 ? 23  PHE A CA    1 
ATOM   129  C  C     . PHE A 1 17  ? 32.023 34.787 16.401 1.00 21.90 ? 23  PHE A C     1 
ATOM   130  O  O     . PHE A 1 17  ? 33.197 34.520 16.223 1.00 22.10 ? 23  PHE A O     1 
ATOM   131  C  CB    . PHE A 1 17  ? 31.065 33.966 14.290 1.00 21.06 ? 23  PHE A CB    1 
ATOM   132  C  CG    . PHE A 1 17  ? 30.406 32.822 13.585 1.00 24.99 ? 23  PHE A CG    1 
ATOM   133  C  CD1   . PHE A 1 17  ? 31.058 31.575 13.488 1.00 26.02 ? 23  PHE A CD1   1 
ATOM   134  C  CD2   . PHE A 1 17  ? 29.139 32.969 13.024 1.00 21.20 ? 23  PHE A CD2   1 
ATOM   135  C  CE1   . PHE A 1 17  ? 30.452 30.493 12.835 1.00 26.45 ? 23  PHE A CE1   1 
ATOM   136  C  CE2   . PHE A 1 17  ? 28.516 31.906 12.378 1.00 22.28 ? 23  PHE A CE2   1 
ATOM   137  C  CZ    . PHE A 1 17  ? 29.165 30.658 12.275 1.00 25.39 ? 23  PHE A CZ    1 
ATOM   138  N  N     . GLY A 1 18  ? 31.622 35.850 17.090 1.00 23.44 ? 24  GLY A N     1 
ATOM   139  C  CA    . GLY A 1 18  ? 32.594 36.766 17.654 1.00 22.89 ? 24  GLY A CA    1 
ATOM   140  C  C     . GLY A 1 18  ? 33.177 37.609 16.528 1.00 24.92 ? 24  GLY A C     1 
ATOM   141  O  O     . GLY A 1 18  ? 34.392 37.816 16.463 1.00 25.59 ? 24  GLY A O     1 
ATOM   142  N  N     . ARG A 1 19  ? 32.318 38.105 15.637 1.00 24.19 ? 25  ARG A N     1 
ATOM   143  C  CA    . ARG A 1 19  ? 32.791 38.896 14.511 1.00 24.21 ? 25  ARG A CA    1 
ATOM   144  C  C     . ARG A 1 19  ? 32.348 40.347 14.506 1.00 25.03 ? 25  ARG A C     1 
ATOM   145  O  O     . ARG A 1 19  ? 33.068 41.206 14.003 1.00 24.75 ? 25  ARG A O     1 
ATOM   146  C  CB    . ARG A 1 19  ? 32.330 38.281 13.179 1.00 23.33 ? 25  ARG A CB    1 
ATOM   147  C  CG    . ARG A 1 19  ? 32.938 36.926 12.782 1.00 22.92 ? 25  ARG A CG    1 
ATOM   148  C  CD    . ARG A 1 19  ? 32.143 36.350 11.560 1.00 21.02 ? 25  ARG A CD    1 
ATOM   149  N  NE    . ARG A 1 19  ? 32.592 35.029 11.135 1.00 22.12 ? 25  ARG A NE    1 
ATOM   150  C  CZ    . ARG A 1 19  ? 31.826 34.091 10.568 1.00 23.52 ? 25  ARG A CZ    1 
ATOM   151  N  NH1   . ARG A 1 19  ? 30.531 34.286 10.343 1.00 22.78 ? 25  ARG A NH1   1 
ATOM   152  N  NH2   . ARG A 1 19  ? 32.377 32.948 10.188 1.00 22.18 ? 25  ARG A NH2   1 
ATOM   153  N  N     . GLY A 1 20  ? 31.171 40.622 15.057 1.00 24.99 ? 26  GLY A N     1 
ATOM   154  C  CA    . GLY A 1 20  ? 30.639 41.973 14.994 1.00 24.89 ? 26  GLY A CA    1 
ATOM   155  C  C     . GLY A 1 20  ? 31.477 43.092 15.560 1.00 25.64 ? 26  GLY A C     1 
ATOM   156  O  O     . GLY A 1 20  ? 31.890 44.030 14.869 1.00 24.21 ? 26  GLY A O     1 
ATOM   157  N  N     . SER A 1 21  ? 31.677 43.015 16.858 1.00 26.47 ? 27  SER A N     1 
ATOM   158  C  CA    . SER A 1 21  ? 32.479 43.986 17.550 1.00 28.80 ? 27  SER A CA    1 
ATOM   159  C  C     . SER A 1 21  ? 33.926 43.863 17.026 1.00 29.37 ? 27  SER A C     1 
ATOM   160  O  O     . SER A 1 21  ? 34.496 44.835 16.514 1.00 30.13 ? 27  SER A O     1 
ATOM   161  C  CB    . SER A 1 21  ? 32.416 43.689 19.042 1.00 29.16 ? 27  SER A CB    1 
ATOM   162  O  OG    . SER A 1 21  ? 32.883 44.788 19.784 1.00 35.41 ? 27  SER A OG    1 
ATOM   163  N  N     . LYS A 1 22  ? 34.479 42.651 17.106 1.00 28.94 ? 28  LYS A N     1 
ATOM   164  C  CA    . LYS A 1 22  ? 35.854 42.346 16.696 1.00 30.50 ? 28  LYS A CA    1 
ATOM   165  C  C     . LYS A 1 22  ? 36.298 42.722 15.273 1.00 30.73 ? 28  LYS A C     1 
ATOM   166  O  O     . LYS A 1 22  ? 37.378 43.280 15.082 1.00 29.77 ? 28  LYS A O     1 
ATOM   167  C  CB    . LYS A 1 22  ? 36.142 40.849 16.911 1.00 31.54 ? 28  LYS A CB    1 
ATOM   168  C  CG    . LYS A 1 22  ? 37.407 40.574 17.707 1.00 32.20 ? 28  LYS A CG    1 
ATOM   169  C  CD    . LYS A 1 22  ? 37.924 39.175 17.468 1.00 34.76 ? 28  LYS A CD    1 
ATOM   170  C  CE    . LYS A 1 22  ? 39.322 38.988 18.077 1.00 35.51 ? 28  LYS A CE    1 
ATOM   171  N  NZ    . LYS A 1 22  ? 39.955 37.699 17.648 1.00 36.94 ? 28  LYS A NZ    1 
ATOM   172  N  N     . GLN A 1 23  ? 35.481 42.402 14.277 1.00 30.46 ? 29  GLN A N     1 
ATOM   173  C  CA    . GLN A 1 23  ? 35.850 42.712 12.903 1.00 30.24 ? 29  GLN A CA    1 
ATOM   174  C  C     . GLN A 1 23  ? 35.193 43.964 12.381 1.00 30.89 ? 29  GLN A C     1 
ATOM   175  O  O     . GLN A 1 23  ? 35.816 44.751 11.676 1.00 31.62 ? 29  GLN A O     1 
ATOM   176  C  CB    . GLN A 1 23  ? 35.472 41.561 11.963 1.00 29.06 ? 29  GLN A CB    1 
ATOM   177  C  CG    . GLN A 1 23  ? 36.355 40.337 12.093 1.00 28.76 ? 29  GLN A CG    1 
ATOM   178  C  CD    . GLN A 1 23  ? 35.956 39.206 11.174 1.00 29.08 ? 29  GLN A CD    1 
ATOM   179  O  OE1   . GLN A 1 23  ? 35.620 39.412 9.986  1.00 29.15 ? 29  GLN A OE1   1 
ATOM   180  N  NE2   . GLN A 1 23  ? 36.008 37.989 11.707 1.00 28.08 ? 29  GLN A NE2   1 
ATOM   181  N  N     . LEU A 1 24  ? 33.938 44.163 12.747 1.00 29.29 ? 30  LEU A N     1 
ATOM   182  C  CA    . LEU A 1 24  ? 33.196 45.287 12.204 1.00 29.04 ? 30  LEU A CA    1 
ATOM   183  C  C     . LEU A 1 24  ? 33.033 46.488 13.090 1.00 27.20 ? 30  LEU A C     1 
ATOM   184  O  O     . LEU A 1 24  ? 32.622 47.528 12.619 1.00 27.09 ? 30  LEU A O     1 
ATOM   185  C  CB    . LEU A 1 24  ? 31.805 44.792 11.767 1.00 28.82 ? 30  LEU A CB    1 
ATOM   186  C  CG    . LEU A 1 24  ? 31.667 43.964 10.473 1.00 28.97 ? 30  LEU A CG    1 
ATOM   187  C  CD1   . LEU A 1 24  ? 32.984 43.336 10.093 1.00 27.74 ? 30  LEU A CD1   1 
ATOM   188  C  CD2   . LEU A 1 24  ? 30.559 42.927 10.617 1.00 27.47 ? 30  LEU A CD2   1 
ATOM   189  N  N     . GLY A 1 25  ? 33.371 46.360 14.363 1.00 26.60 ? 31  GLY A N     1 
ATOM   190  C  CA    . GLY A 1 25  ? 33.148 47.472 15.264 1.00 26.41 ? 31  GLY A CA    1 
ATOM   191  C  C     . GLY A 1 25  ? 31.635 47.689 15.456 1.00 27.13 ? 31  GLY A C     1 
ATOM   192  O  O     . GLY A 1 25  ? 31.198 48.735 15.953 1.00 27.31 ? 31  GLY A O     1 
ATOM   193  N  N     . ILE A 1 26  ? 30.834 46.696 15.062 1.00 25.69 ? 32  ILE A N     1 
ATOM   194  C  CA    . ILE A 1 26  ? 29.377 46.773 15.183 1.00 23.64 ? 32  ILE A CA    1 
ATOM   195  C  C     . ILE A 1 26  ? 28.788 45.505 15.833 1.00 21.90 ? 32  ILE A C     1 
ATOM   196  O  O     . ILE A 1 26  ? 28.422 44.558 15.161 1.00 21.54 ? 32  ILE A O     1 
ATOM   197  C  CB    . ILE A 1 26  ? 28.746 46.998 13.780 1.00 23.25 ? 32  ILE A CB    1 
ATOM   198  C  CG1   . ILE A 1 26  ? 29.497 48.132 13.072 1.00 22.89 ? 32  ILE A CG1   1 
ATOM   199  C  CG2   . ILE A 1 26  ? 27.249 47.342 13.921 1.00 21.91 ? 32  ILE A CG2   1 
ATOM   200  C  CD1   . ILE A 1 26  ? 29.084 48.390 11.655 1.00 24.32 ? 32  ILE A CD1   1 
ATOM   201  N  N     . PRO A 1 27  ? 28.684 45.479 17.161 1.00 21.41 ? 33  PRO A N     1 
ATOM   202  C  CA    . PRO A 1 27  ? 28.129 44.268 17.794 1.00 21.44 ? 33  PRO A CA    1 
ATOM   203  C  C     . PRO A 1 27  ? 26.689 43.989 17.403 1.00 21.04 ? 33  PRO A C     1 
ATOM   204  O  O     . PRO A 1 27  ? 25.933 44.928 17.122 1.00 22.62 ? 33  PRO A O     1 
ATOM   205  C  CB    . PRO A 1 27  ? 28.238 44.565 19.283 1.00 19.89 ? 33  PRO A CB    1 
ATOM   206  C  CG    . PRO A 1 27  ? 28.040 46.065 19.318 1.00 23.13 ? 33  PRO A CG    1 
ATOM   207  C  CD    . PRO A 1 27  ? 28.879 46.559 18.139 1.00 20.29 ? 33  PRO A CD    1 
ATOM   208  N  N     . THR A 1 28  ? 26.317 42.707 17.360 1.00 19.38 ? 34  THR A N     1 
ATOM   209  C  CA    . THR A 1 28  ? 24.942 42.337 17.050 1.00 18.53 ? 34  THR A CA    1 
ATOM   210  C  C     . THR A 1 28  ? 24.497 41.354 18.100 1.00 17.84 ? 34  THR A C     1 
ATOM   211  O  O     . THR A 1 28  ? 25.243 40.471 18.462 1.00 20.32 ? 34  THR A O     1 
ATOM   212  C  CB    . THR A 1 28  ? 24.796 41.674 15.645 1.00 19.54 ? 34  THR A CB    1 
ATOM   213  O  OG1   . THR A 1 28  ? 25.652 40.515 15.542 1.00 20.92 ? 34  THR A OG1   1 
ATOM   214  C  CG2   . THR A 1 28  ? 25.148 42.663 14.569 1.00 17.65 ? 34  THR A CG2   1 
ATOM   215  N  N     . ALA A 1 29  ? 23.285 41.506 18.603 1.00 18.54 ? 35  ALA A N     1 
ATOM   216  C  CA    . ALA A 1 29  ? 22.768 40.580 19.605 1.00 19.58 ? 35  ALA A CA    1 
ATOM   217  C  C     . ALA A 1 29  ? 22.154 39.422 18.812 1.00 19.33 ? 35  ALA A C     1 
ATOM   218  O  O     . ALA A 1 29  ? 21.280 39.648 17.984 1.00 20.81 ? 35  ALA A O     1 
ATOM   219  C  CB    . ALA A 1 29  ? 21.716 41.293 20.469 1.00 18.51 ? 35  ALA A CB    1 
ATOM   220  N  N     . ASN A 1 30  ? 22.602 38.191 19.051 1.00 19.45 ? 36  ASN A N     1 
ATOM   221  C  CA    . ASN A 1 30  ? 22.097 37.045 18.277 1.00 19.73 ? 36  ASN A CA    1 
ATOM   222  C  C     . ASN A 1 30  ? 21.045 36.200 18.967 1.00 20.50 ? 36  ASN A C     1 
ATOM   223  O  O     . ASN A 1 30  ? 21.155 35.911 20.167 1.00 18.56 ? 36  ASN A O     1 
ATOM   224  C  CB    . ASN A 1 30  ? 23.250 36.108 17.876 1.00 20.79 ? 36  ASN A CB    1 
ATOM   225  C  CG    . ASN A 1 30  ? 24.236 36.767 16.929 1.00 22.45 ? 36  ASN A CG    1 
ATOM   226  O  OD1   . ASN A 1 30  ? 24.400 37.986 16.946 1.00 22.69 ? 36  ASN A OD1   1 
ATOM   227  N  ND2   . ASN A 1 30  ? 24.905 35.960 16.099 1.00 23.82 ? 36  ASN A ND2   1 
ATOM   228  N  N     . PHE A 1 31  ? 20.033 35.798 18.200 1.00 19.88 ? 37  PHE A N     1 
ATOM   229  C  CA    . PHE A 1 31  ? 18.987 34.946 18.739 1.00 21.60 ? 37  PHE A CA    1 
ATOM   230  C  C     . PHE A 1 31  ? 19.350 33.482 18.595 1.00 23.06 ? 37  PHE A C     1 
ATOM   231  O  O     . PHE A 1 31  ? 20.191 33.112 17.774 1.00 23.85 ? 37  PHE A O     1 
ATOM   232  C  CB    . PHE A 1 31  ? 17.652 35.170 18.025 1.00 21.77 ? 37  PHE A CB    1 
ATOM   233  C  CG    . PHE A 1 31  ? 16.916 36.388 18.478 1.00 21.28 ? 37  PHE A CG    1 
ATOM   234  C  CD1   . PHE A 1 31  ? 17.142 36.930 19.755 1.00 21.84 ? 37  PHE A CD1   1 
ATOM   235  C  CD2   . PHE A 1 31  ? 15.973 36.973 17.657 1.00 20.47 ? 37  PHE A CD2   1 
ATOM   236  C  CE1   . PHE A 1 31  ? 16.439 38.033 20.196 1.00 18.09 ? 37  PHE A CE1   1 
ATOM   237  C  CE2   . PHE A 1 31  ? 15.270 38.072 18.093 1.00 21.09 ? 37  PHE A CE2   1 
ATOM   238  C  CZ    . PHE A 1 31  ? 15.510 38.602 19.374 1.00 18.73 ? 37  PHE A CZ    1 
ATOM   239  N  N     . PRO A 1 32  ? 18.721 32.620 19.402 1.00 24.34 ? 38  PRO A N     1 
ATOM   240  C  CA    . PRO A 1 32  ? 18.950 31.160 19.373 1.00 24.72 ? 38  PRO A CA    1 
ATOM   241  C  C     . PRO A 1 32  ? 18.370 30.578 18.065 1.00 24.24 ? 38  PRO A C     1 
ATOM   242  O  O     . PRO A 1 32  ? 17.382 31.111 17.546 1.00 24.56 ? 38  PRO A O     1 
ATOM   243  C  CB    . PRO A 1 32  ? 18.169 30.654 20.596 1.00 24.95 ? 38  PRO A CB    1 
ATOM   244  C  CG    . PRO A 1 32  ? 18.030 31.873 21.481 1.00 24.56 ? 38  PRO A CG    1 
ATOM   245  C  CD    . PRO A 1 32  ? 17.845 33.011 20.520 1.00 24.35 ? 38  PRO A CD    1 
ATOM   246  N  N     . GLU A 1 33  ? 18.926 29.483 17.552 1.00 24.27 ? 39  GLU A N     1 
ATOM   247  C  CA    . GLU A 1 33  ? 18.381 28.941 16.311 1.00 26.79 ? 39  GLU A CA    1 
ATOM   248  C  C     . GLU A 1 33  ? 16.867 28.692 16.354 1.00 28.19 ? 39  GLU A C     1 
ATOM   249  O  O     . GLU A 1 33  ? 16.181 28.858 15.334 1.00 29.03 ? 39  GLU A O     1 
ATOM   250  C  CB    . GLU A 1 33  ? 19.064 27.637 15.874 1.00 25.22 ? 39  GLU A CB    1 
ATOM   251  C  CG    . GLU A 1 33  ? 18.848 27.439 14.359 1.00 27.69 ? 39  GLU A CG    1 
ATOM   252  C  CD    . GLU A 1 33  ? 19.364 26.126 13.774 1.00 29.37 ? 39  GLU A CD    1 
ATOM   253  O  OE1   . GLU A 1 33  ? 20.404 25.599 14.225 1.00 32.60 ? 39  GLU A OE1   1 
ATOM   254  O  OE2   . GLU A 1 33  ? 18.724 25.623 12.829 1.00 30.35 ? 39  GLU A OE2   1 
ATOM   255  N  N     . GLN A 1 34  ? 16.360 28.293 17.519 1.00 27.32 ? 40  GLN A N     1 
ATOM   256  C  CA    . GLN A 1 34  ? 14.942 28.015 17.696 1.00 29.19 ? 40  GLN A CA    1 
ATOM   257  C  C     . GLN A 1 34  ? 14.082 29.238 17.361 1.00 29.66 ? 40  GLN A C     1 
ATOM   258  O  O     . GLN A 1 34  ? 12.994 29.110 16.783 1.00 28.44 ? 40  GLN A O     1 
ATOM   259  C  CB    . GLN A 1 34  ? 14.687 27.585 19.138 1.00 32.49 ? 40  GLN A CB    1 
ATOM   260  C  CG    . GLN A 1 34  ? 13.278 27.126 19.459 1.00 37.04 ? 40  GLN A CG    1 
ATOM   261  C  CD    . GLN A 1 34  ? 13.215 26.409 20.830 1.00 41.92 ? 40  GLN A CD    1 
ATOM   262  O  OE1   . GLN A 1 34  ? 13.849 25.357 21.030 1.00 43.86 ? 40  GLN A OE1   1 
ATOM   263  N  NE2   . GLN A 1 34  ? 12.456 26.983 21.776 1.00 41.44 ? 40  GLN A NE2   1 
ATOM   264  N  N     . VAL A 1 35  ? 14.553 30.425 17.738 1.00 28.46 ? 41  VAL A N     1 
ATOM   265  C  CA    . VAL A 1 35  ? 13.796 31.624 17.419 1.00 27.88 ? 41  VAL A CA    1 
ATOM   266  C  C     . VAL A 1 35  ? 13.854 31.888 15.904 1.00 29.44 ? 41  VAL A C     1 
ATOM   267  O  O     . VAL A 1 35  ? 12.833 32.184 15.278 1.00 29.60 ? 41  VAL A O     1 
ATOM   268  C  CB    . VAL A 1 35  ? 14.337 32.846 18.192 1.00 27.20 ? 41  VAL A CB    1 
ATOM   269  C  CG1   . VAL A 1 35  ? 13.700 34.120 17.691 1.00 22.71 ? 41  VAL A CG1   1 
ATOM   270  C  CG2   . VAL A 1 35  ? 14.050 32.675 19.677 1.00 24.26 ? 41  VAL A CG2   1 
ATOM   271  N  N     . VAL A 1 36  ? 15.035 31.742 15.307 1.00 28.47 ? 42  VAL A N     1 
ATOM   272  C  CA    . VAL A 1 36  ? 15.173 31.989 13.873 1.00 28.41 ? 42  VAL A CA    1 
ATOM   273  C  C     . VAL A 1 36  ? 14.341 31.066 13.004 1.00 27.09 ? 42  VAL A C     1 
ATOM   274  O  O     . VAL A 1 36  ? 13.598 31.505 12.140 1.00 26.64 ? 42  VAL A O     1 
ATOM   275  C  CB    . VAL A 1 36  ? 16.643 31.857 13.416 1.00 27.00 ? 42  VAL A CB    1 
ATOM   276  C  CG1   . VAL A 1 36  ? 16.781 32.327 11.966 1.00 25.88 ? 42  VAL A CG1   1 
ATOM   277  C  CG2   . VAL A 1 36  ? 17.534 32.682 14.319 1.00 29.07 ? 42  VAL A CG2   1 
ATOM   278  N  N     . ASP A 1 37  ? 14.475 29.775 13.247 1.00 28.56 ? 43  ASP A N     1 
ATOM   279  C  CA    . ASP A 1 37  ? 13.765 28.793 12.461 1.00 30.68 ? 43  ASP A CA    1 
ATOM   280  C  C     . ASP A 1 37  ? 12.255 28.826 12.647 1.00 33.56 ? 43  ASP A C     1 
ATOM   281  O  O     . ASP A 1 37  ? 11.526 28.299 11.807 1.00 34.22 ? 43  ASP A O     1 
ATOM   282  C  CB    . ASP A 1 37  ? 14.326 27.409 12.747 1.00 27.90 ? 43  ASP A CB    1 
ATOM   283  C  CG    . ASP A 1 37  ? 15.800 27.298 12.374 1.00 30.42 ? 43  ASP A CG    1 
ATOM   284  O  OD1   . ASP A 1 37  ? 16.327 28.222 11.705 1.00 29.53 ? 43  ASP A OD1   1 
ATOM   285  O  OD2   . ASP A 1 37  ? 16.436 26.282 12.737 1.00 31.05 ? 43  ASP A OD2   1 
ATOM   286  N  N     . ASN A 1 38  ? 11.792 29.450 13.731 1.00 34.44 ? 44  ASN A N     1 
ATOM   287  C  CA    . ASN A 1 38  ? 10.363 29.572 13.996 1.00 36.20 ? 44  ASN A CA    1 
ATOM   288  C  C     . ASN A 1 38  ? 9.821  30.884 13.442 1.00 36.20 ? 44  ASN A C     1 
ATOM   289  O  O     . ASN A 1 38  ? 8.657  31.211 13.663 1.00 37.15 ? 44  ASN A O     1 
ATOM   290  C  CB    . ASN A 1 38  ? 10.060 29.542 15.498 1.00 39.88 ? 44  ASN A CB    1 
ATOM   291  C  CG    . ASN A 1 38  ? 10.102 28.146 16.087 1.00 43.56 ? 44  ASN A CG    1 
ATOM   292  O  OD1   . ASN A 1 38  ? 9.975  27.980 17.301 1.00 47.05 ? 44  ASN A OD1   1 
ATOM   293  N  ND2   . ASN A 1 38  ? 10.273 27.134 15.239 1.00 44.81 ? 44  ASN A ND2   1 
ATOM   294  N  N     . LEU A 1 39  ? 10.658 31.656 12.759 1.00 35.24 ? 45  LEU A N     1 
ATOM   295  C  CA    . LEU A 1 39  ? 10.190 32.913 12.185 1.00 35.37 ? 45  LEU A CA    1 
ATOM   296  C  C     . LEU A 1 39  ? 9.096  32.631 11.145 1.00 35.84 ? 45  LEU A C     1 
ATOM   297  O  O     . LEU A 1 39  ? 9.101  31.579 10.509 1.00 35.12 ? 45  LEU A O     1 
ATOM   298  C  CB    . LEU A 1 39  ? 11.339 33.655 11.494 1.00 33.82 ? 45  LEU A CB    1 
ATOM   299  C  CG    . LEU A 1 39  ? 12.252 34.512 12.376 1.00 33.66 ? 45  LEU A CG    1 
ATOM   300  C  CD1   . LEU A 1 39  ? 13.433 34.985 11.564 1.00 31.56 ? 45  LEU A CD1   1 
ATOM   301  C  CD2   . LEU A 1 39  ? 11.482 35.702 12.929 1.00 32.59 ? 45  LEU A CD2   1 
ATOM   302  N  N     . PRO A 1 40  ? 8.132  33.555 10.983 1.00 35.96 ? 46  PRO A N     1 
ATOM   303  C  CA    . PRO A 1 40  ? 7.070  33.342 9.993  1.00 36.40 ? 46  PRO A CA    1 
ATOM   304  C  C     . PRO A 1 40  ? 7.731  33.191 8.621  1.00 37.08 ? 46  PRO A C     1 
ATOM   305  O  O     . PRO A 1 40  ? 8.758  33.826 8.350  1.00 36.16 ? 46  PRO A O     1 
ATOM   306  C  CB    . PRO A 1 40  ? 6.241  34.624 10.092 1.00 35.76 ? 46  PRO A CB    1 
ATOM   307  C  CG    . PRO A 1 40  ? 6.373  35.006 11.521 1.00 35.62 ? 46  PRO A CG    1 
ATOM   308  C  CD    . PRO A 1 40  ? 7.846  34.740 11.818 1.00 35.78 ? 46  PRO A CD    1 
ATOM   309  N  N     . ALA A 1 41  ? 7.150  32.348 7.769  1.00 38.60 ? 47  ALA A N     1 
ATOM   310  C  CA    . ALA A 1 41  ? 7.681  32.102 6.418  1.00 40.93 ? 47  ALA A CA    1 
ATOM   311  C  C     . ALA A 1 41  ? 7.752  33.365 5.579  1.00 42.14 ? 47  ALA A C     1 
ATOM   312  O  O     . ALA A 1 41  ? 8.748  33.610 4.905  1.00 41.30 ? 47  ALA A O     1 
ATOM   313  C  CB    . ALA A 1 41  ? 6.826  31.080 5.688  1.00 39.19 ? 47  ALA A CB    1 
ATOM   314  N  N     . ASP A 1 42  ? 6.683  34.157 5.632  1.00 44.20 ? 48  ASP A N     1 
ATOM   315  C  CA    . ASP A 1 42  ? 6.597  35.386 4.861  1.00 46.20 ? 48  ASP A CA    1 
ATOM   316  C  C     . ASP A 1 42  ? 7.728  36.387 5.113  1.00 46.35 ? 48  ASP A C     1 
ATOM   317  O  O     . ASP A 1 42  ? 7.971  37.263 4.272  1.00 47.47 ? 48  ASP A O     1 
ATOM   318  C  CB    . ASP A 1 42  ? 5.219  36.059 5.062  1.00 48.97 ? 48  ASP A CB    1 
ATOM   319  C  CG    . ASP A 1 42  ? 4.774  36.098 6.535  1.00 52.65 ? 48  ASP A CG    1 
ATOM   320  O  OD1   . ASP A 1 42  ? 4.288  35.048 7.036  1.00 53.79 ? 48  ASP A OD1   1 
ATOM   321  O  OD2   . ASP A 1 42  ? 4.914  37.175 7.186  1.00 52.10 ? 48  ASP A OD2   1 
ATOM   322  N  N     . ILE A 1 43  ? 8.421  36.271 6.247  1.00 44.89 ? 49  ILE A N     1 
ATOM   323  C  CA    . ILE A 1 43  ? 9.531  37.183 6.543  1.00 42.92 ? 49  ILE A CA    1 
ATOM   324  C  C     . ILE A 1 43  ? 10.720 36.839 5.670  1.00 41.57 ? 49  ILE A C     1 
ATOM   325  O  O     . ILE A 1 43  ? 11.374 35.817 5.874  1.00 41.85 ? 49  ILE A O     1 
ATOM   326  C  CB    . ILE A 1 43  ? 10.021 37.052 7.969  1.00 43.73 ? 49  ILE A CB    1 
ATOM   327  C  CG1   . ILE A 1 43  ? 8.886  37.307 8.937  1.00 43.34 ? 49  ILE A CG1   1 
ATOM   328  C  CG2   . ILE A 1 43  ? 11.167 38.022 8.206  1.00 43.84 ? 49  ILE A CG2   1 
ATOM   329  C  CD1   . ILE A 1 43  ? 9.282  36.919 10.318 1.00 47.31 ? 49  ILE A CD1   1 
ATOM   330  N  N     . SER A 1 44  ? 11.024 37.691 4.707  1.00 39.87 ? 50  SER A N     1 
ATOM   331  C  CA    . SER A 1 44  ? 12.146 37.400 3.834  1.00 39.78 ? 50  SER A CA    1 
ATOM   332  C  C     . SER A 1 44  ? 13.487 37.570 4.510  1.00 37.62 ? 50  SER A C     1 
ATOM   333  O  O     . SER A 1 44  ? 13.604 38.232 5.546  1.00 35.63 ? 50  SER A O     1 
ATOM   334  C  CB    . SER A 1 44  ? 12.100 38.288 2.596  1.00 40.74 ? 50  SER A CB    1 
ATOM   335  O  OG    . SER A 1 44  ? 11.025 37.880 1.780  1.00 44.41 ? 50  SER A OG    1 
ATOM   336  N  N     . THR A 1 45  ? 14.502 36.955 3.923  1.00 34.64 ? 51  THR A N     1 
ATOM   337  C  CA    . THR A 1 45  ? 15.820 37.114 4.480  1.00 34.67 ? 51  THR A CA    1 
ATOM   338  C  C     . THR A 1 45  ? 16.209 38.520 4.038  1.00 30.86 ? 51  THR A C     1 
ATOM   339  O  O     . THR A 1 45  ? 15.762 38.980 3.008  1.00 29.91 ? 51  THR A O     1 
ATOM   340  C  CB    . THR A 1 45  ? 16.804 36.082 3.910  1.00 35.48 ? 51  THR A CB    1 
ATOM   341  O  OG1   . THR A 1 45  ? 17.170 36.449 2.581  1.00 38.69 ? 51  THR A OG1   1 
ATOM   342  C  CG2   . THR A 1 45  ? 16.165 34.708 3.891  1.00 37.55 ? 51  THR A CG2   1 
ATOM   343  N  N     . GLY A 1 46  ? 17.003 39.214 4.836  1.00 28.45 ? 52  GLY A N     1 
ATOM   344  C  CA    . GLY A 1 46  ? 17.401 40.552 4.462  1.00 25.44 ? 52  GLY A CA    1 
ATOM   345  C  C     . GLY A 1 46  ? 17.670 41.412 5.674  1.00 25.48 ? 52  GLY A C     1 
ATOM   346  O  O     . GLY A 1 46  ? 17.662 40.941 6.807  1.00 25.40 ? 52  GLY A O     1 
ATOM   347  N  N     . ILE A 1 47  ? 17.874 42.698 5.438  1.00 25.98 ? 53  ILE A N     1 
ATOM   348  C  CA    . ILE A 1 47  ? 18.179 43.628 6.503  1.00 25.16 ? 53  ILE A CA    1 
ATOM   349  C  C     . ILE A 1 47  ? 16.977 44.493 6.823  1.00 26.66 ? 53  ILE A C     1 
ATOM   350  O  O     . ILE A 1 47  ? 16.397 45.112 5.928  1.00 29.71 ? 53  ILE A O     1 
ATOM   351  C  CB    . ILE A 1 47  ? 19.356 44.521 6.079  1.00 25.48 ? 53  ILE A CB    1 
ATOM   352  C  CG1   . ILE A 1 47  ? 20.410 43.672 5.362  1.00 25.37 ? 53  ILE A CG1   1 
ATOM   353  C  CG2   . ILE A 1 47  ? 19.960 45.205 7.287  1.00 23.08 ? 53  ILE A CG2   1 
ATOM   354  C  CD1   . ILE A 1 47  ? 20.916 42.501 6.184  1.00 26.48 ? 53  ILE A CD1   1 
ATOM   355  N  N     . TYR A 1 48  ? 16.604 44.549 8.094  1.00 25.03 ? 54  TYR A N     1 
ATOM   356  C  CA    . TYR A 1 48  ? 15.456 45.348 8.501  1.00 24.70 ? 54  TYR A CA    1 
ATOM   357  C  C     . TYR A 1 48  ? 15.847 46.393 9.557  1.00 25.46 ? 54  TYR A C     1 
ATOM   358  O  O     . TYR A 1 48  ? 16.961 46.371 10.081 1.00 24.49 ? 54  TYR A O     1 
ATOM   359  C  CB    . TYR A 1 48  ? 14.369 44.441 9.103  1.00 22.90 ? 54  TYR A CB    1 
ATOM   360  C  CG    . TYR A 1 48  ? 13.825 43.367 8.193  1.00 25.65 ? 54  TYR A CG    1 
ATOM   361  C  CD1   . TYR A 1 48  ? 14.611 42.287 7.782  1.00 25.21 ? 54  TYR A CD1   1 
ATOM   362  C  CD2   . TYR A 1 48  ? 12.485 43.388 7.800  1.00 28.08 ? 54  TYR A CD2   1 
ATOM   363  C  CE1   . TYR A 1 48  ? 14.073 41.261 7.013  1.00 24.68 ? 54  TYR A CE1   1 
ATOM   364  C  CE2   . TYR A 1 48  ? 11.928 42.357 7.033  1.00 25.85 ? 54  TYR A CE2   1 
ATOM   365  C  CZ    . TYR A 1 48  ? 12.720 41.304 6.648  1.00 26.14 ? 54  TYR A CZ    1 
ATOM   366  O  OH    . TYR A 1 48  ? 12.141 40.295 5.916  1.00 26.35 ? 54  TYR A OH    1 
ATOM   367  N  N     . TYR A 1 49  ? 14.926 47.310 9.862  1.00 25.83 ? 55  TYR A N     1 
ATOM   368  C  CA    . TYR A 1 49  ? 15.166 48.303 10.908 1.00 26.93 ? 55  TYR A CA    1 
ATOM   369  C  C     . TYR A 1 49  ? 13.985 48.144 11.862 1.00 25.60 ? 55  TYR A C     1 
ATOM   370  O  O     . TYR A 1 49  ? 12.956 47.568 11.483 1.00 24.62 ? 55  TYR A O     1 
ATOM   371  C  CB    . TYR A 1 49  ? 15.249 49.744 10.344 1.00 27.58 ? 55  TYR A CB    1 
ATOM   372  C  CG    . TYR A 1 49  ? 14.041 50.217 9.563  1.00 29.44 ? 55  TYR A CG    1 
ATOM   373  C  CD1   . TYR A 1 49  ? 13.952 50.010 8.178  1.00 29.29 ? 55  TYR A CD1   1 
ATOM   374  C  CD2   . TYR A 1 49  ? 12.992 50.898 10.204 1.00 29.83 ? 55  TYR A CD2   1 
ATOM   375  C  CE1   . TYR A 1 49  ? 12.853 50.474 7.442  1.00 29.94 ? 55  TYR A CE1   1 
ATOM   376  C  CE2   . TYR A 1 49  ? 11.886 51.362 9.486  1.00 30.07 ? 55  TYR A CE2   1 
ATOM   377  C  CZ    . TYR A 1 49  ? 11.823 51.150 8.107  1.00 31.31 ? 55  TYR A CZ    1 
ATOM   378  O  OH    . TYR A 1 49  ? 10.742 51.614 7.396  1.00 31.28 ? 55  TYR A OH    1 
ATOM   379  N  N     . GLY A 1 50  ? 14.115 48.628 13.091 1.00 23.85 ? 56  GLY A N     1 
ATOM   380  C  CA    . GLY A 1 50  ? 13.029 48.436 14.027 1.00 23.72 ? 56  GLY A CA    1 
ATOM   381  C  C     . GLY A 1 50  ? 13.376 48.845 15.429 1.00 24.66 ? 56  GLY A C     1 
ATOM   382  O  O     . GLY A 1 50  ? 14.352 49.541 15.650 1.00 27.04 ? 56  GLY A O     1 
ATOM   383  N  N     . TRP A 1 51  ? 12.569 48.407 16.382 1.00 26.77 ? 57  TRP A N     1 
ATOM   384  C  CA    . TRP A 1 51  ? 12.763 48.741 17.788 1.00 26.89 ? 57  TRP A CA    1 
ATOM   385  C  C     . TRP A 1 51  ? 13.194 47.538 18.597 1.00 28.21 ? 57  TRP A C     1 
ATOM   386  O  O     . TRP A 1 51  ? 12.912 46.395 18.230 1.00 28.36 ? 57  TRP A O     1 
ATOM   387  C  CB    . TRP A 1 51  ? 11.467 49.286 18.404 1.00 26.31 ? 57  TRP A CB    1 
ATOM   388  C  CG    . TRP A 1 51  ? 10.870 50.459 17.680 1.00 26.81 ? 57  TRP A CG    1 
ATOM   389  C  CD1   . TRP A 1 51  ? 9.772  50.442 16.853 1.00 27.05 ? 57  TRP A CD1   1 
ATOM   390  C  CD2   . TRP A 1 51  ? 11.333 51.811 17.702 1.00 25.87 ? 57  TRP A CD2   1 
ATOM   391  N  NE1   . TRP A 1 51  ? 9.526  51.700 16.360 1.00 27.12 ? 57  TRP A NE1   1 
ATOM   392  C  CE2   . TRP A 1 51  ? 10.465 52.565 16.858 1.00 25.94 ? 57  TRP A CE2   1 
ATOM   393  C  CE3   . TRP A 1 51  ? 12.393 52.465 18.344 1.00 25.91 ? 57  TRP A CE3   1 
ATOM   394  C  CZ2   . TRP A 1 51  ? 10.626 53.946 16.640 1.00 24.89 ? 57  TRP A CZ2   1 
ATOM   395  C  CZ3   . TRP A 1 51  ? 12.561 53.858 18.125 1.00 27.96 ? 57  TRP A CZ3   1 
ATOM   396  C  CH2   . TRP A 1 51  ? 11.675 54.576 17.276 1.00 25.75 ? 57  TRP A CH2   1 
ATOM   397  N  N     . ALA A 1 52  ? 13.843 47.805 19.731 1.00 29.00 ? 58  ALA A N     1 
ATOM   398  C  CA    . ALA A 1 52  ? 14.301 46.740 20.601 1.00 27.36 ? 58  ALA A CA    1 
ATOM   399  C  C     . ALA A 1 52  ? 14.612 47.231 21.998 1.00 27.66 ? 58  ALA A C     1 
ATOM   400  O  O     . ALA A 1 52  ? 14.994 48.384 22.206 1.00 26.35 ? 58  ALA A O     1 
ATOM   401  C  CB    . ALA A 1 52  ? 15.532 46.075 20.005 1.00 27.87 ? 58  ALA A CB    1 
ATOM   402  N  N     . SER A 1 53  ? 14.456 46.323 22.957 1.00 27.73 ? 59  SER A N     1 
ATOM   403  C  CA    . SER A 1 53  ? 14.733 46.602 24.352 1.00 26.11 ? 59  SER A CA    1 
ATOM   404  C  C     . SER A 1 53  ? 15.381 45.359 24.923 1.00 25.49 ? 59  SER A C     1 
ATOM   405  O  O     . SER A 1 53  ? 15.046 44.247 24.533 1.00 24.66 ? 59  SER A O     1 
ATOM   406  C  CB    . SER A 1 53  ? 13.431 46.911 25.119 1.00 26.84 ? 59  SER A CB    1 
ATOM   407  O  OG    . SER A 1 53  ? 12.572 45.777 25.177 1.00 25.37 ? 59  SER A OG    1 
ATOM   408  N  N     . VAL A 1 54  ? 16.323 45.560 25.836 1.00 27.64 ? 60  VAL A N     1 
ATOM   409  C  CA    . VAL A 1 54  ? 17.010 44.469 26.504 1.00 26.36 ? 60  VAL A CA    1 
ATOM   410  C  C     . VAL A 1 54  ? 16.372 44.359 27.866 1.00 27.98 ? 60  VAL A C     1 
ATOM   411  O  O     . VAL A 1 54  ? 16.436 45.287 28.664 1.00 28.14 ? 60  VAL A O     1 
ATOM   412  C  CB    . VAL A 1 54  ? 18.475 44.778 26.692 1.00 26.53 ? 60  VAL A CB    1 
ATOM   413  C  CG1   . VAL A 1 54  ? 19.181 43.587 27.327 1.00 26.90 ? 60  VAL A CG1   1 
ATOM   414  C  CG2   . VAL A 1 54  ? 19.093 45.122 25.350 1.00 28.12 ? 60  VAL A CG2   1 
ATOM   415  N  N     . GLY A 1 55  ? 15.731 43.228 28.114 1.00 29.56 ? 61  GLY A N     1 
ATOM   416  C  CA    . GLY A 1 55  ? 15.081 42.998 29.382 1.00 31.12 ? 61  GLY A CA    1 
ATOM   417  C  C     . GLY A 1 55  ? 13.966 43.988 29.605 1.00 32.74 ? 61  GLY A C     1 
ATOM   418  O  O     . GLY A 1 55  ? 13.077 44.172 28.774 1.00 32.56 ? 61  GLY A O     1 
ATOM   419  N  N     . SER A 1 56  ? 14.013 44.644 30.747 1.00 33.93 ? 62  SER A N     1 
ATOM   420  C  CA    . SER A 1 56  ? 12.986 45.615 31.056 1.00 35.69 ? 62  SER A CA    1 
ATOM   421  C  C     . SER A 1 56  ? 13.578 47.006 30.877 1.00 34.82 ? 62  SER A C     1 
ATOM   422  O  O     . SER A 1 56  ? 13.212 47.952 31.579 1.00 36.66 ? 62  SER A O     1 
ATOM   423  C  CB    . SER A 1 56  ? 12.464 45.387 32.494 1.00 35.47 ? 62  SER A CB    1 
ATOM   424  O  OG    . SER A 1 56  ? 13.517 45.394 33.443 1.00 36.29 ? 62  SER A OG    1 
ATOM   425  N  N     . GLY A 1 57  ? 14.497 47.116 29.922 1.00 33.86 ? 63  GLY A N     1 
ATOM   426  C  CA    . GLY A 1 57  ? 15.144 48.385 29.644 1.00 31.98 ? 63  GLY A CA    1 
ATOM   427  C  C     . GLY A 1 57  ? 14.332 49.240 28.700 1.00 31.78 ? 63  GLY A C     1 
ATOM   428  O  O     . GLY A 1 57  ? 13.204 48.893 28.352 1.00 30.69 ? 63  GLY A O     1 
ATOM   429  N  N     . ASP A 1 58  ? 14.894 50.358 28.265 1.00 32.54 ? 64  ASP A N     1 
ATOM   430  C  CA    . ASP A 1 58  ? 14.135 51.216 27.366 1.00 35.19 ? 64  ASP A CA    1 
ATOM   431  C  C     . ASP A 1 58  ? 14.195 50.702 25.949 1.00 34.93 ? 64  ASP A C     1 
ATOM   432  O  O     . ASP A 1 58  ? 15.079 49.917 25.609 1.00 34.84 ? 64  ASP A O     1 
ATOM   433  C  CB    . ASP A 1 58  ? 14.668 52.650 27.399 1.00 37.69 ? 64  ASP A CB    1 
ATOM   434  C  CG    . ASP A 1 58  ? 14.291 53.379 28.678 1.00 41.06 ? 64  ASP A CG    1 
ATOM   435  O  OD1   . ASP A 1 58  ? 13.108 53.276 29.079 1.00 43.18 ? 64  ASP A OD1   1 
ATOM   436  O  OD2   . ASP A 1 58  ? 15.165 54.053 29.279 1.00 42.89 ? 64  ASP A OD2   1 
ATOM   437  N  N     . VAL A 1 59  ? 13.249 51.145 25.132 1.00 32.84 ? 65  VAL A N     1 
ATOM   438  C  CA    . VAL A 1 59  ? 13.210 50.748 23.743 1.00 31.85 ? 65  VAL A CA    1 
ATOM   439  C  C     . VAL A 1 59  ? 14.093 51.702 22.929 1.00 32.60 ? 65  VAL A C     1 
ATOM   440  O  O     . VAL A 1 59  ? 14.004 52.915 23.088 1.00 32.81 ? 65  VAL A O     1 
ATOM   441  C  CB    . VAL A 1 59  ? 11.764 50.805 23.203 1.00 32.14 ? 65  VAL A CB    1 
ATOM   442  C  CG1   . VAL A 1 59  ? 11.745 50.441 21.717 1.00 30.64 ? 65  VAL A CG1   1 
ATOM   443  C  CG2   . VAL A 1 59  ? 10.855 49.843 24.010 1.00 31.44 ? 65  VAL A CG2   1 
ATOM   444  N  N     . HIS A 1 60  ? 14.958 51.153 22.079 1.00 32.31 ? 66  HIS A N     1 
ATOM   445  C  CA    . HIS A 1 60  ? 15.838 51.954 21.224 1.00 31.25 ? 66  HIS A CA    1 
ATOM   446  C  C     . HIS A 1 60  ? 15.725 51.520 19.780 1.00 30.40 ? 66  HIS A C     1 
ATOM   447  O  O     . HIS A 1 60  ? 15.210 50.443 19.477 1.00 30.08 ? 66  HIS A O     1 
ATOM   448  C  CB    . HIS A 1 60  ? 17.295 51.796 21.632 1.00 31.81 ? 66  HIS A CB    1 
ATOM   449  C  CG    . HIS A 1 60  ? 17.567 52.189 23.043 1.00 35.51 ? 66  HIS A CG    1 
ATOM   450  N  ND1   . HIS A 1 60  ? 17.428 53.488 23.493 1.00 37.22 ? 66  HIS A ND1   1 
ATOM   451  C  CD2   . HIS A 1 60  ? 17.941 51.450 24.116 1.00 35.03 ? 66  HIS A CD2   1 
ATOM   452  C  CE1   . HIS A 1 60  ? 17.704 53.526 24.786 1.00 38.64 ? 66  HIS A CE1   1 
ATOM   453  N  NE2   . HIS A 1 60  ? 18.018 52.304 25.189 1.00 37.61 ? 66  HIS A NE2   1 
ATOM   454  N  N     . LYS A 1 61  ? 16.213 52.360 18.881 1.00 30.20 ? 67  LYS A N     1 
ATOM   455  C  CA    . LYS A 1 61  ? 16.196 52.007 17.466 1.00 30.31 ? 67  LYS A CA    1 
ATOM   456  C  C     . LYS A 1 61  ? 17.216 50.883 17.232 1.00 28.58 ? 67  LYS A C     1 
ATOM   457  O  O     . LYS A 1 61  ? 18.157 50.696 18.024 1.00 28.11 ? 67  LYS A O     1 
ATOM   458  C  CB    . LYS A 1 61  ? 16.597 53.202 16.602 1.00 30.36 ? 67  LYS A CB    1 
ATOM   459  C  CG    . LYS A 1 61  ? 15.676 54.416 16.646 1.00 30.56 ? 67  LYS A CG    1 
ATOM   460  C  CD    . LYS A 1 61  ? 16.320 55.553 15.828 1.00 30.12 ? 67  LYS A CD    1 
ATOM   461  C  CE    . LYS A 1 61  ? 15.456 56.824 15.796 1.00 31.84 ? 67  LYS A CE    1 
ATOM   462  N  NZ    . LYS A 1 61  ? 16.116 57.939 15.024 1.00 33.63 ? 67  LYS A NZ    1 
ATOM   463  N  N     . MET A 1 62  ? 17.042 50.156 16.130 1.00 26.49 ? 68  MET A N     1 
ATOM   464  C  CA    . MET A 1 62  ? 17.954 49.075 15.795 1.00 23.65 ? 68  MET A CA    1 
ATOM   465  C  C     . MET A 1 62  ? 17.802 48.641 14.357 1.00 24.08 ? 68  MET A C     1 
ATOM   466  O  O     . MET A 1 62  ? 16.852 49.014 13.660 1.00 23.54 ? 68  MET A O     1 
ATOM   467  C  CB    . MET A 1 62  ? 17.685 47.856 16.694 1.00 22.73 ? 68  MET A CB    1 
ATOM   468  C  CG    . MET A 1 62  ? 16.259 47.265 16.556 1.00 20.37 ? 68  MET A CG    1 
ATOM   469  S  SD    . MET A 1 62  ? 15.876 46.378 14.961 1.00 21.62 ? 68  MET A SD    1 
ATOM   470  C  CE    . MET A 1 62  ? 14.610 45.193 15.560 1.00 17.20 ? 68  MET A CE    1 
ATOM   471  N  N     . VAL A 1 63  ? 18.773 47.863 13.913 1.00 23.28 ? 69  VAL A N     1 
ATOM   472  C  CA    . VAL A 1 63  ? 18.718 47.267 12.596 1.00 23.17 ? 69  VAL A CA    1 
ATOM   473  C  C     . VAL A 1 63  ? 18.980 45.809 12.921 1.00 23.74 ? 69  VAL A C     1 
ATOM   474  O  O     . VAL A 1 63  ? 19.705 45.490 13.886 1.00 23.50 ? 69  VAL A O     1 
ATOM   475  C  CB    . VAL A 1 63  ? 19.809 47.764 11.640 1.00 24.02 ? 69  VAL A CB    1 
ATOM   476  C  CG1   . VAL A 1 63  ? 19.429 49.164 11.123 1.00 22.85 ? 69  VAL A CG1   1 
ATOM   477  C  CG2   . VAL A 1 63  ? 21.187 47.723 12.345 1.00 19.97 ? 69  VAL A CG2   1 
ATOM   478  N  N     . VAL A 1 64  ? 18.398 44.932 12.122 1.00 21.73 ? 70  VAL A N     1 
ATOM   479  C  CA    . VAL A 1 64  ? 18.538 43.521 12.352 1.00 22.77 ? 70  VAL A CA    1 
ATOM   480  C  C     . VAL A 1 64  ? 18.748 42.810 11.037 1.00 23.22 ? 70  VAL A C     1 
ATOM   481  O  O     . VAL A 1 64  ? 18.106 43.159 10.034 1.00 22.79 ? 70  VAL A O     1 
ATOM   482  C  CB    . VAL A 1 64  ? 17.257 42.965 13.058 1.00 22.87 ? 70  VAL A CB    1 
ATOM   483  C  CG1   . VAL A 1 64  ? 16.035 43.371 12.285 1.00 21.56 ? 70  VAL A CG1   1 
ATOM   484  C  CG2   . VAL A 1 64  ? 17.334 41.435 13.177 1.00 22.30 ? 70  VAL A CG2   1 
ATOM   485  N  N     . SER A 1 65  ? 19.673 41.850 11.029 1.00 21.73 ? 71  SER A N     1 
ATOM   486  C  CA    . SER A 1 65  ? 19.912 41.059 9.827  1.00 22.48 ? 71  SER A CA    1 
ATOM   487  C  C     . SER A 1 65  ? 19.307 39.670 10.025 1.00 21.93 ? 71  SER A C     1 
ATOM   488  O  O     . SER A 1 65  ? 19.442 39.077 11.109 1.00 19.93 ? 71  SER A O     1 
ATOM   489  C  CB    . SER A 1 65  ? 21.417 40.918 9.533  1.00 24.04 ? 71  SER A CB    1 
ATOM   490  O  OG    . SER A 1 65  ? 22.096 40.153 10.517 1.00 22.77 ? 71  SER A OG    1 
ATOM   491  N  N     . ILE A 1 66  ? 18.626 39.176 8.986  1.00 21.68 ? 72  ILE A N     1 
ATOM   492  C  CA    . ILE A 1 66  ? 18.005 37.843 8.983  1.00 21.09 ? 72  ILE A CA    1 
ATOM   493  C  C     . ILE A 1 66  ? 18.476 37.104 7.727  1.00 22.05 ? 72  ILE A C     1 
ATOM   494  O  O     . ILE A 1 66  ? 18.004 37.362 6.610  1.00 23.20 ? 72  ILE A O     1 
ATOM   495  C  CB    . ILE A 1 66  ? 16.462 37.926 8.953  1.00 21.55 ? 72  ILE A CB    1 
ATOM   496  C  CG1   . ILE A 1 66  ? 15.948 38.483 10.273 1.00 19.94 ? 72  ILE A CG1   1 
ATOM   497  C  CG2   . ILE A 1 66  ? 15.879 36.549 8.699  1.00 19.42 ? 72  ILE A CG2   1 
ATOM   498  C  CD1   . ILE A 1 66  ? 14.470 38.553 10.366 1.00 19.84 ? 72  ILE A CD1   1 
ATOM   499  N  N     . GLY A 1 67  ? 19.421 36.194 7.906  1.00 22.04 ? 73  GLY A N     1 
ATOM   500  C  CA    . GLY A 1 67  ? 19.937 35.469 6.774  1.00 19.65 ? 73  GLY A CA    1 
ATOM   501  C  C     . GLY A 1 67  ? 21.208 34.680 7.025  1.00 20.35 ? 73  GLY A C     1 
ATOM   502  O  O     . GLY A 1 67  ? 21.507 34.275 8.155  1.00 21.08 ? 73  GLY A O     1 
ATOM   503  N  N     . TRP A 1 68  ? 21.961 34.464 5.946  1.00 19.64 ? 74  TRP A N     1 
ATOM   504  C  CA    . TRP A 1 68  ? 23.173 33.664 5.993  1.00 18.26 ? 74  TRP A CA    1 
ATOM   505  C  C     . TRP A 1 68  ? 24.514 34.388 5.924  1.00 17.10 ? 74  TRP A C     1 
ATOM   506  O  O     . TRP A 1 68  ? 25.567 33.739 5.922  1.00 17.17 ? 74  TRP A O     1 
ATOM   507  C  CB    . TRP A 1 68  ? 23.089 32.597 4.901  1.00 16.79 ? 74  TRP A CB    1 
ATOM   508  C  CG    . TRP A 1 68  ? 22.109 31.510 5.203  1.00 18.30 ? 74  TRP A CG    1 
ATOM   509  C  CD1   . TRP A 1 68  ? 22.353 30.357 5.908  1.00 18.39 ? 74  TRP A CD1   1 
ATOM   510  C  CD2   . TRP A 1 68  ? 20.727 31.461 4.818  1.00 18.24 ? 74  TRP A CD2   1 
ATOM   511  N  NE1   . TRP A 1 68  ? 21.213 29.600 5.975  1.00 21.04 ? 74  TRP A NE1   1 
ATOM   512  C  CE2   . TRP A 1 68  ? 20.199 30.252 5.319  1.00 18.43 ? 74  TRP A CE2   1 
ATOM   513  C  CE3   . TRP A 1 68  ? 19.885 32.321 4.093  1.00 16.68 ? 74  TRP A CE3   1 
ATOM   514  C  CZ2   . TRP A 1 68  ? 18.865 29.875 5.121  1.00 18.52 ? 74  TRP A CZ2   1 
ATOM   515  C  CZ3   . TRP A 1 68  ? 18.561 31.949 3.889  1.00 17.85 ? 74  TRP A CZ3   1 
ATOM   516  C  CH2   . TRP A 1 68  ? 18.059 30.730 4.403  1.00 17.85 ? 74  TRP A CH2   1 
ATOM   517  N  N     . ASN A 1 69  ? 24.478 35.715 5.896  1.00 17.39 ? 75  ASN A N     1 
ATOM   518  C  CA    . ASN A 1 69  ? 25.681 36.564 5.844  1.00 17.20 ? 75  ASN A CA    1 
ATOM   519  C  C     . ASN A 1 69  ? 26.618 36.187 4.688  1.00 18.28 ? 75  ASN A C     1 
ATOM   520  O  O     . ASN A 1 69  ? 27.709 35.645 4.901  1.00 17.14 ? 75  ASN A O     1 
ATOM   521  C  CB    . ASN A 1 69  ? 26.422 36.494 7.183  1.00 16.58 ? 75  ASN A CB    1 
ATOM   522  C  CG    . ASN A 1 69  ? 25.513 36.832 8.386  1.00 18.60 ? 75  ASN A CG    1 
ATOM   523  O  OD1   . ASN A 1 69  ? 25.954 36.792 9.555  1.00 18.38 ? 75  ASN A OD1   1 
ATOM   524  N  ND2   . ASN A 1 69  ? 24.251 37.165 8.107  1.00 12.49 ? 75  ASN A ND2   1 
ATOM   525  N  N     . PRO A 1 70  ? 26.208 36.511 3.442  1.00 20.21 ? 76  PRO A N     1 
ATOM   526  C  CA    . PRO A 1 70  ? 26.953 36.231 2.208  1.00 21.68 ? 76  PRO A CA    1 
ATOM   527  C  C     . PRO A 1 70  ? 28.446 36.511 2.245  1.00 22.32 ? 76  PRO A C     1 
ATOM   528  O  O     . PRO A 1 70  ? 29.218 35.860 1.554  1.00 23.00 ? 76  PRO A O     1 
ATOM   529  C  CB    . PRO A 1 70  ? 26.239 37.090 1.153  1.00 21.39 ? 76  PRO A CB    1 
ATOM   530  C  CG    . PRO A 1 70  ? 24.832 37.164 1.688  1.00 22.03 ? 76  PRO A CG    1 
ATOM   531  C  CD    . PRO A 1 70  ? 25.058 37.398 3.158  1.00 20.23 ? 76  PRO A CD    1 
ATOM   532  N  N     . TYR A 1 71  ? 28.857 37.489 3.029  1.00 22.51 ? 77  TYR A N     1 
ATOM   533  C  CA    . TYR A 1 71  ? 30.274 37.797 3.112  1.00 23.69 ? 77  TYR A CA    1 
ATOM   534  C  C     . TYR A 1 71  ? 31.016 36.679 3.833  1.00 24.37 ? 77  TYR A C     1 
ATOM   535  O  O     . TYR A 1 71  ? 32.106 36.308 3.424  1.00 25.94 ? 77  TYR A O     1 
ATOM   536  C  CB    . TYR A 1 71  ? 30.511 39.096 3.871  1.00 22.72 ? 77  TYR A CB    1 
ATOM   537  C  CG    . TYR A 1 71  ? 31.971 39.512 3.923  1.00 26.09 ? 77  TYR A CG    1 
ATOM   538  C  CD1   . TYR A 1 71  ? 32.548 40.255 2.889  1.00 26.20 ? 77  TYR A CD1   1 
ATOM   539  C  CD2   . TYR A 1 71  ? 32.775 39.177 5.016  1.00 25.31 ? 77  TYR A CD2   1 
ATOM   540  C  CE1   . TYR A 1 71  ? 33.884 40.658 2.941  1.00 26.51 ? 77  TYR A CE1   1 
ATOM   541  C  CE2   . TYR A 1 71  ? 34.100 39.574 5.078  1.00 25.01 ? 77  TYR A CE2   1 
ATOM   542  C  CZ    . TYR A 1 71  ? 34.651 40.313 4.040  1.00 26.86 ? 77  TYR A CZ    1 
ATOM   543  O  OH    . TYR A 1 71  ? 35.972 40.699 4.107  1.00 28.99 ? 77  TYR A OH    1 
ATOM   544  N  N     . TYR A 1 72  ? 30.426 36.153 4.904  1.00 22.82 ? 78  TYR A N     1 
ATOM   545  C  CA    . TYR A 1 72  ? 31.059 35.100 5.679  1.00 21.71 ? 78  TYR A CA    1 
ATOM   546  C  C     . TYR A 1 72  ? 30.601 33.722 5.273  1.00 22.85 ? 78  TYR A C     1 
ATOM   547  O  O     . TYR A 1 72  ? 31.165 32.724 5.726  1.00 20.17 ? 78  TYR A O     1 
ATOM   548  C  CB    . TYR A 1 72  ? 30.748 35.282 7.159  1.00 20.69 ? 78  TYR A CB    1 
ATOM   549  C  CG    . TYR A 1 72  ? 31.362 36.523 7.733  1.00 20.71 ? 78  TYR A CG    1 
ATOM   550  C  CD1   . TYR A 1 72  ? 32.702 36.530 8.134  1.00 18.40 ? 78  TYR A CD1   1 
ATOM   551  C  CD2   . TYR A 1 72  ? 30.625 37.718 7.836  1.00 19.76 ? 78  TYR A CD2   1 
ATOM   552  C  CE1   . TYR A 1 72  ? 33.291 37.669 8.612  1.00 17.42 ? 78  TYR A CE1   1 
ATOM   553  C  CE2   . TYR A 1 72  ? 31.218 38.883 8.318  1.00 16.60 ? 78  TYR A CE2   1 
ATOM   554  C  CZ    . TYR A 1 72  ? 32.557 38.849 8.700  1.00 17.92 ? 78  TYR A CZ    1 
ATOM   555  O  OH    . TYR A 1 72  ? 33.203 39.996 9.127  1.00 18.62 ? 78  TYR A OH    1 
ATOM   556  N  N     . LYS A 1 73  ? 29.554 33.663 4.454  1.00 23.97 ? 79  LYS A N     1 
ATOM   557  C  CA    . LYS A 1 73  ? 29.007 32.373 4.023  1.00 26.99 ? 79  LYS A CA    1 
ATOM   558  C  C     . LYS A 1 73  ? 28.583 31.394 5.168  1.00 27.23 ? 79  LYS A C     1 
ATOM   559  O  O     . LYS A 1 73  ? 29.035 30.248 5.228  1.00 25.83 ? 79  LYS A O     1 
ATOM   560  C  CB    . LYS A 1 73  ? 30.011 31.664 3.099  1.00 30.86 ? 79  LYS A CB    1 
ATOM   561  C  CG    . LYS A 1 73  ? 30.257 32.370 1.782  1.00 34.77 ? 79  LYS A CG    1 
ATOM   562  C  CD    . LYS A 1 73  ? 31.250 31.584 0.939  1.00 40.62 ? 79  LYS A CD    1 
ATOM   563  C  CE    . LYS A 1 73  ? 31.428 32.227 -0.437 1.00 44.39 ? 79  LYS A CE    1 
ATOM   564  N  NZ    . LYS A 1 73  ? 32.600 31.652 -1.170 1.00 47.61 ? 79  LYS A NZ    1 
ATOM   565  N  N     . ASN A 1 74  ? 27.722 31.832 6.079  1.00 26.81 ? 80  ASN A N     1 
ATOM   566  C  CA    . ASN A 1 74  ? 27.290 30.928 7.134  1.00 25.88 ? 80  ASN A CA    1 
ATOM   567  C  C     . ASN A 1 74  ? 26.380 29.805 6.638  1.00 24.97 ? 80  ASN A C     1 
ATOM   568  O  O     . ASN A 1 74  ? 25.607 29.959 5.677  1.00 23.40 ? 80  ASN A O     1 
ATOM   569  C  CB    . ASN A 1 74  ? 26.576 31.688 8.254  1.00 25.80 ? 80  ASN A CB    1 
ATOM   570  C  CG    . ASN A 1 74  ? 27.508 32.634 8.993  1.00 27.08 ? 80  ASN A CG    1 
ATOM   571  O  OD1   . ASN A 1 74  ? 28.726 32.382 9.095  1.00 24.63 ? 80  ASN A OD1   1 
ATOM   572  N  ND2   . ASN A 1 74  ? 26.945 33.722 9.528  1.00 23.25 ? 80  ASN A ND2   1 
ATOM   573  N  N     . THR A 1 75  ? 26.486 28.671 7.317  1.00 24.41 ? 81  THR A N     1 
ATOM   574  C  CA    . THR A 1 75  ? 25.683 27.517 6.997  1.00 24.53 ? 81  THR A CA    1 
ATOM   575  C  C     . THR A 1 75  ? 24.279 27.683 7.580  1.00 23.41 ? 81  THR A C     1 
ATOM   576  O  O     . THR A 1 75  ? 23.297 27.389 6.923  1.00 22.70 ? 81  THR A O     1 
ATOM   577  C  CB    . THR A 1 75  ? 26.317 26.233 7.583  1.00 26.86 ? 81  THR A CB    1 
ATOM   578  O  OG1   . THR A 1 75  ? 27.667 26.116 7.131  1.00 29.20 ? 81  THR A OG1   1 
ATOM   579  C  CG2   . THR A 1 75  ? 25.561 24.997 7.115  1.00 29.28 ? 81  THR A CG2   1 
ATOM   580  N  N     . LYS A 1 76  ? 24.185 28.156 8.819  1.00 23.39 ? 82  LYS A N     1 
ATOM   581  C  CA    . LYS A 1 76  ? 22.881 28.325 9.455  1.00 23.13 ? 82  LYS A CA    1 
ATOM   582  C  C     . LYS A 1 76  ? 22.367 29.742 9.390  1.00 22.19 ? 82  LYS A C     1 
ATOM   583  O  O     . LYS A 1 76  ? 23.130 30.698 9.616  1.00 22.48 ? 82  LYS A O     1 
ATOM   584  C  CB    . LYS A 1 76  ? 22.950 27.882 10.908 1.00 25.16 ? 82  LYS A CB    1 
ATOM   585  C  CG    . LYS A 1 76  ? 23.231 26.405 11.063 1.00 29.03 ? 82  LYS A CG    1 
ATOM   586  C  CD    . LYS A 1 76  ? 23.184 26.012 12.520 1.00 33.07 ? 82  LYS A CD    1 
ATOM   587  C  CE    . LYS A 1 76  ? 23.542 24.543 12.729 1.00 33.97 ? 82  LYS A CE    1 
ATOM   588  N  NZ    . LYS A 1 76  ? 23.311 24.130 14.153 1.00 37.12 ? 82  LYS A NZ    1 
ATOM   589  N  N     . LYS A 1 77  ? 21.085 29.885 9.052  1.00 20.84 ? 83  LYS A N     1 
ATOM   590  C  CA    . LYS A 1 77  ? 20.459 31.215 8.999  1.00 20.59 ? 83  LYS A CA    1 
ATOM   591  C  C     . LYS A 1 77  ? 20.505 31.849 10.405 1.00 20.01 ? 83  LYS A C     1 
ATOM   592  O  O     . LYS A 1 77  ? 20.317 31.166 11.398 1.00 17.45 ? 83  LYS A O     1 
ATOM   593  C  CB    . LYS A 1 77  ? 18.993 31.114 8.543  1.00 22.09 ? 83  LYS A CB    1 
ATOM   594  C  CG    . LYS A 1 77  ? 18.259 32.452 8.574  1.00 22.60 ? 83  LYS A CG    1 
ATOM   595  C  CD    . LYS A 1 77  ? 17.208 32.601 7.488  1.00 26.16 ? 83  LYS A CD    1 
ATOM   596  C  CE    . LYS A 1 77  ? 16.028 31.705 7.728  1.00 31.05 ? 83  LYS A CE    1 
ATOM   597  N  NZ    . LYS A 1 77  ? 14.732 32.285 7.240  1.00 33.59 ? 83  LYS A NZ    1 
ATOM   598  N  N     . SER A 1 78  ? 20.767 33.146 10.489 1.00 19.82 ? 84  SER A N     1 
ATOM   599  C  CA    . SER A 1 78  ? 20.805 33.801 11.793 1.00 21.05 ? 84  SER A CA    1 
ATOM   600  C  C     . SER A 1 78  ? 19.932 35.051 11.853 1.00 20.41 ? 84  SER A C     1 
ATOM   601  O  O     . SER A 1 78  ? 19.438 35.554 10.823 1.00 18.06 ? 84  SER A O     1 
ATOM   602  C  CB    . SER A 1 78  ? 22.251 34.189 12.173 1.00 18.16 ? 84  SER A CB    1 
ATOM   603  O  OG    . SER A 1 78  ? 22.822 35.021 11.191 1.00 16.91 ? 84  SER A OG    1 
ATOM   604  N  N     . MET A 1 79  ? 19.741 35.520 13.078 1.00 19.38 ? 85  MET A N     1 
ATOM   605  C  CA    . MET A 1 79  ? 18.982 36.745 13.340 1.00 21.81 ? 85  MET A CA    1 
ATOM   606  C  C     . MET A 1 79  ? 19.834 37.527 14.335 1.00 21.30 ? 85  MET A C     1 
ATOM   607  O  O     . MET A 1 79  ? 20.009 37.106 15.491 1.00 19.92 ? 85  MET A O     1 
ATOM   608  C  CB    . MET A 1 79  ? 17.613 36.464 13.949 1.00 22.09 ? 85  MET A CB    1 
ATOM   609  C  CG    . MET A 1 79  ? 16.813 37.731 14.178 1.00 23.60 ? 85  MET A CG    1 
ATOM   610  S  SD    . MET A 1 79  ? 15.050 37.416 14.296 1.00 28.79 ? 85  MET A SD    1 
ATOM   611  C  CE    . MET A 1 79  ? 14.408 39.018 14.707 1.00 25.25 ? 85  MET A CE    1 
ATOM   612  N  N     . GLU A 1 80  ? 20.345 38.664 13.858 1.00 21.49 ? 86  GLU A N     1 
ATOM   613  C  CA    . GLU A 1 80  ? 21.249 39.521 14.616 1.00 21.66 ? 86  GLU A CA    1 
ATOM   614  C  C     . GLU A 1 80  ? 20.789 40.979 14.668 1.00 20.66 ? 86  GLU A C     1 
ATOM   615  O  O     . GLU A 1 80  ? 20.596 41.643 13.642 1.00 20.99 ? 86  GLU A O     1 
ATOM   616  C  CB    . GLU A 1 80  ? 22.627 39.433 13.975 1.00 21.39 ? 86  GLU A CB    1 
ATOM   617  C  CG    . GLU A 1 80  ? 22.991 38.027 13.575 1.00 22.93 ? 86  GLU A CG    1 
ATOM   618  C  CD    . GLU A 1 80  ? 24.417 37.909 13.029 1.00 25.60 ? 86  GLU A CD    1 
ATOM   619  O  OE1   . GLU A 1 80  ? 25.302 38.683 13.466 1.00 23.57 ? 86  GLU A OE1   1 
ATOM   620  O  OE2   . GLU A 1 80  ? 24.646 37.025 12.176 1.00 24.73 ? 86  GLU A OE2   1 
ATOM   621  N  N     . THR A 1 81  ? 20.644 41.482 15.882 1.00 20.14 ? 87  THR A N     1 
ATOM   622  C  CA    . THR A 1 81  ? 20.180 42.829 16.073 1.00 18.29 ? 87  THR A CA    1 
ATOM   623  C  C     . THR A 1 81  ? 21.270 43.755 16.580 1.00 19.15 ? 87  THR A C     1 
ATOM   624  O  O     . THR A 1 81  ? 21.959 43.467 17.560 1.00 18.70 ? 87  THR A O     1 
ATOM   625  C  CB    . THR A 1 81  ? 19.032 42.852 17.063 1.00 17.00 ? 87  THR A CB    1 
ATOM   626  O  OG1   . THR A 1 81  ? 17.960 42.079 16.543 1.00 18.22 ? 87  THR A OG1   1 
ATOM   627  C  CG2   . THR A 1 81  ? 18.540 44.268 17.273 1.00 18.32 ? 87  THR A CG2   1 
ATOM   628  N  N     . HIS A 1 82  ? 21.451 44.863 15.880 1.00 20.13 ? 88  HIS A N     1 
ATOM   629  C  CA    . HIS A 1 82  ? 22.409 45.849 16.336 1.00 20.40 ? 88  HIS A CA    1 
ATOM   630  C  C     . HIS A 1 82  ? 21.559 47.027 16.802 1.00 20.09 ? 88  HIS A C     1 
ATOM   631  O  O     . HIS A 1 82  ? 20.807 47.613 16.017 1.00 19.35 ? 88  HIS A O     1 
ATOM   632  C  CB    . HIS A 1 82  ? 23.351 46.314 15.242 1.00 19.75 ? 88  HIS A CB    1 
ATOM   633  C  CG    . HIS A 1 82  ? 24.191 47.478 15.670 1.00 21.19 ? 88  HIS A CG    1 
ATOM   634  N  ND1   . HIS A 1 82  ? 25.053 47.406 16.746 1.00 20.94 ? 88  HIS A ND1   1 
ATOM   635  C  CD2   . HIS A 1 82  ? 24.172 48.775 15.291 1.00 19.98 ? 88  HIS A CD2   1 
ATOM   636  C  CE1   . HIS A 1 82  ? 25.514 48.612 17.019 1.00 21.68 ? 88  HIS A CE1   1 
ATOM   637  N  NE2   . HIS A 1 82  ? 24.992 49.462 16.154 1.00 21.30 ? 88  HIS A NE2   1 
ATOM   638  N  N     . ILE A 1 83  ? 21.661 47.343 18.087 1.00 21.51 ? 89  ILE A N     1 
ATOM   639  C  CA    . ILE A 1 83  ? 20.894 48.428 18.673 1.00 22.48 ? 89  ILE A CA    1 
ATOM   640  C  C     . ILE A 1 83  ? 21.666 49.727 18.632 1.00 24.29 ? 89  ILE A C     1 
ATOM   641  O  O     . ILE A 1 83  ? 22.824 49.775 19.034 1.00 24.39 ? 89  ILE A O     1 
ATOM   642  C  CB    . ILE A 1 83  ? 20.568 48.117 20.123 1.00 23.53 ? 89  ILE A CB    1 
ATOM   643  C  CG1   . ILE A 1 83  ? 20.074 46.671 20.235 1.00 21.35 ? 89  ILE A CG1   1 
ATOM   644  C  CG2   . ILE A 1 83  ? 19.498 49.098 20.642 1.00 23.10 ? 89  ILE A CG2   1 
ATOM   645  C  CD1   . ILE A 1 83  ? 19.898 46.206 21.666 1.00 19.66 ? 89  ILE A CD1   1 
ATOM   646  N  N     . MET A 1 84  ? 21.043 50.789 18.132 1.00 27.86 ? 90  MET A N     1 
ATOM   647  C  CA    . MET A 1 84  ? 21.745 52.063 18.102 1.00 29.76 ? 90  MET A CA    1 
ATOM   648  C  C     . MET A 1 84  ? 21.634 52.681 19.483 1.00 30.87 ? 90  MET A C     1 
ATOM   649  O  O     . MET A 1 84  ? 20.814 53.568 19.732 1.00 31.01 ? 90  MET A O     1 
ATOM   650  C  CB    . MET A 1 84  ? 21.163 52.987 17.047 1.00 30.18 ? 90  MET A CB    1 
ATOM   651  C  CG    . MET A 1 84  ? 21.585 52.581 15.649 1.00 33.38 ? 90  MET A CG    1 
ATOM   652  S  SD    . MET A 1 84  ? 20.563 51.255 15.018 1.00 35.89 ? 90  MET A SD    1 
ATOM   653  C  CE    . MET A 1 84  ? 19.531 52.237 13.852 1.00 32.42 ? 90  MET A CE    1 
ATOM   654  N  N     . HIS A 1 85  ? 22.471 52.182 20.384 1.00 31.01 ? 91  HIS A N     1 
ATOM   655  C  CA    . HIS A 1 85  ? 22.492 52.637 21.752 1.00 32.08 ? 91  HIS A CA    1 
ATOM   656  C  C     . HIS A 1 85  ? 23.794 52.162 22.366 1.00 33.61 ? 91  HIS A C     1 
ATOM   657  O  O     . HIS A 1 85  ? 24.300 51.094 22.031 1.00 34.38 ? 91  HIS A O     1 
ATOM   658  C  CB    . HIS A 1 85  ? 21.317 52.037 22.517 1.00 30.47 ? 91  HIS A CB    1 
ATOM   659  C  CG    . HIS A 1 85  ? 21.292 52.431 23.952 1.00 31.67 ? 91  HIS A CG    1 
ATOM   660  N  ND1   . HIS A 1 85  ? 20.819 53.654 24.377 1.00 33.07 ? 91  HIS A ND1   1 
ATOM   661  C  CD2   . HIS A 1 85  ? 21.755 51.800 25.056 1.00 31.68 ? 91  HIS A CD2   1 
ATOM   662  C  CE1   . HIS A 1 85  ? 20.993 53.760 25.683 1.00 32.88 ? 91  HIS A CE1   1 
ATOM   663  N  NE2   . HIS A 1 85  ? 21.561 52.648 26.120 1.00 33.67 ? 91  HIS A NE2   1 
ATOM   664  N  N     . THR A 1 86  ? 24.333 52.941 23.284 1.00 35.63 ? 92  THR A N     1 
ATOM   665  C  CA    . THR A 1 86  ? 25.579 52.555 23.910 1.00 36.43 ? 92  THR A CA    1 
ATOM   666  C  C     . THR A 1 86  ? 25.294 51.937 25.258 1.00 37.29 ? 92  THR A C     1 
ATOM   667  O  O     . THR A 1 86  ? 24.726 52.590 26.129 1.00 39.22 ? 92  THR A O     1 
ATOM   668  C  CB    . THR A 1 86  ? 26.489 53.773 24.066 1.00 36.29 ? 92  THR A CB    1 
ATOM   669  O  OG1   . THR A 1 86  ? 26.770 54.300 22.762 1.00 34.68 ? 92  THR A OG1   1 
ATOM   670  C  CG2   . THR A 1 86  ? 27.799 53.386 24.760 1.00 35.71 ? 92  THR A CG2   1 
ATOM   671  N  N     . PHE A 1 87  ? 25.660 50.671 25.421 1.00 37.26 ? 93  PHE A N     1 
ATOM   672  C  CA    . PHE A 1 87  ? 25.431 49.979 26.688 1.00 38.28 ? 93  PHE A CA    1 
ATOM   673  C  C     . PHE A 1 87  ? 26.759 49.927 27.407 1.00 40.75 ? 93  PHE A C     1 
ATOM   674  O  O     . PHE A 1 87  ? 27.817 49.916 26.767 1.00 40.27 ? 93  PHE A O     1 
ATOM   675  C  CB    . PHE A 1 87  ? 24.936 48.538 26.479 1.00 33.80 ? 93  PHE A CB    1 
ATOM   676  C  CG    . PHE A 1 87  ? 23.598 48.435 25.807 1.00 30.44 ? 93  PHE A CG    1 
ATOM   677  C  CD1   . PHE A 1 87  ? 23.482 48.585 24.440 1.00 28.10 ? 93  PHE A CD1   1 
ATOM   678  C  CD2   . PHE A 1 87  ? 22.453 48.174 26.551 1.00 29.28 ? 93  PHE A CD2   1 
ATOM   679  C  CE1   . PHE A 1 87  ? 22.259 48.477 23.817 1.00 28.85 ? 93  PHE A CE1   1 
ATOM   680  C  CE2   . PHE A 1 87  ? 21.218 48.064 25.937 1.00 29.10 ? 93  PHE A CE2   1 
ATOM   681  C  CZ    . PHE A 1 87  ? 21.115 48.215 24.563 1.00 28.30 ? 93  PHE A CZ    1 
ATOM   682  N  N     . LYS A 1 88  ? 26.710 49.885 28.733 1.00 43.43 ? 94  LYS A N     1 
ATOM   683  C  CA    . LYS A 1 88  ? 27.942 49.835 29.512 1.00 46.17 ? 94  LYS A CA    1 
ATOM   684  C  C     . LYS A 1 88  ? 28.468 48.394 29.555 1.00 44.91 ? 94  LYS A C     1 
ATOM   685  O  O     . LYS A 1 88  ? 29.675 48.144 29.454 1.00 43.69 ? 94  LYS A O     1 
ATOM   686  C  CB    . LYS A 1 88  ? 27.682 50.359 30.933 1.00 49.75 ? 94  LYS A CB    1 
ATOM   687  C  CG    . LYS A 1 88  ? 26.755 49.462 31.787 1.00 54.48 ? 94  LYS A CG    1 
ATOM   688  C  CD    . LYS A 1 88  ? 26.348 50.131 33.116 1.00 56.60 ? 94  LYS A CD    1 
ATOM   689  C  CE    . LYS A 1 88  ? 25.305 51.258 32.921 1.00 58.14 ? 94  LYS A CE    1 
ATOM   690  N  NZ    . LYS A 1 88  ? 25.771 52.414 32.087 1.00 58.49 ? 94  LYS A NZ    1 
ATOM   691  N  N     . GLU A 1 89  ? 27.559 47.442 29.691 1.00 43.10 ? 95  GLU A N     1 
ATOM   692  C  CA    . GLU A 1 89  ? 27.984 46.057 29.751 1.00 44.29 ? 95  GLU A CA    1 
ATOM   693  C  C     . GLU A 1 89  ? 27.288 45.190 28.705 1.00 41.36 ? 95  GLU A C     1 
ATOM   694  O  O     . GLU A 1 89  ? 26.258 45.569 28.144 1.00 39.62 ? 95  GLU A O     1 
ATOM   695  C  CB    . GLU A 1 89  ? 27.715 45.497 31.150 1.00 49.08 ? 95  GLU A CB    1 
ATOM   696  C  CG    . GLU A 1 89  ? 28.631 46.044 32.245 1.00 56.65 ? 95  GLU A CG    1 
ATOM   697  C  CD    . GLU A 1 89  ? 28.047 45.835 33.650 1.00 62.45 ? 95  GLU A CD    1 
ATOM   698  O  OE1   . GLU A 1 89  ? 27.052 46.532 33.984 1.00 64.02 ? 95  GLU A OE1   1 
ATOM   699  O  OE2   . GLU A 1 89  ? 28.571 44.974 34.415 1.00 63.85 ? 95  GLU A OE2   1 
ATOM   700  N  N     . ASP A 1 90  ? 27.874 44.029 28.431 1.00 37.82 ? 96  ASP A N     1 
ATOM   701  C  CA    . ASP A 1 90  ? 27.291 43.103 27.483 1.00 34.79 ? 96  ASP A CA    1 
ATOM   702  C  C     . ASP A 1 90  ? 26.026 42.514 28.106 1.00 32.93 ? 96  ASP A C     1 
ATOM   703  O  O     . ASP A 1 90  ? 25.892 42.502 29.330 1.00 34.10 ? 96  ASP A O     1 
ATOM   704  C  CB    . ASP A 1 90  ? 28.316 42.025 27.123 1.00 33.64 ? 96  ASP A CB    1 
ATOM   705  C  CG    . ASP A 1 90  ? 29.334 42.529 26.099 1.00 34.11 ? 96  ASP A CG    1 
ATOM   706  O  OD1   . ASP A 1 90  ? 29.006 43.490 25.354 1.00 31.00 ? 96  ASP A OD1   1 
ATOM   707  O  OD2   . ASP A 1 90  ? 30.443 41.963 26.019 1.00 34.09 ? 96  ASP A OD2   1 
ATOM   708  N  N     . PHE A 1 91  ? 25.083 42.070 27.280 1.00 28.80 ? 97  PHE A N     1 
ATOM   709  C  CA    . PHE A 1 91  ? 23.844 41.510 27.801 1.00 26.22 ? 97  PHE A CA    1 
ATOM   710  C  C     . PHE A 1 91  ? 23.538 40.067 27.376 1.00 25.67 ? 97  PHE A C     1 
ATOM   711  O  O     . PHE A 1 91  ? 22.371 39.698 27.151 1.00 23.25 ? 97  PHE A O     1 
ATOM   712  C  CB    . PHE A 1 91  ? 22.638 42.427 27.487 1.00 23.65 ? 97  PHE A CB    1 
ATOM   713  C  CG    . PHE A 1 91  ? 22.628 43.003 26.086 1.00 23.52 ? 97  PHE A CG    1 
ATOM   714  C  CD1   . PHE A 1 91  ? 23.377 44.138 25.776 1.00 23.18 ? 97  PHE A CD1   1 
ATOM   715  C  CD2   . PHE A 1 91  ? 21.841 42.432 25.087 1.00 22.52 ? 97  PHE A CD2   1 
ATOM   716  C  CE1   . PHE A 1 91  ? 23.345 44.696 24.503 1.00 23.20 ? 97  PHE A CE1   1 
ATOM   717  C  CE2   . PHE A 1 91  ? 21.797 42.973 23.820 1.00 21.37 ? 97  PHE A CE2   1 
ATOM   718  C  CZ    . PHE A 1 91  ? 22.559 44.121 23.523 1.00 23.94 ? 97  PHE A CZ    1 
ATOM   719  N  N     . TYR A 1 92  ? 24.586 39.251 27.281 1.00 24.07 ? 98  TYR A N     1 
ATOM   720  C  CA    . TYR A 1 92  ? 24.414 37.840 26.948 1.00 24.19 ? 98  TYR A CA    1 
ATOM   721  C  C     . TYR A 1 92  ? 23.501 37.210 27.991 1.00 24.33 ? 98  TYR A C     1 
ATOM   722  O  O     . TYR A 1 92  ? 23.643 37.484 29.187 1.00 24.83 ? 98  TYR A O     1 
ATOM   723  C  CB    . TYR A 1 92  ? 25.757 37.124 26.963 1.00 24.19 ? 98  TYR A CB    1 
ATOM   724  C  CG    . TYR A 1 92  ? 26.620 37.446 25.766 1.00 26.39 ? 98  TYR A CG    1 
ATOM   725  C  CD1   . TYR A 1 92  ? 26.293 36.960 24.487 1.00 27.39 ? 98  TYR A CD1   1 
ATOM   726  C  CD2   . TYR A 1 92  ? 27.751 38.233 25.898 1.00 24.64 ? 98  TYR A CD2   1 
ATOM   727  C  CE1   . TYR A 1 92  ? 27.082 37.258 23.376 1.00 28.70 ? 98  TYR A CE1   1 
ATOM   728  C  CE2   . TYR A 1 92  ? 28.538 38.539 24.799 1.00 28.10 ? 98  TYR A CE2   1 
ATOM   729  C  CZ    . TYR A 1 92  ? 28.201 38.050 23.542 1.00 27.83 ? 98  TYR A CZ    1 
ATOM   730  O  OH    . TYR A 1 92  ? 28.990 38.361 22.465 1.00 29.86 ? 98  TYR A OH    1 
ATOM   731  N  N     . GLY A 1 93  ? 22.548 36.395 27.541 1.00 23.92 ? 99  GLY A N     1 
ATOM   732  C  CA    . GLY A 1 93  ? 21.644 35.737 28.472 1.00 23.72 ? 99  GLY A CA    1 
ATOM   733  C  C     . GLY A 1 93  ? 20.351 36.473 28.757 1.00 23.21 ? 99  GLY A C     1 
ATOM   734  O  O     . GLY A 1 93  ? 19.396 35.881 29.250 1.00 23.19 ? 99  GLY A O     1 
ATOM   735  N  N     . GLU A 1 94  ? 20.321 37.763 28.445 1.00 24.57 ? 100 GLU A N     1 
ATOM   736  C  CA    . GLU A 1 94  ? 19.127 38.585 28.644 1.00 24.60 ? 100 GLU A CA    1 
ATOM   737  C  C     . GLU A 1 94  ? 18.163 38.357 27.497 1.00 22.06 ? 100 GLU A C     1 
ATOM   738  O  O     . GLU A 1 94  ? 18.545 37.900 26.419 1.00 19.00 ? 100 GLU A O     1 
ATOM   739  C  CB    . GLU A 1 94  ? 19.476 40.073 28.662 1.00 28.24 ? 100 GLU A CB    1 
ATOM   740  C  CG    . GLU A 1 94  ? 20.772 40.405 29.365 1.00 36.21 ? 100 GLU A CG    1 
ATOM   741  C  CD    . GLU A 1 94  ? 20.604 40.486 30.849 1.00 41.23 ? 100 GLU A CD    1 
ATOM   742  O  OE1   . GLU A 1 94  ? 19.851 39.636 31.364 1.00 45.99 ? 100 GLU A OE1   1 
ATOM   743  O  OE2   . GLU A 1 94  ? 21.219 41.381 31.499 1.00 44.51 ? 100 GLU A OE2   1 
ATOM   744  N  N     . ILE A 1 95  ? 16.906 38.696 27.735 1.00 21.39 ? 101 ILE A N     1 
ATOM   745  C  CA    . ILE A 1 95  ? 15.912 38.542 26.705 1.00 21.66 ? 101 ILE A CA    1 
ATOM   746  C  C     . ILE A 1 95  ? 15.834 39.807 25.897 1.00 23.35 ? 101 ILE A C     1 
ATOM   747  O  O     . ILE A 1 95  ? 15.621 40.878 26.442 1.00 22.52 ? 101 ILE A O     1 
ATOM   748  C  CB    . ILE A 1 95  ? 14.529 38.258 27.284 1.00 21.93 ? 101 ILE A CB    1 
ATOM   749  C  CG1   . ILE A 1 95  ? 14.565 36.923 28.030 1.00 21.62 ? 101 ILE A CG1   1 
ATOM   750  C  CG2   . ILE A 1 95  ? 13.497 38.203 26.158 1.00 21.26 ? 101 ILE A CG2   1 
ATOM   751  C  CD1   . ILE A 1 95  ? 15.406 35.875 27.313 1.00 21.91 ? 101 ILE A CD1   1 
ATOM   752  N  N     . LEU A 1 96  ? 16.025 39.678 24.592 1.00 24.17 ? 102 LEU A N     1 
ATOM   753  C  CA    . LEU A 1 96  ? 15.953 40.814 23.696 1.00 24.23 ? 102 LEU A CA    1 
ATOM   754  C  C     . LEU A 1 96  ? 14.529 40.885 23.125 1.00 24.01 ? 102 LEU A C     1 
ATOM   755  O  O     . LEU A 1 96  ? 14.066 39.919 22.530 1.00 24.28 ? 102 LEU A O     1 
ATOM   756  C  CB    . LEU A 1 96  ? 16.948 40.647 22.557 1.00 22.60 ? 102 LEU A CB    1 
ATOM   757  C  CG    . LEU A 1 96  ? 16.862 41.862 21.619 1.00 26.55 ? 102 LEU A CG    1 
ATOM   758  C  CD1   . LEU A 1 96  ? 17.385 43.097 22.381 1.00 25.64 ? 102 LEU A CD1   1 
ATOM   759  C  CD2   . LEU A 1 96  ? 17.676 41.645 20.336 1.00 24.81 ? 102 LEU A CD2   1 
ATOM   760  N  N     . ASN A 1 97  ? 13.845 42.013 23.313 1.00 23.46 ? 103 ASN A N     1 
ATOM   761  C  CA    . ASN A 1 97  ? 12.485 42.190 22.799 1.00 24.30 ? 103 ASN A CA    1 
ATOM   762  C  C     . ASN A 1 97  ? 12.552 42.948 21.512 1.00 24.41 ? 103 ASN A C     1 
ATOM   763  O  O     . ASN A 1 97  ? 13.094 44.045 21.465 1.00 25.03 ? 103 ASN A O     1 
ATOM   764  C  CB    . ASN A 1 97  ? 11.638 42.946 23.794 1.00 25.61 ? 103 ASN A CB    1 
ATOM   765  C  CG    . ASN A 1 97  ? 11.717 42.336 25.125 1.00 26.94 ? 103 ASN A CG    1 
ATOM   766  O  OD1   . ASN A 1 97  ? 11.320 41.184 25.309 1.00 28.60 ? 103 ASN A OD1   1 
ATOM   767  N  ND2   . ASN A 1 97  ? 12.281 43.065 26.070 1.00 26.70 ? 103 ASN A ND2   1 
ATOM   768  N  N     . VAL A 1 98  ? 11.955 42.381 20.475 1.00 23.48 ? 104 VAL A N     1 
ATOM   769  C  CA    . VAL A 1 98  ? 12.063 42.986 19.187 1.00 23.51 ? 104 VAL A CA    1 
ATOM   770  C  C     . VAL A 1 98  ? 10.803 43.165 18.369 1.00 24.91 ? 104 VAL A C     1 
ATOM   771  O  O     . VAL A 1 98  ? 9.869  42.364 18.425 1.00 24.20 ? 104 VAL A O     1 
ATOM   772  C  CB    . VAL A 1 98  ? 13.112 42.187 18.396 1.00 23.64 ? 104 VAL A CB    1 
ATOM   773  C  CG1   . VAL A 1 98  ? 12.840 42.249 16.911 1.00 21.93 ? 104 VAL A CG1   1 
ATOM   774  C  CG2   . VAL A 1 98  ? 14.492 42.731 18.731 1.00 24.09 ? 104 VAL A CG2   1 
ATOM   775  N  N     . ALA A 1 99  ? 10.808 44.255 17.610 1.00 25.51 ? 105 ALA A N     1 
ATOM   776  C  CA    . ALA A 1 99  ? 9.725  44.602 16.713 1.00 25.39 ? 105 ALA A CA    1 
ATOM   777  C  C     . ALA A 1 99  ? 10.380 44.975 15.389 1.00 26.19 ? 105 ALA A C     1 
ATOM   778  O  O     . ALA A 1 99  ? 11.059 45.993 15.273 1.00 25.18 ? 105 ALA A O     1 
ATOM   779  C  CB    . ALA A 1 99  ? 8.926  45.784 17.259 1.00 25.45 ? 105 ALA A CB    1 
ATOM   780  N  N     . ILE A 1 100 ? 10.202 44.122 14.398 1.00 26.69 ? 106 ILE A N     1 
ATOM   781  C  CA    . ILE A 1 100 ? 10.745 44.395 13.094 1.00 27.87 ? 106 ILE A CA    1 
ATOM   782  C  C     . ILE A 1 100 ? 9.692  45.251 12.430 1.00 28.15 ? 106 ILE A C     1 
ATOM   783  O  O     . ILE A 1 100 ? 8.558  44.808 12.250 1.00 27.48 ? 106 ILE A O     1 
ATOM   784  C  CB    . ILE A 1 100 ? 10.917 43.114 12.302 1.00 27.56 ? 106 ILE A CB    1 
ATOM   785  C  CG1   . ILE A 1 100 ? 11.880 42.191 13.036 1.00 29.64 ? 106 ILE A CG1   1 
ATOM   786  C  CG2   . ILE A 1 100 ? 11.436 43.431 10.924 1.00 27.84 ? 106 ILE A CG2   1 
ATOM   787  C  CD1   . ILE A 1 100 ? 11.958 40.809 12.433 1.00 30.73 ? 106 ILE A CD1   1 
ATOM   788  N  N     . VAL A 1 101 ? 10.050 46.469 12.048 1.00 29.31 ? 107 VAL A N     1 
ATOM   789  C  CA    . VAL A 1 101 ? 9.044  47.314 11.435 1.00 30.51 ? 107 VAL A CA    1 
ATOM   790  C  C     . VAL A 1 101 ? 9.208  47.654 9.964  1.00 30.78 ? 107 VAL A C     1 
ATOM   791  O  O     . VAL A 1 101 ? 8.229  48.014 9.327  1.00 32.28 ? 107 VAL A O     1 
ATOM   792  C  CB    . VAL A 1 101 ? 8.846  48.622 12.259 1.00 31.95 ? 107 VAL A CB    1 
ATOM   793  C  CG1   . VAL A 1 101 ? 9.469  48.454 13.649 1.00 31.59 ? 107 VAL A CG1   1 
ATOM   794  C  CG2   . VAL A 1 101 ? 9.409  49.819 11.525 1.00 31.76 ? 107 VAL A CG2   1 
ATOM   795  N  N     . GLY A 1 102 ? 10.411 47.532 9.406  1.00 29.89 ? 108 GLY A N     1 
ATOM   796  C  CA    . GLY A 1 102 ? 10.579 47.871 8.000  1.00 29.47 ? 108 GLY A CA    1 
ATOM   797  C  C     . GLY A 1 102 ? 11.720 47.191 7.267  1.00 30.86 ? 108 GLY A C     1 
ATOM   798  O  O     . GLY A 1 102 ? 12.716 46.807 7.876  1.00 31.92 ? 108 GLY A O     1 
ATOM   799  N  N     . TYR A 1 103 ? 11.591 47.045 5.952  1.00 30.21 ? 109 TYR A N     1 
ATOM   800  C  CA    . TYR A 1 103 ? 12.635 46.399 5.179  1.00 30.28 ? 109 TYR A CA    1 
ATOM   801  C  C     . TYR A 1 103 ? 13.556 47.410 4.531  1.00 30.91 ? 109 TYR A C     1 
ATOM   802  O  O     . TYR A 1 103 ? 13.099 48.388 3.931  1.00 31.86 ? 109 TYR A O     1 
ATOM   803  C  CB    . TYR A 1 103 ? 12.032 45.533 4.094  1.00 29.77 ? 109 TYR A CB    1 
ATOM   804  C  CG    . TYR A 1 103 ? 13.038 44.715 3.294  1.00 33.53 ? 109 TYR A CG    1 
ATOM   805  C  CD1   . TYR A 1 103 ? 13.688 43.604 3.860  1.00 34.05 ? 109 TYR A CD1   1 
ATOM   806  C  CD2   . TYR A 1 103 ? 13.259 44.983 1.934  1.00 34.78 ? 109 TYR A CD2   1 
ATOM   807  C  CE1   . TYR A 1 103 ? 14.515 42.770 3.089  1.00 34.77 ? 109 TYR A CE1   1 
ATOM   808  C  CE2   . TYR A 1 103 ? 14.082 44.165 1.156  1.00 35.51 ? 109 TYR A CE2   1 
ATOM   809  C  CZ    . TYR A 1 103 ? 14.702 43.057 1.732  1.00 37.50 ? 109 TYR A CZ    1 
ATOM   810  O  OH    . TYR A 1 103 ? 15.479 42.226 0.938  1.00 39.16 ? 109 TYR A OH    1 
ATOM   811  N  N     . LEU A 1 104 ? 14.862 47.177 4.641  1.00 30.46 ? 110 LEU A N     1 
ATOM   812  C  CA    . LEU A 1 104 ? 15.824 48.090 4.033  1.00 28.85 ? 110 LEU A CA    1 
ATOM   813  C  C     . LEU A 1 104 ? 16.376 47.542 2.732  1.00 28.60 ? 110 LEU A C     1 
ATOM   814  O  O     . LEU A 1 104 ? 16.243 48.178 1.690  1.00 28.69 ? 110 LEU A O     1 
ATOM   815  C  CB    . LEU A 1 104 ? 16.989 48.373 4.976  1.00 30.09 ? 110 LEU A CB    1 
ATOM   816  C  CG    . LEU A 1 104 ? 16.758 49.235 6.217  1.00 29.99 ? 110 LEU A CG    1 
ATOM   817  C  CD1   . LEU A 1 104 ? 18.080 49.305 7.026  1.00 28.88 ? 110 LEU A CD1   1 
ATOM   818  C  CD2   . LEU A 1 104 ? 16.283 50.634 5.796  1.00 28.07 ? 110 LEU A CD2   1 
ATOM   819  N  N     . ARG A 1 105 ? 16.975 46.353 2.788  1.00 27.98 ? 111 ARG A N     1 
ATOM   820  C  CA    . ARG A 1 105 ? 17.584 45.749 1.600  1.00 25.80 ? 111 ARG A CA    1 
ATOM   821  C  C     . ARG A 1 105 ? 17.876 44.277 1.829  1.00 24.97 ? 111 ARG A C     1 
ATOM   822  O  O     . ARG A 1 105 ? 17.675 43.752 2.918  1.00 26.23 ? 111 ARG A O     1 
ATOM   823  C  CB    . ARG A 1 105 ? 18.911 46.452 1.307  1.00 25.26 ? 111 ARG A CB    1 
ATOM   824  C  CG    . ARG A 1 105 ? 19.999 46.199 2.396  1.00 25.58 ? 111 ARG A CG    1 
ATOM   825  C  CD    . ARG A 1 105 ? 21.358 46.875 2.081  1.00 21.47 ? 111 ARG A CD    1 
ATOM   826  N  NE    . ARG A 1 105 ? 22.325 46.730 3.164  1.00 20.19 ? 111 ARG A NE    1 
ATOM   827  C  CZ    . ARG A 1 105 ? 23.011 45.612 3.427  1.00 23.81 ? 111 ARG A CZ    1 
ATOM   828  N  NH1   . ARG A 1 105 ? 22.843 44.519 2.672  1.00 23.00 ? 111 ARG A NH1   1 
ATOM   829  N  NH2   . ARG A 1 105 ? 23.858 45.574 4.455  1.00 18.70 ? 111 ARG A NH2   1 
ATOM   830  N  N     . PRO A 1 106 ? 18.313 43.570 0.786  1.00 25.48 ? 112 PRO A N     1 
ATOM   831  C  CA    . PRO A 1 106 ? 18.606 42.154 1.070  1.00 24.38 ? 112 PRO A CA    1 
ATOM   832  C  C     . PRO A 1 106 ? 20.084 42.029 1.472  1.00 22.62 ? 112 PRO A C     1 
ATOM   833  O  O     . PRO A 1 106 ? 20.841 42.987 1.342  1.00 21.07 ? 112 PRO A O     1 
ATOM   834  C  CB    . PRO A 1 106 ? 18.306 41.457 -0.264 1.00 23.90 ? 112 PRO A CB    1 
ATOM   835  C  CG    . PRO A 1 106 ? 18.680 42.509 -1.283 1.00 22.63 ? 112 PRO A CG    1 
ATOM   836  C  CD    . PRO A 1 106 ? 18.091 43.787 -0.663 1.00 24.05 ? 112 PRO A CD    1 
ATOM   837  N  N     . GLU A 1 107 ? 20.457 40.857 1.988  1.00 24.72 ? 113 GLU A N     1 
ATOM   838  C  CA    . GLU A 1 107 ? 21.830 40.529 2.388  1.00 26.00 ? 113 GLU A CA    1 
ATOM   839  C  C     . GLU A 1 107 ? 22.729 40.591 1.138  1.00 26.77 ? 113 GLU A C     1 
ATOM   840  O  O     . GLU A 1 107 ? 22.286 40.273 0.040  1.00 26.03 ? 113 GLU A O     1 
ATOM   841  C  CB    . GLU A 1 107 ? 21.935 39.082 2.846  1.00 26.99 ? 113 GLU A CB    1 
ATOM   842  C  CG    . GLU A 1 107 ? 21.153 38.607 4.006  1.00 29.30 ? 113 GLU A CG    1 
ATOM   843  C  CD    . GLU A 1 107 ? 21.704 37.246 4.488  1.00 30.35 ? 113 GLU A CD    1 
ATOM   844  O  OE1   . GLU A 1 107 ? 21.457 36.168 3.853  1.00 28.96 ? 113 GLU A OE1   1 
ATOM   845  O  OE2   . GLU A 1 107 ? 22.414 37.274 5.513  1.00 29.95 ? 113 GLU A OE2   1 
ATOM   846  N  N     . LYS A 1 108 ? 23.997 40.929 1.300  1.00 27.15 ? 114 LYS A N     1 
ATOM   847  C  CA    . LYS A 1 108 ? 24.870 40.957 0.142  1.00 29.20 ? 114 LYS A CA    1 
ATOM   848  C  C     . LYS A 1 108 ? 26.252 40.481 0.460  1.00 29.82 ? 114 LYS A C     1 
ATOM   849  O  O     . LYS A 1 108 ? 26.644 40.350 1.625  1.00 28.86 ? 114 LYS A O     1 
ATOM   850  C  CB    . LYS A 1 108 ? 25.063 42.364 -0.390 1.00 31.62 ? 114 LYS A CB    1 
ATOM   851  C  CG    . LYS A 1 108 ? 23.849 43.084 -0.747 1.00 35.14 ? 114 LYS A CG    1 
ATOM   852  C  CD    . LYS A 1 108 ? 24.217 44.529 -0.943 1.00 38.32 ? 114 LYS A CD    1 
ATOM   853  C  CE    . LYS A 1 108 ? 22.970 45.344 -1.243 1.00 41.63 ? 114 LYS A CE    1 
ATOM   854  N  NZ    . LYS A 1 108 ? 23.270 46.806 -1.210 1.00 44.77 ? 114 LYS A NZ    1 
ATOM   855  N  N     . ASN A 1 109 ? 27.001 40.251 -0.610 1.00 30.17 ? 115 ASN A N     1 
ATOM   856  C  CA    . ASN A 1 109 ? 28.388 39.899 -0.462 1.00 29.86 ? 115 ASN A CA    1 
ATOM   857  C  C     . ASN A 1 109 ? 29.114 41.211 -0.770 1.00 29.21 ? 115 ASN A C     1 
ATOM   858  O  O     . ASN A 1 109 ? 28.542 42.117 -1.377 1.00 28.48 ? 115 ASN A O     1 
ATOM   859  C  CB    . ASN A 1 109 ? 28.824 38.812 -1.430 1.00 29.38 ? 115 ASN A CB    1 
ATOM   860  C  CG    . ASN A 1 109 ? 30.196 38.256 -1.067 1.00 31.47 ? 115 ASN A CG    1 
ATOM   861  O  OD1   . ASN A 1 109 ? 30.853 38.757 -0.138 1.00 31.77 ? 115 ASN A OD1   1 
ATOM   862  N  ND2   . ASN A 1 109 ? 30.638 37.227 -1.787 1.00 30.41 ? 115 ASN A ND2   1 
ATOM   863  N  N     . PHE A 1 110 ? 30.348 41.333 -0.309 1.00 29.24 ? 116 PHE A N     1 
ATOM   864  C  CA    . PHE A 1 110 ? 31.119 42.543 -0.539 1.00 30.36 ? 116 PHE A CA    1 
ATOM   865  C  C     . PHE A 1 110 ? 32.533 42.134 -0.892 1.00 31.14 ? 116 PHE A C     1 
ATOM   866  O  O     . PHE A 1 110 ? 32.926 40.989 -0.660 1.00 30.54 ? 116 PHE A O     1 
ATOM   867  C  CB    . PHE A 1 110 ? 31.119 43.418 0.715  1.00 29.92 ? 116 PHE A CB    1 
ATOM   868  C  CG    . PHE A 1 110 ? 29.769 43.981 1.054  1.00 30.06 ? 116 PHE A CG    1 
ATOM   869  C  CD1   . PHE A 1 110 ? 29.312 45.147 0.441  1.00 30.09 ? 116 PHE A CD1   1 
ATOM   870  C  CD2   . PHE A 1 110 ? 28.931 43.313 1.938  1.00 28.96 ? 116 PHE A CD2   1 
ATOM   871  C  CE1   . PHE A 1 110 ? 28.027 45.640 0.703  1.00 30.29 ? 116 PHE A CE1   1 
ATOM   872  C  CE2   . PHE A 1 110 ? 27.653 43.784 2.211  1.00 31.38 ? 116 PHE A CE2   1 
ATOM   873  C  CZ    . PHE A 1 110 ? 27.192 44.962 1.587  1.00 31.91 ? 116 PHE A CZ    1 
ATOM   874  N  N     . ASP A 1 111 ? 33.294 43.067 -1.456 1.00 30.90 ? 117 ASP A N     1 
ATOM   875  C  CA    . ASP A 1 111 ? 34.661 42.777 -1.828 1.00 30.31 ? 117 ASP A CA    1 
ATOM   876  C  C     . ASP A 1 111 ? 35.630 42.997 -0.690 1.00 29.58 ? 117 ASP A C     1 
ATOM   877  O  O     . ASP A 1 111 ? 36.793 42.609 -0.806 1.00 28.39 ? 117 ASP A O     1 
ATOM   878  C  CB    . ASP A 1 111 ? 35.109 43.638 -3.005 1.00 33.02 ? 117 ASP A CB    1 
ATOM   879  C  CG    . ASP A 1 111 ? 34.990 45.137 -2.725 1.00 37.08 ? 117 ASP A CG    1 
ATOM   880  O  OD1   . ASP A 1 111 ? 35.078 45.597 -1.551 1.00 39.67 ? 117 ASP A OD1   1 
ATOM   881  O  OD2   . ASP A 1 111 ? 34.813 45.877 -3.714 1.00 39.70 ? 117 ASP A OD2   1 
ATOM   882  N  N     . SER A 1 112 ? 35.174 43.627 0.396  1.00 27.92 ? 118 SER A N     1 
ATOM   883  C  CA    . SER A 1 112 ? 36.061 43.892 1.529  1.00 27.32 ? 118 SER A CA    1 
ATOM   884  C  C     . SER A 1 112 ? 35.328 44.211 2.826  1.00 27.21 ? 118 SER A C     1 
ATOM   885  O  O     . SER A 1 112 ? 34.149 44.574 2.829  1.00 25.74 ? 118 SER A O     1 
ATOM   886  C  CB    . SER A 1 112 ? 37.003 45.057 1.200  1.00 26.01 ? 118 SER A CB    1 
ATOM   887  O  OG    . SER A 1 112 ? 36.289 46.273 1.102  1.00 25.52 ? 118 SER A OG    1 
ATOM   888  N  N     . LEU A 1 113 ? 36.040 44.080 3.933  1.00 26.24 ? 119 LEU A N     1 
ATOM   889  C  CA    . LEU A 1 113 ? 35.437 44.377 5.216  1.00 28.05 ? 119 LEU A CA    1 
ATOM   890  C  C     . LEU A 1 113 ? 34.991 45.821 5.208  1.00 28.33 ? 119 LEU A C     1 
ATOM   891  O  O     . LEU A 1 113 ? 33.981 46.184 5.801  1.00 26.75 ? 119 LEU A O     1 
ATOM   892  C  CB    . LEU A 1 113 ? 36.437 44.167 6.357  1.00 27.52 ? 119 LEU A CB    1 
ATOM   893  C  CG    . LEU A 1 113 ? 36.590 42.740 6.884  1.00 28.24 ? 119 LEU A CG    1 
ATOM   894  C  CD1   . LEU A 1 113 ? 37.231 42.777 8.258  1.00 26.90 ? 119 LEU A CD1   1 
ATOM   895  C  CD2   . LEU A 1 113 ? 35.216 42.082 6.965  1.00 27.55 ? 119 LEU A CD2   1 
ATOM   896  N  N     . GLU A 1 114 ? 35.768 46.642 4.523  1.00 29.01 ? 120 GLU A N     1 
ATOM   897  C  CA    . GLU A 1 114 ? 35.464 48.041 4.452  1.00 31.11 ? 120 GLU A CA    1 
ATOM   898  C  C     . GLU A 1 114 ? 34.108 48.262 3.785  1.00 30.14 ? 120 GLU A C     1 
ATOM   899  O  O     . GLU A 1 114 ? 33.252 48.968 4.323  1.00 30.57 ? 120 GLU A O     1 
ATOM   900  C  CB    . GLU A 1 114 ? 36.579 48.760 3.701  1.00 33.75 ? 120 GLU A CB    1 
ATOM   901  C  CG    . GLU A 1 114 ? 36.299 50.216 3.398  1.00 41.52 ? 120 GLU A CG    1 
ATOM   902  C  CD    . GLU A 1 114 ? 37.340 50.816 2.449  1.00 46.91 ? 120 GLU A CD    1 
ATOM   903  O  OE1   . GLU A 1 114 ? 37.876 50.046 1.610  1.00 49.59 ? 120 GLU A OE1   1 
ATOM   904  O  OE2   . GLU A 1 114 ? 37.614 52.045 2.531  1.00 48.27 ? 120 GLU A OE2   1 
ATOM   905  N  N     . SER A 1 115 ? 33.899 47.659 2.627  1.00 28.66 ? 121 SER A N     1 
ATOM   906  C  CA    . SER A 1 115 ? 32.628 47.841 1.946  1.00 29.30 ? 121 SER A CA    1 
ATOM   907  C  C     . SER A 1 115 ? 31.439 47.397 2.801  1.00 29.64 ? 121 SER A C     1 
ATOM   908  O  O     . SER A 1 115 ? 30.401 48.067 2.813  1.00 31.34 ? 121 SER A O     1 
ATOM   909  C  CB    . SER A 1 115 ? 32.631 47.078 0.639  1.00 29.04 ? 121 SER A CB    1 
ATOM   910  O  OG    . SER A 1 115 ? 33.746 47.471 -0.129 1.00 31.85 ? 121 SER A OG    1 
ATOM   911  N  N     . LEU A 1 116 ? 31.587 46.278 3.511  1.00 27.84 ? 122 LEU A N     1 
ATOM   912  C  CA    . LEU A 1 116 ? 30.513 45.765 4.368  1.00 27.26 ? 122 LEU A CA    1 
ATOM   913  C  C     . LEU A 1 116 ? 30.239 46.716 5.537  1.00 27.28 ? 122 LEU A C     1 
ATOM   914  O  O     . LEU A 1 116 ? 29.085 47.075 5.808  1.00 28.76 ? 122 LEU A O     1 
ATOM   915  C  CB    . LEU A 1 116 ? 30.866 44.370 4.909  1.00 23.95 ? 122 LEU A CB    1 
ATOM   916  C  CG    . LEU A 1 116 ? 30.035 43.706 6.035  1.00 23.62 ? 122 LEU A CG    1 
ATOM   917  C  CD1   . LEU A 1 116 ? 28.593 43.274 5.586  1.00 19.30 ? 122 LEU A CD1   1 
ATOM   918  C  CD2   . LEU A 1 116 ? 30.820 42.462 6.482  1.00 22.15 ? 122 LEU A CD2   1 
ATOM   919  N  N     . ILE A 1 117 ? 31.292 47.136 6.220  1.00 25.68 ? 123 ILE A N     1 
ATOM   920  C  CA    . ILE A 1 117 ? 31.115 48.038 7.347  1.00 25.87 ? 123 ILE A CA    1 
ATOM   921  C  C     . ILE A 1 117 ? 30.353 49.253 6.855  1.00 26.68 ? 123 ILE A C     1 
ATOM   922  O  O     . ILE A 1 117 ? 29.381 49.701 7.458  1.00 26.73 ? 123 ILE A O     1 
ATOM   923  C  CB    . ILE A 1 117 ? 32.477 48.466 7.938  1.00 24.84 ? 123 ILE A CB    1 
ATOM   924  C  CG1   . ILE A 1 117 ? 33.127 47.261 8.627  1.00 28.13 ? 123 ILE A CG1   1 
ATOM   925  C  CG2   . ILE A 1 117 ? 32.299 49.570 8.955  1.00 23.28 ? 123 ILE A CG2   1 
ATOM   926  C  CD1   . ILE A 1 117 ? 34.459 47.562 9.304  1.00 28.13 ? 123 ILE A CD1   1 
ATOM   927  N  N     . SER A 1 118 ? 30.788 49.756 5.718  1.00 27.33 ? 124 SER A N     1 
ATOM   928  C  CA    . SER A 1 118 ? 30.172 50.917 5.144  1.00 27.57 ? 124 SER A CA    1 
ATOM   929  C  C     . SER A 1 118 ? 28.694 50.680 4.806  1.00 28.10 ? 124 SER A C     1 
ATOM   930  O  O     . SER A 1 118 ? 27.856 51.573 5.008  1.00 27.62 ? 124 SER A O     1 
ATOM   931  C  CB    . SER A 1 118 ? 30.958 51.331 3.901  1.00 27.79 ? 124 SER A CB    1 
ATOM   932  O  OG    . SER A 1 118 ? 30.131 52.094 3.052  1.00 27.30 ? 124 SER A OG    1 
ATOM   933  N  N     . ALA A 1 119 ? 28.355 49.499 4.286  1.00 26.02 ? 125 ALA A N     1 
ATOM   934  C  CA    . ALA A 1 119 ? 26.951 49.250 3.964  1.00 24.62 ? 125 ALA A CA    1 
ATOM   935  C  C     . ALA A 1 119 ? 26.138 49.199 5.267  1.00 24.73 ? 125 ALA A C     1 
ATOM   936  O  O     . ALA A 1 119 ? 25.069 49.798 5.401  1.00 22.74 ? 125 ALA A O     1 
ATOM   937  C  CB    . ALA A 1 119 ? 26.802 47.955 3.214  1.00 22.97 ? 125 ALA A CB    1 
ATOM   938  N  N     . ILE A 1 120 ? 26.673 48.503 6.249  1.00 24.31 ? 126 ILE A N     1 
ATOM   939  C  CA    . ILE A 1 120 ? 25.958 48.395 7.483  1.00 24.53 ? 126 ILE A CA    1 
ATOM   940  C  C     . ILE A 1 120 ? 25.776 49.783 8.074  1.00 26.82 ? 126 ILE A C     1 
ATOM   941  O  O     . ILE A 1 120 ? 24.697 50.126 8.570  1.00 26.01 ? 126 ILE A O     1 
ATOM   942  C  CB    . ILE A 1 120 ? 26.713 47.488 8.421  1.00 22.99 ? 126 ILE A CB    1 
ATOM   943  C  CG1   . ILE A 1 120 ? 26.635 46.073 7.862  1.00 22.49 ? 126 ILE A CG1   1 
ATOM   944  C  CG2   . ILE A 1 120 ? 26.172 47.611 9.836  1.00 21.92 ? 126 ILE A CG2   1 
ATOM   945  C  CD1   . ILE A 1 120 ? 27.456 45.047 8.613  1.00 23.63 ? 126 ILE A CD1   1 
ATOM   946  N  N     . GLN A 1 121 ? 26.828 50.586 8.002  1.00 27.37 ? 127 GLN A N     1 
ATOM   947  C  CA    . GLN A 1 121 ? 26.776 51.928 8.549  1.00 29.43 ? 127 GLN A CA    1 
ATOM   948  C  C     . GLN A 1 121 ? 25.641 52.661 7.829  1.00 29.26 ? 127 GLN A C     1 
ATOM   949  O  O     . GLN A 1 121 ? 24.846 53.413 8.432  1.00 26.19 ? 127 GLN A O     1 
ATOM   950  C  CB    . GLN A 1 121 ? 28.127 52.612 8.330  1.00 31.33 ? 127 GLN A CB    1 
ATOM   951  C  CG    . GLN A 1 121 ? 28.460 53.638 9.397  1.00 36.52 ? 127 GLN A CG    1 
ATOM   952  C  CD    . GLN A 1 121 ? 28.343 53.085 10.819 1.00 39.04 ? 127 GLN A CD    1 
ATOM   953  O  OE1   . GLN A 1 121 ? 29.119 52.206 11.219 1.00 40.75 ? 127 GLN A OE1   1 
ATOM   954  N  NE2   . GLN A 1 121 ? 27.375 53.609 11.595 1.00 38.22 ? 127 GLN A NE2   1 
ATOM   955  N  N     . GLY A 1 122 ? 25.567 52.403 6.529  1.00 28.44 ? 128 GLY A N     1 
ATOM   956  C  CA    . GLY A 1 122 ? 24.514 52.985 5.732  1.00 28.63 ? 128 GLY A CA    1 
ATOM   957  C  C     . GLY A 1 122 ? 23.140 52.544 6.224  1.00 28.89 ? 128 GLY A C     1 
ATOM   958  O  O     . GLY A 1 122 ? 22.231 53.359 6.290  1.00 29.54 ? 128 GLY A O     1 
ATOM   959  N  N     . ASP A 1 123 ? 22.966 51.272 6.572  1.00 27.16 ? 129 ASP A N     1 
ATOM   960  C  CA    . ASP A 1 123 ? 21.655 50.844 7.039  1.00 27.65 ? 129 ASP A CA    1 
ATOM   961  C  C     . ASP A 1 123 ? 21.278 51.566 8.324  1.00 26.12 ? 129 ASP A C     1 
ATOM   962  O  O     . ASP A 1 123 ? 20.133 51.968 8.510  1.00 26.65 ? 129 ASP A O     1 
ATOM   963  C  CB    . ASP A 1 123 ? 21.611 49.342 7.307  1.00 27.12 ? 129 ASP A CB    1 
ATOM   964  C  CG    . ASP A 1 123 ? 22.098 48.539 6.155  1.00 28.87 ? 129 ASP A CG    1 
ATOM   965  O  OD1   . ASP A 1 123 ? 21.809 48.933 5.002  1.00 29.25 ? 129 ASP A OD1   1 
ATOM   966  O  OD2   . ASP A 1 123 ? 22.766 47.505 6.407  1.00 30.26 ? 129 ASP A OD2   1 
ATOM   967  N  N     . ILE A 1 124 ? 22.248 51.723 9.207  1.00 24.89 ? 130 ILE A N     1 
ATOM   968  C  CA    . ILE A 1 124 ? 22.004 52.383 10.473 1.00 27.46 ? 130 ILE A CA    1 
ATOM   969  C  C     . ILE A 1 124 ? 21.461 53.810 10.250 1.00 29.90 ? 130 ILE A C     1 
ATOM   970  O  O     . ILE A 1 124 ? 20.462 54.213 10.874 1.00 29.47 ? 130 ILE A O     1 
ATOM   971  C  CB    . ILE A 1 124 ? 23.309 52.402 11.355 1.00 25.51 ? 130 ILE A CB    1 
ATOM   972  C  CG1   . ILE A 1 124 ? 23.689 50.957 11.759 1.00 24.27 ? 130 ILE A CG1   1 
ATOM   973  C  CG2   . ILE A 1 124 ? 23.090 53.242 12.591 1.00 21.35 ? 130 ILE A CG2   1 
ATOM   974  C  CD1   . ILE A 1 124 ? 25.090 50.781 12.409 1.00 23.97 ? 130 ILE A CD1   1 
ATOM   975  N  N     . GLU A 1 125 ? 22.090 54.566 9.352  1.00 30.26 ? 131 GLU A N     1 
ATOM   976  C  CA    . GLU A 1 125 ? 21.619 55.917 9.109  1.00 31.92 ? 131 GLU A CA    1 
ATOM   977  C  C     . GLU A 1 125 ? 20.226 55.885 8.501  1.00 31.00 ? 131 GLU A C     1 
ATOM   978  O  O     . GLU A 1 125 ? 19.323 56.534 9.003  1.00 29.22 ? 131 GLU A O     1 
ATOM   979  C  CB    . GLU A 1 125 ? 22.549 56.695 8.175  1.00 33.70 ? 131 GLU A CB    1 
ATOM   980  C  CG    . GLU A 1 125 ? 24.018 56.733 8.599  1.00 40.45 ? 131 GLU A CG    1 
ATOM   981  C  CD    . GLU A 1 125 ? 24.257 57.006 10.097 1.00 43.68 ? 131 GLU A CD    1 
ATOM   982  O  OE1   . GLU A 1 125 ? 23.515 57.815 10.715 1.00 45.45 ? 131 GLU A OE1   1 
ATOM   983  O  OE2   . GLU A 1 125 ? 25.219 56.410 10.650 1.00 45.32 ? 131 GLU A OE2   1 
ATOM   984  N  N     . GLU A 1 126 ? 20.044 55.127 7.428  1.00 30.19 ? 132 GLU A N     1 
ATOM   985  C  CA    . GLU A 1 126 ? 18.749 55.102 6.805  1.00 31.09 ? 132 GLU A CA    1 
ATOM   986  C  C     . GLU A 1 126 ? 17.717 54.748 7.858  1.00 31.97 ? 132 GLU A C     1 
ATOM   987  O  O     . GLU A 1 126 ? 16.655 55.376 7.938  1.00 31.92 ? 132 GLU A O     1 
ATOM   988  C  CB    . GLU A 1 126 ? 18.735 54.113 5.648  1.00 32.81 ? 132 GLU A CB    1 
ATOM   989  C  CG    . GLU A 1 126 ? 17.411 54.056 4.877  1.00 35.99 ? 132 GLU A CG    1 
ATOM   990  C  CD    . GLU A 1 126 ? 16.948 55.409 4.357  1.00 37.80 ? 132 GLU A CD    1 
ATOM   991  O  OE1   . GLU A 1 126 ? 17.716 56.397 4.465  1.00 39.98 ? 132 GLU A OE1   1 
ATOM   992  O  OE2   . GLU A 1 126 ? 15.815 55.485 3.831  1.00 37.39 ? 132 GLU A OE2   1 
ATOM   993  N  N     . ALA A 1 127 ? 18.054 53.771 8.695  1.00 32.83 ? 133 ALA A N     1 
ATOM   994  C  CA    . ALA A 1 127 ? 17.165 53.337 9.770  1.00 33.63 ? 133 ALA A CA    1 
ATOM   995  C  C     . ALA A 1 127 ? 16.858 54.492 10.744 1.00 33.87 ? 133 ALA A C     1 
ATOM   996  O  O     . ALA A 1 127 ? 15.699 54.725 11.096 1.00 33.06 ? 133 ALA A O     1 
ATOM   997  C  CB    . ALA A 1 127 ? 17.790 52.163 10.517 1.00 31.83 ? 133 ALA A CB    1 
ATOM   998  N  N     . LYS A 1 128 ? 17.902 55.201 11.165 1.00 34.44 ? 134 LYS A N     1 
ATOM   999  C  CA    . LYS A 1 128 ? 17.774 56.331 12.078 1.00 36.52 ? 134 LYS A CA    1 
ATOM   1000 C  C     . LYS A 1 128 ? 16.714 57.311 11.589 1.00 37.19 ? 134 LYS A C     1 
ATOM   1001 O  O     . LYS A 1 128 ? 15.942 57.862 12.371 1.00 35.51 ? 134 LYS A O     1 
ATOM   1002 C  CB    . LYS A 1 128 ? 19.118 57.060 12.189 1.00 38.97 ? 134 LYS A CB    1 
ATOM   1003 C  CG    . LYS A 1 128 ? 20.014 56.605 13.337 1.00 40.92 ? 134 LYS A CG    1 
ATOM   1004 C  CD    . LYS A 1 128 ? 21.401 57.258 13.292 1.00 41.97 ? 134 LYS A CD    1 
ATOM   1005 C  CE    . LYS A 1 128 ? 22.191 56.925 14.563 1.00 44.09 ? 134 LYS A CE    1 
ATOM   1006 N  NZ    . LYS A 1 128 ? 23.684 56.948 14.393 1.00 46.39 ? 134 LYS A NZ    1 
ATOM   1007 N  N     . LYS A 1 129 ? 16.678 57.512 10.282 1.00 38.51 ? 135 LYS A N     1 
ATOM   1008 C  CA    . LYS A 1 129 ? 15.730 58.429 9.678  1.00 40.99 ? 135 LYS A CA    1 
ATOM   1009 C  C     . LYS A 1 129 ? 14.331 57.858 9.597  1.00 41.85 ? 135 LYS A C     1 
ATOM   1010 O  O     . LYS A 1 129 ? 13.374 58.449 10.105 1.00 42.96 ? 135 LYS A O     1 
ATOM   1011 C  CB    . LYS A 1 129 ? 16.172 58.808 8.265  1.00 42.15 ? 135 LYS A CB    1 
ATOM   1012 C  CG    . LYS A 1 129 ? 17.440 59.636 8.180  1.00 45.66 ? 135 LYS A CG    1 
ATOM   1013 C  CD    . LYS A 1 129 ? 17.732 59.996 6.716  1.00 49.72 ? 135 LYS A CD    1 
ATOM   1014 C  CE    . LYS A 1 129 ? 18.898 60.985 6.564  1.00 51.71 ? 135 LYS A CE    1 
ATOM   1015 N  NZ    . LYS A 1 129 ? 19.094 61.385 5.128  1.00 52.58 ? 135 LYS A NZ    1 
ATOM   1016 N  N     . ARG A 1 130 ? 14.199 56.711 8.949  1.00 41.23 ? 136 ARG A N     1 
ATOM   1017 C  CA    . ARG A 1 130 ? 12.883 56.139 8.800  1.00 40.76 ? 136 ARG A CA    1 
ATOM   1018 C  C     . ARG A 1 130 ? 12.165 55.863 10.117 1.00 40.92 ? 136 ARG A C     1 
ATOM   1019 O  O     . ARG A 1 130 ? 10.953 56.035 10.212 1.00 39.77 ? 136 ARG A O     1 
ATOM   1020 C  CB    . ARG A 1 130 ? 12.961 54.866 7.982  1.00 41.55 ? 136 ARG A CB    1 
ATOM   1021 C  CG    . ARG A 1 130 ? 13.511 55.057 6.606  1.00 42.23 ? 136 ARG A CG    1 
ATOM   1022 C  CD    . ARG A 1 130 ? 13.233 53.818 5.773  1.00 44.04 ? 136 ARG A CD    1 
ATOM   1023 N  NE    . ARG A 1 130 ? 14.063 53.779 4.571  1.00 46.17 ? 136 ARG A NE    1 
ATOM   1024 C  CZ    . ARG A 1 130 ? 13.992 52.844 3.629  1.00 45.86 ? 136 ARG A CZ    1 
ATOM   1025 N  NH1   . ARG A 1 130 ? 13.117 51.845 3.727  1.00 47.38 ? 136 ARG A NH1   1 
ATOM   1026 N  NH2   . ARG A 1 130 ? 14.815 52.904 2.592  1.00 47.69 ? 136 ARG A NH2   1 
ATOM   1027 N  N     . LEU A 1 131 ? 12.890 55.445 11.143 1.00 41.11 ? 137 LEU A N     1 
ATOM   1028 C  CA    . LEU A 1 131 ? 12.206 55.167 12.389 1.00 43.48 ? 137 LEU A CA    1 
ATOM   1029 C  C     . LEU A 1 131 ? 11.564 56.398 12.994 1.00 45.58 ? 137 LEU A C     1 
ATOM   1030 O  O     . LEU A 1 131 ? 10.775 56.281 13.919 1.00 46.38 ? 137 LEU A O     1 
ATOM   1031 C  CB    . LEU A 1 131 ? 13.142 54.508 13.400 1.00 42.72 ? 137 LEU A CB    1 
ATOM   1032 C  CG    . LEU A 1 131 ? 13.296 52.992 13.194 1.00 42.21 ? 137 LEU A CG    1 
ATOM   1033 C  CD1   . LEU A 1 131 ? 14.452 52.485 14.026 1.00 42.77 ? 137 LEU A CD1   1 
ATOM   1034 C  CD2   . LEU A 1 131 ? 12.015 52.267 13.558 1.00 39.67 ? 137 LEU A CD2   1 
ATOM   1035 N  N     . GLU A 1 132 ? 11.881 57.578 12.471 1.00 47.39 ? 138 GLU A N     1 
ATOM   1036 C  CA    . GLU A 1 132 ? 11.287 58.803 13.001 1.00 49.26 ? 138 GLU A CA    1 
ATOM   1037 C  C     . GLU A 1 132 ? 9.847  59.008 12.517 1.00 49.86 ? 138 GLU A C     1 
ATOM   1038 O  O     . GLU A 1 132 ? 9.099  59.786 13.126 1.00 50.45 ? 138 GLU A O     1 
ATOM   1039 C  CB    . GLU A 1 132 ? 12.131 60.033 12.635 1.00 50.50 ? 138 GLU A CB    1 
ATOM   1040 C  CG    . GLU A 1 132 ? 13.516 60.053 13.264 1.00 52.43 ? 138 GLU A CG    1 
ATOM   1041 C  CD    . GLU A 1 132 ? 13.505 60.383 14.743 1.00 53.61 ? 138 GLU A CD    1 
ATOM   1042 O  OE1   . GLU A 1 132 ? 12.556 59.972 15.451 1.00 55.11 ? 138 GLU A OE1   1 
ATOM   1043 O  OE2   . GLU A 1 132 ? 14.464 61.048 15.201 1.00 55.55 ? 138 GLU A OE2   1 
ATOM   1044 N  N     . LEU A 1 133 ? 9.449  58.327 11.437 1.00 49.33 ? 139 LEU A N     1 
ATOM   1045 C  CA    . LEU A 1 133 ? 8.078  58.473 10.952 1.00 49.01 ? 139 LEU A CA    1 
ATOM   1046 C  C     . LEU A 1 133 ? 7.180  58.201 12.143 1.00 48.35 ? 139 LEU A C     1 
ATOM   1047 O  O     . LEU A 1 133 ? 7.275  57.148 12.773 1.00 48.94 ? 139 LEU A O     1 
ATOM   1048 C  CB    . LEU A 1 133 ? 7.746  57.473 9.846  1.00 49.61 ? 139 LEU A CB    1 
ATOM   1049 C  CG    . LEU A 1 133 ? 6.257  57.422 9.436  1.00 51.86 ? 139 LEU A CG    1 
ATOM   1050 C  CD1   . LEU A 1 133 ? 6.063  58.144 8.119  1.00 50.73 ? 139 LEU A CD1   1 
ATOM   1051 C  CD2   . LEU A 1 133 ? 5.793  55.972 9.287  1.00 51.43 ? 139 LEU A CD2   1 
ATOM   1052 N  N     . PRO A 1 134 ? 6.304  59.154 12.481 1.00 47.44 ? 140 PRO A N     1 
ATOM   1053 C  CA    . PRO A 1 134 ? 5.403  58.966 13.621 1.00 46.15 ? 140 PRO A CA    1 
ATOM   1054 C  C     . PRO A 1 134 ? 4.653  57.628 13.639 1.00 44.54 ? 140 PRO A C     1 
ATOM   1055 O  O     . PRO A 1 134 ? 4.487  57.026 14.695 1.00 42.89 ? 140 PRO A O     1 
ATOM   1056 C  CB    . PRO A 1 134 ? 4.475  60.184 13.533 1.00 46.70 ? 140 PRO A CB    1 
ATOM   1057 C  CG    . PRO A 1 134 ? 4.581  60.625 12.080 1.00 46.66 ? 140 PRO A CG    1 
ATOM   1058 C  CD    . PRO A 1 134 ? 6.032  60.426 11.788 1.00 47.05 ? 140 PRO A CD    1 
ATOM   1059 N  N     . GLU A 1 135 ? 4.210  57.153 12.485 1.00 44.28 ? 141 GLU A N     1 
ATOM   1060 C  CA    . GLU A 1 135 ? 3.506  55.881 12.465 1.00 46.19 ? 141 GLU A CA    1 
ATOM   1061 C  C     . GLU A 1 135 ? 4.403  54.820 13.121 1.00 44.34 ? 141 GLU A C     1 
ATOM   1062 O  O     . GLU A 1 135 ? 3.920  53.936 13.826 1.00 43.99 ? 141 GLU A O     1 
ATOM   1063 C  CB    . GLU A 1 135 ? 3.172  55.482 11.022 1.00 50.26 ? 141 GLU A CB    1 
ATOM   1064 C  CG    . GLU A 1 135 ? 2.213  54.291 10.882 1.00 57.89 ? 141 GLU A CG    1 
ATOM   1065 C  CD    . GLU A 1 135 ? 2.047  53.795 9.421  1.00 62.78 ? 141 GLU A CD    1 
ATOM   1066 O  OE1   . GLU A 1 135 ? 1.674  54.605 8.528  1.00 64.91 ? 141 GLU A OE1   1 
ATOM   1067 O  OE2   . GLU A 1 135 ? 2.283  52.586 9.167  1.00 63.74 ? 141 GLU A OE2   1 
ATOM   1068 N  N     . TYR A 1 136 ? 5.710  54.924 12.907 1.00 41.56 ? 142 TYR A N     1 
ATOM   1069 C  CA    . TYR A 1 136 ? 6.644  53.964 13.479 1.00 40.97 ? 142 TYR A CA    1 
ATOM   1070 C  C     . TYR A 1 136 ? 6.966  54.185 14.926 1.00 40.93 ? 142 TYR A C     1 
ATOM   1071 O  O     . TYR A 1 136 ? 7.102  53.231 15.677 1.00 42.66 ? 142 TYR A O     1 
ATOM   1072 C  CB    . TYR A 1 136 ? 7.962  53.945 12.719 1.00 39.76 ? 142 TYR A CB    1 
ATOM   1073 C  CG    . TYR A 1 136 ? 7.847  53.439 11.318 1.00 38.11 ? 142 TYR A CG    1 
ATOM   1074 C  CD1   . TYR A 1 136 ? 6.824  52.559 10.958 1.00 38.39 ? 142 TYR A CD1   1 
ATOM   1075 C  CD2   . TYR A 1 136 ? 8.749  53.846 10.346 1.00 36.36 ? 142 TYR A CD2   1 
ATOM   1076 C  CE1   . TYR A 1 136 ? 6.706  52.105 9.657  1.00 38.14 ? 142 TYR A CE1   1 
ATOM   1077 C  CE2   . TYR A 1 136 ? 8.641  53.403 9.049  1.00 36.85 ? 142 TYR A CE2   1 
ATOM   1078 C  CZ    . TYR A 1 136 ? 7.621  52.537 8.707  1.00 37.94 ? 142 TYR A CZ    1 
ATOM   1079 O  OH    . TYR A 1 136 ? 7.515  52.114 7.409  1.00 39.64 ? 142 TYR A OH    1 
ATOM   1080 N  N     . LEU A 1 137 ? 7.125  55.439 15.316 1.00 41.87 ? 143 LEU A N     1 
ATOM   1081 C  CA    . LEU A 1 137 ? 7.435  55.742 16.699 1.00 42.56 ? 143 LEU A CA    1 
ATOM   1082 C  C     . LEU A 1 137 ? 6.341  55.204 17.608 1.00 43.02 ? 143 LEU A C     1 
ATOM   1083 O  O     . LEU A 1 137 ? 6.609  54.768 18.728 1.00 43.48 ? 143 LEU A O     1 
ATOM   1084 C  CB    . LEU A 1 137 ? 7.580  57.255 16.891 1.00 44.76 ? 143 LEU A CB    1 
ATOM   1085 C  CG    . LEU A 1 137 ? 8.813  57.974 16.323 1.00 45.45 ? 143 LEU A CG    1 
ATOM   1086 C  CD1   . LEU A 1 137 ? 8.474  59.433 16.073 1.00 46.61 ? 143 LEU A CD1   1 
ATOM   1087 C  CD2   . LEU A 1 137 ? 9.984  57.856 17.291 1.00 45.80 ? 143 LEU A CD2   1 
ATOM   1088 N  N     . LYS A 1 138 ? 5.102  55.218 17.137 1.00 43.04 ? 144 LYS A N     1 
ATOM   1089 C  CA    . LYS A 1 138 ? 4.037  54.723 17.985 1.00 44.16 ? 144 LYS A CA    1 
ATOM   1090 C  C     . LYS A 1 138 ? 4.346  53.290 18.378 1.00 42.62 ? 144 LYS A C     1 
ATOM   1091 O  O     . LYS A 1 138 ? 4.183  52.916 19.533 1.00 42.90 ? 144 LYS A O     1 
ATOM   1092 C  CB    . LYS A 1 138 ? 2.676  54.789 17.273 1.00 47.96 ? 144 LYS A CB    1 
ATOM   1093 C  CG    . LYS A 1 138 ? 2.452  53.730 16.165 1.00 52.81 ? 144 LYS A CG    1 
ATOM   1094 C  CD    . LYS A 1 138 ? 1.043  53.837 15.530 1.00 54.13 ? 144 LYS A CD    1 
ATOM   1095 C  CE    . LYS A 1 138 ? 0.840  52.853 14.355 1.00 54.15 ? 144 LYS A CE    1 
ATOM   1096 N  NZ    . LYS A 1 138 ? -0.409 53.159 13.565 1.00 51.39 ? 144 LYS A NZ    1 
ATOM   1097 N  N     . ILE A 1 139 ? 4.820  52.504 17.418 1.00 40.37 ? 145 ILE A N     1 
ATOM   1098 C  CA    . ILE A 1 139 ? 5.129  51.092 17.650 1.00 39.10 ? 145 ILE A CA    1 
ATOM   1099 C  C     . ILE A 1 139 ? 5.912  50.921 18.932 1.00 38.64 ? 145 ILE A C     1 
ATOM   1100 O  O     . ILE A 1 139 ? 5.701  49.985 19.704 1.00 37.33 ? 145 ILE A O     1 
ATOM   1101 C  CB    . ILE A 1 139 ? 5.929  50.493 16.475 1.00 38.74 ? 145 ILE A CB    1 
ATOM   1102 C  CG1   . ILE A 1 139 ? 5.095  50.549 15.203 1.00 37.03 ? 145 ILE A CG1   1 
ATOM   1103 C  CG2   . ILE A 1 139 ? 6.259  49.048 16.754 1.00 36.71 ? 145 ILE A CG2   1 
ATOM   1104 C  CD1   . ILE A 1 139 ? 5.875  50.226 13.955 1.00 41.19 ? 145 ILE A CD1   1 
ATOM   1105 N  N     . LYS A 1 140 ? 6.818  51.849 19.156 1.00 38.77 ? 146 LYS A N     1 
ATOM   1106 C  CA    . LYS A 1 140 ? 7.627  51.842 20.356 1.00 40.21 ? 146 LYS A CA    1 
ATOM   1107 C  C     . LYS A 1 140 ? 6.763  51.867 21.652 1.00 40.64 ? 146 LYS A C     1 
ATOM   1108 O  O     . LYS A 1 140 ? 7.237  51.530 22.732 1.00 40.28 ? 146 LYS A O     1 
ATOM   1109 C  CB    . LYS A 1 140 ? 8.560  53.044 20.267 1.00 40.00 ? 146 LYS A CB    1 
ATOM   1110 C  CG    . LYS A 1 140 ? 9.383  53.356 21.467 1.00 40.37 ? 146 LYS A CG    1 
ATOM   1111 C  CD    . LYS A 1 140 ? 10.252 54.520 21.079 1.00 42.03 ? 146 LYS A CD    1 
ATOM   1112 C  CE    . LYS A 1 140 ? 11.054 55.041 22.230 1.00 43.95 ? 146 LYS A CE    1 
ATOM   1113 N  NZ    . LYS A 1 140 ? 11.871 56.218 21.779 1.00 44.98 ? 146 LYS A NZ    1 
ATOM   1114 N  N     . GLU A 1 141 ? 5.495  52.246 21.536 1.00 41.29 ? 147 GLU A N     1 
ATOM   1115 C  CA    . GLU A 1 141 ? 4.600  52.306 22.694 1.00 42.01 ? 147 GLU A CA    1 
ATOM   1116 C  C     . GLU A 1 141 ? 3.707  51.073 22.821 1.00 41.20 ? 147 GLU A C     1 
ATOM   1117 O  O     . GLU A 1 141 ? 2.993  50.916 23.807 1.00 40.04 ? 147 GLU A O     1 
ATOM   1118 C  CB    . GLU A 1 141 ? 3.709  53.541 22.599 1.00 44.57 ? 147 GLU A CB    1 
ATOM   1119 C  CG    . GLU A 1 141 ? 4.452  54.867 22.663 1.00 48.53 ? 147 GLU A CG    1 
ATOM   1120 C  CD    . GLU A 1 141 ? 3.653  56.018 22.031 1.00 52.17 ? 147 GLU A CD    1 
ATOM   1121 O  OE1   . GLU A 1 141 ? 2.391  56.038 22.164 1.00 53.04 ? 147 GLU A OE1   1 
ATOM   1122 O  OE2   . GLU A 1 141 ? 4.295  56.906 21.407 1.00 53.42 ? 147 GLU A OE2   1 
ATOM   1123 N  N     . ASP A 1 142 ? 3.749  50.209 21.813 1.00 40.48 ? 148 ASP A N     1 
ATOM   1124 C  CA    . ASP A 1 142 ? 2.955  48.993 21.804 1.00 39.49 ? 148 ASP A CA    1 
ATOM   1125 C  C     . ASP A 1 142 ? 3.026  48.257 23.137 1.00 39.93 ? 148 ASP A C     1 
ATOM   1126 O  O     . ASP A 1 142 ? 4.045  48.256 23.832 1.00 38.71 ? 148 ASP A O     1 
ATOM   1127 C  CB    . ASP A 1 142 ? 3.430  48.084 20.674 1.00 40.43 ? 148 ASP A CB    1 
ATOM   1128 C  CG    . ASP A 1 142 ? 2.549  46.875 20.484 1.00 40.16 ? 148 ASP A CG    1 
ATOM   1129 O  OD1   . ASP A 1 142 ? 2.544  45.985 21.354 1.00 40.57 ? 148 ASP A OD1   1 
ATOM   1130 O  OD2   . ASP A 1 142 ? 1.853  46.808 19.448 1.00 41.27 ? 148 ASP A OD2   1 
ATOM   1131 N  N     . ASN A 1 143 ? 1.914  47.632 23.486 1.00 40.51 ? 149 ASN A N     1 
ATOM   1132 C  CA    . ASN A 1 143 ? 1.790  46.884 24.725 1.00 41.79 ? 149 ASN A CA    1 
ATOM   1133 C  C     . ASN A 1 143 ? 2.888  45.853 24.929 1.00 40.40 ? 149 ASN A C     1 
ATOM   1134 O  O     . ASN A 1 143 ? 3.293  45.568 26.056 1.00 39.72 ? 149 ASN A O     1 
ATOM   1135 C  CB    . ASN A 1 143 ? 0.449  46.166 24.758 1.00 43.91 ? 149 ASN A CB    1 
ATOM   1136 C  CG    . ASN A 1 143 ? 0.270  45.375 26.019 1.00 47.00 ? 149 ASN A CG    1 
ATOM   1137 O  OD1   . ASN A 1 143 ? 0.318  45.940 27.118 1.00 48.95 ? 149 ASN A OD1   1 
ATOM   1138 N  ND2   . ASN A 1 143 ? 0.082  44.057 25.885 1.00 48.00 ? 149 ASN A ND2   1 
ATOM   1139 N  N     . PHE A 1 144 ? 3.317  45.267 23.818 1.00 40.05 ? 150 PHE A N     1 
ATOM   1140 C  CA    . PHE A 1 144 ? 4.371  44.266 23.769 1.00 38.87 ? 150 PHE A CA    1 
ATOM   1141 C  C     . PHE A 1 144 ? 5.613  44.720 24.540 1.00 39.58 ? 150 PHE A C     1 
ATOM   1142 O  O     . PHE A 1 144 ? 6.302  43.922 25.174 1.00 39.84 ? 150 PHE A O     1 
ATOM   1143 C  CB    . PHE A 1 144 ? 4.736  44.030 22.307 1.00 37.37 ? 150 PHE A CB    1 
ATOM   1144 C  CG    . PHE A 1 144 ? 5.947  43.179 22.112 1.00 36.33 ? 150 PHE A CG    1 
ATOM   1145 C  CD1   . PHE A 1 144 ? 5.858  41.790 22.189 1.00 35.33 ? 150 PHE A CD1   1 
ATOM   1146 C  CD2   . PHE A 1 144 ? 7.178  43.762 21.839 1.00 35.78 ? 150 PHE A CD2   1 
ATOM   1147 C  CE1   . PHE A 1 144 ? 6.981  40.991 21.993 1.00 35.50 ? 150 PHE A CE1   1 
ATOM   1148 C  CE2   . PHE A 1 144 ? 8.311  42.973 21.640 1.00 35.78 ? 150 PHE A CE2   1 
ATOM   1149 C  CZ    . PHE A 1 144 ? 8.214  41.586 21.717 1.00 34.41 ? 150 PHE A CZ    1 
ATOM   1150 N  N     . PHE A 1 145 ? 5.900  46.009 24.466 1.00 40.03 ? 151 PHE A N     1 
ATOM   1151 C  CA    . PHE A 1 145 ? 7.059  46.571 25.138 1.00 42.25 ? 151 PHE A CA    1 
ATOM   1152 C  C     . PHE A 1 145 ? 6.729  47.078 26.540 1.00 46.06 ? 151 PHE A C     1 
ATOM   1153 O  O     . PHE A 1 145 ? 7.603  47.139 27.398 1.00 47.05 ? 151 PHE A O     1 
ATOM   1154 C  CB    . PHE A 1 145 ? 7.636  47.721 24.316 1.00 37.83 ? 151 PHE A CB    1 
ATOM   1155 C  CG    . PHE A 1 145 ? 8.366  47.292 23.073 1.00 35.13 ? 151 PHE A CG    1 
ATOM   1156 C  CD1   . PHE A 1 145 ? 9.591  46.636 23.154 1.00 32.93 ? 151 PHE A CD1   1 
ATOM   1157 C  CD2   . PHE A 1 145 ? 7.868  47.622 21.806 1.00 33.09 ? 151 PHE A CD2   1 
ATOM   1158 C  CE1   . PHE A 1 145 ? 10.314 46.325 21.982 1.00 31.21 ? 151 PHE A CE1   1 
ATOM   1159 C  CE2   . PHE A 1 145 ? 8.584  47.315 20.635 1.00 30.29 ? 151 PHE A CE2   1 
ATOM   1160 C  CZ    . PHE A 1 145 ? 9.805  46.669 20.723 1.00 29.40 ? 151 PHE A CZ    1 
ATOM   1161 N  N     . GLN A 1 146 ? 5.480  47.462 26.770 1.00 50.25 ? 152 GLN A N     1 
ATOM   1162 C  CA    . GLN A 1 146 ? 5.090  47.948 28.081 1.00 54.64 ? 152 GLN A CA    1 
ATOM   1163 C  C     . GLN A 1 146 ? 5.190  46.778 29.064 1.00 56.45 ? 152 GLN A C     1 
ATOM   1164 O  O     . GLN A 1 146 ? 5.511  46.963 30.238 1.00 56.42 ? 152 GLN A O     1 
ATOM   1165 C  CB    . GLN A 1 146 ? 3.663  48.501 28.026 1.00 57.02 ? 152 GLN A CB    1 
ATOM   1166 C  CG    . GLN A 1 146 ? 3.470  49.548 26.926 1.00 61.83 ? 152 GLN A CG    1 
ATOM   1167 C  CD    . GLN A 1 146 ? 2.099  50.228 26.954 1.00 64.62 ? 152 GLN A CD    1 
ATOM   1168 O  OE1   . GLN A 1 146 ? 1.723  50.936 26.005 1.00 65.89 ? 152 GLN A OE1   1 
ATOM   1169 N  NE2   . GLN A 1 146 ? 1.350  50.024 28.042 1.00 65.78 ? 152 GLN A NE2   1 
ATOM   1170 N  N     . VAL A 1 147 ? 4.936  45.572 28.560 1.00 58.28 ? 153 VAL A N     1 
ATOM   1171 C  CA    . VAL A 1 147 ? 4.995  44.345 29.357 1.00 60.57 ? 153 VAL A CA    1 
ATOM   1172 C  C     . VAL A 1 147 ? 6.432  43.913 29.631 1.00 62.75 ? 153 VAL A C     1 
ATOM   1173 O  O     . VAL A 1 147 ? 6.699  43.179 30.580 1.00 62.55 ? 153 VAL A O     1 
ATOM   1174 C  CB    . VAL A 1 147 ? 4.261  43.186 28.637 1.00 60.24 ? 153 VAL A CB    1 
ATOM   1175 C  CG1   . VAL A 1 147 ? 4.488  41.864 29.369 1.00 58.85 ? 153 VAL A CG1   1 
ATOM   1176 C  CG2   . VAL A 1 147 ? 2.776  43.500 28.557 1.00 60.42 ? 153 VAL A CG2   1 
ATOM   1177 N  N     . SER A 1 148 ? 7.353  44.363 28.785 1.00 66.07 ? 154 SER A N     1 
ATOM   1178 C  CA    . SER A 1 148 ? 8.771  44.043 28.939 1.00 68.48 ? 154 SER A CA    1 
ATOM   1179 C  C     . SER A 1 148 ? 9.245  44.478 30.330 1.00 69.84 ? 154 SER A C     1 
ATOM   1180 O  O     . SER A 1 148 ? 10.017 43.770 30.977 1.00 70.71 ? 154 SER A O     1 
ATOM   1181 C  CB    . SER A 1 148 ? 9.597  44.749 27.852 1.00 69.02 ? 154 SER A CB    1 
ATOM   1182 O  OG    . SER A 1 148 ? 9.191  44.345 26.553 1.00 68.64 ? 154 SER A OG    1 
ATOM   1183 N  N     . LYS A 1 149 ? 8.785  45.642 30.786 1.00 70.81 ? 155 LYS A N     1 
ATOM   1184 C  CA    . LYS A 1 149 ? 9.141  46.130 32.119 1.00 72.14 ? 155 LYS A CA    1 
ATOM   1185 C  C     . LYS A 1 149 ? 8.026  45.797 33.123 1.00 72.59 ? 155 LYS A C     1 
ATOM   1186 O  O     . LYS A 1 149 ? 8.279  44.989 34.050 1.00 73.21 ? 155 LYS A O     1 
ATOM   1187 C  CB    . LYS A 1 149 ? 9.400  47.646 32.100 1.00 71.69 ? 155 LYS A CB    1 
ATOM   1188 C  CG    . LYS A 1 149 ? 8.430  48.444 31.249 1.00 71.60 ? 155 LYS A CG    1 
ATOM   1189 C  CD    . LYS A 1 149 ? 8.733  48.260 29.773 1.00 71.60 ? 155 LYS A CD    1 
ATOM   1190 C  CE    . LYS A 1 149 ? 9.975  49.029 29.332 1.00 71.63 ? 155 LYS A CE    1 
ATOM   1191 N  NZ    . LYS A 1 149 ? 9.674  50.458 29.002 1.00 71.08 ? 155 LYS A NZ    1 
ATOM   1192 O  OXT   . LYS A 1 149 ? 6.907  46.333 32.965 1.00 73.10 ? 155 LYS A OXT   1 
HETATM 1193 MG MG    . MG  B 2 .   ? 26.462 39.036 17.249 1.00 16.53 ? 201 MG  A MG    1 
HETATM 1194 P  PB    . ADP C 3 .   ? 28.583 37.794 18.989 1.00 26.40 ? 301 ADP A PB    1 
HETATM 1195 O  O1B   . ADP C 3 .   ? 27.140 38.117 19.002 1.00 24.14 ? 301 ADP A O1B   1 
HETATM 1196 O  O2B   . ADP C 3 .   ? 28.888 36.839 20.227 1.00 24.33 ? 301 ADP A O2B   1 
HETATM 1197 O  O3B   . ADP C 3 .   ? 29.168 37.168 17.771 1.00 27.78 ? 301 ADP A O3B   1 
HETATM 1198 P  PA    . ADP C 3 .   ? 29.283 40.502 18.664 1.00 23.00 ? 301 ADP A PA    1 
HETATM 1199 O  O1A   . ADP C 3 .   ? 30.647 41.016 18.427 1.00 25.67 ? 301 ADP A O1A   1 
HETATM 1200 O  O2A   . ADP C 3 .   ? 28.356 40.423 17.519 1.00 24.17 ? 301 ADP A O2A   1 
HETATM 1201 O  O3A   . ADP C 3 .   ? 29.469 39.074 19.363 1.00 25.76 ? 301 ADP A O3A   1 
HETATM 1202 O  "O5'" . ADP C 3 .   ? 28.594 41.292 19.872 1.00 22.67 ? 301 ADP A "O5'" 1 
HETATM 1203 C  "C5'" . ADP C 3 .   ? 27.257 41.000 20.283 1.00 20.15 ? 301 ADP A "C5'" 1 
HETATM 1204 C  "C4'" . ADP C 3 .   ? 27.103 41.319 21.760 1.00 22.08 ? 301 ADP A "C4'" 1 
HETATM 1205 O  "O4'" . ADP C 3 .   ? 27.619 42.630 22.096 1.00 22.35 ? 301 ADP A "O4'" 1 
HETATM 1206 C  "C3'" . ADP C 3 .   ? 25.677 41.286 22.257 1.00 23.60 ? 301 ADP A "C3'" 1 
HETATM 1207 O  "O3'" . ADP C 3 .   ? 25.355 39.948 22.639 1.00 21.49 ? 301 ADP A "O3'" 1 
HETATM 1208 C  "C2'" . ADP C 3 .   ? 25.720 42.171 23.487 1.00 23.09 ? 301 ADP A "C2'" 1 
HETATM 1209 O  "O2'" . ADP C 3 .   ? 26.054 41.403 24.642 1.00 22.53 ? 301 ADP A "O2'" 1 
HETATM 1210 C  "C1'" . ADP C 3 .   ? 26.859 43.157 23.215 1.00 23.67 ? 301 ADP A "C1'" 1 
HETATM 1211 N  N9    . ADP C 3 .   ? 26.368 44.496 22.817 1.00 23.73 ? 301 ADP A N9    1 
HETATM 1212 C  C8    . ADP C 3 .   ? 26.785 45.646 23.348 1.00 22.66 ? 301 ADP A C8    1 
HETATM 1213 N  N7    . ADP C 3 .   ? 26.182 46.663 22.735 1.00 24.81 ? 301 ADP A N7    1 
HETATM 1214 C  C5    . ADP C 3 .   ? 25.378 46.167 21.813 1.00 24.78 ? 301 ADP A C5    1 
HETATM 1215 C  C6    . ADP C 3 .   ? 24.522 46.740 20.868 1.00 23.77 ? 301 ADP A C6    1 
HETATM 1216 N  N6    . ADP C 3 .   ? 24.387 48.062 20.788 1.00 22.13 ? 301 ADP A N6    1 
HETATM 1217 N  N1    . ADP C 3 .   ? 23.831 45.932 20.034 1.00 22.98 ? 301 ADP A N1    1 
HETATM 1218 C  C2    . ADP C 3 .   ? 23.963 44.602 20.109 1.00 23.55 ? 301 ADP A C2    1 
HETATM 1219 N  N3    . ADP C 3 .   ? 24.777 44.032 21.008 1.00 23.68 ? 301 ADP A N3    1 
HETATM 1220 C  C4    . ADP C 3 .   ? 25.490 44.786 21.861 1.00 25.36 ? 301 ADP A C4    1 
HETATM 1221 N  N1    . FMN D 4 .   ? 26.417 40.087 6.528  1.00 24.59 ? 401 FMN A N1    1 
HETATM 1222 C  C2    . FMN D 4 .   ? 26.670 39.840 5.182  1.00 23.64 ? 401 FMN A C2    1 
HETATM 1223 O  O2    . FMN D 4 .   ? 27.420 38.932 4.863  1.00 23.72 ? 401 FMN A O2    1 
HETATM 1224 N  N3    . FMN D 4 .   ? 26.098 40.673 4.202  1.00 27.04 ? 401 FMN A N3    1 
HETATM 1225 C  C4    . FMN D 4 .   ? 25.288 41.779 4.585  1.00 26.09 ? 401 FMN A C4    1 
HETATM 1226 O  O4    . FMN D 4 .   ? 24.751 42.480 3.726  1.00 27.53 ? 401 FMN A O4    1 
HETATM 1227 C  C4A   . FMN D 4 .   ? 25.056 42.037 5.936  1.00 25.45 ? 401 FMN A C4A   1 
HETATM 1228 N  N5    . FMN D 4 .   ? 24.318 43.114 6.314  1.00 25.67 ? 401 FMN A N5    1 
HETATM 1229 C  C5A   . FMN D 4 .   ? 24.082 43.393 7.619  1.00 23.79 ? 401 FMN A C5A   1 
HETATM 1230 C  C6    . FMN D 4 .   ? 23.355 44.535 7.969  1.00 24.86 ? 401 FMN A C6    1 
HETATM 1231 C  C7    . FMN D 4 .   ? 23.109 44.835 9.324  1.00 24.88 ? 401 FMN A C7    1 
HETATM 1232 C  C7M   . FMN D 4 .   ? 22.205 46.031 9.655  1.00 26.67 ? 401 FMN A C7M   1 
HETATM 1233 C  C8    . FMN D 4 .   ? 23.615 43.980 10.353 1.00 24.57 ? 401 FMN A C8    1 
HETATM 1234 C  C8M   . FMN D 4 .   ? 23.410 44.256 11.712 1.00 20.47 ? 401 FMN A C8M   1 
HETATM 1235 C  C9    . FMN D 4 .   ? 24.345 42.836 9.997  1.00 23.15 ? 401 FMN A C9    1 
HETATM 1236 C  C9A   . FMN D 4 .   ? 24.582 42.538 8.633  1.00 24.10 ? 401 FMN A C9A   1 
HETATM 1237 N  N10   . FMN D 4 .   ? 25.341 41.406 8.261  1.00 21.96 ? 401 FMN A N10   1 
HETATM 1238 C  C10   . FMN D 4 .   ? 25.606 41.172 6.907  1.00 24.55 ? 401 FMN A C10   1 
HETATM 1239 C  "C1'" . FMN D 4 .   ? 25.665 40.360 9.270  1.00 22.81 ? 401 FMN A "C1'" 1 
HETATM 1240 C  "C2'" . FMN D 4 .   ? 27.093 40.488 9.777  1.00 23.32 ? 401 FMN A "C2'" 1 
HETATM 1241 O  "O2'" . FMN D 4 .   ? 27.968 39.920 8.799  1.00 20.69 ? 401 FMN A "O2'" 1 
HETATM 1242 C  "C3'" . FMN D 4 .   ? 27.248 39.770 11.125 1.00 23.24 ? 401 FMN A "C3'" 1 
HETATM 1243 O  "O3'" . FMN D 4 .   ? 26.322 40.345 12.054 1.00 24.68 ? 401 FMN A "O3'" 1 
HETATM 1244 C  "C4'" . FMN D 4 .   ? 28.677 39.911 11.680 1.00 24.48 ? 401 FMN A "C4'" 1 
HETATM 1245 O  "O4'" . FMN D 4 .   ? 29.575 39.114 10.899 1.00 23.36 ? 401 FMN A "O4'" 1 
HETATM 1246 C  "C5'" . FMN D 4 .   ? 28.768 39.488 13.151 1.00 22.09 ? 401 FMN A "C5'" 1 
HETATM 1247 O  "O5'" . FMN D 4 .   ? 28.403 38.116 13.346 1.00 20.29 ? 401 FMN A "O5'" 1 
HETATM 1248 P  P     . FMN D 4 .   ? 28.305 37.526 14.856 1.00 22.38 ? 401 FMN A P     1 
HETATM 1249 O  O1P   . FMN D 4 .   ? 27.278 38.261 15.607 1.00 18.71 ? 401 FMN A O1P   1 
HETATM 1250 O  O2P   . FMN D 4 .   ? 28.194 36.043 14.785 1.00 20.13 ? 401 FMN A O2P   1 
HETATM 1251 O  O3P   . FMN D 4 .   ? 29.748 37.897 15.487 1.00 18.30 ? 401 FMN A O3P   1 
HETATM 1252 O  O     . HOH E 5 .   ? 21.915 37.574 9.710  1.00 10.24 ? 501 HOH A O     1 
HETATM 1253 O  O     . HOH E 5 .   ? 25.055 38.111 20.481 1.00 13.50 ? 502 HOH A O     1 
HETATM 1254 O  O     . HOH E 5 .   ? 28.756 36.451 10.685 1.00 15.23 ? 503 HOH A O     1 
HETATM 1255 O  O     . HOH E 5 .   ? 18.955 30.896 30.323 1.00 12.34 ? 504 HOH A O     1 
HETATM 1256 O  O     . HOH E 5 .   ? 26.661 35.184 12.596 1.00 20.94 ? 505 HOH A O     1 
HETATM 1257 O  O     . HOH E 5 .   ? 20.944 33.666 15.241 1.00 17.59 ? 506 HOH A O     1 
HETATM 1258 O  O     . HOH E 5 .   ? 26.844 39.537 29.016 1.00 35.43 ? 507 HOH A O     1 
HETATM 1259 O  O     . HOH E 5 .   ? 25.150 52.252 16.195 1.00 30.59 ? 508 HOH A O     1 
HETATM 1260 O  O     . HOH E 5 .   ? 37.465 46.161 14.894 1.00 23.18 ? 509 HOH A O     1 
HETATM 1261 O  O     . HOH E 5 .   ? 24.892 31.971 17.462 1.00 28.31 ? 510 HOH A O     1 
HETATM 1262 O  O     . HOH E 5 .   ? 3.731  39.684 16.008 1.00 28.68 ? 511 HOH A O     1 
HETATM 1263 O  O     . HOH E 5 .   ? 35.080 50.269 0.729  1.00 41.89 ? 512 HOH A O     1 
HETATM 1264 O  O     . HOH E 5 .   ? 18.536 38.860 1.306  1.00 26.91 ? 513 HOH A O     1 
HETATM 1265 O  O     . HOH E 5 .   ? 27.289 49.391 23.130 1.00 24.81 ? 514 HOH A O     1 
HETATM 1266 O  O     . HOH E 5 .   ? 18.453 39.452 17.060 1.00 28.12 ? 515 HOH A O     1 
HETATM 1267 O  O     . HOH E 5 .   ? 33.143 40.188 17.944 1.00 24.26 ? 516 HOH A O     1 
HETATM 1268 O  O     . HOH E 5 .   ? 16.739 62.877 16.520 1.00 32.49 ? 517 HOH A O     1 
HETATM 1269 O  O     . HOH E 5 .   ? 40.024 35.844 15.723 1.00 38.90 ? 518 HOH A O     1 
HETATM 1270 O  O     . HOH E 5 .   ? 31.354 40.567 22.205 1.00 25.62 ? 519 HOH A O     1 
HETATM 1271 O  O     . HOH E 5 .   ? 17.135 48.358 26.679 1.00 28.42 ? 520 HOH A O     1 
HETATM 1272 O  O     . HOH E 5 .   ? 36.755 37.033 14.372 1.00 35.44 ? 521 HOH A O     1 
HETATM 1273 O  O     . HOH E 5 .   ? 16.546 39.526 30.513 1.00 26.82 ? 522 HOH A O     1 
HETATM 1274 O  O     . HOH E 5 .   ? 20.423 50.706 3.411  1.00 33.42 ? 523 HOH A O     1 
HETATM 1275 O  O     . HOH E 5 .   ? 8.994  47.848 4.829  1.00 27.95 ? 524 HOH A O     1 
HETATM 1276 O  O     . HOH E 5 .   ? 10.995 32.546 7.540  1.00 42.34 ? 525 HOH A O     1 
HETATM 1277 O  O     . HOH E 5 .   ? 14.690 32.679 23.147 1.00 20.56 ? 526 HOH A O     1 
HETATM 1278 O  O     . HOH E 5 .   ? 32.026 47.171 19.758 1.00 29.80 ? 527 HOH A O     1 
HETATM 1279 O  O     . HOH E 5 .   ? 29.418 28.262 9.244  1.00 34.06 ? 528 HOH A O     1 
HETATM 1280 O  O     . HOH E 5 .   ? 31.250 36.056 21.010 1.00 35.52 ? 529 HOH A O     1 
HETATM 1281 O  O     . HOH E 5 .   ? 15.902 28.562 8.762  1.00 39.82 ? 530 HOH A O     1 
HETATM 1282 O  O     . HOH E 5 .   ? 16.205 42.929 33.348 1.00 31.71 ? 531 HOH A O     1 
HETATM 1283 O  O     . HOH E 5 .   ? 24.804 47.054 -3.104 1.00 36.46 ? 532 HOH A O     1 
HETATM 1284 O  O     . HOH E 5 .   ? 37.864 48.146 -0.678 1.00 52.93 ? 533 HOH A O     1 
HETATM 1285 O  O     . HOH E 5 .   ? 22.416 26.286 16.556 1.00 45.34 ? 534 HOH A O     1 
HETATM 1286 O  O     . HOH E 5 .   ? 17.027 57.972 2.476  1.00 41.44 ? 535 HOH A O     1 
HETATM 1287 O  O     . HOH E 5 .   ? 25.831 40.321 -3.404 1.00 32.07 ? 536 HOH A O     1 
HETATM 1288 O  O     . HOH E 5 .   ? 24.157 33.395 9.480  1.00 13.87 ? 537 HOH A O     1 
HETATM 1289 O  O     . HOH E 5 .   ? 30.956 43.048 22.713 1.00 35.31 ? 538 HOH A O     1 
HETATM 1290 O  O     . HOH E 5 .   ? 23.835 33.198 15.433 1.00 21.64 ? 539 HOH A O     1 
HETATM 1291 O  O     . HOH E 5 .   ? 25.786 33.064 13.365 1.00 20.78 ? 540 HOH A O     1 
HETATM 1292 O  O     . HOH E 5 .   ? 11.936 46.792 28.141 1.00 44.11 ? 541 HOH A O     1 
HETATM 1293 O  O     . HOH E 5 .   ? 14.711 26.688 7.886  1.00 35.31 ? 542 HOH A O     1 
HETATM 1294 O  O     . HOH E 5 .   ? 24.204 49.623 29.606 1.00 41.07 ? 543 HOH A O     1 
HETATM 1295 O  O     . HOH E 5 .   ? 34.802 31.037 0.066  1.00 42.95 ? 544 HOH A O     1 
HETATM 1296 O  O     . HOH E 5 .   ? 22.363 30.624 17.377 1.00 36.35 ? 545 HOH A O     1 
HETATM 1297 O  O     . HOH E 5 .   ? 26.251 28.796 10.419 1.00 26.39 ? 546 HOH A O     1 
HETATM 1298 O  O     . HOH E 5 .   ? 31.527 53.120 10.168 1.00 33.44 ? 547 HOH A O     1 
HETATM 1299 O  O     . HOH E 5 .   ? 1.420  40.577 17.289 1.00 29.83 ? 548 HOH A O     1 
HETATM 1300 O  O     . HOH E 5 .   ? 30.688 30.974 8.654  1.00 38.48 ? 549 HOH A O     1 
HETATM 1301 O  O     . HOH E 5 .   ? 17.644 48.024 23.324 1.00 32.16 ? 550 HOH A O     1 
HETATM 1302 O  O     . HOH E 5 .   ? 28.493 34.224 -0.482 1.00 32.46 ? 551 HOH A O     1 
HETATM 1303 O  O     . HOH E 5 .   ? 25.471 25.963 15.304 1.00 45.81 ? 552 HOH A O     1 
HETATM 1304 O  O     . HOH E 5 .   ? 15.063 30.373 21.869 1.00 32.92 ? 553 HOH A O     1 
HETATM 1305 O  O     . HOH E 5 .   ? 28.038 33.124 27.465 1.00 42.41 ? 554 HOH A O     1 
HETATM 1306 O  O     . HOH E 5 .   ? 28.027 41.308 31.685 1.00 45.54 ? 555 HOH A O     1 
HETATM 1307 O  O     . HOH E 5 .   ? 22.139 36.916 32.140 1.00 44.55 ? 556 HOH A O     1 
HETATM 1308 O  O     . HOH E 5 .   ? 14.140 50.320 0.985  1.00 42.60 ? 557 HOH A O     1 
HETATM 1309 O  O     . HOH E 5 .   ? 20.729 23.607 12.302 1.00 43.46 ? 558 HOH A O     1 
HETATM 1310 O  O     . HOH E 5 .   ? 27.976 53.801 4.102  1.00 44.06 ? 559 HOH A O     1 
HETATM 1311 O  O     . HOH E 5 .   ? 0.454  45.445 17.178 1.00 36.46 ? 560 HOH A O     1 
HETATM 1312 O  O     . HOH E 5 .   ? 25.715 30.169 20.970 1.00 29.35 ? 561 HOH A O     1 
HETATM 1313 O  O     . HOH E 5 .   ? 24.975 30.975 11.631 1.00 35.54 ? 562 HOH A O     1 
HETATM 1314 O  O     . HOH E 5 .   ? 36.309 47.542 17.471 1.00 41.89 ? 563 HOH A O     1 
HETATM 1315 O  O     . HOH E 5 .   ? 31.334 45.483 35.605 1.00 37.87 ? 564 HOH A O     1 
HETATM 1316 O  O     . HOH E 5 .   ? 0.884  42.601 23.683 1.00 33.99 ? 565 HOH A O     1 
HETATM 1317 O  O     . HOH E 5 .   ? 40.768 35.579 12.998 1.00 43.08 ? 566 HOH A O     1 
HETATM 1318 O  O     . HOH E 5 .   ? 18.428 50.420 28.896 1.00 33.46 ? 567 HOH A O     1 
HETATM 1319 O  O     . HOH E 5 .   ? 23.519 39.419 6.221  1.00 19.45 ? 568 HOH A O     1 
HETATM 1320 O  O     . HOH E 5 .   ? 23.481 56.115 22.696 1.00 24.91 ? 569 HOH A O     1 
HETATM 1321 O  O     . HOH E 5 .   ? 33.653 35.942 -2.092 1.00 31.94 ? 570 HOH A O     1 
HETATM 1322 O  O     . HOH E 5 .   ? 27.443 50.144 19.077 1.00 40.12 ? 571 HOH A O     1 
HETATM 1323 O  O     . HOH E 5 .   ? 13.740 55.137 24.656 1.00 41.95 ? 572 HOH A O     1 
HETATM 1324 O  O     . HOH E 5 .   ? 19.463 37.058 32.262 1.00 45.20 ? 573 HOH A O     1 
HETATM 1325 O  O     . HOH E 5 .   ? 14.612 34.347 0.932  1.00 44.63 ? 574 HOH A O     1 
HETATM 1326 O  O     . HOH E 5 .   ? 21.300 27.876 19.115 1.00 32.70 ? 575 HOH A O     1 
HETATM 1327 O  O     . HOH E 5 .   ? 18.149 26.721 19.637 1.00 29.89 ? 576 HOH A O     1 
HETATM 1328 O  O     . HOH E 5 .   ? 35.823 34.757 10.432 1.00 26.04 ? 577 HOH A O     1 
HETATM 1329 O  O     . HOH E 5 .   ? 22.307 35.251 35.616 1.00 43.77 ? 578 HOH A O     1 
HETATM 1330 O  O     . HOH E 5 .   ? 31.560 53.098 7.606  1.00 40.19 ? 579 HOH A O     1 
HETATM 1331 O  O     . HOH E 5 .   ? 4.402  38.526 9.336  1.00 46.08 ? 580 HOH A O     1 
HETATM 1332 O  O     . HOH E 5 .   ? 25.501 31.528 24.169 1.00 31.92 ? 581 HOH A O     1 
HETATM 1333 O  O     . HOH E 5 .   ? 30.506 41.012 33.762 1.00 43.02 ? 582 HOH A O     1 
HETATM 1334 O  O     . HOH E 5 .   ? 27.983 51.635 1.299  1.00 38.44 ? 583 HOH A O     1 
HETATM 1335 O  O     . HOH E 5 .   ? -0.685 47.587 21.599 1.00 49.16 ? 584 HOH A O     1 
HETATM 1336 O  O     . HOH E 5 .   ? 11.984 33.381 22.299 1.00 37.44 ? 585 HOH A O     1 
HETATM 1337 O  O     . HOH E 5 .   ? 0.000  45.961 9.495  0.50 42.18 ? 586 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ILE 1   7   7   ILE ILE A . n 
A 1 2   MET 2   8   8   MET MET A . n 
A 1 3   ARG 3   9   9   ARG ARG A . n 
A 1 4   HIS 4   10  10  HIS HIS A . n 
A 1 5   LEU 5   11  11  LEU LEU A . n 
A 1 6   PRO 6   12  12  PRO PRO A . n 
A 1 7   TYR 7   13  13  TYR TYR A . n 
A 1 8   PHE 8   14  14  PHE PHE A . n 
A 1 9   CYS 9   15  15  CYS CYS A . n 
A 1 10  ARG 10  16  16  ARG ARG A . n 
A 1 11  GLY 11  17  17  GLY GLY A . n 
A 1 12  GLN 12  18  18  GLN GLN A . n 
A 1 13  VAL 13  19  19  VAL VAL A . n 
A 1 14  VAL 14  20  20  VAL VAL A . n 
A 1 15  ARG 15  21  21  ARG ARG A . n 
A 1 16  GLY 16  22  22  GLY GLY A . n 
A 1 17  PHE 17  23  23  PHE PHE A . n 
A 1 18  GLY 18  24  24  GLY GLY A . n 
A 1 19  ARG 19  25  25  ARG ARG A . n 
A 1 20  GLY 20  26  26  GLY GLY A . n 
A 1 21  SER 21  27  27  SER SER A . n 
A 1 22  LYS 22  28  28  LYS LYS A . n 
A 1 23  GLN 23  29  29  GLN GLN A . n 
A 1 24  LEU 24  30  30  LEU LEU A . n 
A 1 25  GLY 25  31  31  GLY GLY A . n 
A 1 26  ILE 26  32  32  ILE ILE A . n 
A 1 27  PRO 27  33  33  PRO PRO A . n 
A 1 28  THR 28  34  34  THR THR A . n 
A 1 29  ALA 29  35  35  ALA ALA A . n 
A 1 30  ASN 30  36  36  ASN ASN A . n 
A 1 31  PHE 31  37  37  PHE PHE A . n 
A 1 32  PRO 32  38  38  PRO PRO A . n 
A 1 33  GLU 33  39  39  GLU GLU A . n 
A 1 34  GLN 34  40  40  GLN GLN A . n 
A 1 35  VAL 35  41  41  VAL VAL A . n 
A 1 36  VAL 36  42  42  VAL VAL A . n 
A 1 37  ASP 37  43  43  ASP ASP A . n 
A 1 38  ASN 38  44  44  ASN ASN A . n 
A 1 39  LEU 39  45  45  LEU LEU A . n 
A 1 40  PRO 40  46  46  PRO PRO A . n 
A 1 41  ALA 41  47  47  ALA ALA A . n 
A 1 42  ASP 42  48  48  ASP ASP A . n 
A 1 43  ILE 43  49  49  ILE ILE A . n 
A 1 44  SER 44  50  50  SER SER A . n 
A 1 45  THR 45  51  51  THR THR A . n 
A 1 46  GLY 46  52  52  GLY GLY A . n 
A 1 47  ILE 47  53  53  ILE ILE A . n 
A 1 48  TYR 48  54  54  TYR TYR A . n 
A 1 49  TYR 49  55  55  TYR TYR A . n 
A 1 50  GLY 50  56  56  GLY GLY A . n 
A 1 51  TRP 51  57  57  TRP TRP A . n 
A 1 52  ALA 52  58  58  ALA ALA A . n 
A 1 53  SER 53  59  59  SER SER A . n 
A 1 54  VAL 54  60  60  VAL VAL A . n 
A 1 55  GLY 55  61  61  GLY GLY A . n 
A 1 56  SER 56  62  62  SER SER A . n 
A 1 57  GLY 57  63  63  GLY GLY A . n 
A 1 58  ASP 58  64  64  ASP ASP A . n 
A 1 59  VAL 59  65  65  VAL VAL A . n 
A 1 60  HIS 60  66  66  HIS HIS A . n 
A 1 61  LYS 61  67  67  LYS LYS A . n 
A 1 62  MET 62  68  68  MET MET A . n 
A 1 63  VAL 63  69  69  VAL VAL A . n 
A 1 64  VAL 64  70  70  VAL VAL A . n 
A 1 65  SER 65  71  71  SER SER A . n 
A 1 66  ILE 66  72  72  ILE ILE A . n 
A 1 67  GLY 67  73  73  GLY GLY A . n 
A 1 68  TRP 68  74  74  TRP TRP A . n 
A 1 69  ASN 69  75  75  ASN ASN A . n 
A 1 70  PRO 70  76  76  PRO PRO A . n 
A 1 71  TYR 71  77  77  TYR TYR A . n 
A 1 72  TYR 72  78  78  TYR TYR A . n 
A 1 73  LYS 73  79  79  LYS LYS A . n 
A 1 74  ASN 74  80  80  ASN ASN A . n 
A 1 75  THR 75  81  81  THR THR A . n 
A 1 76  LYS 76  82  82  LYS LYS A . n 
A 1 77  LYS 77  83  83  LYS LYS A . n 
A 1 78  SER 78  84  84  SER SER A . n 
A 1 79  MET 79  85  85  MET MET A . n 
A 1 80  GLU 80  86  86  GLU GLU A . n 
A 1 81  THR 81  87  87  THR THR A . n 
A 1 82  HIS 82  88  88  HIS HIS A . n 
A 1 83  ILE 83  89  89  ILE ILE A . n 
A 1 84  MET 84  90  90  MET MET A . n 
A 1 85  HIS 85  91  91  HIS HIS A . n 
A 1 86  THR 86  92  92  THR THR A . n 
A 1 87  PHE 87  93  93  PHE PHE A . n 
A 1 88  LYS 88  94  94  LYS LYS A . n 
A 1 89  GLU 89  95  95  GLU GLU A . n 
A 1 90  ASP 90  96  96  ASP ASP A . n 
A 1 91  PHE 91  97  97  PHE PHE A . n 
A 1 92  TYR 92  98  98  TYR TYR A . n 
A 1 93  GLY 93  99  99  GLY GLY A . n 
A 1 94  GLU 94  100 100 GLU GLU A . n 
A 1 95  ILE 95  101 101 ILE ILE A . n 
A 1 96  LEU 96  102 102 LEU LEU A . n 
A 1 97  ASN 97  103 103 ASN ASN A . n 
A 1 98  VAL 98  104 104 VAL VAL A . n 
A 1 99  ALA 99  105 105 ALA ALA A . n 
A 1 100 ILE 100 106 106 ILE ILE A . n 
A 1 101 VAL 101 107 107 VAL VAL A . n 
A 1 102 GLY 102 108 108 GLY GLY A . n 
A 1 103 TYR 103 109 109 TYR TYR A . n 
A 1 104 LEU 104 110 110 LEU LEU A . n 
A 1 105 ARG 105 111 111 ARG ARG A . n 
A 1 106 PRO 106 112 112 PRO PRO A . n 
A 1 107 GLU 107 113 113 GLU GLU A . n 
A 1 108 LYS 108 114 114 LYS LYS A . n 
A 1 109 ASN 109 115 115 ASN ASN A . n 
A 1 110 PHE 110 116 116 PHE PHE A . n 
A 1 111 ASP 111 117 117 ASP ASP A . n 
A 1 112 SER 112 118 118 SER SER A . n 
A 1 113 LEU 113 119 119 LEU LEU A . n 
A 1 114 GLU 114 120 120 GLU GLU A . n 
A 1 115 SER 115 121 121 SER SER A . n 
A 1 116 LEU 116 122 122 LEU LEU A . n 
A 1 117 ILE 117 123 123 ILE ILE A . n 
A 1 118 SER 118 124 124 SER SER A . n 
A 1 119 ALA 119 125 125 ALA ALA A . n 
A 1 120 ILE 120 126 126 ILE ILE A . n 
A 1 121 GLN 121 127 127 GLN GLN A . n 
A 1 122 GLY 122 128 128 GLY GLY A . n 
A 1 123 ASP 123 129 129 ASP ASP A . n 
A 1 124 ILE 124 130 130 ILE ILE A . n 
A 1 125 GLU 125 131 131 GLU GLU A . n 
A 1 126 GLU 126 132 132 GLU GLU A . n 
A 1 127 ALA 127 133 133 ALA ALA A . n 
A 1 128 LYS 128 134 134 LYS LYS A . n 
A 1 129 LYS 129 135 135 LYS LYS A . n 
A 1 130 ARG 130 136 136 ARG ARG A . n 
A 1 131 LEU 131 137 137 LEU LEU A . n 
A 1 132 GLU 132 138 138 GLU GLU A . n 
A 1 133 LEU 133 139 139 LEU LEU A . n 
A 1 134 PRO 134 140 140 PRO PRO A . n 
A 1 135 GLU 135 141 141 GLU GLU A . n 
A 1 136 TYR 136 142 142 TYR TYR A . n 
A 1 137 LEU 137 143 143 LEU LEU A . n 
A 1 138 LYS 138 144 144 LYS LYS A . n 
A 1 139 ILE 139 145 145 ILE ILE A . n 
A 1 140 LYS 140 146 146 LYS LYS A . n 
A 1 141 GLU 141 147 147 GLU GLU A . n 
A 1 142 ASP 142 148 148 ASP ASP A . n 
A 1 143 ASN 143 149 149 ASN ASN A . n 
A 1 144 PHE 144 150 150 PHE PHE A . n 
A 1 145 PHE 145 151 151 PHE PHE A . n 
A 1 146 GLN 146 152 152 GLN GLN A . n 
A 1 147 VAL 147 153 153 VAL VAL A . n 
A 1 148 SER 148 154 154 SER SER A . n 
A 1 149 LYS 149 155 155 LYS LYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1  201 201 MG  MG  A . 
C 3 ADP 1  301 301 ADP ADP A . 
D 4 FMN 1  401 401 FMN FMN A . 
E 5 HOH 1  501 501 HOH HOH A . 
E 5 HOH 2  502 502 HOH HOH A . 
E 5 HOH 3  503 503 HOH HOH A . 
E 5 HOH 4  504 504 HOH HOH A . 
E 5 HOH 5  505 505 HOH HOH A . 
E 5 HOH 6  506 506 HOH HOH A . 
E 5 HOH 7  507 507 HOH HOH A . 
E 5 HOH 8  508 508 HOH HOH A . 
E 5 HOH 9  509 509 HOH HOH A . 
E 5 HOH 10 510 510 HOH HOH A . 
E 5 HOH 11 511 511 HOH HOH A . 
E 5 HOH 12 512 512 HOH HOH A . 
E 5 HOH 13 513 513 HOH HOH A . 
E 5 HOH 14 514 514 HOH HOH A . 
E 5 HOH 15 515 515 HOH HOH A . 
E 5 HOH 16 516 516 HOH HOH A . 
E 5 HOH 17 517 517 HOH HOH A . 
E 5 HOH 18 518 518 HOH HOH A . 
E 5 HOH 19 519 519 HOH HOH A . 
E 5 HOH 20 520 520 HOH HOH A . 
E 5 HOH 21 521 521 HOH HOH A . 
E 5 HOH 22 522 522 HOH HOH A . 
E 5 HOH 23 523 523 HOH HOH A . 
E 5 HOH 24 524 524 HOH HOH A . 
E 5 HOH 25 525 525 HOH HOH A . 
E 5 HOH 26 526 526 HOH HOH A . 
E 5 HOH 27 527 527 HOH HOH A . 
E 5 HOH 28 528 528 HOH HOH A . 
E 5 HOH 29 529 529 HOH HOH A . 
E 5 HOH 30 530 530 HOH HOH A . 
E 5 HOH 31 531 531 HOH HOH A . 
E 5 HOH 32 532 532 HOH HOH A . 
E 5 HOH 33 533 533 HOH HOH A . 
E 5 HOH 34 534 534 HOH HOH A . 
E 5 HOH 35 535 535 HOH HOH A . 
E 5 HOH 36 536 536 HOH HOH A . 
E 5 HOH 37 537 537 HOH HOH A . 
E 5 HOH 38 538 538 HOH HOH A . 
E 5 HOH 39 539 539 HOH HOH A . 
E 5 HOH 40 540 540 HOH HOH A . 
E 5 HOH 41 541 541 HOH HOH A . 
E 5 HOH 42 542 542 HOH HOH A . 
E 5 HOH 43 543 543 HOH HOH A . 
E 5 HOH 44 544 544 HOH HOH A . 
E 5 HOH 45 545 545 HOH HOH A . 
E 5 HOH 46 546 546 HOH HOH A . 
E 5 HOH 47 547 547 HOH HOH A . 
E 5 HOH 48 548 548 HOH HOH A . 
E 5 HOH 49 549 549 HOH HOH A . 
E 5 HOH 50 550 550 HOH HOH A . 
E 5 HOH 51 551 551 HOH HOH A . 
E 5 HOH 52 552 552 HOH HOH A . 
E 5 HOH 53 553 553 HOH HOH A . 
E 5 HOH 54 554 554 HOH HOH A . 
E 5 HOH 55 555 555 HOH HOH A . 
E 5 HOH 56 556 556 HOH HOH A . 
E 5 HOH 57 557 557 HOH HOH A . 
E 5 HOH 58 558 558 HOH HOH A . 
E 5 HOH 59 559 559 HOH HOH A . 
E 5 HOH 60 560 560 HOH HOH A . 
E 5 HOH 61 561 561 HOH HOH A . 
E 5 HOH 62 562 562 HOH HOH A . 
E 5 HOH 63 563 563 HOH HOH A . 
E 5 HOH 64 564 564 HOH HOH A . 
E 5 HOH 65 565 565 HOH HOH A . 
E 5 HOH 66 566 566 HOH HOH A . 
E 5 HOH 67 567 567 HOH HOH A . 
E 5 HOH 68 568 568 HOH HOH A . 
E 5 HOH 69 569 569 HOH HOH A . 
E 5 HOH 70 570 570 HOH HOH A . 
E 5 HOH 71 571 571 HOH HOH A . 
E 5 HOH 72 572 572 HOH HOH A . 
E 5 HOH 73 573 573 HOH HOH A . 
E 5 HOH 74 574 574 HOH HOH A . 
E 5 HOH 75 575 575 HOH HOH A . 
E 5 HOH 76 576 576 HOH HOH A . 
E 5 HOH 77 577 577 HOH HOH A . 
E 5 HOH 78 578 578 HOH HOH A . 
E 5 HOH 79 579 579 HOH HOH A . 
E 5 HOH 80 580 580 HOH HOH A . 
E 5 HOH 81 581 581 HOH HOH A . 
E 5 HOH 82 582 582 HOH HOH A . 
E 5 HOH 83 583 583 HOH HOH A . 
E 5 HOH 84 584 584 HOH HOH A . 
E 5 HOH 85 585 585 HOH HOH A . 
E 5 HOH 86 586 586 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     586 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   E 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OG1 ? A THR 28 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OD1 ? A ASN 30 ? A ASN 36  ? 1_555 83.5  ? 
2  OG1 ? A THR 28 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? A THR 28 ? A THR 34  ? 1_555 78.9  ? 
3  OD1 ? A ASN 30 ? A ASN 36  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? A THR 28 ? A THR 34  ? 1_555 83.0  ? 
4  OG1 ? A THR 28 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O1B ? C ADP .  ? A ADP 301 ? 1_555 167.5 ? 
5  OD1 ? A ASN 30 ? A ASN 36  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O1B ? C ADP .  ? A ADP 301 ? 1_555 101.4 ? 
6  O   ? A THR 28 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O1B ? C ADP .  ? A ADP 301 ? 1_555 90.2  ? 
7  OG1 ? A THR 28 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O2A ? C ADP .  ? A ADP 301 ? 1_555 89.4  ? 
8  OD1 ? A ASN 30 ? A ASN 36  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O2A ? C ADP .  ? A ADP 301 ? 1_555 170.8 ? 
9  O   ? A THR 28 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O2A ? C ADP .  ? A ADP 301 ? 1_555 89.9  ? 
10 O1B ? C ADP .  ? A ADP 301 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O2A ? C ADP .  ? A ADP 301 ? 1_555 84.4  ? 
11 OG1 ? A THR 28 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O1P ? D FMN .  ? A FMN 401 ? 1_555 78.0  ? 
12 OD1 ? A ASN 30 ? A ASN 36  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O1P ? D FMN .  ? A FMN 401 ? 1_555 94.6  ? 
13 O   ? A THR 28 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O1P ? D FMN .  ? A FMN 401 ? 1_555 156.8 ? 
14 O1B ? C ADP .  ? A ADP 301 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O1P ? D FMN .  ? A FMN 401 ? 1_555 112.8 ? 
15 O2A ? C ADP .  ? A ADP 301 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O1P ? D FMN .  ? A FMN 401 ? 1_555 89.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-12-16 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
HKL-2000  'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
AMoRE     phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 9  ? ? -67.36  37.48 
2 1 HIS A 10 ? ? -104.62 49.24 
3 1 ASN A 75 ? ? 53.35   72.37 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ILE 7 ? CB  ? A ILE 1 CB  
2 1 Y 1 A ILE 7 ? CG1 ? A ILE 1 CG1 
3 1 Y 1 A ILE 7 ? CG2 ? A ILE 1 CG2 
4 1 Y 1 A ILE 7 ? CD1 ? A ILE 1 CD1 
5 1 Y 1 A MET 8 ? CB  ? A MET 2 CB  
6 1 Y 1 A MET 8 ? CG  ? A MET 2 CG  
7 1 Y 1 A MET 8 ? SD  ? A MET 2 SD  
8 1 Y 1 A MET 8 ? CE  ? A MET 2 CE  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'            MG  
3 "ADENOSINE-5'-DIPHOSPHATE" ADP 
4 'FLAVIN MONONUCLEOTIDE'    FMN 
5 water                      HOH 
#