data_1QCY
# 
_entry.id   1QCY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QCY         
RCSB  RCSB009087   
WWPDB D_1000009087 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QCY 
_pdbx_database_status.recvd_initial_deposition_date   1999-05-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kankare, J.A.'  1 
'Salminen, T.A.' 2 
'Nymalm, Y.'     3 
'Kaepylae, J.'   4 
'Heino, J.'      5 
'Johnson, M.S.'  6 
# 
_citation.id                        primary 
_citation.title                     
'Jararhagin-derived RKKH Peptides Induce Structural Changes in a1I Domain of Human Integrin a1b1' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            279 
_citation.page_first                7962 
_citation.page_last                 7970 
_citation.year                      2004 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14660600 
_citation.pdbx_database_id_DOI      10.1074/jbc.M312912200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nymalm, Y.'         1  
primary 'Puranen, J.S.'      2  
primary 'Nyholm, T.K.M.'     3  
primary 'Kaepylae, J.'       4  
primary 'Kidron, H.'         5  
primary 'Pentikaeinen, O.T.' 6  
primary 'Airenne, T.T.'      7  
primary 'Heino, J.'          8  
primary 'Slotte, J.P.'       9  
primary 'Johnson, M.S.'      10 
primary 'Salminen, T.A.'     11 
# 
_cell.entry_id           1QCY 
_cell.length_a           74.457 
_cell.length_b           81.858 
_cell.length_c           37.316 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.78 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QCY 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     monoclinic 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'I-DOMAIN OF INTEGRIN ALPHA1BETA1' 21546.402 1  ? K170E 'FRAGMENT, I-DOMAIN OF HUMAN INTEGRIN A1B1' ? 
2 non-polymer syn 'MAGNESIUM ION'                    24.305    1  ? ?     ?                                           ? 
3 water       nat water                              18.015    94 ? ?     ?                                           ? 
# 
_entity_keywords.entity_id   1 
_entity_keywords.text        
;THE SEQUENCE IS DIFFERENT IN SWISS-PROT, NO ELECTRON SIDE-CHAIN DENSITY WAS EVER SEEN FOR RESIDUE R218, LEFT AS AN ALANINE IN THE STRUCTURE
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;TQLDIVIVLDGSNSIYPWDSVTAFLNDLLKRMDIGPKQTQVGIVQYGENVTHEFNLNKYSSTEEVLVAAKKIVQRGGAQT
MTALGTDTARKEAFTEARGARRGVKKVMVIVTDGESHDNHRLKKVIQDCEDENIQRFSIAILGSYNRGNLSTEKFVEEIK
SIASEPTEKHFFNVSDELALVTIVKTLGERIFA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;TQLDIVIVLDGSNSIYPWDSVTAFLNDLLKRMDIGPKQTQVGIVQYGENVTHEFNLNKYSSTEEVLVAAKKIVQRGGAQT
MTALGTDTARKEAFTEARGARRGVKKVMVIVTDGESHDNHRLKKVIQDCEDENIQRFSIAILGSYNRGNLSTEKFVEEIK
SIASEPTEKHFFNVSDELALVTIVKTLGERIFA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   GLN n 
1 3   LEU n 
1 4   ASP n 
1 5   ILE n 
1 6   VAL n 
1 7   ILE n 
1 8   VAL n 
1 9   LEU n 
1 10  ASP n 
1 11  GLY n 
1 12  SER n 
1 13  ASN n 
1 14  SER n 
1 15  ILE n 
1 16  TYR n 
1 17  PRO n 
1 18  TRP n 
1 19  ASP n 
1 20  SER n 
1 21  VAL n 
1 22  THR n 
1 23  ALA n 
1 24  PHE n 
1 25  LEU n 
1 26  ASN n 
1 27  ASP n 
1 28  LEU n 
1 29  LEU n 
1 30  LYS n 
1 31  ARG n 
1 32  MET n 
1 33  ASP n 
1 34  ILE n 
1 35  GLY n 
1 36  PRO n 
1 37  LYS n 
1 38  GLN n 
1 39  THR n 
1 40  GLN n 
1 41  VAL n 
1 42  GLY n 
1 43  ILE n 
1 44  VAL n 
1 45  GLN n 
1 46  TYR n 
1 47  GLY n 
1 48  GLU n 
1 49  ASN n 
1 50  VAL n 
1 51  THR n 
1 52  HIS n 
1 53  GLU n 
1 54  PHE n 
1 55  ASN n 
1 56  LEU n 
1 57  ASN n 
1 58  LYS n 
1 59  TYR n 
1 60  SER n 
1 61  SER n 
1 62  THR n 
1 63  GLU n 
1 64  GLU n 
1 65  VAL n 
1 66  LEU n 
1 67  VAL n 
1 68  ALA n 
1 69  ALA n 
1 70  LYS n 
1 71  LYS n 
1 72  ILE n 
1 73  VAL n 
1 74  GLN n 
1 75  ARG n 
1 76  GLY n 
1 77  GLY n 
1 78  ALA n 
1 79  GLN n 
1 80  THR n 
1 81  MET n 
1 82  THR n 
1 83  ALA n 
1 84  LEU n 
1 85  GLY n 
1 86  THR n 
1 87  ASP n 
1 88  THR n 
1 89  ALA n 
1 90  ARG n 
1 91  LYS n 
1 92  GLU n 
1 93  ALA n 
1 94  PHE n 
1 95  THR n 
1 96  GLU n 
1 97  ALA n 
1 98  ARG n 
1 99  GLY n 
1 100 ALA n 
1 101 ARG n 
1 102 ARG n 
1 103 GLY n 
1 104 VAL n 
1 105 LYS n 
1 106 LYS n 
1 107 VAL n 
1 108 MET n 
1 109 VAL n 
1 110 ILE n 
1 111 VAL n 
1 112 THR n 
1 113 ASP n 
1 114 GLY n 
1 115 GLU n 
1 116 SER n 
1 117 HIS n 
1 118 ASP n 
1 119 ASN n 
1 120 HIS n 
1 121 ARG n 
1 122 LEU n 
1 123 LYS n 
1 124 LYS n 
1 125 VAL n 
1 126 ILE n 
1 127 GLN n 
1 128 ASP n 
1 129 CYS n 
1 130 GLU n 
1 131 ASP n 
1 132 GLU n 
1 133 ASN n 
1 134 ILE n 
1 135 GLN n 
1 136 ARG n 
1 137 PHE n 
1 138 SER n 
1 139 ILE n 
1 140 ALA n 
1 141 ILE n 
1 142 LEU n 
1 143 GLY n 
1 144 SER n 
1 145 TYR n 
1 146 ASN n 
1 147 ARG n 
1 148 GLY n 
1 149 ASN n 
1 150 LEU n 
1 151 SER n 
1 152 THR n 
1 153 GLU n 
1 154 LYS n 
1 155 PHE n 
1 156 VAL n 
1 157 GLU n 
1 158 GLU n 
1 159 ILE n 
1 160 LYS n 
1 161 SER n 
1 162 ILE n 
1 163 ALA n 
1 164 SER n 
1 165 GLU n 
1 166 PRO n 
1 167 THR n 
1 168 GLU n 
1 169 LYS n 
1 170 HIS n 
1 171 PHE n 
1 172 PHE n 
1 173 ASN n 
1 174 VAL n 
1 175 SER n 
1 176 ASP n 
1 177 GLU n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 VAL n 
1 182 THR n 
1 183 ILE n 
1 184 VAL n 
1 185 LYS n 
1 186 THR n 
1 187 LEU n 
1 188 GLY n 
1 189 GLU n 
1 190 ARG n 
1 191 ILE n 
1 192 PHE n 
1 193 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ITA1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P56199 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1QCY 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 193 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P56199 
_struct_ref_seq.db_align_beg                  141 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  333 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       141 
_struct_ref_seq.pdbx_auth_seq_align_end       333 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1QCY 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      78 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P56199 
_struct_ref_seq_dif.db_mon_id                    ARG 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          218 
_struct_ref_seq_dif.details                      'SEE REMARK 999' 
_struct_ref_seq_dif.pdbx_auth_seq_num            218 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QCY 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.64 
_exptl_crystal.density_percent_sol   53.39 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    'PEG 4000, Na-acetate, glycerol, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IIC' 
_diffrn_detector.pdbx_collection_date   1998-09-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QCY 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             500.0 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   9471 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.8 
_reflns.pdbx_Rmerge_I_obs            0.058 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.3 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   90.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      796 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1QCY 
_refine.ls_number_reflns_obs                     9471 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               374683.35 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             500.0 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    94.8 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2 
_refine.ls_R_factor_R_free                       0.258 
_refine.ls_R_factor_R_free_error                 0.008 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.5 
_refine.ls_number_reflns_R_free                  995 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               24.8 
_refine.aniso_B[1][1]                            2.52 
_refine.aniso_B[2][2]                            -0.49 
_refine.aniso_B[3][3]                            -2.03 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -3.92 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.340 
_refine.solvent_model_param_bsol                 29.22 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.overall_SU_ML                            ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1QCY 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.13 
_refine_analyze.Luzzati_d_res_low_obs           6.00 
_refine_analyze.Luzzati_coordinate_error_free   0.34 
_refine_analyze.Luzzati_sigma_a_free            0.22 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1514 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             94 
_refine_hist.number_atoms_total               1609 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        500.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.005 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               1.20  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.1  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.74  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.38  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.21  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.25  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.25  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.30 
_refine_ls_shell.d_res_low                        2.38 
_refine_ls_shell.number_reflns_R_work             796 
_refine_ls_shell.R_factor_R_work                  0.196 
_refine_ls_shell.percent_reflns_obs               90.9 
_refine_ls_shell.R_factor_R_free                  0.287 
_refine_ls_shell.R_factor_R_free_error            0.030 
_refine_ls_shell.percent_reflns_R_free            10.6 
_refine_ls_shell.number_reflns_R_free             94 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   ?           'X-RAY DIFFRACTION' 
3 ION.PARAM         ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1QCY 
_struct.title                     'THE CRYSTAL STRUCTURE OF THE I-DOMAIN OF HUMAN INTEGRIN ALPHA1BETA1' 
_struct.pdbx_descriptor           'I-DOMAIN OF INTEGRIN ALPHA1BETA1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QCY 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            'DINUCLEOTIDE BINDING FOLD, ROSSMANN FOLD, CELL ADHESION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'I-domain is a fragment of alpha1 subunit of the large integrin heterodimer' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 17  ? ARG A 31  ? PRO A 157 ARG A 171 1 ? 15 
HELX_P HELX_P2 2 SER A 61  ? ILE A 72  ? SER A 201 ILE A 212 1 ? 12 
HELX_P HELX_P3 3 MET A 81  ? GLU A 92  ? MET A 221 GLU A 232 1 ? 12 
HELX_P HELX_P4 4 THR A 95  ? GLY A 99  ? THR A 235 GLY A 239 5 ? 5  
HELX_P HELX_P5 5 ARG A 121 ? GLU A 132 ? ARG A 261 GLU A 272 1 ? 12 
HELX_P HELX_P6 6 LEU A 142 ? GLY A 148 ? LEU A 282 GLY A 288 1 ? 7  
HELX_P HELX_P7 7 THR A 152 ? ALA A 163 ? THR A 292 ALA A 303 1 ? 12 
HELX_P HELX_P8 8 ASP A 176 ? THR A 182 ? ASP A 316 THR A 322 5 ? 7  
HELX_P HELX_P9 9 ILE A 183 ? ALA A 193 ? ILE A 323 ALA A 333 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MG . MG ? ? ? 1_555 A SER 12  OG  ? ? A MG 101 A SER 152 1_555 ? ? ? ? ? ? ? 2.815 ? 
metalc2 metalc ? ? B MG . MG ? ? ? 1_555 A SER 14  OG  ? ? A MG 101 A SER 154 1_555 ? ? ? ? ? ? ? 2.408 ? 
metalc3 metalc ? ? B MG . MG ? ? ? 1_555 A ASP 113 OD1 ? ? A MG 101 A ASP 253 1_555 ? ? ? ? ? ? ? 2.644 ? 
metalc4 metalc ? ? B MG . MG ? ? ? 1_555 C HOH .   O   ? ? A MG 101 A HOH 5   1_555 ? ? ? ? ? ? ? 2.449 ? 
metalc5 metalc ? ? B MG . MG ? ? ? 1_555 C HOH .   O   ? ? A MG 101 A HOH 47  1_555 ? ? ? ? ? ? ? 2.601 ? 
metalc6 metalc ? ? B MG . MG ? ? ? 1_555 C HOH .   O   ? ? A MG 101 A HOH 48  1_555 ? ? ? ? ? ? ? 2.542 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 16  A . ? TYR 156 A PRO 17  A ? PRO 157 A 1 -0.30 
2 GLU 165 A . ? GLU 305 A PRO 166 A ? PRO 306 A 1 0.57  
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 50  ? PHE A 54  ? VAL A 190 PHE A 194 
A 2 GLN A 40  ? TYR A 46  ? GLN A 180 TYR A 186 
A 3 LEU A 3   ? ASP A 10  ? LEU A 143 ASP A 150 
A 4 LYS A 105 ? THR A 112 ? LYS A 245 THR A 252 
A 5 ILE A 134 ? ILE A 141 ? ILE A 274 ILE A 281 
A 6 PHE A 171 ? VAL A 174 ? PHE A 311 VAL A 314 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 54  ? O PHE A 194 N ILE A 43  ? N ILE A 183 
A 2 3 N GLN A 40  ? N GLN A 180 O LEU A 3   ? O LEU A 143 
A 3 4 N ASP A 4   ? N ASP A 144 O LYS A 105 ? O LYS A 245 
A 4 5 N MET A 108 ? N MET A 248 O GLN A 135 ? O GLN A 275 
A 5 6 N ALA A 140 ? N ALA A 280 O PHE A 172 ? O PHE A 312 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE MG A 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 HOH C .   ? HOH A 5   . ? 1_555 ? 
2 AC1 6 HOH C .   ? HOH A 47  . ? 1_555 ? 
3 AC1 6 HOH C .   ? HOH A 48  . ? 1_555 ? 
4 AC1 6 SER A 12  ? SER A 152 . ? 1_555 ? 
5 AC1 6 SER A 14  ? SER A 154 . ? 1_555 ? 
6 AC1 6 ASP A 113 ? ASP A 253 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QCY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QCY 
_atom_sites.fract_transf_matrix[1][1]   0.013431 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000184 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012216 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.026801 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . THR A 1 1   ? 4.667  -17.455 1.177   1.00 38.56 ? 141 THR A N   1 
ATOM   2    C  CA  . THR A 1 1   ? 5.400  -16.734 0.094   1.00 37.91 ? 141 THR A CA  1 
ATOM   3    C  C   . THR A 1 1   ? 6.889  -16.692 0.411   1.00 36.45 ? 141 THR A C   1 
ATOM   4    O  O   . THR A 1 1   ? 7.280  -16.584 1.575   1.00 34.91 ? 141 THR A O   1 
ATOM   5    C  CB  . THR A 1 1   ? 4.907  -15.286 -0.049  1.00 38.67 ? 141 THR A CB  1 
ATOM   6    O  OG1 . THR A 1 1   ? 5.353  -14.520 1.074   1.00 40.21 ? 141 THR A OG1 1 
ATOM   7    C  CG2 . THR A 1 1   ? 3.387  -15.246 -0.104  1.00 39.75 ? 141 THR A CG2 1 
ATOM   8    N  N   . GLN A 1 2   ? 7.717  -16.776 -0.626  1.00 34.61 ? 142 GLN A N   1 
ATOM   9    C  CA  . GLN A 1 2   ? 9.157  -16.744 -0.435  1.00 32.71 ? 142 GLN A CA  1 
ATOM   10   C  C   . GLN A 1 2   ? 9.665  -15.347 -0.094  1.00 30.86 ? 142 GLN A C   1 
ATOM   11   O  O   . GLN A 1 2   ? 8.881  -14.400 0.008   1.00 31.88 ? 142 GLN A O   1 
ATOM   12   C  CB  . GLN A 1 2   ? 9.861  -17.284 -1.673  1.00 33.98 ? 142 GLN A CB  1 
ATOM   13   C  CG  . GLN A 1 2   ? 9.606  -18.761 -1.892  1.00 35.73 ? 142 GLN A CG  1 
ATOM   14   C  CD  . GLN A 1 2   ? 9.794  -19.572 -0.622  1.00 37.07 ? 142 GLN A CD  1 
ATOM   15   O  OE1 . GLN A 1 2   ? 10.843 -19.510 0.021   1.00 35.57 ? 142 GLN A OE1 1 
ATOM   16   N  NE2 . GLN A 1 2   ? 8.772  -20.340 -0.253  1.00 37.43 ? 142 GLN A NE2 1 
ATOM   17   N  N   . LEU A 1 3   ? 10.976 -15.216 0.084   1.00 27.50 ? 143 LEU A N   1 
ATOM   18   C  CA  . LEU A 1 3   ? 11.549 -13.932 0.454   1.00 24.19 ? 143 LEU A CA  1 
ATOM   19   C  C   . LEU A 1 3   ? 12.869 -13.573 -0.220  1.00 23.00 ? 143 LEU A C   1 
ATOM   20   O  O   . LEU A 1 3   ? 13.786 -14.393 -0.311  1.00 20.26 ? 143 LEU A O   1 
ATOM   21   C  CB  . LEU A 1 3   ? 11.773 -13.883 1.967   1.00 23.92 ? 143 LEU A CB  1 
ATOM   22   C  CG  . LEU A 1 3   ? 10.637 -14.173 2.949   1.00 26.46 ? 143 LEU A CG  1 
ATOM   23   C  CD1 . LEU A 1 3   ? 11.226 -14.356 4.338   1.00 27.60 ? 143 LEU A CD1 1 
ATOM   24   C  CD2 . LEU A 1 3   ? 9.629  -13.044 2.949   1.00 25.81 ? 143 LEU A CD2 1 
ATOM   25   N  N   . ASP A 1 4   ? 12.945 -12.330 -0.685  1.00 21.21 ? 144 ASP A N   1 
ATOM   26   C  CA  . ASP A 1 4   ? 14.153 -11.784 -1.281  1.00 19.74 ? 144 ASP A CA  1 
ATOM   27   C  C   . ASP A 1 4   ? 14.695 -10.932 -0.140  1.00 20.28 ? 144 ASP A C   1 
ATOM   28   O  O   . ASP A 1 4   ? 14.079 -9.932  0.241   1.00 20.30 ? 144 ASP A O   1 
ATOM   29   C  CB  . ASP A 1 4   ? 13.841 -10.877 -2.480  1.00 18.71 ? 144 ASP A CB  1 
ATOM   30   C  CG  . ASP A 1 4   ? 13.585 -11.653 -3.756  1.00 19.23 ? 144 ASP A CG  1 
ATOM   31   O  OD1 . ASP A 1 4   ? 14.055 -12.805 -3.864  1.00 16.14 ? 144 ASP A OD1 1 
ATOM   32   O  OD2 . ASP A 1 4   ? 12.933 -11.097 -4.667  1.00 19.97 ? 144 ASP A OD2 1 
ATOM   33   N  N   . ILE A 1 5   ? 15.830 -11.339 0.418   1.00 19.15 ? 145 ILE A N   1 
ATOM   34   C  CA  . ILE A 1 5   ? 16.428 -10.618 1.529   1.00 16.28 ? 145 ILE A CA  1 
ATOM   35   C  C   . ILE A 1 5   ? 17.696 -9.901  1.108   1.00 17.04 ? 145 ILE A C   1 
ATOM   36   O  O   . ILE A 1 5   ? 18.585 -10.487 0.480   1.00 15.37 ? 145 ILE A O   1 
ATOM   37   C  CB  . ILE A 1 5   ? 16.789 -11.569 2.687   1.00 16.78 ? 145 ILE A CB  1 
ATOM   38   C  CG1 . ILE A 1 5   ? 15.554 -12.365 3.113   1.00 15.34 ? 145 ILE A CG1 1 
ATOM   39   C  CG2 . ILE A 1 5   ? 17.344 -10.772 3.863   1.00 14.66 ? 145 ILE A CG2 1 
ATOM   40   C  CD1 . ILE A 1 5   ? 15.796 -13.290 4.294   1.00 14.76 ? 145 ILE A CD1 1 
ATOM   41   N  N   . VAL A 1 6   ? 17.772 -8.623  1.457   1.00 15.67 ? 146 VAL A N   1 
ATOM   42   C  CA  . VAL A 1 6   ? 18.941 -7.828  1.140   1.00 15.26 ? 146 VAL A CA  1 
ATOM   43   C  C   . VAL A 1 6   ? 19.499 -7.261  2.433   1.00 14.35 ? 146 VAL A C   1 
ATOM   44   O  O   . VAL A 1 6   ? 18.833 -6.491  3.135   1.00 15.33 ? 146 VAL A O   1 
ATOM   45   C  CB  . VAL A 1 6   ? 18.612 -6.669  0.170   1.00 16.15 ? 146 VAL A CB  1 
ATOM   46   C  CG1 . VAL A 1 6   ? 19.845 -5.769  0.002   1.00 13.80 ? 146 VAL A CG1 1 
ATOM   47   C  CG2 . VAL A 1 6   ? 18.189 -7.232  -1.189  1.00 13.95 ? 146 VAL A CG2 1 
ATOM   48   N  N   . ILE A 1 7   ? 20.720 -7.672  2.750   1.00 13.84 ? 147 ILE A N   1 
ATOM   49   C  CA  . ILE A 1 7   ? 21.402 -7.220  3.947   1.00 13.25 ? 147 ILE A CA  1 
ATOM   50   C  C   . ILE A 1 7   ? 22.266 -6.030  3.546   1.00 14.34 ? 147 ILE A C   1 
ATOM   51   O  O   . ILE A 1 7   ? 23.011 -6.093  2.562   1.00 14.61 ? 147 ILE A O   1 
ATOM   52   C  CB  . ILE A 1 7   ? 22.263 -8.352  4.533   1.00 12.39 ? 147 ILE A CB  1 
ATOM   53   C  CG1 . ILE A 1 7   ? 21.375 -9.570  4.806   1.00 14.39 ? 147 ILE A CG1 1 
ATOM   54   C  CG2 . ILE A 1 7   ? 22.910 -7.906  5.831   1.00 14.17 ? 147 ILE A CG2 1 
ATOM   55   C  CD1 . ILE A 1 7   ? 22.140 -10.800 5.291   1.00 17.27 ? 147 ILE A CD1 1 
ATOM   56   N  N   . VAL A 1 8   ? 22.134 -4.940  4.295   1.00 12.91 ? 148 VAL A N   1 
ATOM   57   C  CA  . VAL A 1 8   ? 22.870 -3.713  4.031   1.00 12.98 ? 148 VAL A CA  1 
ATOM   58   C  C   . VAL A 1 8   ? 23.816 -3.500  5.203   1.00 13.36 ? 148 VAL A C   1 
ATOM   59   O  O   . VAL A 1 8   ? 23.379 -3.212  6.314   1.00 12.80 ? 148 VAL A O   1 
ATOM   60   C  CB  . VAL A 1 8   ? 21.890 -2.525  3.899   1.00 13.46 ? 148 VAL A CB  1 
ATOM   61   C  CG1 . VAL A 1 8   ? 22.631 -1.257  3.503   1.00 11.84 ? 148 VAL A CG1 1 
ATOM   62   C  CG2 . VAL A 1 8   ? 20.821 -2.862  2.865   1.00 14.33 ? 148 VAL A CG2 1 
ATOM   63   N  N   . LEU A 1 9   ? 25.112 -3.650  4.944   1.00 13.80 ? 149 LEU A N   1 
ATOM   64   C  CA  . LEU A 1 9   ? 26.129 -3.526  5.978   1.00 14.02 ? 149 LEU A CA  1 
ATOM   65   C  C   . LEU A 1 9   ? 26.974 -2.265  5.952   1.00 14.37 ? 149 LEU A C   1 
ATOM   66   O  O   . LEU A 1 9   ? 27.593 -1.933  4.942   1.00 16.25 ? 149 LEU A O   1 
ATOM   67   C  CB  . LEU A 1 9   ? 27.088 -4.720  5.916   1.00 12.22 ? 149 LEU A CB  1 
ATOM   68   C  CG  . LEU A 1 9   ? 26.539 -6.132  6.099   1.00 14.91 ? 149 LEU A CG  1 
ATOM   69   C  CD1 . LEU A 1 9   ? 27.657 -7.129  5.836   1.00 10.96 ? 149 LEU A CD1 1 
ATOM   70   C  CD2 . LEU A 1 9   ? 25.963 -6.299  7.515   1.00 11.32 ? 149 LEU A CD2 1 
ATOM   71   N  N   . ASP A 1 10  ? 26.993 -1.570  7.079   1.00 12.42 ? 150 ASP A N   1 
ATOM   72   C  CA  . ASP A 1 10  ? 27.817 -0.390  7.245   1.00 13.46 ? 150 ASP A CA  1 
ATOM   73   C  C   . ASP A 1 10  ? 29.230 -0.989  7.310   1.00 15.36 ? 150 ASP A C   1 
ATOM   74   O  O   . ASP A 1 10  ? 29.459 -1.938  8.060   1.00 14.07 ? 150 ASP A O   1 
ATOM   75   C  CB  . ASP A 1 10  ? 27.468 0.284   8.574   1.00 16.20 ? 150 ASP A CB  1 
ATOM   76   C  CG  . ASP A 1 10  ? 28.360 1.475   8.894   1.00 16.41 ? 150 ASP A CG  1 
ATOM   77   O  OD1 . ASP A 1 10  ? 29.395 1.663   8.226   1.00 17.85 ? 150 ASP A OD1 1 
ATOM   78   O  OD2 . ASP A 1 10  ? 28.024 2.220   9.836   1.00 20.20 ? 150 ASP A OD2 1 
ATOM   79   N  N   . GLY A 1 11  ? 30.168 -0.452  6.531   1.00 15.23 ? 151 GLY A N   1 
ATOM   80   C  CA  . GLY A 1 11  ? 31.521 -0.986  6.539   1.00 16.03 ? 151 GLY A CA  1 
ATOM   81   C  C   . GLY A 1 11  ? 32.564 -0.096  7.195   1.00 17.16 ? 151 GLY A C   1 
ATOM   82   O  O   . GLY A 1 11  ? 33.759 -0.381  7.128   1.00 17.17 ? 151 GLY A O   1 
ATOM   83   N  N   . SER A 1 12  ? 32.112 0.974   7.840   1.00 18.08 ? 152 SER A N   1 
ATOM   84   C  CA  . SER A 1 12  ? 33.004 1.922   8.502   1.00 20.14 ? 152 SER A CA  1 
ATOM   85   C  C   . SER A 1 12  ? 34.040 1.253   9.400   1.00 20.19 ? 152 SER A C   1 
ATOM   86   O  O   . SER A 1 12  ? 33.783 0.217   10.014  1.00 18.10 ? 152 SER A O   1 
ATOM   87   C  CB  . SER A 1 12  ? 32.189 2.926   9.312   1.00 19.79 ? 152 SER A CB  1 
ATOM   88   O  OG  . SER A 1 12  ? 31.308 2.248   10.181  1.00 28.13 ? 152 SER A OG  1 
ATOM   89   N  N   . ASN A 1 13  ? 35.209 1.880   9.472   1.00 19.57 ? 153 ASN A N   1 
ATOM   90   C  CA  . ASN A 1 13  ? 36.332 1.385   10.254  1.00 20.73 ? 153 ASN A CA  1 
ATOM   91   C  C   . ASN A 1 13  ? 36.112 1.268   11.756  1.00 19.48 ? 153 ASN A C   1 
ATOM   92   O  O   . ASN A 1 13  ? 36.779 0.474   12.418  1.00 19.04 ? 153 ASN A O   1 
ATOM   93   C  CB  . ASN A 1 13  ? 37.552 2.263   9.989   1.00 22.20 ? 153 ASN A CB  1 
ATOM   94   C  CG  . ASN A 1 13  ? 37.819 2.438   8.516   1.00 25.80 ? 153 ASN A CG  1 
ATOM   95   O  OD1 . ASN A 1 13  ? 37.425 3.440   7.913   1.00 27.76 ? 153 ASN A OD1 1 
ATOM   96   N  ND2 . ASN A 1 13  ? 38.467 1.447   7.915   1.00 26.62 ? 153 ASN A ND2 1 
ATOM   97   N  N   . SER A 1 14  ? 35.193 2.054   12.304  1.00 17.77 ? 154 SER A N   1 
ATOM   98   C  CA  . SER A 1 14  ? 34.937 1.989   13.737  1.00 17.48 ? 154 SER A CA  1 
ATOM   99   C  C   . SER A 1 14  ? 34.388 0.616   14.159  1.00 15.17 ? 154 SER A C   1 
ATOM   100  O  O   . SER A 1 14  ? 34.509 0.224   15.321  1.00 15.19 ? 154 SER A O   1 
ATOM   101  C  CB  . SER A 1 14  ? 33.960 3.096   14.146  1.00 15.49 ? 154 SER A CB  1 
ATOM   102  O  OG  . SER A 1 14  ? 32.731 2.958   13.456  1.00 19.97 ? 154 SER A OG  1 
ATOM   103  N  N   . ILE A 1 15  ? 33.791 -0.114  13.217  1.00 14.72 ? 155 ILE A N   1 
ATOM   104  C  CA  . ILE A 1 15  ? 33.235 -1.440  13.518  1.00 13.31 ? 155 ILE A CA  1 
ATOM   105  C  C   . ILE A 1 15  ? 34.368 -2.454  13.608  1.00 15.00 ? 155 ILE A C   1 
ATOM   106  O  O   . ILE A 1 15  ? 35.033 -2.744  12.610  1.00 13.57 ? 155 ILE A O   1 
ATOM   107  C  CB  . ILE A 1 15  ? 32.242 -1.896  12.442  1.00 11.17 ? 155 ILE A CB  1 
ATOM   108  C  CG1 . ILE A 1 15  ? 31.056 -0.922  12.390  1.00 14.03 ? 155 ILE A CG1 1 
ATOM   109  C  CG2 . ILE A 1 15  ? 31.779 -3.319  12.741  1.00 11.64 ? 155 ILE A CG2 1 
ATOM   110  C  CD1 . ILE A 1 15  ? 30.078 -1.169  11.254  1.00 11.19 ? 155 ILE A CD1 1 
ATOM   111  N  N   . TYR A 1 16  ? 34.565 -2.998  14.806  1.00 13.33 ? 156 TYR A N   1 
ATOM   112  C  CA  . TYR A 1 16  ? 35.642 -3.948  15.066  1.00 14.38 ? 156 TYR A CA  1 
ATOM   113  C  C   . TYR A 1 16  ? 35.223 -4.987  16.102  1.00 14.64 ? 156 TYR A C   1 
ATOM   114  O  O   . TYR A 1 16  ? 34.591 -4.653  17.111  1.00 14.54 ? 156 TYR A O   1 
ATOM   115  C  CB  . TYR A 1 16  ? 36.857 -3.183  15.599  1.00 15.52 ? 156 TYR A CB  1 
ATOM   116  C  CG  . TYR A 1 16  ? 38.113 -4.004  15.760  1.00 17.15 ? 156 TYR A CG  1 
ATOM   117  C  CD1 . TYR A 1 16  ? 38.911 -4.310  14.659  1.00 14.38 ? 156 TYR A CD1 1 
ATOM   118  C  CD2 . TYR A 1 16  ? 38.517 -4.456  17.015  1.00 14.36 ? 156 TYR A CD2 1 
ATOM   119  C  CE1 . TYR A 1 16  ? 40.076 -5.040  14.802  1.00 14.37 ? 156 TYR A CE1 1 
ATOM   120  C  CE2 . TYR A 1 16  ? 39.686 -5.191  17.168  1.00 16.09 ? 156 TYR A CE2 1 
ATOM   121  C  CZ  . TYR A 1 16  ? 40.461 -5.477  16.056  1.00 16.30 ? 156 TYR A CZ  1 
ATOM   122  O  OH  . TYR A 1 16  ? 41.628 -6.194  16.198  1.00 17.53 ? 156 TYR A OH  1 
ATOM   123  N  N   . PRO A 1 17  ? 35.572 -6.265  15.878  1.00 13.90 ? 157 PRO A N   1 
ATOM   124  C  CA  . PRO A 1 17  ? 36.316 -6.818  14.741  1.00 11.65 ? 157 PRO A CA  1 
ATOM   125  C  C   . PRO A 1 17  ? 35.344 -7.277  13.655  1.00 12.64 ? 157 PRO A C   1 
ATOM   126  O  O   . PRO A 1 17  ? 34.246 -7.744  13.959  1.00 12.23 ? 157 PRO A O   1 
ATOM   127  C  CB  . PRO A 1 17  ? 37.058 -7.980  15.370  1.00 12.59 ? 157 PRO A CB  1 
ATOM   128  C  CG  . PRO A 1 17  ? 36.015 -8.524  16.326  1.00 12.21 ? 157 PRO A CG  1 
ATOM   129  C  CD  . PRO A 1 17  ? 35.436 -7.268  16.954  1.00 12.81 ? 157 PRO A CD  1 
ATOM   130  N  N   . TRP A 1 18  ? 35.754 -7.149  12.397  1.00 14.25 ? 158 TRP A N   1 
ATOM   131  C  CA  . TRP A 1 18  ? 34.913 -7.530  11.271  1.00 15.63 ? 158 TRP A CA  1 
ATOM   132  C  C   . TRP A 1 18  ? 34.456 -8.983  11.354  1.00 17.98 ? 158 TRP A C   1 
ATOM   133  O  O   . TRP A 1 18  ? 33.426 -9.344  10.782  1.00 19.27 ? 158 TRP A O   1 
ATOM   134  C  CB  . TRP A 1 18  ? 35.643 -7.276  9.946   1.00 14.62 ? 158 TRP A CB  1 
ATOM   135  C  CG  . TRP A 1 18  ? 34.752 -7.381  8.746   1.00 13.77 ? 158 TRP A CG  1 
ATOM   136  C  CD1 . TRP A 1 18  ? 34.814 -8.319  7.757   1.00 15.18 ? 158 TRP A CD1 1 
ATOM   137  C  CD2 . TRP A 1 18  ? 33.649 -6.529  8.423   1.00 13.33 ? 158 TRP A CD2 1 
ATOM   138  N  NE1 . TRP A 1 18  ? 33.815 -8.104  6.832   1.00 13.49 ? 158 TRP A NE1 1 
ATOM   139  C  CE2 . TRP A 1 18  ? 33.084 -7.008  7.220   1.00 13.42 ? 158 TRP A CE2 1 
ATOM   140  C  CE3 . TRP A 1 18  ? 33.079 -5.402  9.034   1.00 13.06 ? 158 TRP A CE3 1 
ATOM   141  C  CZ2 . TRP A 1 18  ? 31.980 -6.402  6.615   1.00 12.82 ? 158 TRP A CZ2 1 
ATOM   142  C  CZ3 . TRP A 1 18  ? 31.981 -4.797  8.431   1.00 13.27 ? 158 TRP A CZ3 1 
ATOM   143  C  CH2 . TRP A 1 18  ? 31.444 -5.299  7.234   1.00 12.72 ? 158 TRP A CH2 1 
ATOM   144  N  N   . ASP A 1 19  ? 35.215 -9.813  12.068  1.00 20.17 ? 159 ASP A N   1 
ATOM   145  C  CA  . ASP A 1 19  ? 34.854 -11.221 12.234  1.00 21.17 ? 159 ASP A CA  1 
ATOM   146  C  C   . ASP A 1 19  ? 33.488 -11.363 12.902  1.00 18.65 ? 159 ASP A C   1 
ATOM   147  O  O   . ASP A 1 19  ? 32.794 -12.353 12.693  1.00 17.19 ? 159 ASP A O   1 
ATOM   148  C  CB  . ASP A 1 19  ? 35.894 -11.959 13.085  1.00 25.35 ? 159 ASP A CB  1 
ATOM   149  C  CG  . ASP A 1 19  ? 37.207 -12.146 12.364  1.00 34.04 ? 159 ASP A CG  1 
ATOM   150  O  OD1 . ASP A 1 19  ? 37.176 -12.443 11.146  1.00 35.98 ? 159 ASP A OD1 1 
ATOM   151  O  OD2 . ASP A 1 19  ? 38.269 -12.010 13.016  1.00 38.19 ? 159 ASP A OD2 1 
ATOM   152  N  N   . SER A 1 20  ? 33.120 -10.381 13.720  1.00 16.38 ? 160 SER A N   1 
ATOM   153  C  CA  . SER A 1 20  ? 31.832 -10.402 14.412  1.00 16.69 ? 160 SER A CA  1 
ATOM   154  C  C   . SER A 1 20  ? 30.694 -10.243 13.421  1.00 14.16 ? 160 SER A C   1 
ATOM   155  O  O   . SER A 1 20  ? 29.643 -10.855 13.566  1.00 14.24 ? 160 SER A O   1 
ATOM   156  C  CB  . SER A 1 20  ? 31.757 -9.280  15.445  1.00 17.31 ? 160 SER A CB  1 
ATOM   157  O  OG  . SER A 1 20  ? 32.427 -9.668  16.625  1.00 19.66 ? 160 SER A OG  1 
ATOM   158  N  N   . VAL A 1 21  ? 30.916 -9.417  12.410  1.00 13.70 ? 161 VAL A N   1 
ATOM   159  C  CA  . VAL A 1 21  ? 29.910 -9.198  11.389  1.00 12.28 ? 161 VAL A CA  1 
ATOM   160  C  C   . VAL A 1 21  ? 29.765 -10.433 10.505  1.00 13.33 ? 161 VAL A C   1 
ATOM   161  O  O   . VAL A 1 21  ? 28.646 -10.868 10.221  1.00 14.29 ? 161 VAL A O   1 
ATOM   162  C  CB  . VAL A 1 21  ? 30.267 -7.989  10.520  1.00 12.46 ? 161 VAL A CB  1 
ATOM   163  C  CG1 . VAL A 1 21  ? 29.324 -7.907  9.331   1.00 11.12 ? 161 VAL A CG1 1 
ATOM   164  C  CG2 . VAL A 1 21  ? 30.204 -6.719  11.366  1.00 8.20  ? 161 VAL A CG2 1 
ATOM   165  N  N   . THR A 1 22  ? 30.877 -11.012 10.065  1.00 12.50 ? 162 THR A N   1 
ATOM   166  C  CA  . THR A 1 22  ? 30.752 -12.197 9.225   1.00 14.79 ? 162 THR A CA  1 
ATOM   167  C  C   . THR A 1 22  ? 30.209 -13.385 10.029  1.00 14.87 ? 162 THR A C   1 
ATOM   168  O  O   . THR A 1 22  ? 29.506 -14.227 9.483   1.00 15.27 ? 162 THR A O   1 
ATOM   169  C  CB  . THR A 1 22  ? 32.087 -12.574 8.538   1.00 13.14 ? 162 THR A CB  1 
ATOM   170  O  OG1 . THR A 1 22  ? 33.131 -12.681 9.512   1.00 14.71 ? 162 THR A OG1 1 
ATOM   171  C  CG2 . THR A 1 22  ? 32.460 -11.514 7.499   1.00 15.18 ? 162 THR A CG2 1 
ATOM   172  N  N   . ALA A 1 23  ? 30.512 -13.444 11.324  1.00 14.22 ? 163 ALA A N   1 
ATOM   173  C  CA  . ALA A 1 23  ? 30.004 -14.538 12.155  1.00 15.98 ? 163 ALA A CA  1 
ATOM   174  C  C   . ALA A 1 23  ? 28.486 -14.379 12.249  1.00 14.84 ? 163 ALA A C   1 
ATOM   175  O  O   . ALA A 1 23  ? 27.735 -15.356 12.234  1.00 14.42 ? 163 ALA A O   1 
ATOM   176  C  CB  . ALA A 1 23  ? 30.627 -14.487 13.549  1.00 14.67 ? 163 ALA A CB  1 
ATOM   177  N  N   . PHE A 1 24  ? 28.051 -13.128 12.339  1.00 14.90 ? 164 PHE A N   1 
ATOM   178  C  CA  . PHE A 1 24  ? 26.634 -12.794 12.416  1.00 14.42 ? 164 PHE A CA  1 
ATOM   179  C  C   . PHE A 1 24  ? 25.940 -13.236 11.119  1.00 14.82 ? 164 PHE A C   1 
ATOM   180  O  O   . PHE A 1 24  ? 24.880 -13.853 11.156  1.00 16.23 ? 164 PHE A O   1 
ATOM   181  C  CB  . PHE A 1 24  ? 26.485 -11.282 12.631  1.00 11.64 ? 164 PHE A CB  1 
ATOM   182  C  CG  . PHE A 1 24  ? 25.128 -10.737 12.271  1.00 12.39 ? 164 PHE A CG  1 
ATOM   183  C  CD1 . PHE A 1 24  ? 24.030 -10.940 13.103  1.00 13.48 ? 164 PHE A CD1 1 
ATOM   184  C  CD2 . PHE A 1 24  ? 24.951 -10.027 11.090  1.00 11.98 ? 164 PHE A CD2 1 
ATOM   185  C  CE1 . PHE A 1 24  ? 22.770 -10.444 12.765  1.00 14.08 ? 164 PHE A CE1 1 
ATOM   186  C  CE2 . PHE A 1 24  ? 23.694 -9.524  10.738  1.00 17.63 ? 164 PHE A CE2 1 
ATOM   187  C  CZ  . PHE A 1 24  ? 22.597 -9.735  11.581  1.00 14.61 ? 164 PHE A CZ  1 
ATOM   188  N  N   . LEU A 1 25  ? 26.546 -12.920 9.978   1.00 14.99 ? 165 LEU A N   1 
ATOM   189  C  CA  . LEU A 1 25  ? 25.997 -13.297 8.678   1.00 17.08 ? 165 LEU A CA  1 
ATOM   190  C  C   . LEU A 1 25  ? 25.915 -14.819 8.544   1.00 18.21 ? 165 LEU A C   1 
ATOM   191  O  O   . LEU A 1 25  ? 24.903 -15.356 8.101   1.00 17.27 ? 165 LEU A O   1 
ATOM   192  C  CB  . LEU A 1 25  ? 26.880 -12.749 7.552   1.00 18.04 ? 165 LEU A CB  1 
ATOM   193  C  CG  . LEU A 1 25  ? 26.600 -11.395 6.895   1.00 18.40 ? 165 LEU A CG  1 
ATOM   194  C  CD1 . LEU A 1 25  ? 25.835 -10.464 7.814   1.00 20.76 ? 165 LEU A CD1 1 
ATOM   195  C  CD2 . LEU A 1 25  ? 27.933 -10.786 6.490   1.00 17.80 ? 165 LEU A CD2 1 
ATOM   196  N  N   . ASN A 1 26  ? 26.992 -15.504 8.920   1.00 17.65 ? 166 ASN A N   1 
ATOM   197  C  CA  . ASN A 1 26  ? 27.045 -16.965 8.840   1.00 19.50 ? 166 ASN A CA  1 
ATOM   198  C  C   . ASN A 1 26  ? 25.927 -17.620 9.649   1.00 20.17 ? 166 ASN A C   1 
ATOM   199  O  O   . ASN A 1 26  ? 25.218 -18.497 9.156   1.00 19.96 ? 166 ASN A O   1 
ATOM   200  C  CB  . ASN A 1 26  ? 28.395 -17.475 9.353   1.00 20.82 ? 166 ASN A CB  1 
ATOM   201  C  CG  . ASN A 1 26  ? 28.518 -18.987 9.270   1.00 20.04 ? 166 ASN A CG  1 
ATOM   202  O  OD1 . ASN A 1 26  ? 28.663 -19.546 8.189   1.00 22.00 ? 166 ASN A OD1 1 
ATOM   203  N  ND2 . ASN A 1 26  ? 28.448 -19.654 10.417  1.00 21.45 ? 166 ASN A ND2 1 
ATOM   204  N  N   . ASP A 1 27  ? 25.782 -17.193 10.898  1.00 20.70 ? 167 ASP A N   1 
ATOM   205  C  CA  . ASP A 1 27  ? 24.760 -17.744 11.774  1.00 20.23 ? 167 ASP A CA  1 
ATOM   206  C  C   . ASP A 1 27  ? 23.353 -17.446 11.265  1.00 20.55 ? 167 ASP A C   1 
ATOM   207  O  O   . ASP A 1 27  ? 22.490 -18.320 11.277  1.00 18.94 ? 167 ASP A O   1 
ATOM   208  C  CB  . ASP A 1 27  ? 24.949 -17.203 13.189  1.00 20.88 ? 167 ASP A CB  1 
ATOM   209  C  CG  . ASP A 1 27  ? 26.232 -17.711 13.841  1.00 21.93 ? 167 ASP A CG  1 
ATOM   210  O  OD1 . ASP A 1 27  ? 27.171 -18.098 13.114  1.00 23.73 ? 167 ASP A OD1 1 
ATOM   211  O  OD2 . ASP A 1 27  ? 26.311 -17.714 15.083  1.00 23.94 ? 167 ASP A OD2 1 
ATOM   212  N  N   . LEU A 1 28  ? 23.112 -16.223 10.804  1.00 20.69 ? 168 LEU A N   1 
ATOM   213  C  CA  . LEU A 1 28  ? 21.780 -15.896 10.301  1.00 19.87 ? 168 LEU A CA  1 
ATOM   214  C  C   . LEU A 1 28  ? 21.450 -16.667 9.031   1.00 20.44 ? 168 LEU A C   1 
ATOM   215  O  O   . LEU A 1 28  ? 20.328 -17.143 8.858   1.00 19.10 ? 168 LEU A O   1 
ATOM   216  C  CB  . LEU A 1 28  ? 21.651 -14.404 9.998   1.00 17.32 ? 168 LEU A CB  1 
ATOM   217  C  CG  . LEU A 1 28  ? 20.267 -13.982 9.483   1.00 17.56 ? 168 LEU A CG  1 
ATOM   218  C  CD1 . LEU A 1 28  ? 19.229 -14.161 10.588  1.00 16.71 ? 168 LEU A CD1 1 
ATOM   219  C  CD2 . LEU A 1 28  ? 20.299 -12.529 9.042   1.00 18.58 ? 168 LEU A CD2 1 
ATOM   220  N  N   . LEU A 1 29  ? 22.435 -16.797 8.149   1.00 20.31 ? 169 LEU A N   1 
ATOM   221  C  CA  . LEU A 1 29  ? 22.223 -17.465 6.875   1.00 22.57 ? 169 LEU A CA  1 
ATOM   222  C  C   . LEU A 1 29  ? 22.173 -18.997 6.870   1.00 24.33 ? 169 LEU A C   1 
ATOM   223  O  O   . LEU A 1 29  ? 21.353 -19.586 6.157   1.00 25.03 ? 169 LEU A O   1 
ATOM   224  C  CB  . LEU A 1 29  ? 23.273 -16.975 5.872   1.00 19.66 ? 169 LEU A CB  1 
ATOM   225  C  CG  . LEU A 1 29  ? 23.352 -15.454 5.691   1.00 18.61 ? 169 LEU A CG  1 
ATOM   226  C  CD1 . LEU A 1 29  ? 24.413 -15.136 4.673   1.00 15.40 ? 169 LEU A CD1 1 
ATOM   227  C  CD2 . LEU A 1 29  ? 22.005 -14.882 5.248   1.00 18.54 ? 169 LEU A CD2 1 
ATOM   228  N  N   . LYS A 1 30  ? 23.018 -19.647 7.662   1.00 26.06 ? 170 LYS A N   1 
ATOM   229  C  CA  . LYS A 1 30  ? 23.045 -21.108 7.664   1.00 28.75 ? 170 LYS A CA  1 
ATOM   230  C  C   . LYS A 1 30  ? 21.712 -21.779 7.997   1.00 30.53 ? 170 LYS A C   1 
ATOM   231  O  O   . LYS A 1 30  ? 21.516 -22.960 7.708   1.00 29.83 ? 170 LYS A O   1 
ATOM   232  C  CB  . LYS A 1 30  ? 24.133 -21.625 8.608   1.00 28.73 ? 170 LYS A CB  1 
ATOM   233  C  CG  . LYS A 1 30  ? 23.887 -21.369 10.079  1.00 30.46 ? 170 LYS A CG  1 
ATOM   234  C  CD  . LYS A 1 30  ? 25.036 -21.920 10.908  1.00 29.99 ? 170 LYS A CD  1 
ATOM   235  C  CE  . LYS A 1 30  ? 24.903 -21.503 12.359  1.00 32.51 ? 170 LYS A CE  1 
ATOM   236  N  NZ  . LYS A 1 30  ? 26.086 -21.923 13.171  1.00 36.26 ? 170 LYS A NZ  1 
ATOM   237  N  N   . ARG A 1 31  ? 20.792 -21.034 8.592   1.00 31.67 ? 171 ARG A N   1 
ATOM   238  C  CA  . ARG A 1 31  ? 19.499 -21.605 8.933   1.00 34.35 ? 171 ARG A CA  1 
ATOM   239  C  C   . ARG A 1 31  ? 18.422 -21.186 7.938   1.00 34.97 ? 171 ARG A C   1 
ATOM   240  O  O   . ARG A 1 31  ? 17.278 -20.922 8.313   1.00 35.59 ? 171 ARG A O   1 
ATOM   241  C  CB  . ARG A 1 31  ? 19.098 -21.187 10.346  1.00 37.77 ? 171 ARG A CB  1 
ATOM   242  C  CG  . ARG A 1 31  ? 20.012 -21.730 11.431  1.00 41.86 ? 171 ARG A CG  1 
ATOM   243  C  CD  . ARG A 1 31  ? 19.437 -21.434 12.794  1.00 46.34 ? 171 ARG A CD  1 
ATOM   244  N  NE  . ARG A 1 31  ? 19.180 -20.008 12.954  1.00 50.18 ? 171 ARG A NE  1 
ATOM   245  C  CZ  . ARG A 1 31  ? 18.491 -19.482 13.960  1.00 53.21 ? 171 ARG A CZ  1 
ATOM   246  N  NH1 . ARG A 1 31  ? 17.985 -20.266 14.905  1.00 54.40 ? 171 ARG A NH1 1 
ATOM   247  N  NH2 . ARG A 1 31  ? 18.301 -18.171 14.016  1.00 54.62 ? 171 ARG A NH2 1 
ATOM   248  N  N   . MET A 1 32  ? 18.795 -21.128 6.664   1.00 32.77 ? 172 MET A N   1 
ATOM   249  C  CA  . MET A 1 32  ? 17.864 -20.739 5.613   1.00 31.11 ? 172 MET A CA  1 
ATOM   250  C  C   . MET A 1 32  ? 17.971 -21.692 4.438   1.00 29.33 ? 172 MET A C   1 
ATOM   251  O  O   . MET A 1 32  ? 19.016 -22.301 4.215   1.00 26.59 ? 172 MET A O   1 
ATOM   252  C  CB  . MET A 1 32  ? 18.166 -19.317 5.112   1.00 31.25 ? 172 MET A CB  1 
ATOM   253  C  CG  . MET A 1 32  ? 17.769 -18.176 6.049   1.00 31.37 ? 172 MET A CG  1 
ATOM   254  S  SD  . MET A 1 32  ? 18.055 -16.541 5.277   1.00 31.63 ? 172 MET A SD  1 
ATOM   255  C  CE  . MET A 1 32  ? 18.642 -15.573 6.684   1.00 30.83 ? 172 MET A CE  1 
ATOM   256  N  N   . ASP A 1 33  ? 16.880 -21.828 3.692   1.00 28.58 ? 173 ASP A N   1 
ATOM   257  C  CA  . ASP A 1 33  ? 16.891 -22.669 2.509   1.00 29.24 ? 173 ASP A CA  1 
ATOM   258  C  C   . ASP A 1 33  ? 16.967 -21.705 1.326   1.00 27.96 ? 173 ASP A C   1 
ATOM   259  O  O   . ASP A 1 33  ? 15.951 -21.195 0.857   1.00 28.76 ? 173 ASP A O   1 
ATOM   260  C  CB  . ASP A 1 33  ? 15.625 -23.530 2.435   1.00 30.22 ? 173 ASP A CB  1 
ATOM   261  C  CG  . ASP A 1 33  ? 15.602 -24.425 1.207   1.00 31.68 ? 173 ASP A CG  1 
ATOM   262  O  OD1 . ASP A 1 33  ? 16.687 -24.875 0.778   1.00 32.71 ? 173 ASP A OD1 1 
ATOM   263  O  OD2 . ASP A 1 33  ? 14.502 -24.688 0.675   1.00 32.80 ? 173 ASP A OD2 1 
ATOM   264  N  N   . ILE A 1 34  ? 18.187 -21.448 0.864   1.00 26.81 ? 174 ILE A N   1 
ATOM   265  C  CA  . ILE A 1 34  ? 18.424 -20.524 -0.240  1.00 25.28 ? 174 ILE A CA  1 
ATOM   266  C  C   . ILE A 1 34  ? 18.229 -21.183 -1.600  1.00 26.54 ? 174 ILE A C   1 
ATOM   267  O  O   . ILE A 1 34  ? 18.769 -22.258 -1.859  1.00 27.29 ? 174 ILE A O   1 
ATOM   268  C  CB  . ILE A 1 34  ? 19.863 -19.962 -0.190  1.00 23.95 ? 174 ILE A CB  1 
ATOM   269  C  CG1 . ILE A 1 34  ? 20.209 -19.515 1.235   1.00 23.52 ? 174 ILE A CG1 1 
ATOM   270  C  CG2 . ILE A 1 34  ? 20.006 -18.818 -1.171  1.00 20.78 ? 174 ILE A CG2 1 
ATOM   271  C  CD1 . ILE A 1 34  ? 19.349 -18.412 1.770   1.00 25.05 ? 174 ILE A CD1 1 
ATOM   272  N  N   . GLY A 1 35  ? 17.470 -20.522 -2.470  1.00 26.83 ? 175 GLY A N   1 
ATOM   273  C  CA  . GLY A 1 35  ? 17.225 -21.053 -3.801  1.00 27.52 ? 175 GLY A CA  1 
ATOM   274  C  C   . GLY A 1 35  ? 16.318 -20.160 -4.633  1.00 27.18 ? 175 GLY A C   1 
ATOM   275  O  O   . GLY A 1 35  ? 15.543 -19.389 -4.075  1.00 27.52 ? 175 GLY A O   1 
ATOM   276  N  N   . PRO A 1 36  ? 16.379 -20.252 -5.973  1.00 29.58 ? 176 PRO A N   1 
ATOM   277  C  CA  . PRO A 1 36  ? 15.548 -19.434 -6.869  1.00 30.65 ? 176 PRO A CA  1 
ATOM   278  C  C   . PRO A 1 36  ? 14.055 -19.557 -6.564  1.00 31.98 ? 176 PRO A C   1 
ATOM   279  O  O   . PRO A 1 36  ? 13.279 -18.634 -6.816  1.00 33.03 ? 176 PRO A O   1 
ATOM   280  C  CB  . PRO A 1 36  ? 15.881 -19.984 -8.256  1.00 32.06 ? 176 PRO A CB  1 
ATOM   281  C  CG  . PRO A 1 36  ? 17.264 -20.561 -8.085  1.00 32.39 ? 176 PRO A CG  1 
ATOM   282  C  CD  . PRO A 1 36  ? 17.177 -21.223 -6.742  1.00 28.59 ? 176 PRO A CD  1 
ATOM   283  N  N   . LYS A 1 37  ? 13.657 -20.702 -6.024  1.00 32.06 ? 177 LYS A N   1 
ATOM   284  C  CA  . LYS A 1 37  ? 12.256 -20.934 -5.702  1.00 33.02 ? 177 LYS A CA  1 
ATOM   285  C  C   . LYS A 1 37  ? 12.058 -20.875 -4.197  1.00 31.85 ? 177 LYS A C   1 
ATOM   286  O  O   . LYS A 1 37  ? 10.946 -21.006 -3.695  1.00 32.20 ? 177 LYS A O   1 
ATOM   287  C  CB  . LYS A 1 37  ? 11.820 -22.292 -6.262  1.00 33.54 ? 177 LYS A CB  1 
ATOM   288  C  CG  . LYS A 1 37  ? 12.087 -22.409 -7.763  1.00 38.00 ? 177 LYS A CG  1 
ATOM   289  C  CD  . LYS A 1 37  ? 11.972 -23.838 -8.295  1.00 41.90 ? 177 LYS A CD  1 
ATOM   290  C  CE  . LYS A 1 37  ? 10.529 -24.292 -8.417  1.00 43.42 ? 177 LYS A CE  1 
ATOM   291  N  NZ  . LYS A 1 37  ? 10.423 -25.628 -9.074  1.00 45.47 ? 177 LYS A NZ  1 
ATOM   292  N  N   . GLN A 1 38  ? 13.153 -20.659 -3.480  1.00 31.69 ? 178 GLN A N   1 
ATOM   293  C  CA  . GLN A 1 38  ? 13.105 -20.576 -2.029  1.00 30.61 ? 178 GLN A CA  1 
ATOM   294  C  C   . GLN A 1 38  ? 13.485 -19.172 -1.578  1.00 29.44 ? 178 GLN A C   1 
ATOM   295  O  O   . GLN A 1 38  ? 12.988 -18.185 -2.118  1.00 27.05 ? 178 GLN A O   1 
ATOM   296  C  CB  . GLN A 1 38  ? 14.055 -21.610 -1.419  1.00 33.53 ? 178 GLN A CB  1 
ATOM   297  C  CG  . GLN A 1 38  ? 13.628 -23.058 -1.653  1.00 35.54 ? 178 GLN A CG  1 
ATOM   298  C  CD  . GLN A 1 38  ? 13.536 -23.410 -3.124  1.00 39.67 ? 178 GLN A CD  1 
ATOM   299  O  OE1 . GLN A 1 38  ? 14.505 -23.260 -3.872  1.00 41.71 ? 178 GLN A OE1 1 
ATOM   300  N  NE2 . GLN A 1 38  ? 12.368 -23.878 -3.550  1.00 40.59 ? 178 GLN A NE2 1 
ATOM   301  N  N   . THR A 1 39  ? 14.351 -19.076 -0.575  1.00 27.77 ? 179 THR A N   1 
ATOM   302  C  CA  . THR A 1 39  ? 14.780 -17.773 -0.102  1.00 24.35 ? 179 THR A CA  1 
ATOM   303  C  C   . THR A 1 39  ? 15.977 -17.327 -0.929  1.00 23.88 ? 179 THR A C   1 
ATOM   304  O  O   . THR A 1 39  ? 16.804 -18.148 -1.336  1.00 23.44 ? 179 THR A O   1 
ATOM   305  C  CB  . THR A 1 39  ? 15.217 -17.805 1.381   1.00 25.03 ? 179 THR A CB  1 
ATOM   306  O  OG1 . THR A 1 39  ? 14.103 -18.157 2.209   1.00 22.40 ? 179 THR A OG1 1 
ATOM   307  C  CG2 . THR A 1 39  ? 15.734 -16.434 1.811   1.00 25.24 ? 179 THR A CG2 1 
ATOM   308  N  N   . GLN A 1 40  ? 16.047 -16.031 -1.205  1.00 21.55 ? 180 GLN A N   1 
ATOM   309  C  CA  . GLN A 1 40  ? 17.177 -15.479 -1.934  1.00 21.23 ? 180 GLN A CA  1 
ATOM   310  C  C   . GLN A 1 40  ? 17.810 -14.408 -1.063  1.00 20.16 ? 180 GLN A C   1 
ATOM   311  O  O   . GLN A 1 40  ? 17.121 -13.657 -0.367  1.00 18.16 ? 180 GLN A O   1 
ATOM   312  C  CB  . GLN A 1 40  ? 16.755 -14.866 -3.268  1.00 20.88 ? 180 GLN A CB  1 
ATOM   313  C  CG  . GLN A 1 40  ? 16.517 -15.870 -4.379  1.00 20.49 ? 180 GLN A CG  1 
ATOM   314  C  CD  . GLN A 1 40  ? 16.566 -15.214 -5.734  1.00 21.31 ? 180 GLN A CD  1 
ATOM   315  O  OE1 . GLN A 1 40  ? 16.012 -14.132 -5.930  1.00 22.45 ? 180 GLN A OE1 1 
ATOM   316  N  NE2 . GLN A 1 40  ? 17.232 -15.862 -6.684  1.00 20.67 ? 180 GLN A NE2 1 
ATOM   317  N  N   . VAL A 1 41  ? 19.131 -14.351 -1.089  1.00 19.20 ? 181 VAL A N   1 
ATOM   318  C  CA  . VAL A 1 41  ? 19.844 -13.365 -0.303  1.00 17.16 ? 181 VAL A CA  1 
ATOM   319  C  C   . VAL A 1 41  ? 20.782 -12.570 -1.187  1.00 15.54 ? 181 VAL A C   1 
ATOM   320  O  O   . VAL A 1 41  ? 21.408 -13.107 -2.100  1.00 15.62 ? 181 VAL A O   1 
ATOM   321  C  CB  . VAL A 1 41  ? 20.667 -14.023 0.828   1.00 13.42 ? 181 VAL A CB  1 
ATOM   322  C  CG1 . VAL A 1 41  ? 21.501 -12.974 1.550   1.00 15.94 ? 181 VAL A CG1 1 
ATOM   323  C  CG2 . VAL A 1 41  ? 19.745 -14.699 1.817   1.00 18.01 ? 181 VAL A CG2 1 
ATOM   324  N  N   . GLY A 1 42  ? 20.848 -11.278 -0.904  1.00 16.16 ? 182 GLY A N   1 
ATOM   325  C  CA  . GLY A 1 42  ? 21.730 -10.373 -1.612  1.00 14.70 ? 182 GLY A CA  1 
ATOM   326  C  C   . GLY A 1 42  ? 22.367 -9.534  -0.518  1.00 15.12 ? 182 GLY A C   1 
ATOM   327  O  O   . GLY A 1 42  ? 21.719 -9.252  0.495   1.00 15.47 ? 182 GLY A O   1 
ATOM   328  N  N   . ILE A 1 43  ? 23.629 -9.154  -0.690  1.00 14.55 ? 183 ILE A N   1 
ATOM   329  C  CA  . ILE A 1 43  ? 24.297 -8.342  0.307   1.00 15.67 ? 183 ILE A CA  1 
ATOM   330  C  C   . ILE A 1 43  ? 24.964 -7.104  -0.295  1.00 15.15 ? 183 ILE A C   1 
ATOM   331  O  O   . ILE A 1 43  ? 25.640 -7.176  -1.319  1.00 15.96 ? 183 ILE A O   1 
ATOM   332  C  CB  . ILE A 1 43  ? 25.346 -9.156  1.086   1.00 16.10 ? 183 ILE A CB  1 
ATOM   333  C  CG1 . ILE A 1 43  ? 24.652 -10.284 1.858   1.00 15.50 ? 183 ILE A CG1 1 
ATOM   334  C  CG2 . ILE A 1 43  ? 26.113 -8.234  2.028   1.00 14.65 ? 183 ILE A CG2 1 
ATOM   335  C  CD1 . ILE A 1 43  ? 25.576 -11.145 2.692   1.00 16.67 ? 183 ILE A CD1 1 
ATOM   336  N  N   . VAL A 1 44  ? 24.740 -5.971  0.361   1.00 14.00 ? 184 VAL A N   1 
ATOM   337  C  CA  . VAL A 1 44  ? 25.287 -4.683  -0.037  1.00 15.49 ? 184 VAL A CA  1 
ATOM   338  C  C   . VAL A 1 44  ? 26.081 -4.090  1.127   1.00 15.01 ? 184 VAL A C   1 
ATOM   339  O  O   . VAL A 1 44  ? 25.620 -4.117  2.267   1.00 15.60 ? 184 VAL A O   1 
ATOM   340  C  CB  . VAL A 1 44  ? 24.158 -3.691  -0.382  1.00 17.20 ? 184 VAL A CB  1 
ATOM   341  C  CG1 . VAL A 1 44  ? 24.723 -2.299  -0.539  1.00 17.48 ? 184 VAL A CG1 1 
ATOM   342  C  CG2 . VAL A 1 44  ? 23.442 -4.130  -1.648  1.00 16.95 ? 184 VAL A CG2 1 
ATOM   343  N  N   . GLN A 1 45  ? 27.270 -3.570  0.842   1.00 13.70 ? 185 GLN A N   1 
ATOM   344  C  CA  . GLN A 1 45  ? 28.082 -2.943  1.873   1.00 13.72 ? 185 GLN A CA  1 
ATOM   345  C  C   . GLN A 1 45  ? 28.273 -1.479  1.517   1.00 14.18 ? 185 GLN A C   1 
ATOM   346  O  O   . GLN A 1 45  ? 28.530 -1.137  0.364   1.00 14.31 ? 185 GLN A O   1 
ATOM   347  C  CB  . GLN A 1 45  ? 29.461 -3.604  2.005   1.00 16.84 ? 185 GLN A CB  1 
ATOM   348  C  CG  . GLN A 1 45  ? 30.370 -2.870  3.018   1.00 17.52 ? 185 GLN A CG  1 
ATOM   349  C  CD  . GLN A 1 45  ? 31.692 -3.585  3.311   1.00 17.10 ? 185 GLN A CD  1 
ATOM   350  O  OE1 . GLN A 1 45  ? 32.473 -3.137  4.155   1.00 15.83 ? 185 GLN A OE1 1 
ATOM   351  N  NE2 . GLN A 1 45  ? 31.944 -4.693  2.617   1.00 11.90 ? 185 GLN A NE2 1 
ATOM   352  N  N   . TYR A 1 46  ? 28.143 -0.611  2.509   1.00 13.75 ? 186 TYR A N   1 
ATOM   353  C  CA  . TYR A 1 46  ? 28.318 0.806   2.270   1.00 14.39 ? 186 TYR A CA  1 
ATOM   354  C  C   . TYR A 1 46  ? 29.221 1.456   3.313   1.00 14.24 ? 186 TYR A C   1 
ATOM   355  O  O   . TYR A 1 46  ? 29.294 1.034   4.470   1.00 13.03 ? 186 TYR A O   1 
ATOM   356  C  CB  . TYR A 1 46  ? 26.957 1.515   2.257   1.00 12.76 ? 186 TYR A CB  1 
ATOM   357  C  CG  . TYR A 1 46  ? 26.340 1.667   3.629   1.00 14.53 ? 186 TYR A CG  1 
ATOM   358  C  CD1 . TYR A 1 46  ? 26.596 2.796   4.408   1.00 12.24 ? 186 TYR A CD1 1 
ATOM   359  C  CD2 . TYR A 1 46  ? 25.516 0.671   4.159   1.00 13.47 ? 186 TYR A CD2 1 
ATOM   360  C  CE1 . TYR A 1 46  ? 26.044 2.932   5.679   1.00 14.18 ? 186 TYR A CE1 1 
ATOM   361  C  CE2 . TYR A 1 46  ? 24.959 0.795   5.428   1.00 11.26 ? 186 TYR A CE2 1 
ATOM   362  C  CZ  . TYR A 1 46  ? 25.223 1.927   6.181   1.00 14.84 ? 186 TYR A CZ  1 
ATOM   363  O  OH  . TYR A 1 46  ? 24.649 2.070   7.423   1.00 13.52 ? 186 TYR A OH  1 
ATOM   364  N  N   . GLY A 1 47  ? 29.910 2.491   2.870   1.00 15.68 ? 187 GLY A N   1 
ATOM   365  C  CA  . GLY A 1 47  ? 30.786 3.256   3.732   1.00 20.04 ? 187 GLY A CA  1 
ATOM   366  C  C   . GLY A 1 47  ? 30.476 4.649   3.246   1.00 23.31 ? 187 GLY A C   1 
ATOM   367  O  O   . GLY A 1 47  ? 29.414 5.198   3.551   1.00 23.98 ? 187 GLY A O   1 
ATOM   368  N  N   . GLU A 1 48  ? 31.383 5.201   2.454   1.00 25.37 ? 188 GLU A N   1 
ATOM   369  C  CA  . GLU A 1 48  ? 31.185 6.521   1.882   1.00 30.11 ? 188 GLU A CA  1 
ATOM   370  C  C   . GLU A 1 48  ? 30.484 6.298   0.540   1.00 30.61 ? 188 GLU A C   1 
ATOM   371  O  O   . GLU A 1 48  ? 29.820 7.189   0.003   1.00 31.96 ? 188 GLU A O   1 
ATOM   372  C  CB  . GLU A 1 48  ? 32.542 7.205   1.714   1.00 33.20 ? 188 GLU A CB  1 
ATOM   373  C  CG  . GLU A 1 48  ? 33.368 7.125   3.001   1.00 37.17 ? 188 GLU A CG  1 
ATOM   374  C  CD  . GLU A 1 48  ? 34.729 7.782   2.894   1.00 38.41 ? 188 GLU A CD  1 
ATOM   375  O  OE1 . GLU A 1 48  ? 35.501 7.416   1.985   1.00 38.26 ? 188 GLU A OE1 1 
ATOM   376  O  OE2 . GLU A 1 48  ? 35.029 8.657   3.732   1.00 40.84 ? 188 GLU A OE2 1 
ATOM   377  N  N   . ASN A 1 49  ? 30.633 5.085   0.012   1.00 30.86 ? 189 ASN A N   1 
ATOM   378  C  CA  . ASN A 1 49  ? 29.994 4.693   -1.241  1.00 29.19 ? 189 ASN A CA  1 
ATOM   379  C  C   . ASN A 1 49  ? 29.314 3.338   -1.045  1.00 26.68 ? 189 ASN A C   1 
ATOM   380  O  O   . ASN A 1 49  ? 29.316 2.795   0.063   1.00 24.09 ? 189 ASN A O   1 
ATOM   381  C  CB  . ASN A 1 49  ? 31.009 4.624   -2.394  1.00 33.65 ? 189 ASN A CB  1 
ATOM   382  C  CG  . ASN A 1 49  ? 32.327 3.998   -1.986  1.00 38.40 ? 189 ASN A CG  1 
ATOM   383  O  OD1 . ASN A 1 49  ? 33.225 4.683   -1.489  1.00 42.45 ? 189 ASN A OD1 1 
ATOM   384  N  ND2 . ASN A 1 49  ? 32.453 2.690   -2.195  1.00 39.19 ? 189 ASN A ND2 1 
ATOM   385  N  N   . VAL A 1 50  ? 28.741 2.794   -2.114  1.00 22.67 ? 190 VAL A N   1 
ATOM   386  C  CA  . VAL A 1 50  ? 28.041 1.519   -2.026  1.00 21.83 ? 190 VAL A CA  1 
ATOM   387  C  C   . VAL A 1 50  ? 28.573 0.441   -2.963  1.00 20.08 ? 190 VAL A C   1 
ATOM   388  O  O   . VAL A 1 50  ? 28.890 0.710   -4.116  1.00 20.45 ? 190 VAL A O   1 
ATOM   389  C  CB  . VAL A 1 50  ? 26.549 1.706   -2.329  1.00 22.68 ? 190 VAL A CB  1 
ATOM   390  C  CG1 . VAL A 1 50  ? 25.838 0.364   -2.276  1.00 23.45 ? 190 VAL A CG1 1 
ATOM   391  C  CG2 . VAL A 1 50  ? 25.941 2.693   -1.344  1.00 21.76 ? 190 VAL A CG2 1 
ATOM   392  N  N   . THR A 1 51  ? 28.648 -0.788  -2.464  1.00 18.27 ? 191 THR A N   1 
ATOM   393  C  CA  . THR A 1 51  ? 29.128 -1.903  -3.267  1.00 19.25 ? 191 THR A CA  1 
ATOM   394  C  C   . THR A 1 51  ? 28.244 -3.139  -3.135  1.00 18.78 ? 191 THR A C   1 
ATOM   395  O  O   . THR A 1 51  ? 27.990 -3.606  -2.030  1.00 20.19 ? 191 THR A O   1 
ATOM   396  C  CB  . THR A 1 51  ? 30.552 -2.328  -2.857  1.00 18.15 ? 191 THR A CB  1 
ATOM   397  O  OG1 . THR A 1 51  ? 31.443 -1.213  -2.962  1.00 19.64 ? 191 THR A OG1 1 
ATOM   398  C  CG2 . THR A 1 51  ? 31.040 -3.456  -3.765  1.00 16.97 ? 191 THR A CG2 1 
ATOM   399  N  N   . HIS A 1 52  ? 27.785 -3.669  -4.260  1.00 17.51 ? 192 HIS A N   1 
ATOM   400  C  CA  . HIS A 1 52  ? 26.969 -4.878  -4.249  1.00 18.86 ? 192 HIS A CA  1 
ATOM   401  C  C   . HIS A 1 52  ? 27.934 -6.050  -4.081  1.00 18.66 ? 192 HIS A C   1 
ATOM   402  O  O   . HIS A 1 52  ? 28.647 -6.389  -5.018  1.00 18.89 ? 192 HIS A O   1 
ATOM   403  C  CB  . HIS A 1 52  ? 26.218 -5.032  -5.576  1.00 17.68 ? 192 HIS A CB  1 
ATOM   404  C  CG  . HIS A 1 52  ? 25.078 -4.081  -5.742  1.00 16.95 ? 192 HIS A CG  1 
ATOM   405  N  ND1 . HIS A 1 52  ? 23.788 -4.396  -5.376  1.00 19.91 ? 192 HIS A ND1 1 
ATOM   406  C  CD2 . HIS A 1 52  ? 25.037 -2.810  -6.204  1.00 20.31 ? 192 HIS A CD2 1 
ATOM   407  C  CE1 . HIS A 1 52  ? 23.001 -3.361  -5.604  1.00 19.82 ? 192 HIS A CE1 1 
ATOM   408  N  NE2 . HIS A 1 52  ? 23.734 -2.384  -6.106  1.00 20.76 ? 192 HIS A NE2 1 
ATOM   409  N  N   . GLU A 1 53  ? 27.973 -6.661  -2.898  1.00 18.69 ? 193 GLU A N   1 
ATOM   410  C  CA  . GLU A 1 53  ? 28.882 -7.787  -2.675  1.00 17.98 ? 193 GLU A CA  1 
ATOM   411  C  C   . GLU A 1 53  ? 28.435 -8.951  -3.555  1.00 18.10 ? 193 GLU A C   1 
ATOM   412  O  O   . GLU A 1 53  ? 29.262 -9.637  -4.155  1.00 18.43 ? 193 GLU A O   1 
ATOM   413  C  CB  . GLU A 1 53  ? 28.901 -8.165  -1.199  1.00 17.33 ? 193 GLU A CB  1 
ATOM   414  C  CG  . GLU A 1 53  ? 29.343 -7.007  -0.300  1.00 19.95 ? 193 GLU A CG  1 
ATOM   415  C  CD  . GLU A 1 53  ? 30.805 -6.606  -0.505  1.00 19.56 ? 193 GLU A CD  1 
ATOM   416  O  OE1 . GLU A 1 53  ? 31.426 -7.043  -1.496  1.00 24.42 ? 193 GLU A OE1 1 
ATOM   417  O  OE2 . GLU A 1 53  ? 31.329 -5.843  0.325   1.00 15.14 ? 193 GLU A OE2 1 
ATOM   418  N  N   . PHE A 1 54  ? 27.125 -9.168  -3.620  1.00 16.66 ? 194 PHE A N   1 
ATOM   419  C  CA  . PHE A 1 54  ? 26.543 -10.180 -4.494  1.00 17.58 ? 194 PHE A CA  1 
ATOM   420  C  C   . PHE A 1 54  ? 25.028 -10.015 -4.620  1.00 16.71 ? 194 PHE A C   1 
ATOM   421  O  O   . PHE A 1 54  ? 24.343 -9.693  -3.649  1.00 16.67 ? 194 PHE A O   1 
ATOM   422  C  CB  . PHE A 1 54  ? 26.957 -11.618 -4.093  1.00 17.25 ? 194 PHE A CB  1 
ATOM   423  C  CG  . PHE A 1 54  ? 26.460 -12.081 -2.748  1.00 19.44 ? 194 PHE A CG  1 
ATOM   424  C  CD1 . PHE A 1 54  ? 25.125 -12.444 -2.559  1.00 18.22 ? 194 PHE A CD1 1 
ATOM   425  C  CD2 . PHE A 1 54  ? 27.353 -12.235 -1.685  1.00 17.54 ? 194 PHE A CD2 1 
ATOM   426  C  CE1 . PHE A 1 54  ? 24.692 -12.957 -1.339  1.00 18.20 ? 194 PHE A CE1 1 
ATOM   427  C  CE2 . PHE A 1 54  ? 26.928 -12.746 -0.460  1.00 17.99 ? 194 PHE A CE2 1 
ATOM   428  C  CZ  . PHE A 1 54  ? 25.600 -13.110 -0.282  1.00 17.97 ? 194 PHE A CZ  1 
ATOM   429  N  N   . ASN A 1 55  ? 24.533 -10.187 -5.845  1.00 15.81 ? 195 ASN A N   1 
ATOM   430  C  CA  . ASN A 1 55  ? 23.113 -10.046 -6.171  1.00 15.22 ? 195 ASN A CA  1 
ATOM   431  C  C   . ASN A 1 55  ? 22.242 -11.143 -5.587  1.00 13.96 ? 195 ASN A C   1 
ATOM   432  O  O   . ASN A 1 55  ? 22.734 -12.200 -5.199  1.00 15.35 ? 195 ASN A O   1 
ATOM   433  C  CB  . ASN A 1 55  ? 22.903 -10.029 -7.695  1.00 12.66 ? 195 ASN A CB  1 
ATOM   434  C  CG  . ASN A 1 55  ? 23.644 -8.897  -8.380  1.00 15.30 ? 195 ASN A CG  1 
ATOM   435  O  OD1 . ASN A 1 55  ? 23.924 -7.859  -7.773  1.00 14.96 ? 195 ASN A OD1 1 
ATOM   436  N  ND2 . ASN A 1 55  ? 23.952 -9.084  -9.659  1.00 10.95 ? 195 ASN A ND2 1 
ATOM   437  N  N   . LEU A 1 56  ? 20.938 -10.883 -5.561  1.00 13.35 ? 196 LEU A N   1 
ATOM   438  C  CA  . LEU A 1 56  ? 19.944 -11.825 -5.043  1.00 15.10 ? 196 LEU A CA  1 
ATOM   439  C  C   . LEU A 1 56  ? 19.929 -13.188 -5.736  1.00 16.82 ? 196 LEU A C   1 
ATOM   440  O  O   . LEU A 1 56  ? 19.585 -14.189 -5.111  1.00 16.49 ? 196 LEU A O   1 
ATOM   441  C  CB  . LEU A 1 56  ? 18.542 -11.215 -5.136  1.00 14.38 ? 196 LEU A CB  1 
ATOM   442  C  CG  . LEU A 1 56  ? 18.163 -10.139 -4.115  1.00 14.42 ? 196 LEU A CG  1 
ATOM   443  C  CD1 . LEU A 1 56  ? 16.939 -9.364  -4.603  1.00 12.15 ? 196 LEU A CD1 1 
ATOM   444  C  CD2 . LEU A 1 56  ? 17.895 -10.799 -2.769  1.00 13.44 ? 196 LEU A CD2 1 
ATOM   445  N  N   . ASN A 1 57  ? 20.287 -13.234 -7.019  1.00 15.88 ? 197 ASN A N   1 
ATOM   446  C  CA  . ASN A 1 57  ? 20.286 -14.505 -7.742  1.00 19.39 ? 197 ASN A CA  1 
ATOM   447  C  C   . ASN A 1 57  ? 21.694 -15.003 -8.058  1.00 20.79 ? 197 ASN A C   1 
ATOM   448  O  O   . ASN A 1 57  ? 21.874 -15.920 -8.861  1.00 21.49 ? 197 ASN A O   1 
ATOM   449  C  CB  . ASN A 1 57  ? 19.478 -14.385 -9.043  1.00 17.82 ? 197 ASN A CB  1 
ATOM   450  C  CG  . ASN A 1 57  ? 20.068 -13.372 -10.006 1.00 22.36 ? 197 ASN A CG  1 
ATOM   451  O  OD1 . ASN A 1 57  ? 21.017 -12.659 -9.676  1.00 19.93 ? 197 ASN A OD1 1 
ATOM   452  N  ND2 . ASN A 1 57  ? 19.501 -13.296 -11.203 1.00 23.31 ? 197 ASN A ND2 1 
ATOM   453  N  N   . LYS A 1 58  ? 22.691 -14.397 -7.424  1.00 22.86 ? 198 LYS A N   1 
ATOM   454  C  CA  . LYS A 1 58  ? 24.074 -14.800 -7.639  1.00 22.88 ? 198 LYS A CA  1 
ATOM   455  C  C   . LYS A 1 58  ? 24.250 -16.244 -7.193  1.00 21.75 ? 198 LYS A C   1 
ATOM   456  O  O   . LYS A 1 58  ? 24.759 -17.078 -7.941  1.00 20.32 ? 198 LYS A O   1 
ATOM   457  C  CB  . LYS A 1 58  ? 25.018 -13.890 -6.846  1.00 24.69 ? 198 LYS A CB  1 
ATOM   458  C  CG  . LYS A 1 58  ? 26.473 -14.330 -6.845  1.00 26.22 ? 198 LYS A CG  1 
ATOM   459  C  CD  . LYS A 1 58  ? 27.053 -14.358 -8.234  1.00 29.32 ? 198 LYS A CD  1 
ATOM   460  C  CE  . LYS A 1 58  ? 28.506 -14.807 -8.213  1.00 32.29 ? 198 LYS A CE  1 
ATOM   461  N  NZ  . LYS A 1 58  ? 29.097 -14.804 -9.581  1.00 30.79 ? 198 LYS A NZ  1 
ATOM   462  N  N   . TYR A 1 59  ? 23.803 -16.539 -5.978  1.00 21.83 ? 199 TYR A N   1 
ATOM   463  C  CA  . TYR A 1 59  ? 23.927 -17.882 -5.430  1.00 23.33 ? 199 TYR A CA  1 
ATOM   464  C  C   . TYR A 1 59  ? 22.594 -18.599 -5.269  1.00 23.73 ? 199 TYR A C   1 
ATOM   465  O  O   . TYR A 1 59  ? 21.632 -18.051 -4.727  1.00 24.68 ? 199 TYR A O   1 
ATOM   466  C  CB  . TYR A 1 59  ? 24.673 -17.819 -4.096  1.00 22.58 ? 199 TYR A CB  1 
ATOM   467  C  CG  . TYR A 1 59  ? 26.038 -17.189 -4.252  1.00 24.41 ? 199 TYR A CG  1 
ATOM   468  C  CD1 . TYR A 1 59  ? 26.317 -15.930 -3.716  1.00 23.97 ? 199 TYR A CD1 1 
ATOM   469  C  CD2 . TYR A 1 59  ? 27.045 -17.835 -4.980  1.00 22.43 ? 199 TYR A CD2 1 
ATOM   470  C  CE1 . TYR A 1 59  ? 27.567 -15.326 -3.901  1.00 22.43 ? 199 TYR A CE1 1 
ATOM   471  C  CE2 . TYR A 1 59  ? 28.295 -17.240 -5.169  1.00 22.28 ? 199 TYR A CE2 1 
ATOM   472  C  CZ  . TYR A 1 59  ? 28.549 -15.990 -4.628  1.00 23.14 ? 199 TYR A CZ  1 
ATOM   473  O  OH  . TYR A 1 59  ? 29.780 -15.402 -4.817  1.00 23.48 ? 199 TYR A OH  1 
ATOM   474  N  N   . SER A 1 60  ? 22.562 -19.841 -5.741  1.00 24.97 ? 200 SER A N   1 
ATOM   475  C  CA  . SER A 1 60  ? 21.362 -20.666 -5.699  1.00 25.10 ? 200 SER A CA  1 
ATOM   476  C  C   . SER A 1 60  ? 21.272 -21.668 -4.553  1.00 25.65 ? 200 SER A C   1 
ATOM   477  O  O   . SER A 1 60  ? 20.375 -22.508 -4.552  1.00 29.19 ? 200 SER A O   1 
ATOM   478  C  CB  . SER A 1 60  ? 21.221 -21.419 -7.017  1.00 24.92 ? 200 SER A CB  1 
ATOM   479  O  OG  . SER A 1 60  ? 22.366 -22.221 -7.253  1.00 27.87 ? 200 SER A OG  1 
ATOM   480  N  N   . SER A 1 61  ? 22.181 -21.601 -3.584  1.00 23.80 ? 201 SER A N   1 
ATOM   481  C  CA  . SER A 1 61  ? 22.127 -22.536 -2.453  1.00 23.90 ? 201 SER A CA  1 
ATOM   482  C  C   . SER A 1 61  ? 22.658 -21.910 -1.177  1.00 23.60 ? 201 SER A C   1 
ATOM   483  O  O   . SER A 1 61  ? 23.440 -20.960 -1.221  1.00 21.79 ? 201 SER A O   1 
ATOM   484  C  CB  . SER A 1 61  ? 22.935 -23.803 -2.743  1.00 23.05 ? 201 SER A CB  1 
ATOM   485  O  OG  . SER A 1 61  ? 24.327 -23.535 -2.706  1.00 25.30 ? 201 SER A OG  1 
ATOM   486  N  N   . THR A 1 62  ? 22.241 -22.458 -0.040  1.00 22.25 ? 202 THR A N   1 
ATOM   487  C  CA  . THR A 1 62  ? 22.680 -21.943 1.243   1.00 23.24 ? 202 THR A CA  1 
ATOM   488  C  C   . THR A 1 62  ? 24.195 -22.062 1.377   1.00 24.10 ? 202 THR A C   1 
ATOM   489  O  O   . THR A 1 62  ? 24.864 -21.090 1.731   1.00 24.15 ? 202 THR A O   1 
ATOM   490  C  CB  . THR A 1 62  ? 21.984 -22.680 2.416   1.00 22.81 ? 202 THR A CB  1 
ATOM   491  O  OG1 . THR A 1 62  ? 20.563 -22.504 2.310   1.00 22.52 ? 202 THR A OG1 1 
ATOM   492  C  CG2 . THR A 1 62  ? 22.436 -22.110 3.748   1.00 19.25 ? 202 THR A CG2 1 
ATOM   493  N  N   . GLU A 1 63  ? 24.733 -23.245 1.075   1.00 24.03 ? 203 GLU A N   1 
ATOM   494  C  CA  . GLU A 1 63  ? 26.176 -23.481 1.163   1.00 24.31 ? 203 GLU A CA  1 
ATOM   495  C  C   . GLU A 1 63  ? 26.963 -22.430 0.379   1.00 24.79 ? 203 GLU A C   1 
ATOM   496  O  O   . GLU A 1 63  ? 27.982 -21.927 0.857   1.00 23.71 ? 203 GLU A O   1 
ATOM   497  C  CB  . GLU A 1 63  ? 26.549 -24.868 0.620   1.00 23.86 ? 203 GLU A CB  1 
ATOM   498  C  CG  . GLU A 1 63  ? 26.117 -26.055 1.471   1.00 25.12 ? 203 GLU A CG  1 
ATOM   499  C  CD  . GLU A 1 63  ? 24.613 -26.242 1.505   1.00 25.79 ? 203 GLU A CD  1 
ATOM   500  O  OE1 . GLU A 1 63  ? 23.959 -26.054 0.455   1.00 22.91 ? 203 GLU A OE1 1 
ATOM   501  O  OE2 . GLU A 1 63  ? 24.087 -26.593 2.581   1.00 26.22 ? 203 GLU A OE2 1 
ATOM   502  N  N   . GLU A 1 64  ? 26.495 -22.118 -0.828  1.00 23.21 ? 204 GLU A N   1 
ATOM   503  C  CA  . GLU A 1 64  ? 27.159 -21.127 -1.666  1.00 23.95 ? 204 GLU A CA  1 
ATOM   504  C  C   . GLU A 1 64  ? 27.134 -19.753 -1.005  1.00 22.88 ? 204 GLU A C   1 
ATOM   505  O  O   . GLU A 1 64  ? 28.149 -19.065 -0.950  1.00 22.33 ? 204 GLU A O   1 
ATOM   506  C  CB  . GLU A 1 64  ? 26.497 -21.070 -3.045  1.00 26.57 ? 204 GLU A CB  1 
ATOM   507  C  CG  . GLU A 1 64  ? 27.073 -22.076 -4.036  1.00 31.02 ? 204 GLU A CG  1 
ATOM   508  C  CD  . GLU A 1 64  ? 26.292 -22.143 -5.341  1.00 34.59 ? 204 GLU A CD  1 
ATOM   509  O  OE1 . GLU A 1 64  ? 25.839 -21.089 -5.832  1.00 34.57 ? 204 GLU A OE1 1 
ATOM   510  O  OE2 . GLU A 1 64  ? 26.141 -23.255 -5.887  1.00 37.56 ? 204 GLU A OE2 1 
ATOM   511  N  N   . VAL A 1 65  ? 25.970 -19.363 -0.497  1.00 21.14 ? 205 VAL A N   1 
ATOM   512  C  CA  . VAL A 1 65  ? 25.832 -18.085 0.172   1.00 20.39 ? 205 VAL A CA  1 
ATOM   513  C  C   . VAL A 1 65  ? 26.822 -18.012 1.336   1.00 20.95 ? 205 VAL A C   1 
ATOM   514  O  O   . VAL A 1 65  ? 27.556 -17.032 1.466   1.00 20.60 ? 205 VAL A O   1 
ATOM   515  C  CB  . VAL A 1 65  ? 24.394 -17.890 0.695   1.00 20.28 ? 205 VAL A CB  1 
ATOM   516  C  CG1 . VAL A 1 65  ? 24.331 -16.705 1.646   1.00 20.26 ? 205 VAL A CG1 1 
ATOM   517  C  CG2 . VAL A 1 65  ? 23.453 -17.669 -0.473  1.00 20.71 ? 205 VAL A CG2 1 
ATOM   518  N  N   . LEU A 1 66  ? 26.850 -19.051 2.170   1.00 20.19 ? 206 LEU A N   1 
ATOM   519  C  CA  . LEU A 1 66  ? 27.760 -19.080 3.316   1.00 20.84 ? 206 LEU A CA  1 
ATOM   520  C  C   . LEU A 1 66  ? 29.186 -18.816 2.883   1.00 21.81 ? 206 LEU A C   1 
ATOM   521  O  O   . LEU A 1 66  ? 29.881 -18.001 3.489   1.00 23.67 ? 206 LEU A O   1 
ATOM   522  C  CB  . LEU A 1 66  ? 27.704 -20.429 4.034   1.00 19.44 ? 206 LEU A CB  1 
ATOM   523  C  CG  . LEU A 1 66  ? 26.371 -20.821 4.666   1.00 19.77 ? 206 LEU A CG  1 
ATOM   524  C  CD1 . LEU A 1 66  ? 26.573 -22.112 5.462   1.00 17.96 ? 206 LEU A CD1 1 
ATOM   525  C  CD2 . LEU A 1 66  ? 25.867 -19.695 5.568   1.00 18.23 ? 206 LEU A CD2 1 
ATOM   526  N  N   . VAL A 1 67  ? 29.619 -19.513 1.837   1.00 20.84 ? 207 VAL A N   1 
ATOM   527  C  CA  . VAL A 1 67  ? 30.965 -19.343 1.309   1.00 21.75 ? 207 VAL A CA  1 
ATOM   528  C  C   . VAL A 1 67  ? 31.220 -17.883 0.933   1.00 21.40 ? 207 VAL A C   1 
ATOM   529  O  O   . VAL A 1 67  ? 32.257 -17.317 1.287   1.00 20.97 ? 207 VAL A O   1 
ATOM   530  C  CB  . VAL A 1 67  ? 31.200 -20.251 0.062   1.00 21.60 ? 207 VAL A CB  1 
ATOM   531  C  CG1 . VAL A 1 67  ? 32.520 -19.903 -0.615  1.00 20.64 ? 207 VAL A CG1 1 
ATOM   532  C  CG2 . VAL A 1 67  ? 31.210 -21.719 0.485   1.00 23.14 ? 207 VAL A CG2 1 
ATOM   533  N  N   . ALA A 1 68  ? 30.276 -17.270 0.225   1.00 20.63 ? 208 ALA A N   1 
ATOM   534  C  CA  . ALA A 1 68  ? 30.435 -15.873 -0.185  1.00 20.84 ? 208 ALA A CA  1 
ATOM   535  C  C   . ALA A 1 68  ? 30.381 -14.890 0.991   1.00 20.96 ? 208 ALA A C   1 
ATOM   536  O  O   . ALA A 1 68  ? 31.107 -13.896 1.003   1.00 19.66 ? 208 ALA A O   1 
ATOM   537  C  CB  . ALA A 1 68  ? 29.377 -15.500 -1.215  1.00 19.22 ? 208 ALA A CB  1 
ATOM   538  N  N   . ALA A 1 69  ? 29.523 -15.162 1.971   1.00 19.60 ? 209 ALA A N   1 
ATOM   539  C  CA  . ALA A 1 69  ? 29.396 -14.275 3.126   1.00 20.50 ? 209 ALA A CA  1 
ATOM   540  C  C   . ALA A 1 69  ? 30.686 -14.219 3.930   1.00 22.06 ? 209 ALA A C   1 
ATOM   541  O  O   . ALA A 1 69  ? 31.077 -13.156 4.413   1.00 20.37 ? 209 ALA A O   1 
ATOM   542  C  CB  . ALA A 1 69  ? 28.247 -14.721 4.013   1.00 18.77 ? 209 ALA A CB  1 
ATOM   543  N  N   . LYS A 1 70  ? 31.350 -15.366 4.059   1.00 23.49 ? 210 LYS A N   1 
ATOM   544  C  CA  . LYS A 1 70  ? 32.603 -15.452 4.800   1.00 25.89 ? 210 LYS A CA  1 
ATOM   545  C  C   . LYS A 1 70  ? 33.739 -14.668 4.150   1.00 25.67 ? 210 LYS A C   1 
ATOM   546  O  O   . LYS A 1 70  ? 34.676 -14.242 4.829   1.00 27.01 ? 210 LYS A O   1 
ATOM   547  C  CB  . LYS A 1 70  ? 33.032 -16.916 4.955   1.00 27.51 ? 210 LYS A CB  1 
ATOM   548  C  CG  . LYS A 1 70  ? 32.214 -17.701 5.961   1.00 28.14 ? 210 LYS A CG  1 
ATOM   549  C  CD  . LYS A 1 70  ? 32.648 -19.164 6.017   1.00 30.13 ? 210 LYS A CD  1 
ATOM   550  C  CE  . LYS A 1 70  ? 31.805 -19.932 7.024   1.00 31.42 ? 210 LYS A CE  1 
ATOM   551  N  NZ  . LYS A 1 70  ? 32.164 -21.375 7.102   1.00 34.96 ? 210 LYS A NZ  1 
ATOM   552  N  N   . LYS A 1 71  ? 33.655 -14.480 2.838   1.00 26.41 ? 211 LYS A N   1 
ATOM   553  C  CA  . LYS A 1 71  ? 34.686 -13.761 2.100   1.00 26.40 ? 211 LYS A CA  1 
ATOM   554  C  C   . LYS A 1 71  ? 34.544 -12.243 2.108   1.00 24.81 ? 211 LYS A C   1 
ATOM   555  O  O   . LYS A 1 71  ? 35.476 -11.543 1.722   1.00 25.68 ? 211 LYS A O   1 
ATOM   556  C  CB  . LYS A 1 71  ? 34.724 -14.229 0.644   1.00 29.51 ? 211 LYS A CB  1 
ATOM   557  C  CG  . LYS A 1 71  ? 35.152 -15.674 0.443   1.00 33.40 ? 211 LYS A CG  1 
ATOM   558  C  CD  . LYS A 1 71  ? 35.419 -15.957 -1.036  1.00 34.55 ? 211 LYS A CD  1 
ATOM   559  C  CE  . LYS A 1 71  ? 34.213 -15.620 -1.902  1.00 34.56 ? 211 LYS A CE  1 
ATOM   560  N  NZ  . LYS A 1 71  ? 34.516 -15.755 -3.356  1.00 36.27 ? 211 LYS A NZ  1 
ATOM   561  N  N   . ILE A 1 72  ? 33.393 -11.732 2.537   1.00 22.35 ? 212 ILE A N   1 
ATOM   562  C  CA  . ILE A 1 72  ? 33.171 -10.284 2.555   1.00 21.24 ? 212 ILE A CA  1 
ATOM   563  C  C   . ILE A 1 72  ? 34.155 -9.537  3.447   1.00 20.11 ? 212 ILE A C   1 
ATOM   564  O  O   . ILE A 1 72  ? 34.262 -9.810  4.642   1.00 20.65 ? 212 ILE A O   1 
ATOM   565  C  CB  . ILE A 1 72  ? 31.750 -9.937  3.019   1.00 21.51 ? 212 ILE A CB  1 
ATOM   566  C  CG1 . ILE A 1 72  ? 30.730 -10.584 2.076   1.00 19.58 ? 212 ILE A CG1 1 
ATOM   567  C  CG2 . ILE A 1 72  ? 31.574 -8.418  3.049   1.00 21.13 ? 212 ILE A CG2 1 
ATOM   568  C  CD1 . ILE A 1 72  ? 29.292 -10.408 2.503   1.00 17.37 ? 212 ILE A CD1 1 
ATOM   569  N  N   . VAL A 1 73  ? 34.866 -8.579  2.867   1.00 18.54 ? 213 VAL A N   1 
ATOM   570  C  CA  . VAL A 1 73  ? 35.836 -7.808  3.631   1.00 18.79 ? 213 VAL A CA  1 
ATOM   571  C  C   . VAL A 1 73  ? 35.303 -6.434  4.011   1.00 18.48 ? 213 VAL A C   1 
ATOM   572  O  O   . VAL A 1 73  ? 34.437 -5.880  3.338   1.00 20.48 ? 213 VAL A O   1 
ATOM   573  C  CB  . VAL A 1 73  ? 37.145 -7.629  2.841   1.00 18.37 ? 213 VAL A CB  1 
ATOM   574  C  CG1 . VAL A 1 73  ? 37.695 -8.997  2.463   1.00 19.78 ? 213 VAL A CG1 1 
ATOM   575  C  CG2 . VAL A 1 73  ? 36.904 -6.778  1.599   1.00 14.81 ? 213 VAL A CG2 1 
ATOM   576  N  N   . GLN A 1 74  ? 35.818 -5.891  5.104   1.00 17.81 ? 214 GLN A N   1 
ATOM   577  C  CA  . GLN A 1 74  ? 35.401 -4.574  5.549   1.00 17.92 ? 214 GLN A CA  1 
ATOM   578  C  C   . GLN A 1 74  ? 36.045 -3.545  4.614   1.00 18.38 ? 214 GLN A C   1 
ATOM   579  O  O   . GLN A 1 74  ? 37.270 -3.516  4.472   1.00 17.94 ? 214 GLN A O   1 
ATOM   580  C  CB  . GLN A 1 74  ? 35.844 -4.369  6.996   1.00 16.08 ? 214 GLN A CB  1 
ATOM   581  C  CG  . GLN A 1 74  ? 35.533 -3.010  7.574   1.00 18.25 ? 214 GLN A CG  1 
ATOM   582  C  CD  . GLN A 1 74  ? 35.708 -2.980  9.079   1.00 18.29 ? 214 GLN A CD  1 
ATOM   583  O  OE1 . GLN A 1 74  ? 36.601 -3.624  9.621   1.00 18.13 ? 214 GLN A OE1 1 
ATOM   584  N  NE2 . GLN A 1 74  ? 34.863 -2.220  9.758   1.00 20.29 ? 214 GLN A NE2 1 
ATOM   585  N  N   . ARG A 1 75  ? 35.223 -2.718  3.966   1.00 15.97 ? 215 ARG A N   1 
ATOM   586  C  CA  . ARG A 1 75  ? 35.740 -1.713  3.036   1.00 17.78 ? 215 ARG A CA  1 
ATOM   587  C  C   . ARG A 1 75  ? 36.117 -0.395  3.709   1.00 17.55 ? 215 ARG A C   1 
ATOM   588  O  O   . ARG A 1 75  ? 36.841 0.408   3.134   1.00 18.32 ? 215 ARG A O   1 
ATOM   589  C  CB  . ARG A 1 75  ? 34.732 -1.474  1.896   1.00 15.09 ? 215 ARG A CB  1 
ATOM   590  C  CG  . ARG A 1 75  ? 34.677 -2.646  0.901   1.00 18.36 ? 215 ARG A CG  1 
ATOM   591  C  CD  . ARG A 1 75  ? 33.385 -2.703  0.085   1.00 16.69 ? 215 ARG A CD  1 
ATOM   592  N  NE  . ARG A 1 75  ? 33.267 -3.961  -0.659  1.00 16.35 ? 215 ARG A NE  1 
ATOM   593  C  CZ  . ARG A 1 75  ? 34.037 -4.299  -1.693  1.00 19.26 ? 215 ARG A CZ  1 
ATOM   594  N  NH1 . ARG A 1 75  ? 34.987 -3.467  -2.116  1.00 16.35 ? 215 ARG A NH1 1 
ATOM   595  N  NH2 . ARG A 1 75  ? 33.863 -5.465  -2.309  1.00 15.36 ? 215 ARG A NH2 1 
ATOM   596  N  N   . GLY A 1 76  ? 35.636 -0.176  4.927   1.00 17.74 ? 216 GLY A N   1 
ATOM   597  C  CA  . GLY A 1 76  ? 35.977 1.044   5.636   1.00 20.55 ? 216 GLY A CA  1 
ATOM   598  C  C   . GLY A 1 76  ? 35.139 2.260   5.296   1.00 21.55 ? 216 GLY A C   1 
ATOM   599  O  O   . GLY A 1 76  ? 34.148 2.166   4.586   1.00 20.81 ? 216 GLY A O   1 
ATOM   600  N  N   . GLY A 1 77  ? 35.557 3.411   5.810   1.00 25.90 ? 217 GLY A N   1 
ATOM   601  C  CA  . GLY A 1 77  ? 34.838 4.650   5.573   1.00 28.60 ? 217 GLY A CA  1 
ATOM   602  C  C   . GLY A 1 77  ? 34.906 5.536   6.805   1.00 31.27 ? 217 GLY A C   1 
ATOM   603  O  O   . GLY A 1 77  ? 34.956 5.035   7.933   1.00 30.56 ? 217 GLY A O   1 
ATOM   604  N  N   . ALA A 1 78  ? 34.909 6.850   6.595   1.00 33.62 ? 218 ALA A N   1 
ATOM   605  C  CA  . ALA A 1 78  ? 34.978 7.801   7.699   1.00 35.42 ? 218 ALA A CA  1 
ATOM   606  C  C   . ALA A 1 78  ? 33.613 8.428   7.965   1.00 36.81 ? 218 ALA A C   1 
ATOM   607  O  O   . ALA A 1 78  ? 33.362 8.935   9.058   1.00 38.81 ? 218 ALA A O   1 
ATOM   608  C  CB  . ALA A 1 78  ? 36.013 8.886   7.398   1.00 35.72 ? 218 ALA A CB  1 
ATOM   609  N  N   . GLN A 1 79  ? 32.738 8.416   6.963   1.00 35.14 ? 219 GLN A N   1 
ATOM   610  C  CA  . GLN A 1 79  ? 31.397 8.954   7.151   1.00 35.46 ? 219 GLN A CA  1 
ATOM   611  C  C   . GLN A 1 79  ? 30.351 7.981   6.624   1.00 33.90 ? 219 GLN A C   1 
ATOM   612  O  O   . GLN A 1 79  ? 30.424 7.502   5.492   1.00 33.76 ? 219 GLN A O   1 
ATOM   613  C  CB  . GLN A 1 79  ? 31.246 10.333  6.500   1.00 39.17 ? 219 GLN A CB  1 
ATOM   614  C  CG  . GLN A 1 79  ? 31.517 10.407  5.018   1.00 42.53 ? 219 GLN A CG  1 
ATOM   615  C  CD  . GLN A 1 79  ? 31.267 11.806  4.483   1.00 46.23 ? 219 GLN A CD  1 
ATOM   616  O  OE1 . GLN A 1 79  ? 31.828 12.782  4.984   1.00 46.73 ? 219 GLN A OE1 1 
ATOM   617  N  NE2 . GLN A 1 79  ? 30.418 11.911  3.464   1.00 47.23 ? 219 GLN A NE2 1 
ATOM   618  N  N   . THR A 1 80  ? 29.381 7.697   7.481   1.00 31.61 ? 220 THR A N   1 
ATOM   619  C  CA  . THR A 1 80  ? 28.309 6.754   7.213   1.00 29.61 ? 220 THR A CA  1 
ATOM   620  C  C   . THR A 1 80  ? 27.188 7.297   6.328   1.00 27.09 ? 220 THR A C   1 
ATOM   621  O  O   . THR A 1 80  ? 26.463 8.205   6.731   1.00 28.89 ? 220 THR A O   1 
ATOM   622  C  CB  . THR A 1 80  ? 27.717 6.299   8.553   1.00 30.84 ? 220 THR A CB  1 
ATOM   623  O  OG1 . THR A 1 80  ? 28.789 6.135   9.486   1.00 31.28 ? 220 THR A OG1 1 
ATOM   624  C  CG2 . THR A 1 80  ? 26.964 4.977   8.413   1.00 28.97 ? 220 THR A CG2 1 
ATOM   625  N  N   . MET A 1 81  ? 27.049 6.735   5.128   1.00 23.09 ? 221 MET A N   1 
ATOM   626  C  CA  . MET A 1 81  ? 26.002 7.152   4.196   1.00 21.53 ? 221 MET A CA  1 
ATOM   627  C  C   . MET A 1 81  ? 24.910 6.093   4.200   1.00 19.56 ? 221 MET A C   1 
ATOM   628  O  O   . MET A 1 81  ? 24.714 5.369   3.219   1.00 19.75 ? 221 MET A O   1 
ATOM   629  C  CB  . MET A 1 81  ? 26.561 7.313   2.777   1.00 22.64 ? 221 MET A CB  1 
ATOM   630  C  CG  . MET A 1 81  ? 27.698 8.331   2.655   1.00 27.87 ? 221 MET A CG  1 
ATOM   631  S  SD  . MET A 1 81  ? 27.212 10.018  3.096   1.00 29.26 ? 221 MET A SD  1 
ATOM   632  C  CE  . MET A 1 81  ? 26.671 10.624  1.503   1.00 32.90 ? 221 MET A CE  1 
ATOM   633  N  N   . THR A 1 82  ? 24.203 6.017   5.322   1.00 17.12 ? 222 THR A N   1 
ATOM   634  C  CA  . THR A 1 82  ? 23.134 5.051   5.514   1.00 14.71 ? 222 THR A CA  1 
ATOM   635  C  C   . THR A 1 82  ? 21.971 5.265   4.558   1.00 15.74 ? 222 THR A C   1 
ATOM   636  O  O   . THR A 1 82  ? 21.380 4.301   4.068   1.00 15.20 ? 222 THR A O   1 
ATOM   637  C  CB  . THR A 1 82  ? 22.627 5.104   6.962   1.00 13.06 ? 222 THR A CB  1 
ATOM   638  O  OG1 . THR A 1 82  ? 23.703 4.750   7.844   1.00 13.08 ? 222 THR A OG1 1 
ATOM   639  C  CG2 . THR A 1 82  ? 21.468 4.136   7.170   1.00 10.48 ? 222 THR A CG2 1 
ATOM   640  N  N   . ALA A 1 83  ? 21.634 6.525   4.301   1.00 15.51 ? 223 ALA A N   1 
ATOM   641  C  CA  . ALA A 1 83  ? 20.544 6.834   3.387   1.00 14.96 ? 223 ALA A CA  1 
ATOM   642  C  C   . ALA A 1 83  ? 20.917 6.296   2.008   1.00 15.61 ? 223 ALA A C   1 
ATOM   643  O  O   . ALA A 1 83  ? 20.116 5.631   1.353   1.00 15.63 ? 223 ALA A O   1 
ATOM   644  C  CB  . ALA A 1 83  ? 20.320 8.335   3.326   1.00 16.64 ? 223 ALA A CB  1 
ATOM   645  N  N   . LEU A 1 84  ? 22.142 6.583   1.578   1.00 15.58 ? 224 LEU A N   1 
ATOM   646  C  CA  . LEU A 1 84  ? 22.627 6.122   0.284   1.00 16.39 ? 224 LEU A CA  1 
ATOM   647  C  C   . LEU A 1 84  ? 22.625 4.591   0.221   1.00 17.03 ? 224 LEU A C   1 
ATOM   648  O  O   . LEU A 1 84  ? 22.066 4.009   -0.702  1.00 15.36 ? 224 LEU A O   1 
ATOM   649  C  CB  . LEU A 1 84  ? 24.042 6.650   0.028   1.00 16.87 ? 224 LEU A CB  1 
ATOM   650  C  CG  . LEU A 1 84  ? 24.689 6.188   -1.282  1.00 20.77 ? 224 LEU A CG  1 
ATOM   651  C  CD1 . LEU A 1 84  ? 23.779 6.533   -2.449  1.00 23.60 ? 224 LEU A CD1 1 
ATOM   652  C  CD2 . LEU A 1 84  ? 26.053 6.846   -1.460  1.00 21.48 ? 224 LEU A CD2 1 
ATOM   653  N  N   . GLY A 1 85  ? 23.246 3.951   1.209   1.00 15.73 ? 225 GLY A N   1 
ATOM   654  C  CA  . GLY A 1 85  ? 23.291 2.500   1.238   1.00 16.16 ? 225 GLY A CA  1 
ATOM   655  C  C   . GLY A 1 85  ? 21.909 1.868   1.176   1.00 17.58 ? 225 GLY A C   1 
ATOM   656  O  O   . GLY A 1 85  ? 21.708 0.872   0.478   1.00 16.90 ? 225 GLY A O   1 
ATOM   657  N  N   . THR A 1 86  ? 20.954 2.451   1.901   1.00 16.25 ? 226 THR A N   1 
ATOM   658  C  CA  . THR A 1 86  ? 19.587 1.945   1.932   1.00 16.05 ? 226 THR A CA  1 
ATOM   659  C  C   . THR A 1 86  ? 18.853 2.190   0.608   1.00 16.96 ? 226 THR A C   1 
ATOM   660  O  O   . THR A 1 86  ? 18.223 1.285   0.058   1.00 14.46 ? 226 THR A O   1 
ATOM   661  C  CB  . THR A 1 86  ? 18.782 2.604   3.069   1.00 15.04 ? 226 THR A CB  1 
ATOM   662  O  OG1 . THR A 1 86  ? 19.413 2.325   4.324   1.00 16.40 ? 226 THR A OG1 1 
ATOM   663  C  CG2 . THR A 1 86  ? 17.362 2.063   3.099   1.00 16.02 ? 226 THR A CG2 1 
ATOM   664  N  N   . ASP A 1 87  ? 18.939 3.418   0.107   1.00 17.13 ? 227 ASP A N   1 
ATOM   665  C  CA  . ASP A 1 87  ? 18.286 3.782   -1.141  1.00 18.48 ? 227 ASP A CA  1 
ATOM   666  C  C   . ASP A 1 87  ? 18.798 2.915   -2.293  1.00 18.10 ? 227 ASP A C   1 
ATOM   667  O  O   . ASP A 1 87  ? 18.023 2.507   -3.163  1.00 17.06 ? 227 ASP A O   1 
ATOM   668  C  CB  . ASP A 1 87  ? 18.543 5.253   -1.463  1.00 21.23 ? 227 ASP A CB  1 
ATOM   669  C  CG  . ASP A 1 87  ? 17.472 5.849   -2.356  1.00 21.86 ? 227 ASP A CG  1 
ATOM   670  O  OD1 . ASP A 1 87  ? 17.726 6.899   -2.981  1.00 23.99 ? 227 ASP A OD1 1 
ATOM   671  O  OD2 . ASP A 1 87  ? 16.367 5.275   -2.420  1.00 24.62 ? 227 ASP A OD2 1 
ATOM   672  N  N   . THR A 1 88  ? 20.101 2.637   -2.290  1.00 16.66 ? 228 THR A N   1 
ATOM   673  C  CA  . THR A 1 88  ? 20.716 1.829   -3.336  1.00 16.38 ? 228 THR A CA  1 
ATOM   674  C  C   . THR A 1 88  ? 20.215 0.395   -3.287  1.00 17.92 ? 228 THR A C   1 
ATOM   675  O  O   . THR A 1 88  ? 20.009 -0.234  -4.327  1.00 19.53 ? 228 THR A O   1 
ATOM   676  C  CB  . THR A 1 88  ? 22.252 1.830   -3.217  1.00 17.04 ? 228 THR A CB  1 
ATOM   677  O  OG1 . THR A 1 88  ? 22.727 3.179   -3.269  1.00 14.99 ? 228 THR A OG1 1 
ATOM   678  C  CG2 . THR A 1 88  ? 22.881 1.031   -4.371  1.00 15.69 ? 228 THR A CG2 1 
ATOM   679  N  N   . ALA A 1 89  ? 20.030 -0.126  -2.080  1.00 17.22 ? 229 ALA A N   1 
ATOM   680  C  CA  . ALA A 1 89  ? 19.520 -1.480  -1.926  1.00 18.23 ? 229 ALA A CA  1 
ATOM   681  C  C   . ALA A 1 89  ? 18.106 -1.511  -2.519  1.00 18.44 ? 229 ALA A C   1 
ATOM   682  O  O   . ALA A 1 89  ? 17.717 -2.483  -3.168  1.00 17.56 ? 229 ALA A O   1 
ATOM   683  C  CB  . ALA A 1 89  ? 19.489 -1.877  -0.448  1.00 15.28 ? 229 ALA A CB  1 
ATOM   684  N  N   . ARG A 1 90  ? 17.345 -0.442  -2.299  1.00 18.81 ? 230 ARG A N   1 
ATOM   685  C  CA  . ARG A 1 90  ? 15.981 -0.357  -2.827  1.00 19.02 ? 230 ARG A CA  1 
ATOM   686  C  C   . ARG A 1 90  ? 15.992 -0.200  -4.343  1.00 20.69 ? 230 ARG A C   1 
ATOM   687  O  O   . ARG A 1 90  ? 15.296 -0.928  -5.051  1.00 18.58 ? 230 ARG A O   1 
ATOM   688  C  CB  . ARG A 1 90  ? 15.234 0.837   -2.226  1.00 17.86 ? 230 ARG A CB  1 
ATOM   689  C  CG  . ARG A 1 90  ? 13.848 1.067   -2.841  1.00 18.37 ? 230 ARG A CG  1 
ATOM   690  C  CD  . ARG A 1 90  ? 13.176 2.325   -2.290  1.00 19.68 ? 230 ARG A CD  1 
ATOM   691  N  NE  . ARG A 1 90  ? 13.826 3.543   -2.766  1.00 20.27 ? 230 ARG A NE  1 
ATOM   692  C  CZ  . ARG A 1 90  ? 13.756 3.991   -4.018  1.00 23.14 ? 230 ARG A CZ  1 
ATOM   693  N  NH1 . ARG A 1 90  ? 13.056 3.325   -4.929  1.00 21.70 ? 230 ARG A NH1 1 
ATOM   694  N  NH2 . ARG A 1 90  ? 14.402 5.100   -4.369  1.00 22.68 ? 230 ARG A NH2 1 
ATOM   695  N  N   . LYS A 1 91  ? 16.792 0.756   -4.819  1.00 21.24 ? 231 LYS A N   1 
ATOM   696  C  CA  . LYS A 1 91  ? 16.912 1.076   -6.241  1.00 23.50 ? 231 LYS A CA  1 
ATOM   697  C  C   . LYS A 1 91  ? 17.594 0.033   -7.118  1.00 22.93 ? 231 LYS A C   1 
ATOM   698  O  O   . LYS A 1 91  ? 17.138 -0.231  -8.224  1.00 23.09 ? 231 LYS A O   1 
ATOM   699  C  CB  . LYS A 1 91  ? 17.680 2.391   -6.427  1.00 27.21 ? 231 LYS A CB  1 
ATOM   700  C  CG  . LYS A 1 91  ? 16.908 3.662   -6.176  1.00 30.64 ? 231 LYS A CG  1 
ATOM   701  C  CD  . LYS A 1 91  ? 17.789 4.871   -6.494  1.00 34.02 ? 231 LYS A CD  1 
ATOM   702  C  CE  . LYS A 1 91  ? 17.020 6.181   -6.371  1.00 37.85 ? 231 LYS A CE  1 
ATOM   703  N  NZ  . LYS A 1 91  ? 17.901 7.370   -6.586  1.00 39.15 ? 231 LYS A NZ  1 
ATOM   704  N  N   . GLU A 1 92  ? 18.695 -0.537  -6.636  1.00 22.82 ? 232 GLU A N   1 
ATOM   705  C  CA  . GLU A 1 92  ? 19.450 -1.513  -7.420  1.00 22.17 ? 232 GLU A CA  1 
ATOM   706  C  C   . GLU A 1 92  ? 19.357 -2.969  -6.974  1.00 21.18 ? 232 GLU A C   1 
ATOM   707  O  O   . GLU A 1 92  ? 19.088 -3.852  -7.792  1.00 19.79 ? 232 GLU A O   1 
ATOM   708  C  CB  . GLU A 1 92  ? 20.926 -1.108  -7.462  1.00 23.06 ? 232 GLU A CB  1 
ATOM   709  C  CG  . GLU A 1 92  ? 21.150 0.382   -7.624  1.00 24.06 ? 232 GLU A CG  1 
ATOM   710  C  CD  . GLU A 1 92  ? 22.576 0.728   -8.007  1.00 24.45 ? 232 GLU A CD  1 
ATOM   711  O  OE1 . GLU A 1 92  ? 23.517 0.032   -7.562  1.00 24.81 ? 232 GLU A OE1 1 
ATOM   712  O  OE2 . GLU A 1 92  ? 22.754 1.714   -8.750  1.00 28.63 ? 232 GLU A OE2 1 
ATOM   713  N  N   . ALA A 1 93  ? 19.601 -3.225  -5.692  1.00 19.29 ? 233 ALA A N   1 
ATOM   714  C  CA  . ALA A 1 93  ? 19.555 -4.596  -5.181  1.00 20.04 ? 233 ALA A CA  1 
ATOM   715  C  C   . ALA A 1 93  ? 18.212 -5.246  -5.476  1.00 19.22 ? 233 ALA A C   1 
ATOM   716  O  O   . ALA A 1 93  ? 18.156 -6.361  -5.988  1.00 20.29 ? 233 ALA A O   1 
ATOM   717  C  CB  . ALA A 1 93  ? 19.839 -4.624  -3.675  1.00 17.76 ? 233 ALA A CB  1 
ATOM   718  N  N   . PHE A 1 94  ? 17.131 -4.537  -5.175  1.00 18.95 ? 234 PHE A N   1 
ATOM   719  C  CA  . PHE A 1 94  ? 15.799 -5.069  -5.413  1.00 19.35 ? 234 PHE A CA  1 
ATOM   720  C  C   . PHE A 1 94  ? 15.283 -4.858  -6.830  1.00 20.80 ? 234 PHE A C   1 
ATOM   721  O  O   . PHE A 1 94  ? 14.228 -4.264  -7.020  1.00 22.46 ? 234 PHE A O   1 
ATOM   722  C  CB  . PHE A 1 94  ? 14.808 -4.467  -4.416  1.00 16.78 ? 234 PHE A CB  1 
ATOM   723  C  CG  . PHE A 1 94  ? 14.906 -5.057  -3.046  1.00 15.03 ? 234 PHE A CG  1 
ATOM   724  C  CD1 . PHE A 1 94  ? 15.307 -4.281  -1.966  1.00 15.07 ? 234 PHE A CD1 1 
ATOM   725  C  CD2 . PHE A 1 94  ? 14.594 -6.396  -2.834  1.00 13.50 ? 234 PHE A CD2 1 
ATOM   726  C  CE1 . PHE A 1 94  ? 15.394 -4.829  -0.693  1.00 14.51 ? 234 PHE A CE1 1 
ATOM   727  C  CE2 . PHE A 1 94  ? 14.678 -6.957  -1.565  1.00 16.51 ? 234 PHE A CE2 1 
ATOM   728  C  CZ  . PHE A 1 94  ? 15.078 -6.174  -0.490  1.00 15.21 ? 234 PHE A CZ  1 
ATOM   729  N  N   . THR A 1 95  ? 16.018 -5.348  -7.822  1.00 21.18 ? 235 THR A N   1 
ATOM   730  C  CA  . THR A 1 95  ? 15.590 -5.204  -9.208  1.00 23.07 ? 235 THR A CA  1 
ATOM   731  C  C   . THR A 1 95  ? 15.716 -6.523  -9.953  1.00 24.06 ? 235 THR A C   1 
ATOM   732  O  O   . THR A 1 95  ? 16.613 -7.324  -9.675  1.00 23.98 ? 235 THR A O   1 
ATOM   733  C  CB  . THR A 1 95  ? 16.417 -4.142  -9.970  1.00 23.24 ? 235 THR A CB  1 
ATOM   734  O  OG1 . THR A 1 95  ? 17.777 -4.574  -10.082 1.00 21.03 ? 235 THR A OG1 1 
ATOM   735  C  CG2 . THR A 1 95  ? 16.364 -2.813  -9.251  1.00 22.25 ? 235 THR A CG2 1 
ATOM   736  N  N   . GLU A 1 96  ? 14.810 -6.738  -10.900 1.00 24.50 ? 236 GLU A N   1 
ATOM   737  C  CA  . GLU A 1 96  ? 14.810 -7.954  -11.695 1.00 25.31 ? 236 GLU A CA  1 
ATOM   738  C  C   . GLU A 1 96  ? 16.195 -8.213  -12.274 1.00 24.58 ? 236 GLU A C   1 
ATOM   739  O  O   . GLU A 1 96  ? 16.640 -9.360  -12.369 1.00 23.68 ? 236 GLU A O   1 
ATOM   740  C  CB  . GLU A 1 96  ? 13.782 -7.837  -12.820 1.00 26.26 ? 236 GLU A CB  1 
ATOM   741  C  CG  . GLU A 1 96  ? 13.933 -8.889  -13.899 1.00 30.11 ? 236 GLU A CG  1 
ATOM   742  C  CD  . GLU A 1 96  ? 12.787 -8.869  -14.890 1.00 33.26 ? 236 GLU A CD  1 
ATOM   743  O  OE1 . GLU A 1 96  ? 11.687 -9.350  -14.529 1.00 32.48 ? 236 GLU A OE1 1 
ATOM   744  O  OE2 . GLU A 1 96  ? 12.987 -8.361  -16.019 1.00 31.32 ? 236 GLU A OE2 1 
ATOM   745  N  N   . ALA A 1 97  ? 16.873 -7.137  -12.657 1.00 23.19 ? 237 ALA A N   1 
ATOM   746  C  CA  . ALA A 1 97  ? 18.211 -7.237  -13.227 1.00 23.99 ? 237 ALA A CA  1 
ATOM   747  C  C   . ALA A 1 97  ? 19.184 -7.938  -12.280 1.00 22.77 ? 237 ALA A C   1 
ATOM   748  O  O   . ALA A 1 97  ? 20.107 -8.626  -12.718 1.00 23.56 ? 237 ALA A O   1 
ATOM   749  C  CB  . ALA A 1 97  ? 18.737 -5.840  -13.570 1.00 22.87 ? 237 ALA A CB  1 
ATOM   750  N  N   . ARG A 1 98  ? 18.983 -7.765  -10.980 1.00 22.00 ? 238 ARG A N   1 
ATOM   751  C  CA  . ARG A 1 98  ? 19.881 -8.386  -10.023 1.00 22.10 ? 238 ARG A CA  1 
ATOM   752  C  C   . ARG A 1 98  ? 19.313 -9.595  -9.297  1.00 20.81 ? 238 ARG A C   1 
ATOM   753  O  O   . ARG A 1 98  ? 19.830 -9.990  -8.258  1.00 20.95 ? 238 ARG A O   1 
ATOM   754  C  CB  . ARG A 1 98  ? 20.376 -7.348  -9.017  1.00 21.73 ? 238 ARG A CB  1 
ATOM   755  C  CG  . ARG A 1 98  ? 21.393 -6.370  -9.596  1.00 19.30 ? 238 ARG A CG  1 
ATOM   756  C  CD  . ARG A 1 98  ? 21.759 -5.321  -8.569  1.00 18.26 ? 238 ARG A CD  1 
ATOM   757  N  NE  . ARG A 1 98  ? 22.687 -4.312  -9.066  1.00 16.01 ? 238 ARG A NE  1 
ATOM   758  C  CZ  . ARG A 1 98  ? 24.007 -4.469  -9.159  1.00 16.57 ? 238 ARG A CZ  1 
ATOM   759  N  NH1 . ARG A 1 98  ? 24.579 -5.606  -8.793  1.00 12.72 ? 238 ARG A NH1 1 
ATOM   760  N  NH2 . ARG A 1 98  ? 24.760 -3.470  -9.603  1.00 16.77 ? 238 ARG A NH2 1 
ATOM   761  N  N   . GLY A 1 99  ? 18.252 -10.184 -9.839  1.00 19.93 ? 239 GLY A N   1 
ATOM   762  C  CA  . GLY A 1 99  ? 17.695 -11.371 -9.215  1.00 17.36 ? 239 GLY A CA  1 
ATOM   763  C  C   . GLY A 1 99  ? 16.386 -11.263 -8.461  1.00 15.70 ? 239 GLY A C   1 
ATOM   764  O  O   . GLY A 1 99  ? 15.789 -12.288 -8.161  1.00 17.30 ? 239 GLY A O   1 
ATOM   765  N  N   . ALA A 1 100 ? 15.938 -10.055 -8.132  1.00 16.11 ? 240 ALA A N   1 
ATOM   766  C  CA  . ALA A 1 100 ? 14.669 -9.906  -7.412  1.00 17.70 ? 240 ALA A CA  1 
ATOM   767  C  C   . ALA A 1 100 ? 13.555 -10.603 -8.199  1.00 18.27 ? 240 ALA A C   1 
ATOM   768  O  O   . ALA A 1 100 ? 13.513 -10.514 -9.425  1.00 19.10 ? 240 ALA A O   1 
ATOM   769  C  CB  . ALA A 1 100 ? 14.334 -8.431  -7.231  1.00 15.83 ? 240 ALA A CB  1 
ATOM   770  N  N   . ARG A 1 101 ? 12.661 -11.296 -7.501  1.00 19.82 ? 241 ARG A N   1 
ATOM   771  C  CA  . ARG A 1 101 ? 11.566 -12.003 -8.164  1.00 21.94 ? 241 ARG A CA  1 
ATOM   772  C  C   . ARG A 1 101 ? 10.202 -11.344 -7.953  1.00 23.20 ? 241 ARG A C   1 
ATOM   773  O  O   . ARG A 1 101 ? 10.027 -10.504 -7.071  1.00 21.77 ? 241 ARG A O   1 
ATOM   774  C  CB  . ARG A 1 101 ? 11.497 -13.455 -7.675  1.00 22.83 ? 241 ARG A CB  1 
ATOM   775  C  CG  . ARG A 1 101 ? 12.824 -14.190 -7.721  1.00 25.19 ? 241 ARG A CG  1 
ATOM   776  C  CD  . ARG A 1 101 ? 13.280 -14.540 -6.317  1.00 26.76 ? 241 ARG A CD  1 
ATOM   777  N  NE  . ARG A 1 101 ? 12.658 -15.770 -5.844  1.00 28.92 ? 241 ARG A NE  1 
ATOM   778  C  CZ  . ARG A 1 101 ? 12.663 -16.183 -4.580  1.00 28.85 ? 241 ARG A CZ  1 
ATOM   779  N  NH1 . ARG A 1 101 ? 13.251 -15.461 -3.634  1.00 28.18 ? 241 ARG A NH1 1 
ATOM   780  N  NH2 . ARG A 1 101 ? 12.094 -17.337 -4.269  1.00 29.69 ? 241 ARG A NH2 1 
ATOM   781  N  N   . ARG A 1 102 ? 9.242  -11.736 -8.781  1.00 25.68 ? 242 ARG A N   1 
ATOM   782  C  CA  . ARG A 1 102 ? 7.879  -11.220 -8.699  1.00 29.47 ? 242 ARG A CA  1 
ATOM   783  C  C   . ARG A 1 102 ? 7.085  -12.049 -7.696  1.00 28.86 ? 242 ARG A C   1 
ATOM   784  O  O   . ARG A 1 102 ? 7.376  -13.223 -7.494  1.00 28.04 ? 242 ARG A O   1 
ATOM   785  C  CB  . ARG A 1 102 ? 7.208  -11.299 -10.072 1.00 33.58 ? 242 ARG A CB  1 
ATOM   786  C  CG  . ARG A 1 102 ? 7.673  -10.243 -11.068 1.00 38.77 ? 242 ARG A CG  1 
ATOM   787  C  CD  . ARG A 1 102 ? 7.187  -8.867  -10.638 1.00 43.52 ? 242 ARG A CD  1 
ATOM   788  N  NE  . ARG A 1 102 ? 7.410  -7.841  -11.653 1.00 48.73 ? 242 ARG A NE  1 
ATOM   789  C  CZ  . ARG A 1 102 ? 6.998  -6.580  -11.541 1.00 51.99 ? 242 ARG A CZ  1 
ATOM   790  N  NH1 . ARG A 1 102 ? 6.340  -6.189  -10.456 1.00 52.52 ? 242 ARG A NH1 1 
ATOM   791  N  NH2 . ARG A 1 102 ? 7.238  -5.709  -12.513 1.00 52.87 ? 242 ARG A NH2 1 
ATOM   792  N  N   . GLY A 1 103 ? 6.089  -11.439 -7.062  1.00 29.88 ? 243 GLY A N   1 
ATOM   793  C  CA  . GLY A 1 103 ? 5.284  -12.169 -6.097  1.00 29.96 ? 243 GLY A CA  1 
ATOM   794  C  C   . GLY A 1 103 ? 6.085  -12.694 -4.919  1.00 30.75 ? 243 GLY A C   1 
ATOM   795  O  O   . GLY A 1 103 ? 5.850  -13.801 -4.428  1.00 30.36 ? 243 GLY A O   1 
ATOM   796  N  N   . VAL A 1 104 ? 7.041  -11.896 -4.460  1.00 28.94 ? 244 VAL A N   1 
ATOM   797  C  CA  . VAL A 1 104 ? 7.870  -12.287 -3.334  1.00 29.01 ? 244 VAL A CA  1 
ATOM   798  C  C   . VAL A 1 104 ? 7.963  -11.137 -2.340  1.00 28.67 ? 244 VAL A C   1 
ATOM   799  O  O   . VAL A 1 104 ? 7.971  -9.971  -2.729  1.00 28.76 ? 244 VAL A O   1 
ATOM   800  C  CB  . VAL A 1 104 ? 9.292  -12.673 -3.804  1.00 29.56 ? 244 VAL A CB  1 
ATOM   801  C  CG1 . VAL A 1 104 ? 10.156 -13.024 -2.614  1.00 30.67 ? 244 VAL A CG1 1 
ATOM   802  C  CG2 . VAL A 1 104 ? 9.218  -13.852 -4.772  1.00 28.64 ? 244 VAL A CG2 1 
ATOM   803  N  N   . LYS A 1 105 ? 8.019  -11.468 -1.056  1.00 28.77 ? 245 LYS A N   1 
ATOM   804  C  CA  . LYS A 1 105 ? 8.128  -10.450 -0.021  1.00 27.86 ? 245 LYS A CA  1 
ATOM   805  C  C   . LYS A 1 105 ? 9.570  -9.952  0.030   1.00 27.58 ? 245 LYS A C   1 
ATOM   806  O  O   . LYS A 1 105 ? 10.514 -10.747 0.026   1.00 27.23 ? 245 LYS A O   1 
ATOM   807  C  CB  . LYS A 1 105 ? 7.729  -11.029 1.337   1.00 28.37 ? 245 LYS A CB  1 
ATOM   808  C  CG  . LYS A 1 105 ? 7.949  -10.084 2.511   1.00 30.04 ? 245 LYS A CG  1 
ATOM   809  C  CD  . LYS A 1 105 ? 7.233  -8.754  2.300   1.00 31.90 ? 245 LYS A CD  1 
ATOM   810  C  CE  . LYS A 1 105 ? 7.441  -7.812  3.479   1.00 31.68 ? 245 LYS A CE  1 
ATOM   811  N  NZ  . LYS A 1 105 ? 6.782  -6.486  3.272   1.00 34.06 ? 245 LYS A NZ  1 
ATOM   812  N  N   . LYS A 1 106 ? 9.732  -8.635  0.072   1.00 26.03 ? 246 LYS A N   1 
ATOM   813  C  CA  . LYS A 1 106 ? 11.051 -8.021  0.120   1.00 25.70 ? 246 LYS A CA  1 
ATOM   814  C  C   . LYS A 1 106 ? 11.421 -7.641  1.543   1.00 24.85 ? 246 LYS A C   1 
ATOM   815  O  O   . LYS A 1 106 ? 10.644 -6.985  2.243   1.00 25.75 ? 246 LYS A O   1 
ATOM   816  C  CB  . LYS A 1 106 ? 11.083 -6.767  -0.753  1.00 28.05 ? 246 LYS A CB  1 
ATOM   817  C  CG  . LYS A 1 106 ? 10.841 -7.017  -2.229  1.00 28.35 ? 246 LYS A CG  1 
ATOM   818  C  CD  . LYS A 1 106 ? 10.914 -5.712  -3.011  1.00 30.87 ? 246 LYS A CD  1 
ATOM   819  C  CE  . LYS A 1 106 ? 10.618 -5.929  -4.480  1.00 33.16 ? 246 LYS A CE  1 
ATOM   820  N  NZ  . LYS A 1 106 ? 10.696 -4.652  -5.242  1.00 37.01 ? 246 LYS A NZ  1 
ATOM   821  N  N   . VAL A 1 107 ? 12.612 -8.048  1.966   1.00 22.58 ? 247 VAL A N   1 
ATOM   822  C  CA  . VAL A 1 107 ? 13.085 -7.738  3.309   1.00 19.81 ? 247 VAL A CA  1 
ATOM   823  C  C   . VAL A 1 107 ? 14.492 -7.147  3.278   1.00 18.82 ? 247 VAL A C   1 
ATOM   824  O  O   . VAL A 1 107 ? 15.379 -7.653  2.590   1.00 16.35 ? 247 VAL A O   1 
ATOM   825  C  CB  . VAL A 1 107 ? 13.106 -8.996  4.200   1.00 19.72 ? 247 VAL A CB  1 
ATOM   826  C  CG1 . VAL A 1 107 ? 13.478 -8.619  5.630   1.00 18.52 ? 247 VAL A CG1 1 
ATOM   827  C  CG2 . VAL A 1 107 ? 11.750 -9.680  4.163   1.00 19.38 ? 247 VAL A CG2 1 
ATOM   828  N  N   . MET A 1 108 ? 14.686 -6.070  4.031   1.00 18.23 ? 248 MET A N   1 
ATOM   829  C  CA  . MET A 1 108 ? 15.982 -5.411  4.111   1.00 16.37 ? 248 MET A CA  1 
ATOM   830  C  C   . MET A 1 108 ? 16.449 -5.467  5.561   1.00 15.30 ? 248 MET A C   1 
ATOM   831  O  O   . MET A 1 108 ? 15.659 -5.269  6.475   1.00 17.00 ? 248 MET A O   1 
ATOM   832  C  CB  . MET A 1 108 ? 15.860 -3.955  3.656   1.00 15.04 ? 248 MET A CB  1 
ATOM   833  C  CG  . MET A 1 108 ? 17.187 -3.281  3.375   1.00 12.95 ? 248 MET A CG  1 
ATOM   834  S  SD  . MET A 1 108 ? 17.027 -1.532  3.036   1.00 16.47 ? 248 MET A SD  1 
ATOM   835  C  CE  . MET A 1 108 ? 15.928 -1.547  1.550   1.00 10.75 ? 248 MET A CE  1 
ATOM   836  N  N   . VAL A 1 109 ? 17.727 -5.760  5.765   1.00 14.94 ? 249 VAL A N   1 
ATOM   837  C  CA  . VAL A 1 109 ? 18.309 -5.836  7.106   1.00 13.65 ? 249 VAL A CA  1 
ATOM   838  C  C   . VAL A 1 109 ? 19.468 -4.848  7.099   1.00 14.22 ? 249 VAL A C   1 
ATOM   839  O  O   . VAL A 1 109 ? 20.454 -5.048  6.387   1.00 14.11 ? 249 VAL A O   1 
ATOM   840  C  CB  . VAL A 1 109 ? 18.851 -7.260  7.415   1.00 13.01 ? 249 VAL A CB  1 
ATOM   841  C  CG1 . VAL A 1 109 ? 19.444 -7.310  8.816   1.00 10.47 ? 249 VAL A CG1 1 
ATOM   842  C  CG2 . VAL A 1 109 ? 17.738 -8.286  7.283   1.00 12.75 ? 249 VAL A CG2 1 
ATOM   843  N  N   . ILE A 1 110 ? 19.342 -3.785  7.888   1.00 14.83 ? 250 ILE A N   1 
ATOM   844  C  CA  . ILE A 1 110 ? 20.351 -2.736  7.946   1.00 14.47 ? 250 ILE A CA  1 
ATOM   845  C  C   . ILE A 1 110 ? 21.173 -2.789  9.234   1.00 15.02 ? 250 ILE A C   1 
ATOM   846  O  O   . ILE A 1 110 ? 20.625 -2.754  10.331  1.00 16.13 ? 250 ILE A O   1 
ATOM   847  C  CB  . ILE A 1 110 ? 19.671 -1.366  7.808   1.00 16.46 ? 250 ILE A CB  1 
ATOM   848  C  CG1 . ILE A 1 110 ? 18.636 -1.439  6.680   1.00 18.41 ? 250 ILE A CG1 1 
ATOM   849  C  CG2 . ILE A 1 110 ? 20.703 -0.289  7.498   1.00 14.08 ? 250 ILE A CG2 1 
ATOM   850  C  CD1 . ILE A 1 110 ? 17.813 -0.192  6.516   1.00 23.52 ? 250 ILE A CD1 1 
ATOM   851  N  N   . VAL A 1 111 ? 22.492 -2.866  9.086   1.00 15.46 ? 251 VAL A N   1 
ATOM   852  C  CA  . VAL A 1 111 ? 23.404 -2.951  10.224  1.00 16.30 ? 251 VAL A CA  1 
ATOM   853  C  C   . VAL A 1 111 ? 24.392 -1.783  10.217  1.00 16.53 ? 251 VAL A C   1 
ATOM   854  O  O   . VAL A 1 111 ? 25.149 -1.619  9.267   1.00 16.39 ? 251 VAL A O   1 
ATOM   855  C  CB  . VAL A 1 111 ? 24.197 -4.290  10.188  1.00 15.21 ? 251 VAL A CB  1 
ATOM   856  C  CG1 . VAL A 1 111 ? 25.053 -4.431  11.434  1.00 12.28 ? 251 VAL A CG1 1 
ATOM   857  C  CG2 . VAL A 1 111 ? 23.233 -5.464  10.073  1.00 15.09 ? 251 VAL A CG2 1 
ATOM   858  N  N   . THR A 1 112 ? 24.392 -0.984  11.282  1.00 15.43 ? 252 THR A N   1 
ATOM   859  C  CA  . THR A 1 112 ? 25.281 0.171   11.369  1.00 15.85 ? 252 THR A CA  1 
ATOM   860  C  C   . THR A 1 112 ? 25.696 0.492   12.814  1.00 15.62 ? 252 THR A C   1 
ATOM   861  O  O   . THR A 1 112 ? 25.023 0.098   13.767  1.00 14.32 ? 252 THR A O   1 
ATOM   862  C  CB  . THR A 1 112 ? 24.598 1.408   10.752  1.00 16.89 ? 252 THR A CB  1 
ATOM   863  O  OG1 . THR A 1 112 ? 25.486 2.535   10.792  1.00 17.07 ? 252 THR A OG1 1 
ATOM   864  C  CG2 . THR A 1 112 ? 23.319 1.735   11.522  1.00 16.74 ? 252 THR A CG2 1 
ATOM   865  N  N   . ASP A 1 113 ? 26.807 1.208   12.972  1.00 16.24 ? 253 ASP A N   1 
ATOM   866  C  CA  . ASP A 1 113 ? 27.288 1.582   14.303  1.00 18.17 ? 253 ASP A CA  1 
ATOM   867  C  C   . ASP A 1 113 ? 27.507 3.090   14.427  1.00 19.31 ? 253 ASP A C   1 
ATOM   868  O  O   . ASP A 1 113 ? 28.328 3.540   15.227  1.00 18.78 ? 253 ASP A O   1 
ATOM   869  C  CB  . ASP A 1 113 ? 28.601 0.860   14.633  1.00 15.01 ? 253 ASP A CB  1 
ATOM   870  C  CG  . ASP A 1 113 ? 29.817 1.566   14.054  1.00 16.45 ? 253 ASP A CG  1 
ATOM   871  O  OD1 . ASP A 1 113 ? 29.705 2.104   12.933  1.00 14.39 ? 253 ASP A OD1 1 
ATOM   872  O  OD2 . ASP A 1 113 ? 30.886 1.575   14.715  1.00 15.29 ? 253 ASP A OD2 1 
ATOM   873  N  N   . GLY A 1 114 ? 26.773 3.872   13.642  1.00 21.68 ? 254 GLY A N   1 
ATOM   874  C  CA  . GLY A 1 114 ? 26.928 5.316   13.719  1.00 22.11 ? 254 GLY A CA  1 
ATOM   875  C  C   . GLY A 1 114 ? 25.826 6.111   13.046  1.00 22.87 ? 254 GLY A C   1 
ATOM   876  O  O   . GLY A 1 114 ? 25.087 5.586   12.212  1.00 22.92 ? 254 GLY A O   1 
ATOM   877  N  N   . GLU A 1 115 ? 25.711 7.382   13.419  1.00 23.46 ? 255 GLU A N   1 
ATOM   878  C  CA  . GLU A 1 115 ? 24.710 8.265   12.837  1.00 23.34 ? 255 GLU A CA  1 
ATOM   879  C  C   . GLU A 1 115 ? 25.132 8.561   11.403  1.00 23.27 ? 255 GLU A C   1 
ATOM   880  O  O   . GLU A 1 115 ? 26.314 8.764   11.121  1.00 22.69 ? 255 GLU A O   1 
ATOM   881  C  CB  . GLU A 1 115 ? 24.625 9.559   13.640  1.00 24.67 ? 255 GLU A CB  1 
ATOM   882  C  CG  . GLU A 1 115 ? 24.269 9.348   15.098  1.00 28.16 ? 255 GLU A CG  1 
ATOM   883  C  CD  . GLU A 1 115 ? 24.439 10.606  15.927  1.00 29.81 ? 255 GLU A CD  1 
ATOM   884  O  OE1 . GLU A 1 115 ? 23.756 11.606  15.635  1.00 33.78 ? 255 GLU A OE1 1 
ATOM   885  O  OE2 . GLU A 1 115 ? 25.259 10.596  16.867  1.00 30.48 ? 255 GLU A OE2 1 
ATOM   886  N  N   . SER A 1 116 ? 24.163 8.592   10.497  1.00 23.63 ? 256 SER A N   1 
ATOM   887  C  CA  . SER A 1 116 ? 24.449 8.826   9.088   1.00 24.09 ? 256 SER A CA  1 
ATOM   888  C  C   . SER A 1 116 ? 24.743 10.280  8.743   1.00 25.38 ? 256 SER A C   1 
ATOM   889  O  O   . SER A 1 116 ? 24.150 11.200  9.307   1.00 23.76 ? 256 SER A O   1 
ATOM   890  C  CB  . SER A 1 116 ? 23.279 8.343   8.243   1.00 25.74 ? 256 SER A CB  1 
ATOM   891  O  OG  . SER A 1 116 ? 22.119 9.097   8.544   1.00 26.61 ? 256 SER A OG  1 
ATOM   892  N  N   . HIS A 1 117 ? 25.658 10.471  7.798   1.00 26.29 ? 257 HIS A N   1 
ATOM   893  C  CA  . HIS A 1 117 ? 26.041 11.800  7.338   1.00 28.72 ? 257 HIS A CA  1 
ATOM   894  C  C   . HIS A 1 117 ? 24.933 12.410  6.475   1.00 27.63 ? 257 HIS A C   1 
ATOM   895  O  O   . HIS A 1 117 ? 24.782 13.633  6.410   1.00 28.42 ? 257 HIS A O   1 
ATOM   896  C  CB  . HIS A 1 117 ? 27.339 11.715  6.531   1.00 32.00 ? 257 HIS A CB  1 
ATOM   897  C  CG  . HIS A 1 117 ? 27.717 12.997  5.861   1.00 36.92 ? 257 HIS A CG  1 
ATOM   898  N  ND1 . HIS A 1 117 ? 28.035 14.140  6.563   1.00 39.00 ? 257 HIS A ND1 1 
ATOM   899  C  CD2 . HIS A 1 117 ? 27.809 13.324  4.549   1.00 38.18 ? 257 HIS A CD2 1 
ATOM   900  C  CE1 . HIS A 1 117 ? 28.306 15.115  5.715   1.00 40.74 ? 257 HIS A CE1 1 
ATOM   901  N  NE2 . HIS A 1 117 ? 28.175 14.647  4.487   1.00 41.17 ? 257 HIS A NE2 1 
ATOM   902  N  N   . ASP A 1 118 ? 24.162 11.551  5.819   1.00 25.00 ? 258 ASP A N   1 
ATOM   903  C  CA  . ASP A 1 118 ? 23.062 11.986  4.958   1.00 24.19 ? 258 ASP A CA  1 
ATOM   904  C  C   . ASP A 1 118 ? 21.720 11.663  5.601   1.00 23.62 ? 258 ASP A C   1 
ATOM   905  O  O   . ASP A 1 118 ? 20.791 11.207  4.932   1.00 23.15 ? 258 ASP A O   1 
ATOM   906  C  CB  . ASP A 1 118 ? 23.147 11.284  3.601   1.00 23.46 ? 258 ASP A CB  1 
ATOM   907  C  CG  . ASP A 1 118 ? 23.143 9.769   3.731   1.00 24.45 ? 258 ASP A CG  1 
ATOM   908  O  OD1 . ASP A 1 118 ? 23.185 9.078   2.694   1.00 24.76 ? 258 ASP A OD1 1 
ATOM   909  O  OD2 . ASP A 1 118 ? 23.099 9.265   4.875   1.00 27.18 ? 258 ASP A OD2 1 
ATOM   910  N  N   . ASN A 1 119 ? 21.622 11.897  6.901   1.00 25.21 ? 259 ASN A N   1 
ATOM   911  C  CA  . ASN A 1 119 ? 20.394 11.615  7.628   1.00 28.18 ? 259 ASN A CA  1 
ATOM   912  C  C   . ASN A 1 119 ? 19.240 12.493  7.151   1.00 28.22 ? 259 ASN A C   1 
ATOM   913  O  O   . ASN A 1 119 ? 18.084 12.234  7.477   1.00 28.70 ? 259 ASN A O   1 
ATOM   914  C  CB  . ASN A 1 119 ? 20.612 11.826  9.124   1.00 30.49 ? 259 ASN A CB  1 
ATOM   915  C  CG  . ASN A 1 119 ? 20.760 13.286  9.482   1.00 34.62 ? 259 ASN A CG  1 
ATOM   916  O  OD1 . ASN A 1 119 ? 21.669 13.970  9.005   1.00 35.44 ? 259 ASN A OD1 1 
ATOM   917  N  ND2 . ASN A 1 119 ? 19.857 13.779  10.322  1.00 37.97 ? 259 ASN A ND2 1 
ATOM   918  N  N   . HIS A 1 120 ? 19.550 13.531  6.381   1.00 29.19 ? 260 HIS A N   1 
ATOM   919  C  CA  . HIS A 1 120 ? 18.509 14.421  5.877   1.00 29.30 ? 260 HIS A CA  1 
ATOM   920  C  C   . HIS A 1 120 ? 17.687 13.749  4.772   1.00 28.67 ? 260 HIS A C   1 
ATOM   921  O  O   . HIS A 1 120 ? 16.606 14.218  4.417   1.00 29.52 ? 260 HIS A O   1 
ATOM   922  C  CB  . HIS A 1 120 ? 19.126 15.734  5.360   1.00 28.56 ? 260 HIS A CB  1 
ATOM   923  C  CG  . HIS A 1 120 ? 19.991 15.570  4.147   1.00 27.78 ? 260 HIS A CG  1 
ATOM   924  N  ND1 . HIS A 1 120 ? 21.129 14.792  4.140   1.00 28.99 ? 260 HIS A ND1 1 
ATOM   925  C  CD2 . HIS A 1 120 ? 19.887 16.093  2.903   1.00 26.04 ? 260 HIS A CD2 1 
ATOM   926  C  CE1 . HIS A 1 120 ? 21.688 14.842  2.943   1.00 25.61 ? 260 HIS A CE1 1 
ATOM   927  N  NE2 . HIS A 1 120 ? 20.955 15.625  2.175   1.00 26.64 ? 260 HIS A NE2 1 
ATOM   928  N  N   . ARG A 1 121 ? 18.200 12.643  4.241   1.00 27.70 ? 261 ARG A N   1 
ATOM   929  C  CA  . ARG A 1 121 ? 17.513 11.907  3.183   1.00 25.56 ? 261 ARG A CA  1 
ATOM   930  C  C   . ARG A 1 121 ? 16.714 10.723  3.719   1.00 24.74 ? 261 ARG A C   1 
ATOM   931  O  O   . ARG A 1 121 ? 15.834 10.196  3.031   1.00 24.31 ? 261 ARG A O   1 
ATOM   932  C  CB  . ARG A 1 121 ? 18.525 11.397  2.153   1.00 25.42 ? 261 ARG A CB  1 
ATOM   933  C  CG  . ARG A 1 121 ? 19.317 12.488  1.457   1.00 27.61 ? 261 ARG A CG  1 
ATOM   934  C  CD  . ARG A 1 121 ? 18.384 13.472  0.774   1.00 29.33 ? 261 ARG A CD  1 
ATOM   935  N  NE  . ARG A 1 121 ? 17.523 12.818  -0.207  1.00 29.63 ? 261 ARG A NE  1 
ATOM   936  C  CZ  . ARG A 1 121 ? 16.218 13.039  -0.317  1.00 31.34 ? 261 ARG A CZ  1 
ATOM   937  N  NH1 . ARG A 1 121 ? 15.621 13.899  0.501   1.00 29.35 ? 261 ARG A NH1 1 
ATOM   938  N  NH2 . ARG A 1 121 ? 15.507 12.400  -1.241  1.00 31.23 ? 261 ARG A NH2 1 
ATOM   939  N  N   . LEU A 1 122 ? 17.015 10.309  4.947   1.00 25.77 ? 262 LEU A N   1 
ATOM   940  C  CA  . LEU A 1 122 ? 16.334 9.162   5.552   1.00 25.84 ? 262 LEU A CA  1 
ATOM   941  C  C   . LEU A 1 122 ? 14.819 9.191   5.464   1.00 25.56 ? 262 LEU A C   1 
ATOM   942  O  O   . LEU A 1 122 ? 14.200 8.172   5.167   1.00 27.24 ? 262 LEU A O   1 
ATOM   943  C  CB  . LEU A 1 122 ? 16.750 8.993   7.016   1.00 25.10 ? 262 LEU A CB  1 
ATOM   944  C  CG  . LEU A 1 122 ? 18.089 8.288   7.238   1.00 24.13 ? 262 LEU A CG  1 
ATOM   945  C  CD1 . LEU A 1 122 ? 18.312 8.050   8.728   1.00 23.27 ? 262 LEU A CD1 1 
ATOM   946  C  CD2 . LEU A 1 122 ? 18.085 6.969   6.487   1.00 23.01 ? 262 LEU A CD2 1 
ATOM   947  N  N   . LYS A 1 123 ? 14.218 10.346  5.727   1.00 25.14 ? 263 LYS A N   1 
ATOM   948  C  CA  . LYS A 1 123 ? 12.766 10.464  5.661   1.00 25.48 ? 263 LYS A CA  1 
ATOM   949  C  C   . LYS A 1 123 ? 12.258 9.978   4.305   1.00 23.76 ? 263 LYS A C   1 
ATOM   950  O  O   . LYS A 1 123 ? 11.426 9.075   4.230   1.00 22.63 ? 263 LYS A O   1 
ATOM   951  C  CB  . LYS A 1 123 ? 12.345 11.920  5.881   1.00 28.18 ? 263 LYS A CB  1 
ATOM   952  C  CG  . LYS A 1 123 ? 10.839 12.160  5.832   1.00 29.90 ? 263 LYS A CG  1 
ATOM   953  C  CD  . LYS A 1 123 ? 10.114 11.348  6.891   1.00 33.86 ? 263 LYS A CD  1 
ATOM   954  C  CE  . LYS A 1 123 ? 8.627  11.673  6.927   1.00 37.28 ? 263 LYS A CE  1 
ATOM   955  N  NZ  . LYS A 1 123 ? 8.369  13.095  7.314   1.00 38.87 ? 263 LYS A NZ  1 
ATOM   956  N  N   . LYS A 1 124 ? 12.774 10.576  3.236   1.00 22.11 ? 264 LYS A N   1 
ATOM   957  C  CA  . LYS A 1 124 ? 12.374 10.210  1.887   1.00 20.93 ? 264 LYS A CA  1 
ATOM   958  C  C   . LYS A 1 124 ? 12.726 8.763   1.534   1.00 20.56 ? 264 LYS A C   1 
ATOM   959  O  O   . LYS A 1 124 ? 11.872 8.010   1.050   1.00 15.85 ? 264 LYS A O   1 
ATOM   960  C  CB  . LYS A 1 124 ? 13.021 11.164  0.876   1.00 22.57 ? 264 LYS A CB  1 
ATOM   961  C  CG  . LYS A 1 124 ? 12.826 10.771  -0.587  1.00 23.58 ? 264 LYS A CG  1 
ATOM   962  C  CD  . LYS A 1 124 ? 11.354 10.690  -0.958  1.00 26.40 ? 264 LYS A CD  1 
ATOM   963  C  CE  . LYS A 1 124 ? 11.175 10.480  -2.453  1.00 29.69 ? 264 LYS A CE  1 
ATOM   964  N  NZ  . LYS A 1 124 ? 9.738  10.438  -2.846  1.00 32.55 ? 264 LYS A NZ  1 
ATOM   965  N  N   . VAL A 1 125 ? 13.980 8.377   1.774   1.00 19.32 ? 265 VAL A N   1 
ATOM   966  C  CA  . VAL A 1 125 ? 14.426 7.018   1.461   1.00 19.16 ? 265 VAL A CA  1 
ATOM   967  C  C   . VAL A 1 125 ? 13.549 5.951   2.110   1.00 18.29 ? 265 VAL A C   1 
ATOM   968  O  O   . VAL A 1 125 ? 13.178 4.964   1.476   1.00 19.13 ? 265 VAL A O   1 
ATOM   969  C  CB  . VAL A 1 125 ? 15.880 6.773   1.913   1.00 17.63 ? 265 VAL A CB  1 
ATOM   970  C  CG1 . VAL A 1 125 ? 16.224 5.298   1.755   1.00 15.60 ? 265 VAL A CG1 1 
ATOM   971  C  CG2 . VAL A 1 125 ? 16.833 7.632   1.098   1.00 16.25 ? 265 VAL A CG2 1 
ATOM   972  N  N   . ILE A 1 126 ? 13.232 6.151   3.379   1.00 18.32 ? 266 ILE A N   1 
ATOM   973  C  CA  . ILE A 1 126 ? 12.406 5.202   4.109   1.00 19.10 ? 266 ILE A CA  1 
ATOM   974  C  C   . ILE A 1 126 ? 11.006 5.159   3.514   1.00 20.35 ? 266 ILE A C   1 
ATOM   975  O  O   . ILE A 1 126 ? 10.503 4.085   3.182   1.00 21.06 ? 266 ILE A O   1 
ATOM   976  C  CB  . ILE A 1 126 ? 12.328 5.586   5.601   1.00 18.93 ? 266 ILE A CB  1 
ATOM   977  C  CG1 . ILE A 1 126 ? 13.693 5.364   6.259   1.00 19.78 ? 266 ILE A CG1 1 
ATOM   978  C  CG2 . ILE A 1 126 ? 11.237 4.792   6.296   1.00 17.57 ? 266 ILE A CG2 1 
ATOM   979  C  CD1 . ILE A 1 126 ? 13.784 5.899   7.686   1.00 20.39 ? 266 ILE A CD1 1 
ATOM   980  N  N   . GLN A 1 127 ? 10.385 6.328   3.366   1.00 20.03 ? 267 GLN A N   1 
ATOM   981  C  CA  . GLN A 1 127 ? 9.039  6.396   2.810   1.00 20.54 ? 267 GLN A CA  1 
ATOM   982  C  C   . GLN A 1 127 ? 8.964  5.654   1.482   1.00 20.40 ? 267 GLN A C   1 
ATOM   983  O  O   . GLN A 1 127 ? 7.994  4.943   1.229   1.00 19.34 ? 267 GLN A O   1 
ATOM   984  C  CB  . GLN A 1 127 ? 8.593  7.848   2.621   1.00 21.87 ? 267 GLN A CB  1 
ATOM   985  C  CG  . GLN A 1 127 ? 7.126  7.974   2.233   1.00 25.90 ? 267 GLN A CG  1 
ATOM   986  C  CD  . GLN A 1 127 ? 6.216  7.126   3.118   1.00 30.60 ? 267 GLN A CD  1 
ATOM   987  O  OE1 . GLN A 1 127 ? 6.265  7.212   4.349   1.00 32.68 ? 267 GLN A OE1 1 
ATOM   988  N  NE2 . GLN A 1 127 ? 5.383  6.300   2.490   1.00 31.41 ? 267 GLN A NE2 1 
ATOM   989  N  N   . ASP A 1 128 ? 9.982  5.815   0.637   1.00 20.88 ? 268 ASP A N   1 
ATOM   990  C  CA  . ASP A 1 128 ? 10.009 5.120   -0.651  1.00 22.07 ? 268 ASP A CA  1 
ATOM   991  C  C   . ASP A 1 128 ? 10.096 3.608   -0.430  1.00 22.13 ? 268 ASP A C   1 
ATOM   992  O  O   . ASP A 1 128 ? 9.549  2.824   -1.212  1.00 20.97 ? 268 ASP A O   1 
ATOM   993  C  CB  . ASP A 1 128 ? 11.196 5.584   -1.501  1.00 23.49 ? 268 ASP A CB  1 
ATOM   994  C  CG  . ASP A 1 128 ? 10.994 6.977   -2.074  1.00 25.56 ? 268 ASP A CG  1 
ATOM   995  O  OD1 . ASP A 1 128 ? 9.861  7.503   -1.994  1.00 25.04 ? 268 ASP A OD1 1 
ATOM   996  O  OD2 . ASP A 1 128 ? 11.968 7.542   -2.610  1.00 23.81 ? 268 ASP A OD2 1 
ATOM   997  N  N   . CYS A 1 129 ? 10.781 3.199   0.635   1.00 20.19 ? 269 CYS A N   1 
ATOM   998  C  CA  . CYS A 1 129 ? 10.896 1.777   0.945   1.00 20.87 ? 269 CYS A CA  1 
ATOM   999  C  C   . CYS A 1 129 ? 9.547  1.242   1.401   1.00 20.65 ? 269 CYS A C   1 
ATOM   1000 O  O   . CYS A 1 129 ? 9.205  0.087   1.142   1.00 20.98 ? 269 CYS A O   1 
ATOM   1001 C  CB  . CYS A 1 129 ? 11.928 1.535   2.053   1.00 19.29 ? 269 CYS A CB  1 
ATOM   1002 S  SG  . CYS A 1 129 ? 13.642 1.672   1.528   1.00 20.00 ? 269 CYS A SG  1 
ATOM   1003 N  N   . GLU A 1 130 ? 8.789  2.092   2.085   1.00 21.83 ? 270 GLU A N   1 
ATOM   1004 C  CA  . GLU A 1 130 ? 7.475  1.722   2.593   1.00 23.95 ? 270 GLU A CA  1 
ATOM   1005 C  C   . GLU A 1 130 ? 6.482  1.606   1.443   1.00 25.28 ? 270 GLU A C   1 
ATOM   1006 O  O   . GLU A 1 130 ? 5.688  0.670   1.389   1.00 26.50 ? 270 GLU A O   1 
ATOM   1007 C  CB  . GLU A 1 130 ? 6.984  2.773   3.592   1.00 26.43 ? 270 GLU A CB  1 
ATOM   1008 C  CG  . GLU A 1 130 ? 5.749  2.370   4.387   1.00 27.39 ? 270 GLU A CG  1 
ATOM   1009 C  CD  . GLU A 1 130 ? 5.974  1.114   5.206   1.00 29.29 ? 270 GLU A CD  1 
ATOM   1010 O  OE1 . GLU A 1 130 ? 7.087  0.948   5.747   1.00 27.42 ? 270 GLU A OE1 1 
ATOM   1011 O  OE2 . GLU A 1 130 ? 5.037  0.295   5.318   1.00 31.91 ? 270 GLU A OE2 1 
ATOM   1012 N  N   . ASP A 1 131 ? 6.530  2.557   0.519   1.00 25.29 ? 271 ASP A N   1 
ATOM   1013 C  CA  . ASP A 1 131 ? 5.619  2.526   -0.610  1.00 27.24 ? 271 ASP A CA  1 
ATOM   1014 C  C   . ASP A 1 131 ? 5.865  1.275   -1.442  1.00 28.12 ? 271 ASP A C   1 
ATOM   1015 O  O   . ASP A 1 131 ? 4.949  0.752   -2.077  1.00 27.68 ? 271 ASP A O   1 
ATOM   1016 C  CB  . ASP A 1 131 ? 5.791  3.778   -1.479  1.00 27.09 ? 271 ASP A CB  1 
ATOM   1017 C  CG  . ASP A 1 131 ? 5.504  5.059   -0.716  1.00 27.32 ? 271 ASP A CG  1 
ATOM   1018 O  OD1 . ASP A 1 131 ? 4.796  4.994   0.311   1.00 26.26 ? 271 ASP A OD1 1 
ATOM   1019 O  OD2 . ASP A 1 131 ? 5.979  6.133   -1.148  1.00 29.02 ? 271 ASP A OD2 1 
ATOM   1020 N  N   . GLU A 1 132 ? 7.102  0.786   -1.431  1.00 27.91 ? 272 GLU A N   1 
ATOM   1021 C  CA  . GLU A 1 132 ? 7.430  -0.404  -2.200  1.00 28.57 ? 272 GLU A CA  1 
ATOM   1022 C  C   . GLU A 1 132 ? 7.295  -1.666  -1.373  1.00 28.16 ? 272 GLU A C   1 
ATOM   1023 O  O   . GLU A 1 132 ? 7.789  -2.728  -1.750  1.00 29.99 ? 272 GLU A O   1 
ATOM   1024 C  CB  . GLU A 1 132 ? 8.834  -0.287  -2.795  1.00 29.27 ? 272 GLU A CB  1 
ATOM   1025 C  CG  . GLU A 1 132 ? 8.883  0.674   -3.971  1.00 30.49 ? 272 GLU A CG  1 
ATOM   1026 C  CD  . GLU A 1 132 ? 10.290 0.986   -4.413  1.00 31.38 ? 272 GLU A CD  1 
ATOM   1027 O  OE1 . GLU A 1 132 ? 11.022 0.048   -4.795  1.00 34.46 ? 272 GLU A OE1 1 
ATOM   1028 O  OE2 . GLU A 1 132 ? 10.664 2.173   -4.377  1.00 30.82 ? 272 GLU A OE2 1 
ATOM   1029 N  N   . ASN A 1 133 ? 6.626  -1.532  -0.234  1.00 27.12 ? 273 ASN A N   1 
ATOM   1030 C  CA  . ASN A 1 133 ? 6.356  -2.658  0.647   1.00 25.73 ? 273 ASN A CA  1 
ATOM   1031 C  C   . ASN A 1 133 ? 7.579  -3.475  1.051   1.00 23.98 ? 273 ASN A C   1 
ATOM   1032 O  O   . ASN A 1 133 ? 7.531  -4.704  1.093   1.00 23.42 ? 273 ASN A O   1 
ATOM   1033 C  CB  . ASN A 1 133 ? 5.316  -3.569  -0.016  1.00 28.49 ? 273 ASN A CB  1 
ATOM   1034 C  CG  . ASN A 1 133 ? 4.070  -2.806  -0.463  1.00 31.95 ? 273 ASN A CG  1 
ATOM   1035 O  OD1 . ASN A 1 133 ? 3.340  -2.245  0.357   1.00 34.85 ? 273 ASN A OD1 1 
ATOM   1036 N  ND2 . ASN A 1 133 ? 3.827  -2.781  -1.770  1.00 33.89 ? 273 ASN A ND2 1 
ATOM   1037 N  N   . ILE A 1 134 ? 8.672  -2.787  1.358   1.00 21.77 ? 274 ILE A N   1 
ATOM   1038 C  CA  . ILE A 1 134 ? 9.898  -3.451  1.780   1.00 19.21 ? 274 ILE A CA  1 
ATOM   1039 C  C   . ILE A 1 134 ? 9.947  -3.426  3.304   1.00 19.88 ? 274 ILE A C   1 
ATOM   1040 O  O   . ILE A 1 134 ? 9.932  -2.360  3.916   1.00 20.47 ? 274 ILE A O   1 
ATOM   1041 C  CB  . ILE A 1 134 ? 11.149 -2.735  1.201   1.00 16.80 ? 274 ILE A CB  1 
ATOM   1042 C  CG1 . ILE A 1 134 ? 11.152 -2.843  -0.325  1.00 16.06 ? 274 ILE A CG1 1 
ATOM   1043 C  CG2 . ILE A 1 134 ? 12.414 -3.343  1.757   1.00 12.22 ? 274 ILE A CG2 1 
ATOM   1044 C  CD1 . ILE A 1 134 ? 12.382 -2.228  -0.985  1.00 16.28 ? 274 ILE A CD1 1 
ATOM   1045 N  N   . GLN A 1 135 ? 9.976  -4.606  3.913   1.00 21.47 ? 275 GLN A N   1 
ATOM   1046 C  CA  . GLN A 1 135 ? 10.019 -4.725  5.367   1.00 21.31 ? 275 GLN A CA  1 
ATOM   1047 C  C   . GLN A 1 135 ? 11.458 -4.490  5.827   1.00 21.20 ? 275 GLN A C   1 
ATOM   1048 O  O   . GLN A 1 135 ? 12.384 -5.126  5.322   1.00 23.26 ? 275 GLN A O   1 
ATOM   1049 C  CB  . GLN A 1 135 ? 9.539  -6.115  5.774   1.00 22.63 ? 275 GLN A CB  1 
ATOM   1050 C  CG  . GLN A 1 135 ? 9.493  -6.361  7.263   1.00 26.80 ? 275 GLN A CG  1 
ATOM   1051 C  CD  . GLN A 1 135 ? 8.907  -7.718  7.589   1.00 30.30 ? 275 GLN A CD  1 
ATOM   1052 O  OE1 . GLN A 1 135 ? 9.104  -8.684  6.844   1.00 33.12 ? 275 GLN A OE1 1 
ATOM   1053 N  NE2 . GLN A 1 135 ? 8.194  -7.808  8.710   1.00 31.60 ? 275 GLN A NE2 1 
ATOM   1054 N  N   . ARG A 1 136 ? 11.640 -3.590  6.789   1.00 18.68 ? 276 ARG A N   1 
ATOM   1055 C  CA  . ARG A 1 136 ? 12.975 -3.245  7.262   1.00 19.11 ? 276 ARG A CA  1 
ATOM   1056 C  C   . ARG A 1 136 ? 13.345 -3.563  8.703   1.00 19.33 ? 276 ARG A C   1 
ATOM   1057 O  O   . ARG A 1 136 ? 12.672 -3.140  9.641   1.00 19.82 ? 276 ARG A O   1 
ATOM   1058 C  CB  . ARG A 1 136 ? 13.209 -1.754  7.049   1.00 20.55 ? 276 ARG A CB  1 
ATOM   1059 C  CG  . ARG A 1 136 ? 13.147 -1.303  5.612   1.00 23.62 ? 276 ARG A CG  1 
ATOM   1060 C  CD  . ARG A 1 136 ? 12.729 0.137   5.573   1.00 24.76 ? 276 ARG A CD  1 
ATOM   1061 N  NE  . ARG A 1 136 ? 11.322 0.256   5.935   1.00 30.43 ? 276 ARG A NE  1 
ATOM   1062 C  CZ  . ARG A 1 136 ? 10.807 1.281   6.600   1.00 31.18 ? 276 ARG A CZ  1 
ATOM   1063 N  NH1 . ARG A 1 136 ? 11.594 2.270   6.981   1.00 32.36 ? 276 ARG A NH1 1 
ATOM   1064 N  NH2 . ARG A 1 136 ? 9.510  1.321   6.871   1.00 30.50 ? 276 ARG A NH2 1 
ATOM   1065 N  N   . PHE A 1 137 ? 14.438 -4.297  8.870   1.00 19.09 ? 277 PHE A N   1 
ATOM   1066 C  CA  . PHE A 1 137 ? 14.954 -4.617  10.193  1.00 19.06 ? 277 PHE A CA  1 
ATOM   1067 C  C   . PHE A 1 137 ? 16.256 -3.832  10.325  1.00 18.72 ? 277 PHE A C   1 
ATOM   1068 O  O   . PHE A 1 137 ? 17.202 -4.059  9.564   1.00 19.54 ? 277 PHE A O   1 
ATOM   1069 C  CB  . PHE A 1 137 ? 15.261 -6.109  10.335  1.00 19.46 ? 277 PHE A CB  1 
ATOM   1070 C  CG  . PHE A 1 137 ? 14.042 -6.983  10.404  1.00 18.81 ? 277 PHE A CG  1 
ATOM   1071 C  CD1 . PHE A 1 137 ? 13.491 -7.527  9.251   1.00 18.00 ? 277 PHE A CD1 1 
ATOM   1072 C  CD2 . PHE A 1 137 ? 13.459 -7.283  11.630  1.00 18.01 ? 277 PHE A CD2 1 
ATOM   1073 C  CE1 . PHE A 1 137 ? 12.375 -8.362  9.319   1.00 20.96 ? 277 PHE A CE1 1 
ATOM   1074 C  CE2 . PHE A 1 137 ? 12.346 -8.116  11.710  1.00 19.03 ? 277 PHE A CE2 1 
ATOM   1075 C  CZ  . PHE A 1 137 ? 11.801 -8.657  10.556  1.00 19.03 ? 277 PHE A CZ  1 
ATOM   1076 N  N   . SER A 1 138 ? 16.299 -2.900  11.269  1.00 17.02 ? 278 SER A N   1 
ATOM   1077 C  CA  . SER A 1 138 ? 17.492 -2.096  11.482  1.00 14.55 ? 278 SER A CA  1 
ATOM   1078 C  C   . SER A 1 138 ? 18.179 -2.536  12.768  1.00 15.82 ? 278 SER A C   1 
ATOM   1079 O  O   . SER A 1 138 ? 17.525 -2.841  13.767  1.00 14.22 ? 278 SER A O   1 
ATOM   1080 C  CB  . SER A 1 138 ? 17.137 -0.605  11.554  1.00 15.17 ? 278 SER A CB  1 
ATOM   1081 O  OG  . SER A 1 138 ? 16.238 -0.331  12.618  1.00 15.62 ? 278 SER A OG  1 
ATOM   1082 N  N   . ILE A 1 139 ? 19.504 -2.569  12.729  1.00 14.85 ? 279 ILE A N   1 
ATOM   1083 C  CA  . ILE A 1 139 ? 20.300 -2.985  13.870  1.00 15.27 ? 279 ILE A CA  1 
ATOM   1084 C  C   . ILE A 1 139 ? 21.334 -1.914  14.155  1.00 16.59 ? 279 ILE A C   1 
ATOM   1085 O  O   . ILE A 1 139 ? 22.104 -1.537  13.274  1.00 16.76 ? 279 ILE A O   1 
ATOM   1086 C  CB  . ILE A 1 139 ? 21.034 -4.305  13.571  1.00 15.10 ? 279 ILE A CB  1 
ATOM   1087 C  CG1 . ILE A 1 139 ? 20.019 -5.388  13.204  1.00 12.48 ? 279 ILE A CG1 1 
ATOM   1088 C  CG2 . ILE A 1 139 ? 21.879 -4.721  14.770  1.00 12.22 ? 279 ILE A CG2 1 
ATOM   1089 C  CD1 . ILE A 1 139 ? 20.647 -6.591  12.553  1.00 11.48 ? 279 ILE A CD1 1 
ATOM   1090 N  N   . ALA A 1 140 ? 21.339 -1.419  15.386  1.00 17.03 ? 280 ALA A N   1 
ATOM   1091 C  CA  . ALA A 1 140 ? 22.288 -0.395  15.784  1.00 17.44 ? 280 ALA A CA  1 
ATOM   1092 C  C   . ALA A 1 140 ? 23.287 -0.982  16.768  1.00 17.27 ? 280 ALA A C   1 
ATOM   1093 O  O   . ALA A 1 140 ? 22.911 -1.508  17.814  1.00 17.62 ? 280 ALA A O   1 
ATOM   1094 C  CB  . ALA A 1 140 ? 21.565 0.774   16.421  1.00 16.08 ? 280 ALA A CB  1 
ATOM   1095 N  N   . ILE A 1 141 ? 24.561 -0.897  16.409  1.00 15.56 ? 281 ILE A N   1 
ATOM   1096 C  CA  . ILE A 1 141 ? 25.639 -1.387  17.243  1.00 13.97 ? 281 ILE A CA  1 
ATOM   1097 C  C   . ILE A 1 141 ? 26.189 -0.179  18.003  1.00 15.57 ? 281 ILE A C   1 
ATOM   1098 O  O   . ILE A 1 141 ? 26.741 0.745   17.401  1.00 15.11 ? 281 ILE A O   1 
ATOM   1099 C  CB  . ILE A 1 141 ? 26.734 -2.031  16.369  1.00 12.87 ? 281 ILE A CB  1 
ATOM   1100 C  CG1 . ILE A 1 141 ? 26.139 -3.243  15.632  1.00 11.67 ? 281 ILE A CG1 1 
ATOM   1101 C  CG2 . ILE A 1 141 ? 27.935 -2.422  17.232  1.00 12.82 ? 281 ILE A CG2 1 
ATOM   1102 C  CD1 . ILE A 1 141 ? 27.094 -3.947  14.673  1.00 9.77  ? 281 ILE A CD1 1 
ATOM   1103 N  N   . LEU A 1 142 ? 26.015 -0.179  19.322  1.00 15.44 ? 282 LEU A N   1 
ATOM   1104 C  CA  . LEU A 1 142 ? 26.474 0.934   20.144  1.00 17.59 ? 282 LEU A CA  1 
ATOM   1105 C  C   . LEU A 1 142 ? 27.914 0.776   20.624  1.00 17.27 ? 282 LEU A C   1 
ATOM   1106 O  O   . LEU A 1 142 ? 28.371 1.524   21.489  1.00 15.36 ? 282 LEU A O   1 
ATOM   1107 C  CB  . LEU A 1 142 ? 25.539 1.113   21.346  1.00 18.32 ? 282 LEU A CB  1 
ATOM   1108 C  CG  . LEU A 1 142 ? 24.186 1.803   21.101  1.00 20.52 ? 282 LEU A CG  1 
ATOM   1109 C  CD1 . LEU A 1 142 ? 23.396 1.066   20.029  1.00 18.36 ? 282 LEU A CD1 1 
ATOM   1110 C  CD2 . LEU A 1 142 ? 23.398 1.861   22.419  1.00 19.01 ? 282 LEU A CD2 1 
ATOM   1111 N  N   . GLY A 1 143 ? 28.627 -0.175  20.023  1.00 17.31 ? 283 GLY A N   1 
ATOM   1112 C  CA  . GLY A 1 143 ? 30.007 -0.456  20.391  1.00 18.62 ? 283 GLY A CA  1 
ATOM   1113 C  C   . GLY A 1 143 ? 31.049 0.656   20.327  1.00 18.39 ? 283 GLY A C   1 
ATOM   1114 O  O   . GLY A 1 143 ? 31.684 0.969   21.338  1.00 17.73 ? 283 GLY A O   1 
ATOM   1115 N  N   . SER A 1 144 ? 31.247 1.244   19.152  1.00 17.37 ? 284 SER A N   1 
ATOM   1116 C  CA  . SER A 1 144 ? 32.240 2.305   19.006  1.00 16.98 ? 284 SER A CA  1 
ATOM   1117 C  C   . SER A 1 144 ? 31.835 3.583   19.732  1.00 17.08 ? 284 SER A C   1 
ATOM   1118 O  O   . SER A 1 144 ? 32.692 4.327   20.209  1.00 17.13 ? 284 SER A O   1 
ATOM   1119 C  CB  . SER A 1 144 ? 32.493 2.608   17.530  1.00 15.84 ? 284 SER A CB  1 
ATOM   1120 O  OG  . SER A 1 144 ? 31.284 2.912   16.854  1.00 20.03 ? 284 SER A OG  1 
ATOM   1121 N  N   . TYR A 1 145 ? 30.533 3.834   19.814  1.00 17.02 ? 285 TYR A N   1 
ATOM   1122 C  CA  . TYR A 1 145 ? 30.032 5.020   20.500  1.00 17.53 ? 285 TYR A CA  1 
ATOM   1123 C  C   . TYR A 1 145 ? 30.337 4.930   21.999  1.00 18.50 ? 285 TYR A C   1 
ATOM   1124 O  O   . TYR A 1 145 ? 30.961 5.825   22.570  1.00 18.09 ? 285 TYR A O   1 
ATOM   1125 C  CB  . TYR A 1 145 ? 28.518 5.167   20.264  1.00 18.28 ? 285 TYR A CB  1 
ATOM   1126 C  CG  . TYR A 1 145 ? 28.162 6.060   19.089  1.00 18.58 ? 285 TYR A CG  1 
ATOM   1127 C  CD1 . TYR A 1 145 ? 28.802 5.923   17.853  1.00 18.84 ? 285 TYR A CD1 1 
ATOM   1128 C  CD2 . TYR A 1 145 ? 27.190 7.051   19.217  1.00 18.03 ? 285 TYR A CD2 1 
ATOM   1129 C  CE1 . TYR A 1 145 ? 28.480 6.753   16.773  1.00 19.28 ? 285 TYR A CE1 1 
ATOM   1130 C  CE2 . TYR A 1 145 ? 26.858 7.883   18.152  1.00 20.88 ? 285 TYR A CE2 1 
ATOM   1131 C  CZ  . TYR A 1 145 ? 27.506 7.732   16.932  1.00 21.54 ? 285 TYR A CZ  1 
ATOM   1132 O  OH  . TYR A 1 145 ? 27.173 8.562   15.885  1.00 21.86 ? 285 TYR A OH  1 
ATOM   1133 N  N   . ASN A 1 146 ? 29.905 3.845   22.629  1.00 18.57 ? 286 ASN A N   1 
ATOM   1134 C  CA  . ASN A 1 146 ? 30.153 3.650   24.052  1.00 20.00 ? 286 ASN A CA  1 
ATOM   1135 C  C   . ASN A 1 146 ? 31.653 3.685   24.352  1.00 19.25 ? 286 ASN A C   1 
ATOM   1136 O  O   . ASN A 1 146 ? 32.086 4.337   25.305  1.00 18.01 ? 286 ASN A O   1 
ATOM   1137 C  CB  . ASN A 1 146 ? 29.557 2.320   24.515  1.00 16.41 ? 286 ASN A CB  1 
ATOM   1138 C  CG  . ASN A 1 146 ? 28.041 2.348   24.577  1.00 16.77 ? 286 ASN A CG  1 
ATOM   1139 O  OD1 . ASN A 1 146 ? 27.399 1.301   24.658  1.00 19.68 ? 286 ASN A OD1 1 
ATOM   1140 N  ND2 . ASN A 1 146 ? 27.462 3.546   24.554  1.00 12.48 ? 286 ASN A ND2 1 
ATOM   1141 N  N   . ARG A 1 147 ? 32.441 2.994   23.534  1.00 20.53 ? 287 ARG A N   1 
ATOM   1142 C  CA  . ARG A 1 147 ? 33.893 2.966   23.724  1.00 22.63 ? 287 ARG A CA  1 
ATOM   1143 C  C   . ARG A 1 147 ? 34.508 4.352   23.546  1.00 24.16 ? 287 ARG A C   1 
ATOM   1144 O  O   . ARG A 1 147 ? 35.606 4.620   24.042  1.00 25.89 ? 287 ARG A O   1 
ATOM   1145 C  CB  . ARG A 1 147 ? 34.556 1.988   22.746  1.00 19.69 ? 287 ARG A CB  1 
ATOM   1146 C  CG  . ARG A 1 147 ? 34.211 0.527   22.989  1.00 17.10 ? 287 ARG A CG  1 
ATOM   1147 C  CD  . ARG A 1 147 ? 35.220 -0.381  22.316  1.00 14.23 ? 287 ARG A CD  1 
ATOM   1148 N  NE  . ARG A 1 147 ? 35.141 -0.341  20.860  1.00 13.79 ? 287 ARG A NE  1 
ATOM   1149 C  CZ  . ARG A 1 147 ? 34.249 -1.014  20.140  1.00 12.64 ? 287 ARG A CZ  1 
ATOM   1150 N  NH1 . ARG A 1 147 ? 33.358 -1.780  20.749  1.00 11.04 ? 287 ARG A NH1 1 
ATOM   1151 N  NH2 . ARG A 1 147 ? 34.258 -0.936  18.810  1.00 10.20 ? 287 ARG A NH2 1 
ATOM   1152 N  N   . GLY A 1 148 ? 33.804 5.222   22.828  1.00 24.79 ? 288 GLY A N   1 
ATOM   1153 C  CA  . GLY A 1 148 ? 34.297 6.570   22.609  1.00 25.72 ? 288 GLY A CA  1 
ATOM   1154 C  C   . GLY A 1 148 ? 33.625 7.547   23.558  1.00 28.17 ? 288 GLY A C   1 
ATOM   1155 O  O   . GLY A 1 148 ? 33.871 8.751   23.501  1.00 27.71 ? 288 GLY A O   1 
ATOM   1156 N  N   . ASN A 1 149 ? 32.774 7.014   24.433  1.00 28.92 ? 289 ASN A N   1 
ATOM   1157 C  CA  . ASN A 1 149 ? 32.040 7.808   25.411  1.00 30.39 ? 289 ASN A CA  1 
ATOM   1158 C  C   . ASN A 1 149 ? 31.130 8.842   24.738  1.00 30.80 ? 289 ASN A C   1 
ATOM   1159 O  O   . ASN A 1 149 ? 30.962 9.957   25.238  1.00 29.66 ? 289 ASN A O   1 
ATOM   1160 C  CB  . ASN A 1 149 ? 33.015 8.516   26.354  1.00 33.96 ? 289 ASN A CB  1 
ATOM   1161 C  CG  . ASN A 1 149 ? 32.318 9.138   27.553  1.00 37.65 ? 289 ASN A CG  1 
ATOM   1162 O  OD1 . ASN A 1 149 ? 32.872 10.012  28.222  1.00 40.00 ? 289 ASN A OD1 1 
ATOM   1163 N  ND2 . ASN A 1 149 ? 31.101 8.681   27.837  1.00 38.76 ? 289 ASN A ND2 1 
ATOM   1164 N  N   . LEU A 1 150 ? 30.540 8.464   23.607  1.00 29.84 ? 290 LEU A N   1 
ATOM   1165 C  CA  . LEU A 1 150 ? 29.652 9.358   22.870  1.00 28.91 ? 290 LEU A CA  1 
ATOM   1166 C  C   . LEU A 1 150 ? 28.188 9.061   23.171  1.00 28.00 ? 290 LEU A C   1 
ATOM   1167 O  O   . LEU A 1 150 ? 27.805 7.908   23.374  1.00 27.42 ? 290 LEU A O   1 
ATOM   1168 C  CB  . LEU A 1 150 ? 29.873 9.215   21.361  1.00 27.71 ? 290 LEU A CB  1 
ATOM   1169 C  CG  . LEU A 1 150 ? 31.281 9.379   20.794  1.00 28.16 ? 290 LEU A CG  1 
ATOM   1170 C  CD1 . LEU A 1 150 ? 31.228 9.171   19.286  1.00 29.00 ? 290 LEU A CD1 1 
ATOM   1171 C  CD2 . LEU A 1 150 ? 31.827 10.762  21.121  1.00 28.08 ? 290 LEU A CD2 1 
ATOM   1172 N  N   . SER A 1 151 ? 27.377 10.113  23.190  1.00 26.83 ? 291 SER A N   1 
ATOM   1173 C  CA  . SER A 1 151 ? 25.950 9.984   23.434  1.00 25.92 ? 291 SER A CA  1 
ATOM   1174 C  C   . SER A 1 151 ? 25.333 9.179   22.291  1.00 25.45 ? 291 SER A C   1 
ATOM   1175 O  O   . SER A 1 151 ? 25.601 9.453   21.127  1.00 22.93 ? 291 SER A O   1 
ATOM   1176 C  CB  . SER A 1 151 ? 25.309 11.373  23.493  1.00 26.17 ? 291 SER A CB  1 
ATOM   1177 O  OG  . SER A 1 151 ? 23.913 11.270  23.686  1.00 29.42 ? 291 SER A OG  1 
ATOM   1178 N  N   . THR A 1 152 ? 24.506 8.193   22.628  1.00 26.55 ? 292 THR A N   1 
ATOM   1179 C  CA  . THR A 1 152 ? 23.869 7.346   21.622  1.00 27.88 ? 292 THR A CA  1 
ATOM   1180 C  C   . THR A 1 152 ? 22.375 7.606   21.436  1.00 29.52 ? 292 THR A C   1 
ATOM   1181 O  O   . THR A 1 152 ? 21.722 6.911   20.665  1.00 30.68 ? 292 THR A O   1 
ATOM   1182 C  CB  . THR A 1 152 ? 24.024 5.860   21.974  1.00 27.31 ? 292 THR A CB  1 
ATOM   1183 O  OG1 . THR A 1 152 ? 23.567 5.641   23.317  1.00 23.87 ? 292 THR A OG1 1 
ATOM   1184 C  CG2 . THR A 1 152 ? 25.468 5.423   21.839  1.00 25.44 ? 292 THR A CG2 1 
ATOM   1185 N  N   . GLU A 1 153 ? 21.838 8.597   22.140  1.00 30.95 ? 293 GLU A N   1 
ATOM   1186 C  CA  . GLU A 1 153 ? 20.414 8.916   22.054  1.00 32.39 ? 293 GLU A CA  1 
ATOM   1187 C  C   . GLU A 1 153 ? 19.917 9.172   20.631  1.00 30.01 ? 293 GLU A C   1 
ATOM   1188 O  O   . GLU A 1 153 ? 19.005 8.491   20.156  1.00 29.51 ? 293 GLU A O   1 
ATOM   1189 C  CB  . GLU A 1 153 ? 20.095 10.125  22.933  1.00 35.48 ? 293 GLU A CB  1 
ATOM   1190 C  CG  . GLU A 1 153 ? 20.583 9.986   24.364  1.00 41.31 ? 293 GLU A CG  1 
ATOM   1191 C  CD  . GLU A 1 153 ? 20.170 8.671   24.997  1.00 44.93 ? 293 GLU A CD  1 
ATOM   1192 O  OE1 . GLU A 1 153 ? 18.961 8.347   24.970  1.00 47.55 ? 293 GLU A OE1 1 
ATOM   1193 O  OE2 . GLU A 1 153 ? 21.054 7.963   25.526  1.00 47.13 ? 293 GLU A OE2 1 
ATOM   1194 N  N   . LYS A 1 154 ? 20.502 10.160  19.960  1.00 28.06 ? 294 LYS A N   1 
ATOM   1195 C  CA  . LYS A 1 154 ? 20.113 10.488  18.588  1.00 27.17 ? 294 LYS A CA  1 
ATOM   1196 C  C   . LYS A 1 154 ? 20.343 9.312   17.638  1.00 24.65 ? 294 LYS A C   1 
ATOM   1197 O  O   . LYS A 1 154 ? 19.522 9.038   16.762  1.00 21.91 ? 294 LYS A O   1 
ATOM   1198 C  CB  . LYS A 1 154 ? 20.909 11.687  18.072  1.00 30.71 ? 294 LYS A CB  1 
ATOM   1199 C  CG  . LYS A 1 154 ? 20.535 13.027  18.676  1.00 36.46 ? 294 LYS A CG  1 
ATOM   1200 C  CD  . LYS A 1 154 ? 21.274 14.145  17.952  1.00 39.74 ? 294 LYS A CD  1 
ATOM   1201 C  CE  . LYS A 1 154 ? 20.872 15.515  18.467  1.00 43.94 ? 294 LYS A CE  1 
ATOM   1202 N  NZ  . LYS A 1 154 ? 21.509 16.603  17.668  1.00 45.58 ? 294 LYS A NZ  1 
ATOM   1203 N  N   . PHE A 1 155 ? 21.474 8.635   17.811  1.00 21.32 ? 295 PHE A N   1 
ATOM   1204 C  CA  . PHE A 1 155 ? 21.823 7.497   16.980  1.00 20.48 ? 295 PHE A CA  1 
ATOM   1205 C  C   . PHE A 1 155 ? 20.731 6.427   17.055  1.00 20.91 ? 295 PHE A C   1 
ATOM   1206 O  O   . PHE A 1 155 ? 20.195 6.005   16.026  1.00 17.66 ? 295 PHE A O   1 
ATOM   1207 C  CB  . PHE A 1 155 ? 23.185 6.940   17.422  1.00 20.79 ? 295 PHE A CB  1 
ATOM   1208 C  CG  . PHE A 1 155 ? 23.572 5.645   16.749  1.00 23.39 ? 295 PHE A CG  1 
ATOM   1209 C  CD1 . PHE A 1 155 ? 23.381 5.465   15.383  1.00 22.06 ? 295 PHE A CD1 1 
ATOM   1210 C  CD2 . PHE A 1 155 ? 24.168 4.621   17.484  1.00 23.44 ? 295 PHE A CD2 1 
ATOM   1211 C  CE1 . PHE A 1 155 ? 23.780 4.288   14.756  1.00 23.83 ? 295 PHE A CE1 1 
ATOM   1212 C  CE2 . PHE A 1 155 ? 24.572 3.439   16.868  1.00 25.87 ? 295 PHE A CE2 1 
ATOM   1213 C  CZ  . PHE A 1 155 ? 24.377 3.272   15.499  1.00 26.45 ? 295 PHE A CZ  1 
ATOM   1214 N  N   . VAL A 1 156 ? 20.389 6.007   18.269  1.00 19.14 ? 296 VAL A N   1 
ATOM   1215 C  CA  . VAL A 1 156 ? 19.351 4.996   18.453  1.00 20.09 ? 296 VAL A CA  1 
ATOM   1216 C  C   . VAL A 1 156 ? 18.036 5.455   17.833  1.00 21.55 ? 296 VAL A C   1 
ATOM   1217 O  O   . VAL A 1 156 ? 17.361 4.690   17.143  1.00 22.44 ? 296 VAL A O   1 
ATOM   1218 C  CB  . VAL A 1 156 ? 19.135 4.695   19.949  1.00 20.81 ? 296 VAL A CB  1 
ATOM   1219 C  CG1 . VAL A 1 156 ? 17.831 3.921   20.159  1.00 18.68 ? 296 VAL A CG1 1 
ATOM   1220 C  CG2 . VAL A 1 156 ? 20.318 3.891   20.479  1.00 20.62 ? 296 VAL A CG2 1 
ATOM   1221 N  N   . GLU A 1 157 ? 17.673 6.706   18.086  1.00 22.66 ? 297 GLU A N   1 
ATOM   1222 C  CA  . GLU A 1 157 ? 16.444 7.274   17.547  1.00 23.59 ? 297 GLU A CA  1 
ATOM   1223 C  C   . GLU A 1 157 ? 16.452 7.253   16.017  1.00 22.27 ? 297 GLU A C   1 
ATOM   1224 O  O   . GLU A 1 157 ? 15.428 7.000   15.384  1.00 21.33 ? 297 GLU A O   1 
ATOM   1225 C  CB  . GLU A 1 157 ? 16.278 8.709   18.067  1.00 27.41 ? 297 GLU A CB  1 
ATOM   1226 C  CG  . GLU A 1 157 ? 15.386 9.607   17.240  1.00 33.34 ? 297 GLU A CG  1 
ATOM   1227 C  CD  . GLU A 1 157 ? 15.224 10.991  17.859  1.00 39.45 ? 297 GLU A CD  1 
ATOM   1228 O  OE1 . GLU A 1 157 ? 14.477 11.119  18.852  1.00 41.45 ? 297 GLU A OE1 1 
ATOM   1229 O  OE2 . GLU A 1 157 ? 15.850 11.949  17.359  1.00 40.91 ? 297 GLU A OE2 1 
ATOM   1230 N  N   . GLU A 1 158 ? 17.613 7.500   15.426  1.00 21.50 ? 298 GLU A N   1 
ATOM   1231 C  CA  . GLU A 1 158 ? 17.724 7.503   13.973  1.00 22.68 ? 298 GLU A CA  1 
ATOM   1232 C  C   . GLU A 1 158 ? 17.571 6.112   13.346  1.00 22.48 ? 298 GLU A C   1 
ATOM   1233 O  O   . GLU A 1 158 ? 16.816 5.939   12.394  1.00 21.92 ? 298 GLU A O   1 
ATOM   1234 C  CB  . GLU A 1 158 ? 19.061 8.121   13.554  1.00 22.22 ? 298 GLU A CB  1 
ATOM   1235 C  CG  . GLU A 1 158 ? 19.348 8.063   12.055  1.00 24.23 ? 298 GLU A CG  1 
ATOM   1236 C  CD  . GLU A 1 158 ? 20.694 8.676   11.696  1.00 24.78 ? 298 GLU A CD  1 
ATOM   1237 O  OE1 . GLU A 1 158 ? 21.434 8.076   10.892  1.00 23.51 ? 298 GLU A OE1 1 
ATOM   1238 O  OE2 . GLU A 1 158 ? 21.010 9.764   12.219  1.00 27.64 ? 298 GLU A OE2 1 
ATOM   1239 N  N   . ILE A 1 159 ? 18.287 5.126   13.879  1.00 22.56 ? 299 ILE A N   1 
ATOM   1240 C  CA  . ILE A 1 159 ? 18.227 3.767   13.345  1.00 23.80 ? 299 ILE A CA  1 
ATOM   1241 C  C   . ILE A 1 159 ? 16.833 3.185   13.565  1.00 24.09 ? 299 ILE A C   1 
ATOM   1242 O  O   . ILE A 1 159 ? 16.321 2.416   12.746  1.00 23.87 ? 299 ILE A O   1 
ATOM   1243 C  CB  . ILE A 1 159 ? 19.292 2.865   14.019  1.00 22.41 ? 299 ILE A CB  1 
ATOM   1244 C  CG1 . ILE A 1 159 ? 20.667 3.527   13.905  1.00 21.30 ? 299 ILE A CG1 1 
ATOM   1245 C  CG2 . ILE A 1 159 ? 19.307 1.489   13.380  1.00 20.58 ? 299 ILE A CG2 1 
ATOM   1246 C  CD1 . ILE A 1 159 ? 21.015 4.022   12.498  1.00 17.25 ? 299 ILE A CD1 1 
ATOM   1247 N  N   . LYS A 1 160 ? 16.229 3.576   14.681  1.00 24.25 ? 300 LYS A N   1 
ATOM   1248 C  CA  . LYS A 1 160 ? 14.887 3.145   15.051  1.00 22.48 ? 300 LYS A CA  1 
ATOM   1249 C  C   . LYS A 1 160 ? 13.903 3.635   13.990  1.00 19.34 ? 300 LYS A C   1 
ATOM   1250 O  O   . LYS A 1 160 ? 12.985 2.914   13.599  1.00 20.45 ? 300 LYS A O   1 
ATOM   1251 C  CB  . LYS A 1 160 ? 14.518 3.756   16.406  1.00 25.46 ? 300 LYS A CB  1 
ATOM   1252 C  CG  . LYS A 1 160 ? 13.875 2.811   17.403  1.00 27.96 ? 300 LYS A CG  1 
ATOM   1253 C  CD  . LYS A 1 160 ? 13.868 3.455   18.785  1.00 30.32 ? 300 LYS A CD  1 
ATOM   1254 C  CE  . LYS A 1 160 ? 13.475 2.467   19.862  1.00 33.65 ? 300 LYS A CE  1 
ATOM   1255 N  NZ  . LYS A 1 160 ? 13.647 3.050   21.222  1.00 35.11 ? 300 LYS A NZ  1 
ATOM   1256 N  N   . SER A 1 161 ? 14.097 4.866   13.529  1.00 17.44 ? 301 SER A N   1 
ATOM   1257 C  CA  . SER A 1 161 ? 13.214 5.441   12.520  1.00 17.85 ? 301 SER A CA  1 
ATOM   1258 C  C   . SER A 1 161 ? 13.279 4.658   11.205  1.00 16.46 ? 301 SER A C   1 
ATOM   1259 O  O   . SER A 1 161 ? 12.384 4.758   10.373  1.00 16.74 ? 301 SER A O   1 
ATOM   1260 C  CB  . SER A 1 161 ? 13.569 6.914   12.265  1.00 17.67 ? 301 SER A CB  1 
ATOM   1261 O  OG  . SER A 1 161 ? 14.774 7.045   11.526  1.00 18.95 ? 301 SER A OG  1 
ATOM   1262 N  N   . ILE A 1 162 ? 14.336 3.875   11.026  1.00 15.70 ? 302 ILE A N   1 
ATOM   1263 C  CA  . ILE A 1 162 ? 14.496 3.090   9.809   1.00 16.89 ? 302 ILE A CA  1 
ATOM   1264 C  C   . ILE A 1 162 ? 13.628 1.841   9.849   1.00 16.44 ? 302 ILE A C   1 
ATOM   1265 O  O   . ILE A 1 162 ? 13.093 1.415   8.827   1.00 14.25 ? 302 ILE A O   1 
ATOM   1266 C  CB  . ILE A 1 162 ? 15.974 2.665   9.613   1.00 19.04 ? 302 ILE A CB  1 
ATOM   1267 C  CG1 . ILE A 1 162 ? 16.834 3.893   9.300   1.00 19.79 ? 302 ILE A CG1 1 
ATOM   1268 C  CG2 . ILE A 1 162 ? 16.086 1.644   8.502   1.00 19.78 ? 302 ILE A CG2 1 
ATOM   1269 C  CD1 . ILE A 1 162 ? 18.309 3.581   9.159   1.00 20.27 ? 302 ILE A CD1 1 
ATOM   1270 N  N   . ALA A 1 163 ? 13.480 1.269   11.039  1.00 17.14 ? 303 ALA A N   1 
ATOM   1271 C  CA  . ALA A 1 163 ? 12.697 0.045   11.231  1.00 19.44 ? 303 ALA A CA  1 
ATOM   1272 C  C   . ALA A 1 163 ? 11.214 0.142   10.872  1.00 20.71 ? 303 ALA A C   1 
ATOM   1273 O  O   . ALA A 1 163 ? 10.593 1.191   11.025  1.00 20.15 ? 303 ALA A O   1 
ATOM   1274 C  CB  . ALA A 1 163 ? 12.840 -0.426  12.679  1.00 18.53 ? 303 ALA A CB  1 
ATOM   1275 N  N   . SER A 1 164 ? 10.661 -0.971  10.393  1.00 21.67 ? 304 SER A N   1 
ATOM   1276 C  CA  . SER A 1 164 ? 9.246  -1.058  10.044  1.00 23.05 ? 304 SER A CA  1 
ATOM   1277 C  C   . SER A 1 164 ? 8.492  -1.186  11.362  1.00 25.76 ? 304 SER A C   1 
ATOM   1278 O  O   . SER A 1 164 ? 9.073  -1.582  12.370  1.00 24.07 ? 304 SER A O   1 
ATOM   1279 C  CB  . SER A 1 164 ? 8.975  -2.311  9.207   1.00 24.24 ? 304 SER A CB  1 
ATOM   1280 O  OG  . SER A 1 164 ? 9.540  -2.226  7.910   1.00 26.56 ? 304 SER A OG  1 
ATOM   1281 N  N   . GLU A 1 165 ? 7.204  -0.864  11.359  1.00 28.64 ? 305 GLU A N   1 
ATOM   1282 C  CA  . GLU A 1 165 ? 6.414  -0.980  12.575  1.00 31.62 ? 305 GLU A CA  1 
ATOM   1283 C  C   . GLU A 1 165 ? 5.832  -2.376  12.625  1.00 31.89 ? 305 GLU A C   1 
ATOM   1284 O  O   . GLU A 1 165 ? 5.598  -2.987  11.579  1.00 32.05 ? 305 GLU A O   1 
ATOM   1285 C  CB  . GLU A 1 165 ? 5.306  0.071   12.602  1.00 36.55 ? 305 GLU A CB  1 
ATOM   1286 C  CG  . GLU A 1 165 ? 5.443  0.966   13.813  1.00 43.43 ? 305 GLU A CG  1 
ATOM   1287 C  CD  . GLU A 1 165 ? 5.023  2.384   13.552  1.00 47.46 ? 305 GLU A CD  1 
ATOM   1288 O  OE1 . GLU A 1 165 ? 5.320  2.894   12.451  1.00 48.84 ? 305 GLU A OE1 1 
ATOM   1289 O  OE2 . GLU A 1 165 ? 4.412  2.992   14.459  1.00 50.07 ? 305 GLU A OE2 1 
ATOM   1290 N  N   . PRO A 1 166 ? 5.555  -2.900  13.834  1.00 31.78 ? 306 PRO A N   1 
ATOM   1291 C  CA  . PRO A 1 166 ? 5.682  -2.403  15.214  1.00 32.85 ? 306 PRO A CA  1 
ATOM   1292 C  C   . PRO A 1 166 ? 6.861  -1.481  15.547  1.00 33.58 ? 306 PRO A C   1 
ATOM   1293 O  O   . PRO A 1 166 ? 6.642  -0.325  15.927  1.00 36.34 ? 306 PRO A O   1 
ATOM   1294 C  CB  . PRO A 1 166 ? 5.701  -3.685  16.044  1.00 32.97 ? 306 PRO A CB  1 
ATOM   1295 C  CG  . PRO A 1 166 ? 4.852  -4.619  15.239  1.00 31.48 ? 306 PRO A CG  1 
ATOM   1296 C  CD  . PRO A 1 166 ? 5.328  -4.356  13.833  1.00 31.41 ? 306 PRO A CD  1 
ATOM   1297 N  N   . THR A 1 167 ? 8.087  -1.987  15.406  1.00 31.37 ? 307 THR A N   1 
ATOM   1298 C  CA  . THR A 1 167 ? 9.329  -1.239  15.698  1.00 32.61 ? 307 THR A CA  1 
ATOM   1299 C  C   . THR A 1 167 ? 10.123 -1.975  16.763  1.00 32.04 ? 307 THR A C   1 
ATOM   1300 O  O   . THR A 1 167 ? 11.269 -2.346  16.542  1.00 30.14 ? 307 THR A O   1 
ATOM   1301 C  CB  . THR A 1 167 ? 9.087  0.201   16.213  1.00 32.58 ? 307 THR A CB  1 
ATOM   1302 O  OG1 . THR A 1 167 ? 8.608  1.022   15.142  1.00 36.37 ? 307 THR A OG1 1 
ATOM   1303 C  CG2 . THR A 1 167 ? 10.382 0.810   16.750  1.00 32.92 ? 307 THR A CG2 1 
ATOM   1304 N  N   . GLU A 1 168 ? 9.495  -2.193  17.913  1.00 33.03 ? 308 GLU A N   1 
ATOM   1305 C  CA  . GLU A 1 168 ? 10.129 -2.917  19.004  1.00 35.44 ? 308 GLU A CA  1 
ATOM   1306 C  C   . GLU A 1 168 ? 10.453 -4.308  18.469  1.00 34.71 ? 308 GLU A C   1 
ATOM   1307 O  O   . GLU A 1 168 ? 11.236 -5.052  19.065  1.00 35.06 ? 308 GLU A O   1 
ATOM   1308 C  CB  . GLU A 1 168 ? 9.169  -3.045  20.189  1.00 38.86 ? 308 GLU A CB  1 
ATOM   1309 C  CG  . GLU A 1 168 ? 8.523  -1.738  20.640  1.00 44.91 ? 308 GLU A CG  1 
ATOM   1310 C  CD  . GLU A 1 168 ? 7.621  -1.124  19.579  1.00 48.82 ? 308 GLU A CD  1 
ATOM   1311 O  OE1 . GLU A 1 168 ? 6.780  -1.859  19.017  1.00 48.60 ? 308 GLU A OE1 1 
ATOM   1312 O  OE2 . GLU A 1 168 ? 7.750  0.092   19.312  1.00 52.95 ? 308 GLU A OE2 1 
ATOM   1313 N  N   . LYS A 1 169 ? 9.838  -4.650  17.338  1.00 32.92 ? 309 LYS A N   1 
ATOM   1314 C  CA  . LYS A 1 169 ? 10.051 -5.948  16.709  1.00 32.73 ? 309 LYS A CA  1 
ATOM   1315 C  C   . LYS A 1 169 ? 11.026 -5.912  15.533  1.00 29.21 ? 309 LYS A C   1 
ATOM   1316 O  O   . LYS A 1 169 ? 11.662 -6.923  15.221  1.00 28.86 ? 309 LYS A O   1 
ATOM   1317 C  CB  . LYS A 1 169 ? 8.710  -6.528  16.247  1.00 35.02 ? 309 LYS A CB  1 
ATOM   1318 C  CG  . LYS A 1 169 ? 7.860  -7.070  17.394  1.00 40.37 ? 309 LYS A CG  1 
ATOM   1319 C  CD  . LYS A 1 169 ? 8.475  -8.335  17.982  1.00 42.94 ? 309 LYS A CD  1 
ATOM   1320 C  CE  . LYS A 1 169 ? 7.819  -8.730  19.299  1.00 44.70 ? 309 LYS A CE  1 
ATOM   1321 N  NZ  . LYS A 1 169 ? 8.184  -7.789  20.397  1.00 46.81 ? 309 LYS A NZ  1 
ATOM   1322 N  N   . HIS A 1 170 ? 11.147 -4.758  14.885  1.00 25.59 ? 310 HIS A N   1 
ATOM   1323 C  CA  . HIS A 1 170 ? 12.043 -4.635  13.736  1.00 24.81 ? 310 HIS A CA  1 
ATOM   1324 C  C   . HIS A 1 170 ? 13.374 -3.946  14.048  1.00 22.18 ? 310 HIS A C   1 
ATOM   1325 O  O   . HIS A 1 170 ? 14.308 -4.003  13.252  1.00 22.32 ? 310 HIS A O   1 
ATOM   1326 C  CB  . HIS A 1 170 ? 11.339 -3.902  12.590  1.00 22.91 ? 310 HIS A CB  1 
ATOM   1327 C  CG  . HIS A 1 170 ? 10.181 -4.656  12.013  1.00 24.74 ? 310 HIS A CG  1 
ATOM   1328 N  ND1 . HIS A 1 170 ? 8.915  -4.605  12.551  1.00 24.62 ? 310 HIS A ND1 1 
ATOM   1329 C  CD2 . HIS A 1 170 ? 10.106 -5.506  10.958  1.00 25.70 ? 310 HIS A CD2 1 
ATOM   1330 C  CE1 . HIS A 1 170 ? 8.109  -5.389  11.856  1.00 26.00 ? 310 HIS A CE1 1 
ATOM   1331 N  NE2 . HIS A 1 170 ? 8.810  -5.947  10.883  1.00 25.02 ? 310 HIS A NE2 1 
ATOM   1332 N  N   . PHE A 1 171 ? 13.455 -3.301  15.206  1.00 20.25 ? 311 PHE A N   1 
ATOM   1333 C  CA  . PHE A 1 171 ? 14.668 -2.617  15.619  1.00 20.15 ? 311 PHE A CA  1 
ATOM   1334 C  C   . PHE A 1 171 ? 15.434 -3.401  16.687  1.00 20.09 ? 311 PHE A C   1 
ATOM   1335 O  O   . PHE A 1 171 ? 14.847 -3.924  17.630  1.00 20.86 ? 311 PHE A O   1 
ATOM   1336 C  CB  . PHE A 1 171 ? 14.334 -1.232  16.161  1.00 18.78 ? 311 PHE A CB  1 
ATOM   1337 C  CG  . PHE A 1 171 ? 15.497 -0.543  16.802  1.00 19.90 ? 311 PHE A CG  1 
ATOM   1338 C  CD1 . PHE A 1 171 ? 16.575 -0.118  16.039  1.00 18.37 ? 311 PHE A CD1 1 
ATOM   1339 C  CD2 . PHE A 1 171 ? 15.522 -0.327  18.178  1.00 20.28 ? 311 PHE A CD2 1 
ATOM   1340 C  CE1 . PHE A 1 171 ? 17.663 0.519   16.638  1.00 20.04 ? 311 PHE A CE1 1 
ATOM   1341 C  CE2 . PHE A 1 171 ? 16.607 0.309   18.785  1.00 18.17 ? 311 PHE A CE2 1 
ATOM   1342 C  CZ  . PHE A 1 171 ? 17.678 0.732   18.014  1.00 17.55 ? 311 PHE A CZ  1 
ATOM   1343 N  N   . PHE A 1 172 ? 16.748 -3.482  16.526  1.00 18.69 ? 312 PHE A N   1 
ATOM   1344 C  CA  . PHE A 1 172 ? 17.587 -4.189  17.484  1.00 19.21 ? 312 PHE A CA  1 
ATOM   1345 C  C   . PHE A 1 172 ? 18.704 -3.299  17.998  1.00 19.21 ? 312 PHE A C   1 
ATOM   1346 O  O   . PHE A 1 172 ? 19.482 -2.752  17.217  1.00 19.19 ? 312 PHE A O   1 
ATOM   1347 C  CB  . PHE A 1 172 ? 18.215 -5.436  16.858  1.00 16.91 ? 312 PHE A CB  1 
ATOM   1348 C  CG  . PHE A 1 172 ? 17.257 -6.567  16.667  1.00 17.17 ? 312 PHE A CG  1 
ATOM   1349 C  CD1 . PHE A 1 172 ? 16.330 -6.544  15.635  1.00 15.90 ? 312 PHE A CD1 1 
ATOM   1350 C  CD2 . PHE A 1 172 ? 17.277 -7.657  17.529  1.00 15.86 ? 312 PHE A CD2 1 
ATOM   1351 C  CE1 . PHE A 1 172 ? 15.430 -7.594  15.461  1.00 17.28 ? 312 PHE A CE1 1 
ATOM   1352 C  CE2 . PHE A 1 172 ? 16.388 -8.707  17.368  1.00 17.09 ? 312 PHE A CE2 1 
ATOM   1353 C  CZ  . PHE A 1 172 ? 15.459 -8.676  16.329  1.00 19.46 ? 312 PHE A CZ  1 
ATOM   1354 N  N   . ASN A 1 173 ? 18.767 -3.154  19.316  1.00 18.76 ? 313 ASN A N   1 
ATOM   1355 C  CA  . ASN A 1 173 ? 19.802 -2.358  19.955  1.00 18.82 ? 313 ASN A CA  1 
ATOM   1356 C  C   . ASN A 1 173 ? 20.862 -3.359  20.433  1.00 17.48 ? 313 ASN A C   1 
ATOM   1357 O  O   . ASN A 1 173 ? 20.638 -4.105  21.382  1.00 16.64 ? 313 ASN A O   1 
ATOM   1358 C  CB  . ASN A 1 173 ? 19.226 -1.595  21.149  1.00 17.00 ? 313 ASN A CB  1 
ATOM   1359 C  CG  . ASN A 1 173 ? 20.265 -0.732  21.841  1.00 20.26 ? 313 ASN A CG  1 
ATOM   1360 O  OD1 . ASN A 1 173 ? 21.439 -1.103  21.920  1.00 21.95 ? 313 ASN A OD1 1 
ATOM   1361 N  ND2 . ASN A 1 173 ? 19.838 0.419   22.358  1.00 15.16 ? 313 ASN A ND2 1 
ATOM   1362 N  N   . VAL A 1 174 ? 22.005 -3.379  19.758  1.00 18.07 ? 314 VAL A N   1 
ATOM   1363 C  CA  . VAL A 1 174 ? 23.098 -4.289  20.096  1.00 18.88 ? 314 VAL A CA  1 
ATOM   1364 C  C   . VAL A 1 174 ? 24.207 -3.506  20.796  1.00 19.16 ? 314 VAL A C   1 
ATOM   1365 O  O   . VAL A 1 174 ? 24.775 -2.571  20.221  1.00 19.37 ? 314 VAL A O   1 
ATOM   1366 C  CB  . VAL A 1 174 ? 23.655 -4.952  18.813  1.00 20.27 ? 314 VAL A CB  1 
ATOM   1367 C  CG1 . VAL A 1 174 ? 24.777 -5.928  19.155  1.00 20.14 ? 314 VAL A CG1 1 
ATOM   1368 C  CG2 . VAL A 1 174 ? 22.529 -5.662  18.084  1.00 20.53 ? 314 VAL A CG2 1 
ATOM   1369 N  N   . SER A 1 175 ? 24.520 -3.892  22.030  1.00 17.83 ? 315 SER A N   1 
ATOM   1370 C  CA  . SER A 1 175 ? 25.537 -3.187  22.810  1.00 18.67 ? 315 SER A CA  1 
ATOM   1371 C  C   . SER A 1 175 ? 26.932 -3.100  22.182  1.00 17.83 ? 315 SER A C   1 
ATOM   1372 O  O   . SER A 1 175 ? 27.585 -2.058  22.272  1.00 18.80 ? 315 SER A O   1 
ATOM   1373 C  CB  . SER A 1 175 ? 25.642 -3.795  24.217  1.00 18.23 ? 315 SER A CB  1 
ATOM   1374 O  OG  . SER A 1 175 ? 26.017 -5.154  24.163  1.00 16.67 ? 315 SER A OG  1 
ATOM   1375 N  N   . ASP A 1 176 ? 27.390 -4.180  21.558  1.00 16.22 ? 316 ASP A N   1 
ATOM   1376 C  CA  . ASP A 1 176 ? 28.717 -4.189  20.941  1.00 17.49 ? 316 ASP A CA  1 
ATOM   1377 C  C   . ASP A 1 176 ? 28.847 -5.289  19.889  1.00 15.58 ? 316 ASP A C   1 
ATOM   1378 O  O   . ASP A 1 176 ? 28.034 -6.212  19.844  1.00 15.55 ? 316 ASP A O   1 
ATOM   1379 C  CB  . ASP A 1 176 ? 29.804 -4.354  22.015  1.00 17.59 ? 316 ASP A CB  1 
ATOM   1380 C  CG  . ASP A 1 176 ? 29.608 -5.604  22.864  1.00 19.51 ? 316 ASP A CG  1 
ATOM   1381 O  OD1 . ASP A 1 176 ? 28.618 -5.679  23.622  1.00 20.15 ? 316 ASP A OD1 1 
ATOM   1382 O  OD2 . ASP A 1 176 ? 30.446 -6.517  22.772  1.00 21.42 ? 316 ASP A OD2 1 
ATOM   1383 N  N   . GLU A 1 177 ? 29.880 -5.191  19.058  1.00 13.65 ? 317 GLU A N   1 
ATOM   1384 C  CA  . GLU A 1 177 ? 30.103 -6.149  17.978  1.00 13.94 ? 317 GLU A CA  1 
ATOM   1385 C  C   . GLU A 1 177 ? 30.005 -7.626  18.351  1.00 15.57 ? 317 GLU A C   1 
ATOM   1386 O  O   . GLU A 1 177 ? 29.378 -8.406  17.639  1.00 14.59 ? 317 GLU A O   1 
ATOM   1387 C  CB  . GLU A 1 177 ? 31.452 -5.881  17.304  1.00 14.41 ? 317 GLU A CB  1 
ATOM   1388 C  CG  . GLU A 1 177 ? 31.515 -4.563  16.545  1.00 15.66 ? 317 GLU A CG  1 
ATOM   1389 C  CD  . GLU A 1 177 ? 31.933 -3.397  17.413  1.00 16.74 ? 317 GLU A CD  1 
ATOM   1390 O  OE1 . GLU A 1 177 ? 31.499 -3.333  18.582  1.00 15.65 ? 317 GLU A OE1 1 
ATOM   1391 O  OE2 . GLU A 1 177 ? 32.695 -2.535  16.920  1.00 17.78 ? 317 GLU A OE2 1 
ATOM   1392 N  N   . LEU A 1 178 ? 30.623 -8.018  19.459  1.00 18.45 ? 318 LEU A N   1 
ATOM   1393 C  CA  . LEU A 1 178 ? 30.581 -9.412  19.873  1.00 21.11 ? 318 LEU A CA  1 
ATOM   1394 C  C   . LEU A 1 178 ? 29.176 -9.877  20.263  1.00 21.52 ? 318 LEU A C   1 
ATOM   1395 O  O   . LEU A 1 178 ? 28.929 -11.076 20.359  1.00 21.33 ? 318 LEU A O   1 
ATOM   1396 C  CB  . LEU A 1 178 ? 31.543 -9.660  21.041  1.00 22.42 ? 318 LEU A CB  1 
ATOM   1397 C  CG  . LEU A 1 178 ? 33.041 -9.439  20.814  1.00 25.49 ? 318 LEU A CG  1 
ATOM   1398 C  CD1 . LEU A 1 178 ? 33.818 -10.091 21.957  1.00 25.75 ? 318 LEU A CD1 1 
ATOM   1399 C  CD2 . LEU A 1 178 ? 33.472 -10.035 19.486  1.00 25.69 ? 318 LEU A CD2 1 
ATOM   1400 N  N   . ALA A 1 179 ? 28.259 -8.937  20.479  1.00 20.86 ? 319 ALA A N   1 
ATOM   1401 C  CA  . ALA A 1 179 ? 26.892 -9.288  20.864  1.00 21.16 ? 319 ALA A CA  1 
ATOM   1402 C  C   . ALA A 1 179 ? 25.958 -9.459  19.665  1.00 21.33 ? 319 ALA A C   1 
ATOM   1403 O  O   . ALA A 1 179 ? 24.821 -9.913  19.814  1.00 21.75 ? 319 ALA A O   1 
ATOM   1404 C  CB  . ALA A 1 179 ? 26.332 -8.236  21.820  1.00 20.05 ? 319 ALA A CB  1 
ATOM   1405 N  N   . LEU A 1 180 ? 26.439 -9.095  18.479  1.00 20.58 ? 320 LEU A N   1 
ATOM   1406 C  CA  . LEU A 1 180 ? 25.654 -9.219  17.257  1.00 20.15 ? 320 LEU A CA  1 
ATOM   1407 C  C   . LEU A 1 180 ? 25.041 -10.605 17.067  1.00 20.83 ? 320 LEU A C   1 
ATOM   1408 O  O   . LEU A 1 180 ? 23.859 -10.737 16.731  1.00 20.28 ? 320 LEU A O   1 
ATOM   1409 C  CB  . LEU A 1 180 ? 26.525 -8.916  16.042  1.00 20.63 ? 320 LEU A CB  1 
ATOM   1410 C  CG  . LEU A 1 180 ? 26.302 -7.613  15.282  1.00 21.27 ? 320 LEU A CG  1 
ATOM   1411 C  CD1 . LEU A 1 180 ? 27.157 -7.658  14.017  1.00 22.47 ? 320 LEU A CD1 1 
ATOM   1412 C  CD2 . LEU A 1 180 ? 24.831 -7.444  14.918  1.00 18.30 ? 320 LEU A CD2 1 
ATOM   1413 N  N   . VAL A 1 181 ? 25.855 -11.635 17.274  1.00 20.20 ? 321 VAL A N   1 
ATOM   1414 C  CA  . VAL A 1 181 ? 25.409 -13.015 17.102  1.00 20.34 ? 321 VAL A CA  1 
ATOM   1415 C  C   . VAL A 1 181 ? 24.285 -13.474 18.029  1.00 20.98 ? 321 VAL A C   1 
ATOM   1416 O  O   . VAL A 1 181 ? 23.632 -14.472 17.747  1.00 22.67 ? 321 VAL A O   1 
ATOM   1417 C  CB  . VAL A 1 181 ? 26.598 -14.007 17.240  1.00 19.90 ? 321 VAL A CB  1 
ATOM   1418 C  CG1 . VAL A 1 181 ? 27.479 -13.939 16.004  1.00 15.22 ? 321 VAL A CG1 1 
ATOM   1419 C  CG2 . VAL A 1 181 ? 27.419 -13.673 18.479  1.00 18.30 ? 321 VAL A CG2 1 
ATOM   1420 N  N   . THR A 1 182 ? 24.045 -12.752 19.118  1.00 22.06 ? 322 THR A N   1 
ATOM   1421 C  CA  . THR A 1 182 ? 22.987 -13.141 20.054  1.00 23.03 ? 322 THR A CA  1 
ATOM   1422 C  C   . THR A 1 182 ? 21.553 -12.821 19.592  1.00 22.90 ? 322 THR A C   1 
ATOM   1423 O  O   . THR A 1 182 ? 20.591 -13.240 20.235  1.00 24.12 ? 322 THR A O   1 
ATOM   1424 C  CB  . THR A 1 182 ? 23.204 -12.499 21.455  1.00 22.96 ? 322 THR A CB  1 
ATOM   1425 O  OG1 . THR A 1 182 ? 22.960 -11.087 21.394  1.00 25.79 ? 322 THR A OG1 1 
ATOM   1426 C  CG2 . THR A 1 182 ? 24.623 -12.739 21.929  1.00 23.12 ? 322 THR A CG2 1 
ATOM   1427 N  N   . ILE A 1 183 ? 21.398 -12.091 18.489  1.00 20.53 ? 323 ILE A N   1 
ATOM   1428 C  CA  . ILE A 1 183 ? 20.057 -11.762 18.004  1.00 18.82 ? 323 ILE A CA  1 
ATOM   1429 C  C   . ILE A 1 183 ? 19.627 -12.630 16.821  1.00 19.00 ? 323 ILE A C   1 
ATOM   1430 O  O   . ILE A 1 183 ? 18.460 -12.623 16.427  1.00 17.39 ? 323 ILE A O   1 
ATOM   1431 C  CB  . ILE A 1 183 ? 19.952 -10.268 17.582  1.00 20.34 ? 323 ILE A CB  1 
ATOM   1432 C  CG1 . ILE A 1 183 ? 20.900 -9.987  16.416  1.00 18.22 ? 323 ILE A CG1 1 
ATOM   1433 C  CG2 . ILE A 1 183 ? 20.267 -9.358  18.774  1.00 15.36 ? 323 ILE A CG2 1 
ATOM   1434 C  CD1 . ILE A 1 183 ? 20.786 -8.600  15.852  1.00 20.18 ? 323 ILE A CD1 1 
ATOM   1435 N  N   . VAL A 1 184 ? 20.575 -13.386 16.273  1.00 20.38 ? 324 VAL A N   1 
ATOM   1436 C  CA  . VAL A 1 184 ? 20.333 -14.252 15.121  1.00 22.00 ? 324 VAL A CA  1 
ATOM   1437 C  C   . VAL A 1 184 ? 19.071 -15.115 15.159  1.00 23.80 ? 324 VAL A C   1 
ATOM   1438 O  O   . VAL A 1 184 ? 18.328 -15.172 14.175  1.00 21.18 ? 324 VAL A O   1 
ATOM   1439 C  CB  . VAL A 1 184 ? 21.562 -15.155 14.860  1.00 23.32 ? 324 VAL A CB  1 
ATOM   1440 C  CG1 . VAL A 1 184 ? 21.171 -16.380 14.036  1.00 19.90 ? 324 VAL A CG1 1 
ATOM   1441 C  CG2 . VAL A 1 184 ? 22.626 -14.351 14.119  1.00 23.36 ? 324 VAL A CG2 1 
ATOM   1442 N  N   . LYS A 1 185 ? 18.819 -15.790 16.276  1.00 26.07 ? 325 LYS A N   1 
ATOM   1443 C  CA  . LYS A 1 185 ? 17.628 -16.626 16.351  1.00 27.37 ? 325 LYS A CA  1 
ATOM   1444 C  C   . LYS A 1 185 ? 16.362 -15.779 16.312  1.00 26.52 ? 325 LYS A C   1 
ATOM   1445 O  O   . LYS A 1 185 ? 15.442 -16.065 15.548  1.00 26.56 ? 325 LYS A O   1 
ATOM   1446 C  CB  . LYS A 1 185 ? 17.631 -17.492 17.615  1.00 30.65 ? 325 LYS A CB  1 
ATOM   1447 C  CG  . LYS A 1 185 ? 16.462 -18.480 17.650  1.00 35.28 ? 325 LYS A CG  1 
ATOM   1448 C  CD  . LYS A 1 185 ? 16.466 -19.358 18.892  1.00 39.84 ? 325 LYS A CD  1 
ATOM   1449 C  CE  . LYS A 1 185 ? 16.179 -18.557 20.151  1.00 42.23 ? 325 LYS A CE  1 
ATOM   1450 N  NZ  . LYS A 1 185 ? 16.122 -19.446 21.346  1.00 45.95 ? 325 LYS A NZ  1 
ATOM   1451 N  N   . THR A 1 186 ? 16.315 -14.731 17.129  1.00 26.35 ? 326 THR A N   1 
ATOM   1452 C  CA  . THR A 1 186 ? 15.141 -13.864 17.163  1.00 24.56 ? 326 THR A CA  1 
ATOM   1453 C  C   . THR A 1 186 ? 14.923 -13.190 15.815  1.00 23.81 ? 326 THR A C   1 
ATOM   1454 O  O   . THR A 1 186 ? 13.821 -13.233 15.269  1.00 24.95 ? 326 THR A O   1 
ATOM   1455 C  CB  . THR A 1 186 ? 15.265 -12.783 18.255  1.00 24.57 ? 326 THR A CB  1 
ATOM   1456 O  OG1 . THR A 1 186 ? 15.396 -13.417 19.532  1.00 27.23 ? 326 THR A OG1 1 
ATOM   1457 C  CG2 . THR A 1 186 ? 14.020 -11.888 18.274  1.00 23.75 ? 326 THR A CG2 1 
ATOM   1458 N  N   . LEU A 1 187 ? 15.966 -12.567 15.276  1.00 21.53 ? 327 LEU A N   1 
ATOM   1459 C  CA  . LEU A 1 187 ? 15.846 -11.910 13.979  1.00 21.38 ? 327 LEU A CA  1 
ATOM   1460 C  C   . LEU A 1 187 ? 15.437 -12.948 12.952  1.00 22.29 ? 327 LEU A C   1 
ATOM   1461 O  O   . LEU A 1 187 ? 14.524 -12.726 12.153  1.00 22.92 ? 327 LEU A O   1 
ATOM   1462 C  CB  . LEU A 1 187 ? 17.175 -11.283 13.549  1.00 17.77 ? 327 LEU A CB  1 
ATOM   1463 C  CG  . LEU A 1 187 ? 17.174 -10.723 12.120  1.00 17.01 ? 327 LEU A CG  1 
ATOM   1464 C  CD1 . LEU A 1 187 ? 16.203 -9.540  12.015  1.00 10.06 ? 327 LEU A CD1 1 
ATOM   1465 C  CD2 . LEU A 1 187 ? 18.590 -10.291 11.736  1.00 15.82 ? 327 LEU A CD2 1 
ATOM   1466 N  N   . GLY A 1 188 ? 16.124 -14.086 12.986  1.00 22.19 ? 328 GLY A N   1 
ATOM   1467 C  CA  . GLY A 1 188 ? 15.834 -15.159 12.058  1.00 23.75 ? 328 GLY A CA  1 
ATOM   1468 C  C   . GLY A 1 188 ? 14.360 -15.508 12.020  1.00 25.98 ? 328 GLY A C   1 
ATOM   1469 O  O   . GLY A 1 188 ? 13.724 -15.443 10.964  1.00 26.00 ? 328 GLY A O   1 
ATOM   1470 N  N   . GLU A 1 189 ? 13.797 -15.857 13.171  1.00 27.53 ? 329 GLU A N   1 
ATOM   1471 C  CA  . GLU A 1 189 ? 12.392 -16.226 13.210  1.00 29.54 ? 329 GLU A CA  1 
ATOM   1472 C  C   . GLU A 1 189 ? 11.447 -15.069 12.924  1.00 29.35 ? 329 GLU A C   1 
ATOM   1473 O  O   . GLU A 1 189 ? 10.313 -15.285 12.500  1.00 31.02 ? 329 GLU A O   1 
ATOM   1474 C  CB  . GLU A 1 189 ? 12.042 -16.894 14.545  1.00 30.68 ? 329 GLU A CB  1 
ATOM   1475 C  CG  . GLU A 1 189 ? 12.444 -16.137 15.782  1.00 34.75 ? 329 GLU A CG  1 
ATOM   1476 C  CD  . GLU A 1 189 ? 12.342 -17.001 17.025  1.00 36.97 ? 329 GLU A CD  1 
ATOM   1477 O  OE1 . GLU A 1 189 ? 12.930 -18.107 17.028  1.00 36.82 ? 329 GLU A OE1 1 
ATOM   1478 O  OE2 . GLU A 1 189 ? 11.680 -16.574 17.997  1.00 37.55 ? 329 GLU A OE2 1 
ATOM   1479 N  N   . ARG A 1 190 ? 11.902 -13.839 13.132  1.00 28.31 ? 330 ARG A N   1 
ATOM   1480 C  CA  . ARG A 1 190 ? 11.035 -12.701 12.855  1.00 28.11 ? 330 ARG A CA  1 
ATOM   1481 C  C   . ARG A 1 190 ? 10.986 -12.401 11.361  1.00 27.97 ? 330 ARG A C   1 
ATOM   1482 O  O   . ARG A 1 190 ? 9.939  -12.041 10.820  1.00 27.39 ? 330 ARG A O   1 
ATOM   1483 C  CB  . ARG A 1 190 ? 11.503 -11.466 13.614  1.00 27.93 ? 330 ARG A CB  1 
ATOM   1484 C  CG  . ARG A 1 190 ? 11.229 -11.539 15.096  1.00 29.15 ? 330 ARG A CG  1 
ATOM   1485 C  CD  . ARG A 1 190 ? 11.612 -10.250 15.769  1.00 27.21 ? 330 ARG A CD  1 
ATOM   1486 N  NE  . ARG A 1 190 ? 11.333 -10.296 17.196  1.00 28.98 ? 330 ARG A NE  1 
ATOM   1487 C  CZ  . ARG A 1 190 ? 11.709 -9.360  18.057  1.00 27.17 ? 330 ARG A CZ  1 
ATOM   1488 N  NH1 . ARG A 1 190 ? 12.385 -8.301  17.634  1.00 27.73 ? 330 ARG A NH1 1 
ATOM   1489 N  NH2 . ARG A 1 190 ? 11.409 -9.484  19.339  1.00 26.07 ? 330 ARG A NH2 1 
ATOM   1490 N  N   . ILE A 1 191 ? 12.123 -12.545 10.693  1.00 27.65 ? 331 ILE A N   1 
ATOM   1491 C  CA  . ILE A 1 191 ? 12.170 -12.297 9.262   1.00 27.66 ? 331 ILE A CA  1 
ATOM   1492 C  C   . ILE A 1 191 ? 11.152 -13.214 8.590   1.00 29.78 ? 331 ILE A C   1 
ATOM   1493 O  O   . ILE A 1 191 ? 10.470 -12.818 7.645   1.00 28.42 ? 331 ILE A O   1 
ATOM   1494 C  CB  . ILE A 1 191 ? 13.577 -12.580 8.696   1.00 24.66 ? 331 ILE A CB  1 
ATOM   1495 C  CG1 . ILE A 1 191 ? 14.572 -11.557 9.252   1.00 22.49 ? 331 ILE A CG1 1 
ATOM   1496 C  CG2 . ILE A 1 191 ? 13.547 -12.543 7.178   1.00 23.95 ? 331 ILE A CG2 1 
ATOM   1497 C  CD1 . ILE A 1 191 ? 15.996 -11.758 8.777   1.00 16.04 ? 331 ILE A CD1 1 
ATOM   1498 N  N   . PHE A 1 192 ? 11.027 -14.433 9.102   1.00 32.56 ? 332 PHE A N   1 
ATOM   1499 C  CA  . PHE A 1 192 ? 10.094 -15.386 8.522   1.00 37.52 ? 332 PHE A CA  1 
ATOM   1500 C  C   . PHE A 1 192 ? 8.690  -15.390 9.111   1.00 39.56 ? 332 PHE A C   1 
ATOM   1501 O  O   . PHE A 1 192 ? 7.713  -15.391 8.368   1.00 41.31 ? 332 PHE A O   1 
ATOM   1502 C  CB  . PHE A 1 192 ? 10.684 -16.793 8.575   1.00 37.72 ? 332 PHE A CB  1 
ATOM   1503 C  CG  . PHE A 1 192 ? 11.900 -16.956 7.719   1.00 39.66 ? 332 PHE A CG  1 
ATOM   1504 C  CD1 . PHE A 1 192 ? 13.137 -16.494 8.152   1.00 40.33 ? 332 PHE A CD1 1 
ATOM   1505 C  CD2 . PHE A 1 192 ? 11.801 -17.518 6.451   1.00 40.57 ? 332 PHE A CD2 1 
ATOM   1506 C  CE1 . PHE A 1 192 ? 14.260 -16.588 7.333   1.00 41.09 ? 332 PHE A CE1 1 
ATOM   1507 C  CE2 . PHE A 1 192 ? 12.920 -17.615 5.622   1.00 40.87 ? 332 PHE A CE2 1 
ATOM   1508 C  CZ  . PHE A 1 192 ? 14.150 -17.149 6.065   1.00 40.68 ? 332 PHE A CZ  1 
ATOM   1509 N  N   . ALA A 1 193 ? 8.581  -15.383 10.434  1.00 42.16 ? 333 ALA A N   1 
ATOM   1510 C  CA  . ALA A 1 193 ? 7.267  -15.404 11.070  1.00 43.80 ? 333 ALA A CA  1 
ATOM   1511 C  C   . ALA A 1 193 ? 6.757  -14.008 11.413  1.00 45.81 ? 333 ALA A C   1 
ATOM   1512 O  O   . ALA A 1 193 ? 7.585  -13.077 11.511  1.00 47.78 ? 333 ALA A O   1 
ATOM   1513 C  CB  . ALA A 1 193 ? 7.315  -16.265 12.328  1.00 43.83 ? 333 ALA A CB  1 
ATOM   1514 O  OXT . ALA A 1 193 ? 5.528  -13.865 11.594  1.00 47.75 ? 333 ALA A OXT 1 
HETATM 1515 MG MG  . MG  B 2 .   ? 31.114 4.213   12.187  1.00 39.92 ? 101 MG  A MG  1 
HETATM 1516 O  O   . HOH C 3 .   ? 30.818 -0.294  16.977  1.00 17.85 ? 1   HOH A O   1 
HETATM 1517 O  O   . HOH C 3 .   ? 22.962 -14.744 -4.078  1.00 18.76 ? 2   HOH A O   1 
HETATM 1518 O  O   . HOH C 3 .   ? 28.342 2.607   17.752  1.00 16.52 ? 3   HOH A O   1 
HETATM 1519 O  O   . HOH C 3 .   ? 10.409 3.116   9.306   1.00 15.20 ? 4   HOH A O   1 
HETATM 1520 O  O   . HOH C 3 .   ? 29.008 4.146   10.938  1.00 16.08 ? 5   HOH A O   1 
HETATM 1521 O  O   . HOH C 3 .   ? 36.130 0.725   17.261  1.00 15.30 ? 6   HOH A O   1 
HETATM 1522 O  O   . HOH C 3 .   ? 24.842 0.005   25.357  1.00 23.67 ? 7   HOH A O   1 
HETATM 1523 O  O   . HOH C 3 .   ? 23.331 5.436   10.109  1.00 15.69 ? 8   HOH A O   1 
HETATM 1524 O  O   . HOH C 3 .   ? 20.411 -7.964  -5.268  1.00 15.29 ? 9   HOH A O   1 
HETATM 1525 O  O   . HOH C 3 .   ? 23.034 -6.104  23.481  1.00 25.66 ? 10  HOH A O   1 
HETATM 1526 O  O   . HOH C 3 .   ? 14.375 12.944  3.727   1.00 19.91 ? 11  HOH A O   1 
HETATM 1527 O  O   . HOH C 3 .   ? 11.318 -8.992  -4.967  1.00 20.05 ? 12  HOH A O   1 
HETATM 1528 O  O   . HOH C 3 .   ? 18.990 -18.182 -6.328  1.00 26.91 ? 13  HOH A O   1 
HETATM 1529 O  O   . HOH C 3 .   ? 23.469 9.675   19.350  1.00 17.33 ? 14  HOH A O   1 
HETATM 1530 O  O   . HOH C 3 .   ? 20.163 -16.004 -3.225  1.00 19.20 ? 15  HOH A O   1 
HETATM 1531 O  O   . HOH C 3 .   ? 15.704 -4.632  -13.824 1.00 25.85 ? 16  HOH A O   1 
HETATM 1532 O  O   . HOH C 3 .   ? 31.221 -12.366 -1.435  1.00 32.82 ? 17  HOH A O   1 
HETATM 1533 O  O   . HOH C 3 .   ? 14.526 -20.048 4.236   1.00 30.56 ? 18  HOH A O   1 
HETATM 1534 O  O   . HOH C 3 .   ? 26.536 -10.632 -7.681  1.00 22.44 ? 19  HOH A O   1 
HETATM 1535 O  O   . HOH C 3 .   ? 26.599 0.785   -7.527  1.00 30.91 ? 20  HOH A O   1 
HETATM 1536 O  O   . HOH C 3 .   ? 28.898 -11.036 16.915  1.00 25.51 ? 21  HOH A O   1 
HETATM 1537 O  O   . HOH C 3 .   ? 28.456 5.950   25.168  1.00 29.62 ? 22  HOH A O   1 
HETATM 1538 O  O   . HOH C 3 .   ? 24.645 -16.966 17.011  1.00 31.74 ? 23  HOH A O   1 
HETATM 1539 O  O   . HOH C 3 .   ? 15.526 12.205  7.291   1.00 28.26 ? 24  HOH A O   1 
HETATM 1540 O  O   . HOH C 3 .   ? 23.705 1.855   -11.038 1.00 19.62 ? 25  HOH A O   1 
HETATM 1541 O  O   . HOH C 3 .   ? 6.000  -0.691  8.934   1.00 36.15 ? 26  HOH A O   1 
HETATM 1542 O  O   . HOH C 3 .   ? 18.116 11.078  15.789  1.00 32.98 ? 27  HOH A O   1 
HETATM 1543 O  O   . HOH C 3 .   ? 22.074 -1.367  -10.745 1.00 32.62 ? 28  HOH A O   1 
HETATM 1544 O  O   . HOH C 3 .   ? 36.157 -0.845  -1.100  1.00 30.54 ? 29  HOH A O   1 
HETATM 1545 O  O   . HOH C 3 .   ? 16.465 -3.950  20.985  1.00 21.62 ? 30  HOH A O   1 
HETATM 1546 O  O   . HOH C 3 .   ? 22.447 -11.099 -11.291 1.00 32.14 ? 31  HOH A O   1 
HETATM 1547 O  O   . HOH C 3 .   ? 38.128 -9.473  12.154  1.00 24.31 ? 32  HOH A O   1 
HETATM 1548 O  O   . HOH C 3 .   ? 8.043  10.241  -0.396  1.00 41.87 ? 33  HOH A O   1 
HETATM 1549 O  O   . HOH C 3 .   ? 30.535 -15.491 7.312   1.00 38.36 ? 34  HOH A O   1 
HETATM 1550 O  O   . HOH C 3 .   ? 6.879  -5.613  8.354   1.00 35.87 ? 35  HOH A O   1 
HETATM 1551 O  O   . HOH C 3 .   ? 40.606 -10.770 1.549   1.00 25.49 ? 36  HOH A O   1 
HETATM 1552 O  O   . HOH C 3 .   ? 30.249 -12.702 -4.408  1.00 38.84 ? 37  HOH A O   1 
HETATM 1553 O  O   . HOH C 3 .   ? 27.831 -4.183  -9.575  1.00 30.96 ? 38  HOH A O   1 
HETATM 1554 O  O   . HOH C 3 .   ? 3.539  -2.245  5.883   1.00 32.47 ? 39  HOH A O   1 
HETATM 1555 O  O   . HOH C 3 .   ? 6.930  -15.062 5.633   1.00 41.06 ? 40  HOH A O   1 
HETATM 1556 O  O   . HOH C 3 .   ? 9.614  -6.928  -9.625  1.00 32.59 ? 41  HOH A O   1 
HETATM 1557 O  O   . HOH C 3 .   ? 24.607 4.140   25.312  1.00 30.51 ? 42  HOH A O   1 
HETATM 1558 O  O   . HOH C 3 .   ? 38.645 -6.889  11.952  1.00 29.38 ? 43  HOH A O   1 
HETATM 1559 O  O   . HOH C 3 .   ? 35.566 4.642   19.489  1.00 29.19 ? 44  HOH A O   1 
HETATM 1560 O  O   . HOH C 3 .   ? 9.633  -18.089 3.583   1.00 32.76 ? 45  HOH A O   1 
HETATM 1561 O  O   . HOH C 3 .   ? 21.069 2.240   24.719  1.00 20.18 ? 46  HOH A O   1 
HETATM 1562 O  O   . HOH C 3 .   ? 30.215 5.582   14.208  1.00 14.51 ? 47  HOH A O   1 
HETATM 1563 O  O   . HOH C 3 .   ? 32.563 6.241   11.686  1.00 30.36 ? 48  HOH A O   1 
HETATM 1564 O  O   . HOH C 3 .   ? 22.573 -6.755  -4.200  1.00 15.37 ? 49  HOH A O   1 
HETATM 1565 O  O   . HOH C 3 .   ? 29.215 -17.411 6.125   1.00 31.42 ? 50  HOH A O   1 
HETATM 1566 O  O   . HOH C 3 .   ? 32.585 -2.106  23.509  1.00 25.36 ? 51  HOH A O   1 
HETATM 1567 O  O   . HOH C 3 .   ? 14.246 -6.295  18.858  1.00 33.74 ? 52  HOH A O   1 
HETATM 1568 O  O   . HOH C 3 .   ? 23.055 -1.487  24.090  1.00 23.66 ? 53  HOH A O   1 
HETATM 1569 O  O   . HOH C 3 .   ? 7.165  -1.546  6.607   1.00 33.49 ? 54  HOH A O   1 
HETATM 1570 O  O   . HOH C 3 .   ? 27.637 11.758  17.550  1.00 27.29 ? 55  HOH A O   1 
HETATM 1571 O  O   . HOH C 3 .   ? 11.689 -17.563 1.480   1.00 20.63 ? 56  HOH A O   1 
HETATM 1572 O  O   . HOH C 3 .   ? 38.322 -2.117  11.636  1.00 29.66 ? 57  HOH A O   1 
HETATM 1573 O  O   . HOH C 3 .   ? 22.623 11.790  21.584  1.00 36.85 ? 58  HOH A O   1 
HETATM 1574 O  O   . HOH C 3 .   ? 38.551 -5.750  8.870   1.00 24.34 ? 59  HOH A O   1 
HETATM 1575 O  O   . HOH C 3 .   ? 18.337 -14.401 19.122  1.00 34.19 ? 60  HOH A O   1 
HETATM 1576 O  O   . HOH C 3 .   ? 20.227 -24.262 -0.226  1.00 31.58 ? 61  HOH A O   1 
HETATM 1577 O  O   . HOH C 3 .   ? 38.099 -7.279  6.649   1.00 30.42 ? 62  HOH A O   1 
HETATM 1578 O  O   . HOH C 3 .   ? 31.865 -17.236 -3.390  1.00 20.19 ? 63  HOH A O   1 
HETATM 1579 O  O   . HOH C 3 .   ? 13.053 -4.626  -11.737 1.00 30.12 ? 64  HOH A O   1 
HETATM 1580 O  O   . HOH C 3 .   ? 21.502 -8.174  -14.869 1.00 29.41 ? 65  HOH A O   1 
HETATM 1581 O  O   . HOH C 3 .   ? 8.902  4.672   -4.571  1.00 27.95 ? 66  HOH A O   1 
HETATM 1582 O  O   . HOH C 3 .   ? 27.220 11.394  20.127  1.00 26.78 ? 67  HOH A O   1 
HETATM 1583 O  O   . HOH C 3 .   ? 9.800  3.012   13.034  1.00 25.08 ? 68  HOH A O   1 
HETATM 1584 O  O   . HOH C 3 .   ? 26.022 -1.047  27.425  1.00 36.77 ? 69  HOH A O   1 
HETATM 1585 O  O   . HOH C 3 .   ? 39.441 -5.402  5.160   1.00 30.56 ? 70  HOH A O   1 
HETATM 1586 O  O   . HOH C 3 .   ? 16.460 -11.336 21.695  1.00 49.37 ? 71  HOH A O   1 
HETATM 1587 O  O   . HOH C 3 .   ? 34.056 -7.558  0.384   1.00 38.32 ? 72  HOH A O   1 
HETATM 1588 O  O   . HOH C 3 .   ? 28.561 -2.415  -6.999  1.00 33.43 ? 73  HOH A O   1 
HETATM 1589 O  O   . HOH C 3 .   ? 31.214 -18.018 11.559  1.00 33.71 ? 74  HOH A O   1 
HETATM 1590 O  O   . HOH C 3 .   ? 25.123 -25.103 6.057   1.00 32.12 ? 75  HOH A O   1 
HETATM 1591 O  O   . HOH C 3 .   ? 16.766 1.140   22.451  1.00 31.26 ? 76  HOH A O   1 
HETATM 1592 O  O   . HOH C 3 .   ? 24.664 12.932  19.028  1.00 58.24 ? 77  HOH A O   1 
HETATM 1593 O  O   . HOH C 3 .   ? 6.421  -3.001  4.483   1.00 28.36 ? 78  HOH A O   1 
HETATM 1594 O  O   . HOH C 3 .   ? 9.360  -0.023  4.768   1.00 27.90 ? 79  HOH A O   1 
HETATM 1595 O  O   . HOH C 3 .   ? 14.418 7.595   -2.141  1.00 32.75 ? 80  HOH A O   1 
HETATM 1596 O  O   . HOH C 3 .   ? 35.747 -11.535 5.777   1.00 19.32 ? 81  HOH A O   1 
HETATM 1597 O  O   . HOH C 3 .   ? 27.985 11.043  26.660  1.00 36.21 ? 82  HOH A O   1 
HETATM 1598 O  O   . HOH C 3 .   ? 23.010 10.255  0.283   1.00 24.67 ? 83  HOH A O   1 
HETATM 1599 O  O   . HOH C 3 .   ? 5.609  -14.374 8.660   1.00 29.58 ? 84  HOH A O   1 
HETATM 1600 O  O   . HOH C 3 .   ? 12.865 -5.495  21.142  1.00 47.38 ? 85  HOH A O   1 
HETATM 1601 O  O   . HOH C 3 .   ? 15.962 9.662   -2.359  1.00 26.75 ? 86  HOH A O   1 
HETATM 1602 O  O   . HOH C 3 .   ? 32.259 -17.335 9.356   1.00 38.10 ? 87  HOH A O   1 
HETATM 1603 O  O   . HOH C 3 .   ? 4.813  -8.147  -7.509  1.00 40.23 ? 88  HOH A O   1 
HETATM 1604 O  O   . HOH C 3 .   ? 6.686  -5.219  5.839   1.00 41.27 ? 89  HOH A O   1 
HETATM 1605 O  O   . HOH C 3 .   ? 22.700 -24.552 6.083   1.00 44.00 ? 90  HOH A O   1 
HETATM 1606 O  O   . HOH C 3 .   ? 19.947 9.425   -1.383  1.00 35.25 ? 91  HOH A O   1 
HETATM 1607 O  O   . HOH C 3 .   ? 5.371  -7.265  -4.904  1.00 40.43 ? 92  HOH A O   1 
HETATM 1608 O  O   . HOH C 3 .   ? 17.274 7.373   21.759  1.00 40.08 ? 93  HOH A O   1 
HETATM 1609 O  O   . HOH C 3 .   ? 18.916 -24.423 6.518   1.00 32.63 ? 94  HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   THR 1   141 141 THR THR A . n 
A 1 2   GLN 2   142 142 GLN GLN A . n 
A 1 3   LEU 3   143 143 LEU LEU A . n 
A 1 4   ASP 4   144 144 ASP ASP A . n 
A 1 5   ILE 5   145 145 ILE ILE A . n 
A 1 6   VAL 6   146 146 VAL VAL A . n 
A 1 7   ILE 7   147 147 ILE ILE A . n 
A 1 8   VAL 8   148 148 VAL VAL A . n 
A 1 9   LEU 9   149 149 LEU LEU A . n 
A 1 10  ASP 10  150 150 ASP ASP A . n 
A 1 11  GLY 11  151 151 GLY GLY A . n 
A 1 12  SER 12  152 152 SER SER A . n 
A 1 13  ASN 13  153 153 ASN ASN A . n 
A 1 14  SER 14  154 154 SER SER A . n 
A 1 15  ILE 15  155 155 ILE ILE A . n 
A 1 16  TYR 16  156 156 TYR TYR A . n 
A 1 17  PRO 17  157 157 PRO PRO A . n 
A 1 18  TRP 18  158 158 TRP TRP A . n 
A 1 19  ASP 19  159 159 ASP ASP A . n 
A 1 20  SER 20  160 160 SER SER A . n 
A 1 21  VAL 21  161 161 VAL VAL A . n 
A 1 22  THR 22  162 162 THR THR A . n 
A 1 23  ALA 23  163 163 ALA ALA A . n 
A 1 24  PHE 24  164 164 PHE PHE A . n 
A 1 25  LEU 25  165 165 LEU LEU A . n 
A 1 26  ASN 26  166 166 ASN ASN A . n 
A 1 27  ASP 27  167 167 ASP ASP A . n 
A 1 28  LEU 28  168 168 LEU LEU A . n 
A 1 29  LEU 29  169 169 LEU LEU A . n 
A 1 30  LYS 30  170 170 LYS LYS A . n 
A 1 31  ARG 31  171 171 ARG ARG A . n 
A 1 32  MET 32  172 172 MET MET A . n 
A 1 33  ASP 33  173 173 ASP ASP A . n 
A 1 34  ILE 34  174 174 ILE ILE A . n 
A 1 35  GLY 35  175 175 GLY GLY A . n 
A 1 36  PRO 36  176 176 PRO PRO A . n 
A 1 37  LYS 37  177 177 LYS LYS A . n 
A 1 38  GLN 38  178 178 GLN GLN A . n 
A 1 39  THR 39  179 179 THR THR A . n 
A 1 40  GLN 40  180 180 GLN GLN A . n 
A 1 41  VAL 41  181 181 VAL VAL A . n 
A 1 42  GLY 42  182 182 GLY GLY A . n 
A 1 43  ILE 43  183 183 ILE ILE A . n 
A 1 44  VAL 44  184 184 VAL VAL A . n 
A 1 45  GLN 45  185 185 GLN GLN A . n 
A 1 46  TYR 46  186 186 TYR TYR A . n 
A 1 47  GLY 47  187 187 GLY GLY A . n 
A 1 48  GLU 48  188 188 GLU GLU A . n 
A 1 49  ASN 49  189 189 ASN ASN A . n 
A 1 50  VAL 50  190 190 VAL VAL A . n 
A 1 51  THR 51  191 191 THR THR A . n 
A 1 52  HIS 52  192 192 HIS HIS A . n 
A 1 53  GLU 53  193 193 GLU GLU A . n 
A 1 54  PHE 54  194 194 PHE PHE A . n 
A 1 55  ASN 55  195 195 ASN ASN A . n 
A 1 56  LEU 56  196 196 LEU LEU A . n 
A 1 57  ASN 57  197 197 ASN ASN A . n 
A 1 58  LYS 58  198 198 LYS LYS A . n 
A 1 59  TYR 59  199 199 TYR TYR A . n 
A 1 60  SER 60  200 200 SER SER A . n 
A 1 61  SER 61  201 201 SER SER A . n 
A 1 62  THR 62  202 202 THR THR A . n 
A 1 63  GLU 63  203 203 GLU GLU A . n 
A 1 64  GLU 64  204 204 GLU GLU A . n 
A 1 65  VAL 65  205 205 VAL VAL A . n 
A 1 66  LEU 66  206 206 LEU LEU A . n 
A 1 67  VAL 67  207 207 VAL VAL A . n 
A 1 68  ALA 68  208 208 ALA ALA A . n 
A 1 69  ALA 69  209 209 ALA ALA A . n 
A 1 70  LYS 70  210 210 LYS LYS A . n 
A 1 71  LYS 71  211 211 LYS LYS A . n 
A 1 72  ILE 72  212 212 ILE ILE A . n 
A 1 73  VAL 73  213 213 VAL VAL A . n 
A 1 74  GLN 74  214 214 GLN GLN A . n 
A 1 75  ARG 75  215 215 ARG ARG A . n 
A 1 76  GLY 76  216 216 GLY GLY A . n 
A 1 77  GLY 77  217 217 GLY GLY A . n 
A 1 78  ALA 78  218 218 ALA ALA A . n 
A 1 79  GLN 79  219 219 GLN GLN A . n 
A 1 80  THR 80  220 220 THR THR A . n 
A 1 81  MET 81  221 221 MET MET A . n 
A 1 82  THR 82  222 222 THR THR A . n 
A 1 83  ALA 83  223 223 ALA ALA A . n 
A 1 84  LEU 84  224 224 LEU LEU A . n 
A 1 85  GLY 85  225 225 GLY GLY A . n 
A 1 86  THR 86  226 226 THR THR A . n 
A 1 87  ASP 87  227 227 ASP ASP A . n 
A 1 88  THR 88  228 228 THR THR A . n 
A 1 89  ALA 89  229 229 ALA ALA A . n 
A 1 90  ARG 90  230 230 ARG ARG A . n 
A 1 91  LYS 91  231 231 LYS LYS A . n 
A 1 92  GLU 92  232 232 GLU GLU A . n 
A 1 93  ALA 93  233 233 ALA ALA A . n 
A 1 94  PHE 94  234 234 PHE PHE A . n 
A 1 95  THR 95  235 235 THR THR A . n 
A 1 96  GLU 96  236 236 GLU GLU A . n 
A 1 97  ALA 97  237 237 ALA ALA A . n 
A 1 98  ARG 98  238 238 ARG ARG A . n 
A 1 99  GLY 99  239 239 GLY GLY A . n 
A 1 100 ALA 100 240 240 ALA ALA A . n 
A 1 101 ARG 101 241 241 ARG ARG A . n 
A 1 102 ARG 102 242 242 ARG ARG A . n 
A 1 103 GLY 103 243 243 GLY GLY A . n 
A 1 104 VAL 104 244 244 VAL VAL A . n 
A 1 105 LYS 105 245 245 LYS LYS A . n 
A 1 106 LYS 106 246 246 LYS LYS A . n 
A 1 107 VAL 107 247 247 VAL VAL A . n 
A 1 108 MET 108 248 248 MET MET A . n 
A 1 109 VAL 109 249 249 VAL VAL A . n 
A 1 110 ILE 110 250 250 ILE ILE A . n 
A 1 111 VAL 111 251 251 VAL VAL A . n 
A 1 112 THR 112 252 252 THR THR A . n 
A 1 113 ASP 113 253 253 ASP ASP A . n 
A 1 114 GLY 114 254 254 GLY GLY A . n 
A 1 115 GLU 115 255 255 GLU GLU A . n 
A 1 116 SER 116 256 256 SER SER A . n 
A 1 117 HIS 117 257 257 HIS HIS A . n 
A 1 118 ASP 118 258 258 ASP ASP A . n 
A 1 119 ASN 119 259 259 ASN ASN A . n 
A 1 120 HIS 120 260 260 HIS HIS A . n 
A 1 121 ARG 121 261 261 ARG ARG A . n 
A 1 122 LEU 122 262 262 LEU LEU A . n 
A 1 123 LYS 123 263 263 LYS LYS A . n 
A 1 124 LYS 124 264 264 LYS LYS A . n 
A 1 125 VAL 125 265 265 VAL VAL A . n 
A 1 126 ILE 126 266 266 ILE ILE A . n 
A 1 127 GLN 127 267 267 GLN GLN A . n 
A 1 128 ASP 128 268 268 ASP ASP A . n 
A 1 129 CYS 129 269 269 CYS CYS A . n 
A 1 130 GLU 130 270 270 GLU GLU A . n 
A 1 131 ASP 131 271 271 ASP ASP A . n 
A 1 132 GLU 132 272 272 GLU GLU A . n 
A 1 133 ASN 133 273 273 ASN ASN A . n 
A 1 134 ILE 134 274 274 ILE ILE A . n 
A 1 135 GLN 135 275 275 GLN GLN A . n 
A 1 136 ARG 136 276 276 ARG ARG A . n 
A 1 137 PHE 137 277 277 PHE PHE A . n 
A 1 138 SER 138 278 278 SER SER A . n 
A 1 139 ILE 139 279 279 ILE ILE A . n 
A 1 140 ALA 140 280 280 ALA ALA A . n 
A 1 141 ILE 141 281 281 ILE ILE A . n 
A 1 142 LEU 142 282 282 LEU LEU A . n 
A 1 143 GLY 143 283 283 GLY GLY A . n 
A 1 144 SER 144 284 284 SER SER A . n 
A 1 145 TYR 145 285 285 TYR TYR A . n 
A 1 146 ASN 146 286 286 ASN ASN A . n 
A 1 147 ARG 147 287 287 ARG ARG A . n 
A 1 148 GLY 148 288 288 GLY GLY A . n 
A 1 149 ASN 149 289 289 ASN ASN A . n 
A 1 150 LEU 150 290 290 LEU LEU A . n 
A 1 151 SER 151 291 291 SER SER A . n 
A 1 152 THR 152 292 292 THR THR A . n 
A 1 153 GLU 153 293 293 GLU GLU A . n 
A 1 154 LYS 154 294 294 LYS LYS A . n 
A 1 155 PHE 155 295 295 PHE PHE A . n 
A 1 156 VAL 156 296 296 VAL VAL A . n 
A 1 157 GLU 157 297 297 GLU GLU A . n 
A 1 158 GLU 158 298 298 GLU GLU A . n 
A 1 159 ILE 159 299 299 ILE ILE A . n 
A 1 160 LYS 160 300 300 LYS LYS A . n 
A 1 161 SER 161 301 301 SER SER A . n 
A 1 162 ILE 162 302 302 ILE ILE A . n 
A 1 163 ALA 163 303 303 ALA ALA A . n 
A 1 164 SER 164 304 304 SER SER A . n 
A 1 165 GLU 165 305 305 GLU GLU A . n 
A 1 166 PRO 166 306 306 PRO PRO A . n 
A 1 167 THR 167 307 307 THR THR A . n 
A 1 168 GLU 168 308 308 GLU GLU A . n 
A 1 169 LYS 169 309 309 LYS LYS A . n 
A 1 170 HIS 170 310 310 HIS HIS A . n 
A 1 171 PHE 171 311 311 PHE PHE A . n 
A 1 172 PHE 172 312 312 PHE PHE A . n 
A 1 173 ASN 173 313 313 ASN ASN A . n 
A 1 174 VAL 174 314 314 VAL VAL A . n 
A 1 175 SER 175 315 315 SER SER A . n 
A 1 176 ASP 176 316 316 ASP ASP A . n 
A 1 177 GLU 177 317 317 GLU GLU A . n 
A 1 178 LEU 178 318 318 LEU LEU A . n 
A 1 179 ALA 179 319 319 ALA ALA A . n 
A 1 180 LEU 180 320 320 LEU LEU A . n 
A 1 181 VAL 181 321 321 VAL VAL A . n 
A 1 182 THR 182 322 322 THR THR A . n 
A 1 183 ILE 183 323 323 ILE ILE A . n 
A 1 184 VAL 184 324 324 VAL VAL A . n 
A 1 185 LYS 185 325 325 LYS LYS A . n 
A 1 186 THR 186 326 326 THR THR A . n 
A 1 187 LEU 187 327 327 LEU LEU A . n 
A 1 188 GLY 188 328 328 GLY GLY A . n 
A 1 189 GLU 189 329 329 GLU GLU A . n 
A 1 190 ARG 190 330 330 ARG ARG A . n 
A 1 191 ILE 191 331 331 ILE ILE A . n 
A 1 192 PHE 192 332 332 PHE PHE A . n 
A 1 193 ALA 193 333 333 ALA ALA A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OG  ? A SER 12  ? A SER 152 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 OG  ? A SER 14  ? A SER 154 ? 1_555 88.0  ? 
2  OG  ? A SER 12  ? A SER 152 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 OD1 ? A ASP 113 ? A ASP 253 ? 1_555 71.4  ? 
3  OG  ? A SER 14  ? A SER 154 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 OD1 ? A ASP 113 ? A ASP 253 ? 1_555 78.1  ? 
4  OG  ? A SER 12  ? A SER 152 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O   ? C HOH .   ? A HOH 5   ? 1_555 71.1  ? 
5  OG  ? A SER 14  ? A SER 154 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O   ? C HOH .   ? A HOH 5   ? 1_555 146.3 ? 
6  OD1 ? A ASP 113 ? A ASP 253 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O   ? C HOH .   ? A HOH 5   ? 1_555 70.4  ? 
7  OG  ? A SER 12  ? A SER 152 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O   ? C HOH .   ? A HOH 47  ? 1_555 160.9 ? 
8  OG  ? A SER 14  ? A SER 154 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O   ? C HOH .   ? A HOH 47  ? 1_555 95.6  ? 
9  OD1 ? A ASP 113 ? A ASP 253 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O   ? C HOH .   ? A HOH 47  ? 1_555 90.9  ? 
10 O   ? C HOH .   ? A HOH 5   ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O   ? C HOH .   ? A HOH 47  ? 1_555 96.5  ? 
11 OG  ? A SER 12  ? A SER 152 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O   ? C HOH .   ? A HOH 48  ? 1_555 112.2 ? 
12 OG  ? A SER 14  ? A SER 154 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O   ? C HOH .   ? A HOH 48  ? 1_555 97.9  ? 
13 OD1 ? A ASP 113 ? A ASP 253 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O   ? C HOH .   ? A HOH 48  ? 1_555 174.7 ? 
14 O   ? C HOH .   ? A HOH 5   ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O   ? C HOH .   ? A HOH 48  ? 1_555 114.3 ? 
15 O   ? C HOH .   ? A HOH 47  ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O   ? C HOH .   ? A HOH 48  ? 1_555 86.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-09-02 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2014-11-12 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Structure summary'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 178 ? ? -114.98 -133.95 
2 1 MET A 221 ? ? -104.39 69.11   
3 1 ASP A 258 ? ? -108.62 41.95   
4 1 THR A 307 ? ? 121.15  -57.50  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION' MG  
3 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1  101 1  MG  MG  A . 
C 3 HOH 1  1   1  HOH TIP A . 
C 3 HOH 2  2   2  HOH TIP A . 
C 3 HOH 3  3   3  HOH TIP A . 
C 3 HOH 4  4   4  HOH TIP A . 
C 3 HOH 5  5   5  HOH TIP A . 
C 3 HOH 6  6   6  HOH TIP A . 
C 3 HOH 7  7   7  HOH TIP A . 
C 3 HOH 8  8   8  HOH TIP A . 
C 3 HOH 9  9   9  HOH TIP A . 
C 3 HOH 10 10  10 HOH TIP A . 
C 3 HOH 11 11  11 HOH TIP A . 
C 3 HOH 12 12  12 HOH TIP A . 
C 3 HOH 13 13  13 HOH TIP A . 
C 3 HOH 14 14  14 HOH TIP A . 
C 3 HOH 15 15  15 HOH TIP A . 
C 3 HOH 16 16  16 HOH TIP A . 
C 3 HOH 17 17  17 HOH TIP A . 
C 3 HOH 18 18  18 HOH TIP A . 
C 3 HOH 19 19  19 HOH TIP A . 
C 3 HOH 20 20  20 HOH TIP A . 
C 3 HOH 21 21  21 HOH TIP A . 
C 3 HOH 22 22  22 HOH TIP A . 
C 3 HOH 23 23  23 HOH TIP A . 
C 3 HOH 24 24  24 HOH TIP A . 
C 3 HOH 25 25  25 HOH TIP A . 
C 3 HOH 26 26  26 HOH TIP A . 
C 3 HOH 27 27  27 HOH TIP A . 
C 3 HOH 28 28  28 HOH TIP A . 
C 3 HOH 29 29  29 HOH TIP A . 
C 3 HOH 30 30  30 HOH TIP A . 
C 3 HOH 31 31  31 HOH TIP A . 
C 3 HOH 32 32  32 HOH TIP A . 
C 3 HOH 33 33  33 HOH TIP A . 
C 3 HOH 34 34  34 HOH TIP A . 
C 3 HOH 35 35  35 HOH TIP A . 
C 3 HOH 36 36  36 HOH TIP A . 
C 3 HOH 37 37  37 HOH TIP A . 
C 3 HOH 38 38  38 HOH TIP A . 
C 3 HOH 39 39  39 HOH TIP A . 
C 3 HOH 40 40  40 HOH TIP A . 
C 3 HOH 41 41  41 HOH TIP A . 
C 3 HOH 42 42  42 HOH TIP A . 
C 3 HOH 43 43  43 HOH TIP A . 
C 3 HOH 44 44  44 HOH TIP A . 
C 3 HOH 45 45  45 HOH TIP A . 
C 3 HOH 46 46  46 HOH TIP A . 
C 3 HOH 47 47  47 HOH TIP A . 
C 3 HOH 48 48  48 HOH TIP A . 
C 3 HOH 49 49  49 HOH TIP A . 
C 3 HOH 50 50  50 HOH TIP A . 
C 3 HOH 51 51  51 HOH TIP A . 
C 3 HOH 52 52  52 HOH TIP A . 
C 3 HOH 53 53  53 HOH TIP A . 
C 3 HOH 54 54  54 HOH TIP A . 
C 3 HOH 55 55  55 HOH TIP A . 
C 3 HOH 56 56  56 HOH TIP A . 
C 3 HOH 57 57  57 HOH TIP A . 
C 3 HOH 58 58  58 HOH TIP A . 
C 3 HOH 59 59  59 HOH TIP A . 
C 3 HOH 60 60  60 HOH TIP A . 
C 3 HOH 61 61  61 HOH TIP A . 
C 3 HOH 62 62  62 HOH TIP A . 
C 3 HOH 63 63  63 HOH TIP A . 
C 3 HOH 64 64  64 HOH TIP A . 
C 3 HOH 65 65  65 HOH TIP A . 
C 3 HOH 66 66  66 HOH TIP A . 
C 3 HOH 67 67  67 HOH TIP A . 
C 3 HOH 68 68  68 HOH TIP A . 
C 3 HOH 69 69  69 HOH TIP A . 
C 3 HOH 70 70  70 HOH TIP A . 
C 3 HOH 71 71  71 HOH TIP A . 
C 3 HOH 72 72  72 HOH TIP A . 
C 3 HOH 73 73  73 HOH TIP A . 
C 3 HOH 74 74  74 HOH TIP A . 
C 3 HOH 75 75  75 HOH TIP A . 
C 3 HOH 76 76  76 HOH TIP A . 
C 3 HOH 77 77  77 HOH TIP A . 
C 3 HOH 78 78  78 HOH TIP A . 
C 3 HOH 79 79  79 HOH TIP A . 
C 3 HOH 80 80  80 HOH TIP A . 
C 3 HOH 81 81  81 HOH TIP A . 
C 3 HOH 82 82  82 HOH TIP A . 
C 3 HOH 83 83  83 HOH TIP A . 
C 3 HOH 84 84  84 HOH TIP A . 
C 3 HOH 85 85  85 HOH TIP A . 
C 3 HOH 86 86  86 HOH TIP A . 
C 3 HOH 87 87  87 HOH TIP A . 
C 3 HOH 88 88  88 HOH TIP A . 
C 3 HOH 89 89  89 HOH TIP A . 
C 3 HOH 90 90  90 HOH TIP A . 
C 3 HOH 91 91  91 HOH TIP A . 
C 3 HOH 92 92  92 HOH TIP A . 
C 3 HOH 93 93  93 HOH TIP A . 
C 3 HOH 94 94  94 HOH TIP A . 
#