data_1QDU
# 
_entry.id   1QDU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QDU         
RCSB  RCSB009324   
WWPDB D_1000009324 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QDU 
_pdbx_database_status.recvd_initial_deposition_date   1999-07-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Blanchard, H.' 1 
'Grutter, M.G.' 2 
# 
_citation.id                        primary 
_citation.title                     'The three-dimensional structure of caspase-8: an initiator enzyme in apoptosis.' 
_citation.journal_abbrev            'Structure Fold.Des.' 
_citation.journal_volume            7 
_citation.page_first                1125 
_citation.page_last                 1133 
_citation.year                      1999 
_citation.journal_id_ASTM           FODEFH 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            1263 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10508784 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(99)80179-8' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Blanchard, H.'   1 
primary 'Kodandapani, L.' 2 
primary 'Mittl, P.R.'     3 
primary 'Marco, S.D.'     4 
primary 'Krebs, J.F.'     5 
primary 'Wu, J.C.'        6 
primary 'Tomaselli, K.J.' 7 
primary 'Grutter, M.G.'   8 
# 
_cell.entry_id           1QDU 
_cell.length_a           93.900 
_cell.length_b           206.530 
_cell.length_c           102.050 
_cell.angle_alpha        90.00 
_cell.angle_beta         102.30 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1QDU 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'CASPASE-8 ALPHA-CHAIN'                          17416.957 6   3.4.22.- ? ? ? 
2 polymer man 'CASPASE-8 BETA-CHAIN'                           10186.642 6   3.4.22.- ? ? ? 
3 polymer syn 'PHQ-GLU-VAL-ASP-DICHLOROMETHYLKETONE INHIBITOR' 546.398   6   ?        ? ? ? 
4 water   nat water                                            18.015    146 ?        ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        Z-EVD-DCBMK 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;LDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHHDCTVEQIYEILKIYQL
MDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD
;
;LDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHHDCTVEQIYEILKIYQL
MDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD
;
A,C,E,G,I,K ? 
2 'polypeptide(L)' no no  
;TRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFT
LRKKLVFP
;
;TRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFT
LRKKLVFP
;
B,D,F,H,J,L ? 
3 'polypeptide(L)' no yes '(PHQ)EVD(0QE)' XEVDX T,U,V,W,X,Y ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LEU n 
1 2   ASP n 
1 3   LYS n 
1 4   VAL n 
1 5   TYR n 
1 6   GLN n 
1 7   MET n 
1 8   LYS n 
1 9   SER n 
1 10  LYS n 
1 11  PRO n 
1 12  ARG n 
1 13  GLY n 
1 14  TYR n 
1 15  CYS n 
1 16  LEU n 
1 17  ILE n 
1 18  ILE n 
1 19  ASN n 
1 20  ASN n 
1 21  HIS n 
1 22  ASN n 
1 23  PHE n 
1 24  ALA n 
1 25  LYS n 
1 26  ALA n 
1 27  ARG n 
1 28  GLU n 
1 29  LYS n 
1 30  VAL n 
1 31  PRO n 
1 32  LYS n 
1 33  LEU n 
1 34  HIS n 
1 35  SER n 
1 36  ILE n 
1 37  ARG n 
1 38  ASP n 
1 39  ARG n 
1 40  ASN n 
1 41  GLY n 
1 42  THR n 
1 43  HIS n 
1 44  LEU n 
1 45  ASP n 
1 46  ALA n 
1 47  GLY n 
1 48  ALA n 
1 49  LEU n 
1 50  THR n 
1 51  THR n 
1 52  THR n 
1 53  PHE n 
1 54  GLU n 
1 55  GLU n 
1 56  LEU n 
1 57  HIS n 
1 58  PHE n 
1 59  GLU n 
1 60  ILE n 
1 61  LYS n 
1 62  PRO n 
1 63  HIS n 
1 64  HIS n 
1 65  ASP n 
1 66  CYS n 
1 67  THR n 
1 68  VAL n 
1 69  GLU n 
1 70  GLN n 
1 71  ILE n 
1 72  TYR n 
1 73  GLU n 
1 74  ILE n 
1 75  LEU n 
1 76  LYS n 
1 77  ILE n 
1 78  TYR n 
1 79  GLN n 
1 80  LEU n 
1 81  MET n 
1 82  ASP n 
1 83  HIS n 
1 84  SER n 
1 85  ASN n 
1 86  MET n 
1 87  ASP n 
1 88  CYS n 
1 89  PHE n 
1 90  ILE n 
1 91  CYS n 
1 92  CYS n 
1 93  ILE n 
1 94  LEU n 
1 95  SER n 
1 96  HIS n 
1 97  GLY n 
1 98  ASP n 
1 99  LYS n 
1 100 GLY n 
1 101 ILE n 
1 102 ILE n 
1 103 TYR n 
1 104 GLY n 
1 105 THR n 
1 106 ASP n 
1 107 GLY n 
1 108 GLN n 
1 109 GLU n 
1 110 ALA n 
1 111 PRO n 
1 112 ILE n 
1 113 TYR n 
1 114 GLU n 
1 115 LEU n 
1 116 THR n 
1 117 SER n 
1 118 GLN n 
1 119 PHE n 
1 120 THR n 
1 121 GLY n 
1 122 LEU n 
1 123 LYS n 
1 124 CYS n 
1 125 PRO n 
1 126 SER n 
1 127 LEU n 
1 128 ALA n 
1 129 GLY n 
1 130 LYS n 
1 131 PRO n 
1 132 LYS n 
1 133 VAL n 
1 134 PHE n 
1 135 PHE n 
1 136 ILE n 
1 137 GLN n 
1 138 ALA n 
1 139 CYS n 
1 140 GLN n 
1 141 GLY n 
1 142 ASP n 
1 143 ASN n 
1 144 TYR n 
1 145 GLN n 
1 146 LYS n 
1 147 GLY n 
1 148 ILE n 
1 149 PRO n 
1 150 VAL n 
1 151 GLU n 
1 152 THR n 
1 153 ASP n 
2 1   THR n 
2 2   ARG n 
2 3   TYR n 
2 4   ILE n 
2 5   PRO n 
2 6   ASP n 
2 7   GLU n 
2 8   ALA n 
2 9   ASP n 
2 10  PHE n 
2 11  LEU n 
2 12  LEU n 
2 13  GLY n 
2 14  MET n 
2 15  ALA n 
2 16  THR n 
2 17  VAL n 
2 18  ASN n 
2 19  ASN n 
2 20  CYS n 
2 21  VAL n 
2 22  SER n 
2 23  TYR n 
2 24  ARG n 
2 25  ASN n 
2 26  PRO n 
2 27  ALA n 
2 28  GLU n 
2 29  GLY n 
2 30  THR n 
2 31  TRP n 
2 32  TYR n 
2 33  ILE n 
2 34  GLN n 
2 35  SER n 
2 36  LEU n 
2 37  CYS n 
2 38  GLN n 
2 39  SER n 
2 40  LEU n 
2 41  ARG n 
2 42  GLU n 
2 43  ARG n 
2 44  CYS n 
2 45  PRO n 
2 46  ARG n 
2 47  GLY n 
2 48  ASP n 
2 49  ASP n 
2 50  ILE n 
2 51  LEU n 
2 52  THR n 
2 53  ILE n 
2 54  LEU n 
2 55  THR n 
2 56  GLU n 
2 57  VAL n 
2 58  ASN n 
2 59  TYR n 
2 60  GLU n 
2 61  VAL n 
2 62  SER n 
2 63  ASN n 
2 64  LYS n 
2 65  ASP n 
2 66  ASP n 
2 67  LYS n 
2 68  LYS n 
2 69  ASN n 
2 70  MET n 
2 71  GLY n 
2 72  LYS n 
2 73  GLN n 
2 74  MET n 
2 75  PRO n 
2 76  GLN n 
2 77  PRO n 
2 78  THR n 
2 79  PHE n 
2 80  THR n 
2 81  LEU n 
2 82  ARG n 
2 83  LYS n 
2 84  LYS n 
2 85  LEU n 
2 86  VAL n 
2 87  PHE n 
2 88  PRO n 
3 1   PHQ n 
3 2   GLU n 
3 3   VAL n 
3 4   ASP n 
3 5   0QE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? PET21B ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? PET21B ? ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'THE PEPTIDE WAS CHEMICALLY SYNTHESIZED.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP ICE8_HUMAN 1 Q14790 ? ?               ? 
2 UNP ICE8_HUMAN 2 Q14790 ? ?               ? 
3 PDB 1QDU       3 1QDU   1 '(PHQ)EVD(0QE)' ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1QDU A 1 ? 153 ? Q14790 222  ? 374  ? 149  299  
2  2 1QDU B 1 ? 88  ? Q14790 390  ? 477  ? 318  401  
3  1 1QDU C 1 ? 153 ? Q14790 222  ? 374  ? 149  299  
4  2 1QDU D 1 ? 88  ? Q14790 390  ? 477  ? 318  401  
5  1 1QDU E 1 ? 153 ? Q14790 222  ? 374  ? 149  299  
6  2 1QDU F 1 ? 88  ? Q14790 390  ? 477  ? 318  401  
7  1 1QDU G 1 ? 153 ? Q14790 222  ? 374  ? 149  299  
8  2 1QDU H 1 ? 88  ? Q14790 390  ? 477  ? 318  401  
9  1 1QDU I 1 ? 153 ? Q14790 222  ? 374  ? 149  299  
10 2 1QDU J 1 ? 88  ? Q14790 390  ? 477  ? 318  401  
11 1 1QDU K 1 ? 153 ? Q14790 222  ? 374  ? 149  299  
12 2 1QDU L 1 ? 88  ? Q14790 390  ? 477  ? 318  401  
13 3 1QDU T 1 ? 5   ? 1QDU   4100 ? 4104 ? 4100 4104 
14 3 1QDU U 1 ? 5   ? 1QDU   4200 ? 4204 ? 4200 4204 
15 3 1QDU V 1 ? 5   ? 1QDU   4300 ? 4304 ? 4300 4304 
16 3 1QDU W 1 ? 5   ? 1QDU   4400 ? 4404 ? 4400 4404 
17 3 1QDU X 1 ? 5   ? 1QDU   4500 ? 4504 ? 4500 4504 
18 3 1QDU Y 1 ? 5   ? 1QDU   4600 ? 4604 ? 4600 4604 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  1QDU HIS A 64 ? UNP Q14790 ASP 285 CONFLICT 204 1 
3  1QDU HIS C 64 ? UNP Q14790 ASP 285 CONFLICT 204 2 
5  1QDU HIS E 64 ? UNP Q14790 ASP 285 CONFLICT 204 3 
7  1QDU HIS G 64 ? UNP Q14790 ASP 285 CONFLICT 204 4 
9  1QDU HIS I 64 ? UNP Q14790 ASP 285 CONFLICT 204 5 
11 1QDU HIS K 64 ? UNP Q14790 ASP 285 CONFLICT 204 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
0QE non-polymer         . chloromethane            'Chloro Methyl group' 'C H3 Cl'        50.488  
ALA 'L-peptide linking' y ALANINE                  ?                     'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ?                     'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ?                     'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ?                     'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                 ?                     'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                ?                     'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ?                     'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ?                     'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ?                     'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                    ?                     'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ?                     'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ?                     'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ?                     'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE               ?                     'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE            ?                     'C9 H11 N O2'    165.189 
PHQ non-polymer         . 'benzyl chlorocarbonate' ?                     'C8 H7 Cl O2'    170.593 
PRO 'L-peptide linking' y PROLINE                  ?                     'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ?                     'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ?                     'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN               ?                     'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                 ?                     'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ?                     'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QDU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.86 
_exptl_crystal.density_percent_sol   57.02 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.3 
_exptl_crystal_grow.pdbx_details    
'300mM ammonium phosphate, 27% (w/v) isopropanol, 100mM sodium phosphate, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-10-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.873 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM1A' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM1A 
_diffrn_source.pdbx_wavelength             0.873 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QDU 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             100 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   44902 
_reflns.number_all                   44902 
_reflns.percent_possible_obs         96.3 
_reflns.pdbx_Rmerge_I_obs            0.0840000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   84.7 
_reflns_shell.Rmerge_I_obs           0.4690000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.1 
_reflns_shell.pdbx_redundancy        3.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2041 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1QDU 
_refine.ls_number_reflns_obs                     39559 
_refine.ls_number_reflns_all                     44902 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             100.0 
_refine.ls_d_res_high                            2.8 
_refine.ls_percent_reflns_obs                    97 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.230 
_refine.ls_R_factor_R_free                       0.3020 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.1 
_refine.ls_number_reflns_R_free                  4003 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'HOMOLOGY MODEL' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11802 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             146 
_refine_hist.number_atoms_total               11948 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        100.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d           0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg        1.50  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d 26.8  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d 0.7   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1QDU 
_struct.title                     'CRYSTAL STRUCTURE OF THE COMPLEX OF CASPASE-8 WITH THE TRIPEPTIDE KETONE INHIBITOR ZEVD-DCBMK' 
_struct.pdbx_descriptor           'CASPASE-8 ALPHA-CHAIN/CASPASE-8 BETA-CHAIN/Z-EVD-DCBMK' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QDU 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            'APOPTOSIS, CYSTEINE PROTEASE, HYDROLASE-HYDROLASE INHIBITOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 3 ? 
G  N N 1 ? 
H  N N 2 ? 
I  N N 3 ? 
J  N N 1 ? 
K  N N 2 ? 
L  N N 3 ? 
M  N N 1 ? 
N  N N 2 ? 
O  N N 3 ? 
P  N N 1 ? 
Q  N N 2 ? 
R  N N 3 ? 
S  N N 4 ? 
T  N N 4 ? 
U  N N 4 ? 
V  N N 4 ? 
W  N N 4 ? 
X  N N 4 ? 
Y  N N 4 ? 
Z  N N 4 ? 
AA N N 4 ? 
BA N N 4 ? 
CA N N 4 ? 
DA N N 4 ? 
EA N N 4 ? 
FA N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PHE A 23  ? LYS A 29  D PHE A 173 LYS A 175 1 ? 7  
HELX_P HELX_P2  2  VAL A 30  E HIS A 34  I VAL A 175 HIS A 175 5 ? 5  
HELX_P HELX_P3  3  GLY A 41  ? GLU A 55  ? GLY A 181 GLU A 195 1 ? 15 
HELX_P HELX_P4  4  THR A 67  ? MET A 81  ? THR A 207 MET A 221 1 ? 15 
HELX_P HELX_P5  5  ASP A 82  ? MET A 86  ? ASP A 222 MET A 227 5 ? 5  
HELX_P HELX_P6  6  ILE A 112 ? SER A 117 ? ILE A 258 SER A 263 1 ? 6  
HELX_P HELX_P7  7  GLN A 118 ? THR A 120 ? GLN A 264 THR A 266 5 ? 3  
HELX_P HELX_P8  8  TRP B 31  ? CYS B 44  ? TRP B 348 CYS B 361 1 ? 14 
HELX_P HELX_P9  9  ASP B 49  ? ASN B 63  ? ASP B 365 ASN B 379 1 ? 15 
HELX_P HELX_P10 10 PHE D 23  ? VAL D 30  E PHE C 173 VAL C 175 1 ? 8  
HELX_P HELX_P11 11 PRO D 31  F HIS D 34  I PRO C 175 HIS C 175 5 ? 4  
HELX_P HELX_P12 12 GLY D 41  ? LEU D 56  ? GLY C 181 LEU C 196 1 ? 16 
HELX_P HELX_P13 13 THR D 67  ? MET D 81  ? THR C 207 MET C 221 1 ? 15 
HELX_P HELX_P14 14 ILE D 112 ? SER D 117 ? ILE C 258 SER C 263 1 ? 6  
HELX_P HELX_P15 15 GLN D 118 ? THR D 120 ? GLN C 264 THR C 266 5 ? 3  
HELX_P HELX_P16 16 CYS D 124 ? ALA D 128 ? CYS C 270 ALA C 274 5 ? 5  
HELX_P HELX_P17 17 TRP E 31  ? CYS E 44  ? TRP D 348 CYS D 361 1 ? 14 
HELX_P HELX_P18 18 PRO E 45  ? GLY E 47  ? PRO D 362 GLY D 363 5 ? 3  
HELX_P HELX_P19 19 ASP E 49  ? ASN E 63  ? ASP D 365 ASN D 379 1 ? 15 
HELX_P HELX_P20 20 LYS E 67  C ASN E 69  E LYS D 381 ASN D 381 5 ? 3  
HELX_P HELX_P21 21 PHE G 23  ? LYS G 29  D PHE E 173 LYS E 175 1 ? 7  
HELX_P HELX_P22 22 GLY G 41  ? GLU G 55  ? GLY E 181 GLU E 195 1 ? 15 
HELX_P HELX_P23 23 THR G 67  ? MET G 81  ? THR E 207 MET E 221 1 ? 15 
HELX_P HELX_P24 24 ASP G 82  ? MET G 86  ? ASP E 222 MET E 227 5 ? 5  
HELX_P HELX_P25 25 ILE G 112 ? SER G 117 ? ILE E 258 SER E 263 1 ? 6  
HELX_P HELX_P26 26 GLN G 118 ? THR G 120 ? GLN E 264 THR E 266 5 ? 3  
HELX_P HELX_P27 27 CYS G 124 ? ALA G 128 ? CYS E 270 ALA E 274 5 ? 5  
HELX_P HELX_P28 28 TRP H 31  ? CYS H 44  ? TRP F 348 CYS F 361 1 ? 14 
HELX_P HELX_P29 29 ASP H 49  ? LYS H 64  ? ASP F 365 LYS F 381 1 ? 16 
HELX_P HELX_P30 30 PHE J 23  ? LYS J 29  D PHE G 173 LYS G 175 1 ? 7  
HELX_P HELX_P31 31 VAL J 30  E HIS J 34  I VAL G 175 HIS G 175 5 ? 5  
HELX_P HELX_P32 32 GLY J 41  ? LEU J 56  ? GLY G 181 LEU G 196 1 ? 16 
HELX_P HELX_P33 33 THR J 67  ? MET J 81  ? THR G 207 MET G 221 1 ? 15 
HELX_P HELX_P34 34 ILE J 112 ? SER J 117 ? ILE G 258 SER G 263 1 ? 6  
HELX_P HELX_P35 35 GLN J 118 ? THR J 120 ? GLN G 264 THR G 266 5 ? 3  
HELX_P HELX_P36 36 CYS J 124 ? ALA J 128 ? CYS G 270 ALA G 274 5 ? 5  
HELX_P HELX_P37 37 TRP K 31  ? CYS K 44  ? TRP H 348 CYS H 361 1 ? 14 
HELX_P HELX_P38 38 ASP K 49  ? ASN K 63  ? ASP H 365 ASN H 379 1 ? 15 
HELX_P HELX_P39 39 PHE M 23  ? LYS M 29  D PHE I 173 LYS I 175 1 ? 7  
HELX_P HELX_P40 40 VAL M 30  E HIS M 34  I VAL I 175 HIS I 175 5 ? 5  
HELX_P HELX_P41 41 GLY M 41  ? GLU M 55  ? GLY I 181 GLU I 195 1 ? 15 
HELX_P HELX_P42 42 THR M 67  ? MET M 81  ? THR I 207 MET I 221 1 ? 15 
HELX_P HELX_P43 43 ASP M 82  ? MET M 86  ? ASP I 222 MET I 227 5 ? 5  
HELX_P HELX_P44 44 ILE M 112 ? SER M 117 ? ILE I 258 SER I 263 1 ? 6  
HELX_P HELX_P45 45 GLN M 118 ? THR M 120 ? GLN I 264 THR I 266 5 ? 3  
HELX_P HELX_P46 46 TRP N 31  ? CYS N 44  ? TRP J 348 CYS J 361 1 ? 14 
HELX_P HELX_P47 47 ASP N 49  ? ASN N 63  ? ASP J 365 ASN J 379 1 ? 15 
HELX_P HELX_P48 48 PHE P 23  ? VAL P 30  E PHE K 173 VAL K 175 1 ? 8  
HELX_P HELX_P49 49 PRO P 31  F HIS P 34  I PRO K 175 HIS K 175 5 ? 4  
HELX_P HELX_P50 50 GLY P 41  ? LEU P 56  ? GLY K 181 LEU K 196 1 ? 16 
HELX_P HELX_P51 51 THR P 67  ? MET P 81  ? THR K 207 MET K 221 1 ? 15 
HELX_P HELX_P52 52 ILE P 112 ? SER P 117 ? ILE K 258 SER K 263 1 ? 6  
HELX_P HELX_P53 53 GLN P 118 ? THR P 120 ? GLN K 264 THR K 266 5 ? 3  
HELX_P HELX_P54 54 CYS P 124 ? ALA P 128 ? CYS K 270 ALA K 274 5 ? 5  
HELX_P HELX_P55 55 TRP Q 31  ? CYS Q 44  ? TRP L 348 CYS L 361 1 ? 14 
HELX_P HELX_P56 56 ASP Q 49  ? ASN Q 63  ? ASP L 365 ASN L 379 1 ? 15 
HELX_P HELX_P57 57 LYS Q 67  C ASN Q 69  E LYS L 381 ASN L 381 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? C PHQ 1   C1 ? ? ? 1_555 C GLU 2 N  ? ? T PHQ 4100 T GLU 4101 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale2  covale ? ? F PHQ 1   C1 ? ? ? 1_555 F GLU 2 N  ? ? U PHQ 4200 U GLU 4201 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale3  covale ? ? I PHQ 1   C1 ? ? ? 1_555 I GLU 2 N  ? ? V PHQ 4300 V GLU 4301 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale4  covale ? ? L PHQ 1   C1 ? ? ? 1_555 L GLU 2 N  ? ? W PHQ 4400 W GLU 4401 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale5  covale ? ? O PHQ 1   C1 ? ? ? 1_555 O GLU 2 N  ? ? X PHQ 4500 X GLU 4501 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale6  covale ? ? R PHQ 1   C1 ? ? ? 1_555 R GLU 2 N  ? ? Y PHQ 4600 Y GLU 4601 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale7  covale ? ? C ASP 4   C  ? ? ? 1_555 C 0QE 5 C1 ? ? T ASP 4103 T 0QE 4104 1_555 ? ? ? ? ? ? ? 1.345 ? 
covale8  covale ? ? F ASP 4   C  ? ? ? 1_555 F 0QE 5 C1 ? ? U ASP 4203 U 0QE 4204 1_555 ? ? ? ? ? ? ? 1.340 ? 
covale9  covale ? ? I ASP 4   C  ? ? ? 1_555 I 0QE 5 C1 ? ? V ASP 4303 V 0QE 4304 1_555 ? ? ? ? ? ? ? 1.342 ? 
covale10 covale ? ? L ASP 4   C  ? ? ? 1_555 L 0QE 5 C1 ? ? W ASP 4403 W 0QE 4404 1_555 ? ? ? ? ? ? ? 1.350 ? 
covale11 covale ? ? O ASP 4   C  ? ? ? 1_555 O 0QE 5 C1 ? ? X ASP 4503 X 0QE 4504 1_555 ? ? ? ? ? ? ? 1.356 ? 
covale12 covale ? ? R ASP 4   C  ? ? ? 1_555 R 0QE 5 C1 ? ? Y ASP 4603 Y 0QE 4604 1_555 ? ? ? ? ? ? ? 1.347 ? 
covale13 covale ? ? A CYS 139 SG ? ? ? 1_555 C 0QE 5 C1 ? ? A CYS 285  T 0QE 4104 1_555 ? ? ? ? ? ? ? 1.816 ? 
covale14 covale ? ? D CYS 139 SG ? ? ? 1_555 F 0QE 5 C1 ? ? C CYS 285  U 0QE 4204 1_555 ? ? ? ? ? ? ? 1.785 ? 
covale15 covale ? ? G CYS 139 SG ? ? ? 1_555 I 0QE 5 C1 ? ? E CYS 285  V 0QE 4304 1_555 ? ? ? ? ? ? ? 1.786 ? 
covale16 covale ? ? J CYS 139 SG ? ? ? 1_555 L 0QE 5 C1 ? ? G CYS 285  W 0QE 4404 1_555 ? ? ? ? ? ? ? 1.808 ? 
covale17 covale ? ? M CYS 139 SG ? ? ? 1_555 O 0QE 5 C1 ? ? I CYS 285  X 0QE 4504 1_555 ? ? ? ? ? ? ? 1.826 ? 
covale18 covale ? ? P CYS 139 SG ? ? ? 1_555 R 0QE 5 C1 ? ? K CYS 285  Y 0QE 4604 1_555 ? ? ? ? ? ? ? 1.835 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 6 ? 
B  ? 3 ? 
C  ? 2 ? 
D  ? 2 ? 
E  ? 3 ? 
F  ? 2 ? 
G  ? 6 ? 
H  ? 3 ? 
I  ? 2 ? 
J  ? 6 ? 
K  ? 3 ? 
L  ? 2 ? 
M  ? 2 ? 
N  ? 3 ? 
O  ? 2 ? 
P  ? 6 ? 
Q  ? 3 ? 
R  ? 2 ? 
S  ? 6 ? 
T  ? 3 ? 
U  ? 2 ? 
V  ? 2 ? 
W  ? 3 ? 
X  ? 2 ? 
Y  ? 6 ? 
Z  ? 3 ? 
AA ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? parallel      
A  2 3 ? parallel      
A  3 4 ? parallel      
A  4 5 ? parallel      
A  5 6 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
C  1 2 ? parallel      
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
F  1 2 ? anti-parallel 
G  1 2 ? parallel      
G  2 3 ? parallel      
G  3 4 ? parallel      
G  4 5 ? parallel      
G  5 6 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? parallel      
J  2 3 ? parallel      
J  3 4 ? parallel      
J  4 5 ? parallel      
J  5 6 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
L  1 2 ? parallel      
M  1 2 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
O  1 2 ? anti-parallel 
P  1 2 ? parallel      
P  2 3 ? parallel      
P  3 4 ? parallel      
P  4 5 ? parallel      
P  5 6 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
R  1 2 ? anti-parallel 
S  1 2 ? parallel      
S  2 3 ? parallel      
S  3 4 ? parallel      
S  4 5 ? parallel      
S  5 6 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
U  1 2 ? parallel      
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
X  1 2 ? anti-parallel 
Y  1 2 ? parallel      
Y  2 3 ? parallel      
Y  3 4 ? parallel      
Y  4 5 ? parallel      
Y  5 6 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
AA 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 GLU A 59  ? HIS A 64  ? GLU A 199 HIS A 204 
A  2 TYR A 14  ? ASN A 19  ? TYR A 164 ASN A 169 
A  3 PHE A 89  ? LEU A 94  ? PHE A 230 LEU A 235 
A  4 LYS A 132 ? GLN A 137 ? LYS A 278 GLN A 283 
A  5 PHE B 10  ? MET B 14  ? PHE B 327 MET B 331 
A  6 GLN B 76  ? PHE B 79  ? GLN B 388 PHE B 392 
B  1 GLY A 97  ? ASP A 98  ? GLY A 238 ASP A 239 
B  2 ILE A 101 ? TYR A 103 ? ILE A 242 TYR A 244 
B  3 GLU A 109 ? PRO A 111 ? GLU A 255 PRO A 257 
C  1 GLY A 141 ? ASN A 143 ? GLY A 287 ASN A 289 
C  2 ASN B 19  ? CYS B 20  ? ASN B 336 CYS B 337 
D  1 ILE A 148 ? VAL A 150 ? ILE A 294 VAL A 296 
D  2 ARG E 2   ? ILE E 4   ? ARG D 319 ILE D 321 
E  1 TYR B 3   ? PRO B 5   ? TYR B 320 PRO B 322 
E  2 GLN D 145 ? PRO D 149 ? GLN C 291 PRO C 295 
E  3 GLY E 71  ? LYS E 72  ? GLY D 383 LYS D 384 
F  1 ARG B 24  ? ASN B 25  ? ARG B 341 ASN B 342 
F  2 GLY B 29  ? THR B 30  ? GLY B 346 THR B 347 
G  1 GLU D 59  ? HIS D 64  ? GLU C 199 HIS C 204 
G  2 TYR D 14  ? ASN D 19  ? TYR C 164 ASN C 169 
G  3 PHE D 89  ? LEU D 94  ? PHE C 230 LEU C 235 
G  4 LYS D 132 ? GLN D 137 ? LYS C 278 GLN C 283 
G  5 PHE E 10  ? MET E 14  ? PHE D 327 MET D 331 
G  6 GLN E 76  ? PHE E 79  ? GLN D 388 PHE D 392 
H  1 GLY D 97  ? ASP D 98  ? GLY C 238 ASP C 239 
H  2 ILE D 101 ? TYR D 103 ? ILE C 242 TYR C 244 
H  3 GLU D 109 ? PRO D 111 ? GLU C 255 PRO C 257 
I  1 ARG E 24  ? ASN E 25  ? ARG D 341 ASN D 342 
I  2 GLY E 29  ? THR E 30  ? GLY D 346 THR D 347 
J  1 GLU G 59  ? HIS G 64  ? GLU E 199 HIS E 204 
J  2 TYR G 14  ? ASN G 19  ? TYR E 164 ASN E 169 
J  3 PHE G 89  ? LEU G 94  ? PHE E 230 LEU E 235 
J  4 LYS G 132 ? GLN G 137 ? LYS E 278 GLN E 283 
J  5 PHE H 10  ? MET H 14  ? PHE F 327 MET F 331 
J  6 GLN H 76  ? PHE H 79  ? GLN F 388 PHE F 392 
K  1 GLY G 97  ? ASP G 98  ? GLY E 238 ASP E 239 
K  2 ILE G 101 ? TYR G 103 ? ILE E 242 TYR E 244 
K  3 GLU G 109 ? PRO G 111 ? GLU E 255 PRO E 257 
L  1 GLY G 141 ? ASN G 143 ? GLY E 287 ASN E 289 
L  2 ASN H 19  ? CYS H 20  ? ASN F 336 CYS F 337 
M  1 ILE G 148 ? VAL G 150 ? ILE E 294 VAL E 296 
M  2 ARG K 2   ? ILE K 4   ? ARG H 319 ILE H 321 
N  1 TYR H 3   ? PRO H 5   ? TYR F 320 PRO F 322 
N  2 GLN J 145 ? PRO J 149 ? GLN G 291 PRO G 295 
N  3 GLY K 71  ? LYS K 72  ? GLY H 383 LYS H 384 
O  1 ARG H 24  ? ASN H 25  ? ARG F 341 ASN F 342 
O  2 GLY H 29  ? THR H 30  ? GLY F 346 THR F 347 
P  1 GLU J 59  ? HIS J 64  ? GLU G 199 HIS G 204 
P  2 TYR J 14  ? ASN J 19  ? TYR G 164 ASN G 169 
P  3 PHE J 89  ? LEU J 94  ? PHE G 230 LEU G 235 
P  4 LYS J 132 ? GLN J 137 ? LYS G 278 GLN G 283 
P  5 PHE K 10  ? MET K 14  ? PHE H 327 MET H 331 
P  6 GLN K 76  ? PHE K 79  ? GLN H 388 PHE H 392 
Q  1 GLY J 97  ? ASP J 98  ? GLY G 238 ASP G 239 
Q  2 ILE J 101 ? TYR J 103 ? ILE G 242 TYR G 244 
Q  3 GLU J 109 ? PRO J 111 ? GLU G 255 PRO G 257 
R  1 ARG K 24  ? ASN K 25  ? ARG H 341 ASN H 342 
R  2 GLY K 29  ? THR K 30  ? GLY H 346 THR H 347 
S  1 GLU M 59  ? HIS M 64  ? GLU I 199 HIS I 204 
S  2 TYR M 14  ? ASN M 19  ? TYR I 164 ASN I 169 
S  3 PHE M 89  ? LEU M 94  ? PHE I 230 LEU I 235 
S  4 LYS M 132 ? GLN M 137 ? LYS I 278 GLN I 283 
S  5 PHE N 10  ? MET N 14  ? PHE J 327 MET J 331 
S  6 GLN N 76  ? PHE N 79  ? GLN J 388 PHE J 392 
T  1 GLY M 97  ? ASP M 98  ? GLY I 238 ASP I 239 
T  2 ILE M 101 ? TYR M 103 ? ILE I 242 TYR I 244 
T  3 GLU M 109 ? PRO M 111 ? GLU I 255 PRO I 257 
U  1 GLY M 141 ? ASN M 143 ? GLY I 287 ASN I 289 
U  2 ASN N 19  ? CYS N 20  ? ASN J 336 CYS J 337 
V  1 ILE M 148 ? VAL M 150 ? ILE I 294 VAL I 296 
V  2 ARG Q 2   ? ILE Q 4   ? ARG L 319 ILE L 321 
W  1 TYR N 3   ? PRO N 5   ? TYR J 320 PRO J 322 
W  2 GLN P 145 ? PRO P 149 ? GLN K 291 PRO K 295 
W  3 GLY Q 71  ? LYS Q 72  ? GLY L 383 LYS L 384 
X  1 ARG N 24  ? ASN N 25  ? ARG J 341 ASN J 342 
X  2 GLY N 29  ? THR N 30  ? GLY J 346 THR J 347 
Y  1 GLU P 59  ? HIS P 64  ? GLU K 199 HIS K 204 
Y  2 TYR P 14  ? ASN P 19  ? TYR K 164 ASN K 169 
Y  3 PHE P 89  ? LEU P 94  ? PHE K 230 LEU K 235 
Y  4 LYS P 132 ? GLN P 137 ? LYS K 278 GLN K 283 
Y  5 PHE Q 10  ? MET Q 14  ? PHE L 327 MET L 331 
Y  6 GLN Q 76  ? PHE Q 79  ? GLN L 388 PHE L 392 
Z  1 GLY P 97  ? ASP P 98  ? GLY K 238 ASP K 239 
Z  2 ILE P 101 ? TYR P 103 ? ILE K 242 TYR K 244 
Z  3 GLU P 109 ? PRO P 111 ? GLU K 255 PRO K 257 
AA 1 ARG Q 24  ? ASN Q 25  ? ARG L 341 ASN L 342 
AA 2 GLY Q 29  ? THR Q 30  ? GLY L 346 THR L 347 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O GLU A 59  ? O GLU A 199 N CYS A 15  ? N CYS A 165 
A  2 3 O TYR A 14  ? O TYR A 164 N ILE A 90  ? N ILE A 231 
A  3 4 O PHE A 89  ? O PHE A 230 N VAL A 133 ? N VAL A 279 
A  4 5 N PHE A 134 ? N PHE A 280 O LEU B 11  ? O LEU B 328 
A  5 6 O MET B 14  ? O MET B 331 N GLN B 76  ? N GLN B 388 
B  1 2 O ASP A 98  ? O ASP A 239 N ILE A 101 ? N ILE A 242 
B  2 3 O ILE A 102 ? O ILE A 243 N ALA A 110 ? N ALA A 256 
C  1 2 N ASN A 143 ? N ASN A 289 O ASN B 19  ? O ASN B 336 
D  1 2 N VAL A 150 ? N VAL A 296 O ARG E 2   ? O ARG D 319 
E  1 2 O ILE B 4   ? O ILE B 321 N ILE D 148 ? N ILE C 294 
E  2 3 N GLN D 145 ? N GLN C 291 O LYS E 72  ? O LYS D 384 
F  1 2 O ASN B 25  ? O ASN B 342 N GLY B 29  ? N GLY B 346 
G  1 2 O GLU D 59  ? O GLU C 199 N CYS D 15  ? N CYS C 165 
G  2 3 O TYR D 14  ? O TYR C 164 N ILE D 90  ? N ILE C 231 
G  3 4 O PHE D 89  ? O PHE C 230 N VAL D 133 ? N VAL C 279 
G  4 5 N PHE D 134 ? N PHE C 280 O LEU E 11  ? O LEU D 328 
G  5 6 O MET E 14  ? O MET D 331 N GLN E 76  ? N GLN D 388 
H  1 2 O ASP D 98  ? O ASP C 239 N ILE D 101 ? N ILE C 242 
H  2 3 N ILE D 102 ? N ILE C 243 O ALA D 110 ? O ALA C 256 
I  1 2 O ASN E 25  ? O ASN D 342 N GLY E 29  ? N GLY D 346 
J  1 2 O GLU G 59  ? O GLU E 199 N CYS G 15  ? N CYS E 165 
J  2 3 O TYR G 14  ? O TYR E 164 N ILE G 90  ? N ILE E 231 
J  3 4 O PHE G 89  ? O PHE E 230 N VAL G 133 ? N VAL E 279 
J  4 5 N PHE G 134 ? N PHE E 280 O LEU H 11  ? O LEU F 328 
J  5 6 O MET H 14  ? O MET F 331 N GLN H 76  ? N GLN F 388 
K  1 2 O ASP G 98  ? O ASP E 239 N ILE G 101 ? N ILE E 242 
K  2 3 O ILE G 102 ? O ILE E 243 N ALA G 110 ? N ALA E 256 
L  1 2 N ASN G 143 ? N ASN E 289 O ASN H 19  ? O ASN F 336 
M  1 2 N VAL G 150 ? N VAL E 296 O ARG K 2   ? O ARG H 319 
N  1 2 O ILE H 4   ? O ILE F 321 N ILE J 148 ? N ILE G 294 
N  2 3 O GLN J 145 ? O GLN G 291 N LYS K 72  ? N LYS H 384 
O  1 2 O ASN H 25  ? O ASN F 342 N GLY H 29  ? N GLY F 346 
P  1 2 O GLU J 59  ? O GLU G 199 N CYS J 15  ? N CYS G 165 
P  2 3 O TYR J 14  ? O TYR G 164 N ILE J 90  ? N ILE G 231 
P  3 4 O PHE J 89  ? O PHE G 230 N VAL J 133 ? N VAL G 279 
P  4 5 N PHE J 134 ? N PHE G 280 O LEU K 11  ? O LEU H 328 
P  5 6 O MET K 14  ? O MET H 331 N GLN K 76  ? N GLN H 388 
Q  1 2 O ASP J 98  ? O ASP G 239 N ILE J 101 ? N ILE G 242 
Q  2 3 O ILE J 102 ? O ILE G 243 N ALA J 110 ? N ALA G 256 
R  1 2 N ASN K 25  ? N ASN H 342 O GLY K 29  ? O GLY H 346 
S  1 2 O GLU M 59  ? O GLU I 199 N CYS M 15  ? N CYS I 165 
S  2 3 O TYR M 14  ? O TYR I 164 N ILE M 90  ? N ILE I 231 
S  3 4 O PHE M 89  ? O PHE I 230 N VAL M 133 ? N VAL I 279 
S  4 5 N PHE M 134 ? N PHE I 280 O LEU N 11  ? O LEU J 328 
S  5 6 O MET N 14  ? O MET J 331 N GLN N 76  ? N GLN J 388 
T  1 2 O ASP M 98  ? O ASP I 239 N ILE M 101 ? N ILE I 242 
T  2 3 O ILE M 102 ? O ILE I 243 N ALA M 110 ? N ALA I 256 
U  1 2 N ASN M 143 ? N ASN I 289 O ASN N 19  ? O ASN J 336 
V  1 2 N VAL M 150 ? N VAL I 296 O ARG Q 2   ? O ARG L 319 
W  1 2 O ILE N 4   ? O ILE J 321 N ILE P 148 ? N ILE K 294 
W  2 3 O GLN P 145 ? O GLN K 291 N LYS Q 72  ? N LYS L 384 
X  1 2 O ASN N 25  ? O ASN J 342 N GLY N 29  ? N GLY J 346 
Y  1 2 O GLU P 59  ? O GLU K 199 N CYS P 15  ? N CYS K 165 
Y  2 3 O TYR P 14  ? O TYR K 164 N ILE P 90  ? N ILE K 231 
Y  3 4 O PHE P 89  ? O PHE K 230 N VAL P 133 ? N VAL K 279 
Y  4 5 N PHE P 134 ? N PHE K 280 O LEU Q 11  ? O LEU L 328 
Y  5 6 O MET Q 14  ? O MET L 331 N GLN Q 76  ? N GLN L 388 
Z  1 2 O ASP P 98  ? O ASP K 239 N ILE P 101 ? N ILE K 242 
Z  2 3 O ILE P 102 ? O ILE K 243 N ALA P 110 ? N ALA K 256 
AA 1 2 N ASN Q 25  ? N ASN L 342 O GLY Q 29  ? O GLY L 346 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR CHAIN T OF PHQ-GLU-VAL-ASP-DICHLOROMETHYLKETONE INHIBITOR' 
AC2 Software ? ? ? ? 10 'BINDING SITE FOR CHAIN U OF PHQ-GLU-VAL-ASP-DICHLOROMETHYLKETONE INHIBITOR' 
AC3 Software ? ? ? ? 11 'BINDING SITE FOR CHAIN V OF PHQ-GLU-VAL-ASP-DICHLOROMETHYLKETONE INHIBITOR' 
AC4 Software ? ? ? ? 9  'BINDING SITE FOR CHAIN W OF PHQ-GLU-VAL-ASP-DICHLOROMETHYLKETONE INHIBITOR' 
AC5 Software ? ? ? ? 9  'BINDING SITE FOR CHAIN X OF PHQ-GLU-VAL-ASP-DICHLOROMETHYLKETONE INHIBITOR' 
AC6 Software ? ? ? ? 9  'BINDING SITE FOR CHAIN Y OF PHQ-GLU-VAL-ASP-DICHLOROMETHYLKETONE INHIBITOR' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  ARG A  39  ? ARG A 179 . ? 1_555 ? 
2  AC1 8  HIS A  96  ? HIS A 237 . ? 1_555 ? 
3  AC1 8  GLY A  97  ? GLY A 238 . ? 1_555 ? 
4  AC1 8  CYS A  139 ? CYS A 285 . ? 1_555 ? 
5  AC1 8  SER B  22  ? SER B 339 . ? 1_555 ? 
6  AC1 8  TYR B  23  ? TYR B 340 . ? 1_555 ? 
7  AC1 8  ARG B  24  ? ARG B 341 . ? 1_555 ? 
8  AC1 8  PRO B  26  ? PRO B 343 . ? 1_555 ? 
9  AC2 10 HOH U  .   ? HOH C 54  . ? 1_555 ? 
10 AC2 10 ARG D  39  ? ARG C 179 . ? 1_555 ? 
11 AC2 10 HIS D  96  ? HIS C 237 . ? 1_555 ? 
12 AC2 10 GLY D  97  ? GLY C 238 . ? 1_555 ? 
13 AC2 10 GLN D  137 ? GLN C 283 . ? 1_555 ? 
14 AC2 10 CYS D  139 ? CYS C 285 . ? 1_555 ? 
15 AC2 10 SER E  22  ? SER D 339 . ? 1_555 ? 
16 AC2 10 TYR E  23  ? TYR D 340 . ? 1_555 ? 
17 AC2 10 ARG E  24  ? ARG D 341 . ? 1_555 ? 
18 AC2 10 THR E  30  ? THR D 347 . ? 1_555 ? 
19 AC3 11 ARG G  37  ? ARG E 177 . ? 1_555 ? 
20 AC3 11 ARG G  39  ? ARG E 179 . ? 1_555 ? 
21 AC3 11 HIS G  96  ? HIS E 237 . ? 1_555 ? 
22 AC3 11 GLY G  97  ? GLY E 238 . ? 1_555 ? 
23 AC3 11 GLN G  137 ? GLN E 283 . ? 1_555 ? 
24 AC3 11 CYS G  139 ? CYS E 285 . ? 1_555 ? 
25 AC3 11 SER H  22  ? SER F 339 . ? 1_555 ? 
26 AC3 11 TYR H  23  ? TYR F 340 . ? 1_555 ? 
27 AC3 11 ARG H  24  ? ARG F 341 . ? 1_555 ? 
28 AC3 11 HOH Y  .   ? HOH V 103 . ? 1_555 ? 
29 AC3 11 HOH Y  .   ? HOH V 116 . ? 1_555 ? 
30 AC4 9  ARG J  39  ? ARG G 179 . ? 1_555 ? 
31 AC4 9  HIS J  96  ? HIS G 237 . ? 1_555 ? 
32 AC4 9  GLY J  97  ? GLY G 238 . ? 1_555 ? 
33 AC4 9  GLN J  137 ? GLN G 283 . ? 1_555 ? 
34 AC4 9  CYS J  139 ? CYS G 285 . ? 1_555 ? 
35 AC4 9  SER K  22  ? SER H 339 . ? 1_555 ? 
36 AC4 9  TYR K  23  ? TYR H 340 . ? 1_555 ? 
37 AC4 9  ARG K  24  ? ARG H 341 . ? 1_555 ? 
38 AC4 9  PRO K  26  ? PRO H 343 . ? 1_555 ? 
39 AC5 9  ARG M  39  ? ARG I 179 . ? 1_555 ? 
40 AC5 9  HIS M  96  ? HIS I 237 . ? 1_555 ? 
41 AC5 9  GLY M  97  ? GLY I 238 . ? 1_555 ? 
42 AC5 9  GLN M  137 ? GLN I 283 . ? 1_555 ? 
43 AC5 9  CYS M  139 ? CYS I 285 . ? 1_555 ? 
44 AC5 9  SER N  22  ? SER J 339 . ? 1_555 ? 
45 AC5 9  TYR N  23  ? TYR J 340 . ? 1_555 ? 
46 AC5 9  ARG N  24  ? ARG J 341 . ? 1_555 ? 
47 AC5 9  PRO N  26  ? PRO J 343 . ? 1_555 ? 
48 AC6 9  ARG P  39  ? ARG K 179 . ? 1_555 ? 
49 AC6 9  HIS P  96  ? HIS K 237 . ? 1_555 ? 
50 AC6 9  GLY P  97  ? GLY K 238 . ? 1_555 ? 
51 AC6 9  GLN P  137 ? GLN K 283 . ? 1_555 ? 
52 AC6 9  CYS P  139 ? CYS K 285 . ? 1_555 ? 
53 AC6 9  SER Q  22  ? SER L 339 . ? 1_555 ? 
54 AC6 9  TYR Q  23  ? TYR L 340 . ? 1_555 ? 
55 AC6 9  ARG Q  24  ? ARG L 341 . ? 1_555 ? 
56 AC6 9  HOH FA .   ? HOH Y 104 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QDU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QDU 
_atom_sites.fract_transf_matrix[1][1]   0.010650 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002322 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004842 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010029 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . LEU A  1 1   ? 17.020  49.489  66.217  1.00 100.00 ? 149  LEU A N   1 
ATOM   2     C CA  . LEU A  1 1   ? 18.041  48.754  67.024  1.00 100.00 ? 149  LEU A CA  1 
ATOM   3     C C   . LEU A  1 1   ? 17.488  48.238  68.358  1.00 100.00 ? 149  LEU A C   1 
ATOM   4     O O   . LEU A  1 1   ? 16.684  48.911  69.026  1.00 100.00 ? 149  LEU A O   1 
ATOM   5     C CB  . LEU A  1 1   ? 19.252  49.653  67.302  1.00 100.00 ? 149  LEU A CB  1 
ATOM   6     C CG  . LEU A  1 1   ? 20.262  49.139  68.335  1.00 100.00 ? 149  LEU A CG  1 
ATOM   7     C CD1 . LEU A  1 1   ? 21.653  49.577  67.925  1.00 100.00 ? 149  LEU A CD1 1 
ATOM   8     C CD2 . LEU A  1 1   ? 19.925  49.669  69.721  1.00 100.00 ? 149  LEU A CD2 1 
ATOM   9     N N   . ASP A  1 2   ? 17.929  47.035  68.725  1.00 75.92  ? 150  ASP A N   1 
ATOM   10    C CA  . ASP A  1 2   ? 17.551  46.357  69.962  1.00 75.92  ? 150  ASP A CA  1 
ATOM   11    C C   . ASP A  1 2   ? 18.157  44.966  69.864  1.00 75.92  ? 150  ASP A C   1 
ATOM   12    O O   . ASP A  1 2   ? 18.507  44.518  68.773  1.00 75.92  ? 150  ASP A O   1 
ATOM   13    C CB  . ASP A  1 2   ? 16.014  46.276  70.152  1.00 75.92  ? 150  ASP A CB  1 
ATOM   14    C CG  . ASP A  1 2   ? 15.227  46.233  68.830  1.00 75.92  ? 150  ASP A CG  1 
ATOM   15    O OD1 . ASP A  1 2   ? 15.836  46.135  67.742  1.00 75.92  ? 150  ASP A OD1 1 
ATOM   16    O OD2 . ASP A  1 2   ? 13.978  46.295  68.885  1.00 75.92  ? 150  ASP A OD2 1 
ATOM   17    N N   . LYS A  1 3   ? 18.282  44.281  70.994  1.00 57.34  ? 151  LYS A N   1 
ATOM   18    C CA  . LYS A  1 3   ? 18.883  42.960  70.992  1.00 57.34  ? 151  LYS A CA  1 
ATOM   19    C C   . LYS A  1 3   ? 18.206  41.892  70.132  1.00 57.34  ? 151  LYS A C   1 
ATOM   20    O O   . LYS A  1 3   ? 16.987  41.770  70.085  1.00 57.34  ? 151  LYS A O   1 
ATOM   21    C CB  . LYS A  1 3   ? 19.030  42.450  72.418  1.00 57.34  ? 151  LYS A CB  1 
ATOM   22    C CG  . LYS A  1 3   ? 20.273  41.588  72.612  1.00 57.34  ? 151  LYS A CG  1 
ATOM   23    C CD  . LYS A  1 3   ? 21.305  41.737  71.458  1.00 57.34  ? 151  LYS A CD  1 
ATOM   24    C CE  . LYS A  1 3   ? 22.449  40.718  71.564  1.00 57.34  ? 151  LYS A CE  1 
ATOM   25    N NZ  . LYS A  1 3   ? 23.287  40.706  70.324  1.00 57.34  ? 151  LYS A NZ  1 
ATOM   26    N N   . VAL A  1 4   ? 19.027  41.110  69.447  1.00 45.78  ? 152  VAL A N   1 
ATOM   27    C CA  . VAL A  1 4   ? 18.523  40.048  68.596  1.00 45.78  ? 152  VAL A CA  1 
ATOM   28    C C   . VAL A  1 4   ? 19.224  38.728  68.899  1.00 45.78  ? 152  VAL A C   1 
ATOM   29    O O   . VAL A  1 4   ? 20.412  38.692  69.252  1.00 45.78  ? 152  VAL A O   1 
ATOM   30    C CB  . VAL A  1 4   ? 18.737  40.366  67.109  1.00 45.78  ? 152  VAL A CB  1 
ATOM   31    C CG1 . VAL A  1 4   ? 18.372  39.163  66.271  1.00 45.78  ? 152  VAL A CG1 1 
ATOM   32    C CG2 . VAL A  1 4   ? 17.909  41.561  66.709  1.00 45.78  ? 152  VAL A CG2 1 
ATOM   33    N N   . TYR A  1 5   ? 18.473  37.643  68.759  1.00 30.66  ? 153  TYR A N   1 
ATOM   34    C CA  . TYR A  1 5   ? 19.002  36.317  68.988  1.00 30.66  ? 153  TYR A CA  1 
ATOM   35    C C   . TYR A  1 5   ? 20.024  36.007  67.898  1.00 30.66  ? 153  TYR A C   1 
ATOM   36    O O   . TYR A  1 5   ? 19.727  36.133  66.703  1.00 30.66  ? 153  TYR A O   1 
ATOM   37    C CB  . TYR A  1 5   ? 17.875  35.306  68.910  1.00 30.66  ? 153  TYR A CB  1 
ATOM   38    C CG  . TYR A  1 5   ? 17.113  35.130  70.200  1.00 30.66  ? 153  TYR A CG  1 
ATOM   39    C CD1 . TYR A  1 5   ? 17.765  34.763  71.367  1.00 30.66  ? 153  TYR A CD1 1 
ATOM   40    C CD2 . TYR A  1 5   ? 15.743  35.314  70.252  1.00 30.66  ? 153  TYR A CD2 1 
ATOM   41    C CE1 . TYR A  1 5   ? 17.076  34.582  72.554  1.00 30.66  ? 153  TYR A CE1 1 
ATOM   42    C CE2 . TYR A  1 5   ? 15.046  35.134  71.438  1.00 30.66  ? 153  TYR A CE2 1 
ATOM   43    C CZ  . TYR A  1 5   ? 15.720  34.767  72.582  1.00 30.66  ? 153  TYR A CZ  1 
ATOM   44    O OH  . TYR A  1 5   ? 15.042  34.571  73.759  1.00 30.66  ? 153  TYR A OH  1 
ATOM   45    N N   . GLN A  1 6   ? 21.225  35.610  68.308  1.00 47.81  ? 154  GLN A N   1 
ATOM   46    C CA  . GLN A  1 6   ? 22.285  35.256  67.375  1.00 47.81  ? 154  GLN A CA  1 
ATOM   47    C C   . GLN A  1 6   ? 21.859  34.103  66.476  1.00 47.81  ? 154  GLN A C   1 
ATOM   48    O O   . GLN A  1 6   ? 21.480  33.035  66.948  1.00 47.81  ? 154  GLN A O   1 
ATOM   49    C CB  . GLN A  1 6   ? 23.528  34.842  68.139  1.00 47.81  ? 154  GLN A CB  1 
ATOM   50    C CG  . GLN A  1 6   ? 24.484  33.982  67.328  1.00 47.81  ? 154  GLN A CG  1 
ATOM   51    C CD  . GLN A  1 6   ? 25.936  34.372  67.565  1.00 47.81  ? 154  GLN A CD  1 
ATOM   52    O OE1 . GLN A  1 6   ? 26.437  34.272  68.696  1.00 47.81  ? 154  GLN A OE1 1 
ATOM   53    N NE2 . GLN A  1 6   ? 26.623  34.823  66.502  1.00 47.81  ? 154  GLN A NE2 1 
ATOM   54    N N   . MET A  1 7   ? 21.932  34.322  65.173  1.00 42.03  ? 155  MET A N   1 
ATOM   55    C CA  . MET A  1 7   ? 21.550  33.301  64.212  1.00 42.03  ? 155  MET A CA  1 
ATOM   56    C C   . MET A  1 7   ? 22.632  33.199  63.157  1.00 42.03  ? 155  MET A C   1 
ATOM   57    O O   . MET A  1 7   ? 22.379  33.461  61.985  1.00 42.03  ? 155  MET A O   1 
ATOM   58    C CB  . MET A  1 7   ? 20.221  33.667  63.541  1.00 42.03  ? 155  MET A CB  1 
ATOM   59    C CG  . MET A  1 7   ? 18.980  33.422  64.405  1.00 42.03  ? 155  MET A CG  1 
ATOM   60    S SD  . MET A  1 7   ? 18.737  31.646  64.693  1.00 42.03  ? 155  MET A SD  1 
ATOM   61    C CE  . MET A  1 7   ? 18.522  31.133  63.046  1.00 42.03  ? 155  MET A CE  1 
ATOM   62    N N   . LYS A  1 8   ? 23.835  32.808  63.581  1.00 67.96  ? 156  LYS A N   1 
ATOM   63    C CA  . LYS A  1 8   ? 24.996  32.677  62.691  1.00 67.96  ? 156  LYS A CA  1 
ATOM   64    C C   . LYS A  1 8   ? 25.328  31.234  62.341  1.00 67.96  ? 156  LYS A C   1 
ATOM   65    O O   . LYS A  1 8   ? 25.650  30.934  61.194  1.00 67.96  ? 156  LYS A O   1 
ATOM   66    C CB  . LYS A  1 8   ? 26.229  33.310  63.343  1.00 67.96  ? 156  LYS A CB  1 
ATOM   67    C CG  . LYS A  1 8   ? 26.651  34.643  62.743  1.00 67.96  ? 156  LYS A CG  1 
ATOM   68    C CD  . LYS A  1 8   ? 27.971  35.159  63.356  1.00 67.96  ? 156  LYS A CD  1 
ATOM   69    C CE  . LYS A  1 8   ? 29.090  35.332  62.286  1.00 67.96  ? 156  LYS A CE  1 
ATOM   70    N NZ  . LYS A  1 8   ? 30.442  34.812  62.696  1.00 67.96  ? 156  LYS A NZ  1 
ATOM   71    N N   . SER A  1 9   ? 25.251  30.360  63.344  1.00 53.44  ? 157  SER A N   1 
ATOM   72    C CA  . SER A  1 9   ? 25.555  28.927  63.229  1.00 53.44  ? 157  SER A CA  1 
ATOM   73    C C   . SER A  1 9   ? 25.433  28.268  61.840  1.00 53.44  ? 157  SER A C   1 
ATOM   74    O O   . SER A  1 9   ? 24.585  28.655  61.033  1.00 53.44  ? 157  SER A O   1 
ATOM   75    C CB  . SER A  1 9   ? 24.696  28.162  64.232  1.00 53.44  ? 157  SER A CB  1 
ATOM   76    O OG  . SER A  1 9   ? 24.598  26.800  63.865  1.00 53.44  ? 157  SER A OG  1 
ATOM   77    N N   . LYS A  1 10  ? 26.283  27.266  61.575  1.00 100.00 ? 160  LYS A N   1 
ATOM   78    C CA  . LYS A  1 10  ? 26.285  26.554  60.285  1.00 100.00 ? 160  LYS A CA  1 
ATOM   79    C C   . LYS A  1 10  ? 24.950  25.888  60.022  1.00 100.00 ? 160  LYS A C   1 
ATOM   80    O O   . LYS A  1 10  ? 24.269  26.229  59.059  1.00 100.00 ? 160  LYS A O   1 
ATOM   81    C CB  . LYS A  1 10  ? 27.389  25.487  60.212  1.00 100.00 ? 160  LYS A CB  1 
ATOM   82    C CG  . LYS A  1 10  ? 28.219  25.316  61.466  1.00 100.00 ? 160  LYS A CG  1 
ATOM   83    C CD  . LYS A  1 10  ? 29.567  24.700  61.128  1.00 100.00 ? 160  LYS A CD  1 
ATOM   84    C CE  . LYS A  1 10  ? 30.423  25.659  60.310  1.00 100.00 ? 160  LYS A CE  1 
ATOM   85    N NZ  . LYS A  1 10  ? 30.396  25.328  58.863  1.00 100.00 ? 160  LYS A NZ  1 
ATOM   86    N N   . PRO A  1 11  ? 24.566  24.902  60.850  1.00 82.14  ? 161  PRO A N   1 
ATOM   87    C CA  . PRO A  1 11  ? 23.264  24.301  60.561  1.00 82.14  ? 161  PRO A CA  1 
ATOM   88    C C   . PRO A  1 11  ? 22.155  25.111  61.252  1.00 82.14  ? 161  PRO A C   1 
ATOM   89    O O   . PRO A  1 11  ? 20.966  24.869  61.033  1.00 82.14  ? 161  PRO A O   1 
ATOM   90    C CB  . PRO A  1 11  ? 23.397  22.890  61.124  1.00 82.14  ? 161  PRO A CB  1 
ATOM   91    C CG  . PRO A  1 11  ? 24.379  23.031  62.250  1.00 82.14  ? 161  PRO A CG  1 
ATOM   92    C CD  . PRO A  1 11  ? 25.211  24.273  62.016  1.00 82.14  ? 161  PRO A CD  1 
ATOM   93    N N   . ARG A  1 12  ? 22.564  26.081  62.074  1.00 38.31  ? 162  ARG A N   1 
ATOM   94    C CA  . ARG A  1 12  ? 21.651  26.949  62.837  1.00 38.31  ? 162  ARG A CA  1 
ATOM   95    C C   . ARG A  1 12  ? 21.005  26.203  63.992  1.00 38.31  ? 162  ARG A C   1 
ATOM   96    O O   . ARG A  1 12  ? 20.963  26.708  65.122  1.00 38.31  ? 162  ARG A O   1 
ATOM   97    C CB  . ARG A  1 12  ? 20.567  27.515  61.939  1.00 38.31  ? 162  ARG A CB  1 
ATOM   98    C CG  . ARG A  1 12  ? 21.098  28.422  60.867  1.00 38.31  ? 162  ARG A CG  1 
ATOM   99    C CD  . ARG A  1 12  ? 20.465  29.782  60.971  1.00 38.31  ? 162  ARG A CD  1 
ATOM   100   N NE  . ARG A  1 12  ? 20.833  30.605  59.830  1.00 38.31  ? 162  ARG A NE  1 
ATOM   101   C CZ  . ARG A  1 12  ? 22.048  31.101  59.653  1.00 38.31  ? 162  ARG A CZ  1 
ATOM   102   N NH1 . ARG A  1 12  ? 22.989  30.845  60.553  1.00 38.31  ? 162  ARG A NH1 1 
ATOM   103   N NH2 . ARG A  1 12  ? 22.312  31.843  58.584  1.00 38.31  ? 162  ARG A NH2 1 
ATOM   104   N N   . GLY A  1 13  ? 20.523  24.995  63.682  1.00 44.23  ? 163  GLY A N   1 
ATOM   105   C CA  . GLY A  1 13  ? 19.875  24.117  64.648  1.00 44.23  ? 163  GLY A CA  1 
ATOM   106   C C   . GLY A  1 13  ? 18.970  23.127  63.929  1.00 44.23  ? 163  GLY A C   1 
ATOM   107   O O   . GLY A  1 13  ? 18.751  23.239  62.714  1.00 44.23  ? 163  GLY A O   1 
ATOM   108   N N   . TYR A  1 14  ? 18.438  22.155  64.660  1.00 45.94  ? 164  TYR A N   1 
ATOM   109   C CA  . TYR A  1 14  ? 17.558  21.165  64.053  1.00 45.94  ? 164  TYR A CA  1 
ATOM   110   C C   . TYR A  1 14  ? 16.148  21.701  63.907  1.00 45.94  ? 164  TYR A C   1 
ATOM   111   O O   . TYR A  1 14  ? 15.740  22.623  64.600  1.00 45.94  ? 164  TYR A O   1 
ATOM   112   C CB  . TYR A  1 14  ? 17.519  19.897  64.902  1.00 45.94  ? 164  TYR A CB  1 
ATOM   113   C CG  . TYR A  1 14  ? 18.831  19.159  64.938  1.00 45.94  ? 164  TYR A CG  1 
ATOM   114   C CD1 . TYR A  1 14  ? 19.464  18.780  63.752  1.00 45.94  ? 164  TYR A CD1 1 
ATOM   115   C CD2 . TYR A  1 14  ? 19.469  18.888  66.150  1.00 45.94  ? 164  TYR A CD2 1 
ATOM   116   C CE1 . TYR A  1 14  ? 20.704  18.161  63.764  1.00 45.94  ? 164  TYR A CE1 1 
ATOM   117   C CE2 . TYR A  1 14  ? 20.707  18.271  66.182  1.00 45.94  ? 164  TYR A CE2 1 
ATOM   118   C CZ  . TYR A  1 14  ? 21.329  17.911  64.986  1.00 45.94  ? 164  TYR A CZ  1 
ATOM   119   O OH  . TYR A  1 14  ? 22.595  17.347  65.009  1.00 45.94  ? 164  TYR A OH  1 
ATOM   120   N N   . CYS A  1 15  ? 15.404  21.118  62.984  1.00 36.80  ? 165  CYS A N   1 
ATOM   121   C CA  . CYS A  1 15  ? 14.028  21.510  62.783  1.00 36.80  ? 165  CYS A CA  1 
ATOM   122   C C   . CYS A  1 15  ? 13.194  20.245  62.680  1.00 36.80  ? 165  CYS A C   1 
ATOM   123   O O   . CYS A  1 15  ? 12.993  19.709  61.592  1.00 36.80  ? 165  CYS A O   1 
ATOM   124   C CB  . CYS A  1 15  ? 13.880  22.325  61.504  1.00 36.80  ? 165  CYS A CB  1 
ATOM   125   S SG  . CYS A  1 15  ? 12.122  22.606  60.987  1.00 36.80  ? 165  CYS A SG  1 
ATOM   126   N N   . LEU A  1 16  ? 12.721  19.752  63.814  1.00 41.64  ? 166  LEU A N   1 
ATOM   127   C CA  . LEU A  1 16  ? 11.897  18.551  63.807  1.00 41.64  ? 166  LEU A CA  1 
ATOM   128   C C   . LEU A  1 16  ? 10.608  18.751  63.050  1.00 41.64  ? 166  LEU A C   1 
ATOM   129   O O   . LEU A  1 16  ? 10.040  19.838  63.025  1.00 41.64  ? 166  LEU A O   1 
ATOM   130   C CB  . LEU A  1 16  ? 11.516  18.149  65.212  1.00 41.64  ? 166  LEU A CB  1 
ATOM   131   C CG  . LEU A  1 16  ? 12.635  17.720  66.122  1.00 41.64  ? 166  LEU A CG  1 
ATOM   132   C CD1 . LEU A  1 16  ? 12.157  16.508  66.890  1.00 41.64  ? 166  LEU A CD1 1 
ATOM   133   C CD2 . LEU A  1 16  ? 13.883  17.425  65.311  1.00 41.64  ? 166  LEU A CD2 1 
ATOM   134   N N   . ILE A  1 17  ? 10.118  17.681  62.461  1.00 22.31  ? 167  ILE A N   1 
ATOM   135   C CA  . ILE A  1 17  ? 8.879   17.773  61.736  1.00 22.31  ? 167  ILE A CA  1 
ATOM   136   C C   . ILE A  1 17  ? 8.109   16.511  61.972  1.00 22.31  ? 167  ILE A C   1 
ATOM   137   O O   . ILE A  1 17  ? 8.189   15.596  61.157  1.00 22.31  ? 167  ILE A O   1 
ATOM   138   C CB  . ILE A  1 17  ? 9.092   17.902  60.221  1.00 22.31  ? 167  ILE A CB  1 
ATOM   139   C CG1 . ILE A  1 17  ? 9.851   19.187  59.896  1.00 22.31  ? 167  ILE A CG1 1 
ATOM   140   C CG2 . ILE A  1 17  ? 7.752   17.940  59.537  1.00 22.31  ? 167  ILE A CG2 1 
ATOM   141   C CD1 . ILE A  1 17  ? 9.704   19.633  58.460  1.00 22.31  ? 167  ILE A CD1 1 
ATOM   142   N N   . ILE A  1 18  ? 7.394   16.438  63.089  1.00 32.69  ? 168  ILE A N   1 
ATOM   143   C CA  . ILE A  1 18  ? 6.591   15.263  63.360  1.00 32.69  ? 168  ILE A CA  1 
ATOM   144   C C   . ILE A  1 18  ? 5.312   15.444  62.553  1.00 32.69  ? 168  ILE A C   1 
ATOM   145   O O   . ILE A  1 18  ? 4.479   16.290  62.856  1.00 32.69  ? 168  ILE A O   1 
ATOM   146   C CB  . ILE A  1 18  ? 6.274   15.159  64.823  1.00 32.69  ? 168  ILE A CB  1 
ATOM   147   C CG1 . ILE A  1 18  ? 7.562   14.848  65.581  1.00 32.69  ? 168  ILE A CG1 1 
ATOM   148   C CG2 . ILE A  1 18  ? 5.205   14.085  65.051  1.00 32.69  ? 168  ILE A CG2 1 
ATOM   149   C CD1 . ILE A  1 18  ? 7.422   14.982  67.092  1.00 32.69  ? 168  ILE A CD1 1 
ATOM   150   N N   . ASN A  1 19  ? 5.170   14.639  61.515  1.00 31.41  ? 169  ASN A N   1 
ATOM   151   C CA  . ASN A  1 19  ? 4.042   14.747  60.615  1.00 31.41  ? 169  ASN A CA  1 
ATOM   152   C C   . ASN A  1 19  ? 3.125   13.530  60.627  1.00 31.41  ? 169  ASN A C   1 
ATOM   153   O O   . ASN A  1 19  ? 3.402   12.544  59.967  1.00 31.41  ? 169  ASN A O   1 
ATOM   154   C CB  . ASN A  1 19  ? 4.599   14.987  59.216  1.00 31.41  ? 169  ASN A CB  1 
ATOM   155   C CG  . ASN A  1 19  ? 3.608   14.677  58.121  1.00 31.41  ? 169  ASN A CG  1 
ATOM   156   O OD1 . ASN A  1 19  ? 2.434   15.075  58.168  1.00 31.41  ? 169  ASN A OD1 1 
ATOM   157   N ND2 . ASN A  1 19  ? 4.079   13.970  57.111  1.00 31.41  ? 169  ASN A ND2 1 
ATOM   158   N N   . ASN A  1 20  ? 2.019   13.617  61.360  1.00 29.65  ? 170  ASN A N   1 
ATOM   159   C CA  . ASN A  1 20  ? 1.068   12.521  61.467  1.00 29.65  ? 170  ASN A CA  1 
ATOM   160   C C   . ASN A  1 20  ? 0.026   12.518  60.337  1.00 29.65  ? 170  ASN A C   1 
ATOM   161   O O   . ASN A  1 20  ? -0.506  13.561  59.990  1.00 29.65  ? 170  ASN A O   1 
ATOM   162   C CB  . ASN A  1 20  ? 0.393   12.596  62.834  1.00 29.65  ? 170  ASN A CB  1 
ATOM   163   C CG  . ASN A  1 20  ? 1.333   12.199  63.957  1.00 29.65  ? 170  ASN A CG  1 
ATOM   164   O OD1 . ASN A  1 20  ? 2.397   11.644  63.708  1.00 29.65  ? 170  ASN A OD1 1 
ATOM   165   N ND2 . ASN A  1 20  ? 0.948   12.482  65.195  1.00 29.65  ? 170  ASN A ND2 1 
ATOM   166   N N   . HIS A  1 21  ? -0.259  11.345  59.769  1.00 35.41  ? 171  HIS A N   1 
ATOM   167   C CA  . HIS A  1 21  ? -1.225  11.231  58.678  1.00 35.41  ? 171  HIS A CA  1 
ATOM   168   C C   . HIS A  1 21  ? -2.171  10.034  58.805  1.00 35.41  ? 171  HIS A C   1 
ATOM   169   O O   . HIS A  1 21  ? -3.395  10.184  58.765  1.00 35.41  ? 171  HIS A O   1 
ATOM   170   C CB  . HIS A  1 21  ? -0.490  11.135  57.350  1.00 35.41  ? 171  HIS A CB  1 
ATOM   171   C CG  . HIS A  1 21  ? -1.375  10.801  56.195  1.00 35.41  ? 171  HIS A CG  1 
ATOM   172   N ND1 . HIS A  1 21  ? -1.561  11.657  55.131  1.00 35.41  ? 171  HIS A ND1 1 
ATOM   173   C CD2 . HIS A  1 21  ? -2.131  9.710   55.936  1.00 35.41  ? 171  HIS A CD2 1 
ATOM   174   C CE1 . HIS A  1 21  ? -2.396  11.109  54.265  1.00 35.41  ? 171  HIS A CE1 1 
ATOM   175   N NE2 . HIS A  1 21  ? -2.757  9.927   54.731  1.00 35.41  ? 171  HIS A NE2 1 
ATOM   176   N N   . ASN A  1 22  ? -1.618  8.837   58.935  1.00 39.24  ? 172  ASN A N   1 
ATOM   177   C CA  . ASN A  1 22  ? -2.454  7.646   59.050  1.00 39.24  ? 172  ASN A CA  1 
ATOM   178   C C   . ASN A  1 22  ? -2.982  7.427   60.468  1.00 39.24  ? 172  ASN A C   1 
ATOM   179   O O   . ASN A  1 22  ? -2.258  6.961   61.351  1.00 39.24  ? 172  ASN A O   1 
ATOM   180   C CB  . ASN A  1 22  ? -1.657  6.429   58.606  1.00 39.24  ? 172  ASN A CB  1 
ATOM   181   C CG  . ASN A  1 22  ? -2.444  5.146   58.713  1.00 39.24  ? 172  ASN A CG  1 
ATOM   182   O OD1 . ASN A  1 22  ? -3.564  5.112   59.241  1.00 39.24  ? 172  ASN A OD1 1 
ATOM   183   N ND2 . ASN A  1 22  ? -1.861  4.071   58.204  1.00 39.24  ? 172  ASN A ND2 1 
ATOM   184   N N   . PHE A  1 23  ? -4.253  7.748   60.681  1.00 25.33  ? 173  PHE A N   1 
ATOM   185   C CA  . PHE A  1 23  ? -4.822  7.574   62.002  1.00 25.33  ? 173  PHE A CA  1 
ATOM   186   C C   . PHE A  1 23  ? -5.680  6.321   62.213  1.00 25.33  ? 173  PHE A C   1 
ATOM   187   O O   . PHE A  1 23  ? -6.583  6.302   63.064  1.00 25.33  ? 173  PHE A O   1 
ATOM   188   C CB  . PHE A  1 23  ? -5.593  8.825   62.387  1.00 25.33  ? 173  PHE A CB  1 
ATOM   189   C CG  . PHE A  1 23  ? -4.707  9.960   62.807  1.00 25.33  ? 173  PHE A CG  1 
ATOM   190   C CD1 . PHE A  1 23  ? -4.070  10.748  61.854  1.00 25.33  ? 173  PHE A CD1 1 
ATOM   191   C CD2 . PHE A  1 23  ? -4.503  10.234  64.155  1.00 25.33  ? 173  PHE A CD2 1 
ATOM   192   C CE1 . PHE A  1 23  ? -3.248  11.788  62.231  1.00 25.33  ? 173  PHE A CE1 1 
ATOM   193   C CE2 . PHE A  1 23  ? -3.681  11.270  64.542  1.00 25.33  ? 173  PHE A CE2 1 
ATOM   194   C CZ  . PHE A  1 23  ? -3.049  12.052  63.576  1.00 25.33  ? 173  PHE A CZ  1 
ATOM   195   N N   . ALA A  1 24  ? -5.375  5.261   61.465  1.00 35.40  ? 174  ALA A N   1 
ATOM   196   C CA  . ALA A  1 24  ? -6.094  3.993   61.581  1.00 35.40  ? 174  ALA A CA  1 
ATOM   197   C C   . ALA A  1 24  ? -5.926  3.321   62.955  1.00 35.40  ? 174  ALA A C   1 
ATOM   198   O O   . ALA A  1 24  ? -6.766  2.542   63.360  1.00 35.40  ? 174  ALA A O   1 
ATOM   199   C CB  . ALA A  1 24  ? -5.645  3.051   60.478  1.00 35.40  ? 174  ALA A CB  1 
ATOM   200   N N   . LYS A  1 25  ? -4.841  3.603   63.663  1.00 55.34  ? 175  LYS A N   1 
ATOM   201   C CA  . LYS A  1 25  ? -4.648  3.006   64.978  1.00 55.34  ? 175  LYS A CA  1 
ATOM   202   C C   . LYS A  1 25  ? -5.712  3.575   65.884  1.00 55.34  ? 175  LYS A C   1 
ATOM   203   O O   . LYS A  1 25  ? -6.504  2.850   66.470  1.00 55.34  ? 175  LYS A O   1 
ATOM   204   C CB  . LYS A  1 25  ? -3.293  3.390   65.565  1.00 55.34  ? 175  LYS A CB  1 
ATOM   205   C CG  . LYS A  1 25  ? -2.314  2.238   65.841  1.00 55.34  ? 175  LYS A CG  1 
ATOM   206   C CD  . LYS A  1 25  ? -2.931  0.949   66.427  1.00 55.34  ? 175  LYS A CD  1 
ATOM   207   C CE  . LYS A  1 25  ? -2.084  -0.282  65.989  1.00 55.34  ? 175  LYS A CE  1 
ATOM   208   N NZ  . LYS A  1 25  ? -2.633  -1.626  66.372  1.00 55.34  ? 175  LYS A NZ  1 
ATOM   209   N N   . ALA A  1 26  A -5.700  4.898   66.009  1.00 39.39  ? 175  ALA A N   1 
ATOM   210   C CA  . ALA A  1 26  A -6.653  5.610   66.844  1.00 39.39  ? 175  ALA A CA  1 
ATOM   211   C C   . ALA A  1 26  A -8.036  5.044   66.619  1.00 39.39  ? 175  ALA A C   1 
ATOM   212   O O   . ALA A  1 26  A -8.724  4.651   67.560  1.00 39.39  ? 175  ALA A O   1 
ATOM   213   C CB  . ALA A  1 26  A -6.644  7.064   66.486  1.00 39.39  ? 175  ALA A CB  1 
ATOM   214   N N   . ARG A  1 27  B -8.433  5.014   65.351  1.00 33.50  ? 175  ARG A N   1 
ATOM   215   C CA  . ARG A  1 27  B -9.738  4.497   64.946  1.00 33.50  ? 175  ARG A CA  1 
ATOM   216   C C   . ARG A  1 27  B -9.984  3.138   65.580  1.00 33.50  ? 175  ARG A C   1 
ATOM   217   O O   . ARG A  1 27  B -11.026 2.909   66.175  1.00 33.50  ? 175  ARG A O   1 
ATOM   218   C CB  . ARG A  1 27  B -9.805  4.378   63.421  1.00 33.50  ? 175  ARG A CB  1 
ATOM   219   C CG  . ARG A  1 27  B -10.563 5.499   62.733  1.00 33.50  ? 175  ARG A CG  1 
ATOM   220   C CD  . ARG A  1 27  B -10.310 5.511   61.245  1.00 33.50  ? 175  ARG A CD  1 
ATOM   221   N NE  . ARG A  1 27  B -9.371  6.568   60.898  1.00 33.50  ? 175  ARG A NE  1 
ATOM   222   C CZ  . ARG A  1 27  B -8.412  6.465   59.973  1.00 33.50  ? 175  ARG A CZ  1 
ATOM   223   N NH1 . ARG A  1 27  B -8.254  5.345   59.284  1.00 33.50  ? 175  ARG A NH1 1 
ATOM   224   N NH2 . ARG A  1 27  B -7.591  7.487   59.739  1.00 33.50  ? 175  ARG A NH2 1 
ATOM   225   N N   . GLU A  1 28  C -9.016  2.243   65.463  1.00 76.93  ? 175  GLU A N   1 
ATOM   226   C CA  . GLU A  1 28  C -9.140  0.911   66.037  1.00 76.93  ? 175  GLU A CA  1 
ATOM   227   C C   . GLU A  1 28  C -9.276  0.986   67.549  1.00 76.93  ? 175  GLU A C   1 
ATOM   228   O O   . GLU A  1 28  C -10.275 0.547   68.114  1.00 76.93  ? 175  GLU A O   1 
ATOM   229   C CB  . GLU A  1 28  C -7.902  0.078   65.712  1.00 76.93  ? 175  GLU A CB  1 
ATOM   230   C CG  . GLU A  1 28  C -8.007  -0.809  64.481  1.00 76.93  ? 175  GLU A CG  1 
ATOM   231   C CD  . GLU A  1 28  C -6.655  -1.377  64.081  1.00 76.93  ? 175  GLU A CD  1 
ATOM   232   O OE1 . GLU A  1 28  C -6.107  -2.216  64.837  1.00 76.93  ? 175  GLU A OE1 1 
ATOM   233   O OE2 . GLU A  1 28  C -6.142  -0.975  63.011  1.00 76.93  ? 175  GLU A OE2 1 
ATOM   234   N N   . LYS A  1 29  D -8.249  1.540   68.191  1.00 76.70  ? 175  LYS A N   1 
ATOM   235   C CA  . LYS A  1 29  D -8.192  1.673   69.642  1.00 76.70  ? 175  LYS A CA  1 
ATOM   236   C C   . LYS A  1 29  D -9.279  2.572   70.201  1.00 76.70  ? 175  LYS A C   1 
ATOM   237   O O   . LYS A  1 29  D -10.420 2.149   70.350  1.00 76.70  ? 175  LYS A O   1 
ATOM   238   C CB  . LYS A  1 29  D -6.816  2.207   70.056  1.00 76.70  ? 175  LYS A CB  1 
ATOM   239   C CG  . LYS A  1 29  D -5.638  1.486   69.407  1.00 76.70  ? 175  LYS A CG  1 
ATOM   240   C CD  . LYS A  1 29  D -5.206  0.291   70.258  1.00 76.70  ? 175  LYS A CD  1 
ATOM   241   C CE  . LYS A  1 29  D -4.735  -0.906  69.417  1.00 76.70  ? 175  LYS A CE  1 
ATOM   242   N NZ  . LYS A  1 29  D -5.023  -2.242  70.067  1.00 76.70  ? 175  LYS A NZ  1 
ATOM   243   N N   . VAL A  1 30  E -8.918  3.815   70.504  1.00 47.78  ? 175  VAL A N   1 
ATOM   244   C CA  . VAL A  1 30  E -9.839  4.802   71.062  1.00 47.78  ? 175  VAL A CA  1 
ATOM   245   C C   . VAL A  1 30  E -11.243 4.720   70.459  1.00 47.78  ? 175  VAL A C   1 
ATOM   246   O O   . VAL A  1 30  E -11.425 4.850   69.243  1.00 47.78  ? 175  VAL A O   1 
ATOM   247   C CB  . VAL A  1 30  E -9.285  6.234   70.879  1.00 47.78  ? 175  VAL A CB  1 
ATOM   248   C CG1 . VAL A  1 30  E -10.136 7.214   71.639  1.00 47.78  ? 175  VAL A CG1 1 
ATOM   249   C CG2 . VAL A  1 30  E -7.853  6.311   71.382  1.00 47.78  ? 175  VAL A CG2 1 
ATOM   250   N N   . PRO A  1 31  F -12.261 4.494   71.311  1.00 46.51  ? 175  PRO A N   1 
ATOM   251   C CA  . PRO A  1 31  F -13.638 4.396   70.825  1.00 46.51  ? 175  PRO A CA  1 
ATOM   252   C C   . PRO A  1 31  F -14.118 5.716   70.265  1.00 46.51  ? 175  PRO A C   1 
ATOM   253   O O   . PRO A  1 31  F -14.488 5.795   69.094  1.00 46.51  ? 175  PRO A O   1 
ATOM   254   C CB  . PRO A  1 31  F -14.431 3.982   72.069  1.00 46.51  ? 175  PRO A CB  1 
ATOM   255   C CG  . PRO A  1 31  F -13.636 4.504   73.191  1.00 46.51  ? 175  PRO A CG  1 
ATOM   256   C CD  . PRO A  1 31  F -12.201 4.326   72.773  1.00 46.51  ? 175  PRO A CD  1 
ATOM   257   N N   . LYS A  1 32  G -14.092 6.750   71.104  1.00 36.88  ? 175  LYS A N   1 
ATOM   258   C CA  . LYS A  1 32  G -14.553 8.073   70.691  1.00 36.88  ? 175  LYS A CA  1 
ATOM   259   C C   . LYS A  1 32  G -13.891 8.643   69.438  1.00 36.88  ? 175  LYS A C   1 
ATOM   260   O O   . LYS A  1 32  G -14.247 9.720   68.997  1.00 36.88  ? 175  LYS A O   1 
ATOM   261   C CB  . LYS A  1 32  G -14.398 9.076   71.836  1.00 36.88  ? 175  LYS A CB  1 
ATOM   262   C CG  . LYS A  1 32  G -13.080 9.835   71.810  1.00 36.88  ? 175  LYS A CG  1 
ATOM   263   C CD  . LYS A  1 32  G -13.217 11.274  72.344  1.00 36.88  ? 175  LYS A CD  1 
ATOM   264   C CE  . LYS A  1 32  G -12.080 11.628  73.336  1.00 36.88  ? 175  LYS A CE  1 
ATOM   265   N NZ  . LYS A  1 32  G -12.563 12.209  74.645  1.00 36.88  ? 175  LYS A NZ  1 
ATOM   266   N N   . LEU A  1 33  H -12.930 7.934   68.859  1.00 35.03  ? 175  LEU A N   1 
ATOM   267   C CA  . LEU A  1 33  H -12.253 8.426   67.655  1.00 35.03  ? 175  LEU A CA  1 
ATOM   268   C C   . LEU A  1 33  H -12.577 7.548   66.461  1.00 35.03  ? 175  LEU A C   1 
ATOM   269   O O   . LEU A  1 33  H -12.014 7.718   65.391  1.00 35.03  ? 175  LEU A O   1 
ATOM   270   C CB  . LEU A  1 33  H -10.727 8.450   67.851  1.00 35.03  ? 175  LEU A CB  1 
ATOM   271   C CG  . LEU A  1 33  H -10.147 9.256   69.024  1.00 35.03  ? 175  LEU A CG  1 
ATOM   272   C CD1 . LEU A  1 33  H -8.637  9.372   68.872  1.00 35.03  ? 175  LEU A CD1 1 
ATOM   273   C CD2 . LEU A  1 33  H -10.785 10.639  69.082  1.00 35.03  ? 175  LEU A CD2 1 
ATOM   274   N N   . HIS A  1 34  I -13.490 6.607   66.650  1.00 34.85  ? 175  HIS A N   1 
ATOM   275   C CA  . HIS A  1 34  I -13.865 5.692   65.594  1.00 34.85  ? 175  HIS A CA  1 
ATOM   276   C C   . HIS A  1 34  I -13.931 6.324   64.217  1.00 34.85  ? 175  HIS A C   1 
ATOM   277   O O   . HIS A  1 34  I -13.792 5.622   63.213  1.00 34.85  ? 175  HIS A O   1 
ATOM   278   C CB  . HIS A  1 34  I -15.204 5.062   65.920  1.00 34.85  ? 175  HIS A CB  1 
ATOM   279   C CG  . HIS A  1 34  I -15.682 4.098   64.887  1.00 34.85  ? 175  HIS A CG  1 
ATOM   280   N ND1 . HIS A  1 34  I -17.010 3.965   64.552  1.00 34.85  ? 175  HIS A ND1 1 
ATOM   281   C CD2 . HIS A  1 34  I -15.011 3.201   64.128  1.00 34.85  ? 175  HIS A CD2 1 
ATOM   282   C CE1 . HIS A  1 34  I -17.141 3.030   63.630  1.00 34.85  ? 175  HIS A CE1 1 
ATOM   283   N NE2 . HIS A  1 34  I -15.942 2.550   63.355  1.00 34.85  ? 175  HIS A NE2 1 
ATOM   284   N N   . SER A  1 35  J -14.122 7.639   64.147  1.00 40.59  ? 175  SER A N   1 
ATOM   285   C CA  . SER A  1 35  J -14.227 8.289   62.835  1.00 40.59  ? 175  SER A CA  1 
ATOM   286   C C   . SER A  1 35  J -13.257 9.405   62.447  1.00 40.59  ? 175  SER A C   1 
ATOM   287   O O   . SER A  1 35  J -13.510 10.078  61.452  1.00 40.59  ? 175  SER A O   1 
ATOM   288   C CB  . SER A  1 35  J -15.646 8.811   62.626  1.00 40.59  ? 175  SER A CB  1 
ATOM   289   O OG  . SER A  1 35  J -15.822 10.019  63.339  1.00 40.59  ? 175  SER A OG  1 
ATOM   290   N N   . ILE A  1 36  ? -12.169 9.616   63.199  1.00 40.24  ? 176  ILE A N   1 
ATOM   291   C CA  . ILE A  1 36  ? -11.186 10.656  62.845  1.00 40.24  ? 176  ILE A CA  1 
ATOM   292   C C   . ILE A  1 36  ? -10.629 10.359  61.458  1.00 40.24  ? 176  ILE A C   1 
ATOM   293   O O   . ILE A  1 36  ? -10.142 9.259   61.193  1.00 40.24  ? 176  ILE A O   1 
ATOM   294   C CB  . ILE A  1 36  ? -9.960  10.707  63.802  1.00 40.24  ? 176  ILE A CB  1 
ATOM   295   C CG1 . ILE A  1 36  ? -9.955  9.492   64.714  1.00 40.24  ? 176  ILE A CG1 1 
ATOM   296   C CG2 . ILE A  1 36  ? -9.960  11.996  64.614  1.00 40.24  ? 176  ILE A CG2 1 
ATOM   297   C CD1 . ILE A  1 36  ? -9.316  8.289   64.073  1.00 40.24  ? 176  ILE A CD1 1 
ATOM   298   N N   . ARG A  1 37  ? -10.693 11.344  60.573  1.00 45.21  ? 177  ARG A N   1 
ATOM   299   C CA  . ARG A  1 37  ? -10.199 11.165  59.212  1.00 45.21  ? 177  ARG A CA  1 
ATOM   300   C C   . ARG A  1 37  ? -8.670  11.187  59.180  1.00 45.21  ? 177  ARG A C   1 
ATOM   301   O O   . ARG A  1 37  ? -8.020  11.717  60.083  1.00 45.21  ? 177  ARG A O   1 
ATOM   302   C CB  . ARG A  1 37  ? -10.742 12.278  58.295  1.00 45.21  ? 177  ARG A CB  1 
ATOM   303   C CG  . ARG A  1 37  ? -12.197 12.113  57.835  1.00 45.21  ? 177  ARG A CG  1 
ATOM   304   C CD  . ARG A  1 37  ? -12.384 12.584  56.379  1.00 45.21  ? 177  ARG A CD  1 
ATOM   305   N NE  . ARG A  1 37  ? -13.672 12.178  55.804  1.00 45.21  ? 177  ARG A NE  1 
ATOM   306   C CZ  . ARG A  1 37  ? -14.549 13.016  55.232  1.00 45.21  ? 177  ARG A CZ  1 
ATOM   307   N NH1 . ARG A  1 37  ? -14.276 14.320  55.153  1.00 45.21  ? 177  ARG A NH1 1 
ATOM   308   N NH2 . ARG A  1 37  ? -15.722 12.561  54.758  1.00 45.21  ? 177  ARG A NH2 1 
ATOM   309   N N   . ASP A  1 38  ? -8.094  10.581  58.151  1.00 45.89  ? 178  ASP A N   1 
ATOM   310   C CA  . ASP A  1 38  ? -6.650  10.607  57.991  1.00 45.89  ? 178  ASP A CA  1 
ATOM   311   C C   . ASP A  1 38  ? -6.391  12.066  57.607  1.00 45.89  ? 178  ASP A C   1 
ATOM   312   O O   . ASP A  1 38  ? -7.249  12.717  57.007  1.00 45.89  ? 178  ASP A O   1 
ATOM   313   C CB  . ASP A  1 38  ? -6.212  9.671   56.862  1.00 45.89  ? 178  ASP A CB  1 
ATOM   314   C CG  . ASP A  1 38  ? -6.049  8.229   57.326  1.00 45.89  ? 178  ASP A CG  1 
ATOM   315   O OD1 . ASP A  1 38  ? -5.530  8.002   58.447  1.00 45.89  ? 178  ASP A OD1 1 
ATOM   316   O OD2 . ASP A  1 38  ? -6.435  7.319   56.563  1.00 45.89  ? 178  ASP A OD2 1 
ATOM   317   N N   . ARG A  1 39  ? -5.217  12.582  57.949  1.00 32.41  ? 179  ARG A N   1 
ATOM   318   C CA  . ARG A  1 39  ? -4.899  13.972  57.664  1.00 32.41  ? 179  ARG A CA  1 
ATOM   319   C C   . ARG A  1 39  ? -4.371  14.214  56.259  1.00 32.41  ? 179  ARG A C   1 
ATOM   320   O O   . ARG A  1 39  ? -3.207  14.543  56.088  1.00 32.41  ? 179  ARG A O   1 
ATOM   321   C CB  . ARG A  1 39  ? -3.909  14.480  58.718  1.00 32.41  ? 179  ARG A CB  1 
ATOM   322   C CG  . ARG A  1 39  ? -4.482  14.425  60.125  1.00 32.41  ? 179  ARG A CG  1 
ATOM   323   C CD  . ARG A  1 39  ? -3.589  15.072  61.159  1.00 32.41  ? 179  ARG A CD  1 
ATOM   324   N NE  . ARG A  1 39  ? -3.426  16.504  60.944  1.00 32.41  ? 179  ARG A NE  1 
ATOM   325   C CZ  . ARG A  1 39  ? -2.392  17.019  60.301  1.00 32.41  ? 179  ARG A CZ  1 
ATOM   326   N NH1 . ARG A  1 39  ? -1.460  16.211  59.828  1.00 32.41  ? 179  ARG A NH1 1 
ATOM   327   N NH2 . ARG A  1 39  ? -2.279  18.319  60.129  1.00 32.41  ? 179  ARG A NH2 1 
ATOM   328   N N   . ASN A  1 40  ? -5.219  14.060  55.248  1.00 43.91  ? 180  ASN A N   1 
ATOM   329   C CA  . ASN A  1 40  ? -4.756  14.293  53.887  1.00 43.91  ? 180  ASN A CA  1 
ATOM   330   C C   . ASN A  1 40  ? -4.374  15.741  53.747  1.00 43.91  ? 180  ASN A C   1 
ATOM   331   O O   . ASN A  1 40  ? -5.078  16.628  54.222  1.00 43.91  ? 180  ASN A O   1 
ATOM   332   C CB  . ASN A  1 40  ? -5.836  13.975  52.872  1.00 43.91  ? 180  ASN A CB  1 
ATOM   333   C CG  . ASN A  1 40  ? -6.190  12.527  52.860  1.00 43.91  ? 180  ASN A CG  1 
ATOM   334   O OD1 . ASN A  1 40  ? -7.314  12.161  53.182  1.00 43.91  ? 180  ASN A OD1 1 
ATOM   335   N ND2 . ASN A  1 40  ? -5.231  11.679  52.497  1.00 43.91  ? 180  ASN A ND2 1 
ATOM   336   N N   . GLY A  1 41  ? -3.248  15.978  53.093  1.00 48.98  ? 181  GLY A N   1 
ATOM   337   C CA  . GLY A  1 41  ? -2.793  17.333  52.901  1.00 48.98  ? 181  GLY A CA  1 
ATOM   338   C C   . GLY A  1 41  ? -1.506  17.623  53.638  1.00 48.98  ? 181  GLY A C   1 
ATOM   339   O O   . GLY A  1 41  ? -0.766  18.505  53.202  1.00 48.98  ? 181  GLY A O   1 
ATOM   340   N N   . THR A  1 42  ? -1.216  16.895  54.727  1.00 41.25  ? 182  THR A N   1 
ATOM   341   C CA  . THR A  1 42  ? 0.016   17.155  55.500  1.00 41.25  ? 182  THR A CA  1 
ATOM   342   C C   . THR A  1 42  ? 1.268   17.077  54.677  1.00 41.25  ? 182  THR A C   1 
ATOM   343   O O   . THR A  1 42  ? 2.162   17.912  54.832  1.00 41.25  ? 182  THR A O   1 
ATOM   344   C CB  . THR A  1 42  ? 0.271   16.190  56.656  1.00 41.25  ? 182  THR A CB  1 
ATOM   345   O OG1 . THR A  1 42  ? -0.829  15.297  56.806  1.00 41.25  ? 182  THR A OG1 1 
ATOM   346   C CG2 . THR A  1 42  ? 0.508   16.973  57.927  1.00 41.25  ? 182  THR A CG2 1 
ATOM   347   N N   . HIS A  1 43  ? 1.353   16.055  53.833  1.00 98.16  ? 183  HIS A N   1 
ATOM   348   C CA  . HIS A  1 43  ? 2.521   15.898  52.984  1.00 98.16  ? 183  HIS A CA  1 
ATOM   349   C C   . HIS A  1 43  ? 2.958   17.294  52.580  1.00 98.16  ? 183  HIS A C   1 
ATOM   350   O O   . HIS A  1 43  ? 4.106   17.685  52.791  1.00 98.16  ? 183  HIS A O   1 
ATOM   351   C CB  . HIS A  1 43  ? 2.191   15.086  51.725  1.00 98.16  ? 183  HIS A CB  1 
ATOM   352   C CG  . HIS A  1 43  ? 0.723   14.863  51.493  1.00 98.16  ? 183  HIS A CG  1 
ATOM   353   N ND1 . HIS A  1 43  ? -0.079  14.178  52.383  1.00 98.16  ? 183  HIS A ND1 1 
ATOM   354   C CD2 . HIS A  1 43  ? -0.067  15.167  50.434  1.00 98.16  ? 183  HIS A CD2 1 
ATOM   355   C CE1 . HIS A  1 43  ? -1.297  14.067  51.881  1.00 98.16  ? 183  HIS A CE1 1 
ATOM   356   N NE2 . HIS A  1 43  ? -1.317  14.659  50.699  1.00 98.16  ? 183  HIS A NE2 1 
ATOM   357   N N   . LEU A  1 44  ? 2.007   18.045  52.030  1.00 36.79  ? 184  LEU A N   1 
ATOM   358   C CA  . LEU A  1 44  ? 2.235   19.416  51.581  1.00 36.79  ? 184  LEU A CA  1 
ATOM   359   C C   . LEU A  1 44  ? 2.788   20.325  52.679  1.00 36.79  ? 184  LEU A C   1 
ATOM   360   O O   . LEU A  1 44  ? 3.674   21.150  52.427  1.00 36.79  ? 184  LEU A O   1 
ATOM   361   C CB  . LEU A  1 44  ? 0.935   20.002  51.014  1.00 36.79  ? 184  LEU A CB  1 
ATOM   362   C CG  . LEU A  1 44  ? 0.597   19.675  49.549  1.00 36.79  ? 184  LEU A CG  1 
ATOM   363   C CD1 . LEU A  1 44  ? 0.911   18.212  49.266  1.00 36.79  ? 184  LEU A CD1 1 
ATOM   364   C CD2 . LEU A  1 44  ? -0.877  19.978  49.268  1.00 36.79  ? 184  LEU A CD2 1 
ATOM   365   N N   . ASP A  1 45  ? 2.269   20.169  53.894  1.00 29.10  ? 185  ASP A N   1 
ATOM   366   C CA  . ASP A  1 45  ? 2.713   20.976  55.025  1.00 29.10  ? 185  ASP A CA  1 
ATOM   367   C C   . ASP A  1 45  ? 4.167   20.648  55.322  1.00 29.10  ? 185  ASP A C   1 
ATOM   368   O O   . ASP A  1 45  ? 5.003   21.543  55.513  1.00 29.10  ? 185  ASP A O   1 
ATOM   369   C CB  . ASP A  1 45  ? 1.866   20.668  56.257  1.00 29.10  ? 185  ASP A CB  1 
ATOM   370   C CG  . ASP A  1 45  ? 0.561   21.433  56.277  1.00 29.10  ? 185  ASP A CG  1 
ATOM   371   O OD1 . ASP A  1 45  ? 0.322   22.235  55.348  1.00 29.10  ? 185  ASP A OD1 1 
ATOM   372   O OD2 . ASP A  1 45  ? -0.220  21.221  57.231  1.00 29.10  ? 185  ASP A OD2 1 
ATOM   373   N N   . ALA A  1 46  ? 4.458   19.354  55.363  1.00 28.88  ? 186  ALA A N   1 
ATOM   374   C CA  . ALA A  1 46  ? 5.811   18.887  55.630  1.00 28.88  ? 186  ALA A CA  1 
ATOM   375   C C   . ALA A  1 46  ? 6.775   19.396  54.554  1.00 28.88  ? 186  ALA A C   1 
ATOM   376   O O   . ALA A  1 46  ? 7.887   19.857  54.851  1.00 28.88  ? 186  ALA A O   1 
ATOM   377   C CB  . ALA A  1 46  ? 5.829   17.374  55.662  1.00 28.88  ? 186  ALA A CB  1 
ATOM   378   N N   . GLY A  1 47  ? 6.345   19.304  53.299  1.00 44.51  ? 187  GLY A N   1 
ATOM   379   C CA  . GLY A  1 47  ? 7.183   19.759  52.208  1.00 44.51  ? 187  GLY A CA  1 
ATOM   380   C C   . GLY A  1 47  ? 7.507   21.223  52.387  1.00 44.51  ? 187  GLY A C   1 
ATOM   381   O O   . GLY A  1 47  ? 8.663   21.597  52.557  1.00 44.51  ? 187  GLY A O   1 
ATOM   382   N N   . ALA A  1 48  ? 6.474   22.053  52.359  1.00 28.71  ? 188  ALA A N   1 
ATOM   383   C CA  . ALA A  1 48  ? 6.634   23.486  52.531  1.00 28.71  ? 188  ALA A CA  1 
ATOM   384   C C   . ALA A  1 48  ? 7.555   23.799  53.713  1.00 28.71  ? 188  ALA A C   1 
ATOM   385   O O   . ALA A  1 48  ? 8.471   24.609  53.599  1.00 28.71  ? 188  ALA A O   1 
ATOM   386   C CB  . ALA A  1 48  ? 5.265   24.126  52.745  1.00 28.71  ? 188  ALA A CB  1 
ATOM   387   N N   . LEU A  1 49  ? 7.301   23.160  54.850  1.00 38.78  ? 189  LEU A N   1 
ATOM   388   C CA  . LEU A  1 49  ? 8.111   23.382  56.033  1.00 38.78  ? 189  LEU A CA  1 
ATOM   389   C C   . LEU A  1 49  ? 9.542   23.041  55.689  1.00 38.78  ? 189  LEU A C   1 
ATOM   390   O O   . LEU A  1 49  ? 10.436  23.870  55.818  1.00 38.78  ? 189  LEU A O   1 
ATOM   391   C CB  . LEU A  1 49  ? 7.635   22.488  57.178  1.00 38.78  ? 189  LEU A CB  1 
ATOM   392   C CG  . LEU A  1 49  ? 6.777   23.074  58.306  1.00 38.78  ? 189  LEU A CG  1 
ATOM   393   C CD1 . LEU A  1 49  ? 6.540   24.529  58.061  1.00 38.78  ? 189  LEU A CD1 1 
ATOM   394   C CD2 . LEU A  1 49  ? 5.450   22.345  58.375  1.00 38.78  ? 189  LEU A CD2 1 
ATOM   395   N N   . THR A  1 50  ? 9.749   21.810  55.244  1.00 46.80  ? 190  THR A N   1 
ATOM   396   C CA  . THR A  1 50  ? 11.072  21.334  54.867  1.00 46.80  ? 190  THR A CA  1 
ATOM   397   C C   . THR A  1 50  ? 11.859  22.355  54.053  1.00 46.80  ? 190  THR A C   1 
ATOM   398   O O   . THR A  1 50  ? 12.931  22.777  54.467  1.00 46.80  ? 190  THR A O   1 
ATOM   399   C CB  . THR A  1 50  ? 10.971  20.029  54.049  1.00 46.80  ? 190  THR A CB  1 
ATOM   400   O OG1 . THR A  1 50  ? 11.001  18.910  54.943  1.00 46.80  ? 190  THR A OG1 1 
ATOM   401   C CG2 . THR A  1 50  ? 12.130  19.919  53.047  1.00 46.80  ? 190  THR A CG2 1 
ATOM   402   N N   . THR A  1 51  ? 11.331  22.732  52.893  1.00 35.47  ? 191  THR A N   1 
ATOM   403   C CA  . THR A  1 51  ? 11.986  23.703  52.021  1.00 35.47  ? 191  THR A CA  1 
ATOM   404   C C   . THR A  1 51  ? 12.285  25.022  52.738  1.00 35.47  ? 191  THR A C   1 
ATOM   405   O O   . THR A  1 51  ? 13.448  25.379  52.950  1.00 35.47  ? 191  THR A O   1 
ATOM   406   C CB  . THR A  1 51  ? 11.118  24.049  50.792  1.00 35.47  ? 191  THR A CB  1 
ATOM   407   O OG1 . THR A  1 51  ? 10.592  22.855  50.208  1.00 35.47  ? 191  THR A OG1 1 
ATOM   408   C CG2 . THR A  1 51  ? 11.938  24.776  49.769  1.00 35.47  ? 191  THR A CG2 1 
ATOM   409   N N   . THR A  1 52  ? 11.230  25.744  53.105  1.00 54.93  ? 192  THR A N   1 
ATOM   410   C CA  . THR A  1 52  ? 11.372  27.029  53.777  1.00 54.93  ? 192  THR A CA  1 
ATOM   411   C C   . THR A  1 52  ? 12.385  27.039  54.933  1.00 54.93  ? 192  THR A C   1 
ATOM   412   O O   . THR A  1 52  ? 13.087  28.026  55.143  1.00 54.93  ? 192  THR A O   1 
ATOM   413   C CB  . THR A  1 52  ? 9.998   27.524  54.277  1.00 54.93  ? 192  THR A CB  1 
ATOM   414   O OG1 . THR A  1 52  ? 9.475   26.595  55.226  1.00 54.93  ? 192  THR A OG1 1 
ATOM   415   C CG2 . THR A  1 52  ? 9.018   27.621  53.118  1.00 54.93  ? 192  THR A CG2 1 
ATOM   416   N N   . PHE A  1 53  ? 12.488  25.951  55.679  1.00 32.99  ? 193  PHE A N   1 
ATOM   417   C CA  . PHE A  1 53  ? 13.438  25.954  56.770  1.00 32.99  ? 193  PHE A CA  1 
ATOM   418   C C   . PHE A  1 53  ? 14.808  25.456  56.341  1.00 32.99  ? 193  PHE A C   1 
ATOM   419   O O   . PHE A  1 53  ? 15.825  25.673  57.030  1.00 32.99  ? 193  PHE A O   1 
ATOM   420   C CB  . PHE A  1 53  ? 12.877  25.156  57.938  1.00 32.99  ? 193  PHE A CB  1 
ATOM   421   C CG  . PHE A  1 53  ? 11.897  25.944  58.755  1.00 32.99  ? 193  PHE A CG  1 
ATOM   422   C CD1 . PHE A  1 53  ? 12.329  27.040  59.507  1.00 32.99  ? 193  PHE A CD1 1 
ATOM   423   C CD2 . PHE A  1 53  ? 10.537  25.628  58.750  1.00 32.99  ? 193  PHE A CD2 1 
ATOM   424   C CE1 . PHE A  1 53  ? 11.427  27.809  60.238  1.00 32.99  ? 193  PHE A CE1 1 
ATOM   425   C CE2 . PHE A  1 53  ? 9.619   26.396  59.483  1.00 32.99  ? 193  PHE A CE2 1 
ATOM   426   C CZ  . PHE A  1 53  ? 10.067  27.483  60.224  1.00 32.99  ? 193  PHE A CZ  1 
ATOM   427   N N   . GLU A  1 54  ? 14.836  24.800  55.187  1.00 40.53  ? 194  GLU A N   1 
ATOM   428   C CA  . GLU A  1 54  ? 16.087  24.307  54.616  1.00 40.53  ? 194  GLU A CA  1 
ATOM   429   C C   . GLU A  1 54  ? 16.774  25.584  54.161  1.00 40.53  ? 194  GLU A C   1 
ATOM   430   O O   . GLU A  1 54  ? 17.874  25.904  54.599  1.00 40.53  ? 194  GLU A O   1 
ATOM   431   C CB  . GLU A  1 54  ? 15.807  23.414  53.401  1.00 40.53  ? 194  GLU A CB  1 
ATOM   432   C CG  . GLU A  1 54  ? 16.508  22.067  53.430  1.00 40.53  ? 194  GLU A CG  1 
ATOM   433   C CD  . GLU A  1 54  ? 15.825  21.029  52.549  1.00 40.53  ? 194  GLU A CD  1 
ATOM   434   O OE1 . GLU A  1 54  ? 15.287  21.386  51.471  1.00 40.53  ? 194  GLU A OE1 1 
ATOM   435   O OE2 . GLU A  1 54  ? 15.833  19.847  52.945  1.00 40.53  ? 194  GLU A OE2 1 
ATOM   436   N N   . GLU A  1 55  ? 16.077  26.325  53.303  1.00 70.49  ? 195  GLU A N   1 
ATOM   437   C CA  . GLU A  1 55  ? 16.571  27.586  52.765  1.00 70.49  ? 195  GLU A CA  1 
ATOM   438   C C   . GLU A  1 55  ? 17.008  28.526  53.872  1.00 70.49  ? 195  GLU A C   1 
ATOM   439   O O   . GLU A  1 55  ? 17.717  29.494  53.622  1.00 70.49  ? 195  GLU A O   1 
ATOM   440   C CB  . GLU A  1 55  ? 15.485  28.291  51.943  1.00 70.49  ? 195  GLU A CB  1 
ATOM   441   C CG  . GLU A  1 55  ? 14.596  27.377  51.101  1.00 70.49  ? 195  GLU A CG  1 
ATOM   442   C CD  . GLU A  1 55  ? 13.836  28.139  50.003  1.00 70.49  ? 195  GLU A CD  1 
ATOM   443   O OE1 . GLU A  1 55  ? 13.240  29.203  50.309  1.00 70.49  ? 195  GLU A OE1 1 
ATOM   444   O OE2 . GLU A  1 55  ? 13.831  27.677  48.836  1.00 70.49  ? 195  GLU A OE2 1 
ATOM   445   N N   . LEU A  1 56  ? 16.567  28.255  55.094  1.00 42.20  ? 196  LEU A N   1 
ATOM   446   C CA  . LEU A  1 56  ? 16.916  29.101  56.224  1.00 42.20  ? 196  LEU A CA  1 
ATOM   447   C C   . LEU A  1 56  ? 18.062  28.465  56.958  1.00 42.20  ? 196  LEU A C   1 
ATOM   448   O O   . LEU A  1 56  ? 18.342  28.817  58.092  1.00 42.20  ? 196  LEU A O   1 
ATOM   449   C CB  . LEU A  1 56  ? 15.721  29.280  57.159  1.00 42.20  ? 196  LEU A CB  1 
ATOM   450   C CG  . LEU A  1 56  ? 14.797  30.422  56.751  1.00 42.20  ? 196  LEU A CG  1 
ATOM   451   C CD1 . LEU A  1 56  ? 13.542  30.404  57.595  1.00 42.20  ? 196  LEU A CD1 1 
ATOM   452   C CD2 . LEU A  1 56  ? 15.540  31.731  56.914  1.00 42.20  ? 196  LEU A CD2 1 
ATOM   453   N N   . HIS A  1 57  ? 18.712  27.511  56.297  1.00 41.41  ? 197  HIS A N   1 
ATOM   454   C CA  . HIS A  1 57  ? 19.884  26.819  56.839  1.00 41.41  ? 197  HIS A CA  1 
ATOM   455   C C   . HIS A  1 57  ? 19.666  26.059  58.131  1.00 41.41  ? 197  HIS A C   1 
ATOM   456   O O   . HIS A  1 57  ? 20.478  26.151  59.048  1.00 41.41  ? 197  HIS A O   1 
ATOM   457   C CB  . HIS A  1 57  ? 21.035  27.811  57.036  1.00 41.41  ? 197  HIS A CB  1 
ATOM   458   C CG  . HIS A  1 57  ? 21.241  28.729  55.872  1.00 41.41  ? 197  HIS A CG  1 
ATOM   459   N ND1 . HIS A  1 57  ? 21.185  28.293  54.564  1.00 41.41  ? 197  HIS A ND1 1 
ATOM   460   C CD2 . HIS A  1 57  ? 21.465  30.066  55.812  1.00 41.41  ? 197  HIS A CD2 1 
ATOM   461   C CE1 . HIS A  1 57  ? 21.359  29.319  53.749  1.00 41.41  ? 197  HIS A CE1 1 
ATOM   462   N NE2 . HIS A  1 57  ? 21.532  30.408  54.481  1.00 41.41  ? 197  HIS A NE2 1 
ATOM   463   N N   . PHE A  1 58  ? 18.567  25.309  58.186  1.00 27.36  ? 198  PHE A N   1 
ATOM   464   C CA  . PHE A  1 58  ? 18.210  24.496  59.349  1.00 27.36  ? 198  PHE A CA  1 
ATOM   465   C C   . PHE A  1 58  ? 18.333  23.050  58.879  1.00 27.36  ? 198  PHE A C   1 
ATOM   466   O O   . PHE A  1 58  ? 18.196  22.766  57.674  1.00 27.36  ? 198  PHE A O   1 
ATOM   467   C CB  . PHE A  1 58  ? 16.773  24.797  59.780  1.00 27.36  ? 198  PHE A CB  1 
ATOM   468   C CG  . PHE A  1 58  ? 16.671  25.791  60.897  1.00 27.36  ? 198  PHE A CG  1 
ATOM   469   C CD1 . PHE A  1 58  ? 16.758  27.156  60.648  1.00 27.36  ? 198  PHE A CD1 1 
ATOM   470   C CD2 . PHE A  1 58  ? 16.505  25.363  62.216  1.00 27.36  ? 198  PHE A CD2 1 
ATOM   471   C CE1 . PHE A  1 58  ? 16.684  28.076  61.695  1.00 27.36  ? 198  PHE A CE1 1 
ATOM   472   C CE2 . PHE A  1 58  ? 16.428  26.291  63.276  1.00 27.36  ? 198  PHE A CE2 1 
ATOM   473   C CZ  . PHE A  1 58  ? 16.518  27.642  63.011  1.00 27.36  ? 198  PHE A CZ  1 
ATOM   474   N N   . GLU A  1 59  ? 18.603  22.136  59.801  1.00 48.82  ? 199  GLU A N   1 
ATOM   475   C CA  . GLU A  1 59  ? 18.738  20.749  59.409  1.00 48.82  ? 199  GLU A CA  1 
ATOM   476   C C   . GLU A  1 59  ? 17.481  19.988  59.774  1.00 48.82  ? 199  GLU A C   1 
ATOM   477   O O   . GLU A  1 59  ? 17.263  19.615  60.930  1.00 48.82  ? 199  GLU A O   1 
ATOM   478   C CB  . GLU A  1 59  ? 19.952  20.132  60.083  1.00 48.82  ? 199  GLU A CB  1 
ATOM   479   C CG  . GLU A  1 59  ? 20.656  19.076  59.249  1.00 48.82  ? 199  GLU A CG  1 
ATOM   480   C CD  . GLU A  1 59  ? 21.370  18.052  60.120  1.00 48.82  ? 199  GLU A CD  1 
ATOM   481   O OE1 . GLU A  1 59  ? 22.276  18.450  60.879  1.00 48.82  ? 199  GLU A OE1 1 
ATOM   482   O OE2 . GLU A  1 59  ? 21.029  16.851  60.060  1.00 48.82  ? 199  GLU A OE2 1 
ATOM   483   N N   . ILE A  1 60  ? 16.654  19.769  58.763  1.00 46.86  ? 200  ILE A N   1 
ATOM   484   C CA  . ILE A  1 60  ? 15.393  19.073  58.919  1.00 46.86  ? 200  ILE A CA  1 
ATOM   485   C C   . ILE A  1 60  ? 15.550  17.648  59.420  1.00 46.86  ? 200  ILE A C   1 
ATOM   486   O O   . ILE A  1 60  ? 16.494  16.954  59.078  1.00 46.86  ? 200  ILE A O   1 
ATOM   487   C CB  . ILE A  1 60  ? 14.643  19.028  57.599  1.00 46.86  ? 200  ILE A CB  1 
ATOM   488   C CG1 . ILE A  1 60  ? 14.898  20.310  56.797  1.00 46.86  ? 200  ILE A CG1 1 
ATOM   489   C CG2 . ILE A  1 60  ? 13.182  18.832  57.860  1.00 46.86  ? 200  ILE A CG2 1 
ATOM   490   C CD1 . ILE A  1 60  ? 14.713  21.600  57.577  1.00 46.86  ? 200  ILE A CD1 1 
ATOM   491   N N   . LYS A  1 61  ? 14.607  17.213  60.236  1.00 29.53  ? 201  LYS A N   1 
ATOM   492   C CA  . LYS A  1 61  ? 14.635  15.881  60.782  1.00 29.53  ? 201  LYS A CA  1 
ATOM   493   C C   . LYS A  1 61  ? 13.193  15.428  60.833  1.00 29.53  ? 201  LYS A C   1 
ATOM   494   O O   . LYS A  1 61  ? 12.538  15.496  61.865  1.00 29.53  ? 201  LYS A O   1 
ATOM   495   C CB  . LYS A  1 61  ? 15.247  15.908  62.172  1.00 29.53  ? 201  LYS A CB  1 
ATOM   496   C CG  . LYS A  1 61  ? 16.717  16.212  62.148  1.00 29.53  ? 201  LYS A CG  1 
ATOM   497   C CD  . LYS A  1 61  ? 17.507  15.134  61.394  1.00 29.53  ? 201  LYS A CD  1 
ATOM   498   C CE  . LYS A  1 61  ? 18.944  15.033  61.907  1.00 29.53  ? 201  LYS A CE  1 
ATOM   499   N NZ  . LYS A  1 61  ? 19.549  13.721  61.549  1.00 29.53  ? 201  LYS A NZ  1 
ATOM   500   N N   . PRO A  1 62  ? 12.681  14.938  59.705  1.00 37.22  ? 202  PRO A N   1 
ATOM   501   C CA  . PRO A  1 62  ? 11.308  14.465  59.565  1.00 37.22  ? 202  PRO A CA  1 
ATOM   502   C C   . PRO A  1 62  ? 11.045  13.177  60.288  1.00 37.22  ? 202  PRO A C   1 
ATOM   503   O O   . PRO A  1 62  ? 11.960  12.437  60.603  1.00 37.22  ? 202  PRO A O   1 
ATOM   504   C CB  . PRO A  1 62  ? 11.130  14.288  58.064  1.00 37.22  ? 202  PRO A CB  1 
ATOM   505   C CG  . PRO A  1 62  ? 12.386  14.803  57.428  1.00 37.22  ? 202  PRO A CG  1 
ATOM   506   C CD  . PRO A  1 62  ? 13.445  14.771  58.465  1.00 37.22  ? 202  PRO A CD  1 
ATOM   507   N N   . HIS A  1 63  ? 9.773   12.922  60.538  1.00 51.50  ? 203  HIS A N   1 
ATOM   508   C CA  . HIS A  1 63  ? 9.322   11.711  61.202  1.00 51.50  ? 203  HIS A CA  1 
ATOM   509   C C   . HIS A  1 63  ? 7.858   11.562  60.818  1.00 51.50  ? 203  HIS A C   1 
ATOM   510   O O   . HIS A  1 63  ? 7.115   12.540  60.819  1.00 51.50  ? 203  HIS A O   1 
ATOM   511   C CB  . HIS A  1 63  ? 9.478   11.846  62.709  1.00 51.50  ? 203  HIS A CB  1 
ATOM   512   C CG  . HIS A  1 63  ? 10.895  11.744  63.166  1.00 51.50  ? 203  HIS A CG  1 
ATOM   513   N ND1 . HIS A  1 63  ? 11.516  10.535  63.384  1.00 51.50  ? 203  HIS A ND1 1 
ATOM   514   C CD2 . HIS A  1 63  ? 11.827  12.696  63.400  1.00 51.50  ? 203  HIS A CD2 1 
ATOM   515   C CE1 . HIS A  1 63  ? 12.774  10.745  63.733  1.00 51.50  ? 203  HIS A CE1 1 
ATOM   516   N NE2 . HIS A  1 63  ? 12.989  12.047  63.750  1.00 51.50  ? 203  HIS A NE2 1 
ATOM   517   N N   . HIS A  1 64  ? 7.428   10.353  60.489  1.00 51.80  ? 204  HIS A N   1 
ATOM   518   C CA  . HIS A  1 64  ? 6.055   10.196  60.064  1.00 51.80  ? 204  HIS A CA  1 
ATOM   519   C C   . HIS A  1 64  ? 5.201   9.226   60.845  1.00 51.80  ? 204  HIS A C   1 
ATOM   520   O O   . HIS A  1 64  ? 5.691   8.228   61.359  1.00 51.80  ? 204  HIS A O   1 
ATOM   521   C CB  . HIS A  1 64  ? 6.052   9.836   58.587  1.00 51.80  ? 204  HIS A CB  1 
ATOM   522   C CG  . HIS A  1 64  ? 6.900   10.750  57.758  1.00 51.80  ? 204  HIS A CG  1 
ATOM   523   N ND1 . HIS A  1 64  ? 6.407   11.897  57.171  1.00 51.80  ? 204  HIS A ND1 1 
ATOM   524   C CD2 . HIS A  1 64  ? 8.210   10.689  57.418  1.00 51.80  ? 204  HIS A CD2 1 
ATOM   525   C CE1 . HIS A  1 64  ? 7.374   12.501  56.502  1.00 51.80  ? 204  HIS A CE1 1 
ATOM   526   N NE2 . HIS A  1 64  ? 8.479   11.789  56.635  1.00 51.80  ? 204  HIS A NE2 1 
ATOM   527   N N   . ASP A  1 65  ? 3.912   9.542   60.927  1.00 33.68  ? 205  ASP A N   1 
ATOM   528   C CA  . ASP A  1 65  ? 2.947   8.715   61.628  1.00 33.68  ? 205  ASP A CA  1 
ATOM   529   C C   . ASP A  1 65  ? 3.502   8.233   62.968  1.00 33.68  ? 205  ASP A C   1 
ATOM   530   O O   . ASP A  1 65  ? 3.802   7.058   63.120  1.00 33.68  ? 205  ASP A O   1 
ATOM   531   C CB  . ASP A  1 65  ? 2.574   7.533   60.733  1.00 33.68  ? 205  ASP A CB  1 
ATOM   532   C CG  . ASP A  1 65  ? 1.956   7.979   59.400  1.00 33.68  ? 205  ASP A CG  1 
ATOM   533   O OD1 . ASP A  1 65  ? 1.247   9.004   59.396  1.00 33.68  ? 205  ASP A OD1 1 
ATOM   534   O OD2 . ASP A  1 65  ? 2.165   7.314   58.359  1.00 33.68  ? 205  ASP A OD2 1 
ATOM   535   N N   . CYS A  1 66  ? 3.629   9.127   63.942  1.00 35.86  ? 206  CYS A N   1 
ATOM   536   C CA  . CYS A  1 66  ? 4.164   8.726   65.230  1.00 35.86  ? 206  CYS A CA  1 
ATOM   537   C C   . CYS A  1 66  ? 3.118   8.632   66.340  1.00 35.86  ? 206  CYS A C   1 
ATOM   538   O O   . CYS A  1 66  ? 2.304   9.532   66.526  1.00 35.86  ? 206  CYS A O   1 
ATOM   539   C CB  . CYS A  1 66  ? 5.295   9.680   65.658  1.00 35.86  ? 206  CYS A CB  1 
ATOM   540   S SG  . CYS A  1 66  ? 6.320   10.328  64.270  1.00 35.86  ? 206  CYS A SG  1 
ATOM   541   N N   . THR A  1 67  ? 3.156   7.516   67.061  1.00 35.51  ? 207  THR A N   1 
ATOM   542   C CA  . THR A  1 67  ? 2.279   7.261   68.188  1.00 35.51  ? 207  THR A CA  1 
ATOM   543   C C   . THR A  1 67  ? 2.728   8.280   69.227  1.00 35.51  ? 207  THR A C   1 
ATOM   544   O O   . THR A  1 67  ? 3.735   8.949   69.031  1.00 35.51  ? 207  THR A O   1 
ATOM   545   C CB  . THR A  1 67  ? 2.534   5.855   68.732  1.00 35.51  ? 207  THR A CB  1 
ATOM   546   O OG1 . THR A  1 67  ? 3.903   5.751   69.161  1.00 35.51  ? 207  THR A OG1 1 
ATOM   547   C CG2 . THR A  1 67  ? 2.301   4.826   67.645  1.00 35.51  ? 207  THR A CG2 1 
ATOM   548   N N   . VAL A  1 68  ? 2.006   8.404   70.331  1.00 44.17  ? 208  VAL A N   1 
ATOM   549   C CA  . VAL A  1 68  ? 2.403   9.364   71.350  1.00 44.17  ? 208  VAL A CA  1 
ATOM   550   C C   . VAL A  1 68  ? 3.776   8.971   71.892  1.00 44.17  ? 208  VAL A C   1 
ATOM   551   O O   . VAL A  1 68  ? 4.644   9.818   72.111  1.00 44.17  ? 208  VAL A O   1 
ATOM   552   C CB  . VAL A  1 68  ? 1.393   9.406   72.520  1.00 44.17  ? 208  VAL A CB  1 
ATOM   553   C CG1 . VAL A  1 68  ? 2.075   9.878   73.771  1.00 44.17  ? 208  VAL A CG1 1 
ATOM   554   C CG2 . VAL A  1 68  ? 0.260   10.343  72.200  1.00 44.17  ? 208  VAL A CG2 1 
ATOM   555   N N   . GLU A  1 69  ? 3.977   7.680   72.101  1.00 51.83  ? 209  GLU A N   1 
ATOM   556   C CA  . GLU A  1 69  ? 5.246   7.194   72.619  1.00 51.83  ? 209  GLU A CA  1 
ATOM   557   C C   . GLU A  1 69  ? 6.418   7.553   71.708  1.00 51.83  ? 209  GLU A C   1 
ATOM   558   O O   . GLU A  1 69  ? 7.464   8.022   72.166  1.00 51.83  ? 209  GLU A O   1 
ATOM   559   C CB  . GLU A  1 69  ? 5.182   5.685   72.788  1.00 51.83  ? 209  GLU A CB  1 
ATOM   560   C CG  . GLU A  1 69  ? 6.431   5.097   73.378  1.00 51.83  ? 209  GLU A CG  1 
ATOM   561   C CD  . GLU A  1 69  ? 6.359   3.595   73.481  1.00 51.83  ? 209  GLU A CD  1 
ATOM   562   O OE1 . GLU A  1 69  ? 6.204   2.925   72.426  1.00 51.83  ? 209  GLU A OE1 1 
ATOM   563   O OE2 . GLU A  1 69  ? 6.459   3.092   74.623  1.00 51.83  ? 209  GLU A OE2 1 
ATOM   564   N N   . GLN A  1 70  ? 6.242   7.313   70.416  1.00 33.62  ? 210  GLN A N   1 
ATOM   565   C CA  . GLN A  1 70  ? 7.281   7.619   69.454  1.00 33.62  ? 210  GLN A CA  1 
ATOM   566   C C   . GLN A  1 70  ? 7.655   9.086   69.557  1.00 33.62  ? 210  GLN A C   1 
ATOM   567   O O   . GLN A  1 70  ? 8.840   9.429   69.526  1.00 33.62  ? 210  GLN A O   1 
ATOM   568   C CB  . GLN A  1 70  ? 6.794   7.320   68.042  1.00 33.62  ? 210  GLN A CB  1 
ATOM   569   C CG  . GLN A  1 70  ? 7.111   5.920   67.591  1.00 33.62  ? 210  GLN A CG  1 
ATOM   570   C CD  . GLN A  1 70  ? 6.101   5.392   66.600  1.00 33.62  ? 210  GLN A CD  1 
ATOM   571   O OE1 . GLN A  1 70  ? 6.361   4.429   65.868  1.00 33.62  ? 210  GLN A OE1 1 
ATOM   572   N NE2 . GLN A  1 70  ? 4.937   6.018   66.566  1.00 33.62  ? 210  GLN A NE2 1 
ATOM   573   N N   . ILE A  1 71  ? 6.637   9.943   69.680  1.00 37.07  ? 211  ILE A N   1 
ATOM   574   C CA  . ILE A  1 71  ? 6.833   11.395  69.786  1.00 37.07  ? 211  ILE A CA  1 
ATOM   575   C C   . ILE A  1 71  ? 7.721   11.747  70.972  1.00 37.07  ? 211  ILE A C   1 
ATOM   576   O O   . ILE A  1 71  ? 8.674   12.526  70.847  1.00 37.07  ? 211  ILE A O   1 
ATOM   577   C CB  . ILE A  1 71  ? 5.500   12.150  69.950  1.00 37.07  ? 211  ILE A CB  1 
ATOM   578   C CG1 . ILE A  1 71  ? 4.514   11.716  68.860  1.00 37.07  ? 211  ILE A CG1 1 
ATOM   579   C CG2 . ILE A  1 71  ? 5.763   13.636  69.937  1.00 37.07  ? 211  ILE A CG2 1 
ATOM   580   C CD1 . ILE A  1 71  ? 3.779   12.834  68.182  1.00 37.07  ? 211  ILE A CD1 1 
ATOM   581   N N   . TYR A  1 72  ? 7.404   11.180  72.128  1.00 37.26  ? 212  TYR A N   1 
ATOM   582   C CA  . TYR A  1 72  ? 8.206   11.441  73.301  1.00 37.26  ? 212  TYR A CA  1 
ATOM   583   C C   . TYR A  1 72  ? 9.614   10.905  73.018  1.00 37.26  ? 212  TYR A C   1 
ATOM   584   O O   . TYR A  1 72  ? 10.607  11.627  73.157  1.00 37.26  ? 212  TYR A O   1 
ATOM   585   C CB  . TYR A  1 72  ? 7.572   10.760  74.508  1.00 37.26  ? 212  TYR A CB  1 
ATOM   586   C CG  . TYR A  1 72  ? 6.437   11.558  75.109  1.00 37.26  ? 212  TYR A CG  1 
ATOM   587   C CD1 . TYR A  1 72  ? 6.626   12.885  75.513  1.00 37.26  ? 212  TYR A CD1 1 
ATOM   588   C CD2 . TYR A  1 72  ? 5.168   11.001  75.263  1.00 37.26  ? 212  TYR A CD2 1 
ATOM   589   C CE1 . TYR A  1 72  ? 5.573   13.645  76.059  1.00 37.26  ? 212  TYR A CE1 1 
ATOM   590   C CE2 . TYR A  1 72  ? 4.100   11.751  75.810  1.00 37.26  ? 212  TYR A CE2 1 
ATOM   591   C CZ  . TYR A  1 72  ? 4.314   13.071  76.204  1.00 37.26  ? 212  TYR A CZ  1 
ATOM   592   O OH  . TYR A  1 72  ? 3.287   13.812  76.753  1.00 37.26  ? 212  TYR A OH  1 
ATOM   593   N N   . GLU A  1 73  ? 9.701   9.650   72.588  1.00 60.20  ? 213  GLU A N   1 
ATOM   594   C CA  . GLU A  1 73  ? 10.997  9.057   72.287  1.00 60.20  ? 213  GLU A CA  1 
ATOM   595   C C   . GLU A  1 73  ? 11.835  10.033  71.489  1.00 60.20  ? 213  GLU A C   1 
ATOM   596   O O   . GLU A  1 73  ? 12.990  10.280  71.799  1.00 60.20  ? 213  GLU A O   1 
ATOM   597   C CB  . GLU A  1 73  ? 10.825  7.788   71.461  1.00 60.20  ? 213  GLU A CB  1 
ATOM   598   C CG  . GLU A  1 73  ? 11.491  6.560   72.054  1.00 60.20  ? 213  GLU A CG  1 
ATOM   599   C CD  . GLU A  1 73  ? 10.731  5.289   71.697  1.00 60.20  ? 213  GLU A CD  1 
ATOM   600   O OE1 . GLU A  1 73  ? 10.516  5.068   70.477  1.00 60.20  ? 213  GLU A OE1 1 
ATOM   601   O OE2 . GLU A  1 73  ? 10.341  4.525   72.624  1.00 60.20  ? 213  GLU A OE2 1 
ATOM   602   N N   . ILE A  1 74  ? 11.227  10.595  70.456  1.00 36.63  ? 214  ILE A N   1 
ATOM   603   C CA  . ILE A  1 74  ? 11.916  11.520  69.576  1.00 36.63  ? 214  ILE A CA  1 
ATOM   604   C C   . ILE A  1 74  ? 12.376  12.792  70.254  1.00 36.63  ? 214  ILE A C   1 
ATOM   605   O O   . ILE A  1 74  ? 13.517  13.227  70.083  1.00 36.63  ? 214  ILE A O   1 
ATOM   606   C CB  . ILE A  1 74  ? 11.026  11.909  68.398  1.00 36.63  ? 214  ILE A CB  1 
ATOM   607   C CG1 . ILE A  1 74  ? 10.735  10.671  67.543  1.00 36.63  ? 214  ILE A CG1 1 
ATOM   608   C CG2 . ILE A  1 74  ? 11.696  13.022  67.596  1.00 36.63  ? 214  ILE A CG2 1 
ATOM   609   C CD1 . ILE A  1 74  ? 9.971   10.957  66.259  1.00 36.63  ? 214  ILE A CD1 1 
ATOM   610   N N   . LEU A  1 75  ? 11.484  13.409  71.008  1.00 41.63  ? 215  LEU A N   1 
ATOM   611   C CA  . LEU A  1 75  ? 11.857  14.637  71.672  1.00 41.63  ? 215  LEU A CA  1 
ATOM   612   C C   . LEU A  1 75  ? 12.950  14.332  72.666  1.00 41.63  ? 215  LEU A C   1 
ATOM   613   O O   . LEU A  1 75  ? 13.897  15.099  72.795  1.00 41.63  ? 215  LEU A O   1 
ATOM   614   C CB  . LEU A  1 75  ? 10.658  15.261  72.388  1.00 41.63  ? 215  LEU A CB  1 
ATOM   615   C CG  . LEU A  1 75  ? 9.544   15.762  71.478  1.00 41.63  ? 215  LEU A CG  1 
ATOM   616   C CD1 . LEU A  1 75  ? 8.497   16.401  72.345  1.00 41.63  ? 215  LEU A CD1 1 
ATOM   617   C CD2 . LEU A  1 75  ? 10.072  16.752  70.458  1.00 41.63  ? 215  LEU A CD2 1 
ATOM   618   N N   . LYS A  1 76  ? 12.836  13.204  73.357  1.00 35.86  ? 216  LYS A N   1 
ATOM   619   C CA  . LYS A  1 76  ? 13.851  12.860  74.350  1.00 35.86  ? 216  LYS A CA  1 
ATOM   620   C C   . LYS A  1 76  ? 15.236  12.781  73.722  1.00 35.86  ? 216  LYS A C   1 
ATOM   621   O O   . LYS A  1 76  ? 16.247  12.958  74.389  1.00 35.86  ? 216  LYS A O   1 
ATOM   622   C CB  . LYS A  1 76  ? 13.543  11.532  75.021  1.00 35.86  ? 216  LYS A CB  1 
ATOM   623   C CG  . LYS A  1 76  ? 14.631  11.098  75.977  1.00 35.86  ? 216  LYS A CG  1 
ATOM   624   C CD  . LYS A  1 76  ? 14.098  10.090  76.977  1.00 35.86  ? 216  LYS A CD  1 
ATOM   625   C CE  . LYS A  1 76  ? 14.915  10.084  78.260  1.00 35.86  ? 216  LYS A CE  1 
ATOM   626   N NZ  . LYS A  1 76  ? 14.873  8.744   78.930  1.00 35.86  ? 216  LYS A NZ  1 
ATOM   627   N N   . ILE A  1 77  ? 15.275  12.498  72.433  1.00 25.30  ? 217  ILE A N   1 
ATOM   628   C CA  . ILE A  1 77  ? 16.540  12.431  71.747  1.00 25.30  ? 217  ILE A CA  1 
ATOM   629   C C   . ILE A  1 77  ? 17.083  13.850  71.682  1.00 25.30  ? 217  ILE A C   1 
ATOM   630   O O   . ILE A  1 77  ? 18.091  14.166  72.314  1.00 25.30  ? 217  ILE A O   1 
ATOM   631   C CB  . ILE A  1 77  ? 16.387  11.879  70.305  1.00 25.30  ? 217  ILE A CB  1 
ATOM   632   C CG1 . ILE A  1 77  ? 16.226  10.366  70.353  1.00 25.30  ? 217  ILE A CG1 1 
ATOM   633   C CG2 . ILE A  1 77  ? 17.609  12.222  69.467  1.00 25.30  ? 217  ILE A CG2 1 
ATOM   634   C CD1 . ILE A  1 77  ? 16.121  9.726   68.988  1.00 25.30  ? 217  ILE A CD1 1 
ATOM   635   N N   . TYR A  1 78  ? 16.410  14.715  70.931  1.00 35.15  ? 218  TYR A N   1 
ATOM   636   C CA  . TYR A  1 78  ? 16.876  16.084  70.789  1.00 35.15  ? 218  TYR A CA  1 
ATOM   637   C C   . TYR A  1 78  ? 16.933  16.796  72.129  1.00 35.15  ? 218  TYR A C   1 
ATOM   638   O O   . TYR A  1 78  ? 17.626  17.795  72.286  1.00 35.15  ? 218  TYR A O   1 
ATOM   639   C CB  . TYR A  1 78  ? 15.989  16.817  69.785  1.00 35.15  ? 218  TYR A CB  1 
ATOM   640   C CG  . TYR A  1 78  ? 16.099  16.190  68.412  1.00 35.15  ? 218  TYR A CG  1 
ATOM   641   C CD1 . TYR A  1 78  ? 15.356  15.065  68.086  1.00 35.15  ? 218  TYR A CD1 1 
ATOM   642   C CD2 . TYR A  1 78  ? 17.012  16.671  67.471  1.00 35.15  ? 218  TYR A CD2 1 
ATOM   643   C CE1 . TYR A  1 78  ? 15.519  14.427  66.860  1.00 35.15  ? 218  TYR A CE1 1 
ATOM   644   C CE2 . TYR A  1 78  ? 17.187  16.044  66.240  1.00 35.15  ? 218  TYR A CE2 1 
ATOM   645   C CZ  . TYR A  1 78  ? 16.436  14.913  65.937  1.00 35.15  ? 218  TYR A CZ  1 
ATOM   646   O OH  . TYR A  1 78  ? 16.584  14.255  64.723  1.00 35.15  ? 218  TYR A OH  1 
ATOM   647   N N   . GLN A  1 79  ? 16.218  16.256  73.105  1.00 31.55  ? 219  GLN A N   1 
ATOM   648   C CA  . GLN A  1 79  ? 16.193  16.834  74.438  1.00 31.55  ? 219  GLN A CA  1 
ATOM   649   C C   . GLN A  1 79  ? 17.528  16.533  75.077  1.00 31.55  ? 219  GLN A C   1 
ATOM   650   O O   . GLN A  1 79  ? 18.014  17.297  75.898  1.00 31.55  ? 219  GLN A O   1 
ATOM   651   C CB  . GLN A  1 79  ? 15.076  16.202  75.271  1.00 31.55  ? 219  GLN A CB  1 
ATOM   652   C CG  . GLN A  1 79  ? 14.951  16.763  76.666  1.00 31.55  ? 219  GLN A CG  1 
ATOM   653   C CD  . GLN A  1 79  ? 15.575  15.870  77.740  1.00 31.55  ? 219  GLN A CD  1 
ATOM   654   O OE1 . GLN A  1 79  ? 14.955  14.916  78.226  1.00 31.55  ? 219  GLN A OE1 1 
ATOM   655   N NE2 . GLN A  1 79  ? 16.807  16.188  78.122  1.00 31.55  ? 219  GLN A NE2 1 
ATOM   656   N N   . LEU A  1 80  ? 18.125  15.415  74.679  1.00 35.59  ? 220  LEU A N   1 
ATOM   657   C CA  . LEU A  1 80  ? 19.410  14.971  75.225  1.00 35.59  ? 220  LEU A CA  1 
ATOM   658   C C   . LEU A  1 80  ? 20.656  15.363  74.429  1.00 35.59  ? 220  LEU A C   1 
ATOM   659   O O   . LEU A  1 80  ? 21.772  15.125  74.871  1.00 35.59  ? 220  LEU A O   1 
ATOM   660   C CB  . LEU A  1 80  ? 19.391  13.456  75.385  1.00 35.59  ? 220  LEU A CB  1 
ATOM   661   C CG  . LEU A  1 80  ? 18.338  13.025  76.386  1.00 35.59  ? 220  LEU A CG  1 
ATOM   662   C CD1 . LEU A  1 80  ? 18.282  11.523  76.420  1.00 35.59  ? 220  LEU A CD1 1 
ATOM   663   C CD2 . LEU A  1 80  ? 18.665  13.602  77.748  1.00 35.59  ? 220  LEU A CD2 1 
ATOM   664   N N   . MET A  1 81  ? 20.468  15.955  73.262  1.00 35.07  ? 221  MET A N   1 
ATOM   665   C CA  . MET A  1 81  ? 21.595  16.344  72.433  1.00 35.07  ? 221  MET A CA  1 
ATOM   666   C C   . MET A  1 81  ? 22.378  17.516  72.971  1.00 35.07  ? 221  MET A C   1 
ATOM   667   O O   . MET A  1 81  ? 21.965  18.179  73.926  1.00 35.07  ? 221  MET A O   1 
ATOM   668   C CB  . MET A  1 81  ? 21.121  16.711  71.039  1.00 35.07  ? 221  MET A CB  1 
ATOM   669   C CG  . MET A  1 81  ? 20.866  15.537  70.155  1.00 35.07  ? 221  MET A CG  1 
ATOM   670   S SD  . MET A  1 81  ? 21.011  16.070  68.463  1.00 35.07  ? 221  MET A SD  1 
ATOM   671   C CE  . MET A  1 81  ? 20.824  14.466  67.621  1.00 35.07  ? 221  MET A CE  1 
ATOM   672   N N   . ASP A  1 82  ? 23.519  17.769  72.335  1.00 47.81  ? 222  ASP A N   1 
ATOM   673   C CA  . ASP A  1 82  ? 24.366  18.885  72.711  1.00 47.81  ? 222  ASP A CA  1 
ATOM   674   C C   . ASP A  1 82  ? 24.185  19.899  71.606  1.00 47.81  ? 222  ASP A C   1 
ATOM   675   O O   . ASP A  1 82  ? 24.767  19.792  70.529  1.00 47.81  ? 222  ASP A O   1 
ATOM   676   C CB  . ASP A  1 82  ? 25.832  18.467  72.813  1.00 47.81  ? 222  ASP A CB  1 
ATOM   677   C CG  . ASP A  1 82  ? 26.725  19.596  73.294  1.00 47.81  ? 222  ASP A CG  1 
ATOM   678   O OD1 . ASP A  1 82  ? 26.196  20.714  73.501  1.00 47.81  ? 222  ASP A OD1 1 
ATOM   679   O OD2 . ASP A  1 82  ? 27.949  19.366  73.464  1.00 47.81  ? 222  ASP A OD2 1 
ATOM   680   N N   . HIS A  1 83  ? 23.338  20.876  71.882  1.00 40.75  ? 224  HIS A N   1 
ATOM   681   C CA  . HIS A  1 83  ? 23.043  21.912  70.918  1.00 40.75  ? 224  HIS A CA  1 
ATOM   682   C C   . HIS A  1 83  ? 24.032  23.058  71.057  1.00 40.75  ? 224  HIS A C   1 
ATOM   683   O O   . HIS A  1 83  ? 23.804  24.153  70.538  1.00 40.75  ? 224  HIS A O   1 
ATOM   684   C CB  . HIS A  1 83  ? 21.615  22.408  71.136  1.00 40.75  ? 224  HIS A CB  1 
ATOM   685   C CG  . HIS A  1 83  ? 20.577  21.337  70.977  1.00 40.75  ? 224  HIS A CG  1 
ATOM   686   N ND1 . HIS A  1 83  ? 19.919  21.110  69.785  1.00 40.75  ? 224  HIS A ND1 1 
ATOM   687   C CD2 . HIS A  1 83  ? 20.071  20.447  71.862  1.00 40.75  ? 224  HIS A CD2 1 
ATOM   688   C CE1 . HIS A  1 83  ? 19.051  20.126  69.948  1.00 40.75  ? 224  HIS A CE1 1 
ATOM   689   N NE2 . HIS A  1 83  ? 19.124  19.708  71.198  1.00 40.75  ? 224  HIS A NE2 1 
ATOM   690   N N   . SER A  1 84  ? 25.139  22.791  71.747  1.00 42.76  ? 225  SER A N   1 
ATOM   691   C CA  . SER A  1 84  ? 26.179  23.788  71.975  1.00 42.76  ? 225  SER A CA  1 
ATOM   692   C C   . SER A  1 84  ? 26.617  24.540  70.729  1.00 42.76  ? 225  SER A C   1 
ATOM   693   O O   . SER A  1 84  ? 26.934  25.724  70.803  1.00 42.76  ? 225  SER A O   1 
ATOM   694   C CB  . SER A  1 84  ? 27.402  23.138  72.612  1.00 42.76  ? 225  SER A CB  1 
ATOM   695   O OG  . SER A  1 84  ? 27.269  23.131  74.015  1.00 42.76  ? 225  SER A OG  1 
ATOM   696   N N   . ASN A  1 85  ? 26.648  23.875  69.587  1.00 46.27  ? 226  ASN A N   1 
ATOM   697   C CA  . ASN A  1 85  ? 27.068  24.565  68.386  1.00 46.27  ? 226  ASN A CA  1 
ATOM   698   C C   . ASN A  1 85  ? 25.871  25.058  67.609  1.00 46.27  ? 226  ASN A C   1 
ATOM   699   O O   . ASN A  1 85  ? 26.006  25.714  66.580  1.00 46.27  ? 226  ASN A O   1 
ATOM   700   C CB  . ASN A  1 85  ? 27.929  23.649  67.526  1.00 46.27  ? 226  ASN A CB  1 
ATOM   701   C CG  . ASN A  1 85  ? 29.379  23.622  67.985  1.00 46.27  ? 226  ASN A CG  1 
ATOM   702   O OD1 . ASN A  1 85  ? 29.773  24.352  68.908  1.00 46.27  ? 226  ASN A OD1 1 
ATOM   703   N ND2 . ASN A  1 85  ? 30.182  22.775  67.346  1.00 46.27  ? 226  ASN A ND2 1 
ATOM   704   N N   . MET A  1 86  ? 24.690  24.748  68.123  1.00 42.02  ? 227  MET A N   1 
ATOM   705   C CA  . MET A  1 86  ? 23.452  25.167  67.490  1.00 42.02  ? 227  MET A CA  1 
ATOM   706   C C   . MET A  1 86  ? 23.043  26.548  67.995  1.00 42.02  ? 227  MET A C   1 
ATOM   707   O O   . MET A  1 86  ? 23.368  26.930  69.126  1.00 42.02  ? 227  MET A O   1 
ATOM   708   C CB  . MET A  1 86  ? 22.379  24.138  67.792  1.00 42.02  ? 227  MET A CB  1 
ATOM   709   C CG  . MET A  1 86  ? 22.744  22.766  67.275  1.00 42.02  ? 227  MET A CG  1 
ATOM   710   S SD  . MET A  1 86  ? 23.187  22.847  65.502  1.00 42.02  ? 227  MET A SD  1 
ATOM   711   C CE  . MET A  1 86  ? 22.856  21.157  64.993  1.00 42.02  ? 227  MET A CE  1 
ATOM   712   N N   . ASP A  1 87  ? 22.337  27.296  67.152  1.00 46.63  ? 228  ASP A N   1 
ATOM   713   C CA  . ASP A  1 87  ? 21.905  28.645  67.505  1.00 46.63  ? 228  ASP A CA  1 
ATOM   714   C C   . ASP A  1 87  ? 20.408  28.736  67.827  1.00 46.63  ? 228  ASP A C   1 
ATOM   715   O O   . ASP A  1 87  ? 19.942  29.723  68.418  1.00 46.63  ? 228  ASP A O   1 
ATOM   716   C CB  . ASP A  1 87  ? 22.229  29.598  66.347  1.00 46.63  ? 228  ASP A CB  1 
ATOM   717   C CG  . ASP A  1 87  ? 23.481  30.397  66.586  1.00 46.63  ? 228  ASP A CG  1 
ATOM   718   O OD1 . ASP A  1 87  ? 23.967  30.390  67.734  1.00 46.63  ? 228  ASP A OD1 1 
ATOM   719   O OD2 . ASP A  1 87  ? 23.973  31.033  65.630  1.00 46.63  ? 228  ASP A OD2 1 
ATOM   720   N N   . CYS A  1 88  ? 19.662  27.705  67.441  1.00 48.25  ? 229  CYS A N   1 
ATOM   721   C CA  . CYS A  1 88  ? 18.220  27.685  67.653  1.00 48.25  ? 229  CYS A CA  1 
ATOM   722   C C   . CYS A  1 88  ? 17.682  26.263  67.473  1.00 48.25  ? 229  CYS A C   1 
ATOM   723   O O   . CYS A  1 88  ? 18.410  25.377  67.030  1.00 48.25  ? 229  CYS A O   1 
ATOM   724   C CB  . CYS A  1 88  ? 17.578  28.656  66.651  1.00 48.25  ? 229  CYS A CB  1 
ATOM   725   S SG  . CYS A  1 88  ? 15.834  28.448  66.352  1.00 48.25  ? 229  CYS A SG  1 
ATOM   726   N N   . PHE A  1 89  ? 16.419  26.043  67.832  1.00 34.20  ? 230  PHE A N   1 
ATOM   727   C CA  . PHE A  1 89  ? 15.790  24.729  67.702  1.00 34.20  ? 230  PHE A CA  1 
ATOM   728   C C   . PHE A  1 89  ? 14.330  24.903  67.366  1.00 34.20  ? 230  PHE A C   1 
ATOM   729   O O   . PHE A  1 89  ? 13.621  25.629  68.051  1.00 34.20  ? 230  PHE A O   1 
ATOM   730   C CB  . PHE A  1 89  ? 15.906  23.938  69.005  1.00 34.20  ? 230  PHE A CB  1 
ATOM   731   C CG  . PHE A  1 89  ? 15.141  22.641  69.001  1.00 34.20  ? 230  PHE A CG  1 
ATOM   732   C CD1 . PHE A  1 89  ? 15.519  21.590  68.171  1.00 34.20  ? 230  PHE A CD1 1 
ATOM   733   C CD2 . PHE A  1 89  ? 14.038  22.469  69.829  1.00 34.20  ? 230  PHE A CD2 1 
ATOM   734   C CE1 . PHE A  1 89  ? 14.811  20.396  68.167  1.00 34.20  ? 230  PHE A CE1 1 
ATOM   735   C CE2 . PHE A  1 89  ? 13.322  21.268  69.829  1.00 34.20  ? 230  PHE A CE2 1 
ATOM   736   C CZ  . PHE A  1 89  ? 13.711  20.235  68.997  1.00 34.20  ? 230  PHE A CZ  1 
ATOM   737   N N   . ILE A  1 90  ? 13.872  24.233  66.321  1.00 24.98  ? 231  ILE A N   1 
ATOM   738   C CA  . ILE A  1 90  ? 12.483  24.351  65.928  1.00 24.98  ? 231  ILE A CA  1 
ATOM   739   C C   . ILE A  1 90  ? 11.825  23.010  65.842  1.00 24.98  ? 231  ILE A C   1 
ATOM   740   O O   . ILE A  1 90  ? 12.371  22.088  65.253  1.00 24.98  ? 231  ILE A O   1 
ATOM   741   C CB  . ILE A  1 90  ? 12.360  24.960  64.562  1.00 24.98  ? 231  ILE A CB  1 
ATOM   742   C CG1 . ILE A  1 90  ? 13.115  26.283  64.517  1.00 24.98  ? 231  ILE A CG1 1 
ATOM   743   C CG2 . ILE A  1 90  ? 10.891  25.061  64.198  1.00 24.98  ? 231  ILE A CG2 1 
ATOM   744   C CD1 . ILE A  1 90  ? 13.013  26.959  63.162  1.00 24.98  ? 231  ILE A CD1 1 
ATOM   745   N N   . CYS A  1 91  ? 10.635  22.890  66.388  1.00 33.65  ? 232  CYS A N   1 
ATOM   746   C CA  . CYS A  1 91  ? 9.960   21.611  66.309  1.00 33.65  ? 232  CYS A CA  1 
ATOM   747   C C   . CYS A  1 91  ? 8.536   21.790  65.805  1.00 33.65  ? 232  CYS A C   1 
ATOM   748   O O   . CYS A  1 91  ? 7.744   22.521  66.402  1.00 33.65  ? 232  CYS A O   1 
ATOM   749   C CB  . CYS A  1 91  ? 9.960   20.933  67.669  1.00 33.65  ? 232  CYS A CB  1 
ATOM   750   S SG  . CYS A  1 91  ? 8.841   19.568  67.695  1.00 33.65  ? 232  CYS A SG  1 
ATOM   751   N N   . CYS A  1 92  ? 8.213   21.127  64.702  1.00 39.05  ? 233  CYS A N   1 
ATOM   752   C CA  . CYS A  1 92  ? 6.879   21.232  64.134  1.00 39.05  ? 233  CYS A CA  1 
ATOM   753   C C   . CYS A  1 92  ? 6.053   19.985  64.315  1.00 39.05  ? 233  CYS A C   1 
ATOM   754   O O   . CYS A  1 92  ? 6.537   18.863  64.178  1.00 39.05  ? 233  CYS A O   1 
ATOM   755   C CB  . CYS A  1 92  ? 6.965   21.550  62.662  1.00 39.05  ? 233  CYS A CB  1 
ATOM   756   S SG  . CYS A  1 92  ? 8.114   22.863  62.377  1.00 39.05  ? 233  CYS A SG  1 
ATOM   757   N N   . ILE A  1 93  ? 4.786   20.186  64.618  1.00 21.47  ? 234  ILE A N   1 
ATOM   758   C CA  . ILE A  1 93  ? 3.911   19.068  64.829  1.00 21.47  ? 234  ILE A CA  1 
ATOM   759   C C   . ILE A  1 93  ? 2.659   19.261  64.019  1.00 21.47  ? 234  ILE A C   1 
ATOM   760   O O   . ILE A  1 93  ? 2.041   20.318  64.049  1.00 21.47  ? 234  ILE A O   1 
ATOM   761   C CB  . ILE A  1 93  ? 3.570   18.935  66.284  1.00 21.47  ? 234  ILE A CB  1 
ATOM   762   C CG1 . ILE A  1 93  ? 4.872   18.820  67.085  1.00 21.47  ? 234  ILE A CG1 1 
ATOM   763   C CG2 . ILE A  1 93  ? 2.692   17.745  66.476  1.00 21.47  ? 234  ILE A CG2 1 
ATOM   764   C CD1 . ILE A  1 93  ? 4.718   18.248  68.488  1.00 21.47  ? 234  ILE A CD1 1 
ATOM   765   N N   . LEU A  1 94  ? 2.312   18.245  63.249  1.00 27.71  ? 235  LEU A N   1 
ATOM   766   C CA  . LEU A  1 94  ? 1.128   18.306  62.430  1.00 27.71  ? 235  LEU A CA  1 
ATOM   767   C C   . LEU A  1 94  ? 0.382   17.049  62.769  1.00 27.71  ? 235  LEU A C   1 
ATOM   768   O O   . LEU A  1 94  ? 0.869   15.960  62.520  1.00 27.71  ? 235  LEU A O   1 
ATOM   769   C CB  . LEU A  1 94  ? 1.511   18.313  60.961  1.00 27.71  ? 235  LEU A CB  1 
ATOM   770   C CG  . LEU A  1 94  ? 2.879   18.937  60.725  1.00 27.71  ? 235  LEU A CG  1 
ATOM   771   C CD1 . LEU A  1 94  ? 3.195   18.949  59.241  1.00 27.71  ? 235  LEU A CD1 1 
ATOM   772   C CD2 . LEU A  1 94  ? 2.875   20.347  61.282  1.00 27.71  ? 235  LEU A CD2 1 
ATOM   773   N N   . SER A  1 95  ? -0.796  17.198  63.353  1.00 30.41  ? 236  SER A N   1 
ATOM   774   C CA  . SER A  1 95  ? -1.598  16.049  63.730  1.00 30.41  ? 236  SER A CA  1 
ATOM   775   C C   . SER A  1 95  ? -2.944  16.554  64.244  1.00 30.41  ? 236  SER A C   1 
ATOM   776   O O   . SER A  1 95  ? -3.174  17.757  64.265  1.00 30.41  ? 236  SER A O   1 
ATOM   777   C CB  . SER A  1 95  ? -0.871  15.259  64.824  1.00 30.41  ? 236  SER A CB  1 
ATOM   778   O OG  . SER A  1 95  ? -1.757  14.391  65.515  1.00 30.41  ? 236  SER A OG  1 
ATOM   779   N N   . HIS A  1 96  ? -3.834  15.645  64.642  1.00 26.96  ? 237  HIS A N   1 
ATOM   780   C CA  . HIS A  1 96  ? -5.145  16.031  65.183  1.00 26.96  ? 237  HIS A CA  1 
ATOM   781   C C   . HIS A  1 96  ? -4.868  16.449  66.626  1.00 26.96  ? 237  HIS A C   1 
ATOM   782   O O   . HIS A  1 96  ? -3.750  16.288  67.113  1.00 26.96  ? 237  HIS A O   1 
ATOM   783   C CB  . HIS A  1 96  ? -6.114  14.841  65.211  1.00 26.96  ? 237  HIS A CB  1 
ATOM   784   C CG  . HIS A  1 96  ? -6.670  14.458  63.873  1.00 26.96  ? 237  HIS A CG  1 
ATOM   785   N ND1 . HIS A  1 96  ? -6.988  15.380  62.904  1.00 26.96  ? 237  HIS A ND1 1 
ATOM   786   C CD2 . HIS A  1 96  ? -6.975  13.246  63.351  1.00 26.96  ? 237  HIS A CD2 1 
ATOM   787   C CE1 . HIS A  1 96  ? -7.467  14.755  61.843  1.00 26.96  ? 237  HIS A CE1 1 
ATOM   788   N NE2 . HIS A  1 96  ? -7.468  13.458  62.089  1.00 26.96  ? 237  HIS A NE2 1 
ATOM   789   N N   . GLY A  1 97  ? -5.883  16.952  67.322  1.00 27.18  ? 238  GLY A N   1 
ATOM   790   C CA  . GLY A  1 97  ? -5.670  17.372  68.696  1.00 27.18  ? 238  GLY A CA  1 
ATOM   791   C C   . GLY A  1 97  ? -6.933  17.833  69.381  1.00 27.18  ? 238  GLY A C   1 
ATOM   792   O O   . GLY A  1 97  ? -7.999  17.801  68.799  1.00 27.18  ? 238  GLY A O   1 
ATOM   793   N N   . ASP A  1 98  ? -6.806  18.255  70.631  1.00 32.28  ? 239  ASP A N   1 
ATOM   794   C CA  . ASP A  1 98  ? -7.943  18.729  71.394  1.00 32.28  ? 239  ASP A CA  1 
ATOM   795   C C   . ASP A  1 98  ? -7.478  19.754  72.414  1.00 32.28  ? 239  ASP A C   1 
ATOM   796   O O   . ASP A  1 98  ? -6.308  20.112  72.451  1.00 32.28  ? 239  ASP A O   1 
ATOM   797   C CB  . ASP A  1 98  ? -8.603  17.563  72.100  1.00 32.28  ? 239  ASP A CB  1 
ATOM   798   C CG  . ASP A  1 98  ? -10.116 17.680  72.142  1.00 32.28  ? 239  ASP A CG  1 
ATOM   799   O OD1 . ASP A  1 98  ? -10.616 18.818  72.304  1.00 32.28  ? 239  ASP A OD1 1 
ATOM   800   O OD2 . ASP A  1 98  ? -10.793 16.625  72.020  1.00 32.28  ? 239  ASP A OD2 1 
ATOM   801   N N   . LYS A  1 99  ? -8.398  20.234  73.232  1.00 53.53  ? 240  LYS A N   1 
ATOM   802   C CA  . LYS A  1 99  ? -8.067  21.219  74.241  1.00 53.53  ? 240  LYS A CA  1 
ATOM   803   C C   . LYS A  1 99  ? -6.679  20.977  74.802  1.00 53.53  ? 240  LYS A C   1 
ATOM   804   O O   . LYS A  1 99  ? -6.471  20.038  75.568  1.00 53.53  ? 240  LYS A O   1 
ATOM   805   C CB  . LYS A  1 99  ? -9.068  21.130  75.373  1.00 53.53  ? 240  LYS A CB  1 
ATOM   806   C CG  . LYS A  1 99  ? -9.160  19.706  75.911  1.00 53.53  ? 240  LYS A CG  1 
ATOM   807   C CD  . LYS A  1 99  ? -10.370 19.506  76.816  1.00 53.53  ? 240  LYS A CD  1 
ATOM   808   C CE  . LYS A  1 99  ? -10.054 18.541  77.962  1.00 53.53  ? 240  LYS A CE  1 
ATOM   809   N NZ  . LYS A  1 99  ? -10.791 18.927  79.205  1.00 53.53  ? 240  LYS A NZ  1 
ATOM   810   N N   . GLY A  1 100 ? -5.731  21.819  74.405  1.00 28.72  ? 241  GLY A N   1 
ATOM   811   C CA  . GLY A  1 100 ? -4.370  21.707  74.906  1.00 28.72  ? 241  GLY A CA  1 
ATOM   812   C C   . GLY A  1 100 ? -3.592  20.403  74.724  1.00 28.72  ? 241  GLY A C   1 
ATOM   813   O O   . GLY A  1 100 ? -2.686  20.101  75.501  1.00 28.72  ? 241  GLY A O   1 
ATOM   814   N N   . ILE A  1 101 ? -3.938  19.624  73.705  1.00 26.20  ? 242  ILE A N   1 
ATOM   815   C CA  . ILE A  1 101 ? -3.232  18.384  73.445  1.00 26.20  ? 242  ILE A CA  1 
ATOM   816   C C   . ILE A  1 101 ? -3.101  18.103  71.961  1.00 26.20  ? 242  ILE A C   1 
ATOM   817   O O   . ILE A  1 101 ? -3.833  18.647  71.109  1.00 26.20  ? 242  ILE A O   1 
ATOM   818   C CB  . ILE A  1 101 ? -3.920  17.167  74.042  1.00 26.20  ? 242  ILE A CB  1 
ATOM   819   C CG1 . ILE A  1 101 ? -5.179  16.865  73.235  1.00 26.20  ? 242  ILE A CG1 1 
ATOM   820   C CG2 . ILE A  1 101 ? -4.179  17.387  75.501  1.00 26.20  ? 242  ILE A CG2 1 
ATOM   821   C CD1 . ILE A  1 101 ? -5.532  15.422  73.213  1.00 26.20  ? 242  ILE A CD1 1 
ATOM   822   N N   . ILE A  1 102 ? -2.151  17.222  71.683  1.00 34.58  ? 243  ILE A N   1 
ATOM   823   C CA  . ILE A  1 102 ? -1.842  16.791  70.350  1.00 34.58  ? 243  ILE A CA  1 
ATOM   824   C C   . ILE A  1 102 ? -2.173  15.315  70.351  1.00 34.58  ? 243  ILE A C   1 
ATOM   825   O O   . ILE A  1 102 ? -2.173  14.673  71.399  1.00 34.58  ? 243  ILE A O   1 
ATOM   826   C CB  . ILE A  1 102 ? -0.348  17.061  70.064  1.00 34.58  ? 243  ILE A CB  1 
ATOM   827   C CG1 . ILE A  1 102 ? -0.239  18.230  69.092  1.00 34.58  ? 243  ILE A CG1 1 
ATOM   828   C CG2 . ILE A  1 102 ? 0.360   15.799  69.530  1.00 34.58  ? 243  ILE A CG2 1 
ATOM   829   C CD1 . ILE A  1 102 ? -1.510  19.024  68.978  1.00 34.58  ? 243  ILE A CD1 1 
ATOM   830   N N   . TYR A  1 103 ? -2.469  14.772  69.186  1.00 40.51  ? 244  TYR A N   1 
ATOM   831   C CA  . TYR A  1 103 ? -2.816  13.377  69.131  1.00 40.51  ? 244  TYR A CA  1 
ATOM   832   C C   . TYR A  1 103 ? -1.762  12.524  68.495  1.00 40.51  ? 244  TYR A C   1 
ATOM   833   O O   . TYR A  1 103 ? -1.254  12.840  67.427  1.00 40.51  ? 244  TYR A O   1 
ATOM   834   C CB  . TYR A  1 103 ? -4.115  13.186  68.359  1.00 40.51  ? 244  TYR A CB  1 
ATOM   835   C CG  . TYR A  1 103 ? -5.350  13.164  69.229  1.00 40.51  ? 244  TYR A CG  1 
ATOM   836   C CD1 . TYR A  1 103 ? -5.530  12.179  70.198  1.00 40.51  ? 244  TYR A CD1 1 
ATOM   837   C CD2 . TYR A  1 103 ? -6.349  14.125  69.072  1.00 40.51  ? 244  TYR A CD2 1 
ATOM   838   C CE1 . TYR A  1 103 ? -6.679  12.151  70.991  1.00 40.51  ? 244  TYR A CE1 1 
ATOM   839   C CE2 . TYR A  1 103 ? -7.494  14.100  69.857  1.00 40.51  ? 244  TYR A CE2 1 
ATOM   840   C CZ  . TYR A  1 103 ? -7.656  13.114  70.811  1.00 40.51  ? 244  TYR A CZ  1 
ATOM   841   O OH  . TYR A  1 103 ? -8.807  13.094  71.565  1.00 40.51  ? 244  TYR A OH  1 
ATOM   842   N N   . GLY A  1 104 ? -1.443  11.427  69.162  1.00 24.97  ? 245  GLY A N   1 
ATOM   843   C CA  . GLY A  1 104 ? -0.475  10.501  68.622  1.00 24.97  ? 245  GLY A CA  1 
ATOM   844   C C   . GLY A  1 104 ? -1.219  9.793   67.509  1.00 24.97  ? 245  GLY A C   1 
ATOM   845   O O   . GLY A  1 104 ? -2.440  9.809   67.484  1.00 24.97  ? 245  GLY A O   1 
ATOM   846   N N   . THR A  1 105 ? -0.498  9.180   66.583  1.00 37.15  ? 246  THR A N   1 
ATOM   847   C CA  . THR A  1 105 ? -1.136  8.497   65.480  1.00 37.15  ? 246  THR A CA  1 
ATOM   848   C C   . THR A  1 105 ? -1.903  7.252   65.949  1.00 37.15  ? 246  THR A C   1 
ATOM   849   O O   . THR A  1 105 ? -2.440  6.508   65.139  1.00 37.15  ? 246  THR A O   1 
ATOM   850   C CB  . THR A  1 105 ? -0.079  8.117   64.439  1.00 37.15  ? 246  THR A CB  1 
ATOM   851   O OG1 . THR A  1 105 ? -0.633  8.220   63.118  1.00 37.15  ? 246  THR A OG1 1 
ATOM   852   C CG2 . THR A  1 105 ? 0.425   6.706   64.691  1.00 37.15  ? 246  THR A CG2 1 
ATOM   853   N N   . ASP A  1 106 ? -1.976  7.041   67.259  1.00 30.99  ? 247  ASP A N   1 
ATOM   854   C CA  . ASP A  1 106 ? -2.663  5.874   67.806  1.00 30.99  ? 247  ASP A CA  1 
ATOM   855   C C   . ASP A  1 106 ? -3.857  6.239   68.671  1.00 30.99  ? 247  ASP A C   1 
ATOM   856   O O   . ASP A  1 106 ? -4.507  5.372   69.255  1.00 30.99  ? 247  ASP A O   1 
ATOM   857   C CB  . ASP A  1 106 ? -1.694  5.043   68.645  1.00 30.99  ? 247  ASP A CB  1 
ATOM   858   C CG  . ASP A  1 106 ? -1.004  5.861   69.728  1.00 30.99  ? 247  ASP A CG  1 
ATOM   859   O OD1 . ASP A  1 106 ? -1.066  7.107   69.651  1.00 30.99  ? 247  ASP A OD1 1 
ATOM   860   O OD2 . ASP A  1 106 ? -0.398  5.270   70.651  1.00 30.99  ? 247  ASP A OD2 1 
ATOM   861   N N   . GLY A  1 107 ? -4.145  7.526   68.773  1.00 32.88  ? 248  GLY A N   1 
ATOM   862   C CA  . GLY A  1 107 ? -5.272  7.939   69.584  1.00 32.88  ? 248  GLY A CA  1 
ATOM   863   C C   . GLY A  1 107 ? -4.846  8.387   70.970  1.00 32.88  ? 248  GLY A C   1 
ATOM   864   O O   . GLY A  1 107 ? -5.584  9.082   71.670  1.00 32.88  ? 248  GLY A O   1 
ATOM   865   N N   . GLN A  1 108 ? -3.662  7.967   71.385  1.00 34.42  ? 254  GLN A N   1 
ATOM   866   C CA  . GLN A  1 108 ? -3.141  8.366   72.686  1.00 34.42  ? 254  GLN A CA  1 
ATOM   867   C C   . GLN A  1 108 ? -2.934  9.859   72.556  1.00 34.42  ? 254  GLN A C   1 
ATOM   868   O O   . GLN A  1 108 ? -2.811  10.358  71.438  1.00 34.42  ? 254  GLN A O   1 
ATOM   869   C CB  . GLN A  1 108 ? -1.802  7.680   72.954  1.00 34.42  ? 254  GLN A CB  1 
ATOM   870   C CG  . GLN A  1 108 ? -1.949  6.294   73.536  1.00 34.42  ? 254  GLN A CG  1 
ATOM   871   C CD  . GLN A  1 108 ? -2.912  6.295   74.690  1.00 34.42  ? 254  GLN A CD  1 
ATOM   872   O OE1 . GLN A  1 108 ? -2.763  7.076   75.627  1.00 34.42  ? 254  GLN A OE1 1 
ATOM   873   N NE2 . GLN A  1 108 ? -3.918  5.431   74.628  1.00 34.42  ? 254  GLN A NE2 1 
ATOM   874   N N   . GLU A  1 109 ? -2.892  10.577  73.674  1.00 46.84  ? 255  GLU A N   1 
ATOM   875   C CA  . GLU A  1 109 ? -2.707  12.022  73.593  1.00 46.84  ? 255  GLU A CA  1 
ATOM   876   C C   . GLU A  1 109 ? -1.526  12.534  74.376  1.00 46.84  ? 255  GLU A C   1 
ATOM   877   O O   . GLU A  1 109 ? -1.092  11.897  75.317  1.00 46.84  ? 255  GLU A O   1 
ATOM   878   C CB  . GLU A  1 109 ? -3.968  12.761  74.052  1.00 46.84  ? 255  GLU A CB  1 
ATOM   879   C CG  . GLU A  1 109 ? -4.601  12.250  75.327  1.00 46.84  ? 255  GLU A CG  1 
ATOM   880   C CD  . GLU A  1 109 ? -5.990  12.854  75.568  1.00 46.84  ? 255  GLU A CD  1 
ATOM   881   O OE1 . GLU A  1 109 ? -6.880  12.721  74.682  1.00 46.84  ? 255  GLU A OE1 1 
ATOM   882   O OE2 . GLU A  1 109 ? -6.184  13.463  76.645  1.00 46.84  ? 255  GLU A OE2 1 
ATOM   883   N N   . ALA A  1 110 ? -1.010  13.692  73.974  1.00 24.49  ? 256  ALA A N   1 
ATOM   884   C CA  . ALA A  1 110 ? 0.119   14.300  74.655  1.00 24.49  ? 256  ALA A CA  1 
ATOM   885   C C   . ALA A  1 110 ? -0.094  15.790  74.870  1.00 24.49  ? 256  ALA A C   1 
ATOM   886   O O   . ALA A  1 110 ? -0.214  16.546  73.912  1.00 24.49  ? 256  ALA A O   1 
ATOM   887   C CB  . ALA A  1 110 ? 1.374   14.088  73.848  1.00 24.49  ? 256  ALA A CB  1 
ATOM   888   N N   . PRO A  1 111 ? -0.174  16.237  76.128  1.00 18.51  ? 257  PRO A N   1 
ATOM   889   C CA  . PRO A  1 111 ? -0.367  17.674  76.375  1.00 18.51  ? 257  PRO A CA  1 
ATOM   890   C C   . PRO A  1 111 ? 0.677   18.513  75.636  1.00 18.51  ? 257  PRO A C   1 
ATOM   891   O O   . PRO A  1 111 ? 1.855   18.139  75.591  1.00 18.51  ? 257  PRO A O   1 
ATOM   892   C CB  . PRO A  1 111 ? -0.197  17.813  77.892  1.00 18.51  ? 257  PRO A CB  1 
ATOM   893   C CG  . PRO A  1 111 ? -0.512  16.451  78.437  1.00 18.51  ? 257  PRO A CG  1 
ATOM   894   C CD  . PRO A  1 111 ? -0.137  15.447  77.374  1.00 18.51  ? 257  PRO A CD  1 
ATOM   895   N N   . ILE A  1 112 ? 0.275   19.639  75.058  1.00 27.28  ? 258  ILE A N   1 
ATOM   896   C CA  . ILE A  1 112 ? 1.252   20.464  74.372  1.00 27.28  ? 258  ILE A CA  1 
ATOM   897   C C   . ILE A  1 112 ? 2.351   20.768  75.391  1.00 27.28  ? 258  ILE A C   1 
ATOM   898   O O   . ILE A  1 112 ? 3.531   20.728  75.076  1.00 27.28  ? 258  ILE A O   1 
ATOM   899   C CB  . ILE A  1 112 ? 0.662   21.794  73.918  1.00 27.28  ? 258  ILE A CB  1 
ATOM   900   C CG1 . ILE A  1 112 ? -0.522  21.557  72.978  1.00 27.28  ? 258  ILE A CG1 1 
ATOM   901   C CG2 . ILE A  1 112 ? 1.757   22.636  73.289  1.00 27.28  ? 258  ILE A CG2 1 
ATOM   902   C CD1 . ILE A  1 112 ? -0.133  21.128  71.617  1.00 27.28  ? 258  ILE A CD1 1 
ATOM   903   N N   . TYR A  1 113 ? 1.952   21.052  76.624  1.00 56.00  ? 259  TYR A N   1 
ATOM   904   C CA  . TYR A  1 113 ? 2.898   21.362  77.685  1.00 56.00  ? 259  TYR A CA  1 
ATOM   905   C C   . TYR A  1 113 ? 3.994   20.333  77.897  1.00 56.00  ? 259  TYR A C   1 
ATOM   906   O O   . TYR A  1 113 ? 5.137   20.697  78.124  1.00 56.00  ? 259  TYR A O   1 
ATOM   907   C CB  . TYR A  1 113 ? 2.158   21.553  78.999  1.00 56.00  ? 259  TYR A CB  1 
ATOM   908   C CG  . TYR A  1 113 ? 3.061   22.010  80.115  1.00 56.00  ? 259  TYR A CG  1 
ATOM   909   C CD1 . TYR A  1 113 ? 3.373   23.363  80.277  1.00 56.00  ? 259  TYR A CD1 1 
ATOM   910   C CD2 . TYR A  1 113 ? 3.622   21.093  81.008  1.00 56.00  ? 259  TYR A CD2 1 
ATOM   911   C CE1 . TYR A  1 113 ? 4.223   23.798  81.302  1.00 56.00  ? 259  TYR A CE1 1 
ATOM   912   C CE2 . TYR A  1 113 ? 4.479   21.515  82.044  1.00 56.00  ? 259  TYR A CE2 1 
ATOM   913   C CZ  . TYR A  1 113 ? 4.772   22.872  82.180  1.00 56.00  ? 259  TYR A CZ  1 
ATOM   914   O OH  . TYR A  1 113 ? 5.617   23.299  83.185  1.00 56.00  ? 259  TYR A OH  1 
ATOM   915   N N   . GLU A  1 114 ? 3.650   19.052  77.854  1.00 48.07  ? 260  GLU A N   1 
ATOM   916   C CA  . GLU A  1 114 ? 4.645   17.998  78.051  1.00 48.07  ? 260  GLU A CA  1 
ATOM   917   C C   . GLU A  1 114 ? 5.769   18.107  77.044  1.00 48.07  ? 260  GLU A C   1 
ATOM   918   O O   . GLU A  1 114 ? 6.939   18.082  77.404  1.00 48.07  ? 260  GLU A O   1 
ATOM   919   C CB  . GLU A  1 114 ? 4.017   16.617  77.899  1.00 48.07  ? 260  GLU A CB  1 
ATOM   920   C CG  . GLU A  1 114 ? 3.020   16.283  78.965  1.00 48.07  ? 260  GLU A CG  1 
ATOM   921   C CD  . GLU A  1 114 ? 3.665   16.131  80.325  1.00 48.07  ? 260  GLU A CD  1 
ATOM   922   O OE1 . GLU A  1 114 ? 4.471   17.013  80.699  1.00 48.07  ? 260  GLU A OE1 1 
ATOM   923   O OE2 . GLU A  1 114 ? 3.364   15.129  81.020  1.00 48.07  ? 260  GLU A OE2 1 
ATOM   924   N N   . LEU A  1 115 ? 5.396   18.212  75.772  1.00 22.04  ? 261  LEU A N   1 
ATOM   925   C CA  . LEU A  1 115 ? 6.352   18.321  74.676  1.00 22.04  ? 261  LEU A CA  1 
ATOM   926   C C   . LEU A  1 115 ? 7.191   19.582  74.827  1.00 22.04  ? 261  LEU A C   1 
ATOM   927   O O   . LEU A  1 115 ? 8.416   19.552  74.785  1.00 22.04  ? 261  LEU A O   1 
ATOM   928   C CB  . LEU A  1 115 ? 5.603   18.363  73.342  1.00 22.04  ? 261  LEU A CB  1 
ATOM   929   C CG  . LEU A  1 115 ? 4.434   17.392  73.205  1.00 22.04  ? 261  LEU A CG  1 
ATOM   930   C CD1 . LEU A  1 115 ? 4.036   17.347  71.761  1.00 22.04  ? 261  LEU A CD1 1 
ATOM   931   C CD2 . LEU A  1 115 ? 4.817   15.995  73.677  1.00 22.04  ? 261  LEU A CD2 1 
ATOM   932   N N   . THR A  1 116 ? 6.501   20.693  75.003  1.00 42.37  ? 262  THR A N   1 
ATOM   933   C CA  . THR A  1 116 ? 7.137   21.982  75.167  1.00 42.37  ? 262  THR A CA  1 
ATOM   934   C C   . THR A  1 116 ? 8.108   22.017  76.337  1.00 42.37  ? 262  THR A C   1 
ATOM   935   O O   . THR A  1 116 ? 9.236   22.462  76.192  1.00 42.37  ? 262  THR A O   1 
ATOM   936   C CB  . THR A  1 116 ? 6.068   23.076  75.366  1.00 42.37  ? 262  THR A CB  1 
ATOM   937   O OG1 . THR A  1 116 ? 6.212   24.045  74.328  1.00 42.37  ? 262  THR A OG1 1 
ATOM   938   C CG2 . THR A  1 116 ? 6.200   23.770  76.729  1.00 42.37  ? 262  THR A CG2 1 
ATOM   939   N N   . SER A  1 117 ? 7.652   21.550  77.494  1.00 62.51  ? 263  SER A N   1 
ATOM   940   C CA  . SER A  1 117 ? 8.440   21.547  78.721  1.00 62.51  ? 263  SER A CA  1 
ATOM   941   C C   . SER A  1 117 ? 9.634   20.605  78.722  1.00 62.51  ? 263  SER A C   1 
ATOM   942   O O   . SER A  1 117 ? 10.325  20.455  79.731  1.00 62.51  ? 263  SER A O   1 
ATOM   943   C CB  . SER A  1 117 ? 7.539   21.194  79.905  1.00 62.51  ? 263  SER A CB  1 
ATOM   944   O OG  . SER A  1 117 ? 7.577   19.804  80.184  1.00 62.51  ? 263  SER A OG  1 
ATOM   945   N N   . GLN A  1 118 ? 9.881   19.959  77.599  1.00 50.72  ? 264  GLN A N   1 
ATOM   946   C CA  . GLN A  1 118 ? 10.995  19.037  77.520  1.00 50.72  ? 264  GLN A CA  1 
ATOM   947   C C   . GLN A  1 118 ? 12.320  19.729  77.294  1.00 50.72  ? 264  GLN A C   1 
ATOM   948   O O   . GLN A  1 118 ? 13.352  19.225  77.705  1.00 50.72  ? 264  GLN A O   1 
ATOM   949   C CB  . GLN A  1 118 ? 10.776  18.063  76.379  1.00 50.72  ? 264  GLN A CB  1 
ATOM   950   C CG  . GLN A  1 118 ? 11.314  16.697  76.648  1.00 50.72  ? 264  GLN A CG  1 
ATOM   951   C CD  . GLN A  1 118 ? 10.199  15.718  76.746  1.00 50.72  ? 264  GLN A CD  1 
ATOM   952   O OE1 . GLN A  1 118 ? 9.196   15.996  77.408  1.00 50.72  ? 264  GLN A OE1 1 
ATOM   953   N NE2 . GLN A  1 118 ? 10.340  14.566  76.080  1.00 50.72  ? 264  GLN A NE2 1 
ATOM   954   N N   . PHE A  1 119 ? 12.285  20.881  76.632  1.00 35.45  ? 265  PHE A N   1 
ATOM   955   C CA  . PHE A  1 119 ? 13.495  21.631  76.293  1.00 35.45  ? 265  PHE A CA  1 
ATOM   956   C C   . PHE A  1 119 ? 13.759  22.905  77.098  1.00 35.45  ? 265  PHE A C   1 
ATOM   957   O O   . PHE A  1 119 ? 14.293  23.887  76.558  1.00 35.45  ? 265  PHE A O   1 
ATOM   958   C CB  . PHE A  1 119 ? 13.490  21.972  74.792  1.00 35.45  ? 265  PHE A CB  1 
ATOM   959   C CG  . PHE A  1 119 ? 13.274  20.776  73.891  1.00 35.45  ? 265  PHE A CG  1 
ATOM   960   C CD1 . PHE A  1 119 ? 12.028  20.163  73.806  1.00 35.45  ? 265  PHE A CD1 1 
ATOM   961   C CD2 . PHE A  1 119 ? 14.305  20.279  73.113  1.00 35.45  ? 265  PHE A CD2 1 
ATOM   962   C CE1 . PHE A  1 119 ? 11.812  19.076  72.957  1.00 35.45  ? 265  PHE A CE1 1 
ATOM   963   C CE2 . PHE A  1 119 ? 14.095  19.194  72.266  1.00 35.45  ? 265  PHE A CE2 1 
ATOM   964   C CZ  . PHE A  1 119 ? 12.845  18.594  72.189  1.00 35.45  ? 265  PHE A CZ  1 
ATOM   965   N N   . THR A  1 120 ? 13.402  22.892  78.383  1.00 40.92  ? 266  THR A N   1 
ATOM   966   C CA  . THR A  1 120 ? 13.639  24.049  79.234  1.00 40.92  ? 266  THR A CA  1 
ATOM   967   C C   . THR A  1 120 ? 15.164  24.276  79.394  1.00 40.92  ? 266  THR A C   1 
ATOM   968   O O   . THR A  1 120 ? 15.987  23.634  78.724  1.00 40.92  ? 266  THR A O   1 
ATOM   969   C CB  . THR A  1 120 ? 12.972  23.877  80.643  1.00 40.92  ? 266  THR A CB  1 
ATOM   970   O OG1 . THR A  1 120 ? 13.848  23.154  81.513  1.00 40.92  ? 266  THR A OG1 1 
ATOM   971   C CG2 . THR A  1 120 ? 11.674  23.123  80.543  1.00 40.92  ? 266  THR A CG2 1 
ATOM   972   N N   . GLY A  1 121 ? 15.545  25.192  80.276  1.00 74.39  ? 267  GLY A N   1 
ATOM   973   C CA  . GLY A  1 121 ? 16.954  25.465  80.464  1.00 74.39  ? 267  GLY A CA  1 
ATOM   974   C C   . GLY A  1 121 ? 17.613  24.379  81.271  1.00 74.39  ? 267  GLY A C   1 
ATOM   975   O O   . GLY A  1 121 ? 18.784  24.064  81.060  1.00 74.39  ? 267  GLY A O   1 
ATOM   976   N N   . LEU A  1 122 ? 16.861  23.810  82.204  1.00 48.34  ? 268  LEU A N   1 
ATOM   977   C CA  . LEU A  1 122 ? 17.382  22.752  83.047  1.00 48.34  ? 268  LEU A CA  1 
ATOM   978   C C   . LEU A  1 122 ? 17.421  21.442  82.272  1.00 48.34  ? 268  LEU A C   1 
ATOM   979   O O   . LEU A  1 122 ? 18.452  20.760  82.219  1.00 48.34  ? 268  LEU A O   1 
ATOM   980   C CB  . LEU A  1 122 ? 16.503  22.576  84.282  1.00 48.34  ? 268  LEU A CB  1 
ATOM   981   C CG  . LEU A  1 122 ? 16.490  23.704  85.313  1.00 48.34  ? 268  LEU A CG  1 
ATOM   982   C CD1 . LEU A  1 122 ? 15.614  23.287  86.479  1.00 48.34  ? 268  LEU A CD1 1 
ATOM   983   C CD2 . LEU A  1 122 ? 17.900  23.988  85.801  1.00 48.34  ? 268  LEU A CD2 1 
ATOM   984   N N   . LYS A  1 123 ? 16.293  21.098  81.665  1.00 39.49  ? 269  LYS A N   1 
ATOM   985   C CA  . LYS A  1 123 ? 16.179  19.868  80.905  1.00 39.49  ? 269  LYS A CA  1 
ATOM   986   C C   . LYS A  1 123 ? 17.160  19.766  79.747  1.00 39.49  ? 269  LYS A C   1 
ATOM   987   O O   . LYS A  1 123 ? 17.612  18.675  79.429  1.00 39.49  ? 269  LYS A O   1 
ATOM   988   C CB  . LYS A  1 123 ? 14.752  19.711  80.395  1.00 39.49  ? 269  LYS A CB  1 
ATOM   989   C CG  . LYS A  1 123 ? 13.780  19.125  81.427  1.00 39.49  ? 269  LYS A CG  1 
ATOM   990   C CD  . LYS A  1 123 ? 12.903  18.018  80.807  1.00 39.49  ? 269  LYS A CD  1 
ATOM   991   C CE  . LYS A  1 123 ? 12.191  17.141  81.871  1.00 39.49  ? 269  LYS A CE  1 
ATOM   992   N NZ  . LYS A  1 123 ? 11.729  15.812  81.336  1.00 39.49  ? 269  LYS A NZ  1 
ATOM   993   N N   . CYS A  1 124 ? 17.497  20.888  79.121  1.00 30.15  ? 270  CYS A N   1 
ATOM   994   C CA  . CYS A  1 124 ? 18.435  20.861  78.008  1.00 30.15  ? 270  CYS A CA  1 
ATOM   995   C C   . CYS A  1 124 ? 19.322  22.113  78.018  1.00 30.15  ? 270  CYS A C   1 
ATOM   996   O O   . CYS A  1 124 ? 19.237  22.968  77.119  1.00 30.15  ? 270  CYS A O   1 
ATOM   997   C CB  . CYS A  1 124 ? 17.658  20.771  76.704  1.00 30.15  ? 270  CYS A CB  1 
ATOM   998   S SG  . CYS A  1 124 ? 18.623  21.097  75.200  1.00 30.15  ? 270  CYS A SG  1 
ATOM   999   N N   . PRO A  1 125 ? 20.230  22.211  79.012  1.00 31.75  ? 271  PRO A N   1 
ATOM   1000  C CA  . PRO A  1 125 ? 21.120  23.373  79.131  1.00 31.75  ? 271  PRO A CA  1 
ATOM   1001  C C   . PRO A  1 125 ? 21.940  23.653  77.900  1.00 31.75  ? 271  PRO A C   1 
ATOM   1002  O O   . PRO A  1 125 ? 22.393  24.774  77.716  1.00 31.75  ? 271  PRO A O   1 
ATOM   1003  C CB  . PRO A  1 125 ? 21.987  23.065  80.349  1.00 31.75  ? 271  PRO A CB  1 
ATOM   1004  C CG  . PRO A  1 125 ? 21.864  21.602  80.551  1.00 31.75  ? 271  PRO A CG  1 
ATOM   1005  C CD  . PRO A  1 125 ? 20.510  21.197  80.042  1.00 31.75  ? 271  PRO A CD  1 
ATOM   1006  N N   . SER A  1 126 ? 22.128  22.655  77.045  1.00 51.57  ? 272  SER A N   1 
ATOM   1007  C CA  . SER A  1 126 ? 22.911  22.879  75.838  1.00 51.57  ? 272  SER A CA  1 
ATOM   1008  C C   . SER A  1 126 ? 22.147  23.816  74.896  1.00 51.57  ? 272  SER A C   1 
ATOM   1009  O O   . SER A  1 126 ? 22.639  24.178  73.824  1.00 51.57  ? 272  SER A O   1 
ATOM   1010  C CB  . SER A  1 126 ? 23.248  21.530  75.167  1.00 51.57  ? 272  SER A CB  1 
ATOM   1011  O OG  . SER A  1 126 ? 22.293  21.147  74.196  1.00 51.57  ? 272  SER A OG  1 
ATOM   1012  N N   . LEU A  1 127 ? 20.946  24.214  75.325  1.00 31.73  ? 273  LEU A N   1 
ATOM   1013  C CA  . LEU A  1 127 ? 20.078  25.113  74.551  1.00 31.73  ? 273  LEU A CA  1 
ATOM   1014  C C   . LEU A  1 127 ? 19.735  26.383  75.317  1.00 31.73  ? 273  LEU A C   1 
ATOM   1015  O O   . LEU A  1 127 ? 19.247  27.347  74.733  1.00 31.73  ? 273  LEU A O   1 
ATOM   1016  C CB  . LEU A  1 127 ? 18.773  24.415  74.171  1.00 31.73  ? 273  LEU A CB  1 
ATOM   1017  C CG  . LEU A  1 127 ? 18.699  23.963  72.714  1.00 31.73  ? 273  LEU A CG  1 
ATOM   1018  C CD1 . LEU A  1 127 ? 17.384  23.248  72.421  1.00 31.73  ? 273  LEU A CD1 1 
ATOM   1019  C CD2 . LEU A  1 127 ? 18.879  25.164  71.837  1.00 31.73  ? 273  LEU A CD2 1 
ATOM   1020  N N   . ALA A  1 128 ? 19.975  26.369  76.625  1.00 35.68  ? 274  ALA A N   1 
ATOM   1021  C CA  . ALA A  1 128 ? 19.702  27.520  77.482  1.00 35.68  ? 274  ALA A CA  1 
ATOM   1022  C C   . ALA A  1 128 ? 20.161  28.818  76.828  1.00 35.68  ? 274  ALA A C   1 
ATOM   1023  O O   . ALA A  1 128 ? 21.285  28.912  76.351  1.00 35.68  ? 274  ALA A O   1 
ATOM   1024  C CB  . ALA A  1 128 ? 20.401  27.346  78.818  1.00 35.68  ? 274  ALA A CB  1 
ATOM   1025  N N   . GLY A  1 129 ? 19.290  29.819  76.802  1.00 29.15  ? 275  GLY A N   1 
ATOM   1026  C CA  . GLY A  1 129 ? 19.660  31.082  76.189  1.00 29.15  ? 275  GLY A CA  1 
ATOM   1027  C C   . GLY A  1 129 ? 19.413  31.176  74.686  1.00 29.15  ? 275  GLY A C   1 
ATOM   1028  O O   . GLY A  1 129 ? 19.558  32.258  74.097  1.00 29.15  ? 275  GLY A O   1 
ATOM   1029  N N   . LYS A  1 130 ? 19.055  30.053  74.062  1.00 35.09  ? 276  LYS A N   1 
ATOM   1030  C CA  . LYS A  1 130 ? 18.767  30.023  72.630  1.00 35.09  ? 276  LYS A CA  1 
ATOM   1031  C C   . LYS A  1 130 ? 17.274  29.812  72.409  1.00 35.09  ? 276  LYS A C   1 
ATOM   1032  O O   . LYS A  1 130 ? 16.602  29.123  73.181  1.00 35.09  ? 276  LYS A O   1 
ATOM   1033  C CB  . LYS A  1 130 ? 19.554  28.906  71.935  1.00 35.09  ? 276  LYS A CB  1 
ATOM   1034  C CG  . LYS A  1 130 ? 20.984  28.755  72.425  1.00 35.09  ? 276  LYS A CG  1 
ATOM   1035  C CD  . LYS A  1 130 ? 21.874  28.097  71.367  1.00 35.09  ? 276  LYS A CD  1 
ATOM   1036  C CE  . LYS A  1 130 ? 23.315  27.849  71.879  1.00 35.09  ? 276  LYS A CE  1 
ATOM   1037  N NZ  . LYS A  1 130 ? 23.562  26.484  72.459  1.00 35.09  ? 276  LYS A NZ  1 
ATOM   1038  N N   . PRO A  1 131 ? 16.744  30.377  71.327  1.00 32.25  ? 277  PRO A N   1 
ATOM   1039  C CA  . PRO A  1 131 ? 15.329  30.282  70.974  1.00 32.25  ? 277  PRO A CA  1 
ATOM   1040  C C   . PRO A  1 131 ? 14.862  28.856  70.722  1.00 32.25  ? 277  PRO A C   1 
ATOM   1041  O O   . PRO A  1 131 ? 15.515  28.103  69.997  1.00 32.25  ? 277  PRO A O   1 
ATOM   1042  C CB  . PRO A  1 131 ? 15.214  31.135  69.714  1.00 32.25  ? 277  PRO A CB  1 
ATOM   1043  C CG  . PRO A  1 131 ? 16.552  31.106  69.131  1.00 32.25  ? 277  PRO A CG  1 
ATOM   1044  C CD  . PRO A  1 131 ? 17.501  31.105  70.304  1.00 32.25  ? 277  PRO A CD  1 
ATOM   1045  N N   . LYS A  1 132 ? 13.731  28.489  71.319  1.00 42.23  ? 278  LYS A N   1 
ATOM   1046  C CA  . LYS A  1 132 ? 13.160  27.168  71.130  1.00 42.23  ? 278  LYS A CA  1 
ATOM   1047  C C   . LYS A  1 132 ? 11.760  27.410  70.558  1.00 42.23  ? 278  LYS A C   1 
ATOM   1048  O O   . LYS A  1 132 ? 10.842  27.804  71.266  1.00 42.23  ? 278  LYS A O   1 
ATOM   1049  C CB  . LYS A  1 132 ? 13.112  26.425  72.468  1.00 42.23  ? 278  LYS A CB  1 
ATOM   1050  C CG  . LYS A  1 132 ? 14.433  26.462  73.203  1.00 42.23  ? 278  LYS A CG  1 
ATOM   1051  C CD  . LYS A  1 132 ? 14.308  25.899  74.599  1.00 42.23  ? 278  LYS A CD  1 
ATOM   1052  C CE  . LYS A  1 132 ? 14.875  26.862  75.659  1.00 42.23  ? 278  LYS A CE  1 
ATOM   1053  N NZ  . LYS A  1 132 ? 16.060  27.674  75.198  1.00 42.23  ? 278  LYS A NZ  1 
ATOM   1054  N N   . VAL A  1 133 ? 11.602  27.180  69.265  1.00 26.86  ? 279  VAL A N   1 
ATOM   1055  C CA  . VAL A  1 133 ? 10.336  27.420  68.611  1.00 26.86  ? 279  VAL A CA  1 
ATOM   1056  C C   . VAL A  1 133 ? 9.543   26.154  68.340  1.00 26.86  ? 279  VAL A C   1 
ATOM   1057  O O   . VAL A  1 133 ? 10.106  25.138  67.943  1.00 26.86  ? 279  VAL A O   1 
ATOM   1058  C CB  . VAL A  1 133 ? 10.581  28.111  67.271  1.00 26.86  ? 279  VAL A CB  1 
ATOM   1059  C CG1 . VAL A  1 133 ? 9.254   28.443  66.595  1.00 26.86  ? 279  VAL A CG1 1 
ATOM   1060  C CG2 . VAL A  1 133 ? 11.426  29.359  67.480  1.00 26.86  ? 279  VAL A CG2 1 
ATOM   1061  N N   . PHE A  1 134 ? 8.227   26.231  68.523  1.00 37.13  ? 280  PHE A N   1 
ATOM   1062  C CA  . PHE A  1 134 ? 7.333   25.103  68.282  1.00 37.13  ? 280  PHE A CA  1 
ATOM   1063  C C   . PHE A  1 134 ? 6.164   25.549  67.453  1.00 37.13  ? 280  PHE A C   1 
ATOM   1064  O O   . PHE A  1 134 ? 5.600   26.599  67.708  1.00 37.13  ? 280  PHE A O   1 
ATOM   1065  C CB  . PHE A  1 134 ? 6.805   24.571  69.591  1.00 37.13  ? 280  PHE A CB  1 
ATOM   1066  C CG  . PHE A  1 134 ? 7.816   23.818  70.355  1.00 37.13  ? 280  PHE A CG  1 
ATOM   1067  C CD1 . PHE A  1 134 ? 8.912   24.478  70.900  1.00 37.13  ? 280  PHE A CD1 1 
ATOM   1068  C CD2 . PHE A  1 134 ? 7.722   22.438  70.475  1.00 37.13  ? 280  PHE A CD2 1 
ATOM   1069  C CE1 . PHE A  1 134 ? 9.904   23.777  71.550  1.00 37.13  ? 280  PHE A CE1 1 
ATOM   1070  C CE2 . PHE A  1 134 ? 8.705   21.721  71.120  1.00 37.13  ? 280  PHE A CE2 1 
ATOM   1071  C CZ  . PHE A  1 134 ? 9.803   22.390  71.660  1.00 37.13  ? 280  PHE A CZ  1 
ATOM   1072  N N   . PHE A  1 135 ? 5.780   24.749  66.473  1.00 30.46  ? 281  PHE A N   1 
ATOM   1073  C CA  . PHE A  1 135 ? 4.652   25.104  65.628  1.00 30.46  ? 281  PHE A CA  1 
ATOM   1074  C C   . PHE A  1 135 ? 3.646   23.975  65.648  1.00 30.46  ? 281  PHE A C   1 
ATOM   1075  O O   . PHE A  1 135 ? 3.723   23.046  64.866  1.00 30.46  ? 281  PHE A O   1 
ATOM   1076  C CB  . PHE A  1 135 ? 5.120   25.334  64.206  1.00 30.46  ? 281  PHE A CB  1 
ATOM   1077  C CG  . PHE A  1 135 ? 5.954   26.557  64.038  1.00 30.46  ? 281  PHE A CG  1 
ATOM   1078  C CD1 . PHE A  1 135 ? 5.406   27.819  64.249  1.00 30.46  ? 281  PHE A CD1 1 
ATOM   1079  C CD2 . PHE A  1 135 ? 7.284   26.460  63.630  1.00 30.46  ? 281  PHE A CD2 1 
ATOM   1080  C CE1 . PHE A  1 135 ? 6.157   28.965  64.056  1.00 30.46  ? 281  PHE A CE1 1 
ATOM   1081  C CE2 . PHE A  1 135 ? 8.056   27.615  63.432  1.00 30.46  ? 281  PHE A CE2 1 
ATOM   1082  C CZ  . PHE A  1 135 ? 7.484   28.867  63.647  1.00 30.46  ? 281  PHE A CZ  1 
ATOM   1083  N N   . ILE A  1 136 ? 2.704   24.039  66.563  1.00 23.75  ? 282  ILE A N   1 
ATOM   1084  C CA  . ILE A  1 136 ? 1.717   22.993  66.651  1.00 23.75  ? 282  ILE A CA  1 
ATOM   1085  C C   . ILE A  1 136 ? 0.617   23.272  65.682  1.00 23.75  ? 282  ILE A C   1 
ATOM   1086  O O   . ILE A  1 136 ? 0.025   24.338  65.728  1.00 23.75  ? 282  ILE A O   1 
ATOM   1087  C CB  . ILE A  1 136 ? 1.103   22.952  68.005  1.00 23.75  ? 282  ILE A CB  1 
ATOM   1088  C CG1 . ILE A  1 136 ? 2.054   22.268  68.978  1.00 23.75  ? 282  ILE A CG1 1 
ATOM   1089  C CG2 . ILE A  1 136 ? -0.194  22.236  67.921  1.00 23.75  ? 282  ILE A CG2 1 
ATOM   1090  C CD1 . ILE A  1 136 ? 3.442   22.793  68.905  1.00 23.75  ? 282  ILE A CD1 1 
ATOM   1091  N N   . GLN A  1 137 ? 0.334   22.316  64.809  1.00 29.10  ? 283  GLN A N   1 
ATOM   1092  C CA  . GLN A  1 137 ? -0.728  22.469  63.832  1.00 29.10  ? 283  GLN A CA  1 
ATOM   1093  C C   . GLN A  1 137 ? -1.660  21.290  64.033  1.00 29.10  ? 283  GLN A C   1 
ATOM   1094  O O   . GLN A  1 137 ? -1.407  20.190  63.555  1.00 29.10  ? 283  GLN A O   1 
ATOM   1095  C CB  . GLN A  1 137 ? -0.151  22.472  62.417  1.00 29.10  ? 283  GLN A CB  1 
ATOM   1096  C CG  . GLN A  1 137 ? -1.102  21.982  61.321  1.00 29.10  ? 283  GLN A CG  1 
ATOM   1097  C CD  . GLN A  1 137 ? -2.370  22.811  61.224  1.00 29.10  ? 283  GLN A CD  1 
ATOM   1098  O OE1 . GLN A  1 137 ? -2.979  23.159  62.235  1.00 29.10  ? 283  GLN A OE1 1 
ATOM   1099  N NE2 . GLN A  1 137 ? -2.775  23.130  60.003  1.00 29.10  ? 283  GLN A NE2 1 
ATOM   1100  N N   . ALA A  1 138 ? -2.732  21.545  64.774  1.00 27.38  ? 284  ALA A N   1 
ATOM   1101  C CA  . ALA A  1 138 ? -3.731  20.547  65.105  1.00 27.38  ? 284  ALA A CA  1 
ATOM   1102  C C   . ALA A  1 138 ? -4.954  21.285  65.587  1.00 27.38  ? 284  ALA A C   1 
ATOM   1103  O O   . ALA A  1 138 ? -4.899  22.487  65.819  1.00 27.38  ? 284  ALA A O   1 
ATOM   1104  C CB  . ALA A  1 138 ? -3.209  19.634  66.220  1.00 27.38  ? 284  ALA A CB  1 
ATOM   1105  N N   . CYS A  1 139 ? -6.057  20.569  65.734  1.00 37.23  ? 285  CYS A N   1 
ATOM   1106  C CA  . CYS A  1 139 ? -7.268  21.181  66.234  1.00 37.23  ? 285  CYS A CA  1 
ATOM   1107  C C   . CYS A  1 139 ? -7.116  21.316  67.734  1.00 37.23  ? 285  CYS A C   1 
ATOM   1108  O O   . CYS A  1 139 ? -6.266  20.653  68.339  1.00 37.23  ? 285  CYS A O   1 
ATOM   1109  C CB  . CYS A  1 139 ? -8.456  20.297  65.949  1.00 37.23  ? 285  CYS A CB  1 
ATOM   1110  S SG  . CYS A  1 139 ? -9.018  20.436  64.276  1.00 37.23  ? 285  CYS A SG  1 
ATOM   1111  N N   . GLN A  1 140 ? -7.940  22.154  68.347  1.00 32.07  ? 286  GLN A N   1 
ATOM   1112  C CA  . GLN A  1 140 ? -7.851  22.329  69.781  1.00 32.07  ? 286  GLN A CA  1 
ATOM   1113  C C   . GLN A  1 140 ? -9.227  22.242  70.415  1.00 32.07  ? 286  GLN A C   1 
ATOM   1114  O O   . GLN A  1 140 ? -9.426  22.678  71.554  1.00 32.07  ? 286  GLN A O   1 
ATOM   1115  C CB  . GLN A  1 140 ? -7.181  23.666  70.099  1.00 32.07  ? 286  GLN A CB  1 
ATOM   1116  C CG  . GLN A  1 140 ? -5.648  23.620  69.990  1.00 32.07  ? 286  GLN A CG  1 
ATOM   1117  C CD  . GLN A  1 140 ? -5.004  22.767  71.085  1.00 32.07  ? 286  GLN A CD  1 
ATOM   1118  O OE1 . GLN A  1 140 ? -4.714  21.580  70.874  1.00 32.07  ? 286  GLN A OE1 1 
ATOM   1119  N NE2 . GLN A  1 140 ? -4.779  23.372  72.261  1.00 32.07  ? 286  GLN A NE2 1 
ATOM   1120  N N   . GLY A  1 141 ? -10.161 21.658  69.664  1.00 33.33  ? 287  GLY A N   1 
ATOM   1121  C CA  . GLY A  1 141 ? -11.531 21.482  70.117  1.00 33.33  ? 287  GLY A CA  1 
ATOM   1122  C C   . GLY A  1 141 ? -12.415 21.122  68.939  1.00 33.33  ? 287  GLY A C   1 
ATOM   1123  O O   . GLY A  1 141 ? -11.908 20.738  67.891  1.00 33.33  ? 287  GLY A O   1 
ATOM   1124  N N   . ASP A  1 142 ? -13.730 21.229  69.090  1.00 48.52  ? 288  ASP A N   1 
ATOM   1125  C CA  . ASP A  1 142 ? -14.626 20.912  67.983  1.00 48.52  ? 288  ASP A CA  1 
ATOM   1126  C C   . ASP A  1 142 ? -15.543 22.077  67.669  1.00 48.52  ? 288  ASP A C   1 
ATOM   1127  O O   . ASP A  1 142 ? -16.505 21.918  66.953  1.00 48.52  ? 288  ASP A O   1 
ATOM   1128  C CB  . ASP A  1 142 ? -15.472 19.686  68.303  1.00 48.52  ? 288  ASP A CB  1 
ATOM   1129  C CG  . ASP A  1 142 ? -16.229 19.843  69.585  1.00 48.52  ? 288  ASP A CG  1 
ATOM   1130  O OD1 . ASP A  1 142 ? -15.906 20.796  70.324  1.00 48.52  ? 288  ASP A OD1 1 
ATOM   1131  O OD2 . ASP A  1 142 ? -17.137 19.028  69.858  1.00 48.52  ? 288  ASP A OD2 1 
ATOM   1132  N N   . ASN A  1 143 ? -15.242 23.250  68.202  1.00 43.74  ? 289  ASN A N   1 
ATOM   1133  C CA  . ASN A  1 143 ? -16.056 24.429  67.955  1.00 43.74  ? 289  ASN A CA  1 
ATOM   1134  C C   . ASN A  1 143 ? -15.543 25.211  66.770  1.00 43.74  ? 289  ASN A C   1 
ATOM   1135  O O   . ASN A  1 143 ? -14.411 25.680  66.797  1.00 43.74  ? 289  ASN A O   1 
ATOM   1136  C CB  . ASN A  1 143 ? -16.030 25.360  69.161  1.00 43.74  ? 289  ASN A CB  1 
ATOM   1137  C CG  . ASN A  1 143 ? -16.292 24.635  70.457  1.00 43.74  ? 289  ASN A CG  1 
ATOM   1138  O OD1 . ASN A  1 143 ? -16.662 23.450  70.458  1.00 43.74  ? 289  ASN A OD1 1 
ATOM   1139  N ND2 . ASN A  1 143 ? -16.107 25.334  71.579  1.00 43.74  ? 289  ASN A ND2 1 
ATOM   1140  N N   . TYR A  1 144 ? -16.365 25.371  65.737  1.00 40.80  ? 290  TYR A N   1 
ATOM   1141  C CA  . TYR A  1 144 ? -15.953 26.142  64.574  1.00 40.80  ? 290  TYR A CA  1 
ATOM   1142  C C   . TYR A  1 144 ? -15.926 27.566  65.043  1.00 40.80  ? 290  TYR A C   1 
ATOM   1143  O O   . TYR A  1 144 ? -16.926 28.055  65.548  1.00 40.80  ? 290  TYR A O   1 
ATOM   1144  C CB  . TYR A  1 144 ? -16.962 25.993  63.450  1.00 40.80  ? 290  TYR A CB  1 
ATOM   1145  C CG  . TYR A  1 144 ? -17.019 24.593  62.931  1.00 40.80  ? 290  TYR A CG  1 
ATOM   1146  C CD1 . TYR A  1 144 ? -17.803 23.628  63.563  1.00 40.80  ? 290  TYR A CD1 1 
ATOM   1147  C CD2 . TYR A  1 144 ? -16.238 24.205  61.846  1.00 40.80  ? 290  TYR A CD2 1 
ATOM   1148  C CE1 . TYR A  1 144 ? -17.804 22.311  63.128  1.00 40.80  ? 290  TYR A CE1 1 
ATOM   1149  C CE2 . TYR A  1 144 ? -16.232 22.886  61.403  1.00 40.80  ? 290  TYR A CE2 1 
ATOM   1150  C CZ  . TYR A  1 144 ? -17.015 21.947  62.049  1.00 40.80  ? 290  TYR A CZ  1 
ATOM   1151  O OH  . TYR A  1 144 ? -17.003 20.644  61.625  1.00 40.80  ? 290  TYR A OH  1 
ATOM   1152  N N   . GLN A  1 145 ? -14.781 28.224  64.904  1.00 38.34  ? 291  GLN A N   1 
ATOM   1153  C CA  . GLN A  1 145 ? -14.656 29.610  65.331  1.00 38.34  ? 291  GLN A CA  1 
ATOM   1154  C C   . GLN A  1 145 ? -15.795 30.408  64.729  1.00 38.34  ? 291  GLN A C   1 
ATOM   1155  O O   . GLN A  1 145 ? -16.208 30.130  63.603  1.00 38.34  ? 291  GLN A O   1 
ATOM   1156  C CB  . GLN A  1 145 ? -13.330 30.190  64.864  1.00 38.34  ? 291  GLN A CB  1 
ATOM   1157  C CG  . GLN A  1 145 ? -13.185 31.683  65.162  1.00 38.34  ? 291  GLN A CG  1 
ATOM   1158  C CD  . GLN A  1 145 ? -12.838 31.970  66.615  1.00 38.34  ? 291  GLN A CD  1 
ATOM   1159  O OE1 . GLN A  1 145 ? -13.048 31.137  67.499  1.00 38.34  ? 291  GLN A OE1 1 
ATOM   1160  N NE2 . GLN A  1 145 ? -12.299 33.155  66.864  1.00 38.34  ? 291  GLN A NE2 1 
ATOM   1161  N N   . LYS A  1 146 ? -16.270 31.413  65.463  1.00 80.35  ? 292  LYS A N   1 
ATOM   1162  C CA  . LYS A  1 146 ? -17.396 32.235  65.041  1.00 80.35  ? 292  LYS A CA  1 
ATOM   1163  C C   . LYS A  1 146 ? -17.242 33.145  63.834  1.00 80.35  ? 292  LYS A C   1 
ATOM   1164  O O   . LYS A  1 146 ? -17.814 32.885  62.776  1.00 80.35  ? 292  LYS A O   1 
ATOM   1165  C CB  . LYS A  1 146 ? -17.878 33.059  66.223  1.00 80.35  ? 292  LYS A CB  1 
ATOM   1166  C CG  . LYS A  1 146 ? -18.361 32.216  67.384  1.00 80.35  ? 292  LYS A CG  1 
ATOM   1167  C CD  . LYS A  1 146 ? -19.520 31.338  66.958  1.00 80.35  ? 292  LYS A CD  1 
ATOM   1168  C CE  . LYS A  1 146 ? -20.038 30.528  68.127  1.00 80.35  ? 292  LYS A CE  1 
ATOM   1169  N NZ  . LYS A  1 146 ? -21.282 29.806  67.755  1.00 80.35  ? 292  LYS A NZ  1 
ATOM   1170  N N   . GLY A  1 147 ? -16.502 34.229  63.982  1.00 53.55  ? 293  GLY A N   1 
ATOM   1171  C CA  . GLY A  1 147 ? -16.351 35.137  62.856  1.00 53.55  ? 293  GLY A CA  1 
ATOM   1172  C C   . GLY A  1 147 ? -17.465 36.177  62.727  1.00 53.55  ? 293  GLY A C   1 
ATOM   1173  O O   . GLY A  1 147 ? -18.605 35.832  62.415  1.00 53.55  ? 293  GLY A O   1 
ATOM   1174  N N   . ILE A  1 148 ? -17.121 37.447  62.971  1.00 44.94  ? 294  ILE A N   1 
ATOM   1175  C CA  . ILE A  1 148 ? -18.052 38.577  62.902  1.00 44.94  ? 294  ILE A CA  1 
ATOM   1176  C C   . ILE A  1 148 ? -17.614 39.511  61.760  1.00 44.94  ? 294  ILE A C   1 
ATOM   1177  O O   . ILE A  1 148 ? -16.484 39.416  61.275  1.00 44.94  ? 294  ILE A O   1 
ATOM   1178  C CB  . ILE A  1 148 ? -18.111 39.348  64.267  1.00 44.94  ? 294  ILE A CB  1 
ATOM   1179  C CG1 . ILE A  1 148 ? -17.170 40.548  64.264  1.00 44.94  ? 294  ILE A CG1 1 
ATOM   1180  C CG2 . ILE A  1 148 ? -17.732 38.428  65.407  1.00 44.94  ? 294  ILE A CG2 1 
ATOM   1181  C CD1 . ILE A  1 148 ? -15.717 40.188  64.333  1.00 44.94  ? 294  ILE A CD1 1 
ATOM   1182  N N   . PRO A  1 149 ? -18.504 40.425  61.316  1.00 60.47  ? 295  PRO A N   1 
ATOM   1183  C CA  . PRO A  1 149 ? -18.221 41.365  60.229  1.00 60.47  ? 295  PRO A CA  1 
ATOM   1184  C C   . PRO A  1 149 ? -17.682 42.723  60.646  1.00 60.47  ? 295  PRO A C   1 
ATOM   1185  O O   . PRO A  1 149 ? -17.881 43.158  61.772  1.00 60.47  ? 295  PRO A O   1 
ATOM   1186  C CB  . PRO A  1 149 ? -19.566 41.497  59.524  1.00 60.47  ? 295  PRO A CB  1 
ATOM   1187  C CG  . PRO A  1 149 ? -20.604 41.089  60.579  1.00 60.47  ? 295  PRO A CG  1 
ATOM   1188  C CD  . PRO A  1 149 ? -19.869 40.631  61.820  1.00 60.47  ? 295  PRO A CD  1 
ATOM   1189  N N   . VAL A  1 150 ? -16.996 43.377  59.709  1.00 86.08  ? 296  VAL A N   1 
ATOM   1190  C CA  . VAL A  1 150 ? -16.405 44.701  59.900  1.00 86.08  ? 296  VAL A CA  1 
ATOM   1191  C C   . VAL A  1 150 ? -15.438 44.979  58.781  1.00 86.08  ? 296  VAL A C   1 
ATOM   1192  O O   . VAL A  1 150 ? -14.575 44.154  58.499  1.00 86.08  ? 296  VAL A O   1 
ATOM   1193  C CB  . VAL A  1 150 ? -15.551 44.824  61.185  1.00 86.08  ? 296  VAL A CB  1 
ATOM   1194  C CG1 . VAL A  1 150 ? -16.407 45.299  62.340  1.00 86.08  ? 296  VAL A CG1 1 
ATOM   1195  C CG2 . VAL A  1 150 ? -14.859 43.515  61.485  1.00 86.08  ? 296  VAL A CG2 1 
ATOM   1196  N N   . GLU A  1 151 ? -15.566 46.132  58.137  1.00 87.90  ? 297  GLU A N   1 
ATOM   1197  C CA  . GLU A  1 151 ? -14.609 46.461  57.096  1.00 87.90  ? 297  GLU A CA  1 
ATOM   1198  C C   . GLU A  1 151 ? -13.625 47.496  57.629  1.00 87.90  ? 297  GLU A C   1 
ATOM   1199  O O   . GLU A  1 151 ? -13.929 48.685  57.717  1.00 87.90  ? 297  GLU A O   1 
ATOM   1200  C CB  . GLU A  1 151 ? -15.292 46.996  55.830  1.00 87.90  ? 297  GLU A CB  1 
ATOM   1201  C CG  . GLU A  1 151 ? -14.327 47.634  54.779  1.00 87.90  ? 297  GLU A CG  1 
ATOM   1202  C CD  . GLU A  1 151 ? -12.903 47.048  54.766  1.00 87.90  ? 297  GLU A CD  1 
ATOM   1203  O OE1 . GLU A  1 151 ? -12.752 45.819  54.943  1.00 87.90  ? 297  GLU A OE1 1 
ATOM   1204  O OE2 . GLU A  1 151 ? -11.936 47.825  54.570  1.00 87.90  ? 297  GLU A OE2 1 
ATOM   1205  N N   . THR A  1 152 ? -12.451 47.010  58.001  1.00 100.00 ? 298  THR A N   1 
ATOM   1206  C CA  . THR A  1 152 ? -11.366 47.840  58.499  1.00 100.00 ? 298  THR A CA  1 
ATOM   1207  C C   . THR A  1 152 ? -10.217 47.406  57.561  1.00 100.00 ? 298  THR A C   1 
ATOM   1208  O O   . THR A  1 152 ? -10.415 47.394  56.338  1.00 100.00 ? 298  THR A O   1 
ATOM   1209  C CB  . THR A  1 152 ? -11.090 47.514  59.993  1.00 100.00 ? 298  THR A CB  1 
ATOM   1210  O OG1 . THR A  1 152 ? -11.430 46.144  60.254  1.00 100.00 ? 298  THR A OG1 1 
ATOM   1211  C CG2 . THR A  1 152 ? -11.946 48.402  60.903  1.00 100.00 ? 298  THR A CG2 1 
ATOM   1212  N N   . ASP A  1 153 ? -9.050  47.042  58.105  1.00 83.77  ? 299  ASP A N   1 
ATOM   1213  C CA  . ASP A  1 153 ? -7.909  46.575  57.298  1.00 83.77  ? 299  ASP A CA  1 
ATOM   1214  C C   . ASP A  1 153 ? -7.704  47.262  55.934  1.00 83.77  ? 299  ASP A C   1 
ATOM   1215  O O   . ASP A  1 153 ? -6.660  47.941  55.775  1.00 83.77  ? 299  ASP A O   1 
ATOM   1216  C CB  . ASP A  1 153 ? -8.032  45.062  57.081  1.00 83.77  ? 299  ASP A CB  1 
ATOM   1217  C CG  . ASP A  1 153 ? -9.223  44.464  57.814  1.00 83.77  ? 299  ASP A CG  1 
ATOM   1218  O OD1 . ASP A  1 153 ? -9.325  44.688  59.039  1.00 83.77  ? 299  ASP A OD1 1 
ATOM   1219  O OD2 . ASP A  1 153 ? -10.056 43.778  57.171  1.00 83.77  ? 299  ASP A OD2 1 
ATOM   1220  O OXT . ASP A  1 153 ? -8.563  47.107  55.029  1.00 83.77  ? 299  ASP A OXT 1 
ATOM   1221  N N   . THR B  2 1   ? 29.335  35.327  83.732  1.00 92.27  ? 318  THR B N   1 
ATOM   1222  C CA  . THR B  2 1   ? 28.089  34.559  83.425  1.00 92.27  ? 318  THR B CA  1 
ATOM   1223  C C   . THR B  2 1   ? 26.903  35.076  84.247  1.00 92.27  ? 318  THR B C   1 
ATOM   1224  O O   . THR B  2 1   ? 27.097  35.619  85.333  1.00 92.27  ? 318  THR B O   1 
ATOM   1225  C CB  . THR B  2 1   ? 28.285  33.050  83.699  1.00 92.27  ? 318  THR B CB  1 
ATOM   1226  O OG1 . THR B  2 1   ? 28.254  32.811  85.109  1.00 92.27  ? 318  THR B OG1 1 
ATOM   1227  C CG2 . THR B  2 1   ? 29.621  32.571  83.138  1.00 92.27  ? 318  THR B CG2 1 
ATOM   1228  N N   . ARG B  2 2   ? 25.679  34.913  83.733  1.00 100.00 ? 319  ARG B N   1 
ATOM   1229  C CA  . ARG B  2 2   ? 24.478  35.397  84.429  1.00 100.00 ? 319  ARG B CA  1 
ATOM   1230  C C   . ARG B  2 2   ? 23.340  34.380  84.512  1.00 100.00 ? 319  ARG B C   1 
ATOM   1231  O O   . ARG B  2 2   ? 23.482  33.238  84.082  1.00 100.00 ? 319  ARG B O   1 
ATOM   1232  C CB  . ARG B  2 2   ? 23.956  36.672  83.753  1.00 100.00 ? 319  ARG B CB  1 
ATOM   1233  C CG  . ARG B  2 2   ? 25.013  37.747  83.495  1.00 100.00 ? 319  ARG B CG  1 
ATOM   1234  C CD  . ARG B  2 2   ? 24.494  38.820  82.526  1.00 100.00 ? 319  ARG B CD  1 
ATOM   1235  N NE  . ARG B  2 2   ? 25.514  39.810  82.170  1.00 100.00 ? 319  ARG B NE  1 
ATOM   1236  C CZ  . ARG B  2 2   ? 25.408  40.679  81.161  1.00 100.00 ? 319  ARG B CZ  1 
ATOM   1237  N NH1 . ARG B  2 2   ? 24.325  40.693  80.389  1.00 100.00 ? 319  ARG B NH1 1 
ATOM   1238  N NH2 . ARG B  2 2   ? 26.389  41.544  80.924  1.00 100.00 ? 319  ARG B NH2 1 
ATOM   1239  N N   . TYR B  2 3   ? 22.206  34.810  85.059  1.00 49.86  ? 320  TYR B N   1 
ATOM   1240  C CA  . TYR B  2 3   ? 21.045  33.941  85.201  1.00 49.86  ? 320  TYR B CA  1 
ATOM   1241  C C   . TYR B  2 3   ? 19.755  34.446  84.551  1.00 49.86  ? 320  TYR B C   1 
ATOM   1242  O O   . TYR B  2 3   ? 19.439  35.637  84.589  1.00 49.86  ? 320  TYR B O   1 
ATOM   1243  C CB  . TYR B  2 3   ? 20.768  33.690  86.674  1.00 49.86  ? 320  TYR B CB  1 
ATOM   1244  C CG  . TYR B  2 3   ? 21.710  32.709  87.283  1.00 49.86  ? 320  TYR B CG  1 
ATOM   1245  C CD1 . TYR B  2 3   ? 21.703  31.384  86.875  1.00 49.86  ? 320  TYR B CD1 1 
ATOM   1246  C CD2 . TYR B  2 3   ? 22.659  33.113  88.209  1.00 49.86  ? 320  TYR B CD2 1 
ATOM   1247  C CE1 . TYR B  2 3   ? 22.635  30.479  87.368  1.00 49.86  ? 320  TYR B CE1 1 
ATOM   1248  C CE2 . TYR B  2 3   ? 23.595  32.226  88.710  1.00 49.86  ? 320  TYR B CE2 1 
ATOM   1249  C CZ  . TYR B  2 3   ? 23.582  30.910  88.281  1.00 49.86  ? 320  TYR B CZ  1 
ATOM   1250  O OH  . TYR B  2 3   ? 24.540  30.032  88.719  1.00 49.86  ? 320  TYR B OH  1 
ATOM   1251  N N   . ILE B  2 4   ? 19.018  33.509  83.960  1.00 45.75  ? 321  ILE B N   1 
ATOM   1252  C CA  . ILE B  2 4   ? 17.732  33.772  83.312  1.00 45.75  ? 321  ILE B CA  1 
ATOM   1253  C C   . ILE B  2 4   ? 16.752  32.652  83.700  1.00 45.75  ? 321  ILE B C   1 
ATOM   1254  O O   . ILE B  2 4   ? 17.168  31.525  83.973  1.00 45.75  ? 321  ILE B O   1 
ATOM   1255  C CB  . ILE B  2 4   ? 17.864  33.844  81.761  1.00 45.75  ? 321  ILE B CB  1 
ATOM   1256  C CG1 . ILE B  2 4   ? 18.279  32.501  81.176  1.00 45.75  ? 321  ILE B CG1 1 
ATOM   1257  C CG2 . ILE B  2 4   ? 18.894  34.882  81.377  1.00 45.75  ? 321  ILE B CG2 1 
ATOM   1258  C CD1 . ILE B  2 4   ? 18.533  32.576  79.664  1.00 45.75  ? 321  ILE B CD1 1 
ATOM   1259  N N   . PRO B  2 5   ? 15.435  32.949  83.735  1.00 66.27  ? 322  PRO B N   1 
ATOM   1260  C CA  . PRO B  2 5   ? 14.407  31.964  84.102  1.00 66.27  ? 322  PRO B CA  1 
ATOM   1261  C C   . PRO B  2 5   ? 14.359  30.700  83.245  1.00 66.27  ? 322  PRO B C   1 
ATOM   1262  O O   . PRO B  2 5   ? 14.493  30.752  82.016  1.00 66.27  ? 322  PRO B O   1 
ATOM   1263  C CB  . PRO B  2 5   ? 13.105  32.753  84.028  1.00 66.27  ? 322  PRO B CB  1 
ATOM   1264  C CG  . PRO B  2 5   ? 13.405  33.915  83.158  1.00 66.27  ? 322  PRO B CG  1 
ATOM   1265  C CD  . PRO B  2 5   ? 14.841  34.255  83.403  1.00 66.27  ? 322  PRO B CD  1 
ATOM   1266  N N   . ASP B  2 6   ? 14.152  29.571  83.922  1.00 49.51  ? 323  ASP B N   1 
ATOM   1267  C CA  . ASP B  2 6   ? 14.078  28.231  83.318  1.00 49.51  ? 323  ASP B CA  1 
ATOM   1268  C C   . ASP B  2 6   ? 13.333  28.153  81.990  1.00 49.51  ? 323  ASP B C   1 
ATOM   1269  O O   . ASP B  2 6   ? 13.770  27.475  81.058  1.00 49.51  ? 323  ASP B O   1 
ATOM   1270  C CB  . ASP B  2 6   ? 13.414  27.269  84.312  1.00 49.51  ? 323  ASP B CB  1 
ATOM   1271  C CG  . ASP B  2 6   ? 13.615  25.816  83.951  1.00 49.51  ? 323  ASP B CG  1 
ATOM   1272  O OD1 . ASP B  2 6   ? 14.603  25.511  83.248  1.00 49.51  ? 323  ASP B OD1 1 
ATOM   1273  O OD2 . ASP B  2 6   ? 12.785  24.979  84.380  1.00 49.51  ? 323  ASP B OD2 1 
ATOM   1274  N N   . GLU B  2 7   ? 12.209  28.860  81.921  1.00 47.02  ? 324  GLU B N   1 
ATOM   1275  C CA  . GLU B  2 7   ? 11.352  28.867  80.740  1.00 47.02  ? 324  GLU B CA  1 
ATOM   1276  C C   . GLU B  2 7   ? 11.543  29.990  79.724  1.00 47.02  ? 324  GLU B C   1 
ATOM   1277  O O   . GLU B  2 7   ? 10.673  30.219  78.887  1.00 47.02  ? 324  GLU B O   1 
ATOM   1278  C CB  . GLU B  2 7   ? 9.897   28.848  81.188  1.00 47.02  ? 324  GLU B CB  1 
ATOM   1279  C CG  . GLU B  2 7   ? 9.344   27.456  81.332  1.00 47.02  ? 324  GLU B CG  1 
ATOM   1280  C CD  . GLU B  2 7   ? 8.178   27.386  82.285  1.00 47.02  ? 324  GLU B CD  1 
ATOM   1281  O OE1 . GLU B  2 7   ? 8.359   27.670  83.488  1.00 47.02  ? 324  GLU B OE1 1 
ATOM   1282  O OE2 . GLU B  2 7   ? 7.071   27.047  81.825  1.00 47.02  ? 324  GLU B OE2 1 
ATOM   1283  N N   . ALA B  2 8   ? 12.671  30.680  79.772  1.00 29.67  ? 325  ALA B N   1 
ATOM   1284  C CA  . ALA B  2 8   ? 12.897  31.755  78.832  1.00 29.67  ? 325  ALA B CA  1 
ATOM   1285  C C   . ALA B  2 8   ? 13.112  31.257  77.402  1.00 29.67  ? 325  ALA B C   1 
ATOM   1286  O O   . ALA B  2 8   ? 13.328  30.066  77.172  1.00 29.67  ? 325  ALA B O   1 
ATOM   1287  C CB  . ALA B  2 8   ? 14.072  32.546  79.272  1.00 29.67  ? 325  ALA B CB  1 
ATOM   1288  N N   . ASP B  2 9   ? 13.034  32.192  76.454  1.00 29.63  ? 326  ASP B N   1 
ATOM   1289  C CA  . ASP B  2 9   ? 13.253  31.966  75.019  1.00 29.63  ? 326  ASP B CA  1 
ATOM   1290  C C   . ASP B  2 9   ? 12.405  30.933  74.272  1.00 29.63  ? 326  ASP B C   1 
ATOM   1291  O O   . ASP B  2 9   ? 12.882  30.274  73.352  1.00 29.63  ? 326  ASP B O   1 
ATOM   1292  C CB  . ASP B  2 9   ? 14.743  31.698  74.793  1.00 29.63  ? 326  ASP B CB  1 
ATOM   1293  C CG  . ASP B  2 9   ? 15.616  32.397  75.829  1.00 29.63  ? 326  ASP B CG  1 
ATOM   1294  O OD1 . ASP B  2 9   ? 15.851  33.622  75.685  1.00 29.63  ? 326  ASP B OD1 1 
ATOM   1295  O OD2 . ASP B  2 9   ? 16.053  31.715  76.792  1.00 29.63  ? 326  ASP B OD2 1 
ATOM   1296  N N   . PHE B  2 10  ? 11.137  30.812  74.642  1.00 37.50  ? 327  PHE B N   1 
ATOM   1297  C CA  . PHE B  2 10  ? 10.243  29.869  73.973  1.00 37.50  ? 327  PHE B CA  1 
ATOM   1298  C C   . PHE B  2 10  ? 9.296   30.621  73.066  1.00 37.50  ? 327  PHE B C   1 
ATOM   1299  O O   . PHE B  2 10  ? 8.988   31.781  73.308  1.00 37.50  ? 327  PHE B O   1 
ATOM   1300  C CB  . PHE B  2 10  ? 9.385   29.128  74.983  1.00 37.50  ? 327  PHE B CB  1 
ATOM   1301  C CG  . PHE B  2 10  ? 10.009  27.875  75.514  1.00 37.50  ? 327  PHE B CG  1 
ATOM   1302  C CD1 . PHE B  2 10  ? 9.900   26.677  74.808  1.00 37.50  ? 327  PHE B CD1 1 
ATOM   1303  C CD2 . PHE B  2 10  ? 10.686  27.884  76.740  1.00 37.50  ? 327  PHE B CD2 1 
ATOM   1304  C CE1 . PHE B  2 10  ? 10.452  25.510  75.316  1.00 37.50  ? 327  PHE B CE1 1 
ATOM   1305  C CE2 . PHE B  2 10  ? 11.241  26.731  77.257  1.00 37.50  ? 327  PHE B CE2 1 
ATOM   1306  C CZ  . PHE B  2 10  ? 11.126  25.544  76.549  1.00 37.50  ? 327  PHE B CZ  1 
ATOM   1307  N N   . LEU B  2 11  ? 8.829   29.961  72.018  1.00 23.57  ? 328  LEU B N   1 
ATOM   1308  C CA  . LEU B  2 11  ? 7.860   30.570  71.114  1.00 23.57  ? 328  LEU B CA  1 
ATOM   1309  C C   . LEU B  2 11  ? 6.936   29.471  70.610  1.00 23.57  ? 328  LEU B C   1 
ATOM   1310  O O   . LEU B  2 11  ? 7.359   28.586  69.858  1.00 23.57  ? 328  LEU B O   1 
ATOM   1311  C CB  . LEU B  2 11  ? 8.519   31.253  69.916  1.00 23.57  ? 328  LEU B CB  1 
ATOM   1312  C CG  . LEU B  2 11  ? 7.483   31.656  68.847  1.00 23.57  ? 328  LEU B CG  1 
ATOM   1313  C CD1 . LEU B  2 11  ? 6.367   32.443  69.512  1.00 23.57  ? 328  LEU B CD1 1 
ATOM   1314  C CD2 . LEU B  2 11  ? 8.100   32.492  67.752  1.00 23.57  ? 328  LEU B CD2 1 
ATOM   1315  N N   . LEU B  2 12  ? 5.678   29.531  71.030  1.00 31.87  ? 329  LEU B N   1 
ATOM   1316  C CA  . LEU B  2 12  ? 4.706   28.540  70.637  1.00 31.87  ? 329  LEU B CA  1 
ATOM   1317  C C   . LEU B  2 12  ? 3.793   29.157  69.616  1.00 31.87  ? 329  LEU B C   1 
ATOM   1318  O O   . LEU B  2 12  ? 3.213   30.210  69.859  1.00 31.87  ? 329  LEU B O   1 
ATOM   1319  C CB  . LEU B  2 12  ? 3.890   28.106  71.848  1.00 31.87  ? 329  LEU B CB  1 
ATOM   1320  C CG  . LEU B  2 12  ? 2.768   27.097  71.637  1.00 31.87  ? 329  LEU B CG  1 
ATOM   1321  C CD1 . LEU B  2 12  ? 2.966   26.278  70.335  1.00 31.87  ? 329  LEU B CD1 1 
ATOM   1322  C CD2 . LEU B  2 12  ? 2.750   26.202  72.853  1.00 31.87  ? 329  LEU B CD2 1 
ATOM   1323  N N   . GLY B  2 13  ? 3.656   28.499  68.478  1.00 27.85  ? 330  GLY B N   1 
ATOM   1324  C CA  . GLY B  2 13  ? 2.795   29.026  67.452  1.00 27.85  ? 330  GLY B CA  1 
ATOM   1325  C C   . GLY B  2 13  ? 1.629   28.094  67.258  1.00 27.85  ? 330  GLY B C   1 
ATOM   1326  O O   . GLY B  2 13  ? 1.704   27.198  66.433  1.00 27.85  ? 330  GLY B O   1 
ATOM   1327  N N   . MET B  2 14  ? 0.562   28.287  68.027  1.00 31.77  ? 331  MET B N   1 
ATOM   1328  C CA  . MET B  2 14  ? -0.638  27.465  67.907  1.00 31.77  ? 331  MET B CA  1 
ATOM   1329  C C   . MET B  2 14  ? -1.364  27.877  66.650  1.00 31.77  ? 331  MET B C   1 
ATOM   1330  O O   . MET B  2 14  ? -1.467  29.061  66.371  1.00 31.77  ? 331  MET B O   1 
ATOM   1331  C CB  . MET B  2 14  ? -1.555  27.704  69.096  1.00 31.77  ? 331  MET B CB  1 
ATOM   1332  C CG  . MET B  2 14  ? -1.074  27.062  70.360  1.00 31.77  ? 331  MET B CG  1 
ATOM   1333  S SD  . MET B  2 14  ? -0.580  25.406  69.979  1.00 31.77  ? 331  MET B SD  1 
ATOM   1334  C CE  . MET B  2 14  ? -2.159  24.511  70.131  1.00 31.77  ? 331  MET B CE  1 
ATOM   1335  N N   . ALA B  2 15  ? -1.860  26.913  65.889  1.00 33.32  ? 332  ALA B N   1 
ATOM   1336  C CA  . ALA B  2 15  ? -2.589  27.223  64.661  1.00 33.32  ? 332  ALA B CA  1 
ATOM   1337  C C   . ALA B  2 15  ? -4.033  27.668  64.953  1.00 33.32  ? 332  ALA B C   1 
ATOM   1338  O O   . ALA B  2 15  ? -4.788  27.998  64.031  1.00 33.32  ? 332  ALA B O   1 
ATOM   1339  C CB  . ALA B  2 15  ? -2.611  26.008  63.758  1.00 33.32  ? 332  ALA B CB  1 
ATOM   1340  N N   . THR B  2 16  ? -4.413  27.679  66.231  1.00 29.49  ? 333  THR B N   1 
ATOM   1341  C CA  . THR B  2 16  ? -5.764  28.053  66.617  1.00 29.49  ? 333  THR B CA  1 
ATOM   1342  C C   . THR B  2 16  ? -5.925  28.267  68.114  1.00 29.49  ? 333  THR B C   1 
ATOM   1343  O O   . THR B  2 16  ? -5.161  27.738  68.923  1.00 29.49  ? 333  THR B O   1 
ATOM   1344  C CB  . THR B  2 16  ? -6.771  26.966  66.210  1.00 29.49  ? 333  THR B CB  1 
ATOM   1345  O OG1 . THR B  2 16  ? -8.072  27.315  66.698  1.00 29.49  ? 333  THR B OG1 1 
ATOM   1346  C CG2 . THR B  2 16  ? -6.372  25.620  66.805  1.00 29.49  ? 333  THR B CG2 1 
ATOM   1347  N N   . VAL B  2 17  ? -6.926  29.059  68.477  1.00 26.22  ? 334  VAL B N   1 
ATOM   1348  C CA  . VAL B  2 17  ? -7.199  29.301  69.877  1.00 26.22  ? 334  VAL B CA  1 
ATOM   1349  C C   . VAL B  2 17  ? -7.837  28.000  70.387  1.00 26.22  ? 334  VAL B C   1 
ATOM   1350  O O   . VAL B  2 17  ? -8.146  27.105  69.589  1.00 26.22  ? 334  VAL B O   1 
ATOM   1351  C CB  . VAL B  2 17  ? -8.154  30.496  70.067  1.00 26.22  ? 334  VAL B CB  1 
ATOM   1352  C CG1 . VAL B  2 17  ? -7.522  31.755  69.474  1.00 26.22  ? 334  VAL B CG1 1 
ATOM   1353  C CG2 . VAL B  2 17  ? -9.499  30.201  69.429  1.00 26.22  ? 334  VAL B CG2 1 
ATOM   1354  N N   . ASN B  2 18  ? -8.026  27.887  71.702  1.00 38.70  ? 335  ASN B N   1 
ATOM   1355  C CA  . ASN B  2 18  ? -8.575  26.681  72.298  1.00 38.70  ? 335  ASN B CA  1 
ATOM   1356  C C   . ASN B  2 18  ? -9.999  26.287  71.894  1.00 38.70  ? 335  ASN B C   1 
ATOM   1357  O O   . ASN B  2 18  ? -10.735 27.065  71.287  1.00 38.70  ? 335  ASN B O   1 
ATOM   1358  C CB  . ASN B  2 18  ? -8.480  26.783  73.814  1.00 38.70  ? 335  ASN B CB  1 
ATOM   1359  C CG  . ASN B  2 18  ? -7.678  25.650  74.418  1.00 38.70  ? 335  ASN B CG  1 
ATOM   1360  O OD1 . ASN B  2 18  ? -8.229  24.619  74.802  1.00 38.70  ? 335  ASN B OD1 1 
ATOM   1361  N ND2 . ASN B  2 18  ? -6.366  25.826  74.491  1.00 38.70  ? 335  ASN B ND2 1 
ATOM   1362  N N   . ASN B  2 19  ? -10.367 25.054  72.236  1.00 46.68  ? 336  ASN B N   1 
ATOM   1363  C CA  . ASN B  2 19  ? -11.686 24.494  71.943  1.00 46.68  ? 336  ASN B CA  1 
ATOM   1364  C C   . ASN B  2 19  ? -12.184 24.684  70.511  1.00 46.68  ? 336  ASN B C   1 
ATOM   1365  O O   . ASN B  2 19  ? -13.353 24.416  70.237  1.00 46.68  ? 336  ASN B O   1 
ATOM   1366  C CB  . ASN B  2 19  ? -12.751 25.050  72.904  1.00 46.68  ? 336  ASN B CB  1 
ATOM   1367  C CG  . ASN B  2 19  ? -12.177 25.469  74.244  1.00 46.68  ? 336  ASN B CG  1 
ATOM   1368  O OD1 . ASN B  2 19  ? -11.770 26.612  74.427  1.00 46.68  ? 336  ASN B OD1 1 
ATOM   1369  N ND2 . ASN B  2 19  ? -12.145 24.543  75.190  1.00 46.68  ? 336  ASN B ND2 1 
ATOM   1370  N N   . CYS B  2 20  ? -11.322 25.130  69.597  1.00 41.51  ? 337  CYS B N   1 
ATOM   1371  C CA  . CYS B  2 20  ? -11.735 25.332  68.205  1.00 41.51  ? 337  CYS B CA  1 
ATOM   1372  C C   . CYS B  2 20  ? -10.968 24.493  67.187  1.00 41.51  ? 337  CYS B C   1 
ATOM   1373  O O   . CYS B  2 20  ? -9.865  24.011  67.446  1.00 41.51  ? 337  CYS B O   1 
ATOM   1374  C CB  . CYS B  2 20  ? -11.620 26.803  67.834  1.00 41.51  ? 337  CYS B CB  1 
ATOM   1375  S SG  . CYS B  2 20  ? -12.694 27.858  68.834  1.00 41.51  ? 337  CYS B SG  1 
ATOM   1376  N N   . VAL B  2 21  ? -11.567 24.320  66.020  1.00 42.61  ? 338  VAL B N   1 
ATOM   1377  C CA  . VAL B  2 21  ? -10.961 23.537  64.957  1.00 42.61  ? 338  VAL B CA  1 
ATOM   1378  C C   . VAL B  2 21  ? -9.947  24.371  64.183  1.00 42.61  ? 338  VAL B C   1 
ATOM   1379  O O   . VAL B  2 21  ? -9.892  25.594  64.352  1.00 42.61  ? 338  VAL B O   1 
ATOM   1380  C CB  . VAL B  2 21  ? -12.051 23.044  63.994  1.00 42.61  ? 338  VAL B CB  1 
ATOM   1381  C CG1 . VAL B  2 21  ? -13.188 22.438  64.786  1.00 42.61  ? 338  VAL B CG1 1 
ATOM   1382  C CG2 . VAL B  2 21  ? -12.578 24.190  63.170  1.00 42.61  ? 338  VAL B CG2 1 
ATOM   1383  N N   . SER B  2 22  ? -9.125  23.709  63.370  1.00 23.52  ? 339  SER B N   1 
ATOM   1384  C CA  . SER B  2 22  ? -8.156  24.397  62.517  1.00 23.52  ? 339  SER B CA  1 
ATOM   1385  C C   . SER B  2 22  ? -8.366  23.659  61.204  1.00 23.52  ? 339  SER B C   1 
ATOM   1386  O O   . SER B  2 22  ? -8.697  22.473  61.212  1.00 23.52  ? 339  SER B O   1 
ATOM   1387  C CB  . SER B  2 22  ? -6.715  24.277  63.052  1.00 23.52  ? 339  SER B CB  1 
ATOM   1388  O OG  . SER B  2 22  ? -6.231  22.956  63.007  1.00 23.52  ? 339  SER B OG  1 
ATOM   1389  N N   . TYR B  2 23  ? -8.212  24.355  60.086  1.00 33.14  ? 340  TYR B N   1 
ATOM   1390  C CA  . TYR B  2 23  ? -8.484  23.758  58.799  1.00 33.14  ? 340  TYR B CA  1 
ATOM   1391  C C   . TYR B  2 23  ? -7.322  23.290  57.992  1.00 33.14  ? 340  TYR B C   1 
ATOM   1392  O O   . TYR B  2 23  ? -6.259  23.887  57.993  1.00 33.14  ? 340  TYR B O   1 
ATOM   1393  C CB  . TYR B  2 23  ? -9.315  24.711  57.951  1.00 33.14  ? 340  TYR B CB  1 
ATOM   1394  C CG  . TYR B  2 23  ? -10.657 25.071  58.571  1.00 33.14  ? 340  TYR B CG  1 
ATOM   1395  C CD1 . TYR B  2 23  ? -10.768 26.143  59.466  1.00 33.14  ? 340  TYR B CD1 1 
ATOM   1396  C CD2 . TYR B  2 23  ? -11.811 24.339  58.265  1.00 33.14  ? 340  TYR B CD2 1 
ATOM   1397  C CE1 . TYR B  2 23  ? -11.984 26.477  60.036  1.00 33.14  ? 340  TYR B CE1 1 
ATOM   1398  C CE2 . TYR B  2 23  ? -13.031 24.666  58.828  1.00 33.14  ? 340  TYR B CE2 1 
ATOM   1399  C CZ  . TYR B  2 23  ? -13.113 25.736  59.717  1.00 33.14  ? 340  TYR B CZ  1 
ATOM   1400  O OH  . TYR B  2 23  ? -14.316 26.078  60.301  1.00 33.14  ? 340  TYR B OH  1 
ATOM   1401  N N   . ARG B  2 24  ? -7.576  22.215  57.265  1.00 31.74  ? 341  ARG B N   1 
ATOM   1402  C CA  . ARG B  2 24  ? -6.606  21.566  56.413  1.00 31.74  ? 341  ARG B CA  1 
ATOM   1403  C C   . ARG B  2 24  ? -7.232  21.209  55.055  1.00 31.74  ? 341  ARG B C   1 
ATOM   1404  O O   . ARG B  2 24  ? -8.118  20.352  54.980  1.00 31.74  ? 341  ARG B O   1 
ATOM   1405  C CB  . ARG B  2 24  ? -6.112  20.288  57.098  1.00 31.74  ? 341  ARG B CB  1 
ATOM   1406  C CG  . ARG B  2 24  ? -5.262  19.385  56.208  1.00 31.74  ? 341  ARG B CG  1 
ATOM   1407  C CD  . ARG B  2 24  ? -5.132  17.998  56.782  1.00 31.74  ? 341  ARG B CD  1 
ATOM   1408  N NE  . ARG B  2 24  ? -6.213  17.147  56.334  1.00 31.74  ? 341  ARG B NE  1 
ATOM   1409  C CZ  . ARG B  2 24  ? -7.018  16.490  57.151  1.00 31.74  ? 341  ARG B CZ  1 
ATOM   1410  N NH1 . ARG B  2 24  ? -6.857  16.590  58.473  1.00 31.74  ? 341  ARG B NH1 1 
ATOM   1411  N NH2 . ARG B  2 24  ? -7.992  15.739  56.643  1.00 31.74  ? 341  ARG B NH2 1 
ATOM   1412  N N   . ASN B  2 25  ? -6.764  21.860  53.990  1.00 38.86  ? 342  ASN B N   1 
ATOM   1413  C CA  . ASN B  2 25  ? -7.267  21.592  52.651  1.00 38.86  ? 342  ASN B CA  1 
ATOM   1414  C C   . ASN B  2 25  ? -6.419  20.496  52.050  1.00 38.86  ? 342  ASN B C   1 
ATOM   1415  O O   . ASN B  2 25  ? -5.231  20.704  51.800  1.00 38.86  ? 342  ASN B O   1 
ATOM   1416  C CB  . ASN B  2 25  ? -7.156  22.832  51.764  1.00 38.86  ? 342  ASN B CB  1 
ATOM   1417  C CG  . ASN B  2 25  ? -7.483  22.535  50.311  1.00 38.86  ? 342  ASN B CG  1 
ATOM   1418  O OD1 . ASN B  2 25  ? -7.923  21.445  49.976  1.00 38.86  ? 342  ASN B OD1 1 
ATOM   1419  N ND2 . ASN B  2 25  ? -7.268  23.506  49.448  1.00 38.86  ? 342  ASN B ND2 1 
ATOM   1420  N N   . PRO B  2 26  ? -7.014  19.322  51.783  1.00 36.36  ? 343  PRO B N   1 
ATOM   1421  C CA  . PRO B  2 26  ? -6.238  18.223  51.200  1.00 36.36  ? 343  PRO B CA  1 
ATOM   1422  C C   . PRO B  2 26  ? -5.575  18.662  49.903  1.00 36.36  ? 343  PRO B C   1 
ATOM   1423  O O   . PRO B  2 26  ? -4.575  18.092  49.497  1.00 36.36  ? 343  PRO B O   1 
ATOM   1424  C CB  . PRO B  2 26  ? -7.277  17.132  50.957  1.00 36.36  ? 343  PRO B CB  1 
ATOM   1425  C CG  . PRO B  2 26  ? -8.413  17.477  51.836  1.00 36.36  ? 343  PRO B CG  1 
ATOM   1426  C CD  . PRO B  2 26  ? -8.428  18.962  51.970  1.00 36.36  ? 343  PRO B CD  1 
ATOM   1427  N N   . ALA B  2 27  ? -6.142  19.688  49.271  1.00 49.81  ? 344  ALA B N   1 
ATOM   1428  C CA  . ALA B  2 27  ? -5.624  20.209  48.013  1.00 49.81  ? 344  ALA B CA  1 
ATOM   1429  C C   . ALA B  2 27  ? -4.309  20.947  48.155  1.00 49.81  ? 344  ALA B C   1 
ATOM   1430  O O   . ALA B  2 27  ? -3.342  20.612  47.475  1.00 49.81  ? 344  ALA B O   1 
ATOM   1431  C CB  . ALA B  2 27  ? -6.635  21.126  47.370  1.00 49.81  ? 344  ALA B CB  1 
ATOM   1432  N N   . GLU B  2 28  ? -4.262  21.954  49.027  1.00 53.52  ? 345  GLU B N   1 
ATOM   1433  C CA  . GLU B  2 28  ? -3.029  22.730  49.183  1.00 53.52  ? 345  GLU B CA  1 
ATOM   1434  C C   . GLU B  2 28  ? -2.367  22.655  50.537  1.00 53.52  ? 345  GLU B C   1 
ATOM   1435  O O   . GLU B  2 28  ? -1.327  23.267  50.750  1.00 53.52  ? 345  GLU B O   1 
ATOM   1436  C CB  . GLU B  2 28  ? -3.271  24.210  48.842  1.00 53.52  ? 345  GLU B CB  1 
ATOM   1437  C CG  . GLU B  2 28  ? -4.727  24.603  48.731  1.00 53.52  ? 345  GLU B CG  1 
ATOM   1438  C CD  . GLU B  2 28  ? -5.135  24.952  47.300  1.00 53.52  ? 345  GLU B CD  1 
ATOM   1439  O OE1 . GLU B  2 28  ? -4.316  25.567  46.586  1.00 53.52  ? 345  GLU B OE1 1 
ATOM   1440  O OE2 . GLU B  2 28  ? -6.274  24.616  46.894  1.00 53.52  ? 345  GLU B OE2 1 
ATOM   1441  N N   . GLY B  2 29  ? -2.955  21.904  51.452  1.00 45.66  ? 346  GLY B N   1 
ATOM   1442  C CA  . GLY B  2 29  ? -2.372  21.814  52.776  1.00 45.66  ? 346  GLY B CA  1 
ATOM   1443  C C   . GLY B  2 29  ? -3.258  22.536  53.773  1.00 45.66  ? 346  GLY B C   1 
ATOM   1444  O O   . GLY B  2 29  ? -4.471  22.647  53.539  1.00 45.66  ? 346  GLY B O   1 
ATOM   1445  N N   . THR B  2 30  ? -2.670  23.035  54.865  1.00 34.03  ? 347  THR B N   1 
ATOM   1446  C CA  . THR B  2 30  ? -3.447  23.731  55.892  1.00 34.03  ? 347  THR B CA  1 
ATOM   1447  C C   . THR B  2 30  ? -3.320  25.250  55.891  1.00 34.03  ? 347  THR B C   1 
ATOM   1448  O O   . THR B  2 30  ? -2.277  25.807  55.565  1.00 34.03  ? 347  THR B O   1 
ATOM   1449  C CB  . THR B  2 30  ? -3.089  23.231  57.292  1.00 34.03  ? 347  THR B CB  1 
ATOM   1450  O OG1 . THR B  2 30  ? -1.746  23.600  57.612  1.00 34.03  ? 347  THR B OG1 1 
ATOM   1451  C CG2 . THR B  2 30  ? -3.205  21.734  57.357  1.00 34.03  ? 347  THR B CG2 1 
ATOM   1452  N N   . TRP B  2 31  ? -4.393  25.917  56.284  1.00 41.59  ? 348  TRP B N   1 
ATOM   1453  C CA  . TRP B  2 31  ? -4.404  27.361  56.317  1.00 41.59  ? 348  TRP B CA  1 
ATOM   1454  C C   . TRP B  2 31  ? -3.222  27.937  57.066  1.00 41.59  ? 348  TRP B C   1 
ATOM   1455  O O   . TRP B  2 31  ? -2.578  28.857  56.575  1.00 41.59  ? 348  TRP B O   1 
ATOM   1456  C CB  . TRP B  2 31  ? -5.680  27.870  56.978  1.00 41.59  ? 348  TRP B CB  1 
ATOM   1457  C CG  . TRP B  2 31  ? -6.938  27.621  56.205  1.00 41.59  ? 348  TRP B CG  1 
ATOM   1458  C CD1 . TRP B  2 31  ? -7.055  26.966  55.024  1.00 41.59  ? 348  TRP B CD1 1 
ATOM   1459  C CD2 . TRP B  2 31  ? -8.266  28.009  56.586  1.00 41.59  ? 348  TRP B CD2 1 
ATOM   1460  N NE1 . TRP B  2 31  ? -8.372  26.917  54.639  1.00 41.59  ? 348  TRP B NE1 1 
ATOM   1461  C CE2 . TRP B  2 31  ? -9.138  27.551  55.580  1.00 41.59  ? 348  TRP B CE2 1 
ATOM   1462  C CE3 . TRP B  2 31  ? -8.801  28.701  57.680  1.00 41.59  ? 348  TRP B CE3 1 
ATOM   1463  C CZ2 . TRP B  2 31  ? -10.520 27.758  55.630  1.00 41.59  ? 348  TRP B CZ2 1 
ATOM   1464  C CZ3 . TRP B  2 31  ? -10.174 28.906  57.732  1.00 41.59  ? 348  TRP B CZ3 1 
ATOM   1465  C CH2 . TRP B  2 31  ? -11.018 28.436  56.707  1.00 41.59  ? 348  TRP B CH2 1 
ATOM   1466  N N   . TYR B  2 32  ? -2.953  27.397  58.254  1.00 38.38  ? 349  TYR B N   1 
ATOM   1467  C CA  . TYR B  2 32  ? -1.868  27.876  59.128  1.00 38.38  ? 349  TYR B CA  1 
ATOM   1468  C C   . TYR B  2 32  ? -0.454  27.627  58.625  1.00 38.38  ? 349  TYR B C   1 
ATOM   1469  O O   . TYR B  2 32  ? 0.299   28.567  58.379  1.00 38.38  ? 349  TYR B O   1 
ATOM   1470  C CB  . TYR B  2 32  ? -2.001  27.263  60.525  1.00 38.38  ? 349  TYR B CB  1 
ATOM   1471  C CG  . TYR B  2 32  ? -0.943  27.734  61.494  1.00 38.38  ? 349  TYR B CG  1 
ATOM   1472  C CD1 . TYR B  2 32  ? -0.762  29.084  61.741  1.00 38.38  ? 349  TYR B CD1 1 
ATOM   1473  C CD2 . TYR B  2 32  ? -0.122  26.827  62.165  1.00 38.38  ? 349  TYR B CD2 1 
ATOM   1474  C CE1 . TYR B  2 32  ? 0.212   29.522  62.634  1.00 38.38  ? 349  TYR B CE1 1 
ATOM   1475  C CE2 . TYR B  2 32  ? 0.851   27.255  63.054  1.00 38.38  ? 349  TYR B CE2 1 
ATOM   1476  C CZ  . TYR B  2 32  ? 1.013   28.600  63.283  1.00 38.38  ? 349  TYR B CZ  1 
ATOM   1477  O OH  . TYR B  2 32  ? 1.973   29.038  64.162  1.00 38.38  ? 349  TYR B OH  1 
ATOM   1478  N N   . ILE B  2 33  ? -0.081  26.361  58.488  1.00 25.39  ? 350  ILE B N   1 
ATOM   1479  C CA  . ILE B  2 33  ? 1.251   26.018  58.023  1.00 25.39  ? 350  ILE B CA  1 
ATOM   1480  C C   . ILE B  2 33  ? 1.554   26.673  56.684  1.00 25.39  ? 350  ILE B C   1 
ATOM   1481  O O   . ILE B  2 33  ? 2.559   27.363  56.537  1.00 25.39  ? 350  ILE B O   1 
ATOM   1482  C CB  . ILE B  2 33  ? 1.399   24.527  57.854  1.00 25.39  ? 350  ILE B CB  1 
ATOM   1483  C CG1 . ILE B  2 33  ? 1.307   23.823  59.215  1.00 25.39  ? 350  ILE B CG1 1 
ATOM   1484  C CG2 . ILE B  2 33  ? 2.703   24.245  57.170  1.00 25.39  ? 350  ILE B CG2 1 
ATOM   1485  C CD1 . ILE B  2 33  ? 2.254   24.358  60.277  1.00 25.39  ? 350  ILE B CD1 1 
ATOM   1486  N N   . GLN B  2 34  ? 0.688   26.450  55.703  1.00 37.66  ? 351  GLN B N   1 
ATOM   1487  C CA  . GLN B  2 34  ? 0.882   27.048  54.386  1.00 37.66  ? 351  GLN B CA  1 
ATOM   1488  C C   . GLN B  2 34  ? 1.102   28.556  54.523  1.00 37.66  ? 351  GLN B C   1 
ATOM   1489  O O   . GLN B  2 34  ? 2.010   29.128  53.927  1.00 37.66  ? 351  GLN B O   1 
ATOM   1490  C CB  . GLN B  2 34  ? -0.341  26.803  53.494  1.00 37.66  ? 351  GLN B CB  1 
ATOM   1491  C CG  . GLN B  2 34  ? -0.489  25.382  52.962  1.00 37.66  ? 351  GLN B CG  1 
ATOM   1492  C CD  . GLN B  2 34  ? 0.838   24.759  52.585  1.00 37.66  ? 351  GLN B CD  1 
ATOM   1493  O OE1 . GLN B  2 34  ? 1.559   25.290  51.753  1.00 37.66  ? 351  GLN B OE1 1 
ATOM   1494  N NE2 . GLN B  2 34  ? 1.167   23.622  53.203  1.00 37.66  ? 351  GLN B NE2 1 
ATOM   1495  N N   . SER B  2 35  ? 0.272   29.201  55.324  1.00 33.58  ? 352  SER B N   1 
ATOM   1496  C CA  . SER B  2 35  ? 0.388   30.634  55.495  1.00 33.58  ? 352  SER B CA  1 
ATOM   1497  C C   . SER B  2 35  ? 1.633   31.018  56.270  1.00 33.58  ? 352  SER B C   1 
ATOM   1498  O O   . SER B  2 35  ? 2.199   32.075  56.037  1.00 33.58  ? 352  SER B O   1 
ATOM   1499  C CB  . SER B  2 35  ? -0.848  31.179  56.202  1.00 33.58  ? 352  SER B CB  1 
ATOM   1500  O OG  . SER B  2 35  ? -0.747  32.581  56.325  1.00 33.58  ? 352  SER B OG  1 
ATOM   1501  N N   . LEU B  2 36  ? 2.056   30.171  57.199  1.00 27.75  ? 353  LEU B N   1 
ATOM   1502  C CA  . LEU B  2 36  ? 3.243   30.473  57.981  1.00 27.75  ? 353  LEU B CA  1 
ATOM   1503  C C   . LEU B  2 36  ? 4.467   30.440  57.077  1.00 27.75  ? 353  LEU B C   1 
ATOM   1504  O O   . LEU B  2 36  ? 5.298   31.357  57.107  1.00 27.75  ? 353  LEU B O   1 
ATOM   1505  C CB  . LEU B  2 36  ? 3.426   29.460  59.119  1.00 27.75  ? 353  LEU B CB  1 
ATOM   1506  C CG  . LEU B  2 36  ? 4.828   29.355  59.752  1.00 27.75  ? 353  LEU B CG  1 
ATOM   1507  C CD1 . LEU B  2 36  ? 5.355   30.741  60.036  1.00 27.75  ? 353  LEU B CD1 1 
ATOM   1508  C CD2 . LEU B  2 36  ? 4.794   28.561  61.061  1.00 27.75  ? 353  LEU B CD2 1 
ATOM   1509  N N   . CYS B  2 37  ? 4.580   29.378  56.282  1.00 39.82  ? 354  CYS B N   1 
ATOM   1510  C CA  . CYS B  2 37  ? 5.708   29.225  55.376  1.00 39.82  ? 354  CYS B CA  1 
ATOM   1511  C C   . CYS B  2 37  ? 5.722   30.353  54.362  1.00 39.82  ? 354  CYS B C   1 
ATOM   1512  O O   . CYS B  2 37  ? 6.705   31.091  54.253  1.00 39.82  ? 354  CYS B O   1 
ATOM   1513  C CB  . CYS B  2 37  ? 5.620   27.887  54.660  1.00 39.82  ? 354  CYS B CB  1 
ATOM   1514  S SG  . CYS B  2 37  ? 5.650   26.543  55.811  1.00 39.82  ? 354  CYS B SG  1 
ATOM   1515  N N   . GLN B  2 38  ? 4.625   30.485  53.629  1.00 77.62  ? 355  GLN B N   1 
ATOM   1516  C CA  . GLN B  2 38  ? 4.511   31.525  52.626  1.00 77.62  ? 355  GLN B CA  1 
ATOM   1517  C C   . GLN B  2 38  ? 5.099   32.820  53.143  1.00 77.62  ? 355  GLN B C   1 
ATOM   1518  O O   . GLN B  2 38  ? 5.962   33.419  52.506  1.00 77.62  ? 355  GLN B O   1 
ATOM   1519  C CB  . GLN B  2 38  ? 3.053   31.754  52.268  1.00 77.62  ? 355  GLN B CB  1 
ATOM   1520  C CG  . GLN B  2 38  ? 2.832   32.931  51.336  1.00 77.62  ? 355  GLN B CG  1 
ATOM   1521  C CD  . GLN B  2 38  ? 1.538   32.803  50.537  1.00 77.62  ? 355  GLN B CD  1 
ATOM   1522  O OE1 . GLN B  2 38  ? 1.311   31.793  49.863  1.00 77.62  ? 355  GLN B OE1 1 
ATOM   1523  N NE2 . GLN B  2 38  ? 0.682   33.823  50.610  1.00 77.62  ? 355  GLN B NE2 1 
ATOM   1524  N N   . SER B  2 39  ? 4.636   33.250  54.310  1.00 56.04  ? 356  SER B N   1 
ATOM   1525  C CA  . SER B  2 39  ? 5.122   34.487  54.904  1.00 56.04  ? 356  SER B CA  1 
ATOM   1526  C C   . SER B  2 39  ? 6.592   34.413  55.233  1.00 56.04  ? 356  SER B C   1 
ATOM   1527  O O   . SER B  2 39  ? 7.327   35.334  54.920  1.00 56.04  ? 356  SER B O   1 
ATOM   1528  C CB  . SER B  2 39  ? 4.339   34.826  56.160  1.00 56.04  ? 356  SER B CB  1 
ATOM   1529  O OG  . SER B  2 39  ? 2.968   34.934  55.836  1.00 56.04  ? 356  SER B OG  1 
ATOM   1530  N N   . LEU B  2 40  ? 7.029   33.329  55.864  1.00 26.25  ? 357  LEU B N   1 
ATOM   1531  C CA  . LEU B  2 40  ? 8.445   33.187  56.197  1.00 26.25  ? 357  LEU B CA  1 
ATOM   1532  C C   . LEU B  2 40  ? 9.287   33.447  54.966  1.00 26.25  ? 357  LEU B C   1 
ATOM   1533  O O   . LEU B  2 40  ? 10.266  34.191  55.025  1.00 26.25  ? 357  LEU B O   1 
ATOM   1534  C CB  . LEU B  2 40  ? 8.751   31.788  56.699  1.00 26.25  ? 357  LEU B CB  1 
ATOM   1535  C CG  . LEU B  2 40  ? 8.259   31.503  58.109  1.00 26.25  ? 357  LEU B CG  1 
ATOM   1536  C CD1 . LEU B  2 40  ? 7.863   30.073  58.151  1.00 26.25  ? 357  LEU B CD1 1 
ATOM   1537  C CD2 . LEU B  2 40  ? 9.329   31.793  59.144  1.00 26.25  ? 357  LEU B CD2 1 
ATOM   1538  N N   . ARG B  2 41  ? 8.901   32.840  53.852  1.00 69.88  ? 358  ARG B N   1 
ATOM   1539  C CA  . ARG B  2 41  ? 9.630   33.019  52.612  1.00 69.88  ? 358  ARG B CA  1 
ATOM   1540  C C   . ARG B  2 41  ? 9.740   34.495  52.244  1.00 69.88  ? 358  ARG B C   1 
ATOM   1541  O O   . ARG B  2 41  ? 10.838  35.041  52.166  1.00 69.88  ? 358  ARG B O   1 
ATOM   1542  C CB  . ARG B  2 41  ? 8.935   32.275  51.475  1.00 69.88  ? 358  ARG B CB  1 
ATOM   1543  C CG  . ARG B  2 41  ? 8.572   30.838  51.789  1.00 69.88  ? 358  ARG B CG  1 
ATOM   1544  C CD  . ARG B  2 41  ? 7.772   30.203  50.652  1.00 69.88  ? 358  ARG B CD  1 
ATOM   1545  N NE  . ARG B  2 41  ? 8.377   28.960  50.179  1.00 69.88  ? 358  ARG B NE  1 
ATOM   1546  C CZ  . ARG B  2 41  ? 9.524   28.890  49.504  1.00 69.88  ? 358  ARG B CZ  1 
ATOM   1547  N NH1 . ARG B  2 41  ? 10.205  29.993  49.215  1.00 69.88  ? 358  ARG B NH1 1 
ATOM   1548  N NH2 . ARG B  2 41  ? 9.994   27.707  49.121  1.00 69.88  ? 358  ARG B NH2 1 
ATOM   1549  N N   . GLU B  2 42  ? 8.595   35.136  52.028  1.00 60.86  ? 359  GLU B N   1 
ATOM   1550  C CA  . GLU B  2 42  ? 8.546   36.543  51.636  1.00 60.86  ? 359  GLU B CA  1 
ATOM   1551  C C   . GLU B  2 42  ? 9.090   37.546  52.643  1.00 60.86  ? 359  GLU B C   1 
ATOM   1552  O O   . GLU B  2 42  ? 9.481   38.643  52.260  1.00 60.86  ? 359  GLU B O   1 
ATOM   1553  C CB  . GLU B  2 42  ? 7.108   36.945  51.307  1.00 60.86  ? 359  GLU B CB  1 
ATOM   1554  C CG  . GLU B  2 42  ? 6.500   36.225  50.103  1.00 60.86  ? 359  GLU B CG  1 
ATOM   1555  C CD  . GLU B  2 42  ? 4.969   36.368  50.023  1.00 60.86  ? 359  GLU B CD  1 
ATOM   1556  O OE1 . GLU B  2 42  ? 4.430   37.374  50.552  1.00 60.86  ? 359  GLU B OE1 1 
ATOM   1557  O OE2 . GLU B  2 42  ? 4.308   35.473  49.431  1.00 60.86  ? 359  GLU B OE2 1 
ATOM   1558  N N   . ARG B  2 43  ? 9.129   37.188  53.923  1.00 50.97  ? 360  ARG B N   1 
ATOM   1559  C CA  . ARG B  2 43  ? 9.581   38.138  54.934  1.00 50.97  ? 360  ARG B CA  1 
ATOM   1560  C C   . ARG B  2 43  ? 10.970  37.991  55.512  1.00 50.97  ? 360  ARG B C   1 
ATOM   1561  O O   . ARG B  2 43  ? 11.662  38.981  55.667  1.00 50.97  ? 360  ARG B O   1 
ATOM   1562  C CB  . ARG B  2 43  ? 8.591   38.175  56.095  1.00 50.97  ? 360  ARG B CB  1 
ATOM   1563  C CG  . ARG B  2 43  ? 7.137   38.368  55.686  1.00 50.97  ? 360  ARG B CG  1 
ATOM   1564  C CD  . ARG B  2 43  ? 6.869   39.788  55.253  1.00 50.97  ? 360  ARG B CD  1 
ATOM   1565  N NE  . ARG B  2 43  ? 5.653   40.311  55.862  1.00 50.97  ? 360  ARG B NE  1 
ATOM   1566  C CZ  . ARG B  2 43  ? 5.630   41.338  56.709  1.00 50.97  ? 360  ARG B CZ  1 
ATOM   1567  N NH1 . ARG B  2 43  ? 6.765   41.949  57.045  1.00 50.97  ? 360  ARG B NH1 1 
ATOM   1568  N NH2 . ARG B  2 43  ? 4.477   41.759  57.223  1.00 50.97  ? 360  ARG B NH2 1 
ATOM   1569  N N   . CYS B  2 44  ? 11.372  36.775  55.852  1.00 45.69  ? 361  CYS B N   1 
ATOM   1570  C CA  . CYS B  2 44  ? 12.680  36.563  56.446  1.00 45.69  ? 361  CYS B CA  1 
ATOM   1571  C C   . CYS B  2 44  ? 13.817  37.271  55.697  1.00 45.69  ? 361  CYS B C   1 
ATOM   1572  O O   . CYS B  2 44  ? 14.686  37.903  56.313  1.00 45.69  ? 361  CYS B O   1 
ATOM   1573  C CB  . CYS B  2 44  ? 12.943  35.067  56.561  1.00 45.69  ? 361  CYS B CB  1 
ATOM   1574  S SG  . CYS B  2 44  ? 11.754  34.224  57.640  1.00 45.69  ? 361  CYS B SG  1 
ATOM   1575  N N   . PRO B  2 45  ? 13.845  37.158  54.359  1.00 59.02  ? 362  PRO B N   1 
ATOM   1576  C CA  . PRO B  2 45  ? 14.919  37.840  53.637  1.00 59.02  ? 362  PRO B CA  1 
ATOM   1577  C C   . PRO B  2 45  ? 14.966  39.312  54.053  1.00 59.02  ? 362  PRO B C   1 
ATOM   1578  O O   . PRO B  2 45  ? 16.015  39.800  54.481  1.00 59.02  ? 362  PRO B O   1 
ATOM   1579  C CB  . PRO B  2 45  ? 14.544  37.666  52.161  1.00 59.02  ? 362  PRO B CB  1 
ATOM   1580  C CG  . PRO B  2 45  ? 13.164  37.108  52.145  1.00 59.02  ? 362  PRO B CG  1 
ATOM   1581  C CD  . PRO B  2 45  ? 12.962  36.410  53.452  1.00 59.02  ? 362  PRO B CD  1 
ATOM   1582  N N   . ARG B  2 46  B 13.829  40.003  53.939  1.00 59.27  ? 362  ARG B N   1 
ATOM   1583  C CA  . ARG B  2 46  B 13.731  41.419  54.314  1.00 59.27  ? 362  ARG B CA  1 
ATOM   1584  C C   . ARG B  2 46  B 14.419  41.656  55.647  1.00 59.27  ? 362  ARG B C   1 
ATOM   1585  O O   . ARG B  2 46  B 15.324  42.466  55.741  1.00 59.27  ? 362  ARG B O   1 
ATOM   1586  C CB  . ARG B  2 46  B 12.272  41.864  54.438  1.00 59.27  ? 362  ARG B CB  1 
ATOM   1587  C CG  . ARG B  2 46  B 11.387  41.476  53.271  1.00 59.27  ? 362  ARG B CG  1 
ATOM   1588  C CD  . ARG B  2 46  B 10.259  42.489  53.039  1.00 59.27  ? 362  ARG B CD  1 
ATOM   1589  N NE  . ARG B  2 46  B 9.352   42.039  51.977  1.00 59.27  ? 362  ARG B NE  1 
ATOM   1590  C CZ  . ARG B  2 46  B 9.711   41.820  50.707  1.00 59.27  ? 362  ARG B CZ  1 
ATOM   1591  N NH1 . ARG B  2 46  B 10.968  42.008  50.313  1.00 59.27  ? 362  ARG B NH1 1 
ATOM   1592  N NH2 . ARG B  2 46  B 8.809   41.401  49.826  1.00 59.27  ? 362  ARG B NH2 1 
ATOM   1593  N N   . GLY B  2 47  ? 13.979  40.948  56.678  1.00 44.92  ? 363  GLY B N   1 
ATOM   1594  C CA  . GLY B  2 47  ? 14.583  41.086  57.987  1.00 44.92  ? 363  GLY B CA  1 
ATOM   1595  C C   . GLY B  2 47  ? 13.557  41.053  59.098  1.00 44.92  ? 363  GLY B C   1 
ATOM   1596  O O   . GLY B  2 47  ? 13.926  41.091  60.276  1.00 44.92  ? 363  GLY B O   1 
ATOM   1597  N N   . ASP B  2 48  ? 12.275  40.978  58.723  1.00 48.25  ? 364  ASP B N   1 
ATOM   1598  C CA  . ASP B  2 48  ? 11.158  40.951  59.670  1.00 48.25  ? 364  ASP B CA  1 
ATOM   1599  C C   . ASP B  2 48  ? 11.285  39.965  60.832  1.00 48.25  ? 364  ASP B C   1 
ATOM   1600  O O   . ASP B  2 48  ? 11.540  38.778  60.651  1.00 48.25  ? 364  ASP B O   1 
ATOM   1601  C CB  . ASP B  2 48  ? 9.860   40.686  58.920  1.00 48.25  ? 364  ASP B CB  1 
ATOM   1602  C CG  . ASP B  2 48  ? 9.661   41.638  57.764  1.00 48.25  ? 364  ASP B CG  1 
ATOM   1603  O OD1 . ASP B  2 48  ? 9.609   42.861  58.006  1.00 48.25  ? 364  ASP B OD1 1 
ATOM   1604  O OD2 . ASP B  2 48  ? 9.557   41.167  56.611  1.00 48.25  ? 364  ASP B OD2 1 
ATOM   1605  N N   . ASP B  2 49  ? 11.103  40.489  62.037  1.00 48.81  ? 365  ASP B N   1 
ATOM   1606  C CA  . ASP B  2 49  ? 11.190  39.691  63.240  1.00 48.81  ? 365  ASP B CA  1 
ATOM   1607  C C   . ASP B  2 49  ? 10.059  38.676  63.204  1.00 48.81  ? 365  ASP B C   1 
ATOM   1608  O O   . ASP B  2 49  ? 8.977   38.988  62.733  1.00 48.81  ? 365  ASP B O   1 
ATOM   1609  C CB  . ASP B  2 49  ? 11.079  40.608  64.458  1.00 48.81  ? 365  ASP B CB  1 
ATOM   1610  C CG  . ASP B  2 49  ? 10.051  40.141  65.458  1.00 48.81  ? 365  ASP B CG  1 
ATOM   1611  O OD1 . ASP B  2 49  ? 10.137  38.979  65.926  1.00 48.81  ? 365  ASP B OD1 1 
ATOM   1612  O OD2 . ASP B  2 49  ? 9.161   40.956  65.780  1.00 48.81  ? 365  ASP B OD2 1 
ATOM   1613  N N   . ILE B  2 50  ? 10.317  37.468  63.695  1.00 37.57  ? 366  ILE B N   1 
ATOM   1614  C CA  . ILE B  2 50  ? 9.325   36.403  63.692  1.00 37.57  ? 366  ILE B CA  1 
ATOM   1615  C C   . ILE B  2 50  ? 7.974   36.793  64.266  1.00 37.57  ? 366  ILE B C   1 
ATOM   1616  O O   . ILE B  2 50  ? 6.946   36.293  63.811  1.00 37.57  ? 366  ILE B O   1 
ATOM   1617  C CB  . ILE B  2 50  ? 9.837   35.161  64.443  1.00 37.57  ? 366  ILE B CB  1 
ATOM   1618  C CG1 . ILE B  2 50  ? 9.642   33.920  63.569  1.00 37.57  ? 366  ILE B CG1 1 
ATOM   1619  C CG2 . ILE B  2 50  ? 9.129   35.012  65.796  1.00 37.57  ? 366  ILE B CG2 1 
ATOM   1620  C CD1 . ILE B  2 50  ? 8.222   33.513  63.381  1.00 37.57  ? 366  ILE B CD1 1 
ATOM   1621  N N   . LEU B  2 51  ? 7.952   37.660  65.275  1.00 38.62  ? 367  LEU B N   1 
ATOM   1622  C CA  . LEU B  2 51  ? 6.665   38.075  65.828  1.00 38.62  ? 367  LEU B CA  1 
ATOM   1623  C C   . LEU B  2 51  ? 5.909   38.767  64.705  1.00 38.62  ? 367  LEU B C   1 
ATOM   1624  O O   . LEU B  2 51  ? 4.739   38.503  64.475  1.00 38.62  ? 367  LEU B O   1 
ATOM   1625  C CB  . LEU B  2 51  ? 6.855   39.038  66.990  1.00 38.62  ? 367  LEU B CB  1 
ATOM   1626  C CG  . LEU B  2 51  ? 6.707   38.451  68.393  1.00 38.62  ? 367  LEU B CG  1 
ATOM   1627  C CD1 . LEU B  2 51  ? 6.540   36.943  68.328  1.00 38.62  ? 367  LEU B CD1 1 
ATOM   1628  C CD2 . LEU B  2 51  ? 7.932   38.815  69.211  1.00 38.62  ? 367  LEU B CD2 1 
ATOM   1629  N N   . THR B  2 52  ? 6.599   39.655  64.001  1.00 38.39  ? 368  THR B N   1 
ATOM   1630  C CA  . THR B  2 52  ? 6.012   40.364  62.870  1.00 38.39  ? 368  THR B CA  1 
ATOM   1631  C C   . THR B  2 52  ? 5.420   39.345  61.885  1.00 38.39  ? 368  THR B C   1 
ATOM   1632  O O   . THR B  2 52  ? 4.244   39.409  61.552  1.00 38.39  ? 368  THR B O   1 
ATOM   1633  C CB  . THR B  2 52  ? 7.081   41.199  62.121  1.00 38.39  ? 368  THR B CB  1 
ATOM   1634  O OG1 . THR B  2 52  ? 7.628   42.179  63.008  1.00 38.39  ? 368  THR B OG1 1 
ATOM   1635  C CG2 . THR B  2 52  ? 6.487   41.870  60.903  1.00 38.39  ? 368  THR B CG2 1 
ATOM   1636  N N   . ILE B  2 53  ? 6.233   38.402  61.417  1.00 42.66  ? 369  ILE B N   1 
ATOM   1637  C CA  . ILE B  2 53  ? 5.739   37.413  60.469  1.00 42.66  ? 369  ILE B CA  1 
ATOM   1638  C C   . ILE B  2 53  ? 4.550   36.688  61.062  1.00 42.66  ? 369  ILE B C   1 
ATOM   1639  O O   . ILE B  2 53  ? 3.544   36.507  60.400  1.00 42.66  ? 369  ILE B O   1 
ATOM   1640  C CB  . ILE B  2 53  ? 6.819   36.355  60.101  1.00 42.66  ? 369  ILE B CB  1 
ATOM   1641  C CG1 . ILE B  2 53  ? 7.955   37.002  59.308  1.00 42.66  ? 369  ILE B CG1 1 
ATOM   1642  C CG2 . ILE B  2 53  ? 6.210   35.266  59.213  1.00 42.66  ? 369  ILE B CG2 1 
ATOM   1643  C CD1 . ILE B  2 53  ? 9.136   37.428  60.159  1.00 42.66  ? 369  ILE B CD1 1 
ATOM   1644  N N   . LEU B  2 54  ? 4.663   36.281  62.319  1.00 25.80  ? 370  LEU B N   1 
ATOM   1645  C CA  . LEU B  2 54  ? 3.579   35.559  62.964  1.00 25.80  ? 370  LEU B CA  1 
ATOM   1646  C C   . LEU B  2 54  ? 2.309   36.386  63.022  1.00 25.80  ? 370  LEU B C   1 
ATOM   1647  O O   . LEU B  2 54  ? 1.223   35.829  62.968  1.00 25.80  ? 370  LEU B O   1 
ATOM   1648  C CB  . LEU B  2 54  ? 3.975   35.130  64.374  1.00 25.80  ? 370  LEU B CB  1 
ATOM   1649  C CG  . LEU B  2 54  ? 4.570   33.726  64.517  1.00 25.80  ? 370  LEU B CG  1 
ATOM   1650  C CD1 . LEU B  2 54  ? 4.661   33.341  66.006  1.00 25.80  ? 370  LEU B CD1 1 
ATOM   1651  C CD2 . LEU B  2 54  ? 3.739   32.737  63.724  1.00 25.80  ? 370  LEU B CD2 1 
ATOM   1652  N N   . THR B  2 55  ? 2.436   37.707  63.132  1.00 38.18  ? 371  THR B N   1 
ATOM   1653  C CA  . THR B  2 55  ? 1.265   38.587  63.178  1.00 38.18  ? 371  THR B CA  1 
ATOM   1654  C C   . THR B  2 55  ? 0.532   38.556  61.857  1.00 38.18  ? 371  THR B C   1 
ATOM   1655  O O   . THR B  2 55  ? -0.689  38.444  61.809  1.00 38.18  ? 371  THR B O   1 
ATOM   1656  C CB  . THR B  2 55  ? 1.646   40.039  63.430  1.00 38.18  ? 371  THR B CB  1 
ATOM   1657  O OG1 . THR B  2 55  ? 2.292   40.143  64.701  1.00 38.18  ? 371  THR B OG1 1 
ATOM   1658  C CG2 . THR B  2 55  ? 0.408   40.911  63.419  1.00 38.18  ? 371  THR B CG2 1 
ATOM   1659  N N   . GLU B  2 56  ? 1.295   38.673  60.781  1.00 53.65  ? 372  GLU B N   1 
ATOM   1660  C CA  . GLU B  2 56  ? 0.742   38.659  59.441  1.00 53.65  ? 372  GLU B CA  1 
ATOM   1661  C C   . GLU B  2 56  ? 0.015   37.351  59.188  1.00 53.65  ? 372  GLU B C   1 
ATOM   1662  O O   . GLU B  2 56  ? -1.022  37.334  58.534  1.00 53.65  ? 372  GLU B O   1 
ATOM   1663  C CB  . GLU B  2 56  ? 1.862   38.834  58.427  1.00 53.65  ? 372  GLU B CB  1 
ATOM   1664  C CG  . GLU B  2 56  ? 1.535   38.346  57.044  1.00 53.65  ? 372  GLU B CG  1 
ATOM   1665  C CD  . GLU B  2 56  ? 2.521   38.885  56.046  1.00 53.65  ? 372  GLU B CD  1 
ATOM   1666  O OE1 . GLU B  2 56  ? 2.629   40.126  55.952  1.00 53.65  ? 372  GLU B OE1 1 
ATOM   1667  O OE2 . GLU B  2 56  ? 3.199   38.077  55.372  1.00 53.65  ? 372  GLU B OE2 1 
ATOM   1668  N N   . VAL B  2 57  ? 0.565   36.254  59.698  1.00 32.99  ? 373  VAL B N   1 
ATOM   1669  C CA  . VAL B  2 57  ? -0.062  34.960  59.517  1.00 32.99  ? 373  VAL B CA  1 
ATOM   1670  C C   . VAL B  2 57  ? -1.395  34.994  60.241  1.00 32.99  ? 373  VAL B C   1 
ATOM   1671  O O   . VAL B  2 57  ? -2.355  34.360  59.812  1.00 32.99  ? 373  VAL B O   1 
ATOM   1672  C CB  . VAL B  2 57  ? 0.772   33.845  60.109  1.00 32.99  ? 373  VAL B CB  1 
ATOM   1673  C CG1 . VAL B  2 57  ? 0.036   32.517  59.960  1.00 32.99  ? 373  VAL B CG1 1 
ATOM   1674  C CG2 . VAL B  2 57  ? 2.111   33.806  59.431  1.00 32.99  ? 373  VAL B CG2 1 
ATOM   1675  N N   . ASN B  2 58  ? -1.451  35.726  61.352  1.00 35.20  ? 374  ASN B N   1 
ATOM   1676  C CA  . ASN B  2 58  ? -2.691  35.855  62.105  1.00 35.20  ? 374  ASN B CA  1 
ATOM   1677  C C   . ASN B  2 58  ? -3.646  36.545  61.137  1.00 35.20  ? 374  ASN B C   1 
ATOM   1678  O O   . ASN B  2 58  ? -4.799  36.162  61.003  1.00 35.20  ? 374  ASN B O   1 
ATOM   1679  C CB  . ASN B  2 58  ? -2.485  36.715  63.365  1.00 35.20  ? 374  ASN B CB  1 
ATOM   1680  C CG  . ASN B  2 58  ? -2.243  35.880  64.604  1.00 35.20  ? 374  ASN B CG  1 
ATOM   1681  O OD1 . ASN B  2 58  ? -2.186  34.657  64.531  1.00 35.20  ? 374  ASN B OD1 1 
ATOM   1682  N ND2 . ASN B  2 58  ? -2.098  36.530  65.745  1.00 35.20  ? 374  ASN B ND2 1 
ATOM   1683  N N   . TYR B  2 59  ? -3.146  37.547  60.431  1.00 61.39  ? 375  TYR B N   1 
ATOM   1684  C CA  . TYR B  2 59  ? -3.967  38.262  59.477  1.00 61.39  ? 375  TYR B CA  1 
ATOM   1685  C C   . TYR B  2 59  ? -4.486  37.371  58.353  1.00 61.39  ? 375  TYR B C   1 
ATOM   1686  O O   . TYR B  2 59  ? -5.668  37.047  58.319  1.00 61.39  ? 375  TYR B O   1 
ATOM   1687  C CB  . TYR B  2 59  ? -3.176  39.410  58.876  1.00 61.39  ? 375  TYR B CB  1 
ATOM   1688  C CG  . TYR B  2 59  ? -3.999  40.325  57.999  1.00 61.39  ? 375  TYR B CG  1 
ATOM   1689  C CD1 . TYR B  2 59  ? -5.347  40.566  58.273  1.00 61.39  ? 375  TYR B CD1 1 
ATOM   1690  C CD2 . TYR B  2 59  ? -3.415  41.002  56.923  1.00 61.39  ? 375  TYR B CD2 1 
ATOM   1691  C CE1 . TYR B  2 59  ? -6.089  41.466  57.497  1.00 61.39  ? 375  TYR B CE1 1 
ATOM   1692  C CE2 . TYR B  2 59  ? -4.149  41.903  56.144  1.00 61.39  ? 375  TYR B CE2 1 
ATOM   1693  C CZ  . TYR B  2 59  ? -5.477  42.134  56.434  1.00 61.39  ? 375  TYR B CZ  1 
ATOM   1694  O OH  . TYR B  2 59  ? -6.176  43.042  55.668  1.00 61.39  ? 375  TYR B OH  1 
ATOM   1695  N N   . GLU B  2 60  ? -3.604  36.985  57.432  1.00 72.16  ? 376  GLU B N   1 
ATOM   1696  C CA  . GLU B  2 60  ? -3.980  36.145  56.292  1.00 72.16  ? 376  GLU B CA  1 
ATOM   1697  C C   . GLU B  2 60  ? -4.969  35.044  56.639  1.00 72.16  ? 376  GLU B C   1 
ATOM   1698  O O   . GLU B  2 60  ? -5.970  34.856  55.950  1.00 72.16  ? 376  GLU B O   1 
ATOM   1699  C CB  . GLU B  2 60  ? -2.749  35.493  55.663  1.00 72.16  ? 376  GLU B CB  1 
ATOM   1700  C CG  . GLU B  2 60  ? -1.569  36.414  55.495  1.00 72.16  ? 376  GLU B CG  1 
ATOM   1701  C CD  . GLU B  2 60  ? -1.860  37.576  54.551  1.00 72.16  ? 376  GLU B CD  1 
ATOM   1702  O OE1 . GLU B  2 60  ? -2.645  37.391  53.588  1.00 72.16  ? 376  GLU B OE1 1 
ATOM   1703  O OE2 . GLU B  2 60  ? -1.298  38.677  54.774  1.00 72.16  ? 376  GLU B OE2 1 
ATOM   1704  N N   . VAL B  2 61  ? -4.690  34.312  57.708  1.00 39.14  ? 377  VAL B N   1 
ATOM   1705  C CA  . VAL B  2 61  ? -5.568  33.224  58.088  1.00 39.14  ? 377  VAL B CA  1 
ATOM   1706  C C   . VAL B  2 61  ? -6.947  33.744  58.519  1.00 39.14  ? 377  VAL B C   1 
ATOM   1707  O O   . VAL B  2 61  ? -7.963  33.068  58.336  1.00 39.14  ? 377  VAL B O   1 
ATOM   1708  C CB  . VAL B  2 61  ? -4.932  32.357  59.228  1.00 39.14  ? 377  VAL B CB  1 
ATOM   1709  C CG1 . VAL B  2 61  ? -5.736  31.093  59.443  1.00 39.14  ? 377  VAL B CG1 1 
ATOM   1710  C CG2 . VAL B  2 61  ? -3.514  31.980  58.861  1.00 39.14  ? 377  VAL B CG2 1 
ATOM   1711  N N   . SER B  2 62  ? -6.997  34.952  59.069  1.00 42.38  ? 378  SER B N   1 
ATOM   1712  C CA  . SER B  2 62  ? -8.267  35.484  59.529  1.00 42.38  ? 378  SER B CA  1 
ATOM   1713  C C   . SER B  2 62  ? -9.210  35.784  58.401  1.00 42.38  ? 378  SER B C   1 
ATOM   1714  O O   . SER B  2 62  ? -10.427 35.737  58.585  1.00 42.38  ? 378  SER B O   1 
ATOM   1715  C CB  . SER B  2 62  ? -8.057  36.736  60.352  1.00 42.38  ? 378  SER B CB  1 
ATOM   1716  O OG  . SER B  2 62  ? -7.526  36.385  61.616  1.00 42.38  ? 378  SER B OG  1 
ATOM   1717  N N   . ASN B  2 63  ? -8.665  36.073  57.226  1.00 56.17  ? 379  ASN B N   1 
ATOM   1718  C CA  . ASN B  2 63  ? -9.505  36.393  56.087  1.00 56.17  ? 379  ASN B CA  1 
ATOM   1719  C C   . ASN B  2 63  ? -10.049 35.180  55.348  1.00 56.17  ? 379  ASN B C   1 
ATOM   1720  O O   . ASN B  2 63  ? -10.879 35.316  54.446  1.00 56.17  ? 379  ASN B O   1 
ATOM   1721  C CB  . ASN B  2 63  ? -8.749  37.323  55.158  1.00 56.17  ? 379  ASN B CB  1 
ATOM   1722  C CG  . ASN B  2 63  ? -8.641  38.719  55.732  1.00 56.17  ? 379  ASN B CG  1 
ATOM   1723  O OD1 . ASN B  2 63  ? -9.154  38.999  56.825  1.00 56.17  ? 379  ASN B OD1 1 
ATOM   1724  N ND2 . ASN B  2 63  ? -7.977  39.607  55.007  1.00 56.17  ? 379  ASN B ND2 1 
ATOM   1725  N N   . LYS B  2 64  ? -9.590  33.995  55.736  1.00 35.01  ? 381  LYS B N   1 
ATOM   1726  C CA  . LYS B  2 64  ? -10.076 32.755  55.138  1.00 35.01  ? 381  LYS B CA  1 
ATOM   1727  C C   . LYS B  2 64  ? -11.456 32.462  55.748  1.00 35.01  ? 381  LYS B C   1 
ATOM   1728  O O   . LYS B  2 64  ? -11.744 32.896  56.864  1.00 35.01  ? 381  LYS B O   1 
ATOM   1729  C CB  . LYS B  2 64  ? -9.113  31.617  55.445  1.00 35.01  ? 381  LYS B CB  1 
ATOM   1730  C CG  . LYS B  2 64  ? -7.808  31.705  54.692  1.00 35.01  ? 381  LYS B CG  1 
ATOM   1731  C CD  . LYS B  2 64  ? -7.785  30.705  53.543  1.00 35.01  ? 381  LYS B CD  1 
ATOM   1732  C CE  . LYS B  2 64  ? -6.432  30.708  52.845  1.00 35.01  ? 381  LYS B CE  1 
ATOM   1733  N NZ  . LYS B  2 64  ? -5.430  31.532  53.592  1.00 35.01  ? 381  LYS B NZ  1 
ATOM   1734  N N   . ASP B  2 65  A -12.307 31.732  55.029  1.00 53.09  ? 381  ASP B N   1 
ATOM   1735  C CA  . ASP B  2 65  A -13.661 31.429  55.513  1.00 53.09  ? 381  ASP B CA  1 
ATOM   1736  C C   . ASP B  2 65  A -14.092 29.996  55.204  1.00 53.09  ? 381  ASP B C   1 
ATOM   1737  O O   . ASP B  2 65  A -13.798 29.478  54.137  1.00 53.09  ? 381  ASP B O   1 
ATOM   1738  C CB  . ASP B  2 65  A -14.674 32.386  54.862  1.00 53.09  ? 381  ASP B CB  1 
ATOM   1739  C CG  . ASP B  2 65  A -14.918 33.648  55.685  1.00 53.09  ? 381  ASP B CG  1 
ATOM   1740  O OD1 . ASP B  2 65  A -15.801 33.611  56.571  1.00 53.09  ? 381  ASP B OD1 1 
ATOM   1741  O OD2 . ASP B  2 65  A -14.240 34.679  55.446  1.00 53.09  ? 381  ASP B OD2 1 
ATOM   1742  N N   . ASP B  2 66  B -14.777 29.349  56.141  1.00 46.20  ? 381  ASP B N   1 
ATOM   1743  C CA  . ASP B  2 66  B -15.285 27.985  55.916  1.00 46.20  ? 381  ASP B CA  1 
ATOM   1744  C C   . ASP B  2 66  B -16.771 28.168  55.583  1.00 46.20  ? 381  ASP B C   1 
ATOM   1745  O O   . ASP B  2 66  B -17.655 27.608  56.238  1.00 46.20  ? 381  ASP B O   1 
ATOM   1746  C CB  . ASP B  2 66  B -15.130 27.106  57.170  1.00 46.20  ? 381  ASP B CB  1 
ATOM   1747  C CG  . ASP B  2 66  B -16.076 25.891  57.172  1.00 46.20  ? 381  ASP B CG  1 
ATOM   1748  O OD1 . ASP B  2 66  B -16.594 25.491  56.102  1.00 46.20  ? 381  ASP B OD1 1 
ATOM   1749  O OD2 . ASP B  2 66  B -16.303 25.333  58.260  1.00 46.20  ? 381  ASP B OD2 1 
ATOM   1750  N N   . LYS B  2 67  C -17.019 28.982  54.561  1.00 71.50  ? 381  LYS B N   1 
ATOM   1751  C CA  . LYS B  2 67  C -18.358 29.311  54.108  1.00 71.50  ? 381  LYS B CA  1 
ATOM   1752  C C   . LYS B  2 67  C -19.449 28.379  54.609  1.00 71.50  ? 381  LYS B C   1 
ATOM   1753  O O   . LYS B  2 67  C -20.474 28.847  55.088  1.00 71.50  ? 381  LYS B O   1 
ATOM   1754  C CB  . LYS B  2 67  C -18.380 29.384  52.579  1.00 71.50  ? 381  LYS B CB  1 
ATOM   1755  C CG  . LYS B  2 67  C -18.452 30.819  52.022  1.00 71.50  ? 381  LYS B CG  1 
ATOM   1756  C CD  . LYS B  2 67  C -17.087 31.512  51.992  1.00 71.50  ? 381  LYS B CD  1 
ATOM   1757  C CE  . LYS B  2 67  C -16.784 32.122  50.619  1.00 71.50  ? 381  LYS B CE  1 
ATOM   1758  N NZ  . LYS B  2 67  C -15.350 32.519  50.493  1.00 71.50  ? 381  LYS B NZ  1 
ATOM   1759  N N   . LYS B  2 68  D -19.237 27.071  54.522  1.00 53.32  ? 381  LYS B N   1 
ATOM   1760  C CA  . LYS B  2 68  D -20.254 26.123  54.977  1.00 53.32  ? 381  LYS B CA  1 
ATOM   1761  C C   . LYS B  2 68  D -20.730 26.459  56.366  1.00 53.32  ? 381  LYS B C   1 
ATOM   1762  O O   . LYS B  2 68  D -21.673 27.237  56.505  1.00 53.32  ? 381  LYS B O   1 
ATOM   1763  C CB  . LYS B  2 68  D -19.745 24.684  54.964  1.00 53.32  ? 381  LYS B CB  1 
ATOM   1764  C CG  . LYS B  2 68  D -20.799 23.700  55.435  1.00 53.32  ? 381  LYS B CG  1 
ATOM   1765  C CD  . LYS B  2 68  D -20.681 22.367  54.728  1.00 53.32  ? 381  LYS B CD  1 
ATOM   1766  C CE  . LYS B  2 68  D -21.480 22.376  53.440  1.00 53.32  ? 381  LYS B CE  1 
ATOM   1767  N NZ  . LYS B  2 68  D -22.942 22.440  53.701  1.00 53.32  ? 381  LYS B NZ  1 
ATOM   1768  N N   . ASN B  2 69  E -20.083 25.885  57.385  1.00 53.28  ? 381  ASN B N   1 
ATOM   1769  C CA  . ASN B  2 69  E -20.466 26.130  58.783  1.00 53.28  ? 381  ASN B CA  1 
ATOM   1770  C C   . ASN B  2 69  E -20.154 27.565  59.218  1.00 53.28  ? 381  ASN B C   1 
ATOM   1771  O O   . ASN B  2 69  E -19.926 27.832  60.402  1.00 53.28  ? 381  ASN B O   1 
ATOM   1772  C CB  . ASN B  2 69  E -19.770 25.148  59.731  1.00 53.28  ? 381  ASN B CB  1 
ATOM   1773  C CG  . ASN B  2 69  E -19.366 23.859  59.044  1.00 53.28  ? 381  ASN B CG  1 
ATOM   1774  O OD1 . ASN B  2 69  E -19.810 22.775  59.425  1.00 53.28  ? 381  ASN B OD1 1 
ATOM   1775  N ND2 . ASN B  2 69  E -18.511 23.968  58.027  1.00 53.28  ? 381  ASN B ND2 1 
ATOM   1776  N N   . MET B  2 70  ? -20.171 28.485  58.251  1.00 74.30  ? 382  MET B N   1 
ATOM   1777  C CA  . MET B  2 70  ? -19.897 29.893  58.506  1.00 74.30  ? 382  MET B CA  1 
ATOM   1778  C C   . MET B  2 70  ? -18.984 29.987  59.717  1.00 74.30  ? 382  MET B C   1 
ATOM   1779  O O   . MET B  2 70  ? -19.377 30.472  60.782  1.00 74.30  ? 382  MET B O   1 
ATOM   1780  C CB  . MET B  2 70  ? -21.208 30.651  58.748  1.00 74.30  ? 382  MET B CB  1 
ATOM   1781  C CG  . MET B  2 70  ? -21.286 32.028  58.074  1.00 74.30  ? 382  MET B CG  1 
ATOM   1782  S SD  . MET B  2 70  ? -20.893 32.073  56.277  1.00 74.30  ? 382  MET B SD  1 
ATOM   1783  C CE  . MET B  2 70  ? -19.017 32.389  56.281  1.00 74.30  ? 382  MET B CE  1 
ATOM   1784  N N   . GLY B  2 71  ? -17.765 29.487  59.536  1.00 50.75  ? 383  GLY B N   1 
ATOM   1785  C CA  . GLY B  2 71  ? -16.792 29.487  60.607  1.00 50.75  ? 383  GLY B CA  1 
ATOM   1786  C C   . GLY B  2 71  ? -15.492 30.142  60.199  1.00 50.75  ? 383  GLY B C   1 
ATOM   1787  O O   . GLY B  2 71  ? -15.290 30.458  59.020  1.00 50.75  ? 383  GLY B O   1 
ATOM   1788  N N   . LYS B  2 72  ? -14.618 30.354  61.184  1.00 34.60  ? 384  LYS B N   1 
ATOM   1789  C CA  . LYS B  2 72  ? -13.321 30.977  60.962  1.00 34.60  ? 384  LYS B CA  1 
ATOM   1790  C C   . LYS B  2 72  ? -12.210 30.195  61.678  1.00 34.60  ? 384  LYS B C   1 
ATOM   1791  O O   . LYS B  2 72  ? -12.466 29.132  62.278  1.00 34.60  ? 384  LYS B O   1 
ATOM   1792  C CB  . LYS B  2 72  ? -13.365 32.415  61.471  1.00 34.60  ? 384  LYS B CB  1 
ATOM   1793  C CG  . LYS B  2 72  ? -14.317 33.313  60.701  1.00 34.60  ? 384  LYS B CG  1 
ATOM   1794  C CD  . LYS B  2 72  ? -13.610 34.545  60.143  1.00 34.60  ? 384  LYS B CD  1 
ATOM   1795  C CE  . LYS B  2 72  ? -13.451 34.452  58.621  1.00 34.60  ? 384  LYS B CE  1 
ATOM   1796  N NZ  . LYS B  2 72  ? -13.245 35.779  57.948  1.00 34.60  ? 384  LYS B NZ  1 
ATOM   1797  N N   . GLN B  2 73  ? -10.976 30.693  61.572  1.00 32.23  ? 385  GLN B N   1 
ATOM   1798  C CA  . GLN B  2 73  ? -9.837  30.077  62.255  1.00 32.23  ? 385  GLN B CA  1 
ATOM   1799  C C   . GLN B  2 73  ? -8.883  31.168  62.729  1.00 32.23  ? 385  GLN B C   1 
ATOM   1800  O O   . GLN B  2 73  ? -8.408  31.970  61.926  1.00 32.23  ? 385  GLN B O   1 
ATOM   1801  C CB  . GLN B  2 73  ? -9.072  29.093  61.349  1.00 32.23  ? 385  GLN B CB  1 
ATOM   1802  C CG  . GLN B  2 73  ? -7.610  28.842  61.825  1.00 32.23  ? 385  GLN B CG  1 
ATOM   1803  C CD  . GLN B  2 73  ? -7.011  27.555  61.305  1.00 32.23  ? 385  GLN B CD  1 
ATOM   1804  O OE1 . GLN B  2 73  ? -7.704  26.743  60.702  1.00 32.23  ? 385  GLN B OE1 1 
ATOM   1805  N NE2 . GLN B  2 73  ? -5.719  27.361  61.531  1.00 32.23  ? 385  GLN B NE2 1 
ATOM   1806  N N   . MET B  2 74  ? -8.591  31.187  64.027  1.00 35.82  ? 386  MET B N   1 
ATOM   1807  C CA  . MET B  2 74  ? -7.695  32.196  64.589  1.00 35.82  ? 386  MET B CA  1 
ATOM   1808  C C   . MET B  2 74  ? -6.426  31.632  65.237  1.00 35.82  ? 386  MET B C   1 
ATOM   1809  O O   . MET B  2 74  ? -6.468  31.074  66.328  1.00 35.82  ? 386  MET B O   1 
ATOM   1810  C CB  . MET B  2 74  ? -8.447  33.043  65.623  1.00 35.82  ? 386  MET B CB  1 
ATOM   1811  C CG  . MET B  2 74  ? -7.592  34.101  66.299  1.00 35.82  ? 386  MET B CG  1 
ATOM   1812  S SD  . MET B  2 74  ? -7.457  35.525  65.229  1.00 35.82  ? 386  MET B SD  1 
ATOM   1813  C CE  . MET B  2 74  ? -5.726  35.564  64.869  1.00 35.82  ? 386  MET B CE  1 
ATOM   1814  N N   . PRO B  2 75  ? -5.287  31.734  64.549  1.00 22.91  ? 387  PRO B N   1 
ATOM   1815  C CA  . PRO B  2 75  ? -4.018  31.236  65.095  1.00 22.91  ? 387  PRO B CA  1 
ATOM   1816  C C   . PRO B  2 75  ? -3.725  32.009  66.362  1.00 22.91  ? 387  PRO B C   1 
ATOM   1817  O O   . PRO B  2 75  ? -4.278  33.070  66.547  1.00 22.91  ? 387  PRO B O   1 
ATOM   1818  C CB  . PRO B  2 75  ? -2.993  31.553  64.002  1.00 22.91  ? 387  PRO B CB  1 
ATOM   1819  C CG  . PRO B  2 75  ? -3.807  31.700  62.740  1.00 22.91  ? 387  PRO B CG  1 
ATOM   1820  C CD  . PRO B  2 75  ? -5.150  32.243  63.174  1.00 22.91  ? 387  PRO B CD  1 
ATOM   1821  N N   . GLN B  2 76  ? -2.841  31.494  67.216  1.00 35.48  ? 388  GLN B N   1 
ATOM   1822  C CA  . GLN B  2 76  ? -2.515  32.175  68.466  1.00 35.48  ? 388  GLN B CA  1 
ATOM   1823  C C   . GLN B  2 76  ? -1.137  31.910  69.108  1.00 35.48  ? 388  GLN B C   1 
ATOM   1824  O O   . GLN B  2 76  ? -0.969  30.997  69.933  1.00 35.48  ? 388  GLN B O   1 
ATOM   1825  C CB  . GLN B  2 76  ? -3.588  31.872  69.493  1.00 35.48  ? 388  GLN B CB  1 
ATOM   1826  C CG  . GLN B  2 76  ? -3.239  32.402  70.853  1.00 35.48  ? 388  GLN B CG  1 
ATOM   1827  C CD  . GLN B  2 76  ? -4.258  32.031  71.887  1.00 35.48  ? 388  GLN B CD  1 
ATOM   1828  O OE1 . GLN B  2 76  ? -5.386  31.664  71.563  1.00 35.48  ? 388  GLN B OE1 1 
ATOM   1829  N NE2 . GLN B  2 76  ? -3.872  32.128  73.146  1.00 35.48  ? 388  GLN B NE2 1 
ATOM   1830  N N   . PRO B  2 77  ? -0.138  32.727  68.745  1.00 20.76  ? 389  PRO B N   1 
ATOM   1831  C CA  . PRO B  2 77  ? 1.214   32.596  69.277  1.00 20.76  ? 389  PRO B CA  1 
ATOM   1832  C C   . PRO B  2 77  ? 1.263   32.939  70.740  1.00 20.76  ? 389  PRO B C   1 
ATOM   1833  O O   . PRO B  2 77  ? 0.446   33.691  71.239  1.00 20.76  ? 389  PRO B O   1 
ATOM   1834  C CB  . PRO B  2 77  ? 2.024   33.590  68.457  1.00 20.76  ? 389  PRO B CB  1 
ATOM   1835  C CG  . PRO B  2 77  ? 1.204   33.847  67.264  1.00 20.76  ? 389  PRO B CG  1 
ATOM   1836  C CD  . PRO B  2 77  ? -0.205  33.809  67.758  1.00 20.76  ? 389  PRO B CD  1 
ATOM   1837  N N   . THR B  2 78  ? 2.230   32.370  71.428  1.00 33.73  ? 390  THR B N   1 
ATOM   1838  C CA  . THR B  2 78  ? 2.440   32.634  72.834  1.00 33.73  ? 390  THR B CA  1 
ATOM   1839  C C   . THR B  2 78  ? 3.941   32.635  72.911  1.00 33.73  ? 390  THR B C   1 
ATOM   1840  O O   . THR B  2 78  ? 4.585   31.758  72.338  1.00 33.73  ? 390  THR B O   1 
ATOM   1841  C CB  . THR B  2 78  ? 1.889   31.527  73.669  1.00 33.73  ? 390  THR B CB  1 
ATOM   1842  O OG1 . THR B  2 78  ? 0.566   31.221  73.210  1.00 33.73  ? 390  THR B OG1 1 
ATOM   1843  C CG2 . THR B  2 78  ? 1.858   31.948  75.115  1.00 33.73  ? 390  THR B CG2 1 
ATOM   1844  N N   . PHE B  2 79  ? 4.521   33.601  73.600  1.00 35.25  ? 392  PHE B N   1 
ATOM   1845  C CA  . PHE B  2 79  ? 5.957   33.635  73.597  1.00 35.25  ? 392  PHE B CA  1 
ATOM   1846  C C   . PHE B  2 79  ? 6.627   34.095  74.848  1.00 35.25  ? 392  PHE B C   1 
ATOM   1847  O O   . PHE B  2 79  ? 6.070   34.856  75.619  1.00 35.25  ? 392  PHE B O   1 
ATOM   1848  C CB  . PHE B  2 79  ? 6.434   34.508  72.443  1.00 35.25  ? 392  PHE B CB  1 
ATOM   1849  C CG  . PHE B  2 79  ? 6.171   35.968  72.647  1.00 35.25  ? 392  PHE B CG  1 
ATOM   1850  C CD1 . PHE B  2 79  ? 4.988   36.550  72.181  1.00 35.25  ? 392  PHE B CD1 1 
ATOM   1851  C CD2 . PHE B  2 79  ? 7.128   36.779  73.238  1.00 35.25  ? 392  PHE B CD2 1 
ATOM   1852  C CE1 . PHE B  2 79  ? 4.762   37.937  72.295  1.00 35.25  ? 392  PHE B CE1 1 
ATOM   1853  C CE2 . PHE B  2 79  ? 6.919   38.157  73.357  1.00 35.25  ? 392  PHE B CE2 1 
ATOM   1854  C CZ  . PHE B  2 79  ? 5.734   38.739  72.880  1.00 35.25  ? 392  PHE B CZ  1 
ATOM   1855  N N   . THR B  2 80  ? 7.867   33.636  74.996  1.00 35.88  ? 393  THR B N   1 
ATOM   1856  C CA  . THR B  2 80  ? 8.722   33.956  76.126  1.00 35.88  ? 393  THR B CA  1 
ATOM   1857  C C   . THR B  2 80  ? 10.076  34.527  75.653  1.00 35.88  ? 393  THR B C   1 
ATOM   1858  O O   . THR B  2 80  ? 10.950  34.835  76.463  1.00 35.88  ? 393  THR B O   1 
ATOM   1859  C CB  . THR B  2 80  ? 8.920   32.707  76.990  1.00 35.88  ? 393  THR B CB  1 
ATOM   1860  O OG1 . THR B  2 80  ? 7.705   32.444  77.686  1.00 35.88  ? 393  THR B OG1 1 
ATOM   1861  C CG2 . THR B  2 80  ? 9.984   32.915  78.016  1.00 35.88  ? 393  THR B CG2 1 
ATOM   1862  N N   . LEU B  2 81  ? 10.238  34.699  74.344  1.00 26.06  ? 394  LEU B N   1 
ATOM   1863  C CA  . LEU B  2 81  ? 11.486  35.251  73.820  1.00 26.06  ? 394  LEU B CA  1 
ATOM   1864  C C   . LEU B  2 81  ? 11.852  36.494  74.618  1.00 26.06  ? 394  LEU B C   1 
ATOM   1865  O O   . LEU B  2 81  ? 10.968  37.139  75.220  1.00 26.06  ? 394  LEU B O   1 
ATOM   1866  C CB  . LEU B  2 81  ? 11.355  35.632  72.343  1.00 26.06  ? 394  LEU B CB  1 
ATOM   1867  C CG  . LEU B  2 81  ? 10.851  34.529  71.422  1.00 26.06  ? 394  LEU B CG  1 
ATOM   1868  C CD1 . LEU B  2 81  ? 10.917  34.991  70.003  1.00 26.06  ? 394  LEU B CD1 1 
ATOM   1869  C CD2 . LEU B  2 81  ? 11.686  33.295  71.609  1.00 26.06  ? 394  LEU B CD2 1 
ATOM   1870  N N   . ARG B  2 82  ? 13.152  36.816  74.616  1.00 38.37  ? 395  ARG B N   1 
ATOM   1871  C CA  . ARG B  2 82  ? 13.689  37.969  75.324  1.00 38.37  ? 395  ARG B CA  1 
ATOM   1872  C C   . ARG B  2 82  ? 14.461  38.844  74.370  1.00 38.37  ? 395  ARG B C   1 
ATOM   1873  O O   . ARG B  2 82  ? 15.000  39.870  74.761  1.00 38.37  ? 395  ARG B O   1 
ATOM   1874  C CB  . ARG B  2 82  ? 14.633  37.528  76.425  1.00 38.37  ? 395  ARG B CB  1 
ATOM   1875  C CG  . ARG B  2 82  ? 13.972  36.832  77.571  1.00 38.37  ? 395  ARG B CG  1 
ATOM   1876  C CD  . ARG B  2 82  ? 15.003  36.137  78.455  1.00 38.37  ? 395  ARG B CD  1 
ATOM   1877  N NE  . ARG B  2 82  ? 16.160  35.640  77.705  1.00 38.37  ? 395  ARG B NE  1 
ATOM   1878  C CZ  . ARG B  2 82  ? 17.372  36.199  77.738  1.00 38.37  ? 395  ARG B CZ  1 
ATOM   1879  N NH1 . ARG B  2 82  ? 17.602  37.283  78.486  1.00 38.37  ? 395  ARG B NH1 1 
ATOM   1880  N NH2 . ARG B  2 82  ? 18.355  35.686  77.004  1.00 38.37  ? 395  ARG B NH2 1 
ATOM   1881  N N   . LYS B  2 83  ? 14.528  38.423  73.118  1.00 34.32  ? 396  LYS B N   1 
ATOM   1882  C CA  . LYS B  2 83  ? 15.243  39.165  72.083  1.00 34.32  ? 396  LYS B CA  1 
ATOM   1883  C C   . LYS B  2 83  ? 14.462  39.034  70.778  1.00 34.32  ? 396  LYS B C   1 
ATOM   1884  O O   . LYS B  2 83  ? 13.683  38.099  70.612  1.00 34.32  ? 396  LYS B O   1 
ATOM   1885  C CB  . LYS B  2 83  ? 16.646  38.576  71.861  1.00 34.32  ? 396  LYS B CB  1 
ATOM   1886  C CG  . LYS B  2 83  ? 17.694  38.942  72.888  1.00 34.32  ? 396  LYS B CG  1 
ATOM   1887  C CD  . LYS B  2 83  ? 19.037  38.350  72.490  1.00 34.32  ? 396  LYS B CD  1 
ATOM   1888  C CE  . LYS B  2 83  ? 19.700  37.607  73.645  1.00 34.32  ? 396  LYS B CE  1 
ATOM   1889  N NZ  . LYS B  2 83  ? 21.130  37.986  73.746  1.00 34.32  ? 396  LYS B NZ  1 
ATOM   1890  N N   . LYS B  2 84  ? 14.661  39.956  69.845  1.00 44.81  ? 397  LYS B N   1 
ATOM   1891  C CA  . LYS B  2 84  ? 13.958  39.829  68.585  1.00 44.81  ? 397  LYS B CA  1 
ATOM   1892  C C   . LYS B  2 84  ? 14.465  38.526  67.966  1.00 44.81  ? 397  LYS B C   1 
ATOM   1893  O O   . LYS B  2 84  ? 15.608  38.127  68.184  1.00 44.81  ? 397  LYS B O   1 
ATOM   1894  C CB  . LYS B  2 84  ? 14.260  41.019  67.677  1.00 44.81  ? 397  LYS B CB  1 
ATOM   1895  C CG  . LYS B  2 84  ? 13.110  41.997  67.551  1.00 44.81  ? 397  LYS B CG  1 
ATOM   1896  C CD  . LYS B  2 84  ? 13.188  42.783  66.243  1.00 44.81  ? 397  LYS B CD  1 
ATOM   1897  C CE  . LYS B  2 84  ? 12.199  43.948  66.252  1.00 44.81  ? 397  LYS B CE  1 
ATOM   1898  N NZ  . LYS B  2 84  ? 11.019  43.722  67.165  1.00 44.81  ? 397  LYS B NZ  1 
ATOM   1899  N N   . LEU B  2 85  ? 13.613  37.838  67.223  1.00 30.26  ? 398  LEU B N   1 
ATOM   1900  C CA  . LEU B  2 85  ? 14.035  36.597  66.603  1.00 30.26  ? 398  LEU B CA  1 
ATOM   1901  C C   . LEU B  2 85  ? 13.974  36.694  65.099  1.00 30.26  ? 398  LEU B C   1 
ATOM   1902  O O   . LEU B  2 85  ? 12.902  36.588  64.508  1.00 30.26  ? 398  LEU B O   1 
ATOM   1903  C CB  . LEU B  2 85  ? 13.160  35.433  67.057  1.00 30.26  ? 398  LEU B CB  1 
ATOM   1904  C CG  . LEU B  2 85  ? 13.398  34.142  66.264  1.00 30.26  ? 398  LEU B CG  1 
ATOM   1905  C CD1 . LEU B  2 85  ? 14.667  33.421  66.765  1.00 30.26  ? 398  LEU B CD1 1 
ATOM   1906  C CD2 . LEU B  2 85  ? 12.181  33.254  66.410  1.00 30.26  ? 398  LEU B CD2 1 
ATOM   1907  N N   . VAL B  2 86  ? 15.121  36.894  64.468  1.00 42.54  ? 399  VAL B N   1 
ATOM   1908  C CA  . VAL B  2 86  ? 15.128  36.966  63.018  1.00 42.54  ? 399  VAL B CA  1 
ATOM   1909  C C   . VAL B  2 86  ? 15.953  35.798  62.449  1.00 42.54  ? 399  VAL B C   1 
ATOM   1910  O O   . VAL B  2 86  ? 16.785  35.207  63.156  1.00 42.54  ? 399  VAL B O   1 
ATOM   1911  C CB  . VAL B  2 86  ? 15.665  38.331  62.522  1.00 42.54  ? 399  VAL B CB  1 
ATOM   1912  C CG1 . VAL B  2 86  ? 16.980  38.620  63.171  1.00 42.54  ? 399  VAL B CG1 1 
ATOM   1913  C CG2 . VAL B  2 86  ? 15.785  38.333  60.996  1.00 42.54  ? 399  VAL B CG2 1 
ATOM   1914  N N   . PHE B  2 87  ? 15.673  35.467  61.186  1.00 55.95  ? 400  PHE B N   1 
ATOM   1915  C CA  . PHE B  2 87  ? 16.316  34.372  60.466  1.00 55.95  ? 400  PHE B CA  1 
ATOM   1916  C C   . PHE B  2 87  ? 17.033  34.864  59.198  1.00 55.95  ? 400  PHE B C   1 
ATOM   1917  O O   . PHE B  2 87  ? 16.454  34.831  58.099  1.00 55.95  ? 400  PHE B O   1 
ATOM   1918  C CB  . PHE B  2 87  ? 15.268  33.333  60.035  1.00 55.95  ? 400  PHE B CB  1 
ATOM   1919  C CG  . PHE B  2 87  ? 14.637  32.576  61.172  1.00 55.95  ? 400  PHE B CG  1 
ATOM   1920  C CD1 . PHE B  2 87  ? 15.392  32.133  62.249  1.00 55.95  ? 400  PHE B CD1 1 
ATOM   1921  C CD2 . PHE B  2 87  ? 13.278  32.293  61.154  1.00 55.95  ? 400  PHE B CD2 1 
ATOM   1922  C CE1 . PHE B  2 87  ? 14.806  31.422  63.288  1.00 55.95  ? 400  PHE B CE1 1 
ATOM   1923  C CE2 . PHE B  2 87  ? 12.685  31.579  62.197  1.00 55.95  ? 400  PHE B CE2 1 
ATOM   1924  C CZ  . PHE B  2 87  ? 13.456  31.145  63.262  1.00 55.95  ? 400  PHE B CZ  1 
ATOM   1925  N N   . PRO B  2 88  ? 18.305  35.305  59.320  1.00 69.05  ? 401  PRO B N   1 
ATOM   1926  C CA  . PRO B  2 88  ? 19.022  35.784  58.128  1.00 69.05  ? 401  PRO B CA  1 
ATOM   1927  C C   . PRO B  2 88  ? 19.135  34.724  57.026  1.00 69.05  ? 401  PRO B C   1 
ATOM   1928  O O   . PRO B  2 88  ? 19.285  33.531  57.378  1.00 69.05  ? 401  PRO B O   1 
ATOM   1929  C CB  . PRO B  2 88  ? 20.390  36.204  58.673  1.00 69.05  ? 401  PRO B CB  1 
ATOM   1930  C CG  . PRO B  2 88  ? 20.181  36.406  60.153  1.00 69.05  ? 401  PRO B CG  1 
ATOM   1931  C CD  . PRO B  2 88  ? 19.139  35.392  60.533  1.00 69.05  ? 401  PRO B CD  1 
ATOM   1932  O OXT . PRO B  2 88  ? 19.070  35.098  55.832  1.00 69.05  ? 401  PRO B OXT 1 
HETATM 1933  C C1  . PHQ C  3 1   ? -11.700 22.127  54.790  1.00 56.77  ? 4100 PHQ T C1  1 
HETATM 1934  O O1  . PHQ C  3 1   ? -12.875 22.323  55.097  1.00 45.13  ? 4100 PHQ T O1  1 
HETATM 1935  O O2  . PHQ C  3 1   ? -11.043 22.985  53.892  0.00 45.13  ? 4100 PHQ T O2  1 
HETATM 1936  C C2  . PHQ C  3 1   ? -11.823 24.087  53.372  0.00 45.13  ? 4100 PHQ T C2  1 
HETATM 1937  C C3  . PHQ C  3 1   ? -10.997 24.964  52.458  0.00 45.13  ? 4100 PHQ T C3  1 
HETATM 1938  C C4  . PHQ C  3 1   ? -10.167 24.412  51.435  0.00 45.13  ? 4100 PHQ T C4  1 
HETATM 1939  C C5  . PHQ C  3 1   ? -9.398  25.278  50.588  0.00 45.13  ? 4100 PHQ T C5  1 
HETATM 1940  C C6  . PHQ C  3 1   ? -9.453  26.693  50.756  0.00 45.13  ? 4100 PHQ T C6  1 
HETATM 1941  C C7  . PHQ C  3 1   ? -10.279 27.254  51.776  0.00 45.13  ? 4100 PHQ T C7  1 
HETATM 1942  C C8  . PHQ C  3 1   ? -11.045 26.389  52.619  0.00 45.13  ? 4100 PHQ T C8  1 
ATOM   1943  N N   . GLU C  3 2   ? -10.882 21.171  55.215  1.00 71.18  ? 4101 GLU T N   1 
ATOM   1944  C CA  . GLU C  3 2   ? -11.270 20.143  56.213  1.00 38.04  ? 4101 GLU T CA  1 
ATOM   1945  C C   . GLU C  3 2   ? -10.625 20.555  57.570  1.00 41.57  ? 4101 GLU T C   1 
ATOM   1946  O O   . GLU C  3 2   ? -9.900  21.562  57.644  1.00 73.56  ? 4101 GLU T O   1 
ATOM   1947  C CB  . GLU C  3 2   ? -10.737 18.745  55.859  1.00 44.48  ? 4101 GLU T CB  1 
ATOM   1948  C CG  . GLU C  3 2   ? -11.254 18.121  54.548  1.00 72.73  ? 4101 GLU T CG  1 
ATOM   1949  C CD  . GLU C  3 2   ? -10.897 16.613  54.427  1.00 75.02  ? 4101 GLU T CD  1 
ATOM   1950  O OE1 . GLU C  3 2   ? -10.283 15.941  55.234  1.00 80.74  ? 4101 GLU T OE1 1 
ATOM   1951  O OE2 . GLU C  3 2   ? -11.371 16.121  53.280  1.00 77.03  ? 4101 GLU T OE2 1 
ATOM   1952  N N   . VAL C  3 3   ? -10.883 19.771  58.643  1.00 40.08  ? 4102 VAL T N   1 
ATOM   1953  C CA  . VAL C  3 3   ? -10.624 20.159  60.053  1.00 48.35  ? 4102 VAL T CA  1 
ATOM   1954  C C   . VAL C  3 3   ? -9.780  19.016  60.662  1.00 47.43  ? 4102 VAL T C   1 
ATOM   1955  O O   . VAL C  3 3   ? -9.845  17.858  60.210  1.00 68.36  ? 4102 VAL T O   1 
ATOM   1956  C CB  . VAL C  3 3   ? -11.950 20.401  60.862  1.00 55.43  ? 4102 VAL T CB  1 
ATOM   1957  C CG1 . VAL C  3 3   ? -12.747 21.568  60.280  1.00 59.65  ? 4102 VAL T CG1 1 
ATOM   1958  C CG2 . VAL C  3 3   ? -12.904 19.183  60.880  1.00 57.54  ? 4102 VAL T CG2 1 
ATOM   1959  N N   . ASP C  3 4   ? -8.984  19.356  61.693  1.00 35.37  ? 4103 ASP T N   1 
ATOM   1960  C CA  . ASP C  3 4   ? -8.094  18.434  62.412  1.00 59.81  ? 4103 ASP T CA  1 
ATOM   1961  C C   . ASP C  3 4   ? -8.595  18.168  63.874  1.00 65.09  ? 4103 ASP T C   1 
ATOM   1962  O O   . ASP C  3 4   ? -7.990  17.500  64.676  1.00 45.13  ? 4103 ASP T O   1 
ATOM   1963  C CB  . ASP C  3 4   ? -6.657  19.026  62.450  1.00 51.04  ? 4103 ASP T CB  1 
ATOM   1964  C CG  . ASP C  3 4   ? -5.876  18.943  61.114  1.00 47.31  ? 4103 ASP T CG  1 
ATOM   1965  O OD1 . ASP C  3 4   ? -5.912  18.043  60.306  1.00 32.69  ? 4103 ASP T OD1 1 
ATOM   1966  O OD2 . ASP C  3 4   ? -5.122  20.022  60.957  1.00 72.49  ? 4103 ASP T OD2 1 
HETATM 1967  C C1  . 0QE C  3 5   ? -9.761  18.785  64.134  1.00 24.46  ? 4104 0QE T C1  1 
ATOM   1968  N N   . LEU D  1 1   ? 5.971   48.693  56.317  1.00 100.00 ? 149  LEU C N   1 
ATOM   1969  C CA  . LEU D  1 1   ? 4.648   48.944  55.678  1.00 100.00 ? 149  LEU C CA  1 
ATOM   1970  C C   . LEU D  1 1   ? 3.658   47.802  55.912  1.00 100.00 ? 149  LEU C C   1 
ATOM   1971  O O   . LEU D  1 1   ? 2.796   47.530  55.074  1.00 100.00 ? 149  LEU C O   1 
ATOM   1972  C CB  . LEU D  1 1   ? 4.823   49.166  54.178  1.00 100.00 ? 149  LEU C CB  1 
ATOM   1973  C CG  . LEU D  1 1   ? 3.786   50.091  53.545  1.00 100.00 ? 149  LEU C CG  1 
ATOM   1974  C CD1 . LEU D  1 1   ? 3.634   51.361  54.385  1.00 100.00 ? 149  LEU C CD1 1 
ATOM   1975  C CD2 . LEU D  1 1   ? 4.231   50.425  52.129  1.00 100.00 ? 149  LEU C CD2 1 
ATOM   1976  N N   . ASP D  1 2   ? 3.797   47.124  57.045  1.00 74.18  ? 150  ASP C N   1 
ATOM   1977  C CA  . ASP D  1 2   ? 2.884   46.049  57.385  1.00 74.18  ? 150  ASP C CA  1 
ATOM   1978  C C   . ASP D  1 2   ? 1.661   46.756  57.942  1.00 74.18  ? 150  ASP C C   1 
ATOM   1979  O O   . ASP D  1 2   ? 1.757   47.900  58.385  1.00 74.18  ? 150  ASP C O   1 
ATOM   1980  C CB  . ASP D  1 2   ? 3.493   45.147  58.458  1.00 74.18  ? 150  ASP C CB  1 
ATOM   1981  C CG  . ASP D  1 2   ? 5.002   45.093  58.379  1.00 74.18  ? 150  ASP C CG  1 
ATOM   1982  O OD1 . ASP D  1 2   ? 5.520   44.606  57.352  1.00 74.18  ? 150  ASP C OD1 1 
ATOM   1983  O OD2 . ASP D  1 2   ? 5.664   45.536  59.343  1.00 74.18  ? 150  ASP C OD2 1 
ATOM   1984  N N   . LYS D  1 3   ? 0.513   46.094  57.919  1.00 73.94  ? 151  LYS C N   1 
ATOM   1985  C CA  . LYS D  1 3   ? -0.696  46.713  58.442  1.00 73.94  ? 151  LYS C CA  1 
ATOM   1986  C C   . LYS D  1 3   ? -0.477  47.137  59.900  1.00 73.94  ? 151  LYS C C   1 
ATOM   1987  O O   . LYS D  1 3   ? 0.285   46.511  60.635  1.00 73.94  ? 151  LYS C O   1 
ATOM   1988  C CB  . LYS D  1 3   ? -1.878  45.747  58.322  1.00 73.94  ? 151  LYS C CB  1 
ATOM   1989  C CG  . LYS D  1 3   ? -2.120  45.240  56.893  1.00 73.94  ? 151  LYS C CG  1 
ATOM   1990  C CD  . LYS D  1 3   ? -2.888  46.253  56.036  1.00 73.94  ? 151  LYS C CD  1 
ATOM   1991  C CE  . LYS D  1 3   ? -2.966  45.809  54.574  1.00 73.94  ? 151  LYS C CE  1 
ATOM   1992  N NZ  . LYS D  1 3   ? -3.390  46.917  53.665  1.00 73.94  ? 151  LYS C NZ  1 
ATOM   1993  N N   . VAL D  1 4   ? -1.134  48.218  60.307  1.00 45.78  ? 152  VAL C N   1 
ATOM   1994  C CA  . VAL D  1 4   ? -1.007  48.745  61.666  1.00 45.78  ? 152  VAL C CA  1 
ATOM   1995  C C   . VAL D  1 4   ? -2.393  49.059  62.253  1.00 45.78  ? 152  VAL C C   1 
ATOM   1996  O O   . VAL D  1 4   ? -3.311  49.481  61.538  1.00 45.78  ? 152  VAL C O   1 
ATOM   1997  C CB  . VAL D  1 4   ? -0.131  50.052  61.675  1.00 45.78  ? 152  VAL C CB  1 
ATOM   1998  C CG1 . VAL D  1 4   ? -0.015  50.617  63.087  1.00 45.78  ? 152  VAL C CG1 1 
ATOM   1999  C CG2 . VAL D  1 4   ? 1.247   49.761  61.112  1.00 45.78  ? 152  VAL C CG2 1 
ATOM   2000  N N   . TYR D  1 5   ? -2.546  48.834  63.555  1.00 36.79  ? 153  TYR C N   1 
ATOM   2001  C CA  . TYR D  1 5   ? -3.808  49.119  64.222  1.00 36.79  ? 153  TYR C CA  1 
ATOM   2002  C C   . TYR D  1 5   ? -3.927  50.628  64.356  1.00 36.79  ? 153  TYR C C   1 
ATOM   2003  O O   . TYR D  1 5   ? -2.989  51.299  64.807  1.00 36.79  ? 153  TYR C O   1 
ATOM   2004  C CB  . TYR D  1 5   ? -3.832  48.490  65.606  1.00 36.79  ? 153  TYR C CB  1 
ATOM   2005  C CG  . TYR D  1 5   ? -4.325  47.069  65.621  1.00 36.79  ? 153  TYR C CG  1 
ATOM   2006  C CD1 . TYR D  1 5   ? -5.480  46.707  64.948  1.00 36.79  ? 153  TYR C CD1 1 
ATOM   2007  C CD2 . TYR D  1 5   ? -3.643  46.091  66.334  1.00 36.79  ? 153  TYR C CD2 1 
ATOM   2008  C CE1 . TYR D  1 5   ? -5.941  45.412  64.991  1.00 36.79  ? 153  TYR C CE1 1 
ATOM   2009  C CE2 . TYR D  1 5   ? -4.097  44.794  66.382  1.00 36.79  ? 153  TYR C CE2 1 
ATOM   2010  C CZ  . TYR D  1 5   ? -5.245  44.460  65.711  1.00 36.79  ? 153  TYR C CZ  1 
ATOM   2011  O OH  . TYR D  1 5   ? -5.695  43.167  65.767  1.00 36.79  ? 153  TYR C OH  1 
ATOM   2012  N N   . GLN D  1 6   ? -5.086  51.148  63.973  1.00 50.45  ? 154  GLN C N   1 
ATOM   2013  C CA  . GLN D  1 6   ? -5.364  52.574  64.014  1.00 50.45  ? 154  GLN C CA  1 
ATOM   2014  C C   . GLN D  1 6   ? -5.459  53.099  65.431  1.00 50.45  ? 154  GLN C C   1 
ATOM   2015  O O   . GLN D  1 6   ? -6.114  52.504  66.275  1.00 50.45  ? 154  GLN C O   1 
ATOM   2016  C CB  . GLN D  1 6   ? -6.666  52.846  63.278  1.00 50.45  ? 154  GLN C CB  1 
ATOM   2017  C CG  . GLN D  1 6   ? -6.998  54.295  63.099  1.00 50.45  ? 154  GLN C CG  1 
ATOM   2018  C CD  . GLN D  1 6   ? -8.049  54.506  62.015  1.00 50.45  ? 154  GLN C CD  1 
ATOM   2019  O OE1 . GLN D  1 6   ? -9.229  54.185  62.198  1.00 50.45  ? 154  GLN C OE1 1 
ATOM   2020  N NE2 . GLN D  1 6   ? -7.621  55.046  60.877  1.00 50.45  ? 154  GLN C NE2 1 
ATOM   2021  N N   . MET D  1 7   ? -4.788  54.215  65.691  1.00 53.84  ? 155  MET C N   1 
ATOM   2022  C CA  . MET D  1 7   ? -4.805  54.848  67.009  1.00 53.84  ? 155  MET C CA  1 
ATOM   2023  C C   . MET D  1 7   ? -4.717  56.366  66.861  1.00 53.84  ? 155  MET C C   1 
ATOM   2024  O O   . MET D  1 7   ? -3.637  56.945  66.983  1.00 53.84  ? 155  MET C O   1 
ATOM   2025  C CB  . MET D  1 7   ? -3.634  54.372  67.861  1.00 53.84  ? 155  MET C CB  1 
ATOM   2026  C CG  . MET D  1 7   ? -3.582  52.885  68.040  1.00 53.84  ? 155  MET C CG  1 
ATOM   2027  S SD  . MET D  1 7   ? -4.551  52.393  69.440  1.00 53.84  ? 155  MET C SD  1 
ATOM   2028  C CE  . MET D  1 7   ? -3.833  53.393  70.683  1.00 53.84  ? 155  MET C CE  1 
ATOM   2029  N N   . LYS D  1 8   ? -5.855  57.007  66.604  1.00 76.87  ? 156  LYS C N   1 
ATOM   2030  C CA  . LYS D  1 8   ? -5.893  58.453  66.443  1.00 76.87  ? 156  LYS C CA  1 
ATOM   2031  C C   . LYS D  1 8   ? -6.927  59.104  67.354  1.00 76.87  ? 156  LYS C C   1 
ATOM   2032  O O   . LYS D  1 8   ? -6.708  60.207  67.848  1.00 76.87  ? 156  LYS C O   1 
ATOM   2033  C CB  . LYS D  1 8   ? -6.203  58.802  64.993  1.00 76.87  ? 156  LYS C CB  1 
ATOM   2034  C CG  . LYS D  1 8   ? -7.294  57.940  64.374  1.00 76.87  ? 156  LYS C CG  1 
ATOM   2035  C CD  . LYS D  1 8   ? -7.432  58.219  62.877  1.00 76.87  ? 156  LYS C CD  1 
ATOM   2036  C CE  . LYS D  1 8   ? -8.848  58.660  62.507  1.00 76.87  ? 156  LYS C CE  1 
ATOM   2037  N NZ  . LYS D  1 8   ? -9.070  58.622  61.031  1.00 76.87  ? 156  LYS C NZ  1 
ATOM   2038  N N   . SER D  1 9   ? -8.047  58.418  67.565  1.00 51.47  ? 157  SER C N   1 
ATOM   2039  C CA  . SER D  1 9   ? -9.139  58.906  68.418  1.00 51.47  ? 157  SER C CA  1 
ATOM   2040  C C   . SER D  1 9   ? -8.713  59.841  69.561  1.00 51.47  ? 157  SER C C   1 
ATOM   2041  O O   . SER D  1 9   ? -7.761  59.527  70.271  1.00 51.47  ? 157  SER C O   1 
ATOM   2042  C CB  . SER D  1 9   ? -9.874  57.719  69.039  1.00 51.47  ? 157  SER C CB  1 
ATOM   2043  O OG  . SER D  1 9   ? -9.568  57.614  70.427  1.00 51.47  ? 157  SER C OG  1 
ATOM   2044  N N   . LYS D  1 10  ? -9.431  60.960  69.750  1.00 89.97  ? 160  LYS C N   1 
ATOM   2045  C CA  . LYS D  1 10  ? -9.122  61.922  70.816  1.00 89.97  ? 160  LYS C CA  1 
ATOM   2046  C C   . LYS D  1 10  ? -8.715  61.094  72.015  1.00 89.97  ? 160  LYS C C   1 
ATOM   2047  O O   . LYS D  1 10  ? -7.532  61.025  72.333  1.00 89.97  ? 160  LYS C O   1 
ATOM   2048  C CB  . LYS D  1 10  ? -10.335 62.789  71.143  1.00 89.97  ? 160  LYS C CB  1 
ATOM   2049  C CG  . LYS D  1 10  ? -11.057 63.312  69.912  1.00 89.97  ? 160  LYS C CG  1 
ATOM   2050  C CD  . LYS D  1 10  ? -11.547 64.759  70.102  1.00 89.97  ? 160  LYS C CD  1 
ATOM   2051  C CE  . LYS D  1 10  ? -12.306 65.291  68.867  1.00 89.97  ? 160  LYS C CE  1 
ATOM   2052  N NZ  . LYS D  1 10  ? -13.495 66.140  69.213  1.00 89.97  ? 160  LYS C NZ  1 
ATOM   2053  N N   . PRO D  1 11  ? -9.678  60.497  72.738  1.00 56.01  ? 161  PRO C N   1 
ATOM   2054  C CA  . PRO D  1 11  ? -9.191  59.686  73.856  1.00 56.01  ? 161  PRO C CA  1 
ATOM   2055  C C   . PRO D  1 11  ? -9.137  58.271  73.253  1.00 56.01  ? 161  PRO C C   1 
ATOM   2056  O O   . PRO D  1 11  ? -10.174 57.633  73.101  1.00 56.01  ? 161  PRO C O   1 
ATOM   2057  C CB  . PRO D  1 11  ? -10.292 59.828  74.907  1.00 56.01  ? 161  PRO C CB  1 
ATOM   2058  C CG  . PRO D  1 11  ? -11.543 60.092  74.105  1.00 56.01  ? 161  PRO C CG  1 
ATOM   2059  C CD  . PRO D  1 11  ? -11.150 60.514  72.693  1.00 56.01  ? 161  PRO C CD  1 
ATOM   2060  N N   . ARG D  1 12  ? -7.953  57.800  72.864  1.00 44.51  ? 162  ARG C N   1 
ATOM   2061  C CA  . ARG D  1 12  ? -7.806  56.469  72.255  1.00 44.51  ? 162  ARG C CA  1 
ATOM   2062  C C   . ARG D  1 12  ? -8.859  55.445  72.678  1.00 44.51  ? 162  ARG C C   1 
ATOM   2063  O O   . ARG D  1 12  ? -9.467  54.790  71.824  1.00 44.51  ? 162  ARG C O   1 
ATOM   2064  C CB  . ARG D  1 12  ? -6.421  55.898  72.549  1.00 44.51  ? 162  ARG C CB  1 
ATOM   2065  C CG  . ARG D  1 12  ? -5.303  56.874  72.338  1.00 44.51  ? 162  ARG C CG  1 
ATOM   2066  C CD  . ARG D  1 12  ? -4.405  56.465  71.186  1.00 44.51  ? 162  ARG C CD  1 
ATOM   2067  N NE  . ARG D  1 12  ? -3.630  57.607  70.723  1.00 44.51  ? 162  ARG C NE  1 
ATOM   2068  C CZ  . ARG D  1 12  ? -4.164  58.619  70.047  1.00 44.51  ? 162  ARG C CZ  1 
ATOM   2069  N NH1 . ARG D  1 12  ? -5.461  58.613  69.768  1.00 44.51  ? 162  ARG C NH1 1 
ATOM   2070  N NH2 . ARG D  1 12  ? -3.420  59.651  69.677  1.00 44.51  ? 162  ARG C NH2 1 
ATOM   2071  N N   . GLY D  1 13  ? -9.058  55.303  73.991  1.00 31.97  ? 163  GLY C N   1 
ATOM   2072  C CA  . GLY D  1 13  ? -10.046 54.371  74.526  1.00 31.97  ? 163  GLY C CA  1 
ATOM   2073  C C   . GLY D  1 13  ? -9.932  54.287  76.033  1.00 31.97  ? 163  GLY C C   1 
ATOM   2074  O O   . GLY D  1 13  ? -9.106  54.974  76.619  1.00 31.97  ? 163  GLY C O   1 
ATOM   2075  N N   . TYR D  1 14  ? -10.738 53.457  76.676  1.00 37.05  ? 164  TYR C N   1 
ATOM   2076  C CA  . TYR D  1 14  ? -10.668 53.333  78.127  1.00 37.05  ? 164  TYR C CA  1 
ATOM   2077  C C   . TYR D  1 14  ? -9.551  52.420  78.593  1.00 37.05  ? 164  TYR C C   1 
ATOM   2078  O O   . TYR D  1 14  ? -9.186  51.473  77.910  1.00 37.05  ? 164  TYR C O   1 
ATOM   2079  C CB  . TYR D  1 14  ? -11.987 52.804  78.678  1.00 37.05  ? 164  TYR C CB  1 
ATOM   2080  C CG  . TYR D  1 14  ? -13.163 53.689  78.354  1.00 37.05  ? 164  TYR C CG  1 
ATOM   2081  C CD1 . TYR D  1 14  ? -13.263 54.979  78.897  1.00 37.05  ? 164  TYR C CD1 1 
ATOM   2082  C CD2 . TYR D  1 14  ? -14.160 53.261  77.480  1.00 37.05  ? 164  TYR C CD2 1 
ATOM   2083  C CE1 . TYR D  1 14  ? -14.322 55.820  78.576  1.00 37.05  ? 164  TYR C CE1 1 
ATOM   2084  C CE2 . TYR D  1 14  ? -15.228 54.094  77.147  1.00 37.05  ? 164  TYR C CE2 1 
ATOM   2085  C CZ  . TYR D  1 14  ? -15.301 55.375  77.700  1.00 37.05  ? 164  TYR C CZ  1 
ATOM   2086  O OH  . TYR D  1 14  ? -16.357 56.202  77.383  1.00 37.05  ? 164  TYR C OH  1 
ATOM   2087  N N   . CYS D  1 15  ? -9.003  52.714  79.762  1.00 34.52  ? 165  CYS C N   1 
ATOM   2088  C CA  . CYS D  1 15  ? -7.957  51.885  80.315  1.00 34.52  ? 165  CYS C CA  1 
ATOM   2089  C C   . CYS D  1 15  ? -8.334  51.433  81.714  1.00 34.52  ? 165  CYS C C   1 
ATOM   2090  O O   . CYS D  1 15  ? -7.845  51.953  82.708  1.00 34.52  ? 165  CYS C O   1 
ATOM   2091  C CB  . CYS D  1 15  ? -6.610  52.620  80.354  1.00 34.52  ? 165  CYS C CB  1 
ATOM   2092  S SG  . CYS D  1 15  ? -5.201  51.549  80.906  1.00 34.52  ? 165  CYS C SG  1 
ATOM   2093  N N   . LEU D  1 16  ? -9.218  50.458  81.790  1.00 40.00  ? 166  LEU C N   1 
ATOM   2094  C CA  . LEU D  1 16  ? -9.605  49.939  83.078  1.00 40.00  ? 166  LEU C CA  1 
ATOM   2095  C C   . LEU D  1 16  ? -8.375  49.521  83.859  1.00 40.00  ? 166  LEU C C   1 
ATOM   2096  O O   . LEU D  1 16  ? -7.449  48.914  83.300  1.00 40.00  ? 166  LEU C O   1 
ATOM   2097  C CB  . LEU D  1 16  ? -10.448 48.704  82.910  1.00 40.00  ? 166  LEU C CB  1 
ATOM   2098  C CG  . LEU D  1 16  ? -11.918 48.980  82.846  1.00 40.00  ? 166  LEU C CG  1 
ATOM   2099  C CD1 . LEU D  1 16  ? -12.214 49.548  81.478  1.00 40.00  ? 166  LEU C CD1 1 
ATOM   2100  C CD2 . LEU D  1 16  ? -12.680 47.697  83.096  1.00 40.00  ? 166  LEU C CD2 1 
ATOM   2101  N N   . ILE D  1 17  ? -8.383  49.817  85.155  1.00 25.18  ? 167  ILE C N   1 
ATOM   2102  C CA  . ILE D  1 17  ? -7.287  49.437  86.027  1.00 25.18  ? 167  ILE C CA  1 
ATOM   2103  C C   . ILE D  1 17  ? -7.891  48.875  87.302  1.00 25.18  ? 167  ILE C C   1 
ATOM   2104  O O   . ILE D  1 17  ? -8.103  49.613  88.261  1.00 25.18  ? 167  ILE C O   1 
ATOM   2105  C CB  . ILE D  1 17  ? -6.374  50.655  86.378  1.00 25.18  ? 167  ILE C CB  1 
ATOM   2106  C CG1 . ILE D  1 17  ? -5.649  51.155  85.115  1.00 25.18  ? 167  ILE C CG1 1 
ATOM   2107  C CG2 . ILE D  1 17  ? -5.356  50.267  87.490  1.00 25.18  ? 167  ILE C CG2 1 
ATOM   2108  C CD1 . ILE D  1 17  ? -4.526  52.124  85.411  1.00 25.18  ? 167  ILE C CD1 1 
ATOM   2109  N N   . ILE D  1 18  ? -8.208  47.581  87.309  1.00 34.29  ? 168  ILE C N   1 
ATOM   2110  C CA  . ILE D  1 18  ? -8.774  46.966  88.507  1.00 34.29  ? 168  ILE C CA  1 
ATOM   2111  C C   . ILE D  1 18  ? -7.598  46.683  89.396  1.00 34.29  ? 168  ILE C C   1 
ATOM   2112  O O   . ILE D  1 18  ? -6.810  45.802  89.096  1.00 34.29  ? 168  ILE C O   1 
ATOM   2113  C CB  . ILE D  1 18  ? -9.478  45.645  88.196  1.00 34.29  ? 168  ILE C CB  1 
ATOM   2114  C CG1 . ILE D  1 18  ? -10.758 45.923  87.415  1.00 34.29  ? 168  ILE C CG1 1 
ATOM   2115  C CG2 . ILE D  1 18  ? -9.772  44.902  89.495  1.00 34.29  ? 168  ILE C CG2 1 
ATOM   2116  C CD1 . ILE D  1 18  ? -11.736 44.777  87.429  1.00 34.29  ? 168  ILE C CD1 1 
ATOM   2117  N N   . ASN D  1 19  ? -7.473  47.427  90.482  1.00 56.05  ? 169  ASN C N   1 
ATOM   2118  C CA  . ASN D  1 19  ? -6.353  47.261  91.385  1.00 56.05  ? 169  ASN C CA  1 
ATOM   2119  C C   . ASN D  1 19  ? -6.828  46.829  92.769  1.00 56.05  ? 169  ASN C C   1 
ATOM   2120  O O   . ASN D  1 19  ? -7.507  47.584  93.466  1.00 56.05  ? 169  ASN C O   1 
ATOM   2121  C CB  . ASN D  1 19  ? -5.585  48.583  91.440  1.00 56.05  ? 169  ASN C CB  1 
ATOM   2122  C CG  . ASN D  1 19  ? -4.654  48.672  92.617  1.00 56.05  ? 169  ASN C CG  1 
ATOM   2123  O OD1 . ASN D  1 19  ? -5.038  48.366  93.734  1.00 56.05  ? 169  ASN C OD1 1 
ATOM   2124  N ND2 . ASN D  1 19  ? -3.416  49.101  92.376  1.00 56.05  ? 169  ASN C ND2 1 
ATOM   2125  N N   . ASN D  1 20  ? -6.472  45.610  93.163  1.00 32.77  ? 170  ASN C N   1 
ATOM   2126  C CA  . ASN D  1 20  ? -6.866  45.080  94.458  1.00 32.77  ? 170  ASN C CA  1 
ATOM   2127  C C   . ASN D  1 20  ? -5.694  45.116  95.438  1.00 32.77  ? 170  ASN C C   1 
ATOM   2128  O O   . ASN D  1 20  ? -4.604  44.660  95.112  1.00 32.77  ? 170  ASN C O   1 
ATOM   2129  C CB  . ASN D  1 20  ? -7.343  43.640  94.295  1.00 32.77  ? 170  ASN C CB  1 
ATOM   2130  C CG  . ASN D  1 20  ? -8.608  43.535  93.482  1.00 32.77  ? 170  ASN C CG  1 
ATOM   2131  O OD1 . ASN D  1 20  ? -9.302  44.522  93.253  1.00 32.77  ? 170  ASN C OD1 1 
ATOM   2132  N ND2 . ASN D  1 20  ? -8.919  42.331  93.041  1.00 32.77  ? 170  ASN C ND2 1 
ATOM   2133  N N   . HIS D  1 21  ? -5.914  45.633  96.643  1.00 52.54  ? 171  HIS C N   1 
ATOM   2134  C CA  . HIS D  1 21  ? -4.842  45.712  97.629  1.00 52.54  ? 171  HIS C CA  1 
ATOM   2135  C C   . HIS D  1 21  ? -5.257  45.098  98.943  1.00 52.54  ? 171  HIS C C   1 
ATOM   2136  O O   . HIS D  1 21  ? -4.542  44.277  99.516  1.00 52.54  ? 171  HIS C O   1 
ATOM   2137  C CB  . HIS D  1 21  ? -4.457  47.174  97.876  1.00 52.54  ? 171  HIS C CB  1 
ATOM   2138  C CG  . HIS D  1 21  ? -3.631  47.390  99.112  1.00 52.54  ? 171  HIS C CG  1 
ATOM   2139  N ND1 . HIS D  1 21  ? -2.403  48.017  99.083  1.00 52.54  ? 171  HIS C ND1 1 
ATOM   2140  C CD2 . HIS D  1 21  ? -3.850  47.057  100.408 1.00 52.54  ? 171  HIS C CD2 1 
ATOM   2141  C CE1 . HIS D  1 21  ? -1.901  48.057  100.306 1.00 52.54  ? 171  HIS C CE1 1 
ATOM   2142  N NE2 . HIS D  1 21  ? -2.758  47.480  101.127 1.00 52.54  ? 171  HIS C NE2 1 
ATOM   2143  N N   . ASN D  1 22  ? -6.405  45.532  99.440  1.00 59.68  ? 172  ASN C N   1 
ATOM   2144  C CA  . ASN D  1 22  ? -6.885  45.031  100.710 1.00 59.68  ? 172  ASN C CA  1 
ATOM   2145  C C   . ASN D  1 22  ? -7.609  43.713  100.554 1.00 59.68  ? 172  ASN C C   1 
ATOM   2146  O O   . ASN D  1 22  ? -8.714  43.652  100.024 1.00 59.68  ? 172  ASN C O   1 
ATOM   2147  C CB  . ASN D  1 22  ? -7.807  46.050  101.367 1.00 59.68  ? 172  ASN C CB  1 
ATOM   2148  C CG  . ASN D  1 22  ? -8.429  45.521  102.628 1.00 59.68  ? 172  ASN C CG  1 
ATOM   2149  O OD1 . ASN D  1 22  ? -7.798  44.769  103.375 1.00 59.68  ? 172  ASN C OD1 1 
ATOM   2150  N ND2 . ASN D  1 22  ? -9.679  45.901  102.874 1.00 59.68  ? 172  ASN C ND2 1 
ATOM   2151  N N   . PHE D  1 23  ? -6.977  42.651  101.025 1.00 34.31  ? 173  PHE C N   1 
ATOM   2152  C CA  . PHE D  1 23  ? -7.580  41.342  100.935 1.00 34.31  ? 173  PHE C CA  1 
ATOM   2153  C C   . PHE D  1 23  ? -8.030  40.856  102.285 1.00 34.31  ? 173  PHE C C   1 
ATOM   2154  O O   . PHE D  1 23  ? -8.001  39.667  102.560 1.00 34.31  ? 173  PHE C O   1 
ATOM   2155  C CB  . PHE D  1 23  ? -6.597  40.349  100.328 1.00 34.31  ? 173  PHE C CB  1 
ATOM   2156  C CG  . PHE D  1 23  ? -6.450  40.495  98.839  1.00 34.31  ? 173  PHE C CG  1 
ATOM   2157  C CD1 . PHE D  1 23  ? -5.832  41.622  98.296  1.00 34.31  ? 173  PHE C CD1 1 
ATOM   2158  C CD2 . PHE D  1 23  ? -6.980  39.541  97.979  1.00 34.31  ? 173  PHE C CD2 1 
ATOM   2159  C CE1 . PHE D  1 23  ? -5.747  41.803  96.921  1.00 34.31  ? 173  PHE C CE1 1 
ATOM   2160  C CE2 . PHE D  1 23  ? -6.903  39.711  96.599  1.00 34.31  ? 173  PHE C CE2 1 
ATOM   2161  C CZ  . PHE D  1 23  ? -6.284  40.847  96.068  1.00 34.31  ? 173  PHE C CZ  1 
ATOM   2162  N N   . ALA D  1 24  ? -8.444  41.782  103.135 1.00 40.91  ? 174  ALA C N   1 
ATOM   2163  C CA  . ALA D  1 24  ? -8.908  41.396  104.447 1.00 40.91  ? 174  ALA C CA  1 
ATOM   2164  C C   . ALA D  1 24  ? -10.165 40.598  104.197 1.00 40.91  ? 174  ALA C C   1 
ATOM   2165  O O   . ALA D  1 24  ? -10.447 39.617  104.883 1.00 40.91  ? 174  ALA C O   1 
ATOM   2166  C CB  . ALA D  1 24  ? -9.217  42.612  105.266 1.00 40.91  ? 174  ALA C CB  1 
ATOM   2167  N N   . LYS D  1 25  ? -10.916 41.016  103.190 1.00 60.43  ? 175  LYS C N   1 
ATOM   2168  C CA  . LYS D  1 25  ? -12.144 40.331  102.860 1.00 60.43  ? 175  LYS C CA  1 
ATOM   2169  C C   . LYS D  1 25  ? -11.804 38.865  102.709 1.00 60.43  ? 175  LYS C C   1 
ATOM   2170  O O   . LYS D  1 25  ? -12.292 38.022  103.459 1.00 60.43  ? 175  LYS C O   1 
ATOM   2171  C CB  . LYS D  1 25  ? -12.705 40.876  101.553 1.00 60.43  ? 175  LYS C CB  1 
ATOM   2172  C CG  . LYS D  1 25  ? -13.734 41.966  101.735 1.00 60.43  ? 175  LYS C CG  1 
ATOM   2173  C CD  . LYS D  1 25  ? -14.872 41.500  102.650 1.00 60.43  ? 175  LYS C CD  1 
ATOM   2174  C CE  . LYS D  1 25  ? -16.198 42.213  102.320 1.00 60.43  ? 175  LYS C CE  1 
ATOM   2175  N NZ  . LYS D  1 25  ? -16.344 43.566  102.951 1.00 60.43  ? 175  LYS C NZ  1 
ATOM   2176  N N   . ALA D  1 26  A -10.937 38.572  101.747 1.00 59.97  ? 175  ALA C N   1 
ATOM   2177  C CA  . ALA D  1 26  A -10.533 37.201  101.476 1.00 59.97  ? 175  ALA C CA  1 
ATOM   2178  C C   . ALA D  1 26  A -10.139 36.469  102.749 1.00 59.97  ? 175  ALA C C   1 
ATOM   2179  O O   . ALA D  1 26  A -10.781 35.495  103.146 1.00 59.97  ? 175  ALA C O   1 
ATOM   2180  C CB  . ALA D  1 26  A -9.378  37.191  100.492 1.00 59.97  ? 175  ALA C CB  1 
ATOM   2181  N N   . ARG D  1 27  B -9.074  36.951  103.377 1.00 52.03  ? 175  ARG C N   1 
ATOM   2182  C CA  . ARG D  1 27  B -8.561  36.362  104.602 1.00 52.03  ? 175  ARG C CA  1 
ATOM   2183  C C   . ARG D  1 27  B -9.701  35.947  105.511 1.00 52.03  ? 175  ARG C C   1 
ATOM   2184  O O   . ARG D  1 27  B -9.724  34.821  106.014 1.00 52.03  ? 175  ARG C O   1 
ATOM   2185  C CB  . ARG D  1 27  B -7.675  37.366  105.329 1.00 52.03  ? 175  ARG C CB  1 
ATOM   2186  C CG  . ARG D  1 27  B -6.205  37.021  105.285 1.00 52.03  ? 175  ARG C CG  1 
ATOM   2187  C CD  . ARG D  1 27  B -5.365  38.166  105.818 1.00 52.03  ? 175  ARG C CD  1 
ATOM   2188  N NE  . ARG D  1 27  B -5.187  39.208  104.815 1.00 52.03  ? 175  ARG C NE  1 
ATOM   2189  C CZ  . ARG D  1 27  B -5.578  40.470  104.960 1.00 52.03  ? 175  ARG C CZ  1 
ATOM   2190  N NH1 . ARG D  1 27  B -6.180  40.870  106.077 1.00 52.03  ? 175  ARG C NH1 1 
ATOM   2191  N NH2 . ARG D  1 27  B -5.370  41.332  103.982 1.00 52.03  ? 175  ARG C NH2 1 
ATOM   2192  N N   . GLU D  1 28  C -10.659 36.853  105.690 1.00 65.84  ? 175  GLU C N   1 
ATOM   2193  C CA  . GLU D  1 28  C -11.809 36.618  106.558 1.00 65.84  ? 175  GLU C CA  1 
ATOM   2194  C C   . GLU D  1 28  C -12.825 35.539  106.136 1.00 65.84  ? 175  GLU C C   1 
ATOM   2195  O O   . GLU D  1 28  C -13.506 34.967  106.984 1.00 65.84  ? 175  GLU C O   1 
ATOM   2196  C CB  . GLU D  1 28  C -12.553 37.944  106.792 1.00 65.84  ? 175  GLU C CB  1 
ATOM   2197  C CG  . GLU D  1 28  C -13.803 37.822  107.671 1.00 65.84  ? 175  GLU C CG  1 
ATOM   2198  C CD  . GLU D  1 28  C -14.800 38.952  107.457 1.00 65.84  ? 175  GLU C CD  1 
ATOM   2199  O OE1 . GLU D  1 28  C -14.416 40.133  107.624 1.00 65.84  ? 175  GLU C OE1 1 
ATOM   2200  O OE2 . GLU D  1 28  C -15.968 38.653  107.126 1.00 65.84  ? 175  GLU C OE2 1 
ATOM   2201  N N   . LYS D  1 29  D -12.945 35.242  104.851 1.00 72.04  ? 175  LYS C N   1 
ATOM   2202  C CA  . LYS D  1 29  D -13.932 34.245  104.465 1.00 72.04  ? 175  LYS C CA  1 
ATOM   2203  C C   . LYS D  1 29  D -13.377 32.898  104.006 1.00 72.04  ? 175  LYS C C   1 
ATOM   2204  O O   . LYS D  1 29  D -13.626 31.880  104.653 1.00 72.04  ? 175  LYS C O   1 
ATOM   2205  C CB  . LYS D  1 29  D -14.859 34.834  103.408 1.00 72.04  ? 175  LYS C CB  1 
ATOM   2206  C CG  . LYS D  1 29  D -15.339 36.233  103.754 1.00 72.04  ? 175  LYS C CG  1 
ATOM   2207  C CD  . LYS D  1 29  D -16.848 36.281  103.922 1.00 72.04  ? 175  LYS C CD  1 
ATOM   2208  C CE  . LYS D  1 29  D -17.314 37.672  104.353 1.00 72.04  ? 175  LYS C CE  1 
ATOM   2209  N NZ  . LYS D  1 29  D -17.991 37.652  105.690 1.00 72.04  ? 175  LYS C NZ  1 
ATOM   2210  N N   . VAL D  1 30  E -12.631 32.879  102.904 1.00 58.46  ? 175  VAL C N   1 
ATOM   2211  C CA  . VAL D  1 30  E -12.070 31.626  102.402 1.00 58.46  ? 175  VAL C CA  1 
ATOM   2212  C C   . VAL D  1 30  E -10.930 31.125  103.285 1.00 58.46  ? 175  VAL C C   1 
ATOM   2213  O O   . VAL D  1 30  E -9.885  31.772  103.409 1.00 58.46  ? 175  VAL C O   1 
ATOM   2214  C CB  . VAL D  1 30  E -11.557 31.781  100.958 1.00 58.46  ? 175  VAL C CB  1 
ATOM   2215  C CG1 . VAL D  1 30  E -10.796 33.070  100.827 1.00 58.46  ? 175  VAL C CG1 1 
ATOM   2216  C CG2 . VAL D  1 30  E -10.683 30.592  100.570 1.00 58.46  ? 175  VAL C CG2 1 
ATOM   2217  N N   . PRO D  1 31  F -11.120 29.952  103.909 1.00 53.74  ? 175  PRO C N   1 
ATOM   2218  C CA  . PRO D  1 31  F -10.135 29.325  104.800 1.00 53.74  ? 175  PRO C CA  1 
ATOM   2219  C C   . PRO D  1 31  F -8.729  29.226  104.229 1.00 53.74  ? 175  PRO C C   1 
ATOM   2220  O O   . PRO D  1 31  F -7.801  29.848  104.746 1.00 53.74  ? 175  PRO C O   1 
ATOM   2221  C CB  . PRO D  1 31  F -10.726 27.950  105.081 1.00 53.74  ? 175  PRO C CB  1 
ATOM   2222  C CG  . PRO D  1 31  F -12.193 28.127  104.883 1.00 53.74  ? 175  PRO C CG  1 
ATOM   2223  C CD  . PRO D  1 31  F -12.341 29.135  103.780 1.00 53.74  ? 175  PRO C CD  1 
ATOM   2224  N N   . LYS D  1 32  G -8.587  28.440  103.164 1.00 39.03  ? 175  LYS C N   1 
ATOM   2225  C CA  . LYS D  1 32  G -7.303  28.212  102.500 1.00 39.03  ? 175  LYS C CA  1 
ATOM   2226  C C   . LYS D  1 32  G -6.505  29.460  102.121 1.00 39.03  ? 175  LYS C C   1 
ATOM   2227  O O   . LYS D  1 32  G -5.384  29.345  101.620 1.00 39.03  ? 175  LYS C O   1 
ATOM   2228  C CB  . LYS D  1 32  G -7.502  27.353  101.241 1.00 39.03  ? 175  LYS C CB  1 
ATOM   2229  C CG  . LYS D  1 32  G -8.088  28.110  100.039 1.00 39.03  ? 175  LYS C CG  1 
ATOM   2230  C CD  . LYS D  1 32  G -7.288  27.909  98.740  1.00 39.03  ? 175  LYS C CD  1 
ATOM   2231  C CE  . LYS D  1 32  G -8.167  28.089  97.494  1.00 39.03  ? 175  LYS C CE  1 
ATOM   2232  N NZ  . LYS D  1 32  G -7.426  27.893  96.216  1.00 39.03  ? 175  LYS C NZ  1 
ATOM   2233  N N   . LEU D  1 33  H -7.079  30.640  102.338 1.00 41.72  ? 175  LEU C N   1 
ATOM   2234  C CA  . LEU D  1 33  H -6.391  31.883  102.014 1.00 41.72  ? 175  LEU C CA  1 
ATOM   2235  C C   . LEU D  1 33  H -6.167  32.695  103.275 1.00 41.72  ? 175  LEU C C   1 
ATOM   2236  O O   . LEU D  1 33  H -5.858  33.885  103.223 1.00 41.72  ? 175  LEU C O   1 
ATOM   2237  C CB  . LEU D  1 33  H -7.204  32.684  101.006 1.00 41.72  ? 175  LEU C CB  1 
ATOM   2238  C CG  . LEU D  1 33  H -7.685  31.816  99.849  1.00 41.72  ? 175  LEU C CG  1 
ATOM   2239  C CD1 . LEU D  1 33  H -8.229  32.668  98.737  1.00 41.72  ? 175  LEU C CD1 1 
ATOM   2240  C CD2 . LEU D  1 33  H -6.539  30.988  99.342  1.00 41.72  ? 175  LEU C CD2 1 
ATOM   2241  N N   . HIS D  1 34  I -6.336  32.030  104.411 1.00 81.15  ? 175  HIS C N   1 
ATOM   2242  C CA  . HIS D  1 34  I -6.149  32.615  105.731 1.00 81.15  ? 175  HIS C CA  1 
ATOM   2243  C C   . HIS D  1 34  I -4.998  33.614  105.829 1.00 81.15  ? 175  HIS C C   1 
ATOM   2244  O O   . HIS D  1 34  I -5.101  34.607  106.542 1.00 81.15  ? 175  HIS C O   1 
ATOM   2245  C CB  . HIS D  1 34  I -5.878  31.497  106.733 1.00 81.15  ? 175  HIS C CB  1 
ATOM   2246  C CG  . HIS D  1 34  I -4.527  30.853  106.569 1.00 81.15  ? 175  HIS C CG  1 
ATOM   2247  N ND1 . HIS D  1 34  I -4.324  29.733  105.789 1.00 81.15  ? 175  HIS C ND1 1 
ATOM   2248  C CD2 . HIS D  1 34  I -3.315  31.172  107.087 1.00 81.15  ? 175  HIS C CD2 1 
ATOM   2249  C CE1 . HIS D  1 34  I -3.047  29.390  105.834 1.00 81.15  ? 175  HIS C CE1 1 
ATOM   2250  N NE2 . HIS D  1 34  I -2.414  30.247  106.614 1.00 81.15  ? 175  HIS C NE2 1 
ATOM   2251  N N   . SER D  1 35  J -3.901  33.350  105.118 1.00 68.93  ? 175  SER C N   1 
ATOM   2252  C CA  . SER D  1 35  J -2.738  34.222  105.220 1.00 68.93  ? 175  SER C CA  1 
ATOM   2253  C C   . SER D  1 35  J -2.349  35.101  104.037 1.00 68.93  ? 175  SER C C   1 
ATOM   2254  O O   . SER D  1 35  J -1.255  35.682  104.032 1.00 68.93  ? 175  SER C O   1 
ATOM   2255  C CB  . SER D  1 35  J -1.516  33.397  105.652 1.00 68.93  ? 175  SER C CB  1 
ATOM   2256  O OG  . SER D  1 35  J -1.154  32.434  104.677 1.00 68.93  ? 175  SER C OG  1 
ATOM   2257  N N   . ILE D  1 36  ? -3.218  35.226  103.044 1.00 66.91  ? 176  ILE C N   1 
ATOM   2258  C CA  . ILE D  1 36  ? -2.879  36.071  101.901 1.00 66.91  ? 176  ILE C CA  1 
ATOM   2259  C C   . ILE D  1 36  ? -2.691  37.505  102.397 1.00 66.91  ? 176  ILE C C   1 
ATOM   2260  O O   . ILE D  1 36  ? -3.596  38.090  102.989 1.00 66.91  ? 176  ILE C O   1 
ATOM   2261  C CB  . ILE D  1 36  ? -3.985  36.066  100.800 1.00 66.91  ? 176  ILE C CB  1 
ATOM   2262  C CG1 . ILE D  1 36  ? -5.368  35.916  101.434 1.00 66.91  ? 176  ILE C CG1 1 
ATOM   2263  C CG2 . ILE D  1 36  ? -3.731  34.950  99.800  1.00 66.91  ? 176  ILE C CG2 1 
ATOM   2264  C CD1 . ILE D  1 36  ? -5.992  37.219  101.906 1.00 66.91  ? 176  ILE C CD1 1 
ATOM   2265  N N   . ARG D  1 37  ? -1.511  38.064  102.163 1.00 74.74  ? 177  ARG C N   1 
ATOM   2266  C CA  . ARG D  1 37  ? -1.234  39.422  102.595 1.00 74.74  ? 177  ARG C CA  1 
ATOM   2267  C C   . ARG D  1 37  ? -1.820  40.436  101.642 1.00 74.74  ? 177  ARG C C   1 
ATOM   2268  O O   . ARG D  1 37  ? -2.217  40.118  100.526 1.00 74.74  ? 177  ARG C O   1 
ATOM   2269  C CB  . ARG D  1 37  ? 0.270   39.665  102.692 1.00 74.74  ? 177  ARG C CB  1 
ATOM   2270  C CG  . ARG D  1 37  ? 1.052   38.510  103.265 1.00 74.74  ? 177  ARG C CG  1 
ATOM   2271  C CD  . ARG D  1 37  ? 2.460   38.937  103.506 1.00 74.74  ? 177  ARG C CD  1 
ATOM   2272  N NE  . ARG D  1 37  ? 3.109   38.070  104.472 1.00 74.74  ? 177  ARG C NE  1 
ATOM   2273  C CZ  . ARG D  1 37  ? 4.218   38.397  105.130 1.00 74.74  ? 177  ARG C CZ  1 
ATOM   2274  N NH1 . ARG D  1 37  ? 4.791   39.583  104.914 1.00 74.74  ? 177  ARG C NH1 1 
ATOM   2275  N NH2 . ARG D  1 37  ? 4.760   37.539  105.998 1.00 74.74  ? 177  ARG C NH2 1 
ATOM   2276  N N   . ASP D  1 38  ? -1.871  41.671  102.104 1.00 51.74  ? 178  ASP C N   1 
ATOM   2277  C CA  . ASP D  1 38  ? -2.371  42.756  101.294 1.00 51.74  ? 178  ASP C CA  1 
ATOM   2278  C C   . ASP D  1 38  ? -1.269  43.071  100.291 1.00 51.74  ? 178  ASP C C   1 
ATOM   2279  O O   . ASP D  1 38  ? -0.083  42.994  100.610 1.00 51.74  ? 178  ASP C O   1 
ATOM   2280  C CB  . ASP D  1 38  ? -2.677  43.948  102.199 1.00 51.74  ? 178  ASP C CB  1 
ATOM   2281  C CG  . ASP D  1 38  ? -3.928  43.724  103.048 1.00 51.74  ? 178  ASP C CG  1 
ATOM   2282  O OD1 . ASP D  1 38  ? -4.822  42.986  102.575 1.00 51.74  ? 178  ASP C OD1 1 
ATOM   2283  O OD2 . ASP D  1 38  ? -4.026  44.276  104.170 1.00 51.74  ? 178  ASP C OD2 1 
ATOM   2284  N N   . ARG D  1 39  ? -1.654  43.398  99.067  1.00 37.53  ? 179  ARG C N   1 
ATOM   2285  C CA  . ARG D  1 39  ? -0.666  43.697  98.034  1.00 37.53  ? 179  ARG C CA  1 
ATOM   2286  C C   . ARG D  1 39  ? -0.035  45.065  98.247  1.00 37.53  ? 179  ARG C C   1 
ATOM   2287  O O   . ARG D  1 39  ? -0.303  46.002  97.495  1.00 37.53  ? 179  ARG C O   1 
ATOM   2288  C CB  . ARG D  1 39  ? -1.306  43.642  96.633  1.00 37.53  ? 179  ARG C CB  1 
ATOM   2289  C CG  . ARG D  1 39  ? -2.411  42.600  96.470  1.00 37.53  ? 179  ARG C CG  1 
ATOM   2290  C CD  . ARG D  1 39  ? -2.092  41.551  95.392  1.00 37.53  ? 179  ARG C CD  1 
ATOM   2291  N NE  . ARG D  1 39  ? -1.185  42.049  94.365  1.00 37.53  ? 179  ARG C NE  1 
ATOM   2292  C CZ  . ARG D  1 39  ? -1.490  43.018  93.510  1.00 37.53  ? 179  ARG C CZ  1 
ATOM   2293  N NH1 . ARG D  1 39  ? -2.681  43.581  93.571  1.00 37.53  ? 179  ARG C NH1 1 
ATOM   2294  N NH2 . ARG D  1 39  ? -0.607  43.425  92.602  1.00 37.53  ? 179  ARG C NH2 1 
ATOM   2295  N N   . ASN D  1 40  ? 0.805   45.186  99.269  1.00 52.95  ? 180  ASN C N   1 
ATOM   2296  C CA  . ASN D  1 40  ? 1.451   46.463  99.540  1.00 52.95  ? 180  ASN C CA  1 
ATOM   2297  C C   . ASN D  1 40  ? 2.391   46.831  98.409  1.00 52.95  ? 180  ASN C C   1 
ATOM   2298  O O   . ASN D  1 40  ? 3.416   46.189  98.199  1.00 52.95  ? 180  ASN C O   1 
ATOM   2299  C CB  . ASN D  1 40  ? 2.218   46.401  100.859 1.00 52.95  ? 180  ASN C CB  1 
ATOM   2300  C CG  . ASN D  1 40  ? 1.295   46.226  102.045 1.00 52.95  ? 180  ASN C CG  1 
ATOM   2301  O OD1 . ASN D  1 40  ? 0.183   46.747  102.049 1.00 52.95  ? 180  ASN C OD1 1 
ATOM   2302  N ND2 . ASN D  1 40  ? 1.744   45.486  103.053 1.00 52.95  ? 180  ASN C ND2 1 
ATOM   2303  N N   . GLY D  1 41  ? 2.027   47.869  97.669  1.00 50.94  ? 181  GLY C N   1 
ATOM   2304  C CA  . GLY D  1 41  ? 2.865   48.293  96.564  1.00 50.94  ? 181  GLY C CA  1 
ATOM   2305  C C   . GLY D  1 41  ? 2.099   48.459  95.267  1.00 50.94  ? 181  GLY C C   1 
ATOM   2306  O O   . GLY D  1 41  ? 2.611   49.070  94.322  1.00 50.94  ? 181  GLY C O   1 
ATOM   2307  N N   . THR D  1 42  ? 0.875   47.930  95.216  1.00 61.38  ? 182  THR C N   1 
ATOM   2308  C CA  . THR D  1 42  ? 0.055   48.020  94.005  1.00 61.38  ? 182  THR C CA  1 
ATOM   2309  C C   . THR D  1 42  ? -0.151  49.456  93.607  1.00 61.38  ? 182  THR C C   1 
ATOM   2310  O O   . THR D  1 42  ? -0.053  49.809  92.437  1.00 61.38  ? 182  THR C O   1 
ATOM   2311  C CB  . THR D  1 42  ? -1.352  47.427  94.172  1.00 61.38  ? 182  THR C CB  1 
ATOM   2312  O OG1 . THR D  1 42  ? -1.516  46.920  95.499  1.00 61.38  ? 182  THR C OG1 1 
ATOM   2313  C CG2 . THR D  1 42  ? -1.572  46.325  93.161  1.00 61.38  ? 182  THR C CG2 1 
ATOM   2314  N N   . HIS D  1 43  ? -0.465  50.278  94.593  1.00 73.56  ? 183  HIS C N   1 
ATOM   2315  C CA  . HIS D  1 43  ? -0.689  51.681  94.347  1.00 73.56  ? 183  HIS C CA  1 
ATOM   2316  C C   . HIS D  1 43  ? 0.337   52.233  93.378  1.00 73.56  ? 183  HIS C C   1 
ATOM   2317  O O   . HIS D  1 43  ? -0.019  52.919  92.419  1.00 73.56  ? 183  HIS C O   1 
ATOM   2318  C CB  . HIS D  1 43  ? -0.642  52.423  95.665  1.00 73.56  ? 183  HIS C CB  1 
ATOM   2319  C CG  . HIS D  1 43  ? -1.571  51.855  96.684  1.00 73.56  ? 183  HIS C CG  1 
ATOM   2320  N ND1 . HIS D  1 43  ? -2.936  52.048  96.628  1.00 73.56  ? 183  HIS C ND1 1 
ATOM   2321  C CD2 . HIS D  1 43  ? -1.340  51.067  97.759  1.00 73.56  ? 183  HIS C CD2 1 
ATOM   2322  C CE1 . HIS D  1 43  ? -3.507  51.403  97.628  1.00 73.56  ? 183  HIS C CE1 1 
ATOM   2323  N NE2 . HIS D  1 43  ? -2.561  50.800  98.329  1.00 73.56  ? 183  HIS C NE2 1 
ATOM   2324  N N   . LEU D  1 44  ? 1.606   51.906  93.612  1.00 46.78  ? 184  LEU C N   1 
ATOM   2325  C CA  . LEU D  1 44  ? 2.691   52.379  92.758  1.00 46.78  ? 184  LEU C CA  1 
ATOM   2326  C C   . LEU D  1 44  ? 2.528   51.860  91.334  1.00 46.78  ? 184  LEU C C   1 
ATOM   2327  O O   . LEU D  1 44  ? 2.811   52.572  90.368  1.00 46.78  ? 184  LEU C O   1 
ATOM   2328  C CB  . LEU D  1 44  ? 4.030   51.942  93.344  1.00 46.78  ? 184  LEU C CB  1 
ATOM   2329  C CG  . LEU D  1 44  ? 4.409   52.701  94.626  1.00 46.78  ? 184  LEU C CG  1 
ATOM   2330  C CD1 . LEU D  1 44  ? 3.527   52.258  95.786  1.00 46.78  ? 184  LEU C CD1 1 
ATOM   2331  C CD2 . LEU D  1 44  ? 5.865   52.452  94.958  1.00 46.78  ? 184  LEU C CD2 1 
ATOM   2332  N N   . ASP D  1 45  ? 2.076   50.615  91.214  1.00 44.02  ? 185  ASP C N   1 
ATOM   2333  C CA  . ASP D  1 45  ? 1.837   50.008  89.913  1.00 44.02  ? 185  ASP C CA  1 
ATOM   2334  C C   . ASP D  1 45  ? 0.756   50.860  89.284  1.00 44.02  ? 185  ASP C C   1 
ATOM   2335  O O   . ASP D  1 45  ? 0.929   51.425  88.208  1.00 44.02  ? 185  ASP C O   1 
ATOM   2336  C CB  . ASP D  1 45  ? 1.271   48.599  90.064  1.00 44.02  ? 185  ASP C CB  1 
ATOM   2337  C CG  . ASP D  1 45  ? 2.340   47.538  90.212  1.00 44.02  ? 185  ASP C CG  1 
ATOM   2338  O OD1 . ASP D  1 45  ? 3.551   47.860  90.050  1.00 44.02  ? 185  ASP C OD1 1 
ATOM   2339  O OD2 . ASP D  1 45  ? 1.951   46.372  90.493  1.00 44.02  ? 185  ASP C OD2 1 
ATOM   2340  N N   . ALA D  1 46  ? -0.373  50.925  89.988  1.00 38.92  ? 186  ALA C N   1 
ATOM   2341  C CA  . ALA D  1 46  ? -1.541  51.687  89.568  1.00 38.92  ? 186  ALA C CA  1 
ATOM   2342  C C   . ALA D  1 46  ? -1.168  53.077  89.077  1.00 38.92  ? 186  ALA C C   1 
ATOM   2343  O O   . ALA D  1 46  ? -1.562  53.492  87.984  1.00 38.92  ? 186  ALA C O   1 
ATOM   2344  C CB  . ALA D  1 46  ? -2.501  51.791  90.708  1.00 38.92  ? 186  ALA C CB  1 
ATOM   2345  N N   . GLY D  1 47  ? -0.406  53.804  89.886  1.00 37.48  ? 187  GLY C N   1 
ATOM   2346  C CA  . GLY D  1 47  ? 0.015   55.136  89.482  1.00 37.48  ? 187  GLY C CA  1 
ATOM   2347  C C   . GLY D  1 47  ? 0.745   55.127  88.147  1.00 37.48  ? 187  GLY C C   1 
ATOM   2348  O O   . GLY D  1 47  ? 0.338   55.814  87.191  1.00 37.48  ? 187  GLY C O   1 
ATOM   2349  N N   . ALA D  1 48  ? 1.822   54.344  88.085  1.00 40.19  ? 188  ALA C N   1 
ATOM   2350  C CA  . ALA D  1 48  ? 2.635   54.217  86.879  1.00 40.19  ? 188  ALA C CA  1 
ATOM   2351  C C   . ALA D  1 48  ? 1.772   53.933  85.639  1.00 40.19  ? 188  ALA C C   1 
ATOM   2352  O O   . ALA D  1 48  ? 1.970   54.538  84.578  1.00 40.19  ? 188  ALA C O   1 
ATOM   2353  C CB  . ALA D  1 48  ? 3.669   53.108  87.072  1.00 40.19  ? 188  ALA C CB  1 
ATOM   2354  N N   . LEU D  1 49  ? 0.823   53.010  85.781  1.00 46.68  ? 189  LEU C N   1 
ATOM   2355  C CA  . LEU D  1 49  ? -0.057  52.649  84.681  1.00 46.68  ? 189  LEU C CA  1 
ATOM   2356  C C   . LEU D  1 49  ? -0.885  53.863  84.328  1.00 46.68  ? 189  LEU C C   1 
ATOM   2357  O O   . LEU D  1 49  ? -1.070  54.208  83.150  1.00 46.68  ? 189  LEU C O   1 
ATOM   2358  C CB  . LEU D  1 49  ? -0.963  51.497  85.095  1.00 46.68  ? 189  LEU C CB  1 
ATOM   2359  C CG  . LEU D  1 49  ? -0.330  50.109  84.969  1.00 46.68  ? 189  LEU C CG  1 
ATOM   2360  C CD1 . LEU D  1 49  ? -0.754  49.265  86.159  1.00 46.68  ? 189  LEU C CD1 1 
ATOM   2361  C CD2 . LEU D  1 49  ? -0.762  49.451  83.661  1.00 46.68  ? 189  LEU C CD2 1 
ATOM   2362  N N   . THR D  1 50  ? -1.374  54.523  85.369  1.00 47.12  ? 190  THR C N   1 
ATOM   2363  C CA  . THR D  1 50  ? -2.173  55.715  85.182  1.00 47.12  ? 190  THR C CA  1 
ATOM   2364  C C   . THR D  1 50  ? -1.388  56.726  84.363  1.00 47.12  ? 190  THR C C   1 
ATOM   2365  O O   . THR D  1 50  ? -1.789  57.105  83.257  1.00 47.12  ? 190  THR C O   1 
ATOM   2366  C CB  . THR D  1 50  ? -2.528  56.358  86.510  1.00 47.12  ? 190  THR C CB  1 
ATOM   2367  O OG1 . THR D  1 50  ? -3.619  55.648  87.100  1.00 47.12  ? 190  THR C OG1 1 
ATOM   2368  C CG2 . THR D  1 50  ? -2.946  57.791  86.298  1.00 47.12  ? 190  THR C CG2 1 
ATOM   2369  N N   . THR D  1 51  ? -0.262  57.157  84.919  1.00 31.66  ? 191  THR C N   1 
ATOM   2370  C CA  . THR D  1 51  ? 0.579   58.133  84.243  1.00 31.66  ? 191  THR C CA  1 
ATOM   2371  C C   . THR D  1 51  ? 0.838   57.765  82.787  1.00 31.66  ? 191  THR C C   1 
ATOM   2372  O O   . THR D  1 51  ? 0.280   58.370  81.878  1.00 31.66  ? 191  THR C O   1 
ATOM   2373  C CB  . THR D  1 51  ? 1.954   58.285  84.929  1.00 31.66  ? 191  THR C CB  1 
ATOM   2374  O OG1 . THR D  1 51  ? 1.771   58.676  86.295  1.00 31.66  ? 191  THR C OG1 1 
ATOM   2375  C CG2 . THR D  1 51  ? 2.806   59.321  84.187  1.00 31.66  ? 191  THR C CG2 1 
ATOM   2376  N N   . THR D  1 52  ? 1.681   56.759  82.579  1.00 58.15  ? 192  THR C N   1 
ATOM   2377  C CA  . THR D  1 52  ? 2.045   56.352  81.234  1.00 58.15  ? 192  THR C CA  1 
ATOM   2378  C C   . THR D  1 52  ? 0.880   56.155  80.270  1.00 58.15  ? 192  THR C C   1 
ATOM   2379  O O   . THR D  1 52  ? 0.977   56.545  79.099  1.00 58.15  ? 192  THR C O   1 
ATOM   2380  C CB  . THR D  1 52  ? 2.937   55.092  81.254  1.00 58.15  ? 192  THR C CB  1 
ATOM   2381  O OG1 . THR D  1 52  ? 2.125   53.922  81.250  1.00 58.15  ? 192  THR C OG1 1 
ATOM   2382  C CG2 . THR D  1 52  ? 3.812   55.087  82.491  1.00 58.15  ? 192  THR C CG2 1 
ATOM   2383  N N   . PHE D  1 53  ? -0.233  55.592  80.728  1.00 50.67  ? 193  PHE C N   1 
ATOM   2384  C CA  . PHE D  1 53  ? -1.321  55.403  79.779  1.00 50.67  ? 193  PHE C CA  1 
ATOM   2385  C C   . PHE D  1 53  ? -2.066  56.697  79.494  1.00 50.67  ? 193  PHE C C   1 
ATOM   2386  O O   . PHE D  1 53  ? -2.601  56.893  78.399  1.00 50.67  ? 193  PHE C O   1 
ATOM   2387  C CB  . PHE D  1 53  ? -2.250  54.275  80.236  1.00 50.67  ? 193  PHE C CB  1 
ATOM   2388  C CG  . PHE D  1 53  ? -1.801  52.928  79.745  1.00 50.67  ? 193  PHE C CG  1 
ATOM   2389  C CD1 . PHE D  1 53  ? -1.729  52.666  78.380  1.00 50.67  ? 193  PHE C CD1 1 
ATOM   2390  C CD2 . PHE D  1 53  ? -1.323  51.969  80.632  1.00 50.67  ? 193  PHE C CD2 1 
ATOM   2391  C CE1 . PHE D  1 53  ? -1.176  51.477  77.903  1.00 50.67  ? 193  PHE C CE1 1 
ATOM   2392  C CE2 . PHE D  1 53  ? -0.768  50.776  80.163  1.00 50.67  ? 193  PHE C CE2 1 
ATOM   2393  C CZ  . PHE D  1 53  ? -0.693  50.534  78.795  1.00 50.67  ? 193  PHE C CZ  1 
ATOM   2394  N N   . GLU D  1 54  ? -2.077  57.597  80.469  1.00 58.96  ? 194  GLU C N   1 
ATOM   2395  C CA  . GLU D  1 54  ? -2.726  58.883  80.266  1.00 58.96  ? 194  GLU C CA  1 
ATOM   2396  C C   . GLU D  1 54  ? -1.956  59.580  79.148  1.00 58.96  ? 194  GLU C C   1 
ATOM   2397  O O   . GLU D  1 54  ? -2.549  60.025  78.178  1.00 58.96  ? 194  GLU C O   1 
ATOM   2398  C CB  . GLU D  1 54  ? -2.669  59.728  81.536  1.00 58.96  ? 194  GLU C CB  1 
ATOM   2399  C CG  . GLU D  1 54  ? -4.028  60.069  82.115  1.00 58.96  ? 194  GLU C CG  1 
ATOM   2400  C CD  . GLU D  1 54  ? -3.929  60.684  83.508  1.00 58.96  ? 194  GLU C CD  1 
ATOM   2401  O OE1 . GLU D  1 54  ? -2.809  61.092  83.899  1.00 58.96  ? 194  GLU C OE1 1 
ATOM   2402  O OE2 . GLU D  1 54  ? -4.971  60.759  84.205  1.00 58.96  ? 194  GLU C OE2 1 
ATOM   2403  N N   . GLU D  1 55  ? -0.632  59.646  79.280  1.00 45.00  ? 195  GLU C N   1 
ATOM   2404  C CA  . GLU D  1 55  ? 0.228   60.289  78.280  1.00 45.00  ? 195  GLU C CA  1 
ATOM   2405  C C   . GLU D  1 55  ? 0.015   59.740  76.874  1.00 45.00  ? 195  GLU C C   1 
ATOM   2406  O O   . GLU D  1 55  ? 0.274   60.425  75.883  1.00 45.00  ? 195  GLU C O   1 
ATOM   2407  C CB  . GLU D  1 55  ? 1.706   60.142  78.657  1.00 45.00  ? 195  GLU C CB  1 
ATOM   2408  C CG  . GLU D  1 55  ? 1.942   59.735  80.108  1.00 45.00  ? 195  GLU C CG  1 
ATOM   2409  C CD  . GLU D  1 55  ? 3.251   60.276  80.686  1.00 45.00  ? 195  GLU C CD  1 
ATOM   2410  O OE1 . GLU D  1 55  ? 3.563   61.463  80.436  1.00 45.00  ? 195  GLU C OE1 1 
ATOM   2411  O OE2 . GLU D  1 55  ? 3.964   59.518  81.396  1.00 45.00  ? 195  GLU C OE2 1 
ATOM   2412  N N   . LEU D  1 56  ? -0.450  58.498  76.784  1.00 51.10  ? 196  LEU C N   1 
ATOM   2413  C CA  . LEU D  1 56  ? -0.716  57.887  75.487  1.00 51.10  ? 196  LEU C CA  1 
ATOM   2414  C C   . LEU D  1 56  ? -2.153  58.171  75.077  1.00 51.10  ? 196  LEU C C   1 
ATOM   2415  O O   . LEU D  1 56  ? -2.742  57.448  74.281  1.00 51.10  ? 196  LEU C O   1 
ATOM   2416  C CB  . LEU D  1 56  ? -0.485  56.385  75.548  1.00 51.10  ? 196  LEU C CB  1 
ATOM   2417  C CG  . LEU D  1 56  ? 0.932   55.992  75.963  1.00 51.10  ? 196  LEU C CG  1 
ATOM   2418  C CD1 . LEU D  1 56  ? 0.897   54.608  76.581  1.00 51.10  ? 196  LEU C CD1 1 
ATOM   2419  C CD2 . LEU D  1 56  ? 1.863   56.019  74.748  1.00 51.10  ? 196  LEU C CD2 1 
ATOM   2420  N N   . HIS D  1 57  ? -2.712  59.227  75.653  1.00 57.35  ? 197  HIS C N   1 
ATOM   2421  C CA  . HIS D  1 57  ? -4.064  59.669  75.348  1.00 57.35  ? 197  HIS C CA  1 
ATOM   2422  C C   . HIS D  1 57  ? -5.150  58.618  75.590  1.00 57.35  ? 197  HIS C C   1 
ATOM   2423  O O   . HIS D  1 57  ? -6.051  58.420  74.775  1.00 57.35  ? 197  HIS C O   1 
ATOM   2424  C CB  . HIS D  1 57  ? -4.100  60.199  73.901  1.00 57.35  ? 197  HIS C CB  1 
ATOM   2425  C CG  . HIS D  1 57  ? -3.045  61.228  73.611  1.00 57.35  ? 197  HIS C CG  1 
ATOM   2426  N ND1 . HIS D  1 57  ? -2.868  62.353  74.390  1.00 57.35  ? 197  HIS C ND1 1 
ATOM   2427  C CD2 . HIS D  1 57  ? -2.083  61.278  72.658  1.00 57.35  ? 197  HIS C CD2 1 
ATOM   2428  C CE1 . HIS D  1 57  ? -1.843  63.051  73.930  1.00 57.35  ? 197  HIS C CE1 1 
ATOM   2429  N NE2 . HIS D  1 57  ? -1.350  62.420  72.880  1.00 57.35  ? 197  HIS C NE2 1 
ATOM   2430  N N   . PHE D  1 58  ? -5.063  57.967  76.740  1.00 45.50  ? 198  PHE C N   1 
ATOM   2431  C CA  . PHE D  1 58  ? -6.027  56.950  77.122  1.00 45.50  ? 198  PHE C CA  1 
ATOM   2432  C C   . PHE D  1 58  ? -6.810  57.448  78.317  1.00 45.50  ? 198  PHE C C   1 
ATOM   2433  O O   . PHE D  1 58  ? -6.239  58.094  79.198  1.00 45.50  ? 198  PHE C O   1 
ATOM   2434  C CB  . PHE D  1 58  ? -5.311  55.664  77.521  1.00 45.50  ? 198  PHE C CB  1 
ATOM   2435  C CG  . PHE D  1 58  ? -5.319  54.617  76.458  1.00 45.50  ? 198  PHE C CG  1 
ATOM   2436  C CD1 . PHE D  1 58  ? -4.458  54.711  75.369  1.00 45.50  ? 198  PHE C CD1 1 
ATOM   2437  C CD2 . PHE D  1 58  ? -6.194  53.542  76.534  1.00 45.50  ? 198  PHE C CD2 1 
ATOM   2438  C CE1 . PHE D  1 58  ? -4.469  53.750  74.364  1.00 45.50  ? 198  PHE C CE1 1 
ATOM   2439  C CE2 . PHE D  1 58  ? -6.218  52.572  75.537  1.00 45.50  ? 198  PHE C CE2 1 
ATOM   2440  C CZ  . PHE D  1 58  ? -5.351  52.676  74.445  1.00 45.50  ? 198  PHE C CZ  1 
ATOM   2441  N N   . GLU D  1 59  ? -8.103  57.138  78.359  1.00 71.21  ? 199  GLU C N   1 
ATOM   2442  C CA  . GLU D  1 59  ? -8.946  57.552  79.473  1.00 71.21  ? 199  GLU C CA  1 
ATOM   2443  C C   . GLU D  1 59  ? -8.931  56.488  80.574  1.00 71.21  ? 199  GLU C C   1 
ATOM   2444  O O   . GLU D  1 59  ? -9.497  55.413  80.424  1.00 71.21  ? 199  GLU C O   1 
ATOM   2445  C CB  . GLU D  1 59  ? -10.379 57.803  78.990  1.00 71.21  ? 199  GLU C CB  1 
ATOM   2446  C CG  . GLU D  1 59  ? -11.267 58.453  80.047  1.00 71.21  ? 199  GLU C CG  1 
ATOM   2447  C CD  . GLU D  1 59  ? -11.963 59.712  79.557  1.00 71.21  ? 199  GLU C CD  1 
ATOM   2448  O OE1 . GLU D  1 59  ? -11.271 60.718  79.264  1.00 71.21  ? 199  GLU C OE1 1 
ATOM   2449  O OE2 . GLU D  1 59  ? -13.211 59.691  79.469  1.00 71.21  ? 199  GLU C OE2 1 
ATOM   2450  N N   . ILE D  1 60  ? -8.280  56.796  81.684  1.00 37.26  ? 200  ILE C N   1 
ATOM   2451  C CA  . ILE D  1 60  ? -8.172  55.854  82.785  1.00 37.26  ? 200  ILE C CA  1 
ATOM   2452  C C   . ILE D  1 60  ? -9.500  55.645  83.496  1.00 37.26  ? 200  ILE C C   1 
ATOM   2453  O O   . ILE D  1 60  ? -10.352 56.511  83.501  1.00 37.26  ? 200  ILE C O   1 
ATOM   2454  C CB  . ILE D  1 60  ? -7.106  56.325  83.816  1.00 37.26  ? 200  ILE C CB  1 
ATOM   2455  C CG1 . ILE D  1 60  ? -5.832  56.783  83.096  1.00 37.26  ? 200  ILE C CG1 1 
ATOM   2456  C CG2 . ILE D  1 60  ? -6.762  55.201  84.777  1.00 37.26  ? 200  ILE C CG2 1 
ATOM   2457  C CD1 . ILE D  1 60  ? -5.388  55.867  81.965  1.00 37.26  ? 200  ILE C CD1 1 
ATOM   2458  N N   . LYS D  1 61  ? -9.667  54.483  84.105  1.00 41.51  ? 201  LYS C N   1 
ATOM   2459  C CA  . LYS D  1 61  ? -10.889 54.166  84.815  1.00 41.51  ? 201  LYS C CA  1 
ATOM   2460  C C   . LYS D  1 61  ? -10.556 53.199  85.943  1.00 41.51  ? 201  LYS C C   1 
ATOM   2461  O O   . LYS D  1 61  ? -10.863 52.014  85.869  1.00 41.51  ? 201  LYS C O   1 
ATOM   2462  C CB  . LYS D  1 61  ? -11.881 53.536  83.850  1.00 41.51  ? 201  LYS C CB  1 
ATOM   2463  C CG  . LYS D  1 61  ? -12.403 54.510  82.814  1.00 41.51  ? 201  LYS C CG  1 
ATOM   2464  C CD  . LYS D  1 61  ? -13.344 55.499  83.460  1.00 41.51  ? 201  LYS C CD  1 
ATOM   2465  C CE  . LYS D  1 61  ? -13.638 56.667  82.558  1.00 41.51  ? 201  LYS C CE  1 
ATOM   2466  N NZ  . LYS D  1 61  ? -14.338 57.758  83.295  1.00 41.51  ? 201  LYS C NZ  1 
ATOM   2467  N N   . PRO D  1 62  ? -9.925  53.705  87.007  1.00 46.45  ? 202  PRO C N   1 
ATOM   2468  C CA  . PRO D  1 62  ? -9.517  52.938  88.184  1.00 46.45  ? 202  PRO C CA  1 
ATOM   2469  C C   . PRO D  1 62  ? -10.656 52.359  89.016  1.00 46.45  ? 202  PRO C C   1 
ATOM   2470  O O   . PRO D  1 62  ? -11.764 52.877  88.993  1.00 46.45  ? 202  PRO C O   1 
ATOM   2471  C CB  . PRO D  1 62  ? -8.709  53.943  88.996  1.00 46.45  ? 202  PRO C CB  1 
ATOM   2472  C CG  . PRO D  1 62  ? -8.407  55.056  88.058  1.00 46.45  ? 202  PRO C CG  1 
ATOM   2473  C CD  . PRO D  1 62  ? -9.559  55.120  87.134  1.00 46.45  ? 202  PRO C CD  1 
ATOM   2474  N N   . HIS D  1 63  ? -10.370 51.284  89.746  1.00 43.74  ? 203  HIS C N   1 
ATOM   2475  C CA  . HIS D  1 63  ? -11.326 50.640  90.648  1.00 43.74  ? 203  HIS C CA  1 
ATOM   2476  C C   . HIS D  1 63  ? -10.515 49.902  91.690  1.00 43.74  ? 203  HIS C C   1 
ATOM   2477  O O   . HIS D  1 63  ? -9.602  49.163  91.340  1.00 43.74  ? 203  HIS C O   1 
ATOM   2478  C CB  . HIS D  1 63  ? -12.200 49.670  89.905  1.00 43.74  ? 203  HIS C CB  1 
ATOM   2479  C CG  . HIS D  1 63  ? -13.218 50.346  89.065  1.00 43.74  ? 203  HIS C CG  1 
ATOM   2480  N ND1 . HIS D  1 63  ? -12.919 50.868  87.827  1.00 43.74  ? 203  HIS C ND1 1 
ATOM   2481  C CD2 . HIS D  1 63  ? -14.517 50.640  89.299  1.00 43.74  ? 203  HIS C CD2 1 
ATOM   2482  C CE1 . HIS D  1 63  ? -13.993 51.458  87.333  1.00 43.74  ? 203  HIS C CE1 1 
ATOM   2483  N NE2 . HIS D  1 63  ? -14.976 51.334  88.205  1.00 43.74  ? 203  HIS C NE2 1 
ATOM   2484  N N   . HIS D  1 64  ? -10.835 50.082  92.965  1.00 57.98  ? 204  HIS C N   1 
ATOM   2485  C CA  . HIS D  1 64  ? -10.047 49.435  94.002  1.00 57.98  ? 204  HIS C CA  1 
ATOM   2486  C C   . HIS D  1 64  ? -10.722 48.270  94.688  1.00 57.98  ? 204  HIS C C   1 
ATOM   2487  O O   . HIS D  1 64  ? -11.946 48.177  94.712  1.00 57.98  ? 204  HIS C O   1 
ATOM   2488  C CB  . HIS D  1 64  ? -9.614  50.480  95.021  1.00 57.98  ? 204  HIS C CB  1 
ATOM   2489  C CG  . HIS D  1 64  ? -8.896  51.640  94.406  1.00 57.98  ? 204  HIS C CG  1 
ATOM   2490  N ND1 . HIS D  1 64  ? -7.522  51.745  94.406  1.00 57.98  ? 204  HIS C ND1 1 
ATOM   2491  C CD2 . HIS D  1 64  ? -9.357  52.715  93.722  1.00 57.98  ? 204  HIS C CD2 1 
ATOM   2492  C CE1 . HIS D  1 64  ? -7.166  52.835  93.747  1.00 57.98  ? 204  HIS C CE1 1 
ATOM   2493  N NE2 . HIS D  1 64  ? -8.260  53.441  93.323  1.00 57.98  ? 204  HIS C NE2 1 
ATOM   2494  N N   . ASP D  1 65  ? -9.899  47.378  95.229  1.00 66.61  ? 205  ASP C N   1 
ATOM   2495  C CA  . ASP D  1 65  ? -10.356 46.188  95.931  1.00 66.61  ? 205  ASP C CA  1 
ATOM   2496  C C   . ASP D  1 65  ? -11.731 45.711  95.467  1.00 66.61  ? 205  ASP C C   1 
ATOM   2497  O O   . ASP D  1 65  ? -12.708 45.791  96.224  1.00 66.61  ? 205  ASP C O   1 
ATOM   2498  C CB  . ASP D  1 65  ? -10.398 46.453  97.440  1.00 66.61  ? 205  ASP C CB  1 
ATOM   2499  C CG  . ASP D  1 65  ? -9.141  47.136  97.958  1.00 66.61  ? 205  ASP C CG  1 
ATOM   2500  O OD1 . ASP D  1 65  ? -8.145  47.195  97.220  1.00 66.61  ? 205  ASP C OD1 1 
ATOM   2501  O OD2 . ASP D  1 65  ? -9.142  47.614  99.109  1.00 66.61  ? 205  ASP C OD2 1 
ATOM   2502  N N   . CYS D  1 66  ? -11.817 45.222  94.232  1.00 42.04  ? 206  CYS C N   1 
ATOM   2503  C CA  . CYS D  1 66  ? -13.089 44.735  93.711  1.00 42.04  ? 206  CYS C CA  1 
ATOM   2504  C C   . CYS D  1 66  ? -13.232 43.248  93.921  1.00 42.04  ? 206  CYS C C   1 
ATOM   2505  O O   . CYS D  1 66  ? -12.330 42.493  93.597  1.00 42.04  ? 206  CYS C O   1 
ATOM   2506  C CB  . CYS D  1 66  ? -13.209 45.022  92.225  1.00 42.04  ? 206  CYS C CB  1 
ATOM   2507  S SG  . CYS D  1 66  ? -12.506 46.596  91.756  1.00 42.04  ? 206  CYS C SG  1 
ATOM   2508  N N   . THR D  1 67  ? -14.363 42.824  94.469  1.00 34.93  ? 207  THR C N   1 
ATOM   2509  C CA  . THR D  1 67  ? -14.580 41.409  94.672  1.00 34.93  ? 207  THR C CA  1 
ATOM   2510  C C   . THR D  1 67  ? -14.734 40.826  93.283  1.00 34.93  ? 207  THR C C   1 
ATOM   2511  O O   . THR D  1 67  ? -14.861 41.570  92.303  1.00 34.93  ? 207  THR C O   1 
ATOM   2512  C CB  . THR D  1 67  ? -15.849 41.173  95.425  1.00 34.93  ? 207  THR C CB  1 
ATOM   2513  O OG1 . THR D  1 67  ? -16.954 41.535  94.597  1.00 34.93  ? 207  THR C OG1 1 
ATOM   2514  C CG2 . THR D  1 67  ? -15.856 42.016  96.672  1.00 34.93  ? 207  THR C CG2 1 
ATOM   2515  N N   . VAL D  1 68  ? -14.715 39.503  93.185  1.00 45.82  ? 208  VAL C N   1 
ATOM   2516  C CA  . VAL D  1 68  ? -14.870 38.881  91.891  1.00 45.82  ? 208  VAL C CA  1 
ATOM   2517  C C   . VAL D  1 68  ? -16.086 39.529  91.257  1.00 45.82  ? 208  VAL C C   1 
ATOM   2518  O O   . VAL D  1 68  ? -16.012 40.113  90.176  1.00 45.82  ? 208  VAL C O   1 
ATOM   2519  C CB  . VAL D  1 68  ? -15.100 37.376  92.044  1.00 45.82  ? 208  VAL C CB  1 
ATOM   2520  C CG1 . VAL D  1 68  ? -16.076 36.876  90.991  1.00 45.82  ? 208  VAL C CG1 1 
ATOM   2521  C CG2 . VAL D  1 68  ? -13.770 36.653  91.925  1.00 45.82  ? 208  VAL C CG2 1 
ATOM   2522  N N   . GLU D  1 69  ? -17.202 39.439  91.969  1.00 50.50  ? 209  GLU C N   1 
ATOM   2523  C CA  . GLU D  1 69  ? -18.458 40.001  91.519  1.00 50.50  ? 209  GLU C CA  1 
ATOM   2524  C C   . GLU D  1 69  ? -18.281 41.398  90.945  1.00 50.50  ? 209  GLU C C   1 
ATOM   2525  O O   . GLU D  1 69  ? -18.634 41.655  89.794  1.00 50.50  ? 209  GLU C O   1 
ATOM   2526  C CB  . GLU D  1 69  ? -19.430 40.046  92.681  1.00 50.50  ? 209  GLU C CB  1 
ATOM   2527  C CG  . GLU D  1 69  ? -20.826 40.441  92.258  1.00 50.50  ? 209  GLU C CG  1 
ATOM   2528  C CD  . GLU D  1 69  ? -21.914 39.891  93.186  1.00 50.50  ? 209  GLU C CD  1 
ATOM   2529  O OE1 . GLU D  1 69  ? -22.143 40.493  94.261  1.00 50.50  ? 209  GLU C OE1 1 
ATOM   2530  O OE2 . GLU D  1 69  ? -22.547 38.864  92.842  1.00 50.50  ? 209  GLU C OE2 1 
ATOM   2531  N N   . GLN D  1 70  ? -17.731 42.301  91.748  1.00 39.07  ? 210  GLN C N   1 
ATOM   2532  C CA  . GLN D  1 70  ? -17.517 43.666  91.291  1.00 39.07  ? 210  GLN C CA  1 
ATOM   2533  C C   . GLN D  1 70  ? -16.803 43.679  89.944  1.00 39.07  ? 210  GLN C C   1 
ATOM   2534  O O   . GLN D  1 70  ? -17.218 44.382  89.020  1.00 39.07  ? 210  GLN C O   1 
ATOM   2535  C CB  . GLN D  1 70  ? -16.670 44.447  92.292  1.00 39.07  ? 210  GLN C CB  1 
ATOM   2536  C CG  . GLN D  1 70  ? -17.455 45.267  93.287  1.00 39.07  ? 210  GLN C CG  1 
ATOM   2537  C CD  . GLN D  1 70  ? -17.020 44.983  94.715  1.00 39.07  ? 210  GLN C CD  1 
ATOM   2538  O OE1 . GLN D  1 70  ? -16.399 45.824  95.379  1.00 39.07  ? 210  GLN C OE1 1 
ATOM   2539  N NE2 . GLN D  1 70  ? -17.336 43.786  95.191  1.00 39.07  ? 210  GLN C NE2 1 
ATOM   2540  N N   . ILE D  1 71  ? -15.726 42.903  89.840  1.00 38.66  ? 211  ILE C N   1 
ATOM   2541  C CA  . ILE D  1 71  ? -14.948 42.850  88.608  1.00 38.66  ? 211  ILE C CA  1 
ATOM   2542  C C   . ILE D  1 71  ? -15.837 42.577  87.414  1.00 38.66  ? 211  ILE C C   1 
ATOM   2543  O O   . ILE D  1 71  ? -15.753 43.266  86.395  1.00 38.66  ? 211  ILE C O   1 
ATOM   2544  C CB  . ILE D  1 71  ? -13.882 41.749  88.634  1.00 38.66  ? 211  ILE C CB  1 
ATOM   2545  C CG1 . ILE D  1 71  ? -12.854 42.027  89.727  1.00 38.66  ? 211  ILE C CG1 1 
ATOM   2546  C CG2 . ILE D  1 71  ? -13.192 41.687  87.300  1.00 38.66  ? 211  ILE C CG2 1 
ATOM   2547  C CD1 . ILE D  1 71  ? -11.983 40.835  90.044  1.00 38.66  ? 211  ILE C CD1 1 
ATOM   2548  N N   . TYR D  1 72  ? -16.695 41.569  87.538  1.00 37.57  ? 212  TYR C N   1 
ATOM   2549  C CA  . TYR D  1 72  ? -17.570 41.221  86.438  1.00 37.57  ? 212  TYR C CA  1 
ATOM   2550  C C   . TYR D  1 72  ? -18.452 42.379  86.111  1.00 37.57  ? 212  TYR C C   1 
ATOM   2551  O O   . TYR D  1 72  ? -18.535 42.777  84.962  1.00 37.57  ? 212  TYR C O   1 
ATOM   2552  C CB  . TYR D  1 72  ? -18.394 40.000  86.785  1.00 37.57  ? 212  TYR C CB  1 
ATOM   2553  C CG  . TYR D  1 72  ? -17.620 38.711  86.601  1.00 37.57  ? 212  TYR C CG  1 
ATOM   2554  C CD1 . TYR D  1 72  ? -17.367 38.191  85.324  1.00 37.57  ? 212  TYR C CD1 1 
ATOM   2555  C CD2 . TYR D  1 72  ? -17.122 38.015  87.701  1.00 37.57  ? 212  TYR C CD2 1 
ATOM   2556  C CE1 . TYR D  1 72  ? -16.631 37.001  85.152  1.00 37.57  ? 212  TYR C CE1 1 
ATOM   2557  C CE2 . TYR D  1 72  ? -16.385 36.825  87.538  1.00 37.57  ? 212  TYR C CE2 1 
ATOM   2558  C CZ  . TYR D  1 72  ? -16.144 36.329  86.268  1.00 37.57  ? 212  TYR C CZ  1 
ATOM   2559  O OH  . TYR D  1 72  ? -15.421 35.165  86.134  1.00 37.57  ? 212  TYR C OH  1 
ATOM   2560  N N   . GLU D  1 73  ? -19.094 42.933  87.130  1.00 67.17  ? 213  GLU C N   1 
ATOM   2561  C CA  . GLU D  1 73  ? -19.964 44.084  86.936  1.00 67.17  ? 213  GLU C CA  1 
ATOM   2562  C C   . GLU D  1 73  ? -19.219 45.122  86.113  1.00 67.17  ? 213  GLU C C   1 
ATOM   2563  O O   . GLU D  1 73  ? -19.694 45.597  85.084  1.00 67.17  ? 213  GLU C O   1 
ATOM   2564  C CB  . GLU D  1 73  ? -20.321 44.717  88.275  1.00 67.17  ? 213  GLU C CB  1 
ATOM   2565  C CG  . GLU D  1 73  ? -21.786 44.669  88.638  1.00 67.17  ? 213  GLU C CG  1 
ATOM   2566  C CD  . GLU D  1 73  ? -21.986 44.436  90.133  1.00 67.17  ? 213  GLU C CD  1 
ATOM   2567  O OE1 . GLU D  1 73  ? -21.372 45.190  90.937  1.00 67.17  ? 213  GLU C OE1 1 
ATOM   2568  O OE2 . GLU D  1 73  ? -22.745 43.499  90.499  1.00 67.17  ? 213  GLU C OE2 1 
ATOM   2569  N N   . ILE D  1 74  ? -18.035 45.473  86.586  1.00 32.15  ? 214  ILE C N   1 
ATOM   2570  C CA  . ILE D  1 74  ? -17.236 46.474  85.914  1.00 32.15  ? 214  ILE C CA  1 
ATOM   2571  C C   . ILE D  1 74  ? -17.013 46.163  84.453  1.00 32.15  ? 214  ILE C C   1 
ATOM   2572  O O   . ILE D  1 74  ? -17.249 47.008  83.599  1.00 32.15  ? 214  ILE C O   1 
ATOM   2573  C CB  . ILE D  1 74  ? -15.868 46.644  86.612  1.00 32.15  ? 214  ILE C CB  1 
ATOM   2574  C CG1 . ILE D  1 74  ? -16.101 46.974  88.098  1.00 32.15  ? 214  ILE C CG1 1 
ATOM   2575  C CG2 . ILE D  1 74  ? -15.048 47.728  85.900  1.00 32.15  ? 214  ILE C CG2 1 
ATOM   2576  C CD1 . ILE D  1 74  ? -14.892 47.508  88.840  1.00 32.15  ? 214  ILE C CD1 1 
ATOM   2577  N N   . LEU D  1 75  ? -16.557 44.951  84.166  1.00 40.54  ? 215  LEU C N   1 
ATOM   2578  C CA  . LEU D  1 75  ? -16.285 44.577  82.792  1.00 40.54  ? 215  LEU C CA  1 
ATOM   2579  C C   . LEU D  1 75  ? -17.580 44.609  82.017  1.00 40.54  ? 215  LEU C C   1 
ATOM   2580  O O   . LEU D  1 75  ? -17.642 45.110  80.888  1.00 40.54  ? 215  LEU C O   1 
ATOM   2581  C CB  . LEU D  1 75  ? -15.656 43.188  82.738  1.00 40.54  ? 215  LEU C CB  1 
ATOM   2582  C CG  . LEU D  1 75  ? -14.327 43.063  83.486  1.00 40.54  ? 215  LEU C CG  1 
ATOM   2583  C CD1 . LEU D  1 75  ? -13.863 41.620  83.478  1.00 40.54  ? 215  LEU C CD1 1 
ATOM   2584  C CD2 . LEU D  1 75  ? -13.297 43.966  82.835  1.00 40.54  ? 215  LEU C CD2 1 
ATOM   2585  N N   . LYS D  1 76  ? -18.627 44.095  82.641  1.00 51.19  ? 216  LYS C N   1 
ATOM   2586  C CA  . LYS D  1 76  ? -19.934 44.070  82.000  1.00 51.19  ? 216  LYS C CA  1 
ATOM   2587  C C   . LYS D  1 76  ? -20.291 45.449  81.465  1.00 51.19  ? 216  LYS C C   1 
ATOM   2588  O O   . LYS D  1 76  ? -20.874 45.577  80.388  1.00 51.19  ? 216  LYS C O   1 
ATOM   2589  C CB  . LYS D  1 76  ? -21.004 43.615  82.990  1.00 51.19  ? 216  LYS C CB  1 
ATOM   2590  C CG  . LYS D  1 76  ? -22.407 44.006  82.590  1.00 51.19  ? 216  LYS C CG  1 
ATOM   2591  C CD  . LYS D  1 76  ? -22.915 43.096  81.494  1.00 51.19  ? 216  LYS C CD  1 
ATOM   2592  C CE  . LYS D  1 76  ? -23.776 41.957  82.067  1.00 51.19  ? 216  LYS C CE  1 
ATOM   2593  N NZ  . LYS D  1 76  ? -23.765 40.706  81.230  1.00 51.19  ? 216  LYS C NZ  1 
ATOM   2594  N N   . ILE D  1 77  ? -19.942 46.480  82.227  1.00 44.41  ? 217  ILE C N   1 
ATOM   2595  C CA  . ILE D  1 77  ? -20.240 47.844  81.809  1.00 44.41  ? 217  ILE C CA  1 
ATOM   2596  C C   . ILE D  1 77  ? -19.526 48.129  80.500  1.00 44.41  ? 217  ILE C C   1 
ATOM   2597  O O   . ILE D  1 77  ? -20.156 48.337  79.459  1.00 44.41  ? 217  ILE C O   1 
ATOM   2598  C CB  . ILE D  1 77  ? -19.763 48.883  82.845  1.00 44.41  ? 217  ILE C CB  1 
ATOM   2599  C CG1 . ILE D  1 77  ? -20.652 48.836  84.088  1.00 44.41  ? 217  ILE C CG1 1 
ATOM   2600  C CG2 . ILE D  1 77  ? -19.780 50.271  82.220  1.00 44.41  ? 217  ILE C CG2 1 
ATOM   2601  C CD1 . ILE D  1 77  ? -20.309 49.916  85.108  1.00 44.41  ? 217  ILE C CD1 1 
ATOM   2602  N N   . TYR D  1 78  ? -18.200 48.125  80.567  1.00 35.23  ? 218  TYR C N   1 
ATOM   2603  C CA  . TYR D  1 78  ? -17.397 48.404  79.402  1.00 35.23  ? 218  TYR C CA  1 
ATOM   2604  C C   . TYR D  1 78  ? -17.713 47.456  78.279  1.00 35.23  ? 218  TYR C C   1 
ATOM   2605  O O   . TYR D  1 78  ? -17.426 47.744  77.111  1.00 35.23  ? 218  TYR C O   1 
ATOM   2606  C CB  . TYR D  1 78  ? -15.931 48.345  79.778  1.00 35.23  ? 218  TYR C CB  1 
ATOM   2607  C CG  . TYR D  1 78  ? -15.603 49.511  80.645  1.00 35.23  ? 218  TYR C CG  1 
ATOM   2608  C CD1 . TYR D  1 78  ? -15.269 50.743  80.081  1.00 35.23  ? 218  TYR C CD1 1 
ATOM   2609  C CD2 . TYR D  1 78  ? -15.742 49.425  82.022  1.00 35.23  ? 218  TYR C CD2 1 
ATOM   2610  C CE1 . TYR D  1 78  ? -15.093 51.860  80.872  1.00 35.23  ? 218  TYR C CE1 1 
ATOM   2611  C CE2 . TYR D  1 78  ? -15.569 50.527  82.820  1.00 35.23  ? 218  TYR C CE2 1 
ATOM   2612  C CZ  . TYR D  1 78  ? -15.248 51.744  82.247  1.00 35.23  ? 218  TYR C CZ  1 
ATOM   2613  O OH  . TYR D  1 78  ? -15.103 52.855  83.047  1.00 35.23  ? 218  TYR C OH  1 
ATOM   2614  N N   . GLN D  1 79  ? -18.332 46.338  78.636  1.00 42.63  ? 219  GLN C N   1 
ATOM   2615  C CA  . GLN D  1 79  ? -18.705 45.340  77.654  1.00 42.63  ? 219  GLN C CA  1 
ATOM   2616  C C   . GLN D  1 79  ? -19.879 45.819  76.791  1.00 42.63  ? 219  GLN C C   1 
ATOM   2617  O O   . GLN D  1 79  ? -19.846 45.703  75.562  1.00 42.63  ? 219  GLN C O   1 
ATOM   2618  C CB  . GLN D  1 79  ? -19.069 44.049  78.369  1.00 42.63  ? 219  GLN C CB  1 
ATOM   2619  C CG  . GLN D  1 79  ? -19.089 42.850  77.473  1.00 42.63  ? 219  GLN C CG  1 
ATOM   2620  C CD  . GLN D  1 79  ? -20.467 42.260  77.355  1.00 42.63  ? 219  GLN C CD  1 
ATOM   2621  O OE1 . GLN D  1 79  ? -20.800 41.278  78.028  1.00 42.63  ? 219  GLN C OE1 1 
ATOM   2622  N NE2 . GLN D  1 79  ? -21.288 42.858  76.499  1.00 42.63  ? 219  GLN C NE2 1 
ATOM   2623  N N   . LEU D  1 80  ? -20.903 46.372  77.441  1.00 41.63  ? 220  LEU C N   1 
ATOM   2624  C CA  . LEU D  1 80  ? -22.096 46.871  76.760  1.00 41.63  ? 220  LEU C CA  1 
ATOM   2625  C C   . LEU D  1 80  ? -21.918 48.267  76.162  1.00 41.63  ? 220  LEU C C   1 
ATOM   2626  O O   . LEU D  1 80  ? -22.757 48.726  75.374  1.00 41.63  ? 220  LEU C O   1 
ATOM   2627  C CB  . LEU D  1 80  ? -23.269 46.884  77.732  1.00 41.63  ? 220  LEU C CB  1 
ATOM   2628  C CG  . LEU D  1 80  ? -23.555 45.497  78.286  1.00 41.63  ? 220  LEU C CG  1 
ATOM   2629  C CD1 . LEU D  1 80  ? -24.464 45.560  79.484  1.00 41.63  ? 220  LEU C CD1 1 
ATOM   2630  C CD2 . LEU D  1 80  ? -24.183 44.698  77.190  1.00 41.63  ? 220  LEU C CD2 1 
ATOM   2631  N N   . MET D  1 81  ? -20.830 48.934  76.531  1.00 34.57  ? 221  MET C N   1 
ATOM   2632  C CA  . MET D  1 81  ? -20.561 50.272  76.039  1.00 34.57  ? 221  MET C CA  1 
ATOM   2633  C C   . MET D  1 81  ? -20.438 50.324  74.529  1.00 34.57  ? 221  MET C C   1 
ATOM   2634  O O   . MET D  1 81  ? -20.397 49.295  73.864  1.00 34.57  ? 221  MET C O   1 
ATOM   2635  C CB  . MET D  1 81  ? -19.283 50.803  76.658  1.00 34.57  ? 221  MET C CB  1 
ATOM   2636  C CG  . MET D  1 81  ? -19.477 51.385  78.018  1.00 34.57  ? 221  MET C CG  1 
ATOM   2637  S SD  . MET D  1 81  ? -18.414 52.784  78.138  1.00 34.57  ? 221  MET C SD  1 
ATOM   2638  C CE  . MET D  1 81  ? -18.836 53.326  79.826  1.00 34.57  ? 221  MET C CE  1 
ATOM   2639  N N   . ASP D  1 82  ? -20.386 51.540  73.997  1.00 58.17  ? 222  ASP C N   1 
ATOM   2640  C CA  . ASP D  1 82  ? -20.259 51.733  72.573  1.00 58.17  ? 222  ASP C CA  1 
ATOM   2641  C C   . ASP D  1 82  ? -18.920 52.387  72.306  1.00 58.17  ? 222  ASP C C   1 
ATOM   2642  O O   . ASP D  1 82  ? -18.806 53.606  72.345  1.00 58.17  ? 222  ASP C O   1 
ATOM   2643  C CB  . ASP D  1 82  ? -21.379 52.624  72.057  1.00 58.17  ? 222  ASP C CB  1 
ATOM   2644  C CG  . ASP D  1 82  ? -21.399 52.707  70.537  1.00 58.17  ? 222  ASP C CG  1 
ATOM   2645  O OD1 . ASP D  1 82  ? -20.316 52.560  69.923  1.00 58.17  ? 222  ASP C OD1 1 
ATOM   2646  O OD2 . ASP D  1 82  ? -22.495 52.918  69.957  1.00 58.17  ? 222  ASP C OD2 1 
ATOM   2647  N N   . HIS D  1 83  ? -17.906 51.568  72.043  1.00 34.50  ? 224  HIS C N   1 
ATOM   2648  C CA  . HIS D  1 83  ? -16.560 52.059  71.765  1.00 34.50  ? 224  HIS C CA  1 
ATOM   2649  C C   . HIS D  1 83  ? -16.385 52.495  70.307  1.00 34.50  ? 224  HIS C C   1 
ATOM   2650  O O   . HIS D  1 83  ? -15.260 52.457  69.777  1.00 34.50  ? 224  HIS C O   1 
ATOM   2651  C CB  . HIS D  1 83  ? -15.521 50.976  72.060  1.00 34.50  ? 224  HIS C CB  1 
ATOM   2652  C CG  . HIS D  1 83  ? -15.593 50.421  73.441  1.00 34.50  ? 224  HIS C CG  1 
ATOM   2653  N ND1 . HIS D  1 83  ? -14.670 50.731  74.410  1.00 34.50  ? 224  HIS C ND1 1 
ATOM   2654  C CD2 . HIS D  1 83  ? -16.476 49.570  74.018  1.00 34.50  ? 224  HIS C CD2 1 
ATOM   2655  C CE1 . HIS D  1 83  ? -14.980 50.098  75.527  1.00 34.50  ? 224  HIS C CE1 1 
ATOM   2656  N NE2 . HIS D  1 83  ? -16.072 49.387  75.317  1.00 34.50  ? 224  HIS C NE2 1 
ATOM   2657  N N   . SER D  1 84  ? -17.472 52.913  69.661  1.00 51.57  ? 225  SER C N   1 
ATOM   2658  C CA  . SER D  1 84  ? -17.400 53.327  68.266  1.00 51.57  ? 225  SER C CA  1 
ATOM   2659  C C   . SER D  1 84  ? -16.369 54.409  67.949  1.00 51.57  ? 225  SER C C   1 
ATOM   2660  O O   . SER D  1 84  ? -15.733 54.374  66.899  1.00 51.57  ? 225  SER C O   1 
ATOM   2661  C CB  . SER D  1 84  ? -18.779 53.758  67.788  1.00 51.57  ? 225  SER C CB  1 
ATOM   2662  O OG  . SER D  1 84  ? -19.600 52.612  67.618  1.00 51.57  ? 225  SER C OG  1 
ATOM   2663  N N   . ASN D  1 85  ? -16.181 55.366  68.844  1.00 59.24  ? 226  ASN C N   1 
ATOM   2664  C CA  . ASN D  1 85  ? -15.203 56.418  68.584  1.00 59.24  ? 226  ASN C CA  1 
ATOM   2665  C C   . ASN D  1 85  ? -13.913 56.135  69.330  1.00 59.24  ? 226  ASN C C   1 
ATOM   2666  O O   . ASN D  1 85  ? -13.086 57.020  69.544  1.00 59.24  ? 226  ASN C O   1 
ATOM   2667  C CB  . ASN D  1 85  ? -15.789 57.765  68.990  1.00 59.24  ? 226  ASN C CB  1 
ATOM   2668  C CG  . ASN D  1 85  ? -17.202 57.956  68.459  1.00 59.24  ? 226  ASN C CG  1 
ATOM   2669  O OD1 . ASN D  1 85  ? -17.486 57.664  67.290  1.00 59.24  ? 226  ASN C OD1 1 
ATOM   2670  N ND2 . ASN D  1 85  ? -18.096 58.437  69.314  1.00 59.24  ? 226  ASN C ND2 1 
ATOM   2671  N N   . MET D  1 86  ? -13.763 54.877  69.723  1.00 54.64  ? 227  MET C N   1 
ATOM   2672  C CA  . MET D  1 86  ? -12.593 54.409  70.445  1.00 54.64  ? 227  MET C CA  1 
ATOM   2673  C C   . MET D  1 86  ? -11.778 53.576  69.479  1.00 54.64  ? 227  MET C C   1 
ATOM   2674  O O   . MET D  1 86  ? -12.342 52.853  68.646  1.00 54.64  ? 227  MET C O   1 
ATOM   2675  C CB  . MET D  1 86  ? -13.025 53.552  71.621  1.00 54.64  ? 227  MET C CB  1 
ATOM   2676  C CG  . MET D  1 86  ? -13.798 54.321  72.649  1.00 54.64  ? 227  MET C CG  1 
ATOM   2677  S SD  . MET D  1 86  ? -13.031 55.913  72.990  1.00 54.64  ? 227  MET C SD  1 
ATOM   2678  C CE  . MET D  1 86  ? -13.410 56.082  74.729  1.00 54.64  ? 227  MET C CE  1 
ATOM   2679  N N   . ASP D  1 87  ? -10.457 53.674  69.593  1.00 46.95  ? 228  ASP C N   1 
ATOM   2680  C CA  . ASP D  1 87  ? -9.570  52.936  68.712  1.00 46.95  ? 228  ASP C CA  1 
ATOM   2681  C C   . ASP D  1 87  ? -8.966  51.723  69.413  1.00 46.95  ? 228  ASP C C   1 
ATOM   2682  O O   . ASP D  1 87  ? -8.418  50.831  68.759  1.00 46.95  ? 228  ASP C O   1 
ATOM   2683  C CB  . ASP D  1 87  ? -8.452  53.860  68.210  1.00 46.95  ? 228  ASP C CB  1 
ATOM   2684  C CG  . ASP D  1 87  ? -8.846  54.630  66.956  1.00 46.95  ? 228  ASP C CG  1 
ATOM   2685  O OD1 . ASP D  1 87  ? -9.804  54.208  66.268  1.00 46.95  ? 228  ASP C OD1 1 
ATOM   2686  O OD2 . ASP D  1 87  ? -8.197  55.659  66.651  1.00 46.95  ? 228  ASP C OD2 1 
ATOM   2687  N N   . CYS D  1 88  ? -9.090  51.671  70.737  1.00 42.09  ? 229  CYS C N   1 
ATOM   2688  C CA  . CYS D  1 88  ? -8.497  50.583  71.505  1.00 42.09  ? 229  CYS C CA  1 
ATOM   2689  C C   . CYS D  1 88  ? -9.130  50.433  72.888  1.00 42.09  ? 229  CYS C C   1 
ATOM   2690  O O   . CYS D  1 88  ? -9.932  51.252  73.300  1.00 42.09  ? 229  CYS C O   1 
ATOM   2691  C CB  . CYS D  1 88  ? -6.990  50.852  71.641  1.00 42.09  ? 229  CYS C CB  1 
ATOM   2692  S SG  . CYS D  1 88  ? -6.012  49.596  72.469  1.00 42.09  ? 229  CYS C SG  1 
ATOM   2693  N N   . PHE D  1 89  ? -8.769  49.378  73.609  1.00 28.92  ? 230  PHE C N   1 
ATOM   2694  C CA  . PHE D  1 89  ? -9.309  49.154  74.946  1.00 28.92  ? 230  PHE C CA  1 
ATOM   2695  C C   . PHE D  1 89  ? -8.310  48.353  75.755  1.00 28.92  ? 230  PHE C C   1 
ATOM   2696  O O   . PHE D  1 89  ? -7.955  47.238  75.395  1.00 28.92  ? 230  PHE C O   1 
ATOM   2697  C CB  . PHE D  1 89  ? -10.646 48.410  74.876  1.00 28.92  ? 230  PHE C CB  1 
ATOM   2698  C CG  . PHE D  1 89  ? -11.205 48.025  76.233  1.00 28.92  ? 230  PHE C CG  1 
ATOM   2699  C CD1 . PHE D  1 89  ? -11.666 48.999  77.121  1.00 28.92  ? 230  PHE C CD1 1 
ATOM   2700  C CD2 . PHE D  1 89  ? -11.250 46.684  76.633  1.00 28.92  ? 230  PHE C CD2 1 
ATOM   2701  C CE1 . PHE D  1 89  ? -12.154 48.649  78.382  1.00 28.92  ? 230  PHE C CE1 1 
ATOM   2702  C CE2 . PHE D  1 89  ? -11.741 46.324  77.901  1.00 28.92  ? 230  PHE C CE2 1 
ATOM   2703  C CZ  . PHE D  1 89  ? -12.191 47.310  78.772  1.00 28.92  ? 230  PHE C CZ  1 
ATOM   2704  N N   . ILE D  1 90  ? -7.866  48.929  76.858  1.00 26.44  ? 231  ILE C N   1 
ATOM   2705  C CA  . ILE D  1 90  ? -6.878  48.283  77.695  1.00 26.44  ? 231  ILE C CA  1 
ATOM   2706  C C   . ILE D  1 90  ? -7.469  47.985  79.053  1.00 26.44  ? 231  ILE C C   1 
ATOM   2707  O O   . ILE D  1 90  ? -8.188  48.807  79.592  1.00 26.44  ? 231  ILE C O   1 
ATOM   2708  C CB  . ILE D  1 90  ? -5.629  49.207  77.843  1.00 26.44  ? 231  ILE C CB  1 
ATOM   2709  C CG1 . ILE D  1 90  ? -5.081  49.516  76.436  1.00 26.44  ? 231  ILE C CG1 1 
ATOM   2710  C CG2 . ILE D  1 90  ? -4.611  48.577  78.807  1.00 26.44  ? 231  ILE C CG2 1 
ATOM   2711  C CD1 . ILE D  1 90  ? -3.811  50.258  76.421  1.00 26.44  ? 231  ILE C CD1 1 
ATOM   2712  N N   . CYS D  1 91  ? -7.170  46.817  79.603  1.00 33.39  ? 232  CYS C N   1 
ATOM   2713  C CA  . CYS D  1 91  ? -7.687  46.460  80.911  1.00 33.39  ? 232  CYS C CA  1 
ATOM   2714  C C   . CYS D  1 91  ? -6.572  45.849  81.749  1.00 33.39  ? 232  CYS C C   1 
ATOM   2715  O O   . CYS D  1 91  ? -6.011  44.808  81.391  1.00 33.39  ? 232  CYS C O   1 
ATOM   2716  C CB  . CYS D  1 91  ? -8.831  45.466  80.764  1.00 33.39  ? 232  CYS C CB  1 
ATOM   2717  S SG  . CYS D  1 91  ? -9.347  44.687  82.324  1.00 33.39  ? 232  CYS C SG  1 
ATOM   2718  N N   . CYS D  1 92  ? -6.242  46.494  82.862  1.00 34.06  ? 233  CYS C N   1 
ATOM   2719  C CA  . CYS D  1 92  ? -5.193  45.992  83.723  1.00 34.06  ? 233  CYS C CA  1 
ATOM   2720  C C   . CYS D  1 92  ? -5.750  45.475  85.018  1.00 34.06  ? 233  CYS C C   1 
ATOM   2721  O O   . CYS D  1 92  ? -6.588  46.119  85.638  1.00 34.06  ? 233  CYS C O   1 
ATOM   2722  C CB  . CYS D  1 92  ? -4.215  47.092  84.038  1.00 34.06  ? 233  CYS C CB  1 
ATOM   2723  S SG  . CYS D  1 92  ? -3.892  48.073  82.621  1.00 34.06  ? 233  CYS C SG  1 
ATOM   2724  N N   . ILE D  1 93  ? -5.291  44.309  85.442  1.00 26.66  ? 234  ILE C N   1 
ATOM   2725  C CA  . ILE D  1 93  ? -5.756  43.752  86.701  1.00 26.66  ? 234  ILE C CA  1 
ATOM   2726  C C   . ILE D  1 93  ? -4.540  43.413  87.523  1.00 26.66  ? 234  ILE C C   1 
ATOM   2727  O O   . ILE D  1 93  ? -3.666  42.680  87.061  1.00 26.66  ? 234  ILE C O   1 
ATOM   2728  C CB  . ILE D  1 93  ? -6.584  42.479  86.487  1.00 26.66  ? 234  ILE C CB  1 
ATOM   2729  C CG1 . ILE D  1 93  ? -7.788  42.811  85.612  1.00 26.66  ? 234  ILE C CG1 1 
ATOM   2730  C CG2 . ILE D  1 93  ? -7.010  41.896  87.825  1.00 26.66  ? 234  ILE C CG2 1 
ATOM   2731  C CD1 . ILE D  1 93  ? -8.416  41.620  84.995  1.00 26.66  ? 234  ILE C CD1 1 
ATOM   2732  N N   . LEU D  1 94  ? -4.482  43.981  88.723  1.00 35.68  ? 235  LEU C N   1 
ATOM   2733  C CA  . LEU D  1 94  ? -3.394  43.752  89.664  1.00 35.68  ? 235  LEU C CA  1 
ATOM   2734  C C   . LEU D  1 94  ? -4.069  43.093  90.868  1.00 35.68  ? 235  LEU C C   1 
ATOM   2735  O O   . LEU D  1 94  ? -4.932  43.691  91.525  1.00 35.68  ? 235  LEU C O   1 
ATOM   2736  C CB  . LEU D  1 94  ? -2.739  45.088  90.057  1.00 35.68  ? 235  LEU C CB  1 
ATOM   2737  C CG  . LEU D  1 94  ? -2.785  46.213  89.005  1.00 35.68  ? 235  LEU C CG  1 
ATOM   2738  C CD1 . LEU D  1 94  ? -2.212  47.490  89.559  1.00 35.68  ? 235  LEU C CD1 1 
ATOM   2739  C CD2 . LEU D  1 94  ? -2.007  45.811  87.786  1.00 35.68  ? 235  LEU C CD2 1 
ATOM   2740  N N   . SER D  1 95  ? -3.700  41.854  91.154  1.00 36.99  ? 236  SER C N   1 
ATOM   2741  C CA  . SER D  1 95  ? -4.330  41.161  92.258  1.00 36.99  ? 236  SER C CA  1 
ATOM   2742  C C   . SER D  1 95  ? -3.623  39.834  92.454  1.00 36.99  ? 236  SER C C   1 
ATOM   2743  O O   . SER D  1 95  ? -2.676  39.525  91.726  1.00 36.99  ? 236  SER C O   1 
ATOM   2744  C CB  . SER D  1 95  ? -5.799  40.939  91.918  1.00 36.99  ? 236  SER C CB  1 
ATOM   2745  O OG  . SER D  1 95  ? -6.486  40.375  93.005  1.00 36.99  ? 236  SER C OG  1 
ATOM   2746  N N   . HIS D  1 96  ? -4.054  39.055  93.440  1.00 42.99  ? 237  HIS C N   1 
ATOM   2747  C CA  . HIS D  1 96  ? -3.439  37.758  93.665  1.00 42.99  ? 237  HIS C CA  1 
ATOM   2748  C C   . HIS D  1 96  ? -4.065  36.842  92.647  1.00 42.99  ? 237  HIS C C   1 
ATOM   2749  O O   . HIS D  1 96  ? -5.117  37.163  92.084  1.00 42.99  ? 237  HIS C O   1 
ATOM   2750  C CB  . HIS D  1 96  ? -3.742  37.240  95.061  1.00 42.99  ? 237  HIS C CB  1 
ATOM   2751  C CG  . HIS D  1 96  ? -2.922  37.883  96.134  1.00 42.99  ? 237  HIS C CG  1 
ATOM   2752  N ND1 . HIS D  1 96  ? -1.617  38.281  95.938  1.00 42.99  ? 237  HIS C ND1 1 
ATOM   2753  C CD2 . HIS D  1 96  ? -3.233  38.222  97.408  1.00 42.99  ? 237  HIS C CD2 1 
ATOM   2754  C CE1 . HIS D  1 96  ? -1.156  38.832  97.047  1.00 42.99  ? 237  HIS C CE1 1 
ATOM   2755  N NE2 . HIS D  1 96  ? -2.117  38.810  97.953  1.00 42.99  ? 237  HIS C NE2 1 
ATOM   2756  N N   . GLY D  1 97  ? -3.433  35.700  92.411  1.00 30.33  ? 238  GLY C N   1 
ATOM   2757  C CA  . GLY D  1 97  ? -3.962  34.776  91.434  1.00 30.33  ? 238  GLY C CA  1 
ATOM   2758  C C   . GLY D  1 97  ? -3.482  33.349  91.581  1.00 30.33  ? 238  GLY C C   1 
ATOM   2759  O O   . GLY D  1 97  ? -2.812  32.996  92.544  1.00 30.33  ? 238  GLY C O   1 
ATOM   2760  N N   . ASP D  1 98  ? -3.843  32.527  90.606  1.00 45.04  ? 239  ASP C N   1 
ATOM   2761  C CA  . ASP D  1 98  ? -3.473  31.130  90.586  1.00 45.04  ? 239  ASP C CA  1 
ATOM   2762  C C   . ASP D  1 98  ? -3.686  30.617  89.155  1.00 45.04  ? 239  ASP C C   1 
ATOM   2763  O O   . ASP D  1 98  ? -4.237  31.319  88.306  1.00 45.04  ? 239  ASP C O   1 
ATOM   2764  C CB  . ASP D  1 98  ? -4.338  30.357  91.579  1.00 45.04  ? 239  ASP C CB  1 
ATOM   2765  C CG  . ASP D  1 98  ? -3.600  29.189  92.222  1.00 45.04  ? 239  ASP C CG  1 
ATOM   2766  O OD1 . ASP D  1 98  ? -2.586  28.725  91.657  1.00 45.04  ? 239  ASP C OD1 1 
ATOM   2767  O OD2 . ASP D  1 98  ? -4.036  28.728  93.297  1.00 45.04  ? 239  ASP C OD2 1 
ATOM   2768  N N   . LYS D  1 99  ? -3.252  29.391  88.893  1.00 54.26  ? 240  LYS C N   1 
ATOM   2769  C CA  . LYS D  1 99  ? -3.365  28.800  87.566  1.00 54.26  ? 240  LYS C CA  1 
ATOM   2770  C C   . LYS D  1 99  ? -4.565  29.254  86.743  1.00 54.26  ? 240  LYS C C   1 
ATOM   2771  O O   . LYS D  1 99  ? -5.683  28.816  86.959  1.00 54.26  ? 240  LYS C O   1 
ATOM   2772  C CB  . LYS D  1 99  ? -3.369  27.274  87.672  1.00 54.26  ? 240  LYS C CB  1 
ATOM   2773  C CG  . LYS D  1 99  ? -2.170  26.708  88.406  1.00 54.26  ? 240  LYS C CG  1 
ATOM   2774  C CD  . LYS D  1 99  ? -2.040  25.201  88.177  1.00 54.26  ? 240  LYS C CD  1 
ATOM   2775  C CE  . LYS D  1 99  ? -1.471  24.475  89.411  1.00 54.26  ? 240  LYS C CE  1 
ATOM   2776  N NZ  . LYS D  1 99  ? -1.618  22.982  89.320  1.00 54.26  ? 240  LYS C NZ  1 
ATOM   2777  N N   . GLY D  1 100 ? -4.318  30.147  85.798  1.00 32.25  ? 241  GLY C N   1 
ATOM   2778  C CA  . GLY D  1 100 ? -5.377  30.623  84.922  1.00 32.25  ? 241  GLY C CA  1 
ATOM   2779  C C   . GLY D  1 100 ? -6.520  31.435  85.522  1.00 32.25  ? 241  GLY C C   1 
ATOM   2780  O O   . GLY D  1 100 ? -7.553  31.635  84.870  1.00 32.25  ? 241  GLY C O   1 
ATOM   2781  N N   . ILE D  1 101 ? -6.342  31.920  86.749  1.00 41.92  ? 242  ILE C N   1 
ATOM   2782  C CA  . ILE D  1 101 ? -7.384  32.697  87.402  1.00 41.92  ? 242  ILE C CA  1 
ATOM   2783  C C   . ILE D  1 101 ? -6.836  33.766  88.329  1.00 41.92  ? 242  ILE C C   1 
ATOM   2784  O O   . ILE D  1 101 ? -5.801  33.576  88.960  1.00 41.92  ? 242  ILE C O   1 
ATOM   2785  C CB  . ILE D  1 101 ? -8.262  31.786  88.223  1.00 41.92  ? 242  ILE C CB  1 
ATOM   2786  C CG1 . ILE D  1 101 ? -7.523  31.359  89.490  1.00 41.92  ? 242  ILE C CG1 1 
ATOM   2787  C CG2 . ILE D  1 101 ? -8.588  30.557  87.422  1.00 41.92  ? 242  ILE C CG2 1 
ATOM   2788  C CD1 . ILE D  1 101 ? -7.713  32.284  90.684  1.00 41.92  ? 242  ILE C CD1 1 
ATOM   2789  N N   . ILE D  1 102 ? -7.535  34.889  88.421  1.00 36.45  ? 243  ILE C N   1 
ATOM   2790  C CA  . ILE D  1 102 ? -7.094  35.933  89.322  1.00 36.45  ? 243  ILE C CA  1 
ATOM   2791  C C   . ILE D  1 102 ? -8.074  35.877  90.471  1.00 36.45  ? 243  ILE C C   1 
ATOM   2792  O O   . ILE D  1 102 ? -9.129  35.250  90.351  1.00 36.45  ? 243  ILE C O   1 
ATOM   2793  C CB  . ILE D  1 102 ? -7.144  37.317  88.671  1.00 36.45  ? 243  ILE C CB  1 
ATOM   2794  C CG1 . ILE D  1 102 ? -8.410  37.445  87.823  1.00 36.45  ? 243  ILE C CG1 1 
ATOM   2795  C CG2 . ILE D  1 102 ? -5.897  37.535  87.850  1.00 36.45  ? 243  ILE C CG2 1 
ATOM   2796  C CD1 . ILE D  1 102 ? -9.478  38.314  88.472  1.00 36.45  ? 243  ILE C CD1 1 
ATOM   2797  N N   . TYR D  1 103 ? -7.725  36.526  91.576  1.00 39.23  ? 244  TYR C N   1 
ATOM   2798  C CA  . TYR D  1 103 ? -8.573  36.544  92.758  1.00 39.23  ? 244  TYR C CA  1 
ATOM   2799  C C   . TYR D  1 103 ? -9.317  37.858  92.998  1.00 39.23  ? 244  TYR C C   1 
ATOM   2800  O O   . TYR D  1 103 ? -8.752  38.942  92.872  1.00 39.23  ? 244  TYR C O   1 
ATOM   2801  C CB  . TYR D  1 103 ? -7.738  36.250  93.983  1.00 39.23  ? 244  TYR C CB  1 
ATOM   2802  C CG  . TYR D  1 103 ? -7.579  34.792  94.256  1.00 39.23  ? 244  TYR C CG  1 
ATOM   2803  C CD1 . TYR D  1 103 ? -8.639  34.040  94.741  1.00 39.23  ? 244  TYR C CD1 1 
ATOM   2804  C CD2 . TYR D  1 103 ? -6.353  34.162  94.072  1.00 39.23  ? 244  TYR C CD2 1 
ATOM   2805  C CE1 . TYR D  1 103 ? -8.483  32.698  95.044  1.00 39.23  ? 244  TYR C CE1 1 
ATOM   2806  C CE2 . TYR D  1 103 ? -6.186  32.819  94.371  1.00 39.23  ? 244  TYR C CE2 1 
ATOM   2807  C CZ  . TYR D  1 103 ? -7.255  32.094  94.862  1.00 39.23  ? 244  TYR C CZ  1 
ATOM   2808  O OH  . TYR D  1 103 ? -7.089  30.765  95.206  1.00 39.23  ? 244  TYR C OH  1 
ATOM   2809  N N   . GLY D  1 104 ? -10.596 37.761  93.342  1.00 48.64  ? 245  GLY C N   1 
ATOM   2810  C CA  . GLY D  1 104 ? -11.339 38.958  93.644  1.00 48.64  ? 245  GLY C CA  1 
ATOM   2811  C C   . GLY D  1 104 ? -10.791 39.317  95.011  1.00 48.64  ? 245  GLY C C   1 
ATOM   2812  O O   . GLY D  1 104 ? -9.993  38.568  95.563  1.00 48.64  ? 245  GLY C O   1 
ATOM   2813  N N   . THR D  1 105 ? -11.196 40.449  95.566  1.00 49.95  ? 246  THR C N   1 
ATOM   2814  C CA  . THR D  1 105 ? -10.725 40.847  96.882  1.00 49.95  ? 246  THR C CA  1 
ATOM   2815  C C   . THR D  1 105 ? -11.415 39.999  97.962  1.00 49.95  ? 246  THR C C   1 
ATOM   2816  O O   . THR D  1 105 ? -11.037 40.013  99.132  1.00 49.95  ? 246  THR C O   1 
ATOM   2817  C CB  . THR D  1 105 ? -11.003 42.345  97.101  1.00 49.95  ? 246  THR C CB  1 
ATOM   2818  O OG1 . THR D  1 105 ? -9.899  42.918  97.801  1.00 49.95  ? 246  THR C OG1 1 
ATOM   2819  C CG2 . THR D  1 105 ? -12.297 42.567  97.886  1.00 49.95  ? 246  THR C CG2 1 
ATOM   2820  N N   . ASP D  1 106 ? -12.424 39.248  97.535  1.00 75.46  ? 247  ASP C N   1 
ATOM   2821  C CA  . ASP D  1 106 ? -13.207 38.392  98.413  1.00 75.46  ? 247  ASP C CA  1 
ATOM   2822  C C   . ASP D  1 106 ? -12.682 36.962  98.438  1.00 75.46  ? 247  ASP C C   1 
ATOM   2823  O O   . ASP D  1 106 ? -13.271 36.086  99.073  1.00 75.46  ? 247  ASP C O   1 
ATOM   2824  C CB  . ASP D  1 106 ? -14.674 38.384  97.958  1.00 75.46  ? 247  ASP C CB  1 
ATOM   2825  C CG  . ASP D  1 106 ? -14.825 38.218  96.447  1.00 75.46  ? 247  ASP C CG  1 
ATOM   2826  O OD1 . ASP D  1 106 ? -13.796 38.062  95.750  1.00 75.46  ? 247  ASP C OD1 1 
ATOM   2827  O OD2 . ASP D  1 106 ? -15.976 38.246  95.950  1.00 75.46  ? 247  ASP C OD2 1 
ATOM   2828  N N   . GLY D  1 107 ? -11.582 36.721  97.736  1.00 48.45  ? 248  GLY C N   1 
ATOM   2829  C CA  . GLY D  1 107 ? -11.008 35.385  97.710  1.00 48.45  ? 248  GLY C CA  1 
ATOM   2830  C C   . GLY D  1 107 ? -11.649 34.506  96.662  1.00 48.45  ? 248  GLY C C   1 
ATOM   2831  O O   . GLY D  1 107 ? -11.330 33.324  96.555  1.00 48.45  ? 248  GLY C O   1 
ATOM   2832  N N   . GLN D  1 108 ? -12.556 35.093  95.886  1.00 52.94  ? 254  GLN C N   1 
ATOM   2833  C CA  . GLN D  1 108 ? -13.267 34.368  94.839  1.00 52.94  ? 254  GLN C CA  1 
ATOM   2834  C C   . GLN D  1 108 ? -12.395 34.260  93.611  1.00 52.94  ? 254  GLN C C   1 
ATOM   2835  O O   . GLN D  1 108 ? -11.500 35.066  93.421  1.00 52.94  ? 254  GLN C O   1 
ATOM   2836  C CB  . GLN D  1 108 ? -14.576 35.088  94.494  1.00 52.94  ? 254  GLN C CB  1 
ATOM   2837  C CG  . GLN D  1 108 ? -15.685 34.913  95.530  1.00 52.94  ? 254  GLN C CG  1 
ATOM   2838  C CD  . GLN D  1 108 ? -15.932 33.455  95.849  1.00 52.94  ? 254  GLN C CD  1 
ATOM   2839  O OE1 . GLN D  1 108 ? -15.820 32.588  94.975  1.00 52.94  ? 254  GLN C OE1 1 
ATOM   2840  N NE2 . GLN D  1 108 ? -16.259 33.169  97.106  1.00 52.94  ? 254  GLN C NE2 1 
ATOM   2841  N N   . GLU D  1 109 ? -12.666 33.269  92.773  1.00 46.46  ? 255  GLU C N   1 
ATOM   2842  C CA  . GLU D  1 109 ? -11.872 33.047  91.573  1.00 46.46  ? 255  GLU C CA  1 
ATOM   2843  C C   . GLU D  1 109 ? -12.481 33.554  90.277  1.00 46.46  ? 255  GLU C C   1 
ATOM   2844  O O   . GLU D  1 109 ? -13.672 33.427  90.036  1.00 46.46  ? 255  GLU C O   1 
ATOM   2845  C CB  . GLU D  1 109 ? -11.559 31.563  91.438  1.00 46.46  ? 255  GLU C CB  1 
ATOM   2846  C CG  . GLU D  1 109 ? -11.022 30.968  92.721  1.00 46.46  ? 255  GLU C CG  1 
ATOM   2847  C CD  . GLU D  1 109 ? -10.354 29.614  92.523  1.00 46.46  ? 255  GLU C CD  1 
ATOM   2848  O OE1 . GLU D  1 109 ? -10.551 29.017  91.438  1.00 46.46  ? 255  GLU C OE1 1 
ATOM   2849  O OE2 . GLU D  1 109 ? -9.636  29.151  93.454  1.00 46.46  ? 255  GLU C OE2 1 
ATOM   2850  N N   . ALA D  1 110 ? -11.638 34.136  89.440  1.00 32.32  ? 256  ALA C N   1 
ATOM   2851  C CA  . ALA D  1 110 ? -12.078 34.653  88.163  1.00 32.32  ? 256  ALA C CA  1 
ATOM   2852  C C   . ALA D  1 110 ? -11.133 34.140  87.084  1.00 32.32  ? 256  ALA C C   1 
ATOM   2853  O O   . ALA D  1 110 ? -9.992  34.582  86.976  1.00 32.32  ? 256  ALA C O   1 
ATOM   2854  C CB  . ALA D  1 110 ? -12.074 36.173  88.185  1.00 32.32  ? 256  ALA C CB  1 
ATOM   2855  N N   . PRO D  1 111 ? -11.584 33.169  86.296  1.00 26.53  ? 257  PRO C N   1 
ATOM   2856  C CA  . PRO D  1 111 ? -10.699 32.667  85.252  1.00 26.53  ? 257  PRO C CA  1 
ATOM   2857  C C   . PRO D  1 111 ? -10.345 33.797  84.304  1.00 26.53  ? 257  PRO C C   1 
ATOM   2858  O O   . PRO D  1 111 ? -11.212 34.500  83.820  1.00 26.53  ? 257  PRO C O   1 
ATOM   2859  C CB  . PRO D  1 111 ? -11.522 31.573  84.581  1.00 26.53  ? 257  PRO C CB  1 
ATOM   2860  C CG  . PRO D  1 111 ? -12.513 31.156  85.634  1.00 26.53  ? 257  PRO C CG  1 
ATOM   2861  C CD  . PRO D  1 111 ? -12.863 32.446  86.321  1.00 26.53  ? 257  PRO C CD  1 
ATOM   2862  N N   . ILE D  1 112 ? -9.059  33.984  84.061  1.00 28.86  ? 258  ILE C N   1 
ATOM   2863  C CA  . ILE D  1 112 ? -8.609  35.028  83.168  1.00 28.86  ? 258  ILE C CA  1 
ATOM   2864  C C   . ILE D  1 112 ? -9.377  34.936  81.861  1.00 28.86  ? 258  ILE C C   1 
ATOM   2865  O O   . ILE D  1 112 ? -9.739  35.959  81.272  1.00 28.86  ? 258  ILE C O   1 
ATOM   2866  C CB  . ILE D  1 112 ? -7.118  34.871  82.894  1.00 28.86  ? 258  ILE C CB  1 
ATOM   2867  C CG1 . ILE D  1 112 ? -6.385  34.797  84.225  1.00 28.86  ? 258  ILE C CG1 1 
ATOM   2868  C CG2 . ILE D  1 112 ? -6.619  35.994  82.012  1.00 28.86  ? 258  ILE C CG2 1 
ATOM   2869  C CD1 . ILE D  1 112 ? -4.935  34.921  84.097  1.00 28.86  ? 258  ILE C CD1 1 
ATOM   2870  N N   . TYR D  1 113 ? -9.630  33.711  81.409  1.00 53.32  ? 259  TYR C N   1 
ATOM   2871  C CA  . TYR D  1 113 ? -10.366 33.501  80.172  1.00 53.32  ? 259  TYR C CA  1 
ATOM   2872  C C   . TYR D  1 113 ? -11.758 34.135  80.249  1.00 53.32  ? 259  TYR C C   1 
ATOM   2873  O O   . TYR D  1 113 ? -12.206 34.788  79.309  1.00 53.32  ? 259  TYR C O   1 
ATOM   2874  C CB  . TYR D  1 113 ? -10.498 32.011  79.886  1.00 53.32  ? 259  TYR C CB  1 
ATOM   2875  C CG  . TYR D  1 113 ? -11.287 31.732  78.629  1.00 53.32  ? 259  TYR C CG  1 
ATOM   2876  C CD1 . TYR D  1 113 ? -10.784 32.084  77.369  1.00 53.32  ? 259  TYR C CD1 1 
ATOM   2877  C CD2 . TYR D  1 113 ? -12.546 31.131  78.694  1.00 53.32  ? 259  TYR C CD2 1 
ATOM   2878  C CE1 . TYR D  1 113 ? -11.520 31.843  76.195  1.00 53.32  ? 259  TYR C CE1 1 
ATOM   2879  C CE2 . TYR D  1 113 ? -13.295 30.884  77.528  1.00 53.32  ? 259  TYR C CE2 1 
ATOM   2880  C CZ  . TYR D  1 113 ? -12.777 31.241  76.281  1.00 53.32  ? 259  TYR C CZ  1 
ATOM   2881  O OH  . TYR D  1 113 ? -13.513 30.993  75.132  1.00 53.32  ? 259  TYR C OH  1 
ATOM   2882  N N   . GLU D  1 114 ? -12.442 33.923  81.366  1.00 59.10  ? 260  GLU C N   1 
ATOM   2883  C CA  . GLU D  1 114 ? -13.769 34.492  81.587  1.00 59.10  ? 260  GLU C CA  1 
ATOM   2884  C C   . GLU D  1 114 ? -13.777 35.994  81.374  1.00 59.10  ? 260  GLU C C   1 
ATOM   2885  O O   . GLU D  1 114 ? -14.721 36.547  80.822  1.00 59.10  ? 260  GLU C O   1 
ATOM   2886  C CB  . GLU D  1 114 ? -14.215 34.243  83.018  1.00 59.10  ? 260  GLU C CB  1 
ATOM   2887  C CG  . GLU D  1 114 ? -14.505 32.829  83.307  1.00 59.10  ? 260  GLU C CG  1 
ATOM   2888  C CD  . GLU D  1 114 ? -15.671 32.372  82.512  1.00 59.10  ? 260  GLU C CD  1 
ATOM   2889  O OE1 . GLU D  1 114 ? -15.695 32.679  81.298  1.00 59.10  ? 260  GLU C OE1 1 
ATOM   2890  O OE2 . GLU D  1 114 ? -16.561 31.721  83.101  1.00 59.10  ? 260  GLU C OE2 1 
ATOM   2891  N N   . LEU D  1 115 ? -12.728 36.650  81.853  1.00 39.35  ? 261  LEU C N   1 
ATOM   2892  C CA  . LEU D  1 115 ? -12.606 38.087  81.743  1.00 39.35  ? 261  LEU C CA  1 
ATOM   2893  C C   . LEU D  1 115 ? -12.389 38.510  80.308  1.00 39.35  ? 261  LEU C C   1 
ATOM   2894  O O   . LEU D  1 115 ? -13.242 39.156  79.702  1.00 39.35  ? 261  LEU C O   1 
ATOM   2895  C CB  . LEU D  1 115 ? -11.447 38.562  82.607  1.00 39.35  ? 261  LEU C CB  1 
ATOM   2896  C CG  . LEU D  1 115 ? -11.411 37.914  83.996  1.00 39.35  ? 261  LEU C CG  1 
ATOM   2897  C CD1 . LEU D  1 115 ? -10.277 38.558  84.795  1.00 39.35  ? 261  LEU C CD1 1 
ATOM   2898  C CD2 . LEU D  1 115 ? -12.761 38.083  84.722  1.00 39.35  ? 261  LEU C CD2 1 
ATOM   2899  N N   . THR D  1 116 ? -11.244 38.136  79.759  1.00 34.78  ? 262  THR C N   1 
ATOM   2900  C CA  . THR D  1 116 ? -10.922 38.491  78.388  1.00 34.78  ? 262  THR C CA  1 
ATOM   2901  C C   . THR D  1 116 ? -12.047 38.186  77.403  1.00 34.78  ? 262  THR C C   1 
ATOM   2902  O O   . THR D  1 116 ? -12.324 38.986  76.528  1.00 34.78  ? 262  THR C O   1 
ATOM   2903  C CB  . THR D  1 116 ? -9.643  37.771  77.938  1.00 34.78  ? 262  THR C CB  1 
ATOM   2904  O OG1 . THR D  1 116 ? -9.624  36.439  78.464  1.00 34.78  ? 262  THR C OG1 1 
ATOM   2905  C CG2 . THR D  1 116 ? -8.430  38.510  78.457  1.00 34.78  ? 262  THR C CG2 1 
ATOM   2906  N N   . SER D  1 117 ? -12.706 37.040  77.547  1.00 49.01  ? 263  SER C N   1 
ATOM   2907  C CA  . SER D  1 117 ? -13.784 36.654  76.628  1.00 49.01  ? 263  SER C CA  1 
ATOM   2908  C C   . SER D  1 117 ? -14.996 37.580  76.647  1.00 49.01  ? 263  SER C C   1 
ATOM   2909  O O   . SER D  1 117 ? -15.836 37.534  75.754  1.00 49.01  ? 263  SER C O   1 
ATOM   2910  C CB  . SER D  1 117 ? -14.230 35.218  76.910  1.00 49.01  ? 263  SER C CB  1 
ATOM   2911  O OG  . SER D  1 117 ? -14.845 35.110  78.179  1.00 49.01  ? 263  SER C OG  1 
ATOM   2912  N N   . GLN D  1 118 ? -15.074 38.427  77.663  1.00 51.07  ? 264  GLN C N   1 
ATOM   2913  C CA  . GLN D  1 118 ? -16.177 39.366  77.789  1.00 51.07  ? 264  GLN C CA  1 
ATOM   2914  C C   . GLN D  1 118 ? -16.183 40.356  76.644  1.00 51.07  ? 264  GLN C C   1 
ATOM   2915  O O   . GLN D  1 118 ? -17.209 40.966  76.349  1.00 51.07  ? 264  GLN C O   1 
ATOM   2916  C CB  . GLN D  1 118 ? -16.043 40.148  79.091  1.00 51.07  ? 264  GLN C CB  1 
ATOM   2917  C CG  . GLN D  1 118 ? -16.376 39.345  80.312  1.00 51.07  ? 264  GLN C CG  1 
ATOM   2918  C CD  . GLN D  1 118 ? -17.602 38.502  80.094  1.00 51.07  ? 264  GLN C CD  1 
ATOM   2919  O OE1 . GLN D  1 118 ? -17.574 37.276  80.273  1.00 51.07  ? 264  GLN C OE1 1 
ATOM   2920  N NE2 . GLN D  1 118 ? -18.698 39.151  79.689  1.00 51.07  ? 264  GLN C NE2 1 
ATOM   2921  N N   . PHE D  1 119 ? -15.039 40.497  75.988  1.00 30.48  ? 265  PHE C N   1 
ATOM   2922  C CA  . PHE D  1 119 ? -14.902 41.473  74.928  1.00 30.48  ? 265  PHE C CA  1 
ATOM   2923  C C   . PHE D  1 119 ? -14.690 40.987  73.518  1.00 30.48  ? 265  PHE C C   1 
ATOM   2924  O O   . PHE D  1 119 ? -14.079 41.683  72.705  1.00 30.48  ? 265  PHE C O   1 
ATOM   2925  C CB  . PHE D  1 119 ? -13.796 42.447  75.317  1.00 30.48  ? 265  PHE C CB  1 
ATOM   2926  C CG  . PHE D  1 119 ? -14.029 43.094  76.649  1.00 30.48  ? 265  PHE C CG  1 
ATOM   2927  C CD1 . PHE D  1 119 ? -13.774 42.392  77.823  1.00 30.48  ? 265  PHE C CD1 1 
ATOM   2928  C CD2 . PHE D  1 119 ? -14.526 44.392  76.734  1.00 30.48  ? 265  PHE C CD2 1 
ATOM   2929  C CE1 . PHE D  1 119 ? -14.005 42.966  79.075  1.00 30.48  ? 265  PHE C CE1 1 
ATOM   2930  C CE2 . PHE D  1 119 ? -14.764 44.985  77.976  1.00 30.48  ? 265  PHE C CE2 1 
ATOM   2931  C CZ  . PHE D  1 119 ? -14.502 44.270  79.155  1.00 30.48  ? 265  PHE C CZ  1 
ATOM   2932  N N   . THR D  1 120 ? -15.228 39.815  73.213  1.00 42.55  ? 266  THR C N   1 
ATOM   2933  C CA  . THR D  1 120 ? -15.079 39.263  71.884  1.00 42.55  ? 266  THR C CA  1 
ATOM   2934  C C   . THR D  1 120 ? -15.750 40.199  70.890  1.00 42.55  ? 266  THR C C   1 
ATOM   2935  O O   . THR D  1 120 ? -16.001 41.364  71.190  1.00 42.55  ? 266  THR C O   1 
ATOM   2936  C CB  . THR D  1 120 ? -15.701 37.848  71.805  1.00 42.55  ? 266  THR C CB  1 
ATOM   2937  O OG1 . THR D  1 120 ? -17.129 37.926  71.874  1.00 42.55  ? 266  THR C OG1 1 
ATOM   2938  C CG2 . THR D  1 120 ? -15.218 37.004  72.965  1.00 42.55  ? 266  THR C CG2 1 
ATOM   2939  N N   . GLY D  1 121 ? -16.019 39.698  69.696  1.00 40.28  ? 267  GLY C N   1 
ATOM   2940  C CA  . GLY D  1 121 ? -16.666 40.530  68.706  1.00 40.28  ? 267  GLY C CA  1 
ATOM   2941  C C   . GLY D  1 121 ? -18.166 40.453  68.891  1.00 40.28  ? 267  GLY C C   1 
ATOM   2942  O O   . GLY D  1 121 ? -18.870 41.461  68.833  1.00 40.28  ? 267  GLY C O   1 
ATOM   2943  N N   . LEU D  1 122 ? -18.663 39.243  69.112  1.00 39.41  ? 268  LEU C N   1 
ATOM   2944  C CA  . LEU D  1 122 ? -20.078 39.064  69.306  1.00 39.41  ? 268  LEU C CA  1 
ATOM   2945  C C   . LEU D  1 122 ? -20.453 39.785  70.594  1.00 39.41  ? 268  LEU C C   1 
ATOM   2946  O O   . LEU D  1 122 ? -21.459 40.492  70.658  1.00 39.41  ? 268  LEU C O   1 
ATOM   2947  C CB  . LEU D  1 122 ? -20.405 37.579  69.401  1.00 39.41  ? 268  LEU C CB  1 
ATOM   2948  C CG  . LEU D  1 122 ? -20.137 36.730  68.156  1.00 39.41  ? 268  LEU C CG  1 
ATOM   2949  C CD1 . LEU D  1 122 ? -20.941 35.439  68.234  1.00 39.41  ? 268  LEU C CD1 1 
ATOM   2950  C CD2 . LEU D  1 122 ? -20.506 37.504  66.911  1.00 39.41  ? 268  LEU C CD2 1 
ATOM   2951  N N   . LYS D  1 123 ? -19.620 39.634  71.614  1.00 31.97  ? 269  LYS C N   1 
ATOM   2952  C CA  . LYS D  1 123 ? -19.887 40.252  72.903  1.00 31.97  ? 269  LYS C CA  1 
ATOM   2953  C C   . LYS D  1 123 ? -19.642 41.745  72.936  1.00 31.97  ? 269  LYS C C   1 
ATOM   2954  O O   . LYS D  1 123 ? -19.943 42.394  73.931  1.00 31.97  ? 269  LYS C O   1 
ATOM   2955  C CB  . LYS D  1 123 ? -19.033 39.590  73.979  1.00 31.97  ? 269  LYS C CB  1 
ATOM   2956  C CG  . LYS D  1 123 ? -19.532 38.223  74.436  1.00 31.97  ? 269  LYS C CG  1 
ATOM   2957  C CD  . LYS D  1 123 ? -19.707 38.224  75.936  1.00 31.97  ? 269  LYS C CD  1 
ATOM   2958  C CE  . LYS D  1 123 ? -20.537 37.052  76.415  1.00 31.97  ? 269  LYS C CE  1 
ATOM   2959  N NZ  . LYS D  1 123 ? -20.683 37.089  77.911  1.00 31.97  ? 269  LYS C NZ  1 
ATOM   2960  N N   . CYS D  1 124 ? -19.105 42.310  71.863  1.00 31.87  ? 270  CYS C N   1 
ATOM   2961  C CA  . CYS D  1 124 ? -18.821 43.738  71.879  1.00 31.87  ? 270  CYS C CA  1 
ATOM   2962  C C   . CYS D  1 124 ? -18.486 44.269  70.499  1.00 31.87  ? 270  CYS C C   1 
ATOM   2963  O O   . CYS D  1 124 ? -17.357 44.682  70.236  1.00 31.87  ? 270  CYS C O   1 
ATOM   2964  C CB  . CYS D  1 124 ? -17.653 44.014  72.812  1.00 31.87  ? 270  CYS C CB  1 
ATOM   2965  S SG  . CYS D  1 124 ? -17.316 45.774  73.094  1.00 31.87  ? 270  CYS C SG  1 
ATOM   2966  N N   . PRO D  1 125 ? -19.472 44.274  69.595  1.00 34.34  ? 271  PRO C N   1 
ATOM   2967  C CA  . PRO D  1 125 ? -19.259 44.760  68.235  1.00 34.34  ? 271  PRO C CA  1 
ATOM   2968  C C   . PRO D  1 125 ? -18.570 46.107  68.172  1.00 34.34  ? 271  PRO C C   1 
ATOM   2969  O O   . PRO D  1 125 ? -17.738 46.334  67.292  1.00 34.34  ? 271  PRO C O   1 
ATOM   2970  C CB  . PRO D  1 125 ? -20.661 44.801  67.658  1.00 34.34  ? 271  PRO C CB  1 
ATOM   2971  C CG  . PRO D  1 125 ? -21.371 43.715  68.395  1.00 34.34  ? 271  PRO C CG  1 
ATOM   2972  C CD  . PRO D  1 125 ? -20.854 43.808  69.793  1.00 34.34  ? 271  PRO C CD  1 
ATOM   2973  N N   . SER D  1 126 ? -18.891 47.002  69.102  1.00 37.59  ? 272  SER C N   1 
ATOM   2974  C CA  . SER D  1 126 ? -18.278 48.330  69.071  1.00 37.59  ? 272  SER C CA  1 
ATOM   2975  C C   . SER D  1 126 ? -16.770 48.247  69.028  1.00 37.59  ? 272  SER C C   1 
ATOM   2976  O O   . SER D  1 126 ? -16.102 49.219  68.677  1.00 37.59  ? 272  SER C O   1 
ATOM   2977  C CB  . SER D  1 126 ? -18.684 49.173  70.287  1.00 37.59  ? 272  SER C CB  1 
ATOM   2978  O OG  . SER D  1 126 ? -19.615 48.500  71.107  1.00 37.59  ? 272  SER C OG  1 
ATOM   2979  N N   . LEU D  1 127 ? -16.237 47.079  69.383  1.00 29.68  ? 273  LEU C N   1 
ATOM   2980  C CA  . LEU D  1 127 ? -14.785 46.865  69.421  1.00 29.68  ? 273  LEU C CA  1 
ATOM   2981  C C   . LEU D  1 127 ? -14.239 45.905  68.367  1.00 29.68  ? 273  LEU C C   1 
ATOM   2982  O O   . LEU D  1 127 ? -13.031 45.665  68.306  1.00 29.68  ? 273  LEU C O   1 
ATOM   2983  C CB  . LEU D  1 127 ? -14.371 46.384  70.811  1.00 29.68  ? 273  LEU C CB  1 
ATOM   2984  C CG  . LEU D  1 127 ? -14.213 47.512  71.816  1.00 29.68  ? 273  LEU C CG  1 
ATOM   2985  C CD1 . LEU D  1 127 ? -14.144 46.978  73.228  1.00 29.68  ? 273  LEU C CD1 1 
ATOM   2986  C CD2 . LEU D  1 127 ? -12.957 48.250  71.469  1.00 29.68  ? 273  LEU C CD2 1 
ATOM   2987  N N   . ALA D  1 128 ? -15.131 45.363  67.544  1.00 21.12  ? 274  ALA C N   1 
ATOM   2988  C CA  . ALA D  1 128 ? -14.736 44.455  66.477  1.00 21.12  ? 274  ALA C CA  1 
ATOM   2989  C C   . ALA D  1 128 ? -13.587 45.076  65.699  1.00 21.12  ? 274  ALA C C   1 
ATOM   2990  O O   . ALA D  1 128 ? -13.609 46.271  65.420  1.00 21.12  ? 274  ALA C O   1 
ATOM   2991  C CB  . ALA D  1 128 ? -15.906 44.197  65.544  1.00 21.12  ? 274  ALA C CB  1 
ATOM   2992  N N   . GLY D  1 129 ? -12.585 44.258  65.370  1.00 32.94  ? 275  GLY C N   1 
ATOM   2993  C CA  . GLY D  1 129 ? -11.441 44.734  64.612  1.00 32.94  ? 275  GLY C CA  1 
ATOM   2994  C C   . GLY D  1 129 ? -10.560 45.723  65.354  1.00 32.94  ? 275  GLY C C   1 
ATOM   2995  O O   . GLY D  1 129 ? -9.642  46.298  64.767  1.00 32.94  ? 275  GLY C O   1 
ATOM   2996  N N   . LYS D  1 130 ? -10.827 45.933  66.641  1.00 42.47  ? 276  LYS C N   1 
ATOM   2997  C CA  . LYS D  1 130 ? -10.020 46.869  67.415  1.00 42.47  ? 276  LYS C CA  1 
ATOM   2998  C C   . LYS D  1 130 ? -9.229  46.150  68.495  1.00 42.47  ? 276  LYS C C   1 
ATOM   2999  O O   . LYS D  1 130 ? -9.729  45.210  69.121  1.00 42.47  ? 276  LYS C O   1 
ATOM   3000  C CB  . LYS D  1 130 ? -10.905 47.948  68.050  1.00 42.47  ? 276  LYS C CB  1 
ATOM   3001  C CG  . LYS D  1 130 ? -11.851 48.626  67.068  1.00 42.47  ? 276  LYS C CG  1 
ATOM   3002  C CD  . LYS D  1 130 ? -12.781 49.594  67.779  1.00 42.47  ? 276  LYS C CD  1 
ATOM   3003  C CE  . LYS D  1 130 ? -13.129 50.776  66.882  1.00 42.47  ? 276  LYS C CE  1 
ATOM   3004  N NZ  . LYS D  1 130 ? -14.589 51.058  66.854  1.00 42.47  ? 276  LYS C NZ  1 
ATOM   3005  N N   . PRO D  1 131 ? -7.978  46.591  68.736  1.00 54.28  ? 277  PRO C N   1 
ATOM   3006  C CA  . PRO D  1 131 ? -7.093  45.994  69.741  1.00 54.28  ? 277  PRO C CA  1 
ATOM   3007  C C   . PRO D  1 131 ? -7.659  45.991  71.150  1.00 54.28  ? 277  PRO C C   1 
ATOM   3008  O O   . PRO D  1 131 ? -8.067  47.029  71.662  1.00 54.28  ? 277  PRO C O   1 
ATOM   3009  C CB  . PRO D  1 131 ? -5.812  46.833  69.651  1.00 54.28  ? 277  PRO C CB  1 
ATOM   3010  C CG  . PRO D  1 131 ? -6.216  48.084  68.992  1.00 54.28  ? 277  PRO C CG  1 
ATOM   3011  C CD  . PRO D  1 131 ? -7.322  47.713  68.046  1.00 54.28  ? 277  PRO C CD  1 
ATOM   3012  N N   . LYS D  1 132 ? -7.676  44.818  71.773  1.00 33.84  ? 278  LYS C N   1 
ATOM   3013  C CA  . LYS D  1 132 ? -8.168  44.703  73.135  1.00 33.84  ? 278  LYS C CA  1 
ATOM   3014  C C   . LYS D  1 132 ? -7.009  44.174  73.956  1.00 33.84  ? 278  LYS C C   1 
ATOM   3015  O O   . LYS D  1 132 ? -6.642  43.012  73.839  1.00 33.84  ? 278  LYS C O   1 
ATOM   3016  C CB  . LYS D  1 132 ? -9.362  43.755  73.171  1.00 33.84  ? 278  LYS C CB  1 
ATOM   3017  C CG  . LYS D  1 132 ? -10.324 44.012  72.032  1.00 33.84  ? 278  LYS C CG  1 
ATOM   3018  C CD  . LYS D  1 132 ? -11.494 43.066  72.060  1.00 33.84  ? 278  LYS C CD  1 
ATOM   3019  C CE  . LYS D  1 132 ? -11.865 42.562  70.650  1.00 33.84  ? 278  LYS C CE  1 
ATOM   3020  N NZ  . LYS D  1 132 ? -11.419 43.452  69.540  1.00 33.84  ? 278  LYS C NZ  1 
ATOM   3021  N N   . VAL D  1 133 ? -6.425  45.029  74.787  1.00 27.15  ? 279  VAL C N   1 
ATOM   3022  C CA  . VAL D  1 133 ? -5.280  44.627  75.585  1.00 27.15  ? 279  VAL C CA  1 
ATOM   3023  C C   . VAL D  1 133 ? -5.602  44.325  77.028  1.00 27.15  ? 279  VAL C C   1 
ATOM   3024  O O   . VAL D  1 133 ? -6.430  44.992  77.623  1.00 27.15  ? 279  VAL C O   1 
ATOM   3025  C CB  . VAL D  1 133 ? -4.216  45.712  75.544  1.00 27.15  ? 279  VAL C CB  1 
ATOM   3026  C CG1 . VAL D  1 133 ? -3.056  45.335  76.428  1.00 27.15  ? 279  VAL C CG1 1 
ATOM   3027  C CG2 . VAL D  1 133 ? -3.757  45.926  74.091  1.00 27.15  ? 279  VAL C CG2 1 
ATOM   3028  N N   . PHE D  1 134 ? -4.944  43.314  77.583  1.00 23.62  ? 280  PHE C N   1 
ATOM   3029  C CA  . PHE D  1 134 ? -5.143  42.926  78.973  1.00 23.62  ? 280  PHE C CA  1 
ATOM   3030  C C   . PHE D  1 134 ? -3.783  42.687  79.567  1.00 23.62  ? 280  PHE C C   1 
ATOM   3031  O O   . PHE D  1 134 ? -2.971  41.947  79.006  1.00 23.62  ? 280  PHE C O   1 
ATOM   3032  C CB  . PHE D  1 134 ? -5.905  41.626  79.087  1.00 23.62  ? 280  PHE C CB  1 
ATOM   3033  C CG  . PHE D  1 134 ? -7.359  41.757  78.847  1.00 23.62  ? 280  PHE C CG  1 
ATOM   3034  C CD1 . PHE D  1 134 ? -7.851  41.967  77.562  1.00 23.62  ? 280  PHE C CD1 1 
ATOM   3035  C CD2 . PHE D  1 134 ? -8.260  41.647  79.906  1.00 23.62  ? 280  PHE C CD2 1 
ATOM   3036  C CE1 . PHE D  1 134 ? -9.233  42.066  77.328  1.00 23.62  ? 280  PHE C CE1 1 
ATOM   3037  C CE2 . PHE D  1 134 ? -9.646  41.746  79.689  1.00 23.62  ? 280  PHE C CE2 1 
ATOM   3038  C CZ  . PHE D  1 134 ? -10.128 41.955  78.399  1.00 23.62  ? 280  PHE C CZ  1 
ATOM   3039  N N   . PHE D  1 135 ? -3.535  43.320  80.705  1.00 25.91  ? 281  PHE C N   1 
ATOM   3040  C CA  . PHE D  1 135 ? -2.276  43.165  81.400  1.00 25.91  ? 281  PHE C CA  1 
ATOM   3041  C C   . PHE D  1 135 ? -2.681  42.613  82.722  1.00 25.91  ? 281  PHE C C   1 
ATOM   3042  O O   . PHE D  1 135 ? -3.335  43.297  83.491  1.00 25.91  ? 281  PHE C O   1 
ATOM   3043  C CB  . PHE D  1 135 ? -1.595  44.514  81.593  1.00 25.91  ? 281  PHE C CB  1 
ATOM   3044  C CG  . PHE D  1 135 ? -1.005  45.059  80.339  1.00 25.91  ? 281  PHE C CG  1 
ATOM   3045  C CD1 . PHE D  1 135 ? -0.176  44.256  79.548  1.00 25.91  ? 281  PHE C CD1 1 
ATOM   3046  C CD2 . PHE D  1 135 ? -1.328  46.336  79.899  1.00 25.91  ? 281  PHE C CD2 1 
ATOM   3047  C CE1 . PHE D  1 135 ? 0.321   44.718  78.324  1.00 25.91  ? 281  PHE C CE1 1 
ATOM   3048  C CE2 . PHE D  1 135 ? -0.842  46.807  78.683  1.00 25.91  ? 281  PHE C CE2 1 
ATOM   3049  C CZ  . PHE D  1 135 ? -0.014  45.995  77.888  1.00 25.91  ? 281  PHE C CZ  1 
ATOM   3050  N N   . ILE D  1 136 ? -2.353  41.364  82.991  1.00 29.90  ? 282  ILE C N   1 
ATOM   3051  C CA  . ILE D  1 136 ? -2.729  40.826  84.280  1.00 29.90  ? 282  ILE C CA  1 
ATOM   3052  C C   . ILE D  1 136 ? -1.455  40.721  85.103  1.00 29.90  ? 282  ILE C C   1 
ATOM   3053  O O   . ILE D  1 136 ? -0.414  40.288  84.602  1.00 29.90  ? 282  ILE C O   1 
ATOM   3054  C CB  . ILE D  1 136 ? -3.395  39.449  84.146  1.00 29.90  ? 282  ILE C CB  1 
ATOM   3055  C CG1 . ILE D  1 136 ? -4.829  39.601  83.651  1.00 29.90  ? 282  ILE C CG1 1 
ATOM   3056  C CG2 . ILE D  1 136 ? -3.459  38.772  85.496  1.00 29.90  ? 282  ILE C CG2 1 
ATOM   3057  C CD1 . ILE D  1 136 ? -4.951  40.199  82.281  1.00 29.90  ? 282  ILE C CD1 1 
ATOM   3058  N N   . GLN D  1 137 ? -1.537  41.148  86.357  1.00 31.87  ? 283  GLN C N   1 
ATOM   3059  C CA  . GLN D  1 137 ? -0.403  41.103  87.269  1.00 31.87  ? 283  GLN C CA  1 
ATOM   3060  C C   . GLN D  1 137 ? -0.854  40.398  88.538  1.00 31.87  ? 283  GLN C C   1 
ATOM   3061  O O   . GLN D  1 137 ? -1.307  41.017  89.501  1.00 31.87  ? 283  GLN C O   1 
ATOM   3062  C CB  . GLN D  1 137 ? 0.087   42.520  87.580  1.00 31.87  ? 283  GLN C CB  1 
ATOM   3063  C CG  . GLN D  1 137 ? 0.956   42.642  88.827  1.00 31.87  ? 283  GLN C CG  1 
ATOM   3064  C CD  . GLN D  1 137 ? 2.141   41.697  88.824  1.00 31.87  ? 283  GLN C CD  1 
ATOM   3065  O OE1 . GLN D  1 137 ? 3.231   42.041  88.354  1.00 31.87  ? 283  GLN C OE1 1 
ATOM   3066  N NE2 . GLN D  1 137 ? 1.934   40.495  89.351  1.00 31.87  ? 283  GLN C NE2 1 
ATOM   3067  N N   . ALA D  1 138 ? -0.752  39.080  88.509  1.00 39.64  ? 284  ALA C N   1 
ATOM   3068  C CA  . ALA D  1 138 ? -1.126  38.240  89.635  1.00 39.64  ? 284  ALA C CA  1 
ATOM   3069  C C   . ALA D  1 138 ? -0.146  37.075  89.650  1.00 39.64  ? 284  ALA C C   1 
ATOM   3070  O O   . ALA D  1 138 ? 0.905   37.124  89.016  1.00 39.64  ? 284  ALA C O   1 
ATOM   3071  C CB  . ALA D  1 138 ? -2.549  37.724  89.450  1.00 39.64  ? 284  ALA C CB  1 
ATOM   3072  N N   . CYS D  1 139 ? -0.484  36.032  90.388  1.00 41.84  ? 285  CYS C N   1 
ATOM   3073  C CA  . CYS D  1 139 ? 0.357   34.854  90.434  1.00 41.84  ? 285  CYS C CA  1 
ATOM   3074  C C   . CYS D  1 139 ? -0.443  33.802  89.720  1.00 41.84  ? 285  CYS C C   1 
ATOM   3075  O O   . CYS D  1 139 ? -1.668  33.897  89.644  1.00 41.84  ? 285  CYS C O   1 
ATOM   3076  C CB  . CYS D  1 139 ? 0.604   34.410  91.866  1.00 41.84  ? 285  CYS C CB  1 
ATOM   3077  S SG  . CYS D  1 139 ? 1.956   35.290  92.617  1.00 41.84  ? 285  CYS C SG  1 
ATOM   3078  N N   . GLN D  1 140 ? 0.241   32.793  89.206  1.00 57.01  ? 286  GLN C N   1 
ATOM   3079  C CA  . GLN D  1 140 ? -0.448  31.733  88.504  1.00 57.01  ? 286  GLN C CA  1 
ATOM   3080  C C   . GLN D  1 140 ? -0.229  30.374  89.165  1.00 57.01  ? 286  GLN C C   1 
ATOM   3081  O O   . GLN D  1 140 ? -0.549  29.333  88.593  1.00 57.01  ? 286  GLN C O   1 
ATOM   3082  C CB  . GLN D  1 140 ? 0.016   31.724  87.057  1.00 57.01  ? 286  GLN C CB  1 
ATOM   3083  C CG  . GLN D  1 140 ? -0.500  32.914  86.278  1.00 57.01  ? 286  GLN C CG  1 
ATOM   3084  C CD  . GLN D  1 140 ? -2.000  32.860  86.095  1.00 57.01  ? 286  GLN C CD  1 
ATOM   3085  O OE1 . GLN D  1 140 ? -2.751  33.344  86.937  1.00 57.01  ? 286  GLN C OE1 1 
ATOM   3086  N NE2 . GLN D  1 140 ? -2.448  32.259  84.996  1.00 57.01  ? 286  GLN C NE2 1 
ATOM   3087  N N   . GLY D  1 141 ? 0.295   30.403  90.387  1.00 59.00  ? 287  GLY C N   1 
ATOM   3088  C CA  . GLY D  1 141 ? 0.567   29.191  91.139  1.00 59.00  ? 287  GLY C CA  1 
ATOM   3089  C C   . GLY D  1 141 ? 1.549   29.560  92.233  1.00 59.00  ? 287  GLY C C   1 
ATOM   3090  O O   . GLY D  1 141 ? 1.806   30.754  92.428  1.00 59.00  ? 287  GLY C O   1 
ATOM   3091  N N   . ASP D  1 142 ? 2.097   28.575  92.946  1.00 53.38  ? 288  ASP C N   1 
ATOM   3092  C CA  . ASP D  1 142 ? 3.058   28.879  94.009  1.00 53.38  ? 288  ASP C CA  1 
ATOM   3093  C C   . ASP D  1 142 ? 4.503   28.386  93.767  1.00 53.38  ? 288  ASP C C   1 
ATOM   3094  O O   . ASP D  1 142 ? 5.281   28.226  94.704  1.00 53.38  ? 288  ASP C O   1 
ATOM   3095  C CB  . ASP D  1 142 ? 2.538   28.368  95.362  1.00 53.38  ? 288  ASP C CB  1 
ATOM   3096  C CG  . ASP D  1 142 ? 2.156   26.908  95.334  1.00 53.38  ? 288  ASP C CG  1 
ATOM   3097  O OD1 . ASP D  1 142 ? 2.479   26.231  94.332  1.00 53.38  ? 288  ASP C OD1 1 
ATOM   3098  O OD2 . ASP D  1 142 ? 1.533   26.437  96.314  1.00 53.38  ? 288  ASP C OD2 1 
ATOM   3099  N N   . ASN D  1 143 ? 4.862   28.170  92.504  1.00 81.44  ? 289  ASN C N   1 
ATOM   3100  C CA  . ASN D  1 143 ? 6.205   27.719  92.148  1.00 81.44  ? 289  ASN C CA  1 
ATOM   3101  C C   . ASN D  1 143 ? 7.134   28.918  92.037  1.00 81.44  ? 289  ASN C C   1 
ATOM   3102  O O   . ASN D  1 143 ? 6.682   30.058  92.044  1.00 81.44  ? 289  ASN C O   1 
ATOM   3103  C CB  . ASN D  1 143 ? 6.187   27.008  90.795  1.00 81.44  ? 289  ASN C CB  1 
ATOM   3104  C CG  . ASN D  1 143 ? 5.654   25.597  90.881  1.00 81.44  ? 289  ASN C CG  1 
ATOM   3105  O OD1 . ASN D  1 143 ? 4.912   25.257  91.801  1.00 81.44  ? 289  ASN C OD1 1 
ATOM   3106  N ND2 . ASN D  1 143 ? 6.027   24.764  89.914  1.00 81.44  ? 289  ASN C ND2 1 
ATOM   3107  N N   . TYR D  1 144 ? 8.433   28.651  91.936  1.00 66.48  ? 290  TYR C N   1 
ATOM   3108  C CA  . TYR D  1 144 ? 9.429   29.700  91.775  1.00 66.48  ? 290  TYR C CA  1 
ATOM   3109  C C   . TYR D  1 144 ? 10.169  29.350  90.513  1.00 66.48  ? 290  TYR C C   1 
ATOM   3110  O O   . TYR D  1 144 ? 10.662  28.238  90.352  1.00 66.48  ? 290  TYR C O   1 
ATOM   3111  C CB  . TYR D  1 144 ? 10.414  29.741  92.942  1.00 66.48  ? 290  TYR C CB  1 
ATOM   3112  C CG  . TYR D  1 144 ? 9.841   30.355  94.195  1.00 66.48  ? 290  TYR C CG  1 
ATOM   3113  C CD1 . TYR D  1 144 ? 8.985   29.620  95.017  1.00 66.48  ? 290  TYR C CD1 1 
ATOM   3114  C CD2 . TYR D  1 144 ? 10.136  31.674  94.555  1.00 66.48  ? 290  TYR C CD2 1 
ATOM   3115  C CE1 . TYR D  1 144 ? 8.427   30.176  96.170  1.00 66.48  ? 290  TYR C CE1 1 
ATOM   3116  C CE2 . TYR D  1 144 ? 9.582   32.247  95.711  1.00 66.48  ? 290  TYR C CE2 1 
ATOM   3117  C CZ  . TYR D  1 144 ? 8.723   31.489  96.515  1.00 66.48  ? 290  TYR C CZ  1 
ATOM   3118  O OH  . TYR D  1 144 ? 8.142   32.026  97.650  1.00 66.48  ? 290  TYR C OH  1 
ATOM   3119  N N   . GLN D  1 145 ? 10.223  30.300  89.601  1.00 54.11  ? 291  GLN C N   1 
ATOM   3120  C CA  . GLN D  1 145 ? 10.907  30.077  88.353  1.00 54.11  ? 291  GLN C CA  1 
ATOM   3121  C C   . GLN D  1 145 ? 12.388  29.905  88.626  1.00 54.11  ? 291  GLN C C   1 
ATOM   3122  O O   . GLN D  1 145 ? 13.093  30.890  88.861  1.00 54.11  ? 291  GLN C O   1 
ATOM   3123  C CB  . GLN D  1 145 ? 10.696  31.270  87.426  1.00 54.11  ? 291  GLN C CB  1 
ATOM   3124  C CG  . GLN D  1 145 ? 11.173  31.042  86.008  1.00 54.11  ? 291  GLN C CG  1 
ATOM   3125  C CD  . GLN D  1 145 ? 10.350  30.009  85.297  1.00 54.11  ? 291  GLN C CD  1 
ATOM   3126  O OE1 . GLN D  1 145 ? 9.489   29.367  85.898  1.00 54.11  ? 291  GLN C OE1 1 
ATOM   3127  N NE2 . GLN D  1 145 ? 10.605  29.835  84.009  1.00 54.11  ? 291  GLN C NE2 1 
ATOM   3128  N N   . LYS D  1 146 ? 12.865  28.663  88.602  1.00 85.88  ? 292  LYS C N   1 
ATOM   3129  C CA  . LYS D  1 146 ? 14.280  28.415  88.830  1.00 85.88  ? 292  LYS C CA  1 
ATOM   3130  C C   . LYS D  1 146 ? 15.059  29.027  87.670  1.00 85.88  ? 292  LYS C C   1 
ATOM   3131  O O   . LYS D  1 146 ? 14.619  28.977  86.527  1.00 85.88  ? 292  LYS C O   1 
ATOM   3132  C CB  . LYS D  1 146 ? 14.556  26.914  88.910  1.00 85.88  ? 292  LYS C CB  1 
ATOM   3133  C CG  . LYS D  1 146 ? 15.996  26.586  89.287  1.00 85.88  ? 292  LYS C CG  1 
ATOM   3134  C CD  . LYS D  1 146 ? 16.099  25.372  90.209  1.00 85.88  ? 292  LYS C CD  1 
ATOM   3135  C CE  . LYS D  1 146 ? 17.533  25.158  90.698  1.00 85.88  ? 292  LYS C CE  1 
ATOM   3136  N NZ  . LYS D  1 146 ? 17.912  23.712  90.652  1.00 85.88  ? 292  LYS C NZ  1 
ATOM   3137  N N   . GLY D  1 147 ? 16.207  29.622  87.969  1.00 70.11  ? 293  GLY C N   1 
ATOM   3138  C CA  . GLY D  1 147 ? 17.016  30.227  86.927  1.00 70.11  ? 293  GLY C CA  1 
ATOM   3139  C C   . GLY D  1 147 ? 18.182  29.351  86.499  1.00 70.11  ? 293  GLY C C   1 
ATOM   3140  O O   . GLY D  1 147 ? 18.634  28.481  87.243  1.00 70.11  ? 293  GLY C O   1 
ATOM   3141  N N   . ILE D  1 148 ? 18.668  29.568  85.283  1.00 56.85  ? 294  ILE C N   1 
ATOM   3142  C CA  . ILE D  1 148 ? 19.793  28.802  84.769  1.00 56.85  ? 294  ILE C CA  1 
ATOM   3143  C C   . ILE D  1 148 ? 20.842  29.775  84.230  1.00 56.85  ? 294  ILE C C   1 
ATOM   3144  O O   . ILE D  1 148 ? 20.508  30.851  83.739  1.00 56.85  ? 294  ILE C O   1 
ATOM   3145  C CB  . ILE D  1 148 ? 19.347  27.835  83.661  1.00 56.85  ? 294  ILE C CB  1 
ATOM   3146  C CG1 . ILE D  1 148 ? 19.092  28.613  82.366  1.00 56.85  ? 294  ILE C CG1 1 
ATOM   3147  C CG2 . ILE D  1 148 ? 18.126  27.032  84.132  1.00 56.85  ? 294  ILE C CG2 1 
ATOM   3148  C CD1 . ILE D  1 148 ? 17.641  28.905  82.086  1.00 56.85  ? 294  ILE C CD1 1 
ATOM   3149  N N   . PRO D  1 149 ? 22.132  29.400  84.299  1.00 55.77  ? 295  PRO C N   1 
ATOM   3150  C CA  . PRO D  1 149 ? 23.239  30.243  83.831  1.00 55.77  ? 295  PRO C CA  1 
ATOM   3151  C C   . PRO D  1 149 ? 23.430  30.292  82.327  1.00 55.77  ? 295  PRO C C   1 
ATOM   3152  O O   . PRO D  1 149 ? 22.953  29.413  81.620  1.00 55.77  ? 295  PRO C O   1 
ATOM   3153  C CB  . PRO D  1 149 ? 24.466  29.649  84.527  1.00 55.77  ? 295  PRO C CB  1 
ATOM   3154  C CG  . PRO D  1 149 ? 23.990  28.408  85.260  1.00 55.77  ? 295  PRO C CG  1 
ATOM   3155  C CD  . PRO D  1 149 ? 22.609  28.103  84.807  1.00 55.77  ? 295  PRO C CD  1 
ATOM   3156  N N   . VAL D  1 150 ? 24.136  31.311  81.837  1.00 51.51  ? 296  VAL C N   1 
ATOM   3157  C CA  . VAL D  1 150 ? 24.372  31.404  80.401  1.00 51.51  ? 296  VAL C CA  1 
ATOM   3158  C C   . VAL D  1 150 ? 25.344  32.480  79.894  1.00 51.51  ? 296  VAL C C   1 
ATOM   3159  O O   . VAL D  1 150 ? 26.314  32.187  79.165  1.00 51.51  ? 296  VAL C O   1 
ATOM   3160  C CB  . VAL D  1 150 ? 23.027  31.575  79.641  1.00 51.51  ? 296  VAL C CB  1 
ATOM   3161  C CG1 . VAL D  1 150 ? 22.310  32.819  80.125  1.00 51.51  ? 296  VAL C CG1 1 
ATOM   3162  C CG2 . VAL D  1 150 ? 23.268  31.640  78.131  1.00 51.51  ? 296  VAL C CG2 1 
ATOM   3163  N N   . GLU D  1 151 ? 25.071  33.722  80.291  1.00 100.00 ? 297  GLU C N   1 
ATOM   3164  C CA  . GLU D  1 151 ? 25.830  34.896  79.850  1.00 100.00 ? 297  GLU C CA  1 
ATOM   3165  C C   . GLU D  1 151 ? 26.048  34.952  78.339  1.00 100.00 ? 297  GLU C C   1 
ATOM   3166  O O   . GLU D  1 151 ? 27.150  34.717  77.830  1.00 100.00 ? 297  GLU C O   1 
ATOM   3167  C CB  . GLU D  1 151 ? 27.183  35.037  80.548  1.00 100.00 ? 297  GLU C CB  1 
ATOM   3168  C CG  . GLU D  1 151 ? 27.911  36.411  80.305  1.00 100.00 ? 297  GLU C CG  1 
ATOM   3169  C CD  . GLU D  1 151 ? 27.105  37.454  79.486  1.00 100.00 ? 297  GLU C CD  1 
ATOM   3170  O OE1 . GLU D  1 151 ? 25.980  37.810  79.893  1.00 100.00 ? 297  GLU C OE1 1 
ATOM   3171  O OE2 . GLU D  1 151 ? 27.603  37.934  78.439  1.00 100.00 ? 297  GLU C OE2 1 
ATOM   3172  N N   . THR D  1 152 ? 24.963  35.245  77.631  1.00 100.00 ? 298  THR C N   1 
ATOM   3173  C CA  . THR D  1 152 ? 24.978  35.428  76.191  1.00 100.00 ? 298  THR C CA  1 
ATOM   3174  C C   . THR D  1 152 ? 24.715  36.948  76.169  1.00 100.00 ? 298  THR C C   1 
ATOM   3175  O O   . THR D  1 152 ? 25.631  37.739  76.454  1.00 100.00 ? 298  THR C O   1 
ATOM   3176  C CB  . THR D  1 152 ? 23.827  34.607  75.469  1.00 100.00 ? 298  THR C CB  1 
ATOM   3177  O OG1 . THR D  1 152 ? 22.698  34.437  76.346  1.00 100.00 ? 298  THR C OG1 1 
ATOM   3178  C CG2 . THR D  1 152 ? 24.341  33.225  75.040  1.00 100.00 ? 298  THR C CG2 1 
ATOM   3179  N N   . ASP D  1 153 ? 23.468  37.340  75.893  1.00 100.00 ? 299  ASP C N   1 
ATOM   3180  C CA  . ASP D  1 153 ? 23.038  38.746  75.870  1.00 100.00 ? 299  ASP C CA  1 
ATOM   3181  C C   . ASP D  1 153 ? 24.156  39.789  75.723  1.00 100.00 ? 299  ASP C C   1 
ATOM   3182  O O   . ASP D  1 153 ? 24.316  40.308  74.596  1.00 100.00 ? 299  ASP C O   1 
ATOM   3183  C CB  . ASP D  1 153 ? 22.230  39.043  77.139  1.00 100.00 ? 299  ASP C CB  1 
ATOM   3184  C CG  . ASP D  1 153 ? 21.822  37.772  77.884  1.00 100.00 ? 299  ASP C CG  1 
ATOM   3185  O OD1 . ASP D  1 153 ? 21.116  36.928  77.276  1.00 100.00 ? 299  ASP C OD1 1 
ATOM   3186  O OD2 . ASP D  1 153 ? 22.208  37.623  79.069  1.00 100.00 ? 299  ASP C OD2 1 
ATOM   3187  O OXT . ASP D  1 153 ? 24.849  40.090  76.727  1.00 100.00 ? 299  ASP C OXT 1 
ATOM   3188  N N   . THR E  2 1   ? -16.974 45.579  53.705  1.00 82.39  ? 318  THR D N   1 
ATOM   3189  C CA  . THR E  2 1   ? -17.362 44.740  54.877  1.00 82.39  ? 318  THR D CA  1 
ATOM   3190  C C   . THR E  2 1   ? -16.767 43.343  54.788  1.00 82.39  ? 318  THR D C   1 
ATOM   3191  O O   . THR E  2 1   ? -17.179 42.538  53.954  1.00 82.39  ? 318  THR D O   1 
ATOM   3192  C CB  . THR E  2 1   ? -18.899 44.601  54.979  1.00 82.39  ? 318  THR D CB  1 
ATOM   3193  O OG1 . THR E  2 1   ? -19.444 45.795  55.549  1.00 82.39  ? 318  THR D OG1 1 
ATOM   3194  C CG2 . THR E  2 1   ? -19.283 43.405  55.849  1.00 82.39  ? 318  THR D CG2 1 
ATOM   3195  N N   . ARG E  2 2   ? -15.802 43.053  55.653  1.00 84.72  ? 319  ARG D N   1 
ATOM   3196  C CA  . ARG E  2 2   ? -15.172 41.742  55.660  1.00 84.72  ? 319  ARG D CA  1 
ATOM   3197  C C   . ARG E  2 2   ? -15.465 41.020  56.969  1.00 84.72  ? 319  ARG D C   1 
ATOM   3198  O O   . ARG E  2 2   ? -16.158 41.549  57.838  1.00 84.72  ? 319  ARG D O   1 
ATOM   3199  C CB  . ARG E  2 2   ? -13.666 41.886  55.473  1.00 84.72  ? 319  ARG D CB  1 
ATOM   3200  C CG  . ARG E  2 2   ? -13.277 42.431  54.114  1.00 84.72  ? 319  ARG D CG  1 
ATOM   3201  C CD  . ARG E  2 2   ? -11.882 43.048  54.140  1.00 84.72  ? 319  ARG D CD  1 
ATOM   3202  N NE  . ARG E  2 2   ? -11.403 43.386  52.798  1.00 84.72  ? 319  ARG D NE  1 
ATOM   3203  C CZ  . ARG E  2 2   ? -10.121 43.413  52.433  1.00 84.72  ? 319  ARG D CZ  1 
ATOM   3204  N NH1 . ARG E  2 2   ? -9.165  43.122  53.312  1.00 84.72  ? 319  ARG D NH1 1 
ATOM   3205  N NH2 . ARG E  2 2   ? -9.795  43.722  51.181  1.00 84.72  ? 319  ARG D NH2 1 
ATOM   3206  N N   . TYR E  2 3   ? -14.949 39.804  57.104  1.00 73.50  ? 320  TYR D N   1 
ATOM   3207  C CA  . TYR E  2 3   ? -15.159 39.032  58.319  1.00 73.50  ? 320  TYR D CA  1 
ATOM   3208  C C   . TYR E  2 3   ? -13.839 38.696  58.960  1.00 73.50  ? 320  TYR D C   1 
ATOM   3209  O O   . TYR E  2 3   ? -12.804 38.623  58.294  1.00 73.50  ? 320  TYR D O   1 
ATOM   3210  C CB  . TYR E  2 3   ? -15.910 37.741  58.029  1.00 73.50  ? 320  TYR D CB  1 
ATOM   3211  C CG  . TYR E  2 3   ? -17.397 37.919  58.087  1.00 73.50  ? 320  TYR D CG  1 
ATOM   3212  C CD1 . TYR E  2 3   ? -18.044 38.777  57.193  1.00 73.50  ? 320  TYR D CD1 1 
ATOM   3213  C CD2 . TYR E  2 3   ? -18.161 37.262  59.047  1.00 73.50  ? 320  TYR D CD2 1 
ATOM   3214  C CE1 . TYR E  2 3   ? -19.423 38.985  57.252  1.00 73.50  ? 320  TYR D CE1 1 
ATOM   3215  C CE2 . TYR E  2 3   ? -19.546 37.459  59.118  1.00 73.50  ? 320  TYR D CE2 1 
ATOM   3216  C CZ  . TYR E  2 3   ? -20.166 38.327  58.215  1.00 73.50  ? 320  TYR D CZ  1 
ATOM   3217  O OH  . TYR E  2 3   ? -21.515 38.564  58.284  1.00 73.50  ? 320  TYR D OH  1 
ATOM   3218  N N   . ILE E  2 4   ? -13.884 38.499  60.269  1.00 36.09  ? 321  ILE D N   1 
ATOM   3219  C CA  . ILE E  2 4   ? -12.696 38.170  61.038  1.00 36.09  ? 321  ILE D CA  1 
ATOM   3220  C C   . ILE E  2 4   ? -13.146 37.265  62.165  1.00 36.09  ? 321  ILE D C   1 
ATOM   3221  O O   . ILE E  2 4   ? -14.303 37.309  62.556  1.00 36.09  ? 321  ILE D O   1 
ATOM   3222  C CB  . ILE E  2 4   ? -12.037 39.443  61.619  1.00 36.09  ? 321  ILE D CB  1 
ATOM   3223  C CG1 . ILE E  2 4   ? -13.105 40.372  62.186  1.00 36.09  ? 321  ILE D CG1 1 
ATOM   3224  C CG2 . ILE E  2 4   ? -11.247 40.168  60.541  1.00 36.09  ? 321  ILE D CG2 1 
ATOM   3225  C CD1 . ILE E  2 4   ? -12.600 41.226  63.341  1.00 36.09  ? 321  ILE D CD1 1 
ATOM   3226  N N   . PRO E  2 5   ? -12.247 36.426  62.696  1.00 39.85  ? 322  PRO D N   1 
ATOM   3227  C CA  . PRO E  2 5   ? -12.601 35.514  63.789  1.00 39.85  ? 322  PRO D CA  1 
ATOM   3228  C C   . PRO E  2 5   ? -13.045 36.233  65.050  1.00 39.85  ? 322  PRO D C   1 
ATOM   3229  O O   . PRO E  2 5   ? -12.476 37.253  65.418  1.00 39.85  ? 322  PRO D O   1 
ATOM   3230  C CB  . PRO E  2 5   ? -11.321 34.721  64.027  1.00 39.85  ? 322  PRO D CB  1 
ATOM   3231  C CG  . PRO E  2 5   ? -10.246 35.613  63.516  1.00 39.85  ? 322  PRO D CG  1 
ATOM   3232  C CD  . PRO E  2 5   ? -10.835 36.286  62.312  1.00 39.85  ? 322  PRO D CD  1 
ATOM   3233  N N   . ASP E  2 6   ? -14.056 35.677  65.707  1.00 40.29  ? 323  ASP D N   1 
ATOM   3234  C CA  . ASP E  2 6   ? -14.623 36.210  66.950  1.00 40.29  ? 323  ASP D CA  1 
ATOM   3235  C C   . ASP E  2 6   ? -13.577 36.651  67.977  1.00 40.29  ? 323  ASP D C   1 
ATOM   3236  O O   . ASP E  2 6   ? -13.744 37.671  68.634  1.00 40.29  ? 323  ASP D O   1 
ATOM   3237  C CB  . ASP E  2 6   ? -15.528 35.130  67.563  1.00 40.29  ? 323  ASP D CB  1 
ATOM   3238  C CG  . ASP E  2 6   ? -16.395 35.637  68.712  1.00 40.29  ? 323  ASP D CG  1 
ATOM   3239  O OD1 . ASP E  2 6   ? -16.377 36.850  69.012  1.00 40.29  ? 323  ASP D OD1 1 
ATOM   3240  O OD2 . ASP E  2 6   ? -17.105 34.795  69.315  1.00 40.29  ? 323  ASP D OD2 1 
ATOM   3241  N N   . GLU E  2 7   ? -12.496 35.883  68.096  1.00 43.69  ? 324  GLU D N   1 
ATOM   3242  C CA  . GLU E  2 7   ? -11.416 36.144  69.059  1.00 43.69  ? 324  GLU D CA  1 
ATOM   3243  C C   . GLU E  2 7   ? -10.221 37.020  68.625  1.00 43.69  ? 324  GLU D C   1 
ATOM   3244  O O   . GLU E  2 7   ? -9.271  37.204  69.394  1.00 43.69  ? 324  GLU D O   1 
ATOM   3245  C CB  . GLU E  2 7   ? -10.870 34.809  69.549  1.00 43.69  ? 324  GLU D CB  1 
ATOM   3246  C CG  . GLU E  2 7   ? -11.389 34.399  70.896  1.00 43.69  ? 324  GLU D CG  1 
ATOM   3247  C CD  . GLU E  2 7   ? -11.964 33.000  70.884  1.00 43.69  ? 324  GLU D CD  1 
ATOM   3248  O OE1 . GLU E  2 7   ? -12.787 32.698  69.988  1.00 43.69  ? 324  GLU D OE1 1 
ATOM   3249  O OE2 . GLU E  2 7   ? -11.592 32.204  71.773  1.00 43.69  ? 324  GLU D OE2 1 
ATOM   3250  N N   . ALA E  2 8   ? -10.265 37.558  67.411  1.00 29.71  ? 325  ALA D N   1 
ATOM   3251  C CA  . ALA E  2 8   ? -9.186  38.384  66.894  1.00 29.71  ? 325  ALA D CA  1 
ATOM   3252  C C   . ALA E  2 8   ? -8.782  39.613  67.723  1.00 29.71  ? 325  ALA D C   1 
ATOM   3253  O O   . ALA E  2 8   ? -9.402  39.952  68.739  1.00 29.71  ? 325  ALA D O   1 
ATOM   3254  C CB  . ALA E  2 8   ? -9.536  38.820  65.484  1.00 29.71  ? 325  ALA D CB  1 
ATOM   3255  N N   . ASP E  2 9   ? -7.707  40.253  67.271  1.00 31.54  ? 326  ASP D N   1 
ATOM   3256  C CA  . ASP E  2 9   ? -7.175  41.478  67.857  1.00 31.54  ? 326  ASP D CA  1 
ATOM   3257  C C   . ASP E  2 9   ? -7.042  41.576  69.382  1.00 31.54  ? 326  ASP D C   1 
ATOM   3258  O O   . ASP E  2 9   ? -7.246  42.648  69.967  1.00 31.54  ? 326  ASP D O   1 
ATOM   3259  C CB  . ASP E  2 9   ? -8.003  42.637  67.321  1.00 31.54  ? 326  ASP D CB  1 
ATOM   3260  C CG  . ASP E  2 9   ? -8.487  42.390  65.884  1.00 31.54  ? 326  ASP D CG  1 
ATOM   3261  O OD1 . ASP E  2 9   ? -7.651  42.343  64.959  1.00 31.54  ? 326  ASP D OD1 1 
ATOM   3262  O OD2 . ASP E  2 9   ? -9.706  42.241  65.673  1.00 31.54  ? 326  ASP D OD2 1 
ATOM   3263  N N   . PHE E  2 10  ? -6.681  40.465  70.021  1.00 31.46  ? 327  PHE D N   1 
ATOM   3264  C CA  . PHE E  2 10  ? -6.503  40.446  71.471  1.00 31.46  ? 327  PHE D CA  1 
ATOM   3265  C C   . PHE E  2 10  ? -5.044  40.445  71.823  1.00 31.46  ? 327  PHE D C   1 
ATOM   3266  O O   . PHE E  2 10  ? -4.202  40.266  70.960  1.00 31.46  ? 327  PHE D O   1 
ATOM   3267  C CB  . PHE E  2 10  ? -7.108  39.196  72.071  1.00 31.46  ? 327  PHE D CB  1 
ATOM   3268  C CG  . PHE E  2 10  ? -8.498  39.381  72.561  1.00 31.46  ? 327  PHE D CG  1 
ATOM   3269  C CD1 . PHE E  2 10  ? -8.734  39.817  73.862  1.00 31.46  ? 327  PHE D CD1 1 
ATOM   3270  C CD2 . PHE E  2 10  ? -9.584  39.110  71.723  1.00 31.46  ? 327  PHE D CD2 1 
ATOM   3271  C CE1 . PHE E  2 10  ? -10.027 39.979  74.322  1.00 31.46  ? 327  PHE D CE1 1 
ATOM   3272  C CE2 . PHE E  2 10  ? -10.875 39.267  72.170  1.00 31.46  ? 327  PHE D CE2 1 
ATOM   3273  C CZ  . PHE E  2 10  ? -11.104 39.701  73.472  1.00 31.46  ? 327  PHE D CZ  1 
ATOM   3274  N N   . LEU E  2 11  ? -4.751  40.640  73.100  1.00 25.59  ? 328  LEU D N   1 
ATOM   3275  C CA  . LEU E  2 11  ? -3.375  40.610  73.565  1.00 25.59  ? 328  LEU D CA  1 
ATOM   3276  C C   . LEU E  2 11  ? -3.351  40.536  75.060  1.00 25.59  ? 328  LEU D C   1 
ATOM   3277  O O   . LEU E  2 11  ? -3.684  41.497  75.748  1.00 25.59  ? 328  LEU D O   1 
ATOM   3278  C CB  . LEU E  2 11  ? -2.573  41.838  73.118  1.00 25.59  ? 328  LEU D CB  1 
ATOM   3279  C CG  . LEU E  2 11  ? -1.232  42.003  73.875  1.00 25.59  ? 328  LEU D CG  1 
ATOM   3280  C CD1 . LEU E  2 11  ? -0.474  40.685  73.951  1.00 25.59  ? 328  LEU D CD1 1 
ATOM   3281  C CD2 . LEU E  2 11  ? -0.385  43.047  73.172  1.00 25.59  ? 328  LEU D CD2 1 
ATOM   3282  N N   . LEU E  2 12  ? -2.950  39.374  75.553  1.00 27.23  ? 329  LEU D N   1 
ATOM   3283  C CA  . LEU E  2 12  ? -2.860  39.137  76.974  1.00 27.23  ? 329  LEU D CA  1 
ATOM   3284  C C   . LEU E  2 12  ? -1.421  39.403  77.451  1.00 27.23  ? 329  LEU D C   1 
ATOM   3285  O O   . LEU E  2 12  ? -0.458  38.922  76.866  1.00 27.23  ? 329  LEU D O   1 
ATOM   3286  C CB  . LEU E  2 12  ? -3.257  37.706  77.263  1.00 27.23  ? 329  LEU D CB  1 
ATOM   3287  C CG  . LEU E  2 12  ? -3.343  37.365  78.739  1.00 27.23  ? 329  LEU D CG  1 
ATOM   3288  C CD1 . LEU E  2 12  ? -4.036  38.483  79.482  1.00 27.23  ? 329  LEU D CD1 1 
ATOM   3289  C CD2 . LEU E  2 12  ? -4.115  36.093  78.902  1.00 27.23  ? 329  LEU D CD2 1 
ATOM   3290  N N   . GLY E  2 13  ? -1.273  40.206  78.494  1.00 27.49  ? 330  GLY D N   1 
ATOM   3291  C CA  . GLY E  2 13  ? 0.052   40.485  78.991  1.00 27.49  ? 330  GLY D CA  1 
ATOM   3292  C C   . GLY E  2 13  ? 0.189   39.780  80.317  1.00 27.49  ? 330  GLY D C   1 
ATOM   3293  O O   . GLY E  2 13  ? -0.038  40.382  81.369  1.00 27.49  ? 330  GLY D O   1 
ATOM   3294  N N   . MET E  2 14  ? 0.524   38.496  80.279  1.00 31.29  ? 331  MET D N   1 
ATOM   3295  C CA  . MET E  2 14  ? 0.694   37.733  81.514  1.00 31.29  ? 331  MET D CA  1 
ATOM   3296  C C   . MET E  2 14  ? 1.984   38.196  82.144  1.00 31.29  ? 331  MET D C   1 
ATOM   3297  O O   . MET E  2 14  ? 2.960   38.475  81.437  1.00 31.29  ? 331  MET D O   1 
ATOM   3298  C CB  . MET E  2 14  ? 0.806   36.233  81.244  1.00 31.29  ? 331  MET D CB  1 
ATOM   3299  C CG  . MET E  2 14  ? -0.514  35.531  81.033  1.00 31.29  ? 331  MET D CG  1 
ATOM   3300  S SD  . MET E  2 14  ? -1.812  36.211  82.033  1.00 31.29  ? 331  MET D SD  1 
ATOM   3301  C CE  . MET E  2 14  ? -1.548  35.393  83.569  1.00 31.29  ? 331  MET D CE  1 
ATOM   3302  N N   . ALA E  2 15  ? 1.981   38.277  83.471  1.00 43.16  ? 332  ALA D N   1 
ATOM   3303  C CA  . ALA E  2 15  ? 3.143   38.719  84.229  1.00 43.16  ? 332  ALA D CA  1 
ATOM   3304  C C   . ALA E  2 15  ? 4.063   37.559  84.518  1.00 43.16  ? 332  ALA D C   1 
ATOM   3305  O O   . ALA E  2 15  ? 5.264   37.743  84.693  1.00 43.16  ? 332  ALA D O   1 
ATOM   3306  C CB  . ALA E  2 15  ? 2.703   39.361  85.536  1.00 43.16  ? 332  ALA D CB  1 
ATOM   3307  N N   . THR E  2 16  ? 3.492   36.363  84.572  1.00 36.50  ? 333  THR D N   1 
ATOM   3308  C CA  . THR E  2 16  ? 4.262   35.155  84.849  1.00 36.50  ? 333  THR D CA  1 
ATOM   3309  C C   . THR E  2 16  ? 3.727   33.954  84.081  1.00 36.50  ? 333  THR D C   1 
ATOM   3310  O O   . THR E  2 16  ? 2.545   33.908  83.734  1.00 36.50  ? 333  THR D O   1 
ATOM   3311  C CB  . THR E  2 16  ? 4.217   34.807  86.355  1.00 36.50  ? 333  THR D CB  1 
ATOM   3312  O OG1 . THR E  2 16  ? 4.798   33.514  86.579  1.00 36.50  ? 333  THR D OG1 1 
ATOM   3313  C CG2 . THR E  2 16  ? 2.792   34.778  86.837  1.00 36.50  ? 333  THR D CG2 1 
ATOM   3314  N N   . VAL E  2 17  ? 4.598   32.989  83.803  1.00 31.65  ? 334  VAL D N   1 
ATOM   3315  C CA  . VAL E  2 17  ? 4.172   31.771  83.116  1.00 31.65  ? 334  VAL D CA  1 
ATOM   3316  C C   . VAL E  2 17  ? 3.325   31.010  84.164  1.00 31.65  ? 334  VAL D C   1 
ATOM   3317  O O   . VAL E  2 17  ? 3.448   31.275  85.358  1.00 31.65  ? 334  VAL D O   1 
ATOM   3318  C CB  . VAL E  2 17  ? 5.404   30.913  82.641  1.00 31.65  ? 334  VAL D CB  1 
ATOM   3319  C CG1 . VAL E  2 17  ? 6.227   31.679  81.613  1.00 31.65  ? 334  VAL D CG1 1 
ATOM   3320  C CG2 . VAL E  2 17  ? 6.288   30.550  83.815  1.00 31.65  ? 334  VAL D CG2 1 
ATOM   3321  N N   . ASN E  2 18  ? 2.471   30.083  83.738  1.00 29.63  ? 335  ASN D N   1 
ATOM   3322  C CA  . ASN E  2 18  ? 1.603   29.358  84.666  1.00 29.63  ? 335  ASN D CA  1 
ATOM   3323  C C   . ASN E  2 18  ? 2.308   28.649  85.800  1.00 29.63  ? 335  ASN D C   1 
ATOM   3324  O O   . ASN E  2 18  ? 3.504   28.438  85.757  1.00 29.63  ? 335  ASN D O   1 
ATOM   3325  C CB  . ASN E  2 18  ? 0.750   28.346  83.897  1.00 29.63  ? 335  ASN D CB  1 
ATOM   3326  C CG  . ASN E  2 18  ? -0.660  28.202  84.474  1.00 29.63  ? 335  ASN D CG  1 
ATOM   3327  O OD1 . ASN E  2 18  ? -1.241  27.121  84.444  1.00 29.63  ? 335  ASN D OD1 1 
ATOM   3328  N ND2 . ASN E  2 18  ? -1.211  29.295  84.998  1.00 29.63  ? 335  ASN D ND2 1 
ATOM   3329  N N   . ASN E  2 19  ? 1.547   28.293  86.824  1.00 69.23  ? 336  ASN D N   1 
ATOM   3330  C CA  . ASN E  2 19  ? 2.065   27.573  87.986  1.00 69.23  ? 336  ASN D CA  1 
ATOM   3331  C C   . ASN E  2 19  ? 3.099   28.291  88.857  1.00 69.23  ? 336  ASN D C   1 
ATOM   3332  O O   . ASN E  2 19  ? 3.411   27.821  89.950  1.00 69.23  ? 336  ASN D O   1 
ATOM   3333  C CB  . ASN E  2 19  ? 2.637   26.222  87.538  1.00 69.23  ? 336  ASN D CB  1 
ATOM   3334  C CG  . ASN E  2 19  ? 1.727   25.496  86.550  1.00 69.23  ? 336  ASN D CG  1 
ATOM   3335  O OD1 . ASN E  2 19  ? 2.061   25.353  85.364  1.00 69.23  ? 336  ASN D OD1 1 
ATOM   3336  N ND2 . ASN E  2 19  ? 0.574   25.028  87.035  1.00 69.23  ? 336  ASN D ND2 1 
ATOM   3337  N N   . CYS E  2 20  ? 3.615   29.425  88.396  1.00 52.52  ? 337  CYS D N   1 
ATOM   3338  C CA  . CYS E  2 20  ? 4.624   30.157  89.156  1.00 52.52  ? 337  CYS D CA  1 
ATOM   3339  C C   . CYS E  2 20  ? 4.173   31.468  89.784  1.00 52.52  ? 337  CYS D C   1 
ATOM   3340  O O   . CYS E  2 20  ? 3.063   31.929  89.539  1.00 52.52  ? 337  CYS D O   1 
ATOM   3341  C CB  . CYS E  2 20  ? 5.825   30.423  88.267  1.00 52.52  ? 337  CYS D CB  1 
ATOM   3342  S SG  . CYS E  2 20  ? 6.423   28.928  87.518  1.00 52.52  ? 337  CYS D SG  1 
ATOM   3343  N N   . VAL E  2 21  ? 5.055   32.069  90.586  1.00 37.78  ? 338  VAL D N   1 
ATOM   3344  C CA  . VAL E  2 21  ? 4.749   33.325  91.269  1.00 37.78  ? 338  VAL D CA  1 
ATOM   3345  C C   . VAL E  2 21  ? 5.166   34.591  90.526  1.00 37.78  ? 338  VAL D C   1 
ATOM   3346  O O   . VAL E  2 21  ? 5.832   34.546  89.482  1.00 37.78  ? 338  VAL D O   1 
ATOM   3347  C CB  . VAL E  2 21  ? 5.390   33.393  92.674  1.00 37.78  ? 338  VAL D CB  1 
ATOM   3348  C CG1 . VAL E  2 21  ? 5.066   32.144  93.451  1.00 37.78  ? 338  VAL D CG1 1 
ATOM   3349  C CG2 . VAL E  2 21  ? 6.887   33.582  92.557  1.00 37.78  ? 338  VAL D CG2 1 
ATOM   3350  N N   . SER E  2 22  ? 4.753   35.725  91.082  1.00 52.44  ? 339  SER D N   1 
ATOM   3351  C CA  . SER E  2 22  ? 5.069   37.019  90.517  1.00 52.44  ? 339  SER D CA  1 
ATOM   3352  C C   . SER E  2 22  ? 5.668   37.820  91.647  1.00 52.44  ? 339  SER D C   1 
ATOM   3353  O O   . SER E  2 22  ? 5.370   37.555  92.814  1.00 52.44  ? 339  SER D O   1 
ATOM   3354  C CB  . SER E  2 22  ? 3.814   37.697  90.007  1.00 52.44  ? 339  SER D CB  1 
ATOM   3355  O OG  . SER E  2 22  ? 4.025   38.139  88.681  1.00 52.44  ? 339  SER D OG  1 
ATOM   3356  N N   . TYR E  2 23  ? 6.505   38.799  91.314  1.00 49.51  ? 340  TYR D N   1 
ATOM   3357  C CA  . TYR E  2 23  ? 7.162   39.594  92.339  1.00 49.51  ? 340  TYR D CA  1 
ATOM   3358  C C   . TYR E  2 23  ? 6.746   41.041  92.420  1.00 49.51  ? 340  TYR D C   1 
ATOM   3359  O O   . TYR E  2 23  ? 6.703   41.761  91.420  1.00 49.51  ? 340  TYR D O   1 
ATOM   3360  C CB  . TYR E  2 23  ? 8.679   39.521  92.159  1.00 49.51  ? 340  TYR D CB  1 
ATOM   3361  C CG  . TYR E  2 23  ? 9.261   38.179  92.536  1.00 49.51  ? 340  TYR D CG  1 
ATOM   3362  C CD1 . TYR E  2 23  ? 9.105   37.673  93.825  1.00 49.51  ? 340  TYR D CD1 1 
ATOM   3363  C CD2 . TYR E  2 23  ? 9.919   37.394  91.590  1.00 49.51  ? 340  TYR D CD2 1 
ATOM   3364  C CE1 . TYR E  2 23  ? 9.586   36.416  94.166  1.00 49.51  ? 340  TYR D CE1 1 
ATOM   3365  C CE2 . TYR E  2 23  ? 10.408  36.135  91.914  1.00 49.51  ? 340  TYR D CE2 1 
ATOM   3366  C CZ  . TYR E  2 23  ? 10.235  35.644  93.209  1.00 49.51  ? 340  TYR D CZ  1 
ATOM   3367  O OH  . TYR E  2 23  ? 10.697  34.378  93.538  1.00 49.51  ? 340  TYR D OH  1 
ATOM   3368  N N   . ARG E  2 24  ? 6.462   41.461  93.642  1.00 40.12  ? 341  ARG D N   1 
ATOM   3369  C CA  . ARG E  2 24  ? 6.067   42.825  93.896  1.00 40.12  ? 341  ARG D CA  1 
ATOM   3370  C C   . ARG E  2 24  ? 6.815   43.404  95.101  1.00 40.12  ? 341  ARG D C   1 
ATOM   3371  O O   . ARG E  2 24  ? 6.604   42.979  96.241  1.00 40.12  ? 341  ARG D O   1 
ATOM   3372  C CB  . ARG E  2 24  ? 4.561   42.885  94.120  1.00 40.12  ? 341  ARG D CB  1 
ATOM   3373  C CG  . ARG E  2 24  ? 4.137   43.738  95.267  1.00 40.12  ? 341  ARG D CG  1 
ATOM   3374  C CD  . ARG E  2 24  ? 2.809   43.302  95.740  1.00 40.12  ? 341  ARG D CD  1 
ATOM   3375  N NE  . ARG E  2 24  ? 2.895   42.837  97.109  1.00 40.12  ? 341  ARG D NE  1 
ATOM   3376  C CZ  . ARG E  2 24  ? 2.130   41.873  97.594  1.00 40.12  ? 341  ARG D CZ  1 
ATOM   3377  N NH1 . ARG E  2 24  ? 1.243   41.301  96.794  1.00 40.12  ? 341  ARG D NH1 1 
ATOM   3378  N NH2 . ARG E  2 24  ? 2.236   41.489  98.865  1.00 40.12  ? 341  ARG D NH2 1 
ATOM   3379  N N   . ASN E  2 25  ? 7.696   44.366  94.837  1.00 58.47  ? 342  ASN D N   1 
ATOM   3380  C CA  . ASN E  2 25  ? 8.450   45.012  95.900  1.00 58.47  ? 342  ASN D CA  1 
ATOM   3381  C C   . ASN E  2 25  ? 7.514   46.045  96.515  1.00 58.47  ? 342  ASN D C   1 
ATOM   3382  O O   . ASN E  2 25  ? 7.158   47.036  95.866  1.00 58.47  ? 342  ASN D O   1 
ATOM   3383  C CB  . ASN E  2 25  ? 9.696   45.703  95.332  1.00 58.47  ? 342  ASN D CB  1 
ATOM   3384  C CG  . ASN E  2 25  ? 10.487  46.450  96.392  1.00 58.47  ? 342  ASN D CG  1 
ATOM   3385  O OD1 . ASN E  2 25  ? 10.213  46.337  97.595  1.00 58.47  ? 342  ASN D OD1 1 
ATOM   3386  N ND2 . ASN E  2 25  ? 11.479  47.211  95.952  1.00 58.47  ? 342  ASN D ND2 1 
ATOM   3387  N N   . PRO E  2 26  ? 7.094   45.823  97.773  1.00 41.00  ? 343  PRO D N   1 
ATOM   3388  C CA  . PRO E  2 26  ? 6.189   46.783  98.415  1.00 41.00  ? 343  PRO D CA  1 
ATOM   3389  C C   . PRO E  2 26  ? 6.775   48.193  98.466  1.00 41.00  ? 343  PRO D C   1 
ATOM   3390  O O   . PRO E  2 26  ? 6.158   49.117  98.990  1.00 41.00  ? 343  PRO D O   1 
ATOM   3391  C CB  . PRO E  2 26  ? 5.951   46.193  99.807  1.00 41.00  ? 343  PRO D CB  1 
ATOM   3392  C CG  . PRO E  2 26  ? 7.037   45.190  100.012 1.00 41.00  ? 343  PRO D CG  1 
ATOM   3393  C CD  . PRO E  2 26  ? 7.428   44.690  98.655  1.00 41.00  ? 343  PRO D CD  1 
ATOM   3394  N N   . ALA E  2 27  ? 7.964   48.370  97.900  1.00 57.78  ? 344  ALA D N   1 
ATOM   3395  C CA  . ALA E  2 27  ? 8.601   49.678  97.912  1.00 57.78  ? 344  ALA D CA  1 
ATOM   3396  C C   . ALA E  2 27  ? 8.747   50.342  96.546  1.00 57.78  ? 344  ALA D C   1 
ATOM   3397  O O   . ALA E  2 27  ? 9.351   51.404  96.446  1.00 57.78  ? 344  ALA D O   1 
ATOM   3398  C CB  . ALA E  2 27  ? 9.957   49.574  98.575  1.00 57.78  ? 344  ALA D CB  1 
ATOM   3399  N N   . GLU E  2 28  ? 8.216   49.731  95.492  1.00 66.45  ? 345  GLU D N   1 
ATOM   3400  C CA  . GLU E  2 28  ? 8.315   50.346  94.172  1.00 66.45  ? 345  GLU D CA  1 
ATOM   3401  C C   . GLU E  2 28  ? 7.417   49.715  93.122  1.00 66.45  ? 345  GLU D C   1 
ATOM   3402  O O   . GLU E  2 28  ? 7.439   50.123  91.961  1.00 66.45  ? 345  GLU D O   1 
ATOM   3403  C CB  . GLU E  2 28  ? 9.763   50.333  93.679  1.00 66.45  ? 345  GLU D CB  1 
ATOM   3404  C CG  . GLU E  2 28  ? 10.586  49.170  94.171  1.00 66.45  ? 345  GLU D CG  1 
ATOM   3405  C CD  . GLU E  2 28  ? 11.991  49.172  93.598  1.00 66.45  ? 345  GLU D CD  1 
ATOM   3406  O OE1 . GLU E  2 28  ? 12.652  50.231  93.633  1.00 66.45  ? 345  GLU D OE1 1 
ATOM   3407  O OE2 . GLU E  2 28  ? 12.437  48.109  93.109  1.00 66.45  ? 345  GLU D OE2 1 
ATOM   3408  N N   . GLY E  2 29  ? 6.633   48.723  93.530  1.00 53.65  ? 346  GLY D N   1 
ATOM   3409  C CA  . GLY E  2 29  ? 5.728   48.067  92.603  1.00 53.65  ? 346  GLY D CA  1 
ATOM   3410  C C   . GLY E  2 29  ? 6.175   46.685  92.163  1.00 53.65  ? 346  GLY D C   1 
ATOM   3411  O O   . GLY E  2 29  ? 7.165   46.141  92.669  1.00 53.65  ? 346  GLY D O   1 
ATOM   3412  N N   . THR E  2 30  ? 5.428   46.115  91.217  1.00 40.29  ? 347  THR D N   1 
ATOM   3413  C CA  . THR E  2 30  ? 5.730   44.790  90.684  1.00 40.29  ? 347  THR D CA  1 
ATOM   3414  C C   . THR E  2 30  ? 6.712   44.878  89.527  1.00 40.29  ? 347  THR D C   1 
ATOM   3415  O O   . THR E  2 30  ? 6.627   45.786  88.688  1.00 40.29  ? 347  THR D O   1 
ATOM   3416  C CB  . THR E  2 30  ? 4.462   44.075  90.178  1.00 40.29  ? 347  THR D CB  1 
ATOM   3417  O OG1 . THR E  2 30  ? 3.981   44.715  88.981  1.00 40.29  ? 347  THR D OG1 1 
ATOM   3418  C CG2 . THR E  2 30  ? 3.400   44.073  91.262  1.00 40.29  ? 347  THR D CG2 1 
ATOM   3419  N N   . TRP E  2 31  ? 7.637   43.924  89.486  1.00 45.80  ? 348  TRP D N   1 
ATOM   3420  C CA  . TRP E  2 31  ? 8.646   43.890  88.441  1.00 45.80  ? 348  TRP D CA  1 
ATOM   3421  C C   . TRP E  2 31  ? 8.007   44.095  87.082  1.00 45.80  ? 348  TRP D C   1 
ATOM   3422  O O   . TRP E  2 31  ? 8.384   44.993  86.338  1.00 45.80  ? 348  TRP D O   1 
ATOM   3423  C CB  . TRP E  2 31  ? 9.363   42.547  88.425  1.00 45.80  ? 348  TRP D CB  1 
ATOM   3424  C CG  . TRP E  2 31  ? 10.097  42.208  89.663  1.00 45.80  ? 348  TRP D CG  1 
ATOM   3425  C CD1 . TRP E  2 31  ? 10.183  42.953  90.796  1.00 45.80  ? 348  TRP D CD1 1 
ATOM   3426  C CD2 . TRP E  2 31  ? 10.869  41.024  89.893  1.00 45.80  ? 348  TRP D CD2 1 
ATOM   3427  N NE1 . TRP E  2 31  ? 10.963  42.306  91.722  1.00 45.80  ? 348  TRP D NE1 1 
ATOM   3428  C CE2 . TRP E  2 31  ? 11.396  41.119  91.191  1.00 45.80  ? 348  TRP D CE2 1 
ATOM   3429  C CE3 . TRP E  2 31  ? 11.163  39.890  89.124  1.00 45.80  ? 348  TRP D CE3 1 
ATOM   3430  C CZ2 . TRP E  2 31  ? 12.206  40.125  91.744  1.00 45.80  ? 348  TRP D CZ2 1 
ATOM   3431  C CZ3 . TRP E  2 31  ? 11.968  38.903  89.672  1.00 45.80  ? 348  TRP D CZ3 1 
ATOM   3432  C CH2 . TRP E  2 31  ? 12.480  39.028  90.973  1.00 45.80  ? 348  TRP D CH2 1 
ATOM   3433  N N   . TYR E  2 32  ? 7.036   43.248  86.769  1.00 41.97  ? 349  TYR D N   1 
ATOM   3434  C CA  . TYR E  2 32  ? 6.360   43.306  85.481  1.00 41.97  ? 349  TYR D CA  1 
ATOM   3435  C C   . TYR E  2 32  ? 5.788   44.669  85.161  1.00 41.97  ? 349  TYR D C   1 
ATOM   3436  O O   . TYR E  2 32  ? 6.214   45.318  84.203  1.00 41.97  ? 349  TYR D O   1 
ATOM   3437  C CB  . TYR E  2 32  ? 5.226   42.279  85.405  1.00 41.97  ? 349  TYR D CB  1 
ATOM   3438  C CG  . TYR E  2 32  ? 4.502   42.272  84.069  1.00 41.97  ? 349  TYR D CG  1 
ATOM   3439  C CD1 . TYR E  2 32  ? 5.189   42.013  82.881  1.00 41.97  ? 349  TYR D CD1 1 
ATOM   3440  C CD2 . TYR E  2 32  ? 3.118   42.455  83.999  1.00 41.97  ? 349  TYR D CD2 1 
ATOM   3441  C CE1 . TYR E  2 32  ? 4.509   41.927  81.651  1.00 41.97  ? 349  TYR D CE1 1 
ATOM   3442  C CE2 . TYR E  2 32  ? 2.426   42.373  82.775  1.00 41.97  ? 349  TYR D CE2 1 
ATOM   3443  C CZ  . TYR E  2 32  ? 3.125   42.107  81.608  1.00 41.97  ? 349  TYR D CZ  1 
ATOM   3444  O OH  . TYR E  2 32  ? 2.451   42.017  80.406  1.00 41.97  ? 349  TYR D OH  1 
ATOM   3445  N N   . ILE E  2 33  ? 4.828   45.107  85.969  1.00 27.84  ? 350  ILE D N   1 
ATOM   3446  C CA  . ILE E  2 33  ? 4.184   46.372  85.699  1.00 27.84  ? 350  ILE D CA  1 
ATOM   3447  C C   . ILE E  2 33  ? 5.185   47.503  85.593  1.00 27.84  ? 350  ILE D C   1 
ATOM   3448  O O   . ILE E  2 33  ? 5.142   48.306  84.654  1.00 27.84  ? 350  ILE D O   1 
ATOM   3449  C CB  . ILE E  2 33  ? 3.158   46.706  86.760  1.00 27.84  ? 350  ILE D CB  1 
ATOM   3450  C CG1 . ILE E  2 33  ? 2.032   45.663  86.750  1.00 27.84  ? 350  ILE D CG1 1 
ATOM   3451  C CG2 . ILE E  2 33  ? 2.609   48.085  86.481  1.00 27.84  ? 350  ILE D CG2 1 
ATOM   3452  C CD1 . ILE E  2 33  ? 1.275   45.607  85.442  1.00 27.84  ? 350  ILE D CD1 1 
ATOM   3453  N N   . GLN E  2 34  ? 6.096   47.568  86.547  1.00 40.78  ? 351  GLN D N   1 
ATOM   3454  C CA  . GLN E  2 34  ? 7.083   48.621  86.512  1.00 40.78  ? 351  GLN D CA  1 
ATOM   3455  C C   . GLN E  2 34  ? 7.838   48.601  85.194  1.00 40.78  ? 351  GLN D C   1 
ATOM   3456  O O   . GLN E  2 34  ? 7.954   49.623  84.527  1.00 40.78  ? 351  GLN D O   1 
ATOM   3457  C CB  . GLN E  2 34  ? 8.032   48.459  87.687  1.00 40.78  ? 351  GLN D CB  1 
ATOM   3458  C CG  . GLN E  2 34  ? 7.324   48.631  89.034  1.00 40.78  ? 351  GLN D CG  1 
ATOM   3459  C CD  . GLN E  2 34  ? 6.654   50.000  89.171  1.00 40.78  ? 351  GLN D CD  1 
ATOM   3460  O OE1 . GLN E  2 34  ? 7.304   51.033  89.016  1.00 40.78  ? 351  GLN D OE1 1 
ATOM   3461  N NE2 . GLN E  2 34  ? 5.352   50.006  89.462  1.00 40.78  ? 351  GLN D NE2 1 
ATOM   3462  N N   . SER E  2 35  ? 8.332   47.433  84.798  1.00 38.62  ? 352  SER D N   1 
ATOM   3463  C CA  . SER E  2 35  ? 9.079   47.327  83.547  1.00 38.62  ? 352  SER D CA  1 
ATOM   3464  C C   . SER E  2 35  ? 8.174   47.671  82.390  1.00 38.62  ? 352  SER D C   1 
ATOM   3465  O O   . SER E  2 35  ? 8.559   48.383  81.462  1.00 38.62  ? 352  SER D O   1 
ATOM   3466  C CB  . SER E  2 35  ? 9.614   45.911  83.354  1.00 38.62  ? 352  SER D CB  1 
ATOM   3467  O OG  . SER E  2 35  ? 10.212  45.455  84.553  1.00 38.62  ? 352  SER D OG  1 
ATOM   3468  N N   . LEU E  2 36  ? 6.955   47.159  82.454  1.00 37.40  ? 353  LEU D N   1 
ATOM   3469  C CA  . LEU E  2 36  ? 5.992   47.394  81.392  1.00 37.40  ? 353  LEU D CA  1 
ATOM   3470  C C   . LEU E  2 36  ? 5.928   48.882  81.103  1.00 37.40  ? 353  LEU D C   1 
ATOM   3471  O O   . LEU E  2 36  ? 6.035   49.330  79.954  1.00 37.40  ? 353  LEU D O   1 
ATOM   3472  C CB  . LEU E  2 36  ? 4.604   46.882  81.809  1.00 37.40  ? 353  LEU D CB  1 
ATOM   3473  C CG  . LEU E  2 36  ? 3.494   47.071  80.779  1.00 37.40  ? 353  LEU D CG  1 
ATOM   3474  C CD1 . LEU E  2 36  ? 4.021   46.718  79.401  1.00 37.40  ? 353  LEU D CD1 1 
ATOM   3475  C CD2 . LEU E  2 36  ? 2.308   46.207  81.146  1.00 37.40  ? 353  LEU D CD2 1 
ATOM   3476  N N   . CYS E  2 37  ? 5.770   49.647  82.169  1.00 48.52  ? 354  CYS D N   1 
ATOM   3477  C CA  . CYS E  2 37  ? 5.658   51.080  82.042  1.00 48.52  ? 354  CYS D CA  1 
ATOM   3478  C C   . CYS E  2 37  ? 6.922   51.649  81.478  1.00 48.52  ? 354  CYS D C   1 
ATOM   3479  O O   . CYS E  2 37  ? 6.925   52.174  80.368  1.00 48.52  ? 354  CYS D O   1 
ATOM   3480  C CB  . CYS E  2 37  ? 5.356   51.694  83.397  1.00 48.52  ? 354  CYS D CB  1 
ATOM   3481  S SG  . CYS E  2 37  ? 3.618   51.469  83.851  1.00 48.52  ? 354  CYS D SG  1 
ATOM   3482  N N   . GLN E  2 38  ? 8.001   51.521  82.241  1.00 62.64  ? 355  GLN D N   1 
ATOM   3483  C CA  . GLN E  2 38  ? 9.293   52.032  81.824  1.00 62.64  ? 355  GLN D CA  1 
ATOM   3484  C C   . GLN E  2 38  ? 9.527   51.807  80.341  1.00 62.64  ? 355  GLN D C   1 
ATOM   3485  O O   . GLN E  2 38  ? 9.866   52.728  79.601  1.00 62.64  ? 355  GLN D O   1 
ATOM   3486  C CB  . GLN E  2 38  ? 10.390  51.358  82.619  1.00 62.64  ? 355  GLN D CB  1 
ATOM   3487  C CG  . GLN E  2 38  ? 11.567  52.254  82.873  1.00 62.64  ? 355  GLN D CG  1 
ATOM   3488  C CD  . GLN E  2 38  ? 12.819  51.465  83.198  1.00 62.64  ? 355  GLN D CD  1 
ATOM   3489  O OE1 . GLN E  2 38  ? 13.607  51.125  82.307  1.00 62.64  ? 355  GLN D OE1 1 
ATOM   3490  N NE2 . GLN E  2 38  ? 13.010  51.159  84.482  1.00 62.64  ? 355  GLN D NE2 1 
ATOM   3491  N N   . SER E  2 39  ? 9.330   50.574  79.903  1.00 41.38  ? 356  SER D N   1 
ATOM   3492  C CA  . SER E  2 39  ? 9.526   50.253  78.508  1.00 41.38  ? 356  SER D CA  1 
ATOM   3493  C C   . SER E  2 39  ? 8.510   50.996  77.676  1.00 41.38  ? 356  SER D C   1 
ATOM   3494  O O   . SER E  2 39  ? 8.835   51.505  76.610  1.00 41.38  ? 356  SER D O   1 
ATOM   3495  C CB  . SER E  2 39  ? 9.379   48.743  78.282  1.00 41.38  ? 356  SER D CB  1 
ATOM   3496  O OG  . SER E  2 39  ? 10.646  48.106  78.168  1.00 41.38  ? 356  SER D OG  1 
ATOM   3497  N N   . LEU E  2 40  ? 7.277   51.061  78.171  1.00 42.03  ? 357  LEU D N   1 
ATOM   3498  C CA  . LEU E  2 40  ? 6.210   51.731  77.434  1.00 42.03  ? 357  LEU D CA  1 
ATOM   3499  C C   . LEU E  2 40  ? 6.518   53.195  77.148  1.00 42.03  ? 357  LEU D C   1 
ATOM   3500  O O   . LEU E  2 40  ? 6.517   53.625  75.988  1.00 42.03  ? 357  LEU D O   1 
ATOM   3501  C CB  . LEU E  2 40  ? 4.889   51.610  78.190  1.00 42.03  ? 357  LEU D CB  1 
ATOM   3502  C CG  . LEU E  2 40  ? 3.981   50.528  77.607  1.00 42.03  ? 357  LEU D CG  1 
ATOM   3503  C CD1 . LEU E  2 40  ? 2.725   50.423  78.442  1.00 42.03  ? 357  LEU D CD1 1 
ATOM   3504  C CD2 . LEU E  2 40  ? 3.631   50.861  76.172  1.00 42.03  ? 357  LEU D CD2 1 
ATOM   3505  N N   . ARG E  2 41  ? 6.791   53.957  78.201  1.00 58.48  ? 358  ARG D N   1 
ATOM   3506  C CA  . ARG E  2 41  ? 7.105   55.369  78.039  1.00 58.48  ? 358  ARG D CA  1 
ATOM   3507  C C   . ARG E  2 41  ? 8.376   55.581  77.206  1.00 58.48  ? 358  ARG D C   1 
ATOM   3508  O O   . ARG E  2 41  ? 8.517   56.594  76.531  1.00 58.48  ? 358  ARG D O   1 
ATOM   3509  C CB  . ARG E  2 41  ? 7.260   56.042  79.407  1.00 58.48  ? 358  ARG D CB  1 
ATOM   3510  C CG  . ARG E  2 41  ? 7.291   55.090  80.594  1.00 58.48  ? 358  ARG D CG  1 
ATOM   3511  C CD  . ARG E  2 41  ? 8.041   55.704  81.778  1.00 58.48  ? 358  ARG D CD  1 
ATOM   3512  N NE  . ARG E  2 41  ? 7.111   56.254  82.755  1.00 58.48  ? 358  ARG D NE  1 
ATOM   3513  C CZ  . ARG E  2 41  ? 6.461   57.406  82.601  1.00 58.48  ? 358  ARG D CZ  1 
ATOM   3514  N NH1 . ARG E  2 41  ? 6.636   58.140  81.510  1.00 58.48  ? 358  ARG D NH1 1 
ATOM   3515  N NH2 . ARG E  2 41  ? 5.615   57.824  83.534  1.00 58.48  ? 358  ARG D NH2 1 
ATOM   3516  N N   . GLU E  2 42  ? 9.291   54.619  77.247  1.00 75.36  ? 359  GLU D N   1 
ATOM   3517  C CA  . GLU E  2 42  ? 10.535  54.720  76.491  1.00 75.36  ? 359  GLU D CA  1 
ATOM   3518  C C   . GLU E  2 42  ? 10.400  54.407  74.997  1.00 75.36  ? 359  GLU D C   1 
ATOM   3519  O O   . GLU E  2 42  ? 10.661  55.256  74.144  1.00 75.36  ? 359  GLU D O   1 
ATOM   3520  C CB  . GLU E  2 42  ? 11.579  53.778  77.083  1.00 75.36  ? 359  GLU D CB  1 
ATOM   3521  C CG  . GLU E  2 42  ? 12.391  54.367  78.199  1.00 75.36  ? 359  GLU D CG  1 
ATOM   3522  C CD  . GLU E  2 42  ? 13.283  53.329  78.837  1.00 75.36  ? 359  GLU D CD  1 
ATOM   3523  O OE1 . GLU E  2 42  ? 13.566  52.304  78.174  1.00 75.36  ? 359  GLU D OE1 1 
ATOM   3524  O OE2 . GLU E  2 42  ? 13.696  53.534  79.997  1.00 75.36  ? 359  GLU D OE2 1 
ATOM   3525  N N   . ARG E  2 43  ? 10.000  53.181  74.681  1.00 63.79  ? 360  ARG D N   1 
ATOM   3526  C CA  . ARG E  2 43  ? 9.887   52.773  73.297  1.00 63.79  ? 360  ARG D CA  1 
ATOM   3527  C C   . ARG E  2 43  ? 8.755   53.423  72.527  1.00 63.79  ? 360  ARG D C   1 
ATOM   3528  O O   . ARG E  2 43  ? 8.931   53.772  71.363  1.00 63.79  ? 360  ARG D O   1 
ATOM   3529  C CB  . ARG E  2 43  ? 9.744   51.255  73.194  1.00 63.79  ? 360  ARG D CB  1 
ATOM   3530  C CG  . ARG E  2 43  ? 10.382  50.475  74.332  1.00 63.79  ? 360  ARG D CG  1 
ATOM   3531  C CD  . ARG E  2 43  ? 11.882  50.688  74.368  1.00 63.79  ? 360  ARG D CD  1 
ATOM   3532  N NE  . ARG E  2 43  ? 12.645  49.574  73.794  1.00 63.79  ? 360  ARG D NE  1 
ATOM   3533  C CZ  . ARG E  2 43  ? 12.546  49.143  72.537  1.00 63.79  ? 360  ARG D CZ  1 
ATOM   3534  N NH1 . ARG E  2 43  ? 11.702  49.721  71.691  1.00 63.79  ? 360  ARG D NH1 1 
ATOM   3535  N NH2 . ARG E  2 43  ? 13.318  48.149  72.117  1.00 63.79  ? 360  ARG D NH2 1 
ATOM   3536  N N   . CYS E  2 44  ? 7.597   53.593  73.155  1.00 46.14  ? 361  CYS D N   1 
ATOM   3537  C CA  . CYS E  2 44  ? 6.446   54.173  72.456  1.00 46.14  ? 361  CYS D CA  1 
ATOM   3538  C C   . CYS E  2 44  ? 6.732   55.445  71.663  1.00 46.14  ? 361  CYS D C   1 
ATOM   3539  O O   . CYS E  2 44  ? 6.289   55.577  70.516  1.00 46.14  ? 361  CYS D O   1 
ATOM   3540  C CB  . CYS E  2 44  ? 5.310   54.408  73.430  1.00 46.14  ? 361  CYS D CB  1 
ATOM   3541  S SG  . CYS E  2 44  ? 4.468   52.886  73.808  1.00 46.14  ? 361  CYS D SG  1 
ATOM   3542  N N   . PRO E  2 45  ? 7.441   56.414  72.273  1.00 74.21  ? 362  PRO D N   1 
ATOM   3543  C CA  . PRO E  2 45  ? 7.759   57.651  71.556  1.00 74.21  ? 362  PRO D CA  1 
ATOM   3544  C C   . PRO E  2 45  ? 8.619   57.321  70.337  1.00 74.21  ? 362  PRO D C   1 
ATOM   3545  O O   . PRO E  2 45  ? 8.471   57.944  69.294  1.00 74.21  ? 362  PRO D O   1 
ATOM   3546  C CB  . PRO E  2 45  ? 8.528   58.483  72.581  1.00 74.21  ? 362  PRO D CB  1 
ATOM   3547  C CG  . PRO E  2 45  ? 8.153   57.925  73.891  1.00 74.21  ? 362  PRO D CG  1 
ATOM   3548  C CD  . PRO E  2 45  ? 7.950   56.453  73.654  1.00 74.21  ? 362  PRO D CD  1 
ATOM   3549  N N   . ARG E  2 46  B 9.520   56.345  70.476  1.00 72.49  ? 362  ARG D N   1 
ATOM   3550  C CA  . ARG E  2 46  B 10.372  55.930  69.365  1.00 72.49  ? 362  ARG D CA  1 
ATOM   3551  C C   . ARG E  2 46  B 9.527   55.206  68.319  1.00 72.49  ? 362  ARG D C   1 
ATOM   3552  O O   . ARG E  2 46  B 10.035  54.816  67.272  1.00 72.49  ? 362  ARG D O   1 
ATOM   3553  C CB  . ARG E  2 46  B 11.488  55.008  69.852  1.00 72.49  ? 362  ARG D CB  1 
ATOM   3554  C CG  . ARG E  2 46  B 11.982  55.326  71.242  1.00 72.49  ? 362  ARG D CG  1 
ATOM   3555  C CD  . ARG E  2 46  B 13.469  55.629  71.241  1.00 72.49  ? 362  ARG D CD  1 
ATOM   3556  N NE  . ARG E  2 46  B 13.963  55.932  72.587  1.00 72.49  ? 362  ARG D NE  1 
ATOM   3557  C CZ  . ARG E  2 46  B 14.815  56.919  72.884  1.00 72.49  ? 362  ARG D CZ  1 
ATOM   3558  N NH1 . ARG E  2 46  B 15.282  57.717  71.928  1.00 72.49  ? 362  ARG D NH1 1 
ATOM   3559  N NH2 . ARG E  2 46  B 15.209  57.109  74.141  1.00 72.49  ? 362  ARG D NH2 1 
ATOM   3560  N N   . GLY E  2 47  ? 8.242   55.019  68.621  1.00 70.41  ? 363  GLY D N   1 
ATOM   3561  C CA  . GLY E  2 47  ? 7.318   54.369  67.699  1.00 70.41  ? 363  GLY D CA  1 
ATOM   3562  C C   . GLY E  2 47  ? 7.382   52.854  67.606  1.00 70.41  ? 363  GLY D C   1 
ATOM   3563  O O   . GLY E  2 47  ? 6.890   52.254  66.646  1.00 70.41  ? 363  GLY D O   1 
ATOM   3564  N N   . ASP E  2 48  ? 7.974   52.230  68.614  1.00 54.80  ? 364  ASP D N   1 
ATOM   3565  C CA  . ASP E  2 48  ? 8.114   50.787  68.636  1.00 54.80  ? 364  ASP D CA  1 
ATOM   3566  C C   . ASP E  2 48  ? 6.815   50.028  68.883  1.00 54.80  ? 364  ASP D C   1 
ATOM   3567  O O   . ASP E  2 48  ? 6.040   50.380  69.764  1.00 54.80  ? 364  ASP D O   1 
ATOM   3568  C CB  . ASP E  2 48  ? 9.158   50.408  69.680  1.00 54.80  ? 364  ASP D CB  1 
ATOM   3569  C CG  . ASP E  2 48  ? 10.561  50.732  69.222  1.00 54.80  ? 364  ASP D CG  1 
ATOM   3570  O OD1 . ASP E  2 48  ? 10.898  50.394  68.065  1.00 54.80  ? 364  ASP D OD1 1 
ATOM   3571  O OD2 . ASP E  2 48  ? 11.323  51.334  70.005  1.00 54.80  ? 364  ASP D OD2 1 
ATOM   3572  N N   . ASP E  2 49  ? 6.597   48.975  68.097  1.00 60.50  ? 365  ASP D N   1 
ATOM   3573  C CA  . ASP E  2 49  ? 5.402   48.136  68.196  1.00 60.50  ? 365  ASP D CA  1 
ATOM   3574  C C   . ASP E  2 49  ? 5.316   47.502  69.574  1.00 60.50  ? 365  ASP D C   1 
ATOM   3575  O O   . ASP E  2 49  ? 6.332   47.273  70.223  1.00 60.50  ? 365  ASP D O   1 
ATOM   3576  C CB  . ASP E  2 49  ? 5.437   47.058  67.118  1.00 60.50  ? 365  ASP D CB  1 
ATOM   3577  C CG  . ASP E  2 49  ? 5.078   45.696  67.648  1.00 60.50  ? 365  ASP D CG  1 
ATOM   3578  O OD1 . ASP E  2 49  ? 5.992   44.989  68.127  1.00 60.50  ? 365  ASP D OD1 1 
ATOM   3579  O OD2 . ASP E  2 49  ? 3.882   45.333  67.586  1.00 60.50  ? 365  ASP D OD2 1 
ATOM   3580  N N   . ILE E  2 50  ? 4.104   47.189  70.013  1.00 34.95  ? 366  ILE D N   1 
ATOM   3581  C CA  . ILE E  2 50  ? 3.921   46.635  71.353  1.00 34.95  ? 366  ILE D CA  1 
ATOM   3582  C C   . ILE E  2 50  ? 4.560   45.296  71.607  1.00 34.95  ? 366  ILE D C   1 
ATOM   3583  O O   . ILE E  2 50  ? 5.046   45.034  72.714  1.00 34.95  ? 366  ILE D O   1 
ATOM   3584  C CB  . ILE E  2 50  ? 2.431   46.531  71.724  1.00 34.95  ? 366  ILE D CB  1 
ATOM   3585  C CG1 . ILE E  2 50  ? 2.234   47.006  73.162  1.00 34.95  ? 366  ILE D CG1 1 
ATOM   3586  C CG2 . ILE E  2 50  ? 1.931   45.105  71.550  1.00 34.95  ? 366  ILE D CG2 1 
ATOM   3587  C CD1 . ILE E  2 50  ? 3.017   46.245  74.132  1.00 34.95  ? 366  ILE D CD1 1 
ATOM   3588  N N   . LEU E  2 51  ? 4.543   44.432  70.599  1.00 30.26  ? 367  LEU D N   1 
ATOM   3589  C CA  . LEU E  2 51  ? 5.144   43.121  70.771  1.00 30.26  ? 367  LEU D CA  1 
ATOM   3590  C C   . LEU E  2 51  ? 6.614   43.366  71.093  1.00 30.26  ? 367  LEU D C   1 
ATOM   3591  O O   . LEU E  2 51  ? 7.157   42.801  72.047  1.00 30.26  ? 367  LEU D O   1 
ATOM   3592  C CB  . LEU E  2 51  ? 4.972   42.292  69.497  1.00 30.26  ? 367  LEU D CB  1 
ATOM   3593  C CG  . LEU E  2 51  ? 3.915   41.183  69.602  1.00 30.26  ? 367  LEU D CG  1 
ATOM   3594  C CD1 . LEU E  2 51  ? 3.030   41.380  70.817  1.00 30.26  ? 367  LEU D CD1 1 
ATOM   3595  C CD2 . LEU E  2 51  ? 3.077   41.183  68.349  1.00 30.26  ? 367  LEU D CD2 1 
ATOM   3596  N N   . THR E  2 52  ? 7.238   44.248  70.315  1.00 27.19  ? 368  THR D N   1 
ATOM   3597  C CA  . THR E  2 52  ? 8.635   44.605  70.523  1.00 27.19  ? 368  THR D CA  1 
ATOM   3598  C C   . THR E  2 52  ? 8.822   45.031  71.980  1.00 27.19  ? 368  THR D C   1 
ATOM   3599  O O   . THR E  2 52  ? 9.694   44.537  72.669  1.00 27.19  ? 368  THR D O   1 
ATOM   3600  C CB  . THR E  2 52  ? 9.061   45.770  69.610  1.00 27.19  ? 368  THR D CB  1 
ATOM   3601  O OG1 . THR E  2 52  ? 8.892   45.406  68.231  1.00 27.19  ? 368  THR D OG1 1 
ATOM   3602  C CG2 . THR E  2 52  ? 10.510  46.116  69.861  1.00 27.19  ? 368  THR D CG2 1 
ATOM   3603  N N   . ILE E  2 53  ? 7.993   45.941  72.455  1.00 39.92  ? 369  ILE D N   1 
ATOM   3604  C CA  . ILE E  2 53  ? 8.134   46.388  73.822  1.00 39.92  ? 369  ILE D CA  1 
ATOM   3605  C C   . ILE E  2 53  ? 8.001   45.220  74.769  1.00 39.92  ? 369  ILE D C   1 
ATOM   3606  O O   . ILE E  2 53  ? 8.878   44.969  75.592  1.00 39.92  ? 369  ILE D O   1 
ATOM   3607  C CB  . ILE E  2 53  ? 7.064   47.433  74.181  1.00 39.92  ? 369  ILE D CB  1 
ATOM   3608  C CG1 . ILE E  2 53  ? 7.361   48.735  73.436  1.00 39.92  ? 369  ILE D CG1 1 
ATOM   3609  C CG2 . ILE E  2 53  ? 7.028   47.661  75.700  1.00 39.92  ? 369  ILE D CG2 1 
ATOM   3610  C CD1 . ILE E  2 53  ? 6.285   49.131  72.448  1.00 39.92  ? 369  ILE D CD1 1 
ATOM   3611  N N   . LEU E  2 54  ? 6.890   44.505  74.650  1.00 35.15  ? 370  LEU D N   1 
ATOM   3612  C CA  . LEU E  2 54  ? 6.627   43.369  75.531  1.00 35.15  ? 370  LEU D CA  1 
ATOM   3613  C C   . LEU E  2 54  ? 7.802   42.407  75.521  1.00 35.15  ? 370  LEU D C   1 
ATOM   3614  O O   . LEU E  2 54  ? 8.096   41.774  76.527  1.00 35.15  ? 370  LEU D O   1 
ATOM   3615  C CB  . LEU E  2 54  ? 5.337   42.646  75.119  1.00 35.15  ? 370  LEU D CB  1 
ATOM   3616  C CG  . LEU E  2 54  ? 4.036   43.151  75.752  1.00 35.15  ? 370  LEU D CG  1 
ATOM   3617  C CD1 . LEU E  2 54  ? 2.906   42.240  75.337  1.00 35.15  ? 370  LEU D CD1 1 
ATOM   3618  C CD2 . LEU E  2 54  ? 4.152   43.203  77.258  1.00 35.15  ? 370  LEU D CD2 1 
ATOM   3619  N N   . THR E  2 55  ? 8.481   42.302  74.387  1.00 29.74  ? 371  THR D N   1 
ATOM   3620  C CA  . THR E  2 55  ? 9.633   41.417  74.303  1.00 29.74  ? 371  THR D CA  1 
ATOM   3621  C C   . THR E  2 55  ? 10.698  41.931  75.268  1.00 29.74  ? 371  THR D C   1 
ATOM   3622  O O   . THR E  2 55  ? 11.272  41.172  76.046  1.00 29.74  ? 371  THR D O   1 
ATOM   3623  C CB  . THR E  2 55  ? 10.222  41.398  72.878  1.00 29.74  ? 371  THR D CB  1 
ATOM   3624  O OG1 . THR E  2 55  ? 9.353   40.664  72.012  1.00 29.74  ? 371  THR D OG1 1 
ATOM   3625  C CG2 . THR E  2 55  ? 11.579  40.756  72.874  1.00 29.74  ? 371  THR D CG2 1 
ATOM   3626  N N   . GLU E  2 56  ? 10.951  43.231  75.217  1.00 45.44  ? 372  GLU D N   1 
ATOM   3627  C CA  . GLU E  2 56  ? 11.949  43.848  76.072  1.00 45.44  ? 372  GLU D CA  1 
ATOM   3628  C C   . GLU E  2 56  ? 11.572  43.696  77.528  1.00 45.44  ? 372  GLU D C   1 
ATOM   3629  O O   . GLU E  2 56  ? 12.423  43.440  78.366  1.00 45.44  ? 372  GLU D O   1 
ATOM   3630  C CB  . GLU E  2 56  ? 12.087  45.321  75.731  1.00 45.44  ? 372  GLU D CB  1 
ATOM   3631  C CG  . GLU E  2 56  ? 12.965  46.106  76.674  1.00 45.44  ? 372  GLU D CG  1 
ATOM   3632  C CD  . GLU E  2 56  ? 13.198  47.512  76.167  1.00 45.44  ? 372  GLU D CD  1 
ATOM   3633  O OE1 . GLU E  2 56  ? 13.574  47.647  74.980  1.00 45.44  ? 372  GLU D OE1 1 
ATOM   3634  O OE2 . GLU E  2 56  ? 12.998  48.474  76.945  1.00 45.44  ? 372  GLU D OE2 1 
ATOM   3635  N N   . VAL E  2 57  ? 10.299  43.868  77.839  1.00 37.36  ? 373  VAL D N   1 
ATOM   3636  C CA  . VAL E  2 57  ? 9.868   43.714  79.217  1.00 37.36  ? 373  VAL D CA  1 
ATOM   3637  C C   . VAL E  2 57  ? 10.252  42.289  79.629  1.00 37.36  ? 373  VAL D C   1 
ATOM   3638  O O   . VAL E  2 57  ? 10.579  42.016  80.789  1.00 37.36  ? 373  VAL D O   1 
ATOM   3639  C CB  . VAL E  2 57  ? 8.327   43.883  79.351  1.00 37.36  ? 373  VAL D CB  1 
ATOM   3640  C CG1 . VAL E  2 57  ? 7.879   43.545  80.775  1.00 37.36  ? 373  VAL D CG1 1 
ATOM   3641  C CG2 . VAL E  2 57  ? 7.915   45.304  78.974  1.00 37.36  ? 373  VAL D CG2 1 
ATOM   3642  N N   . ASN E  2 58  ? 10.205  41.384  78.656  1.00 36.88  ? 374  ASN D N   1 
ATOM   3643  C CA  . ASN E  2 58  ? 10.530  39.993  78.903  1.00 36.88  ? 374  ASN D CA  1 
ATOM   3644  C C   . ASN E  2 58  ? 11.995  39.958  79.269  1.00 36.88  ? 374  ASN D C   1 
ATOM   3645  O O   . ASN E  2 58  ? 12.424  39.234  80.171  1.00 36.88  ? 374  ASN D O   1 
ATOM   3646  C CB  . ASN E  2 58  ? 10.291  39.157  77.646  1.00 36.88  ? 374  ASN D CB  1 
ATOM   3647  C CG  . ASN E  2 58  ? 8.929   38.491  77.632  1.00 36.88  ? 374  ASN D CG  1 
ATOM   3648  O OD1 . ASN E  2 58  ? 8.190   38.521  78.620  1.00 36.88  ? 374  ASN D OD1 1 
ATOM   3649  N ND2 . ASN E  2 58  ? 8.590   37.882  76.503  1.00 36.88  ? 374  ASN D ND2 1 
ATOM   3650  N N   . TYR E  2 59  ? 12.778  40.751  78.564  1.00 44.07  ? 375  TYR D N   1 
ATOM   3651  C CA  . TYR E  2 59  ? 14.186  40.792  78.851  1.00 44.07  ? 375  TYR D CA  1 
ATOM   3652  C C   . TYR E  2 59  ? 14.406  41.349  80.259  1.00 44.07  ? 375  TYR D C   1 
ATOM   3653  O O   . TYR E  2 59  ? 14.784  40.616  81.158  1.00 44.07  ? 375  TYR D O   1 
ATOM   3654  C CB  . TYR E  2 59  ? 14.882  41.652  77.818  1.00 44.07  ? 375  TYR D CB  1 
ATOM   3655  C CG  . TYR E  2 59  ? 16.375  41.629  77.943  1.00 44.07  ? 375  TYR D CG  1 
ATOM   3656  C CD1 . TYR E  2 59  ? 17.016  42.317  78.971  1.00 44.07  ? 375  TYR D CD1 1 
ATOM   3657  C CD2 . TYR E  2 59  ? 17.157  40.944  77.021  1.00 44.07  ? 375  TYR D CD2 1 
ATOM   3658  C CE1 . TYR E  2 59  ? 18.396  42.327  79.077  1.00 44.07  ? 375  TYR D CE1 1 
ATOM   3659  C CE2 . TYR E  2 59  ? 18.535  40.947  77.118  1.00 44.07  ? 375  TYR D CE2 1 
ATOM   3660  C CZ  . TYR E  2 59  ? 19.149  41.641  78.148  1.00 44.07  ? 375  TYR D CZ  1 
ATOM   3661  O OH  . TYR E  2 59  ? 20.522  41.640  78.249  1.00 44.07  ? 375  TYR D OH  1 
ATOM   3662  N N   . GLU E  2 60  ? 14.152  42.638  80.448  1.00 56.27  ? 376  GLU D N   1 
ATOM   3663  C CA  . GLU E  2 60  ? 14.338  43.283  81.748  1.00 56.27  ? 376  GLU D CA  1 
ATOM   3664  C C   . GLU E  2 60  ? 13.958  42.394  82.937  1.00 56.27  ? 376  GLU D C   1 
ATOM   3665  O O   . GLU E  2 60  ? 14.752  42.196  83.855  1.00 56.27  ? 376  GLU D O   1 
ATOM   3666  C CB  . GLU E  2 60  ? 13.526  44.592  81.819  1.00 56.27  ? 376  GLU D CB  1 
ATOM   3667  C CG  . GLU E  2 60  ? 13.730  45.560  80.653  1.00 56.27  ? 376  GLU D CG  1 
ATOM   3668  C CD  . GLU E  2 60  ? 15.203  45.802  80.345  1.00 56.27  ? 376  GLU D CD  1 
ATOM   3669  O OE1 . GLU E  2 60  ? 15.970  46.068  81.304  1.00 56.27  ? 376  GLU D OE1 1 
ATOM   3670  O OE2 . GLU E  2 60  ? 15.589  45.725  79.149  1.00 56.27  ? 376  GLU D OE2 1 
ATOM   3671  N N   . VAL E  2 61  ? 12.740  41.862  82.917  1.00 25.96  ? 377  VAL D N   1 
ATOM   3672  C CA  . VAL E  2 61  ? 12.267  41.012  84.006  1.00 25.96  ? 377  VAL D CA  1 
ATOM   3673  C C   . VAL E  2 61  ? 13.130  39.783  84.212  1.00 25.96  ? 377  VAL D C   1 
ATOM   3674  O O   . VAL E  2 61  ? 13.325  39.341  85.335  1.00 25.96  ? 377  VAL D O   1 
ATOM   3675  C CB  . VAL E  2 61  ? 10.819  40.535  83.778  1.00 25.96  ? 377  VAL D CB  1 
ATOM   3676  C CG1 . VAL E  2 61  ? 10.337  39.730  84.984  1.00 25.96  ? 377  VAL D CG1 1 
ATOM   3677  C CG2 . VAL E  2 61  ? 9.926   41.717  83.550  1.00 25.96  ? 377  VAL D CG2 1 
ATOM   3678  N N   . SER E  2 62  ? 13.641  39.223  83.130  1.00 54.14  ? 378  SER D N   1 
ATOM   3679  C CA  . SER E  2 62  ? 14.472  38.037  83.221  1.00 54.14  ? 378  SER D CA  1 
ATOM   3680  C C   . SER E  2 62  ? 15.715  38.228  84.076  1.00 54.14  ? 378  SER D C   1 
ATOM   3681  O O   . SER E  2 62  ? 16.171  37.290  84.733  1.00 54.14  ? 378  SER D O   1 
ATOM   3682  C CB  . SER E  2 62  ? 14.906  37.597  81.829  1.00 54.14  ? 378  SER D CB  1 
ATOM   3683  O OG  . SER E  2 62  ? 13.798  37.110  81.108  1.00 54.14  ? 378  SER D OG  1 
ATOM   3684  N N   . ASN E  2 63  ? 16.263  39.437  84.075  1.00 56.35  ? 379  ASN D N   1 
ATOM   3685  C CA  . ASN E  2 63  ? 17.483  39.692  84.829  1.00 56.35  ? 379  ASN D CA  1 
ATOM   3686  C C   . ASN E  2 63  ? 17.308  40.025  86.288  1.00 56.35  ? 379  ASN D C   1 
ATOM   3687  O O   . ASN E  2 63  ? 18.282  40.344  86.966  1.00 56.35  ? 379  ASN D O   1 
ATOM   3688  C CB  . ASN E  2 63  ? 18.275  40.798  84.161  1.00 56.35  ? 379  ASN D CB  1 
ATOM   3689  C CG  . ASN E  2 63  ? 18.475  40.537  82.701  1.00 56.35  ? 379  ASN D CG  1 
ATOM   3690  O OD1 . ASN E  2 63  ? 18.310  39.402  82.239  1.00 56.35  ? 379  ASN D OD1 1 
ATOM   3691  N ND2 . ASN E  2 63  ? 18.823  41.576  81.951  1.00 56.35  ? 379  ASN D ND2 1 
ATOM   3692  N N   . LYS E  2 64  ? 16.080  39.958  86.782  1.00 46.77  ? 381  LYS D N   1 
ATOM   3693  C CA  . LYS E  2 64  ? 15.843  40.255  88.187  1.00 46.77  ? 381  LYS D CA  1 
ATOM   3694  C C   . LYS E  2 64  ? 16.059  38.980  89.003  1.00 46.77  ? 381  LYS D C   1 
ATOM   3695  O O   . LYS E  2 64  ? 15.985  37.877  88.460  1.00 46.77  ? 381  LYS D O   1 
ATOM   3696  C CB  . LYS E  2 64  ? 14.423  40.801  88.363  1.00 46.77  ? 381  LYS D CB  1 
ATOM   3697  C CG  . LYS E  2 64  ? 14.036  41.793  87.268  1.00 46.77  ? 381  LYS D CG  1 
ATOM   3698  C CD  . LYS E  2 64  ? 13.458  43.057  87.871  1.00 46.77  ? 381  LYS D CD  1 
ATOM   3699  C CE  . LYS E  2 64  ? 13.587  44.243  86.935  1.00 46.77  ? 381  LYS D CE  1 
ATOM   3700  N NZ  . LYS E  2 64  ? 13.710  45.474  87.759  1.00 46.77  ? 381  LYS D NZ  1 
ATOM   3701  N N   . ASP E  2 65  A 16.356  39.131  90.290  1.00 54.45  ? 381  ASP D N   1 
ATOM   3702  C CA  . ASP E  2 65  A 16.579  37.970  91.143  1.00 54.45  ? 381  ASP D CA  1 
ATOM   3703  C C   . ASP E  2 65  A 16.015  38.126  92.538  1.00 54.45  ? 381  ASP D C   1 
ATOM   3704  O O   . ASP E  2 65  A 15.977  39.222  93.105  1.00 54.45  ? 381  ASP D O   1 
ATOM   3705  C CB  . ASP E  2 65  A 18.071  37.661  91.296  1.00 54.45  ? 381  ASP D CB  1 
ATOM   3706  C CG  . ASP E  2 65  A 18.742  37.382  89.986  1.00 54.45  ? 381  ASP D CG  1 
ATOM   3707  O OD1 . ASP E  2 65  A 19.095  38.364  89.297  1.00 54.45  ? 381  ASP D OD1 1 
ATOM   3708  O OD2 . ASP E  2 65  A 18.919  36.187  89.647  1.00 54.45  ? 381  ASP D OD2 1 
ATOM   3709  N N   . ASP E  2 66  B 15.600  36.993  93.082  1.00 69.25  ? 381  ASP D N   1 
ATOM   3710  C CA  . ASP E  2 66  B 15.075  36.911  94.427  1.00 69.25  ? 381  ASP D CA  1 
ATOM   3711  C C   . ASP E  2 66  B 16.034  35.950  95.098  1.00 69.25  ? 381  ASP D C   1 
ATOM   3712  O O   . ASP E  2 66  B 15.784  34.744  95.151  1.00 69.25  ? 381  ASP D O   1 
ATOM   3713  C CB  . ASP E  2 66  B 13.675  36.311  94.427  1.00 69.25  ? 381  ASP D CB  1 
ATOM   3714  C CG  . ASP E  2 66  B 13.296  35.747  95.772  1.00 69.25  ? 381  ASP D CG  1 
ATOM   3715  O OD1 . ASP E  2 66  B 13.588  36.412  96.790  1.00 69.25  ? 381  ASP D OD1 1 
ATOM   3716  O OD2 . ASP E  2 66  B 12.717  34.640  95.814  1.00 69.25  ? 381  ASP D OD2 1 
ATOM   3717  N N   . LYS E  2 67  C 17.145  36.479  95.593  1.00 100.00 ? 381  LYS D N   1 
ATOM   3718  C CA  . LYS E  2 67  C 18.147  35.635  96.219  1.00 100.00 ? 381  LYS D CA  1 
ATOM   3719  C C   . LYS E  2 67  C 17.610  34.714  97.297  1.00 100.00 ? 381  LYS D C   1 
ATOM   3720  O O   . LYS E  2 67  C 17.992  33.546  97.340  1.00 100.00 ? 381  LYS D O   1 
ATOM   3721  C CB  . LYS E  2 67  C 19.285  36.487  96.774  1.00 100.00 ? 381  LYS D CB  1 
ATOM   3722  C CG  . LYS E  2 67  C 20.363  36.791  95.738  1.00 100.00 ? 381  LYS D CG  1 
ATOM   3723  C CD  . LYS E  2 67  C 20.451  35.706  94.661  1.00 100.00 ? 381  LYS D CD  1 
ATOM   3724  C CE  . LYS E  2 67  C 20.863  36.288  93.313  1.00 100.00 ? 381  LYS D CE  1 
ATOM   3725  N NZ  . LYS E  2 67  C 22.087  35.631  92.748  1.00 100.00 ? 381  LYS D NZ  1 
ATOM   3726  N N   . LYS E  2 68  D 16.718  35.218  98.148  1.00 97.25  ? 381  LYS D N   1 
ATOM   3727  C CA  . LYS E  2 68  D 16.158  34.394  99.222  1.00 97.25  ? 381  LYS D CA  1 
ATOM   3728  C C   . LYS E  2 68  D 15.903  32.937  98.799  1.00 97.25  ? 381  LYS D C   1 
ATOM   3729  O O   . LYS E  2 68  D 16.439  32.020  99.418  1.00 97.25  ? 381  LYS D O   1 
ATOM   3730  C CB  . LYS E  2 68  D 14.865  35.007  99.772  1.00 97.25  ? 381  LYS D CB  1 
ATOM   3731  C CG  . LYS E  2 68  D 14.476  34.437  101.129 1.00 97.25  ? 381  LYS D CG  1 
ATOM   3732  C CD  . LYS E  2 68  D 13.039  34.754  101.502 1.00 97.25  ? 381  LYS D CD  1 
ATOM   3733  C CE  . LYS E  2 68  D 12.489  33.727  102.493 1.00 97.25  ? 381  LYS D CE  1 
ATOM   3734  N NZ  . LYS E  2 68  D 10.995  33.726  102.539 1.00 97.25  ? 381  LYS D NZ  1 
ATOM   3735  N N   . ASN E  2 69  E 15.095  32.709  97.764  1.00 57.64  ? 381  ASN D N   1 
ATOM   3736  C CA  . ASN E  2 69  E 14.848  31.343  97.317  1.00 57.64  ? 381  ASN D CA  1 
ATOM   3737  C C   . ASN E  2 69  E 15.390  31.217  95.919  1.00 57.64  ? 381  ASN D C   1 
ATOM   3738  O O   . ASN E  2 69  E 14.838  30.473  95.108  1.00 57.64  ? 381  ASN D O   1 
ATOM   3739  C CB  . ASN E  2 69  E 13.352  30.993  97.307  1.00 57.64  ? 381  ASN D CB  1 
ATOM   3740  C CG  . ASN E  2 69  E 12.531  31.860  98.249  1.00 57.64  ? 381  ASN D CG  1 
ATOM   3741  O OD1 . ASN E  2 69  E 12.092  31.413  99.318  1.00 57.64  ? 381  ASN D OD1 1 
ATOM   3742  N ND2 . ASN E  2 69  E 12.311  33.110  97.849  1.00 57.64  ? 381  ASN D ND2 1 
ATOM   3743  N N   . MET E  2 70  ? 16.467  31.956  95.646  1.00 87.66  ? 382  MET D N   1 
ATOM   3744  C CA  . MET E  2 70  ? 17.134  31.956  94.339  1.00 87.66  ? 382  MET D CA  1 
ATOM   3745  C C   . MET E  2 70  ? 16.108  31.907  93.202  1.00 87.66  ? 382  MET D C   1 
ATOM   3746  O O   . MET E  2 70  ? 16.239  31.112  92.273  1.00 87.66  ? 382  MET D O   1 
ATOM   3747  C CB  . MET E  2 70  ? 18.090  30.753  94.246  1.00 87.66  ? 382  MET D CB  1 
ATOM   3748  C CG  . MET E  2 70  ? 17.439  29.401  94.581  1.00 87.66  ? 382  MET D CG  1 
ATOM   3749  S SD  . MET E  2 70  ? 18.569  28.004  94.836  1.00 87.66  ? 382  MET D SD  1 
ATOM   3750  C CE  . MET E  2 70  ? 18.657  27.282  93.147  1.00 87.66  ? 382  MET D CE  1 
ATOM   3751  N N   . GLY E  2 71  ? 15.103  32.777  93.275  1.00 67.83  ? 383  GLY D N   1 
ATOM   3752  C CA  . GLY E  2 71  ? 14.042  32.786  92.279  1.00 67.83  ? 383  GLY D CA  1 
ATOM   3753  C C   . GLY E  2 71  ? 14.084  33.740  91.093  1.00 67.83  ? 383  GLY D C   1 
ATOM   3754  O O   . GLY E  2 71  ? 14.844  34.709  91.053  1.00 67.83  ? 383  GLY D O   1 
ATOM   3755  N N   . LYS E  2 72  ? 13.230  33.441  90.115  1.00 47.14  ? 384  LYS D N   1 
ATOM   3756  C CA  . LYS E  2 72  ? 13.102  34.221  88.885  1.00 47.14  ? 384  LYS D CA  1 
ATOM   3757  C C   . LYS E  2 72  ? 11.622  34.420  88.558  1.00 47.14  ? 384  LYS D C   1 
ATOM   3758  O O   . LYS E  2 72  ? 10.737  33.899  89.259  1.00 47.14  ? 384  LYS D O   1 
ATOM   3759  C CB  . LYS E  2 72  ? 13.781  33.493  87.728  1.00 47.14  ? 384  LYS D CB  1 
ATOM   3760  C CG  . LYS E  2 72  ? 15.248  33.299  87.943  1.00 47.14  ? 384  LYS D CG  1 
ATOM   3761  C CD  . LYS E  2 72  ? 16.025  34.033  86.893  1.00 47.14  ? 384  LYS D CD  1 
ATOM   3762  C CE  . LYS E  2 72  ? 16.584  35.311  87.430  1.00 47.14  ? 384  LYS D CE  1 
ATOM   3763  N NZ  . LYS E  2 72  ? 17.831  35.616  86.682  1.00 47.14  ? 384  LYS D NZ  1 
ATOM   3764  N N   . GLN E  2 73  ? 11.363  35.176  87.498  1.00 40.92  ? 385  GLN D N   1 
ATOM   3765  C CA  . GLN E  2 73  ? 9.998   35.435  87.079  1.00 40.92  ? 385  GLN D CA  1 
ATOM   3766  C C   . GLN E  2 73  ? 9.979   35.573  85.570  1.00 40.92  ? 385  GLN D C   1 
ATOM   3767  O O   . GLN E  2 73  ? 10.738  36.370  85.015  1.00 40.92  ? 385  GLN D O   1 
ATOM   3768  C CB  . GLN E  2 73  ? 9.479   36.715  87.744  1.00 40.92  ? 385  GLN D CB  1 
ATOM   3769  C CG  . GLN E  2 73  ? 8.507   37.534  86.889  1.00 40.92  ? 385  GLN D CG  1 
ATOM   3770  C CD  . GLN E  2 73  ? 7.429   38.238  87.707  1.00 40.92  ? 385  GLN D CD  1 
ATOM   3771  O OE1 . GLN E  2 73  ? 7.327   38.050  88.922  1.00 40.92  ? 385  GLN D OE1 1 
ATOM   3772  N NE2 . GLN E  2 73  ? 6.618   39.054  87.036  1.00 40.92  ? 385  GLN D NE2 1 
ATOM   3773  N N   . MET E  2 74  ? 9.109   34.798  84.916  1.00 39.21  ? 386  MET D N   1 
ATOM   3774  C CA  . MET E  2 74  ? 8.988   34.801  83.459  1.00 39.21  ? 386  MET D CA  1 
ATOM   3775  C C   . MET E  2 74  ? 7.642   35.267  82.907  1.00 39.21  ? 386  MET D C   1 
ATOM   3776  O O   . MET E  2 74  ? 6.673   34.509  82.891  1.00 39.21  ? 386  MET D O   1 
ATOM   3777  C CB  . MET E  2 74  ? 9.264   33.407  82.907  1.00 39.21  ? 386  MET D CB  1 
ATOM   3778  C CG  . MET E  2 74  ? 9.489   33.391  81.407  1.00 39.21  ? 386  MET D CG  1 
ATOM   3779  S SD  . MET E  2 74  ? 10.971  34.310  80.992  1.00 39.21  ? 386  MET D SD  1 
ATOM   3780  C CE  . MET E  2 74  ? 10.354  35.536  79.877  1.00 39.21  ? 386  MET D CE  1 
ATOM   3781  N N   . PRO E  2 75  ? 7.556   36.533  82.482  1.00 40.40  ? 387  PRO D N   1 
ATOM   3782  C CA  . PRO E  2 75  ? 6.311   37.056  81.927  1.00 40.40  ? 387  PRO D CA  1 
ATOM   3783  C C   . PRO E  2 75  ? 6.072   36.348  80.604  1.00 40.40  ? 387  PRO D C   1 
ATOM   3784  O O   . PRO E  2 75  ? 7.025   35.931  79.949  1.00 40.40  ? 387  PRO D O   1 
ATOM   3785  C CB  . PRO E  2 75  ? 6.593   38.544  81.740  1.00 40.40  ? 387  PRO D CB  1 
ATOM   3786  C CG  . PRO E  2 75  ? 7.780   38.822  82.620  1.00 40.40  ? 387  PRO D CG  1 
ATOM   3787  C CD  . PRO E  2 75  ? 8.589   37.572  82.567  1.00 40.40  ? 387  PRO D CD  1 
ATOM   3788  N N   . GLN E  2 76  ? 4.805   36.222  80.209  1.00 36.06  ? 388  GLN D N   1 
ATOM   3789  C CA  . GLN E  2 76  ? 4.458   35.542  78.973  1.00 36.06  ? 388  GLN D CA  1 
ATOM   3790  C C   . GLN E  2 76  ? 3.218   36.097  78.279  1.00 36.06  ? 388  GLN D C   1 
ATOM   3791  O O   . GLN E  2 76  ? 2.083   35.771  78.634  1.00 36.06  ? 388  GLN D O   1 
ATOM   3792  C CB  . GLN E  2 76  ? 4.263   34.062  79.265  1.00 36.06  ? 388  GLN D CB  1 
ATOM   3793  C CG  . GLN E  2 76  ? 3.686   33.273  78.126  1.00 36.06  ? 388  GLN D CG  1 
ATOM   3794  C CD  . GLN E  2 76  ? 3.279   31.900  78.573  1.00 36.06  ? 388  GLN D CD  1 
ATOM   3795  O OE1 . GLN E  2 76  ? 3.926   31.301  79.424  1.00 36.06  ? 388  GLN D OE1 1 
ATOM   3796  N NE2 . GLN E  2 76  ? 2.195   31.390  78.011  1.00 36.06  ? 388  GLN D NE2 1 
ATOM   3797  N N   . PRO E  2 77  ? 3.421   36.960  77.280  1.00 34.24  ? 389  PRO D N   1 
ATOM   3798  C CA  . PRO E  2 77  ? 2.340   37.574  76.511  1.00 34.24  ? 389  PRO D CA  1 
ATOM   3799  C C   . PRO E  2 77  ? 1.844   36.649  75.404  1.00 34.24  ? 389  PRO D C   1 
ATOM   3800  O O   . PRO E  2 77  ? 2.649   36.031  74.716  1.00 34.24  ? 389  PRO D O   1 
ATOM   3801  C CB  . PRO E  2 77  ? 2.991   38.808  75.928  1.00 34.24  ? 389  PRO D CB  1 
ATOM   3802  C CG  . PRO E  2 77  ? 4.380   38.366  75.703  1.00 34.24  ? 389  PRO D CG  1 
ATOM   3803  C CD  . PRO E  2 77  ? 4.734   37.452  76.845  1.00 34.24  ? 389  PRO D CD  1 
ATOM   3804  N N   . THR E  2 78  ? 0.527   36.569  75.241  1.00 35.96  ? 390  THR D N   1 
ATOM   3805  C CA  . THR E  2 78  ? -0.101  35.745  74.215  1.00 35.96  ? 390  THR D CA  1 
ATOM   3806  C C   . THR E  2 78  ? -0.870  36.716  73.376  1.00 35.96  ? 390  THR D C   1 
ATOM   3807  O O   . THR E  2 78  ? -1.262  37.766  73.872  1.00 35.96  ? 390  THR D O   1 
ATOM   3808  C CB  . THR E  2 78  ? -1.084  34.778  74.818  1.00 35.96  ? 390  THR D CB  1 
ATOM   3809  O OG1 . THR E  2 78  ? -0.559  34.304  76.066  1.00 35.96  ? 390  THR D OG1 1 
ATOM   3810  C CG2 . THR E  2 78  ? -1.325  33.622  73.874  1.00 35.96  ? 390  THR D CG2 1 
ATOM   3811  N N   . PHE E  2 79  ? -1.120  36.396  72.116  1.00 28.11  ? 392  PHE D N   1 
ATOM   3812  C CA  . PHE E  2 79  ? -1.839  37.367  71.321  1.00 28.11  ? 392  PHE D CA  1 
ATOM   3813  C C   . PHE E  2 79  ? -2.565  36.885  70.085  1.00 28.11  ? 392  PHE D C   1 
ATOM   3814  O O   . PHE E  2 79  ? -2.363  35.767  69.601  1.00 28.11  ? 392  PHE D O   1 
ATOM   3815  C CB  . PHE E  2 79  ? -0.889  38.496  70.940  1.00 28.11  ? 392  PHE D CB  1 
ATOM   3816  C CG  . PHE E  2 79  ? 0.083   38.136  69.865  1.00 28.11  ? 392  PHE D CG  1 
ATOM   3817  C CD1 . PHE E  2 79  ? -0.269  38.261  68.522  1.00 28.11  ? 392  PHE D CD1 1 
ATOM   3818  C CD2 . PHE E  2 79  ? 1.357   37.674  70.188  1.00 28.11  ? 392  PHE D CD2 1 
ATOM   3819  C CE1 . PHE E  2 79  ? 0.644   37.925  67.494  1.00 28.11  ? 392  PHE D CE1 1 
ATOM   3820  C CE2 . PHE E  2 79  ? 2.282   37.333  69.177  1.00 28.11  ? 392  PHE D CE2 1 
ATOM   3821  C CZ  . PHE E  2 79  ? 1.922   37.460  67.824  1.00 28.11  ? 392  PHE D CZ  1 
ATOM   3822  N N   . THR E  2 80  ? -3.432  37.752  69.578  1.00 28.24  ? 393  THR D N   1 
ATOM   3823  C CA  . THR E  2 80  ? -4.192  37.450  68.393  1.00 28.24  ? 393  THR D CA  1 
ATOM   3824  C C   . THR E  2 80  ? -4.216  38.702  67.539  1.00 28.24  ? 393  THR D C   1 
ATOM   3825  O O   . THR E  2 80  ? -4.982  38.805  66.586  1.00 28.24  ? 393  THR D O   1 
ATOM   3826  C CB  . THR E  2 80  ? -5.593  37.019  68.764  1.00 28.24  ? 393  THR D CB  1 
ATOM   3827  O OG1 . THR E  2 80  ? -5.567  35.642  69.131  1.00 28.24  ? 393  THR D OG1 1 
ATOM   3828  C CG2 . THR E  2 80  ? -6.503  37.131  67.613  1.00 28.24  ? 393  THR D CG2 1 
ATOM   3829  N N   . LEU E  2 81  ? -3.356  39.661  67.860  1.00 25.96  ? 394  LEU D N   1 
ATOM   3830  C CA  . LEU E  2 81  ? -3.311  40.886  67.075  1.00 25.96  ? 394  LEU D CA  1 
ATOM   3831  C C   . LEU E  2 81  ? -3.154  40.488  65.614  1.00 25.96  ? 394  LEU D C   1 
ATOM   3832  O O   . LEU E  2 81  ? -2.544  39.457  65.311  1.00 25.96  ? 394  LEU D O   1 
ATOM   3833  C CB  . LEU E  2 81  ? -2.147  41.775  67.512  1.00 25.96  ? 394  LEU D CB  1 
ATOM   3834  C CG  . LEU E  2 81  ? -2.169  42.094  69.009  1.00 25.96  ? 394  LEU D CG  1 
ATOM   3835  C CD1 . LEU E  2 81  ? -1.158  43.161  69.334  1.00 25.96  ? 394  LEU D CD1 1 
ATOM   3836  C CD2 . LEU E  2 81  ? -3.575  42.548  69.418  1.00 25.96  ? 394  LEU D CD2 1 
ATOM   3837  N N   . ARG E  2 82  ? -3.719  41.293  64.716  1.00 45.29  ? 395  ARG D N   1 
ATOM   3838  C CA  . ARG E  2 82  ? -3.659  41.011  63.292  1.00 45.29  ? 395  ARG D CA  1 
ATOM   3839  C C   . ARG E  2 82  ? -2.799  42.022  62.571  1.00 45.29  ? 395  ARG D C   1 
ATOM   3840  O O   . ARG E  2 82  ? -2.582  41.922  61.360  1.00 45.29  ? 395  ARG D O   1 
ATOM   3841  C CB  . ARG E  2 82  ? -5.061  41.022  62.693  1.00 45.29  ? 395  ARG D CB  1 
ATOM   3842  C CG  . ARG E  2 82  ? -5.653  39.648  62.540  1.00 45.29  ? 395  ARG D CG  1 
ATOM   3843  C CD  . ARG E  2 82  ? -7.147  39.661  62.783  1.00 45.29  ? 395  ARG D CD  1 
ATOM   3844  N NE  . ARG E  2 82  ? -7.690  41.011  62.742  1.00 45.29  ? 395  ARG D NE  1 
ATOM   3845  C CZ  . ARG E  2 82  ? -8.159  41.589  61.644  1.00 45.29  ? 395  ARG D CZ  1 
ATOM   3846  N NH1 . ARG E  2 82  ? -8.149  40.932  60.490  1.00 45.29  ? 395  ARG D NH1 1 
ATOM   3847  N NH2 . ARG E  2 82  ? -8.634  42.824  61.706  1.00 45.29  ? 395  ARG D NH2 1 
ATOM   3848  N N   . LYS E  2 83  ? -2.327  43.012  63.314  1.00 34.15  ? 396  LYS D N   1 
ATOM   3849  C CA  . LYS E  2 83  ? -1.465  44.035  62.741  1.00 34.15  ? 396  LYS D CA  1 
ATOM   3850  C C   . LYS E  2 83  ? -0.611  44.621  63.827  1.00 34.15  ? 396  LYS D C   1 
ATOM   3851  O O   . LYS E  2 83  ? -0.860  44.401  65.008  1.00 34.15  ? 396  LYS D O   1 
ATOM   3852  C CB  . LYS E  2 83  ? -2.261  45.167  62.066  1.00 34.15  ? 396  LYS D CB  1 
ATOM   3853  C CG  . LYS E  2 83  ? -3.670  45.439  62.600  1.00 34.15  ? 396  LYS D CG  1 
ATOM   3854  C CD  . LYS E  2 83  ? -4.732  45.291  61.482  1.00 34.15  ? 396  LYS D CD  1 
ATOM   3855  C CE  . LYS E  2 83  ? -5.729  46.450  61.445  1.00 34.15  ? 396  LYS D CE  1 
ATOM   3856  N NZ  . LYS E  2 83  ? -5.759  47.190  60.129  1.00 34.15  ? 396  LYS D NZ  1 
ATOM   3857  N N   . LYS E  2 84  ? 0.409   45.363  63.426  1.00 58.83  ? 397  LYS D N   1 
ATOM   3858  C CA  . LYS E  2 84  ? 1.292   45.965  64.392  1.00 58.83  ? 397  LYS D CA  1 
ATOM   3859  C C   . LYS E  2 84  ? 0.414   46.818  65.280  1.00 58.83  ? 397  LYS D C   1 
ATOM   3860  O O   . LYS E  2 84  ? -0.534  47.432  64.804  1.00 58.83  ? 397  LYS D O   1 
ATOM   3861  C CB  . LYS E  2 84  ? 2.339   46.825  63.685  1.00 58.83  ? 397  LYS D CB  1 
ATOM   3862  C CG  . LYS E  2 84  ? 3.584   46.058  63.219  1.00 58.83  ? 397  LYS D CG  1 
ATOM   3863  C CD  . LYS E  2 84  ? 4.477   45.611  64.390  1.00 58.83  ? 397  LYS D CD  1 
ATOM   3864  C CE  . LYS E  2 84  ? 5.517   44.548  63.960  1.00 58.83  ? 397  LYS D CE  1 
ATOM   3865  N NZ  . LYS E  2 84  ? 5.992   43.659  65.087  1.00 58.83  ? 397  LYS D NZ  1 
ATOM   3866  N N   . LEU E  2 85  ? 0.697   46.813  66.576  1.00 29.62  ? 398  LEU D N   1 
ATOM   3867  C CA  . LEU E  2 85  ? -0.064  47.630  67.506  1.00 29.62  ? 398  LEU D CA  1 
ATOM   3868  C C   . LEU E  2 85  ? 0.851   48.672  68.116  1.00 29.62  ? 398  LEU D C   1 
ATOM   3869  O O   . LEU E  2 85  ? 1.527   48.403  69.103  1.00 29.62  ? 398  LEU D O   1 
ATOM   3870  C CB  . LEU E  2 85  ? -0.669  46.809  68.648  1.00 29.62  ? 398  LEU D CB  1 
ATOM   3871  C CG  . LEU E  2 85  ? -1.317  47.797  69.635  1.00 29.62  ? 398  LEU D CG  1 
ATOM   3872  C CD1 . LEU E  2 85  ? -2.590  48.345  68.993  1.00 29.62  ? 398  LEU D CD1 1 
ATOM   3873  C CD2 . LEU E  2 85  ? -1.619  47.156  70.975  1.00 29.62  ? 398  LEU D CD2 1 
ATOM   3874  N N   . VAL E  2 86  ? 0.873   49.859  67.531  1.00 32.50  ? 399  VAL D N   1 
ATOM   3875  C CA  . VAL E  2 86  ? 1.712   50.914  68.052  1.00 32.50  ? 399  VAL D CA  1 
ATOM   3876  C C   . VAL E  2 86  ? 0.785   51.919  68.712  1.00 32.50  ? 399  VAL D C   1 
ATOM   3877  O O   . VAL E  2 86  ? -0.381  52.024  68.328  1.00 32.50  ? 399  VAL D O   1 
ATOM   3878  C CB  . VAL E  2 86  ? 2.515   51.583  66.921  1.00 32.50  ? 399  VAL D CB  1 
ATOM   3879  C CG1 . VAL E  2 86  ? 1.559   52.227  65.932  1.00 32.50  ? 399  VAL D CG1 1 
ATOM   3880  C CG2 . VAL E  2 86  ? 3.498   52.594  67.502  1.00 32.50  ? 399  VAL D CG2 1 
ATOM   3881  N N   . PHE E  2 87  ? 1.306   52.621  69.721  1.00 38.75  ? 400  PHE D N   1 
ATOM   3882  C CA  . PHE E  2 87  ? 0.569   53.649  70.472  1.00 38.75  ? 400  PHE D CA  1 
ATOM   3883  C C   . PHE E  2 87  ? 1.193   55.010  70.167  1.00 38.75  ? 400  PHE D C   1 
ATOM   3884  O O   . PHE E  2 87  ? 2.081   55.462  70.884  1.00 38.75  ? 400  PHE D O   1 
ATOM   3885  C CB  . PHE E  2 87  ? 0.692   53.411  71.981  1.00 38.75  ? 400  PHE D CB  1 
ATOM   3886  C CG  . PHE E  2 87  ? -0.073  52.232  72.479  1.00 38.75  ? 400  PHE D CG  1 
ATOM   3887  C CD1 . PHE E  2 87  ? -1.245  51.837  71.860  1.00 38.75  ? 400  PHE D CD1 1 
ATOM   3888  C CD2 . PHE E  2 87  ? 0.366   51.528  73.583  1.00 38.75  ? 400  PHE D CD2 1 
ATOM   3889  C CE1 . PHE E  2 87  ? -1.975  50.756  72.338  1.00 38.75  ? 400  PHE D CE1 1 
ATOM   3890  C CE2 . PHE E  2 87  ? -0.359  50.445  74.067  1.00 38.75  ? 400  PHE D CE2 1 
ATOM   3891  C CZ  . PHE E  2 87  ? -1.531  50.060  73.444  1.00 38.75  ? 400  PHE D CZ  1 
ATOM   3892  N N   . PRO E  2 88  ? 0.743   55.688  69.110  1.00 79.01  ? 401  PRO D N   1 
ATOM   3893  C CA  . PRO E  2 88  ? 1.373   56.983  68.856  1.00 79.01  ? 401  PRO D CA  1 
ATOM   3894  C C   . PRO E  2 88  ? 1.115   57.915  70.025  1.00 79.01  ? 401  PRO D C   1 
ATOM   3895  O O   . PRO E  2 88  ? -0.031  57.883  70.530  1.00 79.01  ? 401  PRO D O   1 
ATOM   3896  C CB  . PRO E  2 88  ? 0.700   57.470  67.577  1.00 79.01  ? 401  PRO D CB  1 
ATOM   3897  C CG  . PRO E  2 88  ? 0.086   56.252  66.971  1.00 79.01  ? 401  PRO D CG  1 
ATOM   3898  C CD  . PRO E  2 88  ? -0.305  55.388  68.129  1.00 79.01  ? 401  PRO D CD  1 
ATOM   3899  O OXT . PRO E  2 88  ? 2.048   58.649  70.421  1.00 79.01  ? 401  PRO D OXT 1 
HETATM 3900  C C1  . PHQ F  3 1   ? 9.441   40.558  98.004  1.00 64.16  ? 4200 PHQ U C1  1 
HETATM 3901  O O1  . PHQ F  3 1   ? 9.888   39.459  98.358  1.00 45.13  ? 4200 PHQ U O1  1 
HETATM 3902  O O2  . PHQ F  3 1   ? 10.313  41.572  97.588  0.00 45.13  ? 4200 PHQ U O2  1 
HETATM 3903  C C2  . PHQ F  3 1   ? 11.722  41.250  97.615  0.00 45.13  ? 4200 PHQ U C2  1 
HETATM 3904  C C3  . PHQ F  3 1   ? 12.560  42.399  97.098  0.00 45.13  ? 4200 PHQ U C3  1 
HETATM 3905  C C4  . PHQ F  3 1   ? 12.348  43.748  97.529  0.00 45.13  ? 4200 PHQ U C4  1 
HETATM 3906  C C5  . PHQ F  3 1   ? 13.166  44.806  97.012  0.00 45.13  ? 4200 PHQ U C5  1 
HETATM 3907  C C6  . PHQ F  3 1   ? 14.195  44.524  96.062  0.00 45.13  ? 4200 PHQ U C6  1 
HETATM 3908  C C7  . PHQ F  3 1   ? 14.413  43.180  95.627  0.00 45.13  ? 4200 PHQ U C7  1 
HETATM 3909  C C8  . PHQ F  3 1   ? 13.597  42.127  96.145  0.00 45.13  ? 4200 PHQ U C8  1 
ATOM   3910  N N   . GLU F  3 2   ? 8.175   40.953  97.930  1.00 63.31  ? 4201 GLU U N   1 
ATOM   3911  C CA  . GLU F  3 2   ? 7.039   40.058  98.279  1.00 56.84  ? 4201 GLU U CA  1 
ATOM   3912  C C   . GLU F  3 2   ? 6.450   39.497  96.947  1.00 64.01  ? 4201 GLU U C   1 
ATOM   3913  O O   . GLU F  3 2   ? 6.904   39.873  95.842  1.00 82.79  ? 4201 GLU U O   1 
ATOM   3914  C CB  . GLU F  3 2   ? 5.901   40.812  99.022  1.00 63.02  ? 4201 GLU U CB  1 
ATOM   3915  C CG  . GLU F  3 2   ? 6.260   41.442  100.383 1.00 74.94  ? 4201 GLU U CG  1 
ATOM   3916  C CD  . GLU F  3 2   ? 4.999   41.880  101.172 1.00 76.24  ? 4201 GLU U CD  1 
ATOM   3917  O OE1 . GLU F  3 2   ? 3.850   41.766  100.809 1.00 80.76  ? 4201 GLU U OE1 1 
ATOM   3918  O OE2 . GLU F  3 2   ? 5.339   42.416  102.349 1.00 67.05  ? 4201 GLU U OE2 1 
ATOM   3919  N N   . VAL F  3 3   ? 5.420   38.614  97.050  1.00 58.59  ? 4202 VAL U N   1 
ATOM   3920  C CA  . VAL F  3 3   ? 4.916   37.778  95.933  1.00 54.88  ? 4202 VAL U CA  1 
ATOM   3921  C C   . VAL F  3 3   ? 3.408   38.066  95.831  1.00 68.83  ? 4202 VAL U C   1 
ATOM   3922  O O   . VAL F  3 3   ? 2.771   38.451  96.828  1.00 79.24  ? 4202 VAL U O   1 
ATOM   3923  C CB  . VAL F  3 3   ? 5.189   36.259  96.157  1.00 47.67  ? 4202 VAL U CB  1 
ATOM   3924  C CG1 . VAL F  3 3   ? 6.691   35.972  96.215  1.00 56.07  ? 4202 VAL U CG1 1 
ATOM   3925  C CG2 . VAL F  3 3   ? 4.572   35.718  97.463  1.00 51.88  ? 4202 VAL U CG2 1 
ATOM   3926  N N   . ASP F  3 4   ? 2.848   37.872  94.607  1.00 62.32  ? 4203 ASP U N   1 
ATOM   3927  C CA  . ASP F  3 4   ? 1.438   38.091  94.274  1.00 46.70  ? 4203 ASP U CA  1 
ATOM   3928  C C   . ASP F  3 4   ? 0.677   36.734  94.035  1.00 48.75  ? 4203 ASP U C   1 
ATOM   3929  O O   . ASP F  3 4   ? -0.464  36.669  93.677  1.00 45.13  ? 4203 ASP U O   1 
ATOM   3930  C CB  . ASP F  3 4   ? 1.357   38.989  93.017  1.00 37.49  ? 4203 ASP U CB  1 
ATOM   3931  C CG  . ASP F  3 4   ? 1.597   40.495  93.269  1.00 53.74  ? 4203 ASP U CG  1 
ATOM   3932  O OD1 . ASP F  3 4   ? 1.290   41.118  94.258  1.00 54.41  ? 4203 ASP U OD1 1 
ATOM   3933  O OD2 . ASP F  3 4   ? 2.199   41.049  92.215  1.00 59.78  ? 4203 ASP U OD2 1 
HETATM 3934  C C1  . 0QE F  3 5   ? 1.441   35.662  94.285  1.00 23.01  ? 4204 0QE U C1  1 
ATOM   3935  N N   . LEU G  1 1   ? 0.892   97.194  97.317  1.00 100.00 ? 149  LEU E N   1 
ATOM   3936  C CA  . LEU G  1 1   ? 1.514   95.894  96.920  1.00 100.00 ? 149  LEU E CA  1 
ATOM   3937  C C   . LEU G  1 1   ? 0.973   95.348  95.587  1.00 100.00 ? 149  LEU E C   1 
ATOM   3938  O O   . LEU G  1 1   ? -0.217  95.461  95.275  1.00 100.00 ? 149  LEU E O   1 
ATOM   3939  C CB  . LEU G  1 1   ? 1.310   94.841  98.026  1.00 100.00 ? 149  LEU E CB  1 
ATOM   3940  C CG  . LEU G  1 1   ? 1.726   93.392  97.711  1.00 100.00 ? 149  LEU E CG  1 
ATOM   3941  C CD1 . LEU G  1 1   ? 2.277   92.749  98.970  1.00 100.00 ? 149  LEU E CD1 1 
ATOM   3942  C CD2 . LEU G  1 1   ? 0.539   92.587  97.174  1.00 100.00 ? 149  LEU E CD2 1 
ATOM   3943  N N   . ASP G  1 2   ? 1.879   94.764  94.809  1.00 100.00 ? 150  ASP E N   1 
ATOM   3944  C CA  . ASP G  1 2   ? 1.598   94.158  93.508  1.00 100.00 ? 150  ASP E CA  1 
ATOM   3945  C C   . ASP G  1 2   ? 2.964   93.783  92.935  1.00 100.00 ? 150  ASP E C   1 
ATOM   3946  O O   . ASP G  1 2   ? 3.988   94.310  93.377  1.00 100.00 ? 150  ASP E O   1 
ATOM   3947  C CB  . ASP G  1 2   ? 0.850   95.117  92.555  1.00 100.00 ? 150  ASP E CB  1 
ATOM   3948  C CG  . ASP G  1 2   ? 1.179   96.599  92.790  1.00 100.00 ? 150  ASP E CG  1 
ATOM   3949  O OD1 . ASP G  1 2   ? 2.033   96.929  93.643  1.00 100.00 ? 150  ASP E OD1 1 
ATOM   3950  O OD2 . ASP G  1 2   ? 0.572   97.450  92.105  1.00 100.00 ? 150  ASP E OD2 1 
ATOM   3951  N N   . LYS G  1 3   ? 2.997   92.883  91.961  1.00 78.47  ? 151  LYS E N   1 
ATOM   3952  C CA  . LYS G  1 3   ? 4.276   92.453  91.417  1.00 78.47  ? 151  LYS E CA  1 
ATOM   3953  C C   . LYS G  1 3   ? 5.162   93.528  90.807  1.00 78.47  ? 151  LYS E C   1 
ATOM   3954  O O   . LYS G  1 3   ? 4.687   94.431  90.122  1.00 78.47  ? 151  LYS E O   1 
ATOM   3955  C CB  . LYS G  1 3   ? 4.080   91.326  90.405  1.00 78.47  ? 151  LYS E CB  1 
ATOM   3956  C CG  . LYS G  1 3   ? 5.248   90.323  90.396  1.00 78.47  ? 151  LYS E CG  1 
ATOM   3957  C CD  . LYS G  1 3   ? 6.109   90.356  91.699  1.00 78.47  ? 151  LYS E CD  1 
ATOM   3958  C CE  . LYS G  1 3   ? 7.355   89.460  91.594  1.00 78.47  ? 151  LYS E CE  1 
ATOM   3959  N NZ  . LYS G  1 3   ? 8.406   89.775  92.608  1.00 78.47  ? 151  LYS E NZ  1 
ATOM   3960  N N   . VAL G  1 4   ? 6.464   93.410  91.066  1.00 55.31  ? 152  VAL E N   1 
ATOM   3961  C CA  . VAL G  1 4   ? 7.449   94.352  90.551  1.00 55.31  ? 152  VAL E CA  1 
ATOM   3962  C C   . VAL G  1 4   ? 8.575   93.622  89.846  1.00 55.31  ? 152  VAL E C   1 
ATOM   3963  O O   . VAL G  1 4   ? 8.932   92.496  90.198  1.00 55.31  ? 152  VAL E O   1 
ATOM   3964  C CB  . VAL G  1 4   ? 8.065   95.204  91.677  1.00 55.31  ? 152  VAL E CB  1 
ATOM   3965  C CG1 . VAL G  1 4   ? 9.235   96.015  91.137  1.00 55.31  ? 152  VAL E CG1 1 
ATOM   3966  C CG2 . VAL G  1 4   ? 7.014   96.120  92.260  1.00 55.31  ? 152  VAL E CG2 1 
ATOM   3967  N N   . TYR G  1 5   ? 9.129   94.274  88.835  1.00 48.64  ? 153  TYR E N   1 
ATOM   3968  C CA  . TYR G  1 5   ? 10.229  93.696  88.091  1.00 48.64  ? 153  TYR E CA  1 
ATOM   3969  C C   . TYR G  1 5   ? 11.434  93.745  89.004  1.00 48.64  ? 153  TYR E C   1 
ATOM   3970  O O   . TYR G  1 5   ? 11.707  94.777  89.637  1.00 48.64  ? 153  TYR E O   1 
ATOM   3971  C CB  . TYR G  1 5   ? 10.504  94.513  86.833  1.00 48.64  ? 153  TYR E CB  1 
ATOM   3972  C CG  . TYR G  1 5   ? 9.600   94.161  85.673  1.00 48.64  ? 153  TYR E CG  1 
ATOM   3973  C CD1 . TYR G  1 5   ? 8.798   95.129  85.063  1.00 48.64  ? 153  TYR E CD1 1 
ATOM   3974  C CD2 . TYR G  1 5   ? 9.576   92.869  85.159  1.00 48.64  ? 153  TYR E CD2 1 
ATOM   3975  C CE1 . TYR G  1 5   ? 8.007   94.819  83.966  1.00 48.64  ? 153  TYR E CE1 1 
ATOM   3976  C CE2 . TYR G  1 5   ? 8.788   92.553  84.062  1.00 48.64  ? 153  TYR E CE2 1 
ATOM   3977  C CZ  . TYR G  1 5   ? 8.010   93.534  83.469  1.00 48.64  ? 153  TYR E CZ  1 
ATOM   3978  O OH  . TYR G  1 5   ? 7.256   93.240  82.358  1.00 48.64  ? 153  TYR E OH  1 
ATOM   3979  N N   . GLN G  1 6   ? 12.142  92.622  89.079  1.00 57.63  ? 154  GLN E N   1 
ATOM   3980  C CA  . GLN G  1 6   ? 13.339  92.518  89.897  1.00 57.63  ? 154  GLN E CA  1 
ATOM   3981  C C   . GLN G  1 6   ? 14.417  93.456  89.367  1.00 57.63  ? 154  GLN E C   1 
ATOM   3982  O O   . GLN G  1 6   ? 14.812  93.371  88.201  1.00 57.63  ? 154  GLN E O   1 
ATOM   3983  C CB  . GLN G  1 6   ? 13.853  91.089  89.867  1.00 57.63  ? 154  GLN E CB  1 
ATOM   3984  C CG  . GLN G  1 6   ? 15.312  90.952  90.256  1.00 57.63  ? 154  GLN E CG  1 
ATOM   3985  C CD  . GLN G  1 6   ? 15.551  89.761  91.173  1.00 57.63  ? 154  GLN E CD  1 
ATOM   3986  O OE1 . GLN G  1 6   ? 15.186  88.619  90.848  1.00 57.63  ? 154  GLN E OE1 1 
ATOM   3987  N NE2 . GLN G  1 6   ? 16.165  90.020  92.330  1.00 57.63  ? 154  GLN E NE2 1 
ATOM   3988  N N   . MET G  1 7   ? 14.879  94.354  90.228  1.00 49.81  ? 155  MET E N   1 
ATOM   3989  C CA  . MET G  1 7   ? 15.912  95.321  89.858  1.00 49.81  ? 155  MET E CA  1 
ATOM   3990  C C   . MET G  1 7   ? 17.051  95.304  90.885  1.00 49.81  ? 155  MET E C   1 
ATOM   3991  O O   . MET G  1 7   ? 17.350  96.326  91.509  1.00 49.81  ? 155  MET E O   1 
ATOM   3992  C CB  . MET G  1 7   ? 15.316  96.737  89.789  1.00 49.81  ? 155  MET E CB  1 
ATOM   3993  C CG  . MET G  1 7   ? 14.527  97.045  88.515  1.00 49.81  ? 155  MET E CG  1 
ATOM   3994  S SD  . MET G  1 7   ? 15.451  96.890  86.953  1.00 49.81  ? 155  MET E SD  1 
ATOM   3995  C CE  . MET G  1 7   ? 16.632  98.183  87.156  1.00 49.81  ? 155  MET E CE  1 
ATOM   3996  N N   . LYS G  1 8   ? 17.690  94.144  91.047  1.00 61.14  ? 156  LYS E N   1 
ATOM   3997  C CA  . LYS G  1 8   ? 18.770  93.971  92.022  1.00 61.14  ? 156  LYS E CA  1 
ATOM   3998  C C   . LYS G  1 8   ? 20.162  93.963  91.399  1.00 61.14  ? 156  LYS E C   1 
ATOM   3999  O O   . LYS G  1 8   ? 21.081  94.574  91.935  1.00 61.14  ? 156  LYS E O   1 
ATOM   4000  C CB  . LYS G  1 8   ? 18.556  92.661  92.798  1.00 61.14  ? 156  LYS E CB  1 
ATOM   4001  C CG  . LYS G  1 8   ? 18.044  92.836  94.223  1.00 61.14  ? 156  LYS E CG  1 
ATOM   4002  C CD  . LYS G  1 8   ? 18.002  91.498  94.962  1.00 61.14  ? 156  LYS E CD  1 
ATOM   4003  C CE  . LYS G  1 8   ? 19.048  91.417  96.091  1.00 61.14  ? 156  LYS E CE  1 
ATOM   4004  N NZ  . LYS G  1 8   ? 19.796  90.113  96.106  1.00 61.14  ? 156  LYS E NZ  1 
ATOM   4005  N N   . SER G  1 9   ? 20.298  93.268  90.272  1.00 47.61  ? 157  SER E N   1 
ATOM   4006  C CA  . SER G  1 9   ? 21.558  93.121  89.548  1.00 47.61  ? 157  SER E CA  1 
ATOM   4007  C C   . SER G  1 9   ? 22.634  94.203  89.772  1.00 47.61  ? 157  SER E C   1 
ATOM   4008  O O   . SER G  1 9   ? 22.322  95.370  90.025  1.00 47.61  ? 157  SER E O   1 
ATOM   4009  C CB  . SER G  1 9   ? 21.251  92.984  88.060  1.00 47.61  ? 157  SER E CB  1 
ATOM   4010  O OG  . SER G  1 9   ? 22.332  93.450  87.271  1.00 47.61  ? 157  SER E OG  1 
ATOM   4011  N N   . LYS G  1 10  ? 23.906  93.795  89.674  1.00 100.00 ? 160  LYS E N   1 
ATOM   4012  C CA  . LYS G  1 10  ? 25.046  94.699  89.867  1.00 100.00 ? 160  LYS E CA  1 
ATOM   4013  C C   . LYS G  1 10  ? 25.043  95.813  88.839  1.00 100.00 ? 160  LYS E C   1 
ATOM   4014  O O   . LYS G  1 10  ? 24.933  96.981  89.196  1.00 100.00 ? 160  LYS E O   1 
ATOM   4015  C CB  . LYS G  1 10  ? 26.384  93.950  89.794  1.00 100.00 ? 160  LYS E CB  1 
ATOM   4016  C CG  . LYS G  1 10  ? 26.289  92.472  89.438  1.00 100.00 ? 160  LYS E CG  1 
ATOM   4017  C CD  . LYS G  1 10  ? 27.531  91.710  89.898  1.00 100.00 ? 160  LYS E CD  1 
ATOM   4018  C CE  . LYS G  1 10  ? 27.642  91.699  91.424  1.00 100.00 ? 160  LYS E CE  1 
ATOM   4019  N NZ  . LYS G  1 10  ? 28.523  92.787  91.945  1.00 100.00 ? 160  LYS E NZ  1 
ATOM   4020  N N   . PRO G  1 11  ? 25.188  95.483  87.546  1.00 94.60  ? 161  PRO E N   1 
ATOM   4021  C CA  . PRO G  1 11  ? 25.162  96.605  86.611  1.00 94.60  ? 161  PRO E CA  1 
ATOM   4022  C C   . PRO G  1 11  ? 23.711  96.903  86.195  1.00 94.60  ? 161  PRO E C   1 
ATOM   4023  O O   . PRO G  1 11  ? 23.447  97.891  85.507  1.00 94.60  ? 161  PRO E O   1 
ATOM   4024  C CB  . PRO G  1 11  ? 26.016  96.112  85.448  1.00 94.60  ? 161  PRO E CB  1 
ATOM   4025  C CG  . PRO G  1 11  ? 25.815  94.625  85.452  1.00 94.60  ? 161  PRO E CG  1 
ATOM   4026  C CD  . PRO G  1 11  ? 25.381  94.201  86.846  1.00 94.60  ? 161  PRO E CD  1 
ATOM   4027  N N   . ARG G  1 12  ? 22.781  96.048  86.633  1.00 58.65  ? 162  ARG E N   1 
ATOM   4028  C CA  . ARG G  1 12  ? 21.342  96.170  86.317  1.00 58.65  ? 162  ARG E CA  1 
ATOM   4029  C C   . ARG G  1 12  ? 21.030  95.795  84.873  1.00 58.65  ? 162  ARG E C   1 
ATOM   4030  O O   . ARG G  1 12  ? 20.075  95.066  84.612  1.00 58.65  ? 162  ARG E O   1 
ATOM   4031  C CB  . ARG G  1 12  ? 20.825  97.593  86.571  1.00 58.65  ? 162  ARG E CB  1 
ATOM   4032  C CG  . ARG G  1 12  ? 20.898  98.025  88.011  1.00 58.65  ? 162  ARG E CG  1 
ATOM   4033  C CD  . ARG G  1 12  ? 19.541  98.439  88.536  1.00 58.65  ? 162  ARG E CD  1 
ATOM   4034  N NE  . ARG G  1 12  ? 19.628  98.884  89.924  1.00 58.65  ? 162  ARG E NE  1 
ATOM   4035  C CZ  . ARG G  1 12  ? 19.974  98.099  90.947  1.00 58.65  ? 162  ARG E CZ  1 
ATOM   4036  N NH1 . ARG G  1 12  ? 20.267  96.818  90.744  1.00 58.65  ? 162  ARG E NH1 1 
ATOM   4037  N NH2 . ARG G  1 12  ? 20.038  98.595  92.180  1.00 58.65  ? 162  ARG E NH2 1 
ATOM   4038  N N   . GLY G  1 13  ? 21.844  96.318  83.951  1.00 24.34  ? 163  GLY E N   1 
ATOM   4039  C CA  . GLY G  1 13  ? 21.693  96.067  82.528  1.00 24.34  ? 163  GLY E CA  1 
ATOM   4040  C C   . GLY G  1 13  ? 22.388  97.185  81.776  1.00 24.34  ? 163  GLY E C   1 
ATOM   4041  O O   . GLY G  1 13  ? 22.835  98.157  82.384  1.00 24.34  ? 163  GLY E O   1 
ATOM   4042  N N   . TYR G  1 14  ? 22.482  97.066  80.458  1.00 42.54  ? 164  TYR E N   1 
ATOM   4043  C CA  . TYR G  1 14  ? 23.130  98.098  79.661  1.00 42.54  ? 164  TYR E CA  1 
ATOM   4044  C C   . TYR G  1 14  ? 22.180  99.214  79.332  1.00 42.54  ? 164  TYR E C   1 
ATOM   4045  O O   . TYR G  1 14  ? 20.970  99.023  79.313  1.00 42.54  ? 164  TYR E O   1 
ATOM   4046  C CB  . TYR G  1 14  ? 23.651  97.505  78.370  1.00 42.54  ? 164  TYR E CB  1 
ATOM   4047  C CG  . TYR G  1 14  ? 24.810  96.575  78.603  1.00 42.54  ? 164  TYR E CG  1 
ATOM   4048  C CD1 . TYR G  1 14  ? 24.790  95.273  78.120  1.00 42.54  ? 164  TYR E CD1 1 
ATOM   4049  C CD2 . TYR G  1 14  ? 25.926  96.993  79.322  1.00 42.54  ? 164  TYR E CD2 1 
ATOM   4050  C CE1 . TYR G  1 14  ? 25.850  94.407  78.345  1.00 42.54  ? 164  TYR E CE1 1 
ATOM   4051  C CE2 . TYR G  1 14  ? 26.991  96.137  79.553  1.00 42.54  ? 164  TYR E CE2 1 
ATOM   4052  C CZ  . TYR G  1 14  ? 26.949  94.845  79.061  1.00 42.54  ? 164  TYR E CZ  1 
ATOM   4053  O OH  . TYR G  1 14  ? 28.011  94.001  79.277  1.00 42.54  ? 164  TYR E OH  1 
ATOM   4054  N N   . CYS G  1 15  ? 22.718  100.394 79.080  1.00 41.97  ? 165  CYS E N   1 
ATOM   4055  C CA  . CYS G  1 15  ? 21.867  101.508 78.734  1.00 41.97  ? 165  CYS E CA  1 
ATOM   4056  C C   . CYS G  1 15  ? 22.465  102.178 77.513  1.00 41.97  ? 165  CYS E C   1 
ATOM   4057  O O   . CYS G  1 15  ? 23.338  103.023 77.635  1.00 41.97  ? 165  CYS E O   1 
ATOM   4058  C CB  . CYS G  1 15  ? 21.777  102.483 79.902  1.00 41.97  ? 165  CYS E CB  1 
ATOM   4059  S SG  . CYS G  1 15  ? 20.884  103.993 79.500  1.00 41.97  ? 165  CYS E SG  1 
ATOM   4060  N N   . LEU G  1 16  ? 22.010  101.774 76.330  1.00 37.81  ? 166  LEU E N   1 
ATOM   4061  C CA  . LEU G  1 16  ? 22.508  102.344 75.083  1.00 37.81  ? 166  LEU E CA  1 
ATOM   4062  C C   . LEU G  1 16  ? 22.096  103.777 74.917  1.00 37.81  ? 166  LEU E C   1 
ATOM   4063  O O   . LEU G  1 16  ? 21.032  104.195 75.376  1.00 37.81  ? 166  LEU E O   1 
ATOM   4064  C CB  . LEU G  1 16  ? 21.963  101.602 73.886  1.00 37.81  ? 166  LEU E CB  1 
ATOM   4065  C CG  . LEU G  1 16  ? 22.405  100.171 73.774  1.00 37.81  ? 166  LEU E CG  1 
ATOM   4066  C CD1 . LEU G  1 16  ? 22.491  99.803  72.321  1.00 37.81  ? 166  LEU E CD1 1 
ATOM   4067  C CD2 . LEU G  1 16  ? 23.730  100.023 74.469  1.00 37.81  ? 166  LEU E CD2 1 
ATOM   4068  N N   . ILE G  1 17  ? 22.939  104.530 74.237  1.00 25.85  ? 167  ILE E N   1 
ATOM   4069  C CA  . ILE G  1 17  ? 22.626  105.905 73.985  1.00 25.85  ? 167  ILE E CA  1 
ATOM   4070  C C   . ILE G  1 17  ? 23.095  106.215 72.582  1.00 25.85  ? 167  ILE E C   1 
ATOM   4071  O O   . ILE G  1 17  ? 24.252  106.580 72.390  1.00 25.85  ? 167  ILE E O   1 
ATOM   4072  C CB  . ILE G  1 17  ? 23.345  106.818 74.954  1.00 25.85  ? 167  ILE E CB  1 
ATOM   4073  C CG1 . ILE G  1 17  ? 22.914  106.507 76.380  1.00 25.85  ? 167  ILE E CG1 1 
ATOM   4074  C CG2 . ILE G  1 17  ? 23.017  108.254 74.627  1.00 25.85  ? 167  ILE E CG2 1 
ATOM   4075  C CD1 . ILE G  1 17  ? 23.330  107.561 77.399  1.00 25.85  ? 167  ILE E CD1 1 
ATOM   4076  N N   . ILE G  1 18  ? 22.227  106.032 71.594  1.00 23.63  ? 168  ILE E N   1 
ATOM   4077  C CA  . ILE G  1 18  ? 22.617  106.340 70.234  1.00 23.63  ? 168  ILE E CA  1 
ATOM   4078  C C   . ILE G  1 18  ? 22.264  107.781 70.089  1.00 23.63  ? 168  ILE E C   1 
ATOM   4079  O O   . ILE G  1 18  ? 21.084  108.133 70.037  1.00 23.63  ? 168  ILE E O   1 
ATOM   4080  C CB  . ILE G  1 18  ? 21.841  105.542 69.207  1.00 23.63  ? 168  ILE E CB  1 
ATOM   4081  C CG1 . ILE G  1 18  ? 22.365  104.101 69.199  1.00 23.63  ? 168  ILE E CG1 1 
ATOM   4082  C CG2 . ILE G  1 18  ? 22.008  106.168 67.824  1.00 23.63  ? 168  ILE E CG2 1 
ATOM   4083  C CD1 . ILE G  1 18  ? 21.524  103.113 68.392  1.00 23.63  ? 168  ILE E CD1 1 
ATOM   4084  N N   . ASN G  1 19  ? 23.303  108.605 70.018  1.00 26.99  ? 169  ASN E N   1 
ATOM   4085  C CA  . ASN G  1 19  ? 23.166  110.045 69.938  1.00 26.99  ? 169  ASN E CA  1 
ATOM   4086  C C   . ASN G  1 19  ? 23.631  110.683 68.615  1.00 26.99  ? 169  ASN E C   1 
ATOM   4087  O O   . ASN G  1 19  ? 24.808  110.972 68.412  1.00 26.99  ? 169  ASN E O   1 
ATOM   4088  C CB  . ASN G  1 19  ? 23.925  110.639 71.115  1.00 26.99  ? 169  ASN E CB  1 
ATOM   4089  C CG  . ASN G  1 19  ? 24.112  112.099 70.985  1.00 26.99  ? 169  ASN E CG  1 
ATOM   4090  O OD1 . ASN G  1 19  ? 23.241  112.788 70.474  1.00 26.99  ? 169  ASN E OD1 1 
ATOM   4091  N ND2 . ASN G  1 19  ? 25.255  112.601 71.440  1.00 26.99  ? 169  ASN E ND2 1 
ATOM   4092  N N   . ASN G  1 20  ? 22.691  110.917 67.718  1.00 37.05  ? 170  ASN E N   1 
ATOM   4093  C CA  . ASN G  1 20  ? 23.004  111.519 66.435  1.00 37.05  ? 170  ASN E CA  1 
ATOM   4094  C C   . ASN G  1 20  ? 23.004  113.055 66.464  1.00 37.05  ? 170  ASN E C   1 
ATOM   4095  O O   . ASN G  1 20  ? 22.069  113.682 66.961  1.00 37.05  ? 170  ASN E O   1 
ATOM   4096  C CB  . ASN G  1 20  ? 22.008  111.016 65.389  1.00 37.05  ? 170  ASN E CB  1 
ATOM   4097  C CG  . ASN G  1 20  ? 22.191  109.541 65.082  1.00 37.05  ? 170  ASN E CG  1 
ATOM   4098  O OD1 . ASN G  1 20  ? 23.164  108.932 65.517  1.00 37.05  ? 170  ASN E OD1 1 
ATOM   4099  N ND2 . ASN G  1 20  ? 21.258  108.961 64.335  1.00 37.05  ? 170  ASN E ND2 1 
ATOM   4100  N N   . HIS G  1 21  ? 24.055  113.658 65.918  1.00 56.96  ? 171  HIS E N   1 
ATOM   4101  C CA  . HIS G  1 21  ? 24.166  115.115 65.886  1.00 56.96  ? 171  HIS E CA  1 
ATOM   4102  C C   . HIS G  1 21  ? 24.599  115.630 64.509  1.00 56.96  ? 171  HIS E C   1 
ATOM   4103  O O   . HIS G  1 21  ? 24.013  116.569 63.969  1.00 56.96  ? 171  HIS E O   1 
ATOM   4104  C CB  . HIS G  1 21  ? 25.161  115.587 66.958  1.00 56.96  ? 171  HIS E CB  1 
ATOM   4105  C CG  . HIS G  1 21  ? 25.529  117.039 66.859  1.00 56.96  ? 171  HIS E CG  1 
ATOM   4106  N ND1 . HIS G  1 21  ? 25.354  117.923 67.905  1.00 56.96  ? 171  HIS E ND1 1 
ATOM   4107  C CD2 . HIS G  1 21  ? 26.065  117.761 65.844  1.00 56.96  ? 171  HIS E CD2 1 
ATOM   4108  C CE1 . HIS G  1 21  ? 25.763  119.124 67.536  1.00 56.96  ? 171  HIS E CE1 1 
ATOM   4109  N NE2 . HIS G  1 21  ? 26.199  119.053 66.290  1.00 56.96  ? 171  HIS E NE2 1 
ATOM   4110  N N   . ASN G  1 22  ? 25.625  115.017 63.937  1.00 50.43  ? 172  ASN E N   1 
ATOM   4111  C CA  . ASN G  1 22  ? 26.107  115.467 62.648  1.00 50.43  ? 172  ASN E CA  1 
ATOM   4112  C C   . ASN G  1 22  ? 25.331  114.877 61.504  1.00 50.43  ? 172  ASN E C   1 
ATOM   4113  O O   . ASN G  1 22  ? 25.581  113.750 61.099  1.00 50.43  ? 172  ASN E O   1 
ATOM   4114  C CB  . ASN G  1 22  ? 27.577  115.122 62.468  1.00 50.43  ? 172  ASN E CB  1 
ATOM   4115  C CG  . ASN G  1 22  ? 28.141  115.699 61.189  1.00 50.43  ? 172  ASN E CG  1 
ATOM   4116  O OD1 . ASN G  1 22  ? 27.399  116.094 60.285  1.00 50.43  ? 172  ASN E OD1 1 
ATOM   4117  N ND2 . ASN G  1 22  ? 29.455  115.758 61.104  1.00 50.43  ? 172  ASN E ND2 1 
ATOM   4118  N N   . PHE G  1 23  ? 24.407  115.647 60.952  1.00 42.07  ? 173  PHE E N   1 
ATOM   4119  C CA  . PHE G  1 23  ? 23.626  115.126 59.847  1.00 42.07  ? 173  PHE E CA  1 
ATOM   4120  C C   . PHE G  1 23  ? 24.115  115.591 58.464  1.00 42.07  ? 173  PHE E C   1 
ATOM   4121  O O   . PHE G  1 23  ? 23.339  115.726 57.519  1.00 42.07  ? 173  PHE E O   1 
ATOM   4122  C CB  . PHE G  1 23  ? 22.129  115.436 60.076  1.00 42.07  ? 173  PHE E CB  1 
ATOM   4123  C CG  . PHE G  1 23  ? 21.462  114.494 61.070  1.00 42.07  ? 173  PHE E CG  1 
ATOM   4124  C CD1 . PHE G  1 23  ? 21.686  114.630 62.438  1.00 42.07  ? 173  PHE E CD1 1 
ATOM   4125  C CD2 . PHE G  1 23  ? 20.648  113.451 60.633  1.00 42.07  ? 173  PHE E CD2 1 
ATOM   4126  C CE1 . PHE G  1 23  ? 21.112  113.745 63.359  1.00 42.07  ? 173  PHE E CE1 1 
ATOM   4127  C CE2 . PHE G  1 23  ? 20.069  112.558 61.539  1.00 42.07  ? 173  PHE E CE2 1 
ATOM   4128  C CZ  . PHE G  1 23  ? 20.302  112.707 62.903  1.00 42.07  ? 173  PHE E CZ  1 
ATOM   4129  N N   . ALA G  1 24  ? 25.422  115.793 58.350  1.00 29.82  ? 174  ALA E N   1 
ATOM   4130  C CA  . ALA G  1 24  ? 26.038  116.213 57.094  1.00 29.82  ? 174  ALA E CA  1 
ATOM   4131  C C   . ALA G  1 24  ? 25.927  115.165 55.974  1.00 29.82  ? 174  ALA E C   1 
ATOM   4132  O O   . ALA G  1 24  ? 25.759  115.512 54.797  1.00 29.82  ? 174  ALA E O   1 
ATOM   4133  C CB  . ALA G  1 24  ? 27.505  116.550 57.328  1.00 29.82  ? 174  ALA E CB  1 
ATOM   4134  N N   . LYS G  1 25  ? 26.042  113.890 56.331  1.00 59.26  ? 175  LYS E N   1 
ATOM   4135  C CA  . LYS G  1 25  ? 25.953  112.836 55.336  1.00 59.26  ? 175  LYS E CA  1 
ATOM   4136  C C   . LYS G  1 25  ? 24.585  112.923 54.707  1.00 59.26  ? 175  LYS E C   1 
ATOM   4137  O O   . LYS G  1 25  ? 24.465  112.999 53.483  1.00 59.26  ? 175  LYS E O   1 
ATOM   4138  C CB  . LYS G  1 25  ? 26.137  111.469 55.977  1.00 59.26  ? 175  LYS E CB  1 
ATOM   4139  C CG  . LYS G  1 25  ? 27.512  110.868 55.754  1.00 59.26  ? 175  LYS E CG  1 
ATOM   4140  C CD  . LYS G  1 25  ? 27.768  110.547 54.283  1.00 59.26  ? 175  LYS E CD  1 
ATOM   4141  C CE  . LYS G  1 25  ? 29.245  110.229 54.046  1.00 59.26  ? 175  LYS E CE  1 
ATOM   4142  N NZ  . LYS G  1 25  ? 29.796  110.867 52.808  1.00 59.26  ? 175  LYS E NZ  1 
ATOM   4143  N N   . ALA G  1 26  A 23.559  112.924 55.559  1.00 32.05  ? 175  ALA E N   1 
ATOM   4144  C CA  . ALA G  1 26  A 22.168  113.014 55.122  1.00 32.05  ? 175  ALA E CA  1 
ATOM   4145  C C   . ALA G  1 26  A 22.067  114.133 54.103  1.00 32.05  ? 175  ALA E C   1 
ATOM   4146  O O   . ALA G  1 26  A 21.605  113.924 52.975  1.00 32.05  ? 175  ALA E O   1 
ATOM   4147  C CB  . ALA G  1 26  A 21.281  113.311 56.308  1.00 32.05  ? 175  ALA E CB  1 
ATOM   4148  N N   . ARG G  1 27  B 22.523  115.319 54.513  1.00 40.78  ? 175  ARG E N   1 
ATOM   4149  C CA  . ARG G  1 27  B 22.509  116.515 53.664  1.00 40.78  ? 175  ARG E CA  1 
ATOM   4150  C C   . ARG G  1 27  B 23.122  116.208 52.311  1.00 40.78  ? 175  ARG E C   1 
ATOM   4151  O O   . ARG G  1 27  B 22.560  116.561 51.274  1.00 40.78  ? 175  ARG E O   1 
ATOM   4152  C CB  . ARG G  1 27  B 23.296  117.649 54.322  1.00 40.78  ? 175  ARG E CB  1 
ATOM   4153  C CG  . ARG G  1 27  B 22.442  118.791 54.849  1.00 40.78  ? 175  ARG E CG  1 
ATOM   4154  C CD  . ARG G  1 27  B 23.235  119.699 55.778  1.00 40.78  ? 175  ARG E CD  1 
ATOM   4155  N NE  . ARG G  1 27  B 22.963  119.388 57.174  1.00 40.78  ? 175  ARG E NE  1 
ATOM   4156  C CZ  . ARG G  1 27  B 23.892  119.315 58.122  1.00 40.78  ? 175  ARG E CZ  1 
ATOM   4157  N NH1 . ARG G  1 27  B 25.164  119.531 57.828  1.00 40.78  ? 175  ARG E NH1 1 
ATOM   4158  N NH2 . ARG G  1 27  B 23.545  119.014 59.368  1.00 40.78  ? 175  ARG E NH2 1 
ATOM   4159  N N   . GLU G  1 28  C 24.270  115.537 52.340  1.00 59.01  ? 175  GLU E N   1 
ATOM   4160  C CA  . GLU G  1 28  C 24.999  115.153 51.141  1.00 59.01  ? 175  GLU E CA  1 
ATOM   4161  C C   . GLU G  1 28  C 24.235  114.215 50.221  1.00 59.01  ? 175  GLU E C   1 
ATOM   4162  O O   . GLU G  1 28  C 24.174  114.451 49.022  1.00 59.01  ? 175  GLU E O   1 
ATOM   4163  C CB  . GLU G  1 28  C 26.306  114.490 51.524  1.00 59.01  ? 175  GLU E CB  1 
ATOM   4164  C CG  . GLU G  1 28  C 27.529  115.321 51.236  1.00 59.01  ? 175  GLU E CG  1 
ATOM   4165  C CD  . GLU G  1 28  C 28.812  114.590 51.604  1.00 59.01  ? 175  GLU E CD  1 
ATOM   4166  O OE1 . GLU G  1 28  C 29.196  113.665 50.846  1.00 59.01  ? 175  GLU E OE1 1 
ATOM   4167  O OE2 . GLU G  1 28  C 29.430  114.934 52.648  1.00 59.01  ? 175  GLU E OE2 1 
ATOM   4168  N N   . LYS G  1 29  D 23.664  113.150 50.773  1.00 85.56  ? 175  LYS E N   1 
ATOM   4169  C CA  . LYS G  1 29  D 22.912  112.177 49.978  1.00 85.56  ? 175  LYS E CA  1 
ATOM   4170  C C   . LYS G  1 29  D 21.437  112.545 49.785  1.00 85.56  ? 175  LYS E C   1 
ATOM   4171  O O   . LYS G  1 29  D 21.082  113.288 48.874  1.00 85.56  ? 175  LYS E O   1 
ATOM   4172  C CB  . LYS G  1 29  D 23.017  110.804 50.633  1.00 85.56  ? 175  LYS E CB  1 
ATOM   4173  C CG  . LYS G  1 29  D 24.422  110.457 51.058  1.00 85.56  ? 175  LYS E CG  1 
ATOM   4174  C CD  . LYS G  1 29  D 25.355  110.613 49.877  1.00 85.56  ? 175  LYS E CD  1 
ATOM   4175  C CE  . LYS G  1 29  D 26.549  109.673 49.960  1.00 85.56  ? 175  LYS E CE  1 
ATOM   4176  N NZ  . LYS G  1 29  D 26.957  109.209 48.597  1.00 85.56  ? 175  LYS E NZ  1 
ATOM   4177  N N   . VAL G  1 30  E 20.577  112.014 50.643  1.00 64.34  ? 175  VAL E N   1 
ATOM   4178  C CA  . VAL G  1 30  E 19.157  112.292 50.545  1.00 64.34  ? 175  VAL E CA  1 
ATOM   4179  C C   . VAL G  1 30  E 18.902  113.740 50.087  1.00 64.34  ? 175  VAL E C   1 
ATOM   4180  O O   . VAL G  1 30  E 19.411  114.691 50.681  1.00 64.34  ? 175  VAL E O   1 
ATOM   4181  C CB  . VAL G  1 30  E 18.457  112.013 51.906  1.00 64.34  ? 175  VAL E CB  1 
ATOM   4182  C CG1 . VAL G  1 30  E 16.954  112.141 51.767  1.00 64.34  ? 175  VAL E CG1 1 
ATOM   4183  C CG2 . VAL G  1 30  E 18.792  110.610 52.372  1.00 64.34  ? 175  VAL E CG2 1 
ATOM   4184  N N   . PRO G  1 31  F 18.125  113.912 48.997  1.00 75.09  ? 175  PRO E N   1 
ATOM   4185  C CA  . PRO G  1 31  F 17.792  115.227 48.448  1.00 75.09  ? 175  PRO E CA  1 
ATOM   4186  C C   . PRO G  1 31  F 16.837  115.965 49.371  1.00 75.09  ? 175  PRO E C   1 
ATOM   4187  O O   . PRO G  1 31  F 17.207  116.954 49.992  1.00 75.09  ? 175  PRO E O   1 
ATOM   4188  C CB  . PRO G  1 31  F 17.129  114.898 47.119  1.00 75.09  ? 175  PRO E CB  1 
ATOM   4189  C CG  . PRO G  1 31  F 16.485  113.583 47.359  1.00 75.09  ? 175  PRO E CG  1 
ATOM   4190  C CD  . PRO G  1 31  F 17.489  112.838 48.211  1.00 75.09  ? 175  PRO E CD  1 
ATOM   4191  N N   . LYS G  1 32  G 15.607  115.474 49.462  1.00 67.36  ? 175  LYS E N   1 
ATOM   4192  C CA  . LYS G  1 32  G 14.599  116.098 50.312  1.00 67.36  ? 175  LYS E CA  1 
ATOM   4193  C C   . LYS G  1 32  G 15.121  116.491 51.708  1.00 67.36  ? 175  LYS E C   1 
ATOM   4194  O O   . LYS G  1 32  G 14.462  117.240 52.438  1.00 67.36  ? 175  LYS E O   1 
ATOM   4195  C CB  . LYS G  1 32  G 13.384  115.161 50.440  1.00 67.36  ? 175  LYS E CB  1 
ATOM   4196  C CG  . LYS G  1 32  G 13.524  114.017 51.461  1.00 67.36  ? 175  LYS E CG  1 
ATOM   4197  C CD  . LYS G  1 32  G 12.302  113.932 52.392  1.00 67.36  ? 175  LYS E CD  1 
ATOM   4198  C CE  . LYS G  1 32  G 12.047  112.507 52.861  1.00 67.36  ? 175  LYS E CE  1 
ATOM   4199  N NZ  . LYS G  1 32  G 10.772  111.954 52.337  1.00 67.36  ? 175  LYS E NZ  1 
ATOM   4200  N N   . LEU G  1 33  H 16.309  116.001 52.062  1.00 50.37  ? 175  LEU E N   1 
ATOM   4201  C CA  . LEU G  1 33  H 16.909  116.271 53.364  1.00 50.37  ? 175  LEU E CA  1 
ATOM   4202  C C   . LEU G  1 33  H 17.951  117.359 53.274  1.00 50.37  ? 175  LEU E C   1 
ATOM   4203  O O   . LEU G  1 33  H 18.605  117.713 54.251  1.00 50.37  ? 175  LEU E O   1 
ATOM   4204  C CB  . LEU G  1 33  H 17.557  114.997 53.905  1.00 50.37  ? 175  LEU E CB  1 
ATOM   4205  C CG  . LEU G  1 33  H 16.599  113.926 54.414  1.00 50.37  ? 175  LEU E CG  1 
ATOM   4206  C CD1 . LEU G  1 33  H 17.295  113.121 55.492  1.00 50.37  ? 175  LEU E CD1 1 
ATOM   4207  C CD2 . LEU G  1 33  H 15.327  114.571 54.945  1.00 50.37  ? 175  LEU E CD2 1 
ATOM   4208  N N   . HIS G  1 34  I 18.104  117.888 52.082  1.00 99.09  ? 175  HIS E N   1 
ATOM   4209  C CA  . HIS G  1 34  I 19.075  118.922 51.864  1.00 99.09  ? 175  HIS E CA  1 
ATOM   4210  C C   . HIS G  1 34  I 19.200  119.924 53.012  1.00 99.09  ? 175  HIS E C   1 
ATOM   4211  O O   . HIS G  1 34  I 20.276  120.482 53.227  1.00 99.09  ? 175  HIS E O   1 
ATOM   4212  C CB  . HIS G  1 34  I 18.737  119.674 50.588  1.00 99.09  ? 175  HIS E CB  1 
ATOM   4213  C CG  . HIS G  1 34  I 19.629  120.843 50.347  1.00 99.09  ? 175  HIS E CG  1 
ATOM   4214  N ND1 . HIS G  1 34  I 19.150  122.097 50.040  1.00 99.09  ? 175  HIS E ND1 1 
ATOM   4215  C CD2 . HIS G  1 34  I 20.977  120.961 50.433  1.00 99.09  ? 175  HIS E CD2 1 
ATOM   4216  C CE1 . HIS G  1 34  I 20.165  122.940 49.948  1.00 99.09  ? 175  HIS E CE1 1 
ATOM   4217  N NE2 . HIS G  1 34  I 21.283  122.277 50.184  1.00 99.09  ? 175  HIS E NE2 1 
ATOM   4218  N N   . SER G  1 35  J 18.125  120.142 53.765  1.00 55.69  ? 175  SER E N   1 
ATOM   4219  C CA  . SER G  1 35  J 18.185  121.138 54.835  1.00 55.69  ? 175  SER E CA  1 
ATOM   4220  C C   . SER G  1 35  J 18.147  120.719 56.300  1.00 55.69  ? 175  SER E C   1 
ATOM   4221  O O   . SER G  1 35  J 18.034  121.585 57.171  1.00 55.69  ? 175  SER E O   1 
ATOM   4222  C CB  . SER G  1 35  J 17.095  122.187 54.617  1.00 55.69  ? 175  SER E CB  1 
ATOM   4223  O OG  . SER G  1 35  J 15.926  121.848 55.339  1.00 55.69  ? 175  SER E OG  1 
ATOM   4224  N N   . ILE G  1 36  ? 18.251  119.425 56.590  1.00 54.45  ? 176  ILE E N   1 
ATOM   4225  C CA  . ILE G  1 36  ? 18.219  118.985 57.987  1.00 54.45  ? 176  ILE E CA  1 
ATOM   4226  C C   . ILE G  1 36  ? 19.335  119.596 58.803  1.00 54.45  ? 176  ILE E C   1 
ATOM   4227  O O   . ILE G  1 36  ? 20.509  119.495 58.464  1.00 54.45  ? 176  ILE E O   1 
ATOM   4228  C CB  . ILE G  1 36  ? 18.351  117.460 58.150  1.00 54.45  ? 176  ILE E CB  1 
ATOM   4229  C CG1 . ILE G  1 36  ? 18.816  116.833 56.842  1.00 54.45  ? 176  ILE E CG1 1 
ATOM   4230  C CG2 . ILE G  1 36  ? 17.034  116.876 58.633  1.00 54.45  ? 176  ILE E CG2 1 
ATOM   4231  C CD1 . ILE G  1 36  ? 20.239  117.166 56.506  1.00 54.45  ? 176  ILE E CD1 1 
ATOM   4232  N N   . ARG G  1 37  ? 18.950  120.216 59.900  1.00 65.37  ? 177  ARG E N   1 
ATOM   4233  C CA  . ARG G  1 37  ? 19.911  120.846 60.770  1.00 65.37  ? 177  ARG E CA  1 
ATOM   4234  C C   . ARG G  1 37  ? 20.592  119.847 61.713  1.00 65.37  ? 177  ARG E C   1 
ATOM   4235  O O   . ARG G  1 37  ? 20.005  118.843 62.120  1.00 65.37  ? 177  ARG E O   1 
ATOM   4236  C CB  . ARG G  1 37  ? 19.212  121.931 61.593  1.00 65.37  ? 177  ARG E CB  1 
ATOM   4237  C CG  . ARG G  1 37  ? 18.954  123.230 60.857  1.00 65.37  ? 177  ARG E CG  1 
ATOM   4238  C CD  . ARG G  1 37  ? 18.895  124.376 61.852  1.00 65.37  ? 177  ARG E CD  1 
ATOM   4239  N NE  . ARG G  1 37  ? 18.978  125.680 61.200  1.00 65.37  ? 177  ARG E NE  1 
ATOM   4240  C CZ  . ARG G  1 37  ? 18.254  126.743 61.547  1.00 65.37  ? 177  ARG E CZ  1 
ATOM   4241  N NH1 . ARG G  1 37  ? 17.379  126.670 62.553  1.00 65.37  ? 177  ARG E NH1 1 
ATOM   4242  N NH2 . ARG G  1 37  ? 18.405  127.883 60.877  1.00 65.37  ? 177  ARG E NH2 1 
ATOM   4243  N N   . ASP G  1 38  ? 21.842  120.126 62.052  1.00 45.75  ? 178  ASP E N   1 
ATOM   4244  C CA  . ASP G  1 38  ? 22.559  119.287 62.984  1.00 45.75  ? 178  ASP E CA  1 
ATOM   4245  C C   . ASP G  1 38  ? 21.856  119.499 64.326  1.00 45.75  ? 178  ASP E C   1 
ATOM   4246  O O   . ASP G  1 38  ? 21.563  120.632 64.718  1.00 45.75  ? 178  ASP E O   1 
ATOM   4247  C CB  . ASP G  1 38  ? 24.022  119.723 63.063  1.00 45.75  ? 178  ASP E CB  1 
ATOM   4248  C CG  . ASP G  1 38  ? 24.816  119.292 61.850  1.00 45.75  ? 178  ASP E CG  1 
ATOM   4249  O OD1 . ASP G  1 38  ? 24.557  118.178 61.341  1.00 45.75  ? 178  ASP E OD1 1 
ATOM   4250  O OD2 . ASP G  1 38  ? 25.694  120.061 61.406  1.00 45.75  ? 178  ASP E OD2 1 
ATOM   4251  N N   . ARG G  1 39  ? 21.597  118.408 65.034  1.00 37.69  ? 179  ARG E N   1 
ATOM   4252  C CA  . ARG G  1 39  ? 20.890  118.464 66.310  1.00 37.69  ? 179  ARG E CA  1 
ATOM   4253  C C   . ARG G  1 39  ? 21.629  119.080 67.506  1.00 37.69  ? 179  ARG E C   1 
ATOM   4254  O O   . ARG G  1 39  ? 21.923  118.406 68.494  1.00 37.69  ? 179  ARG E O   1 
ATOM   4255  C CB  . ARG G  1 39  ? 20.379  117.056 66.663  1.00 37.69  ? 179  ARG E CB  1 
ATOM   4256  C CG  . ARG G  1 39  ? 19.598  116.386 65.518  1.00 37.69  ? 179  ARG E CG  1 
ATOM   4257  C CD  . ARG G  1 39  ? 18.958  115.054 65.937  1.00 37.69  ? 179  ARG E CD  1 
ATOM   4258  N NE  . ARG G  1 39  ? 18.228  115.162 67.200  1.00 37.69  ? 179  ARG E NE  1 
ATOM   4259  C CZ  . ARG G  1 39  ? 18.773  114.952 68.396  1.00 37.69  ? 179  ARG E CZ  1 
ATOM   4260  N NH1 . ARG G  1 39  ? 20.051  114.619 68.487  1.00 37.69  ? 179  ARG E NH1 1 
ATOM   4261  N NH2 . ARG G  1 39  ? 18.058  115.092 69.502  1.00 37.69  ? 179  ARG E NH2 1 
ATOM   4262  N N   . ASN G  1 40  ? 21.897  120.375 67.429  1.00 60.80  ? 180  ASN E N   1 
ATOM   4263  C CA  . ASN G  1 40  ? 22.581  121.038 68.523  1.00 60.80  ? 180  ASN E CA  1 
ATOM   4264  C C   . ASN G  1 40  ? 21.766  120.907 69.790  1.00 60.80  ? 180  ASN E C   1 
ATOM   4265  O O   . ASN G  1 40  ? 20.558  121.115 69.788  1.00 60.80  ? 180  ASN E O   1 
ATOM   4266  C CB  . ASN G  1 40  ? 22.793  122.507 68.203  1.00 60.80  ? 180  ASN E CB  1 
ATOM   4267  C CG  . ASN G  1 40  ? 23.662  122.710 66.986  1.00 60.80  ? 180  ASN E CG  1 
ATOM   4268  O OD1 . ASN G  1 40  ? 23.187  123.142 65.942  1.00 60.80  ? 180  ASN E OD1 1 
ATOM   4269  N ND2 . ASN G  1 40  ? 24.944  122.396 67.113  1.00 60.80  ? 180  ASN E ND2 1 
ATOM   4270  N N   . GLY G  1 41  ? 22.439  120.566 70.875  1.00 27.34  ? 181  GLY E N   1 
ATOM   4271  C CA  . GLY G  1 41  ? 21.760  120.398 72.143  1.00 27.34  ? 181  GLY E CA  1 
ATOM   4272  C C   . GLY G  1 41  ? 21.818  118.959 72.619  1.00 27.34  ? 181  GLY E C   1 
ATOM   4273  O O   . GLY G  1 41  ? 21.821  118.714 73.823  1.00 27.34  ? 181  GLY E O   1 
ATOM   4274  N N   . THR G  1 42  ? 21.891  118.006 71.692  1.00 33.47  ? 182  THR E N   1 
ATOM   4275  C CA  . THR G  1 42  ? 21.925  116.615 72.099  1.00 33.47  ? 182  THR E CA  1 
ATOM   4276  C C   . THR G  1 42  ? 22.959  116.336 73.160  1.00 33.47  ? 182  THR E C   1 
ATOM   4277  O O   . THR G  1 42  ? 22.633  115.680 74.154  1.00 33.47  ? 182  THR E O   1 
ATOM   4278  C CB  . THR G  1 42  ? 22.196  115.640 70.955  1.00 33.47  ? 182  THR E CB  1 
ATOM   4279  O OG1 . THR G  1 42  ? 22.164  116.323 69.706  1.00 33.47  ? 182  THR E OG1 1 
ATOM   4280  C CG2 . THR G  1 42  ? 21.145  114.553 70.969  1.00 33.47  ? 182  THR E CG2 1 
ATOM   4281  N N   . HIS G  1 43  ? 24.195  116.813 72.966  1.00 57.75  ? 183  HIS E N   1 
ATOM   4282  C CA  . HIS G  1 43  ? 25.255  116.565 73.948  1.00 57.75  ? 183  HIS E CA  1 
ATOM   4283  C C   . HIS G  1 43  ? 24.619  116.563 75.316  1.00 57.75  ? 183  HIS E C   1 
ATOM   4284  O O   . HIS G  1 43  ? 24.761  115.609 76.070  1.00 57.75  ? 183  HIS E O   1 
ATOM   4285  C CB  . HIS G  1 43  ? 26.343  117.641 73.922  1.00 57.75  ? 183  HIS E CB  1 
ATOM   4286  C CG  . HIS G  1 43  ? 26.010  118.829 73.080  1.00 57.75  ? 183  HIS E CG  1 
ATOM   4287  N ND1 . HIS G  1 43  ? 25.691  118.729 71.740  1.00 57.75  ? 183  HIS E ND1 1 
ATOM   4288  C CD2 . HIS G  1 43  ? 25.989  120.152 73.375  1.00 57.75  ? 183  HIS E CD2 1 
ATOM   4289  C CE1 . HIS G  1 43  ? 25.490  119.940 71.246  1.00 57.75  ? 183  HIS E CE1 1 
ATOM   4290  N NE2 . HIS G  1 43  ? 25.665  120.821 72.219  1.00 57.75  ? 183  HIS E NE2 1 
ATOM   4291  N N   . LEU G  1 44  ? 23.880  117.629 75.601  1.00 36.19  ? 184  LEU E N   1 
ATOM   4292  C CA  . LEU G  1 44  ? 23.193  117.797 76.873  1.00 36.19  ? 184  LEU E CA  1 
ATOM   4293  C C   . LEU G  1 44  ? 22.258  116.630 77.207  1.00 36.19  ? 184  LEU E C   1 
ATOM   4294  O O   . LEU G  1 44  ? 22.209  116.167 78.356  1.00 36.19  ? 184  LEU E O   1 
ATOM   4295  C CB  . LEU G  1 44  ? 22.411  119.115 76.863  1.00 36.19  ? 184  LEU E CB  1 
ATOM   4296  C CG  . LEU G  1 44  ? 23.205  120.397 77.170  1.00 36.19  ? 184  LEU E CG  1 
ATOM   4297  C CD1 . LEU G  1 44  ? 24.593  120.338 76.579  1.00 36.19  ? 184  LEU E CD1 1 
ATOM   4298  C CD2 . LEU G  1 44  ? 22.495  121.575 76.579  1.00 36.19  ? 184  LEU E CD2 1 
ATOM   4299  N N   . ASP G  1 45  ? 21.517  116.160 76.205  1.00 39.27  ? 185  ASP E N   1 
ATOM   4300  C CA  . ASP G  1 45  ? 20.581  115.051 76.369  1.00 39.27  ? 185  ASP E CA  1 
ATOM   4301  C C   . ASP G  1 45  ? 21.353  113.791 76.785  1.00 39.27  ? 185  ASP E C   1 
ATOM   4302  O O   . ASP G  1 45  ? 20.969  113.077 77.723  1.00 39.27  ? 185  ASP E O   1 
ATOM   4303  C CB  . ASP G  1 45  ? 19.852  114.803 75.041  1.00 39.27  ? 185  ASP E CB  1 
ATOM   4304  C CG  . ASP G  1 45  ? 18.649  115.732 74.829  1.00 39.27  ? 185  ASP E CG  1 
ATOM   4305  O OD1 . ASP G  1 45  ? 18.332  116.539 75.737  1.00 39.27  ? 185  ASP E OD1 1 
ATOM   4306  O OD2 . ASP G  1 45  ? 18.025  115.640 73.739  1.00 39.27  ? 185  ASP E OD2 1 
ATOM   4307  N N   . ALA G  1 46  ? 22.452  113.528 76.076  1.00 33.17  ? 186  ALA E N   1 
ATOM   4308  C CA  . ALA G  1 46  ? 23.299  112.366 76.344  1.00 33.17  ? 186  ALA E CA  1 
ATOM   4309  C C   . ALA G  1 46  ? 23.893  112.434 77.754  1.00 33.17  ? 186  ALA E C   1 
ATOM   4310  O O   . ALA G  1 46  ? 23.868  111.456 78.503  1.00 33.17  ? 186  ALA E O   1 
ATOM   4311  C CB  . ALA G  1 46  ? 24.400  112.293 75.315  1.00 33.17  ? 186  ALA E CB  1 
ATOM   4312  N N   . GLY G  1 47  ? 24.419  113.601 78.114  1.00 31.20  ? 187  GLY E N   1 
ATOM   4313  C CA  . GLY G  1 47  ? 24.999  113.780 79.433  1.00 31.20  ? 187  GLY E CA  1 
ATOM   4314  C C   . GLY G  1 47  ? 23.974  113.480 80.510  1.00 31.20  ? 187  GLY E C   1 
ATOM   4315  O O   . GLY G  1 47  ? 24.184  112.609 81.363  1.00 31.20  ? 187  GLY E O   1 
ATOM   4316  N N   . ALA G  1 48  ? 22.853  114.195 80.463  1.00 35.66  ? 188  ALA E N   1 
ATOM   4317  C CA  . ALA G  1 48  ? 21.783  114.014 81.430  1.00 35.66  ? 188  ALA E CA  1 
ATOM   4318  C C   . ALA G  1 48  ? 21.388  112.545 81.547  1.00 35.66  ? 188  ALA E C   1 
ATOM   4319  O O   . ALA G  1 48  ? 21.216  112.034 82.652  1.00 35.66  ? 188  ALA E O   1 
ATOM   4320  C CB  . ALA G  1 48  ? 20.583  114.844 81.022  1.00 35.66  ? 188  ALA E CB  1 
ATOM   4321  N N   . LEU G  1 49  ? 21.239  111.870 80.407  1.00 38.67  ? 189  LEU E N   1 
ATOM   4322  C CA  . LEU G  1 49  ? 20.868  110.458 80.399  1.00 38.67  ? 189  LEU E CA  1 
ATOM   4323  C C   . LEU G  1 49  ? 21.974  109.664 81.087  1.00 38.67  ? 189  LEU E C   1 
ATOM   4324  O O   . LEU G  1 49  ? 21.727  108.888 82.022  1.00 38.67  ? 189  LEU E O   1 
ATOM   4325  C CB  . LEU G  1 49  ? 20.711  109.970 78.964  1.00 38.67  ? 189  LEU E CB  1 
ATOM   4326  C CG  . LEU G  1 49  ? 19.320  109.752 78.356  1.00 38.67  ? 189  LEU E CG  1 
ATOM   4327  C CD1 . LEU G  1 49  ? 18.246  110.105 79.341  1.00 38.67  ? 189  LEU E CD1 1 
ATOM   4328  C CD2 . LEU G  1 49  ? 19.189  110.602 77.099  1.00 38.67  ? 189  LEU E CD2 1 
ATOM   4329  N N   . THR G  1 50  ? 23.199  109.877 80.615  1.00 54.00  ? 190  THR E N   1 
ATOM   4330  C CA  . THR G  1 50  ? 24.364  109.205 81.159  1.00 54.00  ? 190  THR E CA  1 
ATOM   4331  C C   . THR G  1 50  ? 24.328  109.246 82.672  1.00 54.00  ? 190  THR E C   1 
ATOM   4332  O O   . THR G  1 50  ? 24.301  108.212 83.317  1.00 54.00  ? 190  THR E O   1 
ATOM   4333  C CB  . THR G  1 50  ? 25.673  109.863 80.679  1.00 54.00  ? 190  THR E CB  1 
ATOM   4334  O OG1 . THR G  1 50  ? 26.147  109.188 79.508  1.00 54.00  ? 190  THR E OG1 1 
ATOM   4335  C CG2 . THR G  1 50  ? 26.743  109.757 81.744  1.00 54.00  ? 190  THR E CG2 1 
ATOM   4336  N N   . THR G  1 51  ? 24.323  110.446 83.232  1.00 31.44  ? 191  THR E N   1 
ATOM   4337  C CA  . THR G  1 51  ? 24.300  110.621 84.673  1.00 31.44  ? 191  THR E CA  1 
ATOM   4338  C C   . THR G  1 51  ? 23.173  109.879 85.356  1.00 31.44  ? 191  THR E C   1 
ATOM   4339  O O   . THR G  1 51  ? 23.389  108.895 86.067  1.00 31.44  ? 191  THR E O   1 
ATOM   4340  C CB  . THR G  1 51  ? 24.111  112.085 85.068  1.00 31.44  ? 191  THR E CB  1 
ATOM   4341  O OG1 . THR G  1 51  ? 24.774  112.942 84.128  1.00 31.44  ? 191  THR E OG1 1 
ATOM   4342  C CG2 . THR G  1 51  ? 24.655  112.316 86.476  1.00 31.44  ? 191  THR E CG2 1 
ATOM   4343  N N   . THR G  1 52  ? 21.960  110.374 85.157  1.00 39.86  ? 192  THR E N   1 
ATOM   4344  C CA  . THR G  1 52  ? 20.775  109.782 85.772  1.00 39.86  ? 192  THR E CA  1 
ATOM   4345  C C   . THR G  1 52  ? 20.694  108.242 85.697  1.00 39.86  ? 192  THR E C   1 
ATOM   4346  O O   . THR G  1 52  ? 20.236  107.590 86.646  1.00 39.86  ? 192  THR E O   1 
ATOM   4347  C CB  . THR G  1 52  ? 19.520  110.394 85.165  1.00 39.86  ? 192  THR E CB  1 
ATOM   4348  O OG1 . THR G  1 52  ? 19.474  110.077 83.776  1.00 39.86  ? 192  THR E OG1 1 
ATOM   4349  C CG2 . THR G  1 52  ? 19.557  111.910 85.307  1.00 39.86  ? 192  THR E CG2 1 
ATOM   4350  N N   . PHE G  1 53  ? 21.137  107.647 84.589  1.00 43.28  ? 193  PHE E N   1 
ATOM   4351  C CA  . PHE G  1 53  ? 21.084  106.189 84.487  1.00 43.28  ? 193  PHE E CA  1 
ATOM   4352  C C   . PHE G  1 53  ? 22.304  105.520 85.113  1.00 43.28  ? 193  PHE E C   1 
ATOM   4353  O O   . PHE G  1 53  ? 22.263  104.328 85.471  1.00 43.28  ? 193  PHE E O   1 
ATOM   4354  C CB  . PHE G  1 53  ? 20.900  105.762 83.030  1.00 43.28  ? 193  PHE E CB  1 
ATOM   4355  C CG  . PHE G  1 53  ? 19.471  105.822 82.590  1.00 43.28  ? 193  PHE E CG  1 
ATOM   4356  C CD1 . PHE G  1 53  ? 19.037  106.813 81.716  1.00 43.28  ? 193  PHE E CD1 1 
ATOM   4357  C CD2 . PHE G  1 53  ? 18.531  104.952 83.130  1.00 43.28  ? 193  PHE E CD2 1 
ATOM   4358  C CE1 . PHE G  1 53  ? 17.687  106.944 81.393  1.00 43.28  ? 193  PHE E CE1 1 
ATOM   4359  C CE2 . PHE G  1 53  ? 17.181  105.078 82.812  1.00 43.28  ? 193  PHE E CE2 1 
ATOM   4360  C CZ  . PHE G  1 53  ? 16.759  106.076 81.944  1.00 43.28  ? 193  PHE E CZ  1 
ATOM   4361  N N   . GLU G  1 54  ? 23.380  106.303 85.252  1.00 51.07  ? 194  GLU E N   1 
ATOM   4362  C CA  . GLU G  1 54  ? 24.615  105.833 85.864  1.00 51.07  ? 194  GLU E CA  1 
ATOM   4363  C C   . GLU G  1 54  ? 24.270  105.727 87.335  1.00 51.07  ? 194  GLU E C   1 
ATOM   4364  O O   . GLU G  1 54  ? 24.460  104.677 87.945  1.00 51.07  ? 194  GLU E O   1 
ATOM   4365  C CB  . GLU G  1 54  ? 25.742  106.849 85.660  1.00 51.07  ? 194  GLU E CB  1 
ATOM   4366  C CG  . GLU G  1 54  ? 26.991  106.281 84.987  1.00 51.07  ? 194  GLU E CG  1 
ATOM   4367  C CD  . GLU G  1 54  ? 27.913  107.361 84.430  1.00 51.07  ? 194  GLU E CD  1 
ATOM   4368  O OE1 . GLU G  1 54  ? 27.903  108.503 84.951  1.00 51.07  ? 194  GLU E OE1 1 
ATOM   4369  O OE2 . GLU G  1 54  ? 28.650  107.063 83.466  1.00 51.07  ? 194  GLU E OE2 1 
ATOM   4370  N N   . GLU G  1 55  ? 23.726  106.815 87.884  1.00 52.25  ? 195  GLU E N   1 
ATOM   4371  C CA  . GLU G  1 55  ? 23.330  106.850 89.289  1.00 52.25  ? 195  GLU E CA  1 
ATOM   4372  C C   . GLU G  1 55  ? 22.304  105.769 89.579  1.00 52.25  ? 195  GLU E C   1 
ATOM   4373  O O   . GLU G  1 55  ? 22.080  105.412 90.735  1.00 52.25  ? 195  GLU E O   1 
ATOM   4374  C CB  . GLU G  1 55  ? 22.720  108.200 89.664  1.00 52.25  ? 195  GLU E CB  1 
ATOM   4375  C CG  . GLU G  1 55  ? 23.284  109.385 88.937  1.00 52.25  ? 195  GLU E CG  1 
ATOM   4376  C CD  . GLU G  1 55  ? 22.931  110.698 89.617  1.00 52.25  ? 195  GLU E CD  1 
ATOM   4377  O OE1 . GLU G  1 55  ? 21.744  110.903 89.971  1.00 52.25  ? 195  GLU E OE1 1 
ATOM   4378  O OE2 . GLU G  1 55  ? 23.846  111.534 89.793  1.00 52.25  ? 195  GLU E OE2 1 
ATOM   4379  N N   . LEU G  1 56  ? 21.660  105.266 88.533  1.00 56.65  ? 196  LEU E N   1 
ATOM   4380  C CA  . LEU G  1 56  ? 20.666  104.226 88.717  1.00 56.65  ? 196  LEU E CA  1 
ATOM   4381  C C   . LEU G  1 56  ? 21.320  102.864 88.545  1.00 56.65  ? 196  LEU E C   1 
ATOM   4382  O O   . LEU G  1 56  ? 20.644  101.843 88.433  1.00 56.65  ? 196  LEU E O   1 
ATOM   4383  C CB  . LEU G  1 56  ? 19.503  104.409 87.736  1.00 56.65  ? 196  LEU E CB  1 
ATOM   4384  C CG  . LEU G  1 56  ? 18.469  105.449 88.184  1.00 56.65  ? 196  LEU E CG  1 
ATOM   4385  C CD1 . LEU G  1 56  ? 17.534  105.762 87.047  1.00 56.65  ? 196  LEU E CD1 1 
ATOM   4386  C CD2 . LEU G  1 56  ? 17.698  104.928 89.388  1.00 56.65  ? 196  LEU E CD2 1 
ATOM   4387  N N   . HIS G  1 57  ? 22.648  102.862 88.534  1.00 61.30  ? 197  HIS E N   1 
ATOM   4388  C CA  . HIS G  1 57  ? 23.413  101.632 88.423  1.00 61.30  ? 197  HIS E CA  1 
ATOM   4389  C C   . HIS G  1 57  ? 23.233  100.903 87.111  1.00 61.30  ? 197  HIS E C   1 
ATOM   4390  O O   . HIS G  1 57  ? 23.027  99.695  87.091  1.00 61.30  ? 197  HIS E O   1 
ATOM   4391  C CB  . HIS G  1 57  ? 23.056  100.696 89.576  1.00 61.30  ? 197  HIS E CB  1 
ATOM   4392  C CG  . HIS G  1 57  ? 23.086  101.362 90.914  1.00 61.30  ? 197  HIS E CG  1 
ATOM   4393  N ND1 . HIS G  1 57  ? 23.992  102.353 91.228  1.00 61.30  ? 197  HIS E ND1 1 
ATOM   4394  C CD2 . HIS G  1 57  ? 22.308  101.199 92.011  1.00 61.30  ? 197  HIS E CD2 1 
ATOM   4395  C CE1 . HIS G  1 57  ? 23.767  102.775 92.460  1.00 61.30  ? 197  HIS E CE1 1 
ATOM   4396  N NE2 . HIS G  1 57  ? 22.751  102.091 92.958  1.00 61.30  ? 197  HIS E NE2 1 
ATOM   4397  N N   . PHE G  1 58  ? 23.311  101.644 86.017  1.00 38.94  ? 198  PHE E N   1 
ATOM   4398  C CA  . PHE G  1 58  ? 23.185  101.060 84.688  1.00 38.94  ? 198  PHE E CA  1 
ATOM   4399  C C   . PHE G  1 58  ? 24.545  101.275 84.040  1.00 38.94  ? 198  PHE E C   1 
ATOM   4400  O O   . PHE G  1 58  ? 25.235  102.225 84.380  1.00 38.94  ? 198  PHE E O   1 
ATOM   4401  C CB  . PHE G  1 58  ? 22.075  101.781 83.875  1.00 38.94  ? 198  PHE E CB  1 
ATOM   4402  C CG  . PHE G  1 58  ? 20.739  101.054 83.871  1.00 38.94  ? 198  PHE E CG  1 
ATOM   4403  C CD1 . PHE G  1 58  ? 19.838  101.219 84.912  1.00 38.94  ? 198  PHE E CD1 1 
ATOM   4404  C CD2 . PHE G  1 58  ? 20.411  100.170 82.858  1.00 38.94  ? 198  PHE E CD2 1 
ATOM   4405  C CE1 . PHE G  1 58  ? 18.640  100.511 84.947  1.00 38.94  ? 198  PHE E CE1 1 
ATOM   4406  C CE2 . PHE G  1 58  ? 19.205  99.457  82.890  1.00 38.94  ? 198  PHE E CE2 1 
ATOM   4407  C CZ  . PHE G  1 58  ? 18.327  99.632  83.940  1.00 38.94  ? 198  PHE E CZ  1 
ATOM   4408  N N   . GLU G  1 59  ? 24.936  100.407 83.119  1.00 61.56  ? 199  GLU E N   1 
ATOM   4409  C CA  . GLU G  1 59  ? 26.216  100.573 82.458  1.00 61.56  ? 199  GLU E CA  1 
ATOM   4410  C C   . GLU G  1 59  ? 26.014  101.224 81.098  1.00 61.56  ? 199  GLU E C   1 
ATOM   4411  O O   . GLU G  1 59  ? 25.610  100.574 80.132  1.00 61.56  ? 199  GLU E O   1 
ATOM   4412  C CB  . GLU G  1 59  ? 26.899  99.225  82.307  1.00 61.56  ? 199  GLU E CB  1 
ATOM   4413  C CG  . GLU G  1 59  ? 28.402  99.301  82.426  1.00 61.56  ? 199  GLU E CG  1 
ATOM   4414  C CD  . GLU G  1 59  ? 29.080  98.157  81.696  1.00 61.56  ? 199  GLU E CD  1 
ATOM   4415  O OE1 . GLU G  1 59  ? 28.953  97.006  82.182  1.00 61.56  ? 199  GLU E OE1 1 
ATOM   4416  O OE2 . GLU G  1 59  ? 29.727  98.408  80.642  1.00 61.56  ? 199  GLU E OE2 1 
ATOM   4417  N N   . ILE G  1 60  ? 26.294  102.520 81.040  1.00 38.90  ? 200  ILE E N   1 
ATOM   4418  C CA  . ILE G  1 60  ? 26.146  103.306 79.818  1.00 38.90  ? 200  ILE E CA  1 
ATOM   4419  C C   . ILE G  1 60  ? 27.034  102.840 78.673  1.00 38.90  ? 200  ILE E C   1 
ATOM   4420  O O   . ILE G  1 60  ? 28.186  102.462 78.874  1.00 38.90  ? 200  ILE E O   1 
ATOM   4421  C CB  . ILE G  1 60  ? 26.459  104.790 80.082  1.00 38.90  ? 200  ILE E CB  1 
ATOM   4422  C CG1 . ILE G  1 60  ? 25.930  105.198 81.455  1.00 38.90  ? 200  ILE E CG1 1 
ATOM   4423  C CG2 . ILE G  1 60  ? 25.836  105.653 79.032  1.00 38.90  ? 200  ILE E CG2 1 
ATOM   4424  C CD1 . ILE G  1 60  ? 24.508  104.738 81.738  1.00 38.90  ? 200  ILE E CD1 1 
ATOM   4425  N N   . LYS G  1 61  ? 26.487  102.872 77.469  1.00 38.29  ? 201  LYS E N   1 
ATOM   4426  C CA  . LYS G  1 61  ? 27.221  102.470 76.283  1.00 38.29  ? 201  LYS E CA  1 
ATOM   4427  C C   . LYS G  1 61  ? 26.835  103.482 75.225  1.00 38.29  ? 201  LYS E C   1 
ATOM   4428  O O   . LYS G  1 61  ? 25.911  103.258 74.441  1.00 38.29  ? 201  LYS E O   1 
ATOM   4429  C CB  . LYS G  1 61  ? 26.806  101.069 75.850  1.00 38.29  ? 201  LYS E CB  1 
ATOM   4430  C CG  . LYS G  1 61  ? 27.331  99.970  76.755  1.00 38.29  ? 201  LYS E CG  1 
ATOM   4431  C CD  . LYS G  1 61  ? 28.856  99.931  76.781  1.00 38.29  ? 201  LYS E CD  1 
ATOM   4432  C CE  . LYS G  1 61  ? 29.343  98.558  77.232  1.00 38.29  ? 201  LYS E CE  1 
ATOM   4433  N NZ  . LYS G  1 61  ? 30.821  98.463  77.365  1.00 38.29  ? 201  LYS E NZ  1 
ATOM   4434  N N   . PRO G  1 62  ? 27.567  104.602 75.172  1.00 31.35  ? 202  PRO E N   1 
ATOM   4435  C CA  . PRO G  1 62  ? 27.327  105.693 74.228  1.00 31.35  ? 202  PRO E CA  1 
ATOM   4436  C C   . PRO G  1 62  ? 27.791  105.387 72.840  1.00 31.35  ? 202  PRO E C   1 
ATOM   4437  O O   . PRO G  1 62  ? 28.676  104.572 72.663  1.00 31.35  ? 202  PRO E O   1 
ATOM   4438  C CB  . PRO G  1 62  ? 28.108  106.861 74.814  1.00 31.35  ? 202  PRO E CB  1 
ATOM   4439  C CG  . PRO G  1 62  ? 28.820  106.331 76.046  1.00 31.35  ? 202  PRO E CG  1 
ATOM   4440  C CD  . PRO G  1 62  ? 28.752  104.852 76.008  1.00 31.35  ? 202  PRO E CD  1 
ATOM   4441  N N   . HIS G  1 63  ? 27.190  106.057 71.863  1.00 40.35  ? 203  HIS E N   1 
ATOM   4442  C CA  . HIS G  1 63  ? 27.536  105.907 70.450  1.00 40.35  ? 203  HIS E CA  1 
ATOM   4443  C C   . HIS G  1 63  ? 27.152  107.202 69.767  1.00 40.35  ? 203  HIS E C   1 
ATOM   4444  O O   . HIS G  1 63  ? 26.072  107.723 70.024  1.00 40.35  ? 203  HIS E O   1 
ATOM   4445  C CB  . HIS G  1 63  ? 26.772  104.750 69.851  1.00 40.35  ? 203  HIS E CB  1 
ATOM   4446  C CG  . HIS G  1 63  ? 27.300  103.420 70.280  1.00 40.35  ? 203  HIS E CG  1 
ATOM   4447  N ND1 . HIS G  1 63  ? 28.315  102.773 69.608  1.00 40.35  ? 203  HIS E ND1 1 
ATOM   4448  C CD2 . HIS G  1 63  ? 26.996  102.644 71.346  1.00 40.35  ? 203  HIS E CD2 1 
ATOM   4449  C CE1 . HIS G  1 63  ? 28.616  101.655 70.242  1.00 40.35  ? 203  HIS E CE1 1 
ATOM   4450  N NE2 . HIS G  1 63  ? 27.830  101.553 71.300  1.00 40.35  ? 203  HIS E NE2 1 
ATOM   4451  N N   . HIS G  1 64  ? 28.013  107.744 68.910  1.00 34.24  ? 204  HIS E N   1 
ATOM   4452  C CA  . HIS G  1 64  ? 27.671  109.012 68.280  1.00 34.24  ? 204  HIS E CA  1 
ATOM   4453  C C   . HIS G  1 64  ? 27.611  109.023 66.767  1.00 34.24  ? 204  HIS E C   1 
ATOM   4454  O O   . HIS G  1 64  ? 28.310  108.268 66.095  1.00 34.24  ? 204  HIS E O   1 
ATOM   4455  C CB  . HIS G  1 64  ? 28.617  110.092 68.774  1.00 34.24  ? 204  HIS E CB  1 
ATOM   4456  C CG  . HIS G  1 64  ? 28.720  110.144 70.260  1.00 34.24  ? 204  HIS E CG  1 
ATOM   4457  N ND1 . HIS G  1 64  ? 27.955  110.987 71.031  1.00 34.24  ? 204  HIS E ND1 1 
ATOM   4458  C CD2 . HIS G  1 64  ? 29.470  109.423 71.125  1.00 34.24  ? 204  HIS E CD2 1 
ATOM   4459  C CE1 . HIS G  1 64  ? 28.224  110.786 72.309  1.00 34.24  ? 204  HIS E CE1 1 
ATOM   4460  N NE2 . HIS G  1 64  ? 29.142  109.842 72.395  1.00 34.24  ? 204  HIS E NE2 1 
ATOM   4461  N N   . ASP G  1 65  ? 26.740  109.876 66.236  1.00 50.01  ? 205  ASP E N   1 
ATOM   4462  C CA  . ASP G  1 65  ? 26.581  110.002 64.792  1.00 50.01  ? 205  ASP E CA  1 
ATOM   4463  C C   . ASP G  1 65  ? 26.563  108.660 64.060  1.00 50.01  ? 205  ASP E C   1 
ATOM   4464  O O   . ASP G  1 65  ? 27.490  108.346 63.322  1.00 50.01  ? 205  ASP E O   1 
ATOM   4465  C CB  . ASP G  1 65  ? 27.715  110.853 64.232  1.00 50.01  ? 205  ASP E CB  1 
ATOM   4466  C CG  . ASP G  1 65  ? 27.857  112.167 64.949  1.00 50.01  ? 205  ASP E CG  1 
ATOM   4467  O OD1 . ASP G  1 65  ? 26.805  112.734 65.323  1.00 50.01  ? 205  ASP E OD1 1 
ATOM   4468  O OD2 . ASP G  1 65  ? 29.009  112.627 65.134  1.00 50.01  ? 205  ASP E OD2 1 
ATOM   4469  N N   . CYS G  1 66  ? 25.513  107.870 64.249  1.00 37.01  ? 206  CYS E N   1 
ATOM   4470  C CA  . CYS G  1 66  ? 25.455  106.585 63.573  1.00 37.01  ? 206  CYS E CA  1 
ATOM   4471  C C   . CYS G  1 66  ? 24.525  106.576 62.392  1.00 37.01  ? 206  CYS E C   1 
ATOM   4472  O O   . CYS G  1 66  ? 23.381  107.005 62.474  1.00 37.01  ? 206  CYS E O   1 
ATOM   4473  C CB  . CYS G  1 66  ? 25.012  105.468 64.514  1.00 37.01  ? 206  CYS E CB  1 
ATOM   4474  S SG  . CYS G  1 66  ? 25.674  105.574 66.159  1.00 37.01  ? 206  CYS E SG  1 
ATOM   4475  N N   . THR G  1 67  ? 25.038  106.078 61.284  1.00 27.87  ? 207  THR E N   1 
ATOM   4476  C CA  . THR G  1 67  ? 24.245  105.927 60.086  1.00 27.87  ? 207  THR E CA  1 
ATOM   4477  C C   . THR G  1 67  ? 23.209  104.882 60.499  1.00 27.87  ? 207  THR E C   1 
ATOM   4478  O O   . THR G  1 67  ? 23.273  104.352 61.614  1.00 27.87  ? 207  THR E O   1 
ATOM   4479  C CB  . THR G  1 67  ? 25.104  105.378 58.947  1.00 27.87  ? 207  THR E CB  1 
ATOM   4480  O OG1 . THR G  1 67  ? 25.459  104.014 59.220  1.00 27.87  ? 207  THR E OG1 1 
ATOM   4481  C CG2 . THR G  1 67  ? 26.365  106.194 58.830  1.00 27.87  ? 207  THR E CG2 1 
ATOM   4482  N N   . VAL G  1 68  ? 22.258  104.579 59.625  1.00 33.22  ? 208  VAL E N   1 
ATOM   4483  C CA  . VAL G  1 68  ? 21.244  103.599 59.984  1.00 33.22  ? 208  VAL E CA  1 
ATOM   4484  C C   . VAL G  1 68  ? 21.908  102.246 60.178  1.00 33.22  ? 208  VAL E C   1 
ATOM   4485  O O   . VAL G  1 68  ? 21.649  101.561 61.171  1.00 33.22  ? 208  VAL E O   1 
ATOM   4486  C CB  . VAL G  1 68  ? 20.149  103.484 58.909  1.00 33.22  ? 208  VAL E CB  1 
ATOM   4487  C CG1 . VAL G  1 68  ? 19.518  102.122 58.984  1.00 33.22  ? 208  VAL E CG1 1 
ATOM   4488  C CG2 . VAL G  1 68  ? 19.099  104.568 59.106  1.00 33.22  ? 208  VAL E CG2 1 
ATOM   4489  N N   . GLU G  1 69  ? 22.780  101.876 59.243  1.00 59.20  ? 209  GLU E N   1 
ATOM   4490  C CA  . GLU G  1 69  ? 23.487  100.602 59.323  1.00 59.20  ? 209  GLU E CA  1 
ATOM   4491  C C   . GLU G  1 69  ? 24.264  100.431 60.628  1.00 59.20  ? 209  GLU E C   1 
ATOM   4492  O O   . GLU G  1 69  ? 24.277  99.355  61.217  1.00 59.20  ? 209  GLU E O   1 
ATOM   4493  C CB  . GLU G  1 69  ? 24.442  100.467 58.152  1.00 59.20  ? 209  GLU E CB  1 
ATOM   4494  C CG  . GLU G  1 69  ? 25.199  99.164  58.161  1.00 59.20  ? 209  GLU E CG  1 
ATOM   4495  C CD  . GLU G  1 69  ? 26.214  99.077  57.033  1.00 59.20  ? 209  GLU E CD  1 
ATOM   4496  O OE1 . GLU G  1 69  ? 27.099  99.965  56.956  1.00 59.20  ? 209  GLU E OE1 1 
ATOM   4497  O OE2 . GLU G  1 69  ? 26.134  98.122  56.226  1.00 59.20  ? 209  GLU E OE2 1 
ATOM   4498  N N   . GLN G  1 70  ? 24.925  101.490 61.069  1.00 30.72  ? 210  GLN E N   1 
ATOM   4499  C CA  . GLN G  1 70  ? 25.665  101.430 62.312  1.00 30.72  ? 210  GLN E CA  1 
ATOM   4500  C C   . GLN G  1 70  ? 24.696  101.132 63.446  1.00 30.72  ? 210  GLN E C   1 
ATOM   4501  O O   . GLN G  1 70  ? 25.002  100.351 64.345  1.00 30.72  ? 210  GLN E O   1 
ATOM   4502  C CB  . GLN G  1 70  ? 26.352  102.758 62.583  1.00 30.72  ? 210  GLN E CB  1 
ATOM   4503  C CG  . GLN G  1 70  ? 27.744  102.858 62.023  1.00 30.72  ? 210  GLN E CG  1 
ATOM   4504  C CD  . GLN G  1 70  ? 28.098  104.275 61.622  1.00 30.72  ? 210  GLN E CD  1 
ATOM   4505  O OE1 . GLN G  1 70  ? 29.256  104.580 61.345  1.00 30.72  ? 210  GLN E OE1 1 
ATOM   4506  N NE2 . GLN G  1 70  ? 27.102  105.154 61.587  1.00 30.72  ? 210  GLN E NE2 1 
ATOM   4507  N N   . ILE G  1 71  ? 23.523  101.764 63.410  1.00 26.57  ? 211  ILE E N   1 
ATOM   4508  C CA  . ILE G  1 71  ? 22.508  101.564 64.451  1.00 26.57  ? 211  ILE E CA  1 
ATOM   4509  C C   . ILE G  1 71  ? 22.108  100.098 64.535  1.00 26.57  ? 211  ILE E C   1 
ATOM   4510  O O   . ILE G  1 71  ? 22.051  99.519  65.613  1.00 26.57  ? 211  ILE E O   1 
ATOM   4511  C CB  . ILE G  1 71  ? 21.243  102.403 64.176  1.00 26.57  ? 211  ILE E CB  1 
ATOM   4512  C CG1 . ILE G  1 71  ? 21.640  103.846 63.835  1.00 26.57  ? 211  ILE E CG1 1 
ATOM   4513  C CG2 . ILE G  1 71  ? 20.300  102.316 65.368  1.00 26.57  ? 211  ILE E CG2 1 
ATOM   4514  C CD1 . ILE G  1 71  ? 20.804  104.925 64.523  1.00 26.57  ? 211  ILE E CD1 1 
ATOM   4515  N N   . TYR G  1 72  ? 21.828  99.498  63.392  1.00 38.42  ? 212  TYR E N   1 
ATOM   4516  C CA  . TYR G  1 72  ? 21.468  98.098  63.378  1.00 38.42  ? 212  TYR E CA  1 
ATOM   4517  C C   . TYR G  1 72  ? 22.642  97.272  63.888  1.00 38.42  ? 212  TYR E C   1 
ATOM   4518  O O   . TYR G  1 72  ? 22.480  96.424  64.763  1.00 38.42  ? 212  TYR E O   1 
ATOM   4519  C CB  . TYR G  1 72  ? 21.098  97.681  61.968  1.00 38.42  ? 212  TYR E CB  1 
ATOM   4520  C CG  . TYR G  1 72  ? 19.693  98.090  61.608  1.00 38.42  ? 212  TYR E CG  1 
ATOM   4521  C CD1 . TYR G  1 72  ? 19.440  98.857  60.479  1.00 38.42  ? 212  TYR E CD1 1 
ATOM   4522  C CD2 . TYR G  1 72  ? 18.612  97.722  62.408  1.00 38.42  ? 212  TYR E CD2 1 
ATOM   4523  C CE1 . TYR G  1 72  ? 18.142  99.250  60.152  1.00 38.42  ? 212  TYR E CE1 1 
ATOM   4524  C CE2 . TYR G  1 72  ? 17.322  98.106  62.092  1.00 38.42  ? 212  TYR E CE2 1 
ATOM   4525  C CZ  . TYR G  1 72  ? 17.095  98.868  60.963  1.00 38.42  ? 212  TYR E CZ  1 
ATOM   4526  O OH  . TYR G  1 72  ? 15.819  99.236  60.625  1.00 38.42  ? 212  TYR E OH  1 
ATOM   4527  N N   . GLU G  1 73  ? 23.825  97.529  63.345  1.00 58.44  ? 213  GLU E N   1 
ATOM   4528  C CA  . GLU G  1 73  ? 25.029  96.832  63.769  1.00 58.44  ? 213  GLU E CA  1 
ATOM   4529  C C   . GLU G  1 73  ? 25.106  96.840  65.293  1.00 58.44  ? 213  GLU E C   1 
ATOM   4530  O O   . GLU G  1 73  ? 25.361  95.818  65.919  1.00 58.44  ? 213  GLU E O   1 
ATOM   4531  C CB  . GLU G  1 73  ? 26.254  97.542  63.214  1.00 58.44  ? 213  GLU E CB  1 
ATOM   4532  C CG  . GLU G  1 73  ? 27.215  96.661  62.454  1.00 58.44  ? 213  GLU E CG  1 
ATOM   4533  C CD  . GLU G  1 73  ? 27.968  97.430  61.358  1.00 58.44  ? 213  GLU E CD  1 
ATOM   4534  O OE1 . GLU G  1 73  ? 28.673  98.421  61.690  1.00 58.44  ? 213  GLU E OE1 1 
ATOM   4535  O OE2 . GLU G  1 73  ? 27.852  97.040  60.166  1.00 58.44  ? 213  GLU E OE2 1 
ATOM   4536  N N   . ILE G  1 74  ? 24.876  98.007  65.884  1.00 29.47  ? 214  ILE E N   1 
ATOM   4537  C CA  . ILE G  1 74  ? 24.929  98.183  67.339  1.00 29.47  ? 214  ILE E CA  1 
ATOM   4538  C C   . ILE G  1 74  ? 23.882  97.370  68.111  1.00 29.47  ? 214  ILE E C   1 
ATOM   4539  O O   . ILE G  1 74  ? 24.186  96.712  69.113  1.00 29.47  ? 214  ILE E O   1 
ATOM   4540  C CB  . ILE G  1 74  ? 24.720  99.658  67.719  1.00 29.47  ? 214  ILE E CB  1 
ATOM   4541  C CG1 . ILE G  1 74  ? 25.852  100.501 67.167  1.00 29.47  ? 214  ILE E CG1 1 
ATOM   4542  C CG2 . ILE G  1 74  ? 24.652  99.801  69.218  1.00 29.47  ? 214  ILE E CG2 1 
ATOM   4543  C CD1 . ILE G  1 74  ? 25.820  101.917 67.649  1.00 29.47  ? 214  ILE E CD1 1 
ATOM   4544  N N   . LEU G  1 75  ? 22.636  97.446  67.663  1.00 32.85  ? 215  LEU E N   1 
ATOM   4545  C CA  . LEU G  1 75  ? 21.584  96.723  68.335  1.00 32.85  ? 215  LEU E CA  1 
ATOM   4546  C C   . LEU G  1 75  ? 21.865  95.252  68.153  1.00 32.85  ? 215  LEU E C   1 
ATOM   4547  O O   . LEU G  1 75  ? 21.705  94.467  69.077  1.00 32.85  ? 215  LEU E O   1 
ATOM   4548  C CB  . LEU G  1 75  ? 20.221  97.102  67.748  1.00 32.85  ? 215  LEU E CB  1 
ATOM   4549  C CG  . LEU G  1 75  ? 19.764  98.542  68.039  1.00 32.85  ? 215  LEU E CG  1 
ATOM   4550  C CD1 . LEU G  1 75  ? 18.382  98.746  67.466  1.00 32.85  ? 215  LEU E CD1 1 
ATOM   4551  C CD2 . LEU G  1 75  ? 19.744  98.821  69.526  1.00 32.85  ? 215  LEU E CD2 1 
ATOM   4552  N N   . LYS G  1 76  ? 22.310  94.872  66.965  1.00 49.09  ? 216  LYS E N   1 
ATOM   4553  C CA  . LYS G  1 76  ? 22.601  93.469  66.732  1.00 49.09  ? 216  LYS E CA  1 
ATOM   4554  C C   . LYS G  1 76  ? 23.566  92.924  67.776  1.00 49.09  ? 216  LYS E C   1 
ATOM   4555  O O   . LYS G  1 76  ? 23.526  91.744  68.113  1.00 49.09  ? 216  LYS E O   1 
ATOM   4556  C CB  . LYS G  1 76  ? 23.204  93.248  65.351  1.00 49.09  ? 216  LYS E CB  1 
ATOM   4557  C CG  . LYS G  1 76  ? 23.561  91.791  65.108  1.00 49.09  ? 216  LYS E CG  1 
ATOM   4558  C CD  . LYS G  1 76  ? 23.429  91.442  63.643  1.00 49.09  ? 216  LYS E CD  1 
ATOM   4559  C CE  . LYS G  1 76  ? 23.281  89.947  63.413  1.00 49.09  ? 216  LYS E CE  1 
ATOM   4560  N NZ  . LYS G  1 76  ? 23.891  89.576  62.096  1.00 49.09  ? 216  LYS E NZ  1 
ATOM   4561  N N   . ILE G  1 77  ? 24.445  93.777  68.283  1.00 34.89  ? 217  ILE E N   1 
ATOM   4562  C CA  . ILE G  1 77  ? 25.398  93.326  69.277  1.00 34.89  ? 217  ILE E CA  1 
ATOM   4563  C C   . ILE G  1 77  ? 24.682  92.988  70.565  1.00 34.89  ? 217  ILE E C   1 
ATOM   4564  O O   . ILE G  1 77  ? 24.719  91.851  71.025  1.00 34.89  ? 217  ILE E O   1 
ATOM   4565  C CB  . ILE G  1 77  ? 26.448  94.385  69.579  1.00 34.89  ? 217  ILE E CB  1 
ATOM   4566  C CG1 . ILE G  1 77  ? 27.476  94.420  68.453  1.00 34.89  ? 217  ILE E CG1 1 
ATOM   4567  C CG2 . ILE G  1 77  ? 27.121  94.073  70.909  1.00 34.89  ? 217  ILE E CG2 1 
ATOM   4568  C CD1 . ILE G  1 77  ? 28.664  95.328  68.735  1.00 34.89  ? 217  ILE E CD1 1 
ATOM   4569  N N   . TYR G  1 78  ? 24.027  93.979  71.149  1.00 31.48  ? 218  TYR E N   1 
ATOM   4570  C CA  . TYR G  1 78  ? 23.306  93.769  72.395  1.00 31.48  ? 218  TYR E CA  1 
ATOM   4571  C C   . TYR G  1 78  ? 22.154  92.818  72.219  1.00 31.48  ? 218  TYR E C   1 
ATOM   4572  O O   . TYR G  1 78  ? 21.641  92.267  73.190  1.00 31.48  ? 218  TYR E O   1 
ATOM   4573  C CB  . TYR G  1 78  ? 22.844  95.101  72.951  1.00 31.48  ? 218  TYR E CB  1 
ATOM   4574  C CG  . TYR G  1 78  ? 24.034  95.973  73.279  1.00 31.48  ? 218  TYR E CG  1 
ATOM   4575  C CD1 . TYR G  1 78  ? 24.671  96.720  72.286  1.00 31.48  ? 218  TYR E CD1 1 
ATOM   4576  C CD2 . TYR G  1 78  ? 24.560  96.007  74.575  1.00 31.48  ? 218  TYR E CD2 1 
ATOM   4577  C CE1 . TYR G  1 78  ? 25.805  97.480  72.580  1.00 31.48  ? 218  TYR E CE1 1 
ATOM   4578  C CE2 . TYR G  1 78  ? 25.692  96.761  74.878  1.00 31.48  ? 218  TYR E CE2 1 
ATOM   4579  C CZ  . TYR G  1 78  ? 26.310  97.498  73.881  1.00 31.48  ? 218  TYR E CZ  1 
ATOM   4580  O OH  . TYR G  1 78  ? 27.411  98.281  74.184  1.00 31.48  ? 218  TYR E OH  1 
ATOM   4581  N N   . GLN G  1 79  ? 21.771  92.608  70.966  1.00 38.79  ? 219  GLN E N   1 
ATOM   4582  C CA  . GLN G  1 79  ? 20.707  91.678  70.651  1.00 38.79  ? 219  GLN E CA  1 
ATOM   4583  C C   . GLN G  1 79  ? 21.242  90.260  70.836  1.00 38.79  ? 219  GLN E C   1 
ATOM   4584  O O   . GLN G  1 79  ? 20.504  89.353  71.229  1.00 38.79  ? 219  GLN E O   1 
ATOM   4585  C CB  . GLN G  1 79  ? 20.260  91.854  69.209  1.00 38.79  ? 219  GLN E CB  1 
ATOM   4586  C CG  . GLN G  1 79  ? 19.072  91.001  68.859  1.00 38.79  ? 219  GLN E CG  1 
ATOM   4587  C CD  . GLN G  1 79  ? 19.432  89.817  67.985  1.00 38.79  ? 219  GLN E CD  1 
ATOM   4588  O OE1 . GLN G  1 79  ? 19.632  89.953  66.769  1.00 38.79  ? 219  GLN E OE1 1 
ATOM   4589  N NE2 . GLN G  1 79  ? 19.508  88.640  68.596  1.00 38.79  ? 219  GLN E NE2 1 
ATOM   4590  N N   . LEU G  1 80  ? 22.538  90.084  70.568  1.00 35.58  ? 220  LEU E N   1 
ATOM   4591  C CA  . LEU G  1 80  ? 23.202  88.787  70.667  1.00 35.58  ? 220  LEU E CA  1 
ATOM   4592  C C   . LEU G  1 80  ? 23.895  88.489  71.986  1.00 35.58  ? 220  LEU E C   1 
ATOM   4593  O O   . LEU G  1 80  ? 24.359  87.375  72.203  1.00 35.58  ? 220  LEU E O   1 
ATOM   4594  C CB  . LEU G  1 80  ? 24.216  88.654  69.547  1.00 35.58  ? 220  LEU E CB  1 
ATOM   4595  C CG  . LEU G  1 80  ? 23.570  88.727  68.171  1.00 35.58  ? 220  LEU E CG  1 
ATOM   4596  C CD1 . LEU G  1 80  ? 24.605  88.861  67.087  1.00 35.58  ? 220  LEU E CD1 1 
ATOM   4597  C CD2 . LEU G  1 80  ? 22.755  87.482  67.951  1.00 35.58  ? 220  LEU E CD2 1 
ATOM   4598  N N   . MET G  1 81  ? 23.974  89.469  72.870  1.00 39.78  ? 221  MET E N   1 
ATOM   4599  C CA  . MET G  1 81  ? 24.623  89.262  74.151  1.00 39.78  ? 221  MET E CA  1 
ATOM   4600  C C   . MET G  1 81  ? 23.864  88.345  75.084  1.00 39.78  ? 221  MET E C   1 
ATOM   4601  O O   . MET G  1 81  ? 22.720  87.967  74.818  1.00 39.78  ? 221  MET E O   1 
ATOM   4602  C CB  . MET G  1 81  ? 24.776  90.577  74.853  1.00 39.78  ? 221  MET E CB  1 
ATOM   4603  C CG  . MET G  1 81  ? 25.975  91.314  74.454  1.00 39.78  ? 221  MET E CG  1 
ATOM   4604  S SD  . MET G  1 81  ? 26.409  92.331  75.857  1.00 39.78  ? 221  MET E SD  1 
ATOM   4605  C CE  . MET G  1 81  ? 27.815  93.269  75.096  1.00 39.78  ? 221  MET E CE  1 
ATOM   4606  N N   . ASP G  1 82  ? 24.514  88.004  76.194  1.00 39.66  ? 222  ASP E N   1 
ATOM   4607  C CA  . ASP G  1 82  ? 23.895  87.165  77.207  1.00 39.66  ? 222  ASP E CA  1 
ATOM   4608  C C   . ASP G  1 82  ? 23.579  88.061  78.371  1.00 39.66  ? 222  ASP E C   1 
ATOM   4609  O O   . ASP G  1 82  ? 24.444  88.340  79.198  1.00 39.66  ? 222  ASP E O   1 
ATOM   4610  C CB  . ASP G  1 82  ? 24.832  86.059  77.682  1.00 39.66  ? 222  ASP E CB  1 
ATOM   4611  C CG  . ASP G  1 82  ? 24.195  85.185  78.759  1.00 39.66  ? 222  ASP E CG  1 
ATOM   4612  O OD1 . ASP G  1 82  ? 23.043  85.470  79.143  1.00 39.66  ? 222  ASP E OD1 1 
ATOM   4613  O OD2 . ASP G  1 82  ? 24.835  84.215  79.224  1.00 39.66  ? 222  ASP E OD2 1 
ATOM   4614  N N   . HIS G  1 83  ? 22.335  88.518  78.424  1.00 39.95  ? 224  HIS E N   1 
ATOM   4615  C CA  . HIS G  1 83  ? 21.904  89.406  79.493  1.00 39.95  ? 224  HIS E CA  1 
ATOM   4616  C C   . HIS G  1 83  ? 21.475  88.614  80.728  1.00 39.95  ? 224  HIS E C   1 
ATOM   4617  O O   . HIS G  1 83  ? 20.829  89.158  81.629  1.00 39.95  ? 224  HIS E O   1 
ATOM   4618  C CB  . HIS G  1 83  ? 20.741  90.290  79.006  1.00 39.95  ? 224  HIS E CB  1 
ATOM   4619  C CG  . HIS G  1 83  ? 21.078  91.150  77.821  1.00 39.95  ? 224  HIS E CG  1 
ATOM   4620  N ND1 . HIS G  1 83  ? 21.404  92.485  77.938  1.00 39.95  ? 224  HIS E ND1 1 
ATOM   4621  C CD2 . HIS G  1 83  ? 21.141  90.860  76.496  1.00 39.95  ? 224  HIS E CD2 1 
ATOM   4622  C CE1 . HIS G  1 83  ? 21.655  92.977  76.738  1.00 39.95  ? 224  HIS E CE1 1 
ATOM   4623  N NE2 . HIS G  1 83  ? 21.502  92.013  75.846  1.00 39.95  ? 224  HIS E NE2 1 
ATOM   4624  N N   . SER G  1 84  ? 21.858  87.339  80.776  1.00 28.35  ? 225  SER E N   1 
ATOM   4625  C CA  . SER G  1 84  ? 21.480  86.468  81.884  1.00 28.35  ? 225  SER E CA  1 
ATOM   4626  C C   . SER G  1 84  ? 21.710  87.063  83.268  1.00 28.35  ? 225  SER E C   1 
ATOM   4627  O O   . SER G  1 84  ? 20.904  86.875  84.188  1.00 28.35  ? 225  SER E O   1 
ATOM   4628  C CB  . SER G  1 84  ? 22.195  85.128  81.755  1.00 28.35  ? 225  SER E CB  1 
ATOM   4629  O OG  . SER G  1 84  ? 21.470  84.277  80.880  1.00 28.35  ? 225  SER E OG  1 
ATOM   4630  N N   . ASN G  1 85  ? 22.786  87.807  83.425  1.00 60.48  ? 226  ASN E N   1 
ATOM   4631  C CA  . ASN G  1 85  ? 23.045  88.387  84.727  1.00 60.48  ? 226  ASN E CA  1 
ATOM   4632  C C   . ASN G  1 85  ? 22.453  89.791  84.834  1.00 60.48  ? 226  ASN E C   1 
ATOM   4633  O O   . ASN G  1 85  ? 22.500  90.434  85.885  1.00 60.48  ? 226  ASN E O   1 
ATOM   4634  C CB  . ASN G  1 85  ? 24.552  88.378  84.994  1.00 60.48  ? 226  ASN E CB  1 
ATOM   4635  C CG  . ASN G  1 85  ? 25.061  86.991  85.396  1.00 60.48  ? 226  ASN E CG  1 
ATOM   4636  O OD1 . ASN G  1 85  ? 24.312  86.003  85.381  1.00 60.48  ? 226  ASN E OD1 1 
ATOM   4637  N ND2 . ASN G  1 85  ? 26.335  86.916  85.763  1.00 60.48  ? 226  ASN E ND2 1 
ATOM   4638  N N   . MET G  1 86  ? 21.871  90.251  83.735  1.00 58.07  ? 227  MET E N   1 
ATOM   4639  C CA  . MET G  1 86  ? 21.256  91.563  83.701  1.00 58.07  ? 227  MET E CA  1 
ATOM   4640  C C   . MET G  1 86  ? 19.795  91.472  84.159  1.00 58.07  ? 227  MET E C   1 
ATOM   4641  O O   . MET G  1 86  ? 19.155  90.425  84.034  1.00 58.07  ? 227  MET E O   1 
ATOM   4642  C CB  . MET G  1 86  ? 21.345  92.134  82.286  1.00 58.07  ? 227  MET E CB  1 
ATOM   4643  C CG  . MET G  1 86  ? 22.764  92.293  81.786  1.00 58.07  ? 227  MET E CG  1 
ATOM   4644  S SD  . MET G  1 86  ? 23.721  93.296  82.916  1.00 58.07  ? 227  MET E SD  1 
ATOM   4645  C CE  . MET G  1 86  ? 25.018  93.833  81.849  1.00 58.07  ? 227  MET E CE  1 
ATOM   4646  N N   . ASP G  1 87  ? 19.276  92.578  84.686  1.00 58.59  ? 228  ASP E N   1 
ATOM   4647  C CA  . ASP G  1 87  ? 17.910  92.636  85.177  1.00 58.59  ? 228  ASP E CA  1 
ATOM   4648  C C   . ASP G  1 87  ? 16.996  93.492  84.305  1.00 58.59  ? 228  ASP E C   1 
ATOM   4649  O O   . ASP G  1 87  ? 15.768  93.406  84.414  1.00 58.59  ? 228  ASP E O   1 
ATOM   4650  C CB  . ASP G  1 87  ? 17.908  93.190  86.600  1.00 58.59  ? 228  ASP E CB  1 
ATOM   4651  C CG  . ASP G  1 87  ? 17.887  92.103  87.639  1.00 58.59  ? 228  ASP E CG  1 
ATOM   4652  O OD1 . ASP G  1 87  ? 17.537  90.962  87.282  1.00 58.59  ? 228  ASP E OD1 1 
ATOM   4653  O OD2 . ASP G  1 87  ? 18.215  92.386  88.810  1.00 58.59  ? 228  ASP E OD2 1 
ATOM   4654  N N   . CYS G  1 88  ? 17.595  94.318  83.452  1.00 54.74  ? 229  CYS E N   1 
ATOM   4655  C CA  . CYS G  1 88  ? 16.840  95.212  82.572  1.00 54.74  ? 229  CYS E CA  1 
ATOM   4656  C C   . CYS G  1 88  ? 17.735  95.776  81.457  1.00 54.74  ? 229  CYS E C   1 
ATOM   4657  O O   . CYS G  1 88  ? 18.962  95.711  81.534  1.00 54.74  ? 229  CYS E O   1 
ATOM   4658  C CB  . CYS G  1 88  ? 16.226  96.344  83.410  1.00 54.74  ? 229  CYS E CB  1 
ATOM   4659  S SG  . CYS G  1 88  ? 15.661  97.780  82.493  1.00 54.74  ? 229  CYS E SG  1 
ATOM   4660  N N   . PHE G  1 89  ? 17.118  96.329  80.423  1.00 50.90  ? 230  PHE E N   1 
ATOM   4661  C CA  . PHE G  1 89  ? 17.860  96.875  79.293  1.00 50.90  ? 230  PHE E CA  1 
ATOM   4662  C C   . PHE G  1 89  ? 17.213  98.161  78.804  1.00 50.90  ? 230  PHE E C   1 
ATOM   4663  O O   . PHE G  1 89  ? 16.008  98.219  78.588  1.00 50.90  ? 230  PHE E O   1 
ATOM   4664  C CB  . PHE G  1 89  ? 17.897  95.853  78.147  1.00 50.90  ? 230  PHE E CB  1 
ATOM   4665  C CG  . PHE G  1 89  ? 18.471  96.394  76.867  1.00 50.90  ? 230  PHE E CG  1 
ATOM   4666  C CD1 . PHE G  1 89  ? 19.836  96.663  76.760  1.00 50.90  ? 230  PHE E CD1 1 
ATOM   4667  C CD2 . PHE G  1 89  ? 17.654  96.625  75.772  1.00 50.90  ? 230  PHE E CD2 1 
ATOM   4668  C CE1 . PHE G  1 89  ? 20.377  97.152  75.588  1.00 50.90  ? 230  PHE E CE1 1 
ATOM   4669  C CE2 . PHE G  1 89  ? 18.192  97.114  74.591  1.00 50.90  ? 230  PHE E CE2 1 
ATOM   4670  C CZ  . PHE G  1 89  ? 19.557  97.378  74.499  1.00 50.90  ? 230  PHE E CZ  1 
ATOM   4671  N N   . ILE G  1 90  ? 18.023  99.189  78.624  1.00 27.28  ? 231  ILE E N   1 
ATOM   4672  C CA  . ILE G  1 90  ? 17.519  100.457 78.164  1.00 27.28  ? 231  ILE E CA  1 
ATOM   4673  C C   . ILE G  1 90  ? 18.235  100.910 76.907  1.00 27.28  ? 231  ILE E C   1 
ATOM   4674  O O   . ILE G  1 90  ? 19.459  100.809 76.824  1.00 27.28  ? 231  ILE E O   1 
ATOM   4675  C CB  . ILE G  1 90  ? 17.755  101.506 79.204  1.00 27.28  ? 231  ILE E CB  1 
ATOM   4676  C CG1 . ILE G  1 90  ? 17.124  101.068 80.509  1.00 27.28  ? 231  ILE E CG1 1 
ATOM   4677  C CG2 . ILE G  1 90  ? 17.187  102.815 78.732  1.00 27.28  ? 231  ILE E CG2 1 
ATOM   4678  C CD1 . ILE G  1 90  ? 16.987  102.199 81.493  1.00 27.28  ? 231  ILE E CD1 1 
ATOM   4679  N N   . CYS G  1 91  ? 17.499  101.403 75.920  1.00 28.22  ? 232  CYS E N   1 
ATOM   4680  C CA  . CYS G  1 91  ? 18.160  101.906 74.731  1.00 28.22  ? 232  CYS E CA  1 
ATOM   4681  C C   . CYS G  1 91  ? 17.588  103.265 74.399  1.00 28.22  ? 232  CYS E C   1 
ATOM   4682  O O   . CYS G  1 91  ? 16.392  103.410 74.213  1.00 28.22  ? 232  CYS E O   1 
ATOM   4683  C CB  . CYS G  1 91  ? 17.970  100.991 73.534  1.00 28.22  ? 232  CYS E CB  1 
ATOM   4684  S SG  . CYS G  1 91  ? 18.288  101.889 71.970  1.00 28.22  ? 232  CYS E SG  1 
ATOM   4685  N N   . CYS G  1 92  ? 18.441  104.268 74.321  1.00 36.09  ? 233  CYS E N   1 
ATOM   4686  C CA  . CYS G  1 92  ? 17.974  105.597 74.007  1.00 36.09  ? 233  CYS E CA  1 
ATOM   4687  C C   . CYS G  1 92  ? 18.437  106.025 72.648  1.00 36.09  ? 233  CYS E C   1 
ATOM   4688  O O   . CYS G  1 92  ? 19.580  105.784 72.255  1.00 36.09  ? 233  CYS E O   1 
ATOM   4689  C CB  . CYS G  1 92  ? 18.500  106.584 75.015  1.00 36.09  ? 233  CYS E CB  1 
ATOM   4690  S SG  . CYS G  1 92  ? 18.249  106.003 76.637  1.00 36.09  ? 233  CYS E SG  1 
ATOM   4691  N N   . ILE G  1 93  ? 17.555  106.683 71.920  1.00 25.36  ? 234  ILE E N   1 
ATOM   4692  C CA  . ILE G  1 93  ? 17.932  107.155 70.614  1.00 25.36  ? 234  ILE E CA  1 
ATOM   4693  C C   . ILE G  1 93  ? 17.552  108.601 70.527  1.00 25.36  ? 234  ILE E C   1 
ATOM   4694  O O   . ILE G  1 93  ? 16.431  108.964 70.870  1.00 25.36  ? 234  ILE E O   1 
ATOM   4695  C CB  . ILE G  1 93  ? 17.224  106.386 69.548  1.00 25.36  ? 234  ILE E CB  1 
ATOM   4696  C CG1 . ILE G  1 93  ? 17.461  104.899 69.786  1.00 25.36  ? 234  ILE E CG1 1 
ATOM   4697  C CG2 . ILE G  1 93  ? 17.715  106.830 68.186  1.00 25.36  ? 234  ILE E CG2 1 
ATOM   4698  C CD1 . ILE G  1 93  ? 17.177  104.047 68.574  1.00 25.36  ? 234  ILE E CD1 1 
ATOM   4699  N N   . LEU G  1 94  ? 18.508  109.423 70.106  1.00 22.51  ? 235  LEU E N   1 
ATOM   4700  C CA  . LEU G  1 94  ? 18.299  110.854 69.958  1.00 22.51  ? 235  LEU E CA  1 
ATOM   4701  C C   . LEU G  1 94  ? 18.672  111.225 68.547  1.00 22.51  ? 235  LEU E C   1 
ATOM   4702  O O   . LEU G  1 94  ? 19.838  111.208 68.205  1.00 22.51  ? 235  LEU E O   1 
ATOM   4703  C CB  . LEU G  1 94  ? 19.195  111.598 70.915  1.00 22.51  ? 235  LEU E CB  1 
ATOM   4704  C CG  . LEU G  1 94  ? 19.448  110.800 72.179  1.00 22.51  ? 235  LEU E CG  1 
ATOM   4705  C CD1 . LEU G  1 94  ? 20.286  111.632 73.093  1.00 22.51  ? 235  LEU E CD1 1 
ATOM   4706  C CD2 . LEU G  1 94  ? 18.160  110.444 72.851  1.00 22.51  ? 235  LEU E CD2 1 
ATOM   4707  N N   . SER G  1 95  ? 17.699  111.568 67.716  1.00 30.56  ? 236  SER E N   1 
ATOM   4708  C CA  . SER G  1 95  ? 18.024  111.912 66.339  1.00 30.56  ? 236  SER E CA  1 
ATOM   4709  C C   . SER G  1 95  ? 16.780  112.484 65.668  1.00 30.56  ? 236  SER E C   1 
ATOM   4710  O O   . SER G  1 95  ? 15.764  112.648 66.318  1.00 30.56  ? 236  SER E O   1 
ATOM   4711  C CB  . SER G  1 95  ? 18.519  110.641 65.625  1.00 30.56  ? 236  SER E CB  1 
ATOM   4712  O OG  . SER G  1 95  ? 18.322  110.697 64.226  1.00 30.56  ? 236  SER E OG  1 
ATOM   4713  N N   . HIS G  1 96  ? 16.869  112.809 64.386  1.00 40.53  ? 237  HIS E N   1 
ATOM   4714  C CA  . HIS G  1 96  ? 15.714  113.314 63.660  1.00 40.53  ? 237  HIS E CA  1 
ATOM   4715  C C   . HIS G  1 96  ? 14.823  112.113 63.329  1.00 40.53  ? 237  HIS E C   1 
ATOM   4716  O O   . HIS G  1 96  ? 15.234  110.960 63.503  1.00 40.53  ? 237  HIS E O   1 
ATOM   4717  C CB  . HIS G  1 96  ? 16.141  113.971 62.357  1.00 40.53  ? 237  HIS E CB  1 
ATOM   4718  C CG  . HIS G  1 96  ? 16.752  115.323 62.527  1.00 40.53  ? 237  HIS E CG  1 
ATOM   4719  N ND1 . HIS G  1 96  ? 16.407  116.175 63.552  1.00 40.53  ? 237  HIS E ND1 1 
ATOM   4720  C CD2 . HIS G  1 96  ? 17.676  115.980 61.788  1.00 40.53  ? 237  HIS E CD2 1 
ATOM   4721  C CE1 . HIS G  1 96  ? 17.088  117.299 63.436  1.00 40.53  ? 237  HIS E CE1 1 
ATOM   4722  N NE2 . HIS G  1 96  ? 17.866  117.207 62.374  1.00 40.53  ? 237  HIS E NE2 1 
ATOM   4723  N N   . GLY G  1 97  ? 13.615  112.377 62.838  1.00 57.28  ? 238  GLY E N   1 
ATOM   4724  C CA  . GLY G  1 97  ? 12.718  111.288 62.510  1.00 57.28  ? 238  GLY E CA  1 
ATOM   4725  C C   . GLY G  1 97  ? 11.445  111.715 61.807  1.00 57.28  ? 238  GLY E C   1 
ATOM   4726  O O   . GLY G  1 97  ? 11.218  112.888 61.554  1.00 57.28  ? 238  GLY E O   1 
ATOM   4727  N N   . ASP G  1 98  ? 10.606  110.739 61.496  1.00 39.49  ? 239  ASP E N   1 
ATOM   4728  C CA  . ASP G  1 98  ? 9.347   110.982 60.816  1.00 39.49  ? 239  ASP E CA  1 
ATOM   4729  C C   . ASP G  1 98  ? 8.297   109.957 61.257  1.00 39.49  ? 239  ASP E C   1 
ATOM   4730  O O   . ASP G  1 98  ? 8.509   109.188 62.197  1.00 39.49  ? 239  ASP E O   1 
ATOM   4731  C CB  . ASP G  1 98  ? 9.556   110.881 59.313  1.00 39.49  ? 239  ASP E CB  1 
ATOM   4732  C CG  . ASP G  1 98  ? 8.854   111.962 58.572  1.00 39.49  ? 239  ASP E CG  1 
ATOM   4733  O OD1 . ASP G  1 98  ? 7.681   112.216 58.891  1.00 39.49  ? 239  ASP E OD1 1 
ATOM   4734  O OD2 . ASP G  1 98  ? 9.468   112.564 57.675  1.00 39.49  ? 239  ASP E OD2 1 
ATOM   4735  N N   . LYS G  1 99  ? 7.163   109.953 60.577  1.00 52.29  ? 240  LYS E N   1 
ATOM   4736  C CA  . LYS G  1 99  ? 6.102   109.027 60.909  1.00 52.29  ? 240  LYS E CA  1 
ATOM   4737  C C   . LYS G  1 99  ? 6.681   107.651 61.204  1.00 52.29  ? 240  LYS E C   1 
ATOM   4738  O O   . LYS G  1 99  ? 7.123   106.950 60.304  1.00 52.29  ? 240  LYS E O   1 
ATOM   4739  C CB  . LYS G  1 99  ? 5.137   108.915 59.742  1.00 52.29  ? 240  LYS E CB  1 
ATOM   4740  C CG  . LYS G  1 99  ? 5.851   108.493 58.458  1.00 52.29  ? 240  LYS E CG  1 
ATOM   4741  C CD  . LYS G  1 99  ? 4.996   108.725 57.215  1.00 52.29  ? 240  LYS E CD  1 
ATOM   4742  C CE  . LYS G  1 99  ? 5.344   107.746 56.097  1.00 52.29  ? 240  LYS E CE  1 
ATOM   4743  N NZ  . LYS G  1 99  ? 4.162   107.519 55.215  1.00 52.29  ? 240  LYS E NZ  1 
ATOM   4744  N N   . GLY G  1 100 ? 6.694   107.283 62.476  1.00 47.97  ? 241  GLY E N   1 
ATOM   4745  C CA  . GLY G  1 100 ? 7.176   105.974 62.878  1.00 47.97  ? 241  GLY E CA  1 
ATOM   4746  C C   . GLY G  1 100 ? 8.584   105.553 62.499  1.00 47.97  ? 241  GLY E C   1 
ATOM   4747  O O   . GLY G  1 100 ? 8.855   104.355 62.366  1.00 47.97  ? 241  GLY E O   1 
ATOM   4748  N N   . ILE G  1 101 ? 9.488   106.516 62.329  1.00 34.75  ? 242  ILE E N   1 
ATOM   4749  C CA  . ILE G  1 101 ? 10.867  106.188 61.982  1.00 34.75  ? 242  ILE E CA  1 
ATOM   4750  C C   . ILE G  1 101 ? 11.857  107.130 62.623  1.00 34.75  ? 242  ILE E C   1 
ATOM   4751  O O   . ILE G  1 101 ? 11.522  108.236 63.032  1.00 34.75  ? 242  ILE E O   1 
ATOM   4752  C CB  . ILE G  1 101 ? 11.153  106.271 60.482  1.00 34.75  ? 242  ILE E CB  1 
ATOM   4753  C CG1 . ILE G  1 101 ? 11.176  107.740 60.073  1.00 34.75  ? 242  ILE E CG1 1 
ATOM   4754  C CG2 . ILE G  1 101 ? 10.161  105.435 59.701  1.00 34.75  ? 242  ILE E CG2 1 
ATOM   4755  C CD1 . ILE G  1 101 ? 11.939  108.009 58.817  1.00 34.75  ? 242  ILE E CD1 1 
ATOM   4756  N N   . ILE G  1 102 ? 13.095  106.663 62.684  1.00 39.02  ? 243  ILE E N   1 
ATOM   4757  C CA  . ILE G  1 102 ? 14.190  107.414 63.244  1.00 39.02  ? 243  ILE E CA  1 
ATOM   4758  C C   . ILE G  1 102 ? 15.141  107.597 62.086  1.00 39.02  ? 243  ILE E C   1 
ATOM   4759  O O   . ILE G  1 102 ? 15.136  106.815 61.123  1.00 39.02  ? 243  ILE E O   1 
ATOM   4760  C CB  . ILE G  1 102 ? 14.841  106.641 64.400  1.00 39.02  ? 243  ILE E CB  1 
ATOM   4761  C CG1 . ILE G  1 102 ? 14.601  107.402 65.697  1.00 39.02  ? 243  ILE E CG1 1 
ATOM   4762  C CG2 . ILE G  1 102 ? 16.329  106.444 64.165  1.00 39.02  ? 243  ILE E CG2 1 
ATOM   4763  C CD1 . ILE G  1 102 ? 13.331  108.198 65.701  1.00 39.02  ? 243  ILE E CD1 1 
ATOM   4764  N N   . TYR G  1 103 ? 15.951  108.637 62.158  1.00 35.12  ? 244  TYR E N   1 
ATOM   4765  C CA  . TYR G  1 103 ? 16.857  108.891 61.066  1.00 35.12  ? 244  TYR E CA  1 
ATOM   4766  C C   . TYR G  1 103 ? 18.288  108.540 61.372  1.00 35.12  ? 244  TYR E C   1 
ATOM   4767  O O   . TYR G  1 103 ? 18.818  108.893 62.417  1.00 35.12  ? 244  TYR E O   1 
ATOM   4768  C CB  . TYR G  1 103 ? 16.784  110.363 60.666  1.00 35.12  ? 244  TYR E CB  1 
ATOM   4769  C CG  . TYR G  1 103 ? 15.833  110.658 59.526  1.00 35.12  ? 244  TYR E CG  1 
ATOM   4770  C CD1 . TYR G  1 103 ? 14.700  111.439 59.737  1.00 35.12  ? 244  TYR E CD1 1 
ATOM   4771  C CD2 . TYR G  1 103 ? 16.066  110.158 58.237  1.00 35.12  ? 244  TYR E CD2 1 
ATOM   4772  C CE1 . TYR G  1 103 ? 13.813  111.721 58.696  1.00 35.12  ? 244  TYR E CE1 1 
ATOM   4773  C CE2 . TYR G  1 103 ? 15.184  110.435 57.184  1.00 35.12  ? 244  TYR E CE2 1 
ATOM   4774  C CZ  . TYR G  1 103 ? 14.054  111.221 57.424  1.00 35.12  ? 244  TYR E CZ  1 
ATOM   4775  O OH  . TYR G  1 103 ? 13.154  111.511 56.413  1.00 35.12  ? 244  TYR E OH  1 
ATOM   4776  N N   . GLY G  1 104 ? 18.909  107.825 60.449  1.00 45.03  ? 245  GLY E N   1 
ATOM   4777  C CA  . GLY G  1 104 ? 20.304  107.510 60.617  1.00 45.03  ? 245  GLY E CA  1 
ATOM   4778  C C   . GLY G  1 104 ? 21.014  108.830 60.336  1.00 45.03  ? 245  GLY E C   1 
ATOM   4779  O O   . GLY G  1 104 ? 20.459  109.747 59.722  1.00 45.03  ? 245  GLY E O   1 
ATOM   4780  N N   . THR G  1 105 ? 22.250  108.942 60.786  1.00 34.00  ? 246  THR E N   1 
ATOM   4781  C CA  . THR G  1 105 ? 23.003  110.156 60.574  1.00 34.00  ? 246  THR E CA  1 
ATOM   4782  C C   . THR G  1 105 ? 23.344  110.353 59.097  1.00 34.00  ? 246  THR E C   1 
ATOM   4783  O O   . THR G  1 105 ? 24.024  111.301 58.738  1.00 34.00  ? 246  THR E O   1 
ATOM   4784  C CB  . THR G  1 105 ? 24.275  110.117 61.442  1.00 34.00  ? 246  THR E CB  1 
ATOM   4785  O OG1 . THR G  1 105 ? 24.527  111.423 61.976  1.00 34.00  ? 246  THR E OG1 1 
ATOM   4786  C CG2 . THR G  1 105 ? 25.479  109.597 60.635  1.00 34.00  ? 246  THR E CG2 1 
ATOM   4787  N N   . ASP G  1 106 ? 22.844  109.471 58.244  1.00 40.13  ? 247  ASP E N   1 
ATOM   4788  C CA  . ASP G  1 106 ? 23.118  109.552 56.811  1.00 40.13  ? 247  ASP E CA  1 
ATOM   4789  C C   . ASP G  1 106 ? 21.852  109.788 55.991  1.00 40.13  ? 247  ASP E C   1 
ATOM   4790  O O   . ASP G  1 106 ? 21.873  109.752 54.758  1.00 40.13  ? 247  ASP E O   1 
ATOM   4791  C CB  . ASP G  1 106 ? 23.787  108.261 56.335  1.00 40.13  ? 247  ASP E CB  1 
ATOM   4792  C CG  . ASP G  1 106 ? 22.961  107.024 56.659  1.00 40.13  ? 247  ASP E CG  1 
ATOM   4793  O OD1 . ASP G  1 106 ? 22.014  107.156 57.464  1.00 40.13  ? 247  ASP E OD1 1 
ATOM   4794  O OD2 . ASP G  1 106 ? 23.249  105.924 56.122  1.00 40.13  ? 247  ASP E OD2 1 
ATOM   4795  N N   . GLY G  1 107 ? 20.745  110.021 56.678  1.00 34.68  ? 248  GLY E N   1 
ATOM   4796  C CA  . GLY G  1 107 ? 19.508  110.259 55.972  1.00 34.68  ? 248  GLY E CA  1 
ATOM   4797  C C   . GLY G  1 107 ? 18.717  108.986 55.775  1.00 34.68  ? 248  GLY E C   1 
ATOM   4798  O O   . GLY G  1 107 ? 17.505  109.042 55.578  1.00 34.68  ? 248  GLY E O   1 
ATOM   4799  N N   . GLN G  1 108 ? 19.393  107.842 55.800  1.00 43.47  ? 254  GLN E N   1 
ATOM   4800  C CA  . GLN G  1 108 ? 18.702  106.573 55.641  1.00 43.47  ? 254  GLN E CA  1 
ATOM   4801  C C   . GLN G  1 108 ? 17.755  106.516 56.812  1.00 43.47  ? 254  GLN E C   1 
ATOM   4802  O O   . GLN G  1 108 ? 17.968  107.229 57.794  1.00 43.47  ? 254  GLN E O   1 
ATOM   4803  C CB  . GLN G  1 108 ? 19.695  105.430 55.722  1.00 43.47  ? 254  GLN E CB  1 
ATOM   4804  C CG  . GLN G  1 108 ? 20.413  105.198 54.430  1.00 43.47  ? 254  GLN E CG  1 
ATOM   4805  C CD  . GLN G  1 108 ? 19.453  105.092 53.270  1.00 43.47  ? 254  GLN E CD  1 
ATOM   4806  O OE1 . GLN G  1 108 ? 18.515  104.289 53.297  1.00 43.47  ? 254  GLN E OE1 1 
ATOM   4807  N NE2 . GLN G  1 108 ? 19.673  105.906 52.243  1.00 43.47  ? 254  GLN E NE2 1 
ATOM   4808  N N   . GLU G  1 109 ? 16.713  105.696 56.740  1.00 47.21  ? 255  GLU E N   1 
ATOM   4809  C CA  . GLU G  1 109 ? 15.790  105.639 57.871  1.00 47.21  ? 255  GLU E CA  1 
ATOM   4810  C C   . GLU G  1 109 ? 15.581  104.240 58.446  1.00 47.21  ? 255  GLU E C   1 
ATOM   4811  O O   . GLU G  1 109 ? 15.779  103.246 57.761  1.00 47.21  ? 255  GLU E O   1 
ATOM   4812  C CB  . GLU G  1 109 ? 14.446  106.244 57.476  1.00 47.21  ? 255  GLU E CB  1 
ATOM   4813  C CG  . GLU G  1 109 ? 13.999  105.935 56.057  1.00 47.21  ? 255  GLU E CG  1 
ATOM   4814  C CD  . GLU G  1 109 ? 12.678  106.618 55.705  1.00 47.21  ? 255  GLU E CD  1 
ATOM   4815  O OE1 . GLU G  1 109 ? 11.650  105.912 55.644  1.00 47.21  ? 255  GLU E OE1 1 
ATOM   4816  O OE2 . GLU G  1 109 ? 12.667  107.856 55.493  1.00 47.21  ? 255  GLU E OE2 1 
ATOM   4817  N N   . ALA G  1 110 ? 15.179  104.169 59.710  1.00 45.46  ? 256  ALA E N   1 
ATOM   4818  C CA  . ALA G  1 110 ? 14.934  102.890 60.357  1.00 45.46  ? 256  ALA E CA  1 
ATOM   4819  C C   . ALA G  1 110 ? 13.613  102.924 61.145  1.00 45.46  ? 256  ALA E C   1 
ATOM   4820  O O   . ALA G  1 110 ? 13.484  103.664 62.117  1.00 45.46  ? 256  ALA E O   1 
ATOM   4821  C CB  . ALA G  1 110 ? 16.081  102.579 61.279  1.00 45.46  ? 256  ALA E CB  1 
ATOM   4822  N N   . PRO G  1 111 ? 12.620  102.114 60.748  1.00 33.95  ? 257  PRO E N   1 
ATOM   4823  C CA  . PRO G  1 111 ? 11.353  102.134 61.486  1.00 33.95  ? 257  PRO E CA  1 
ATOM   4824  C C   . PRO G  1 111 ? 11.604  101.877 62.955  1.00 33.95  ? 257  PRO E C   1 
ATOM   4825  O O   . PRO G  1 111 ? 12.465  101.071 63.296  1.00 33.95  ? 257  PRO E O   1 
ATOM   4826  C CB  . PRO G  1 111 ? 10.541  101.002 60.861  1.00 33.95  ? 257  PRO E CB  1 
ATOM   4827  C CG  . PRO G  1 111 ? 11.126  100.809 59.533  1.00 33.95  ? 257  PRO E CG  1 
ATOM   4828  C CD  . PRO G  1 111 ? 12.596  101.145 59.648  1.00 33.95  ? 257  PRO E CD  1 
ATOM   4829  N N   . ILE G  1 112 ? 10.868  102.561 63.826  1.00 41.40  ? 258  ILE E N   1 
ATOM   4830  C CA  . ILE G  1 112 ? 11.041  102.343 65.257  1.00 41.40  ? 258  ILE E CA  1 
ATOM   4831  C C   . ILE G  1 112 ? 10.811  100.852 65.524  1.00 41.40  ? 258  ILE E C   1 
ATOM   4832  O O   . ILE G  1 112 ? 11.522  100.231 66.322  1.00 41.40  ? 258  ILE E O   1 
ATOM   4833  C CB  . ILE G  1 112 ? 10.034  103.152 66.085  1.00 41.40  ? 258  ILE E CB  1 
ATOM   4834  C CG1 . ILE G  1 112 ? 10.128  104.634 65.717  1.00 41.40  ? 258  ILE E CG1 1 
ATOM   4835  C CG2 . ILE G  1 112 ? 10.270  102.909 67.564  1.00 41.40  ? 258  ILE E CG2 1 
ATOM   4836  C CD1 . ILE G  1 112 ? 11.180  105.386 66.462  1.00 41.40  ? 258  ILE E CD1 1 
ATOM   4837  N N   . TYR G  1 113 ? 9.829   100.275 64.834  1.00 54.02  ? 259  TYR E N   1 
ATOM   4838  C CA  . TYR G  1 113 ? 9.525   98.864  65.000  1.00 54.02  ? 259  TYR E CA  1 
ATOM   4839  C C   . TYR G  1 113 ? 10.710  97.937  64.741  1.00 54.02  ? 259  TYR E C   1 
ATOM   4840  O O   . TYR G  1 113 ? 10.871  96.935  65.421  1.00 54.02  ? 259  TYR E O   1 
ATOM   4841  C CB  . TYR G  1 113 ? 8.391   98.451  64.083  1.00 54.02  ? 259  TYR E CB  1 
ATOM   4842  C CG  . TYR G  1 113 ? 7.978   97.015  64.300  1.00 54.02  ? 259  TYR E CG  1 
ATOM   4843  C CD1 . TYR G  1 113 ? 7.183   96.653  65.405  1.00 54.02  ? 259  TYR E CD1 1 
ATOM   4844  C CD2 . TYR G  1 113 ? 8.364   96.014  63.401  1.00 54.02  ? 259  TYR E CD2 1 
ATOM   4845  C CE1 . TYR G  1 113 ? 6.778   95.326  65.608  1.00 54.02  ? 259  TYR E CE1 1 
ATOM   4846  C CE2 . TYR G  1 113 ? 7.969   94.680  63.590  1.00 54.02  ? 259  TYR E CE2 1 
ATOM   4847  C CZ  . TYR G  1 113 ? 7.178   94.344  64.692  1.00 54.02  ? 259  TYR E CZ  1 
ATOM   4848  O OH  . TYR G  1 113 ? 6.796   93.033  64.868  1.00 54.02  ? 259  TYR E OH  1 
ATOM   4849  N N   . GLU G  1 114 ? 11.519  98.252  63.742  1.00 58.95  ? 260  GLU E N   1 
ATOM   4850  C CA  . GLU G  1 114 ? 12.668  97.416  63.441  1.00 58.95  ? 260  GLU E CA  1 
ATOM   4851  C C   . GLU G  1 114 ? 13.614  97.348  64.628  1.00 58.95  ? 260  GLU E C   1 
ATOM   4852  O O   . GLU G  1 114 ? 14.030  96.270  65.047  1.00 58.95  ? 260  GLU E O   1 
ATOM   4853  C CB  . GLU G  1 114 ? 13.433  97.961  62.237  1.00 58.95  ? 260  GLU E CB  1 
ATOM   4854  C CG  . GLU G  1 114 ? 12.649  97.964  60.943  1.00 58.95  ? 260  GLU E CG  1 
ATOM   4855  C CD  . GLU G  1 114 ? 12.397  96.569  60.401  1.00 58.95  ? 260  GLU E CD  1 
ATOM   4856  O OE1 . GLU G  1 114 ? 12.037  95.674  61.204  1.00 58.95  ? 260  GLU E OE1 1 
ATOM   4857  O OE2 . GLU G  1 114 ? 12.553  96.377  59.170  1.00 58.95  ? 260  GLU E OE2 1 
ATOM   4858  N N   . LEU G  1 115 ? 13.960  98.507  65.165  1.00 39.22  ? 261  LEU E N   1 
ATOM   4859  C CA  . LEU G  1 115 ? 14.872  98.574  66.298  1.00 39.22  ? 261  LEU E CA  1 
ATOM   4860  C C   . LEU G  1 115 ? 14.266  97.906  67.517  1.00 39.22  ? 261  LEU E C   1 
ATOM   4861  O O   . LEU G  1 115 ? 14.910  97.118  68.195  1.00 39.22  ? 261  LEU E O   1 
ATOM   4862  C CB  . LEU G  1 115 ? 15.187  100.027 66.639  1.00 39.22  ? 261  LEU E CB  1 
ATOM   4863  C CG  . LEU G  1 115 ? 15.324  100.964 65.444  1.00 39.22  ? 261  LEU E CG  1 
ATOM   4864  C CD1 . LEU G  1 115 ? 15.755  102.336 65.936  1.00 39.22  ? 261  LEU E CD1 1 
ATOM   4865  C CD2 . LEU G  1 115 ? 16.336  100.400 64.439  1.00 39.22  ? 261  LEU E CD2 1 
ATOM   4866  N N   . THR G  1 116 ? 13.013  98.237  67.783  1.00 41.50  ? 262  THR E N   1 
ATOM   4867  C CA  . THR G  1 116 ? 12.287  97.707  68.918  1.00 41.50  ? 262  THR E CA  1 
ATOM   4868  C C   . THR G  1 116 ? 12.154  96.191  68.904  1.00 41.50  ? 262  THR E C   1 
ATOM   4869  O O   . THR G  1 116 ? 12.461  95.536  69.901  1.00 41.50  ? 262  THR E O   1 
ATOM   4870  C CB  . THR G  1 116 ? 10.912  98.358  68.968  1.00 41.50  ? 262  THR E CB  1 
ATOM   4871  O OG1 . THR G  1 116 ? 10.809  99.093  70.184  1.00 41.50  ? 262  THR E OG1 1 
ATOM   4872  C CG2 . THR G  1 116 ? 9.791   97.316  68.885  1.00 41.50  ? 262  THR E CG2 1 
ATOM   4873  N N   . SER G  1 117 ? 11.714  95.658  67.761  1.00 50.21  ? 263  SER E N   1 
ATOM   4874  C CA  . SER G  1 117 ? 11.480  94.232  67.541  1.00 50.21  ? 263  SER E CA  1 
ATOM   4875  C C   . SER G  1 117 ? 12.728  93.352  67.503  1.00 50.21  ? 263  SER E C   1 
ATOM   4876  O O   . SER G  1 117 ? 12.647  92.149  67.233  1.00 50.21  ? 263  SER E O   1 
ATOM   4877  C CB  . SER G  1 117 ? 10.674  94.044  66.249  1.00 50.21  ? 263  SER E CB  1 
ATOM   4878  O OG  . SER G  1 117 ? 11.516  93.842  65.131  1.00 50.21  ? 263  SER E OG  1 
ATOM   4879  N N   . GLN G  1 118 ? 13.879  93.946  67.791  1.00 58.77  ? 264  GLN E N   1 
ATOM   4880  C CA  . GLN G  1 118 ? 15.144  93.220  67.806  1.00 58.77  ? 264  GLN E CA  1 
ATOM   4881  C C   . GLN G  1 118 ? 15.379  92.475  69.118  1.00 58.77  ? 264  GLN E C   1 
ATOM   4882  O O   . GLN G  1 118 ? 16.095  91.483  69.153  1.00 58.77  ? 264  GLN E O   1 
ATOM   4883  C CB  . GLN G  1 118 ? 16.295  94.194  67.600  1.00 58.77  ? 264  GLN E CB  1 
ATOM   4884  C CG  . GLN G  1 118 ? 17.444  93.620  66.826  1.00 58.77  ? 264  GLN E CG  1 
ATOM   4885  C CD  . GLN G  1 118 ? 17.548  94.245  65.469  1.00 58.77  ? 264  GLN E CD  1 
ATOM   4886  O OE1 . GLN G  1 118 ? 16.535  94.386  64.768  1.00 58.77  ? 264  GLN E OE1 1 
ATOM   4887  N NE2 . GLN G  1 118 ? 18.770  94.641  65.079  1.00 58.77  ? 264  GLN E NE2 1 
ATOM   4888  N N   . PHE G  1 119 ? 14.778  92.956  70.196  1.00 37.64  ? 265  PHE E N   1 
ATOM   4889  C CA  . PHE G  1 119 ? 14.978  92.340  71.491  1.00 37.64  ? 265  PHE E CA  1 
ATOM   4890  C C   . PHE G  1 119 ? 13.757  91.589  72.049  1.00 37.64  ? 265  PHE E C   1 
ATOM   4891  O O   . PHE G  1 119 ? 13.487  91.590  73.266  1.00 37.64  ? 265  PHE E O   1 
ATOM   4892  C CB  . PHE G  1 119 ? 15.435  93.404  72.480  1.00 37.64  ? 265  PHE E CB  1 
ATOM   4893  C CG  . PHE G  1 119 ? 16.626  94.198  72.012  1.00 37.64  ? 265  PHE E CG  1 
ATOM   4894  C CD1 . PHE G  1 119 ? 16.505  95.138  70.995  1.00 37.64  ? 265  PHE E CD1 1 
ATOM   4895  C CD2 . PHE G  1 119 ? 17.869  94.028  72.615  1.00 37.64  ? 265  PHE E CD2 1 
ATOM   4896  C CE1 . PHE G  1 119 ? 17.613  95.903  70.587  1.00 37.64  ? 265  PHE E CE1 1 
ATOM   4897  C CE2 . PHE G  1 119 ? 18.973  94.786  72.214  1.00 37.64  ? 265  PHE E CE2 1 
ATOM   4898  C CZ  . PHE G  1 119 ? 18.842  95.724  71.199  1.00 37.64  ? 265  PHE E CZ  1 
ATOM   4899  N N   . THR G  1 120 ? 13.020  90.933  71.164  1.00 36.38  ? 266  THR E N   1 
ATOM   4900  C CA  . THR G  1 120 ? 11.873  90.171  71.606  1.00 36.38  ? 266  THR E CA  1 
ATOM   4901  C C   . THR G  1 120 ? 12.368  89.023  72.514  1.00 36.38  ? 266  THR E C   1 
ATOM   4902  O O   . THR G  1 120 ? 13.542  88.964  72.893  1.00 36.38  ? 266  THR E O   1 
ATOM   4903  C CB  . THR G  1 120 ? 11.120  89.615  70.404  1.00 36.38  ? 266  THR E CB  1 
ATOM   4904  O OG1 . THR G  1 120 ? 11.705  88.379  70.012  1.00 36.38  ? 266  THR E OG1 1 
ATOM   4905  C CG2 . THR G  1 120 ? 11.232  90.557  69.240  1.00 36.38  ? 266  THR E CG2 1 
ATOM   4906  N N   . GLY G  1 121 ? 11.473  88.116  72.879  1.00 44.14  ? 267  GLY E N   1 
ATOM   4907  C CA  . GLY G  1 121 ? 11.885  87.023  73.736  1.00 44.14  ? 267  GLY E CA  1 
ATOM   4908  C C   . GLY G  1 121 ? 12.591  85.969  72.919  1.00 44.14  ? 267  GLY E C   1 
ATOM   4909  O O   . GLY G  1 121 ? 13.496  85.300  73.409  1.00 44.14  ? 267  GLY E O   1 
ATOM   4910  N N   . LEU G  1 122 ? 12.170  85.819  71.666  1.00 48.71  ? 268  LEU E N   1 
ATOM   4911  C CA  . LEU G  1 122 ? 12.759  84.832  70.780  1.00 48.71  ? 268  LEU E CA  1 
ATOM   4912  C C   . LEU G  1 122 ? 14.110  85.361  70.365  1.00 48.71  ? 268  LEU E C   1 
ATOM   4913  O O   . LEU G  1 122 ? 15.129  84.721  70.593  1.00 48.71  ? 268  LEU E O   1 
ATOM   4914  C CB  . LEU G  1 122 ? 11.872  84.598  69.543  1.00 48.71  ? 268  LEU E CB  1 
ATOM   4915  C CG  . LEU G  1 122 ? 10.525  83.865  69.729  1.00 48.71  ? 268  LEU E CG  1 
ATOM   4916  C CD1 . LEU G  1 122 ? 9.787   83.817  68.407  1.00 48.71  ? 268  LEU E CD1 1 
ATOM   4917  C CD2 . LEU G  1 122 ? 10.741  82.437  70.251  1.00 48.71  ? 268  LEU E CD2 1 
ATOM   4918  N N   . LYS G  1 123 ? 14.119  86.555  69.789  1.00 44.32  ? 269  LYS E N   1 
ATOM   4919  C CA  . LYS G  1 123 ? 15.353  87.182  69.325  1.00 44.32  ? 269  LYS E CA  1 
ATOM   4920  C C   . LYS G  1 123 ? 16.453  87.284  70.381  1.00 44.32  ? 269  LYS E C   1 
ATOM   4921  O O   . LYS G  1 123 ? 17.628  87.179  70.059  1.00 44.32  ? 269  LYS E O   1 
ATOM   4922  C CB  . LYS G  1 123 ? 15.038  88.567  68.774  1.00 44.32  ? 269  LYS E CB  1 
ATOM   4923  C CG  . LYS G  1 123 ? 14.540  88.548  67.349  1.00 44.32  ? 269  LYS E CG  1 
ATOM   4924  C CD  . LYS G  1 123 ? 15.380  89.471  66.480  1.00 44.32  ? 269  LYS E CD  1 
ATOM   4925  C CE  . LYS G  1 123 ? 15.232  89.155  64.988  1.00 44.32  ? 269  LYS E CE  1 
ATOM   4926  N NZ  . LYS G  1 123 ? 16.263  89.867  64.149  1.00 44.32  ? 269  LYS E NZ  1 
ATOM   4927  N N   . CYS G  1 124 ? 16.075  87.485  71.637  1.00 30.57  ? 270  CYS E N   1 
ATOM   4928  C CA  . CYS G  1 124 ? 17.063  87.609  72.690  1.00 30.57  ? 270  CYS E CA  1 
ATOM   4929  C C   . CYS G  1 124 ? 16.554  87.019  73.996  1.00 30.57  ? 270  CYS E C   1 
ATOM   4930  O O   . CYS G  1 124 ? 16.243  87.738  74.961  1.00 30.57  ? 270  CYS E O   1 
ATOM   4931  C CB  . CYS G  1 124 ? 17.439  89.072  72.868  1.00 30.57  ? 270  CYS E CB  1 
ATOM   4932  S SG  . CYS G  1 124 ? 18.331  89.445  74.396  1.00 30.57  ? 270  CYS E SG  1 
ATOM   4933  N N   . PRO G  1 125 ? 16.476  85.683  74.041  1.00 35.11  ? 271  PRO E N   1 
ATOM   4934  C CA  . PRO G  1 125 ? 16.011  84.931  75.205  1.00 35.11  ? 271  PRO E CA  1 
ATOM   4935  C C   . PRO G  1 125 ? 16.733  85.284  76.494  1.00 35.11  ? 271  PRO E C   1 
ATOM   4936  O O   . PRO G  1 125 ? 16.161  85.196  77.589  1.00 35.11  ? 271  PRO E O   1 
ATOM   4937  C CB  . PRO G  1 125 ? 16.240  83.479  74.808  1.00 35.11  ? 271  PRO E CB  1 
ATOM   4938  C CG  . PRO G  1 125 ? 17.164  83.531  73.649  1.00 35.11  ? 271  PRO E CG  1 
ATOM   4939  C CD  . PRO G  1 125 ? 16.843  84.787  72.938  1.00 35.11  ? 271  PRO E CD  1 
ATOM   4940  N N   . SER G  1 126 ? 17.988  85.687  76.377  1.00 36.09  ? 272  SER E N   1 
ATOM   4941  C CA  . SER G  1 126 ? 18.746  86.023  77.572  1.00 36.09  ? 272  SER E CA  1 
ATOM   4942  C C   . SER G  1 126 ? 18.120  87.225  78.281  1.00 36.09  ? 272  SER E C   1 
ATOM   4943  O O   . SER G  1 126 ? 18.573  87.635  79.356  1.00 36.09  ? 272  SER E O   1 
ATOM   4944  C CB  . SER G  1 126 ? 20.205  86.301  77.199  1.00 36.09  ? 272  SER E CB  1 
ATOM   4945  O OG  . SER G  1 126 ? 20.351  87.543  76.540  1.00 36.09  ? 272  SER E OG  1 
ATOM   4946  N N   . LEU G  1 127 ? 17.068  87.774  77.674  1.00 48.60  ? 273  LEU E N   1 
ATOM   4947  C CA  . LEU G  1 127 ? 16.371  88.938  78.226  1.00 48.60  ? 273  LEU E CA  1 
ATOM   4948  C C   . LEU G  1 127 ? 14.895  88.647  78.507  1.00 48.60  ? 273  LEU E C   1 
ATOM   4949  O O   . LEU G  1 127 ? 14.233  89.387  79.240  1.00 48.60  ? 273  LEU E O   1 
ATOM   4950  C CB  . LEU G  1 127 ? 16.480  90.132  77.263  1.00 48.60  ? 273  LEU E CB  1 
ATOM   4951  C CG  . LEU G  1 127 ? 17.453  91.256  77.655  1.00 48.60  ? 273  LEU E CG  1 
ATOM   4952  C CD1 . LEU G  1 127 ? 17.441  92.353  76.597  1.00 48.60  ? 273  LEU E CD1 1 
ATOM   4953  C CD2 . LEU G  1 127 ? 17.070  91.816  79.007  1.00 48.60  ? 273  LEU E CD2 1 
ATOM   4954  N N   . ALA G  1 128 ? 14.388  87.570  77.916  1.00 39.60  ? 274  ALA E N   1 
ATOM   4955  C CA  . ALA G  1 128 ? 12.997  87.171  78.103  1.00 39.60  ? 274  ALA E CA  1 
ATOM   4956  C C   . ALA G  1 128 ? 12.527  87.360  79.546  1.00 39.60  ? 274  ALA E C   1 
ATOM   4957  O O   . ALA G  1 128 ? 13.182  86.904  80.472  1.00 39.60  ? 274  ALA E O   1 
ATOM   4958  C CB  . ALA G  1 128 ? 12.820  85.712  77.687  1.00 39.60  ? 274  ALA E CB  1 
ATOM   4959  N N   . GLY G  1 129 ? 11.394  88.038  79.725  1.00 45.45  ? 275  GLY E N   1 
ATOM   4960  C CA  . GLY G  1 129 ? 10.863  88.257  81.056  1.00 45.45  ? 275  GLY E CA  1 
ATOM   4961  C C   . GLY G  1 129 ? 11.438  89.459  81.787  1.00 45.45  ? 275  GLY E C   1 
ATOM   4962  O O   . GLY G  1 129 ? 11.012  89.785  82.897  1.00 45.45  ? 275  GLY E O   1 
ATOM   4963  N N   . LYS G  1 130 ? 12.421  90.116  81.188  1.00 45.25  ? 276  LYS E N   1 
ATOM   4964  C CA  . LYS G  1 130 ? 13.018  91.284  81.822  1.00 45.25  ? 276  LYS E CA  1 
ATOM   4965  C C   . LYS G  1 130 ? 12.585  92.501  81.029  1.00 45.25  ? 276  LYS E C   1 
ATOM   4966  O O   . LYS G  1 130 ? 12.402  92.445  79.808  1.00 45.25  ? 276  LYS E O   1 
ATOM   4967  C CB  . LYS G  1 130 ? 14.552  91.194  81.842  1.00 45.25  ? 276  LYS E CB  1 
ATOM   4968  C CG  . LYS G  1 130 ? 15.110  89.849  82.285  1.00 45.25  ? 276  LYS E CG  1 
ATOM   4969  C CD  . LYS G  1 130 ? 16.499  89.992  82.902  1.00 45.25  ? 276  LYS E CD  1 
ATOM   4970  C CE  . LYS G  1 130 ? 17.147  88.627  83.175  1.00 45.25  ? 276  LYS E CE  1 
ATOM   4971  N NZ  . LYS G  1 130 ? 17.941  88.099  82.018  1.00 45.25  ? 276  LYS E NZ  1 
ATOM   4972  N N   . PRO G  1 131 ? 12.448  93.633  81.713  1.00 38.56  ? 277  PRO E N   1 
ATOM   4973  C CA  . PRO G  1 131 ? 12.023  94.882  81.084  1.00 38.56  ? 277  PRO E CA  1 
ATOM   4974  C C   . PRO G  1 131 ? 12.969  95.339  80.002  1.00 38.56  ? 277  PRO E C   1 
ATOM   4975  O O   . PRO G  1 131 ? 14.176  95.318  80.184  1.00 38.56  ? 277  PRO E O   1 
ATOM   4976  C CB  . PRO G  1 131 ? 11.997  95.870  82.241  1.00 38.56  ? 277  PRO E CB  1 
ATOM   4977  C CG  . PRO G  1 131 ? 12.966  95.288  83.242  1.00 38.56  ? 277  PRO E CG  1 
ATOM   4978  C CD  . PRO G  1 131 ? 12.756  93.806  83.143  1.00 38.56  ? 277  PRO E CD  1 
ATOM   4979  N N   . LYS G  1 132 ? 12.415  95.759  78.878  1.00 34.21  ? 278  LYS E N   1 
ATOM   4980  C CA  . LYS G  1 132 ? 13.218  96.262  77.781  1.00 34.21  ? 278  LYS E CA  1 
ATOM   4981  C C   . LYS G  1 132 ? 12.647  97.645  77.452  1.00 34.21  ? 278  LYS E C   1 
ATOM   4982  O O   . LYS G  1 132 ? 11.594  97.764  76.829  1.00 34.21  ? 278  LYS E O   1 
ATOM   4983  C CB  . LYS G  1 132 ? 13.121  95.319  76.584  1.00 34.21  ? 278  LYS E CB  1 
ATOM   4984  C CG  . LYS G  1 132 ? 13.247  93.849  76.955  1.00 34.21  ? 278  LYS E CG  1 
ATOM   4985  C CD  . LYS G  1 132 ? 13.007  92.970  75.724  1.00 34.21  ? 278  LYS E CD  1 
ATOM   4986  C CE  . LYS G  1 132 ? 12.203  91.701  76.038  1.00 34.21  ? 278  LYS E CE  1 
ATOM   4987  N NZ  . LYS G  1 132 ? 12.343  91.255  77.459  1.00 34.21  ? 278  LYS E NZ  1 
ATOM   4988  N N   . VAL G  1 133 ? 13.355  98.684  77.881  1.00 29.08  ? 279  VAL E N   1 
ATOM   4989  C CA  . VAL G  1 133 ? 12.935  100.062 77.695  1.00 29.08  ? 279  VAL E CA  1 
ATOM   4990  C C   . VAL G  1 133 ? 13.607  100.811 76.558  1.00 29.08  ? 279  VAL E C   1 
ATOM   4991  O O   . VAL G  1 133 ? 14.803  100.677 76.340  1.00 29.08  ? 279  VAL E O   1 
ATOM   4992  C CB  . VAL G  1 133 ? 13.204  100.824 78.962  1.00 29.08  ? 279  VAL E CB  1 
ATOM   4993  C CG1 . VAL G  1 133 ? 12.665  102.205 78.852  1.00 29.08  ? 279  VAL E CG1 1 
ATOM   4994  C CG2 . VAL G  1 133 ? 12.585  100.091 80.127  1.00 29.08  ? 279  VAL E CG2 1 
ATOM   4995  N N   . PHE G  1 134 ? 12.839  101.629 75.852  1.00 35.96  ? 280  PHE E N   1 
ATOM   4996  C CA  . PHE G  1 134 ? 13.382  102.413 74.754  1.00 35.96  ? 280  PHE E CA  1 
ATOM   4997  C C   . PHE G  1 134 ? 12.906  103.821 74.875  1.00 35.96  ? 280  PHE E C   1 
ATOM   4998  O O   . PHE G  1 134 ? 11.756  104.051 75.196  1.00 35.96  ? 280  PHE E O   1 
ATOM   4999  C CB  . PHE G  1 134 ? 12.905  101.878 73.422  1.00 35.96  ? 280  PHE E CB  1 
ATOM   5000  C CG  . PHE G  1 134 ? 13.554  100.609 73.041  1.00 35.96  ? 280  PHE E CG  1 
ATOM   5001  C CD1 . PHE G  1 134 ? 13.338  99.453  73.802  1.00 35.96  ? 280  PHE E CD1 1 
ATOM   5002  C CD2 . PHE G  1 134 ? 14.420  100.564 71.953  1.00 35.96  ? 280  PHE E CD2 1 
ATOM   5003  C CE1 . PHE G  1 134 ? 13.979  98.266  73.489  1.00 35.96  ? 280  PHE E CE1 1 
ATOM   5004  C CE2 . PHE G  1 134 ? 15.073  99.380  71.626  1.00 35.96  ? 280  PHE E CE2 1 
ATOM   5005  C CZ  . PHE G  1 134 ? 14.852  98.224  72.398  1.00 35.96  ? 280  PHE E CZ  1 
ATOM   5006  N N   . PHE G  1 135 ? 13.782  104.765 74.585  1.00 29.57  ? 281  PHE E N   1 
ATOM   5007  C CA  . PHE G  1 135 ? 13.415  106.154 74.673  1.00 29.57  ? 281  PHE E CA  1 
ATOM   5008  C C   . PHE G  1 135 ? 13.754  106.857 73.386  1.00 29.57  ? 281  PHE E C   1 
ATOM   5009  O O   . PHE G  1 135 ? 14.826  107.414 73.237  1.00 29.57  ? 281  PHE E O   1 
ATOM   5010  C CB  . PHE G  1 135 ? 14.147  106.815 75.824  1.00 29.57  ? 281  PHE E CB  1 
ATOM   5011  C CG  . PHE G  1 135 ? 13.703  106.341 77.161  1.00 29.57  ? 281  PHE E CG  1 
ATOM   5012  C CD1 . PHE G  1 135 ? 14.585  105.696 78.010  1.00 29.57  ? 281  PHE E CD1 1 
ATOM   5013  C CD2 . PHE G  1 135 ? 12.408  106.570 77.593  1.00 29.57  ? 281  PHE E CD2 1 
ATOM   5014  C CE1 . PHE G  1 135 ? 14.189  105.289 79.282  1.00 29.57  ? 281  PHE E CE1 1 
ATOM   5015  C CE2 . PHE G  1 135 ? 11.982  106.171 78.869  1.00 29.57  ? 281  PHE E CE2 1 
ATOM   5016  C CZ  . PHE G  1 135 ? 12.878  105.528 79.718  1.00 29.57  ? 281  PHE E CZ  1 
ATOM   5017  N N   . ILE G  1 136 ? 12.842  106.829 72.438  1.00 27.33  ? 282  ILE E N   1 
ATOM   5018  C CA  . ILE G  1 136 ? 13.112  107.506 71.199  1.00 27.33  ? 282  ILE E CA  1 
ATOM   5019  C C   . ILE G  1 136 ? 12.797  108.987 71.343  1.00 27.33  ? 282  ILE E C   1 
ATOM   5020  O O   . ILE G  1 136 ? 11.707  109.373 71.752  1.00 27.33  ? 282  ILE E O   1 
ATOM   5021  C CB  . ILE G  1 136 ? 12.267  106.949 70.055  1.00 27.33  ? 282  ILE E CB  1 
ATOM   5022  C CG1 . ILE G  1 136 ? 12.801  105.587 69.645  1.00 27.33  ? 282  ILE E CG1 1 
ATOM   5023  C CG2 . ILE G  1 136 ? 12.285  107.923 68.876  1.00 27.33  ? 282  ILE E CG2 1 
ATOM   5024  C CD1 . ILE G  1 136 ? 13.111  104.707 70.821  1.00 27.33  ? 282  ILE E CD1 1 
ATOM   5025  N N   . GLN G  1 137 ? 13.769  109.817 71.020  1.00 39.22  ? 283  GLN E N   1 
ATOM   5026  C CA  . GLN G  1 137 ? 13.573  111.245 71.073  1.00 39.22  ? 283  GLN E CA  1 
ATOM   5027  C C   . GLN G  1 137 ? 13.928  111.792 69.680  1.00 39.22  ? 283  GLN E C   1 
ATOM   5028  O O   . GLN G  1 137 ? 15.096  112.034 69.342  1.00 39.22  ? 283  GLN E O   1 
ATOM   5029  C CB  . GLN G  1 137 ? 14.439  111.865 72.170  1.00 39.22  ? 283  GLN E CB  1 
ATOM   5030  C CG  . GLN G  1 137 ? 14.995  113.237 71.848  1.00 39.22  ? 283  GLN E CG  1 
ATOM   5031  C CD  . GLN G  1 137 ? 13.914  114.253 71.603  1.00 39.22  ? 283  GLN E CD  1 
ATOM   5032  O OE1 . GLN G  1 137 ? 12.900  113.954 70.996  1.00 39.22  ? 283  GLN E OE1 1 
ATOM   5033  N NE2 . GLN G  1 137 ? 14.119  115.463 72.079  1.00 39.22  ? 283  GLN E NE2 1 
ATOM   5034  N N   . ALA G  1 138 ? 12.884  111.943 68.867  1.00 37.42  ? 284  ALA E N   1 
ATOM   5035  C CA  . ALA G  1 138 ? 12.996  112.453 67.509  1.00 37.42  ? 284  ALA E CA  1 
ATOM   5036  C C   . ALA G  1 138 ? 11.634  113.007 67.121  1.00 37.42  ? 284  ALA E C   1 
ATOM   5037  O O   . ALA G  1 138 ? 10.678  112.915 67.879  1.00 37.42  ? 284  ALA E O   1 
ATOM   5038  C CB  . ALA G  1 138 ? 13.396  111.326 66.548  1.00 37.42  ? 284  ALA E CB  1 
ATOM   5039  N N   . CYS G  1 139 ? 11.557  113.598 65.940  1.00 55.45  ? 285  CYS E N   1 
ATOM   5040  C CA  . CYS G  1 139 ? 10.303  114.127 65.465  1.00 55.45  ? 285  CYS E CA  1 
ATOM   5041  C C   . CYS G  1 139 ? 9.597   112.960 64.865  1.00 55.45  ? 285  CYS E C   1 
ATOM   5042  O O   . CYS G  1 139 ? 10.216  111.938 64.590  1.00 55.45  ? 285  CYS E O   1 
ATOM   5043  C CB  . CYS G  1 139 ? 10.529  115.158 64.383  1.00 55.45  ? 285  CYS E CB  1 
ATOM   5044  S SG  . CYS G  1 139 ? 10.876  116.747 65.066  1.00 55.45  ? 285  CYS E SG  1 
ATOM   5045  N N   . GLN G  1 140 ? 8.304   113.110 64.638  1.00 35.05  ? 286  GLN E N   1 
ATOM   5046  C CA  . GLN G  1 140 ? 7.544   112.025 64.052  1.00 35.05  ? 286  GLN E CA  1 
ATOM   5047  C C   . GLN G  1 140 ? 6.721   112.538 62.876  1.00 35.05  ? 286  GLN E C   1 
ATOM   5048  O O   . GLN G  1 140 ? 5.868   111.824 62.330  1.00 35.05  ? 286  GLN E O   1 
ATOM   5049  C CB  . GLN G  1 140 ? 6.668   111.375 65.128  1.00 35.05  ? 286  GLN E CB  1 
ATOM   5050  C CG  . GLN G  1 140 ? 7.443   110.437 66.035  1.00 35.05  ? 286  GLN E CG  1 
ATOM   5051  C CD  . GLN G  1 140 ? 7.900   109.203 65.303  1.00 35.05  ? 286  GLN E CD  1 
ATOM   5052  O OE1 . GLN G  1 140 ? 9.004   109.168 64.769  1.00 35.05  ? 286  GLN E OE1 1 
ATOM   5053  N NE2 . GLN G  1 140 ? 7.050   108.181 65.266  1.00 35.05  ? 286  GLN E NE2 1 
ATOM   5054  N N   . GLY G  1 141 ? 7.020   113.772 62.477  1.00 73.13  ? 287  GLY E N   1 
ATOM   5055  C CA  . GLY G  1 141 ? 6.337   114.418 61.366  1.00 73.13  ? 287  GLY E CA  1 
ATOM   5056  C C   . GLY G  1 141 ? 6.751   115.880 61.282  1.00 73.13  ? 287  GLY E C   1 
ATOM   5057  O O   . GLY G  1 141 ? 7.769   116.272 61.861  1.00 73.13  ? 287  GLY E O   1 
ATOM   5058  N N   . ASP G  1 142 ? 5.976   116.693 60.569  1.00 52.74  ? 288  ASP E N   1 
ATOM   5059  C CA  . ASP G  1 142 ? 6.282   118.119 60.442  1.00 52.74  ? 288  ASP E CA  1 
ATOM   5060  C C   . ASP G  1 142 ? 5.150   119.023 60.943  1.00 52.74  ? 288  ASP E C   1 
ATOM   5061  O O   . ASP G  1 142 ? 5.196   120.234 60.767  1.00 52.74  ? 288  ASP E O   1 
ATOM   5062  C CB  . ASP G  1 142 ? 6.602   118.465 58.982  1.00 52.74  ? 288  ASP E CB  1 
ATOM   5063  C CG  . ASP G  1 142 ? 5.454   118.148 58.041  1.00 52.74  ? 288  ASP E CG  1 
ATOM   5064  O OD1 . ASP G  1 142 ? 4.546   117.396 58.447  1.00 52.74  ? 288  ASP E OD1 1 
ATOM   5065  O OD2 . ASP G  1 142 ? 5.450   118.644 56.892  1.00 52.74  ? 288  ASP E OD2 1 
ATOM   5066  N N   . ASN G  1 143 ? 4.143   118.436 61.578  1.00 59.68  ? 289  ASN E N   1 
ATOM   5067  C CA  . ASN G  1 143 ? 3.018   119.207 62.083  1.00 59.68  ? 289  ASN E CA  1 
ATOM   5068  C C   . ASN G  1 143 ? 3.253   119.662 63.502  1.00 59.68  ? 289  ASN E C   1 
ATOM   5069  O O   . ASN G  1 143 ? 3.464   118.825 64.373  1.00 59.68  ? 289  ASN E O   1 
ATOM   5070  C CB  . ASN G  1 143 ? 1.739   118.369 62.071  1.00 59.68  ? 289  ASN E CB  1 
ATOM   5071  C CG  . ASN G  1 143 ? 1.446   117.756 60.709  1.00 59.68  ? 289  ASN E CG  1 
ATOM   5072  O OD1 . ASN G  1 143 ? 2.046   118.141 59.700  1.00 59.68  ? 289  ASN E OD1 1 
ATOM   5073  N ND2 . ASN G  1 143 ? 0.515   116.794 60.672  1.00 59.68  ? 289  ASN E ND2 1 
ATOM   5074  N N   . TYR G  1 144 ? 3.209   120.977 63.733  1.00 56.30  ? 290  TYR E N   1 
ATOM   5075  C CA  . TYR G  1 144 ? 3.375   121.534 65.080  1.00 56.30  ? 290  TYR E CA  1 
ATOM   5076  C C   . TYR G  1 144 ? 2.090   121.225 65.816  1.00 56.30  ? 290  TYR E C   1 
ATOM   5077  O O   . TYR G  1 144 ? 1.018   121.639 65.382  1.00 56.30  ? 290  TYR E O   1 
ATOM   5078  C CB  . TYR G  1 144 ? 3.575   123.056 65.050  1.00 56.30  ? 290  TYR E CB  1 
ATOM   5079  C CG  . TYR G  1 144 ? 4.849   123.474 64.355  1.00 56.30  ? 290  TYR E CG  1 
ATOM   5080  C CD1 . TYR G  1 144 ? 4.903   123.568 62.961  1.00 56.30  ? 290  TYR E CD1 1 
ATOM   5081  C CD2 . TYR G  1 144 ? 6.019   123.708 65.080  1.00 56.30  ? 290  TYR E CD2 1 
ATOM   5082  C CE1 . TYR G  1 144 ? 6.087   123.872 62.304  1.00 56.30  ? 290  TYR E CE1 1 
ATOM   5083  C CE2 . TYR G  1 144 ? 7.218   124.014 64.436  1.00 56.30  ? 290  TYR E CE2 1 
ATOM   5084  C CZ  . TYR G  1 144 ? 7.251   124.089 63.043  1.00 56.30  ? 290  TYR E CZ  1 
ATOM   5085  O OH  . TYR G  1 144 ? 8.443   124.339 62.373  1.00 56.30  ? 290  TYR E OH  1 
ATOM   5086  N N   . GLN G  1 145 ? 2.199   120.481 66.914  1.00 47.28  ? 291  GLN E N   1 
ATOM   5087  C CA  . GLN G  1 145 ? 1.038   120.109 67.712  1.00 47.28  ? 291  GLN E CA  1 
ATOM   5088  C C   . GLN G  1 145 ? 0.203   121.353 67.954  1.00 47.28  ? 291  GLN E C   1 
ATOM   5089  O O   . GLN G  1 145 ? 0.742   122.455 68.120  1.00 47.28  ? 291  GLN E O   1 
ATOM   5090  C CB  . GLN G  1 145 ? 1.476   119.521 69.048  1.00 47.28  ? 291  GLN E CB  1 
ATOM   5091  C CG  . GLN G  1 145 ? 0.328   119.230 69.983  1.00 47.28  ? 291  GLN E CG  1 
ATOM   5092  C CD  . GLN G  1 145 ? -0.348  117.939 69.634  1.00 47.28  ? 291  GLN E CD  1 
ATOM   5093  O OE1 . GLN G  1 145 ? -0.145  117.400 68.547  1.00 47.28  ? 291  GLN E OE1 1 
ATOM   5094  N NE2 . GLN G  1 145 ? -1.155  117.425 70.553  1.00 47.28  ? 291  GLN E NE2 1 
ATOM   5095  N N   . LYS G  1 146 ? -1.112  121.161 67.993  1.00 78.08  ? 292  LYS E N   1 
ATOM   5096  C CA  . LYS G  1 146 ? -2.061  122.248 68.169  1.00 78.08  ? 292  LYS E CA  1 
ATOM   5097  C C   . LYS G  1 146 ? -2.046  122.977 69.501  1.00 78.08  ? 292  LYS E C   1 
ATOM   5098  O O   . LYS G  1 146 ? -1.532  124.088 69.590  1.00 78.08  ? 292  LYS E O   1 
ATOM   5099  C CB  . LYS G  1 146 ? -3.467  121.731 67.875  1.00 78.08  ? 292  LYS E CB  1 
ATOM   5100  C CG  . LYS G  1 146 ? -3.640  121.226 66.444  1.00 78.08  ? 292  LYS E CG  1 
ATOM   5101  C CD  . LYS G  1 146 ? -3.292  122.322 65.441  1.00 78.08  ? 292  LYS E CD  1 
ATOM   5102  C CE  . LYS G  1 146 ? -3.561  121.888 64.006  1.00 78.08  ? 292  LYS E CE  1 
ATOM   5103  N NZ  . LYS G  1 146 ? -3.336  123.021 63.058  1.00 78.08  ? 292  LYS E NZ  1 
ATOM   5104  N N   . GLY G  1 147 ? -2.605  122.368 70.539  1.00 41.26  ? 293  GLY E N   1 
ATOM   5105  C CA  . GLY G  1 147 ? -2.642  123.051 71.823  1.00 41.26  ? 293  GLY E CA  1 
ATOM   5106  C C   . GLY G  1 147 ? -3.906  123.902 71.992  1.00 41.26  ? 293  GLY E C   1 
ATOM   5107  O O   . GLY G  1 147 ? -4.105  124.900 71.301  1.00 41.26  ? 293  GLY E O   1 
ATOM   5108  N N   . ILE G  1 148 ? -4.773  123.499 72.916  1.00 55.29  ? 294  ILE E N   1 
ATOM   5109  C CA  . ILE G  1 148 ? -6.023  124.201 73.181  1.00 55.29  ? 294  ILE E CA  1 
ATOM   5110  C C   . ILE G  1 148 ? -5.998  124.707 74.627  1.00 55.29  ? 294  ILE E C   1 
ATOM   5111  O O   . ILE G  1 148 ? -5.208  124.214 75.434  1.00 55.29  ? 294  ILE E O   1 
ATOM   5112  C CB  . ILE G  1 148 ? -7.228  123.261 72.961  1.00 55.29  ? 294  ILE E CB  1 
ATOM   5113  C CG1 . ILE G  1 148 ? -7.687  122.673 74.293  1.00 55.29  ? 294  ILE E CG1 1 
ATOM   5114  C CG2 . ILE G  1 148 ? -6.855  122.151 71.982  1.00 55.29  ? 294  ILE E CG2 1 
ATOM   5115  C CD1 . ILE G  1 148 ? -6.818  121.559 74.772  1.00 55.29  ? 294  ILE E CD1 1 
ATOM   5116  N N   . PRO G  1 149 ? -6.877  125.677 74.973  1.00 41.91  ? 295  PRO E N   1 
ATOM   5117  C CA  . PRO G  1 149 ? -6.960  126.272 76.315  1.00 41.91  ? 295  PRO E CA  1 
ATOM   5118  C C   . PRO G  1 149 ? -7.794  125.548 77.340  1.00 41.91  ? 295  PRO E C   1 
ATOM   5119  O O   . PRO G  1 149 ? -8.631  124.751 76.974  1.00 41.91  ? 295  PRO E O   1 
ATOM   5120  C CB  . PRO G  1 149 ? -7.530  127.668 76.051  1.00 41.91  ? 295  PRO E CB  1 
ATOM   5121  C CG  . PRO G  1 149 ? -8.038  127.662 74.599  1.00 41.91  ? 295  PRO E CG  1 
ATOM   5122  C CD  . PRO G  1 149 ? -7.878  126.273 74.071  1.00 41.91  ? 295  PRO E CD  1 
ATOM   5123  N N   . VAL G  1 150 ? -7.548  125.845 78.617  1.00 65.96  ? 296  VAL E N   1 
ATOM   5124  C CA  . VAL G  1 150 ? -8.288  125.286 79.755  1.00 65.96  ? 296  VAL E CA  1 
ATOM   5125  C C   . VAL G  1 150 ? -7.512  125.407 81.035  1.00 65.96  ? 296  VAL E C   1 
ATOM   5126  O O   . VAL G  1 150 ? -6.342  125.014 81.088  1.00 65.96  ? 296  VAL E O   1 
ATOM   5127  C CB  . VAL G  1 150 ? -8.585  123.781 79.644  1.00 65.96  ? 296  VAL E CB  1 
ATOM   5128  C CG1 . VAL G  1 150 ? -9.923  123.568 78.972  1.00 65.96  ? 296  VAL E CG1 1 
ATOM   5129  C CG2 . VAL G  1 150 ? -7.450  123.067 78.944  1.00 65.96  ? 296  VAL E CG2 1 
ATOM   5130  N N   . GLU G  1 151 ? -8.140  125.941 82.074  1.00 92.07  ? 297  GLU E N   1 
ATOM   5131  C CA  . GLU G  1 151 ? -7.443  126.012 83.345  1.00 92.07  ? 297  GLU E CA  1 
ATOM   5132  C C   . GLU G  1 151 ? -7.997  124.955 84.289  1.00 92.07  ? 297  GLU E C   1 
ATOM   5133  O O   . GLU G  1 151 ? -9.062  125.125 84.883  1.00 92.07  ? 297  GLU E O   1 
ATOM   5134  C CB  . GLU G  1 151 ? -7.565  127.391 83.995  1.00 92.07  ? 297  GLU E CB  1 
ATOM   5135  C CG  . GLU G  1 151 ? -7.060  127.462 85.464  1.00 92.07  ? 297  GLU E CG  1 
ATOM   5136  C CD  . GLU G  1 151 ? -5.967  126.436 85.825  1.00 92.07  ? 297  GLU E CD  1 
ATOM   5137  O OE1 . GLU G  1 151 ? -5.102  126.150 84.963  1.00 92.07  ? 297  GLU E OE1 1 
ATOM   5138  O OE2 . GLU G  1 151 ? -5.974  125.925 86.980  1.00 92.07  ? 297  GLU E OE2 1 
ATOM   5139  N N   . THR G  1 152 ? -7.265  123.850 84.389  1.00 100.00 ? 298  THR E N   1 
ATOM   5140  C CA  . THR G  1 152 ? -7.588  122.732 85.275  1.00 100.00 ? 298  THR E CA  1 
ATOM   5141  C C   . THR G  1 152 ? -6.275  122.587 86.068  1.00 100.00 ? 298  THR E C   1 
ATOM   5142  O O   . THR G  1 152 ? -5.768  123.591 86.585  1.00 100.00 ? 298  THR E O   1 
ATOM   5143  C CB  . THR G  1 152 ? -7.926  121.428 84.463  1.00 100.00 ? 298  THR E CB  1 
ATOM   5144  O OG1 . THR G  1 152 ? -7.106  121.348 83.286  1.00 100.00 ? 298  THR E OG1 1 
ATOM   5145  C CG2 . THR G  1 152 ? -9.403  121.439 84.033  1.00 100.00 ? 298  THR E CG2 1 
ATOM   5146  N N   . ASP G  1 153 ? -5.721  121.376 86.156  1.00 96.17  ? 299  ASP E N   1 
ATOM   5147  C CA  . ASP G  1 153 ? -4.448  121.143 86.857  1.00 96.17  ? 299  ASP E CA  1 
ATOM   5148  C C   . ASP G  1 153 ? -4.189  121.993 88.122  1.00 96.17  ? 299  ASP E C   1 
ATOM   5149  O O   . ASP G  1 153 ? -4.048  121.408 89.220  1.00 96.17  ? 299  ASP E O   1 
ATOM   5150  C CB  . ASP G  1 153 ? -3.283  121.348 85.874  1.00 96.17  ? 299  ASP E CB  1 
ATOM   5151  C CG  . ASP G  1 153 ? -3.751  121.651 84.457  1.00 96.17  ? 299  ASP E CG  1 
ATOM   5152  O OD1 . ASP G  1 153 ? -4.545  120.858 83.904  1.00 96.17  ? 299  ASP E OD1 1 
ATOM   5153  O OD2 . ASP G  1 153 ? -3.318  122.686 83.895  1.00 96.17  ? 299  ASP E OD2 1 
ATOM   5154  O OXT . ASP G  1 153 ? -4.111  123.238 88.015  1.00 96.17  ? 299  ASP E OXT 1 
ATOM   5155  N N   . THR H  2 1   ? 8.737   76.009  85.229  1.00 92.74  ? 318  THR F N   1 
ATOM   5156  C CA  . THR H  2 1   ? 8.853   77.078  84.196  1.00 92.74  ? 318  THR F CA  1 
ATOM   5157  C C   . THR H  2 1   ? 7.511   77.357  83.507  1.00 92.74  ? 318  THR F C   1 
ATOM   5158  O O   . THR H  2 1   ? 6.651   76.472  83.431  1.00 92.74  ? 318  THR F O   1 
ATOM   5159  C CB  . THR H  2 1   ? 9.905   76.701  83.135  1.00 92.74  ? 318  THR F CB  1 
ATOM   5160  O OG1 . THR H  2 1   ? 9.400   75.645  82.303  1.00 92.74  ? 318  THR F OG1 1 
ATOM   5161  C CG2 . THR H  2 1   ? 11.190  76.246  83.813  1.00 92.74  ? 318  THR F CG2 1 
ATOM   5162  N N   . ARG H  2 2   ? 7.345   78.587  83.009  1.00 100.00 ? 319  ARG F N   1 
ATOM   5163  C CA  . ARG H  2 2   ? 6.107   79.011  82.343  1.00 100.00 ? 319  ARG F CA  1 
ATOM   5164  C C   . ARG H  2 2   ? 6.293   79.742  81.010  1.00 100.00 ? 319  ARG F C   1 
ATOM   5165  O O   . ARG H  2 2   ? 7.412   79.960  80.556  1.00 100.00 ? 319  ARG F O   1 
ATOM   5166  C CB  . ARG H  2 2   ? 5.293   79.896  83.286  1.00 100.00 ? 319  ARG F CB  1 
ATOM   5167  C CG  . ARG H  2 2   ? 5.120   79.314  84.677  1.00 100.00 ? 319  ARG F CG  1 
ATOM   5168  C CD  . ARG H  2 2   ? 4.577   80.356  85.654  1.00 100.00 ? 319  ARG F CD  1 
ATOM   5169  N NE  . ARG H  2 2   ? 4.440   79.837  87.021  1.00 100.00 ? 319  ARG F NE  1 
ATOM   5170  C CZ  . ARG H  2 2   ? 4.203   80.587  88.100  1.00 100.00 ? 319  ARG F CZ  1 
ATOM   5171  N NH1 . ARG H  2 2   ? 4.075   81.907  87.988  1.00 100.00 ? 319  ARG F NH1 1 
ATOM   5172  N NH2 . ARG H  2 2   ? 4.089   80.020  89.295  1.00 100.00 ? 319  ARG F NH2 1 
ATOM   5173  N N   . TYR H  2 3   ? 5.177   80.133  80.401  1.00 80.66  ? 320  TYR F N   1 
ATOM   5174  C CA  . TYR H  2 3   ? 5.186   80.813  79.111  1.00 80.66  ? 320  TYR F CA  1 
ATOM   5175  C C   . TYR H  2 3   ? 4.521   82.180  79.095  1.00 80.66  ? 320  TYR F C   1 
ATOM   5176  O O   . TYR H  2 3   ? 3.450   82.368  79.683  1.00 80.66  ? 320  TYR F O   1 
ATOM   5177  C CB  . TYR H  2 3   ? 4.500   79.935  78.062  1.00 80.66  ? 320  TYR F CB  1 
ATOM   5178  C CG  . TYR H  2 3   ? 5.373   78.810  77.581  1.00 80.66  ? 320  TYR F CG  1 
ATOM   5179  C CD1 . TYR H  2 3   ? 5.046   77.480  77.848  1.00 80.66  ? 320  TYR F CD1 1 
ATOM   5180  C CD2 . TYR H  2 3   ? 6.570   79.076  76.921  1.00 80.66  ? 320  TYR F CD2 1 
ATOM   5181  C CE1 . TYR H  2 3   ? 5.899   76.437  77.476  1.00 80.66  ? 320  TYR F CE1 1 
ATOM   5182  C CE2 . TYR H  2 3   ? 7.430   78.050  76.544  1.00 80.66  ? 320  TYR F CE2 1 
ATOM   5183  C CZ  . TYR H  2 3   ? 7.095   76.733  76.826  1.00 80.66  ? 320  TYR F CZ  1 
ATOM   5184  O OH  . TYR H  2 3   ? 7.972   75.724  76.483  1.00 80.66  ? 320  TYR F OH  1 
ATOM   5185  N N   . ILE H  2 4   ? 5.162   83.124  78.402  1.00 67.36  ? 321  ILE F N   1 
ATOM   5186  C CA  . ILE H  2 4   ? 4.652   84.491  78.250  1.00 67.36  ? 321  ILE F CA  1 
ATOM   5187  C C   . ILE H  2 4   ? 4.839   84.914  76.796  1.00 67.36  ? 321  ILE F C   1 
ATOM   5188  O O   . ILE H  2 4   ? 5.728   84.413  76.114  1.00 67.36  ? 321  ILE F O   1 
ATOM   5189  C CB  . ILE H  2 4   ? 5.377   85.516  79.182  1.00 67.36  ? 321  ILE F CB  1 
ATOM   5190  C CG1 . ILE H  2 4   ? 6.857   85.630  78.810  1.00 67.36  ? 321  ILE F CG1 1 
ATOM   5191  C CG2 . ILE H  2 4   ? 5.209   85.112  80.650  1.00 67.36  ? 321  ILE F CG2 1 
ATOM   5192  C CD1 . ILE H  2 4   ? 7.659   86.561  79.733  1.00 67.36  ? 321  ILE F CD1 1 
ATOM   5193  N N   . PRO H  2 5   ? 3.995   85.839  76.305  1.00 70.76  ? 322  PRO F N   1 
ATOM   5194  C CA  . PRO H  2 5   ? 4.084   86.306  74.913  1.00 70.76  ? 322  PRO F CA  1 
ATOM   5195  C C   . PRO H  2 5   ? 5.424   86.913  74.498  1.00 70.76  ? 322  PRO F C   1 
ATOM   5196  O O   . PRO H  2 5   ? 6.064   87.636  75.264  1.00 70.76  ? 322  PRO F O   1 
ATOM   5197  C CB  . PRO H  2 5   ? 2.922   87.302  74.780  1.00 70.76  ? 322  PRO F CB  1 
ATOM   5198  C CG  . PRO H  2 5   ? 2.566   87.683  76.184  1.00 70.76  ? 322  PRO F CG  1 
ATOM   5199  C CD  . PRO H  2 5   ? 2.903   86.500  77.044  1.00 70.76  ? 322  PRO F CD  1 
ATOM   5200  N N   . ASP H  2 6   ? 5.820   86.604  73.264  1.00 58.86  ? 323  ASP F N   1 
ATOM   5201  C CA  . ASP H  2 6   ? 7.066   87.066  72.633  1.00 58.86  ? 323  ASP F CA  1 
ATOM   5202  C C   . ASP H  2 6   ? 7.373   88.547  72.866  1.00 58.86  ? 323  ASP F C   1 
ATOM   5203  O O   . ASP H  2 6   ? 8.518   88.941  73.106  1.00 58.86  ? 323  ASP F O   1 
ATOM   5204  C CB  . ASP H  2 6   ? 6.974   86.809  71.121  1.00 58.86  ? 323  ASP F CB  1 
ATOM   5205  C CG  . ASP H  2 6   ? 8.318   86.848  70.431  1.00 58.86  ? 323  ASP F CG  1 
ATOM   5206  O OD1 . ASP H  2 6   ? 9.345   86.646  71.100  1.00 58.86  ? 323  ASP F OD1 1 
ATOM   5207  O OD2 . ASP H  2 6   ? 8.346   87.075  69.208  1.00 58.86  ? 323  ASP F OD2 1 
ATOM   5208  N N   . GLU H  2 7   ? 6.325   89.359  72.802  1.00 43.04  ? 324  GLU F N   1 
ATOM   5209  C CA  . GLU H  2 7   ? 6.459   90.791  72.947  1.00 43.04  ? 324  GLU F CA  1 
ATOM   5210  C C   . GLU H  2 7   ? 6.198   91.386  74.307  1.00 43.04  ? 324  GLU F C   1 
ATOM   5211  O O   . GLU H  2 7   ? 6.041   92.597  74.428  1.00 43.04  ? 324  GLU F O   1 
ATOM   5212  C CB  . GLU H  2 7   ? 5.572   91.480  71.929  1.00 43.04  ? 324  GLU F CB  1 
ATOM   5213  C CG  . GLU H  2 7   ? 6.332   91.884  70.701  1.00 43.04  ? 324  GLU F CG  1 
ATOM   5214  C CD  . GLU H  2 7   ? 5.456   91.958  69.496  1.00 43.04  ? 324  GLU F CD  1 
ATOM   5215  O OE1 . GLU H  2 7   ? 4.902   90.904  69.118  1.00 43.04  ? 324  GLU F OE1 1 
ATOM   5216  O OE2 . GLU H  2 7   ? 5.323   93.067  68.935  1.00 43.04  ? 324  GLU F OE2 1 
ATOM   5217  N N   . ALA H  2 8   ? 6.151   90.560  75.339  1.00 26.49  ? 325  ALA F N   1 
ATOM   5218  C CA  . ALA H  2 8   ? 5.930   91.096  76.675  1.00 26.49  ? 325  ALA F CA  1 
ATOM   5219  C C   . ALA H  2 8   ? 7.104   91.955  77.189  1.00 26.49  ? 325  ALA F C   1 
ATOM   5220  O O   . ALA H  2 8   ? 8.184   92.024  76.589  1.00 26.49  ? 325  ALA F O   1 
ATOM   5221  C CB  . ALA H  2 8   ? 5.653   89.959  77.645  1.00 26.49  ? 325  ALA F CB  1 
ATOM   5222  N N   . ASP H  2 9   ? 6.851   92.622  78.303  1.00 36.12  ? 326  ASP F N   1 
ATOM   5223  C CA  . ASP H  2 9   ? 7.813   93.469  78.986  1.00 36.12  ? 326  ASP F CA  1 
ATOM   5224  C C   . ASP H  2 9   ? 8.561   94.557  78.205  1.00 36.12  ? 326  ASP F C   1 
ATOM   5225  O O   . ASP H  2 9   ? 9.744   94.806  78.449  1.00 36.12  ? 326  ASP F O   1 
ATOM   5226  C CB  . ASP H  2 9   ? 8.793   92.574  79.722  1.00 36.12  ? 326  ASP F CB  1 
ATOM   5227  C CG  . ASP H  2 9   ? 8.165   91.269  80.157  1.00 36.12  ? 326  ASP F CG  1 
ATOM   5228  O OD1 . ASP H  2 9   ? 7.585   91.220  81.259  1.00 36.12  ? 326  ASP F OD1 1 
ATOM   5229  O OD2 . ASP H  2 9   ? 8.257   90.286  79.393  1.00 36.12  ? 326  ASP F OD2 1 
ATOM   5230  N N   . PHE H  2 10  ? 7.860   95.227  77.296  1.00 41.46  ? 327  PHE F N   1 
ATOM   5231  C CA  . PHE H  2 10  ? 8.458   96.308  76.525  1.00 41.46  ? 327  PHE F CA  1 
ATOM   5232  C C   . PHE H  2 10  ? 7.909   97.639  77.013  1.00 41.46  ? 327  PHE F C   1 
ATOM   5233  O O   . PHE H  2 10  ? 6.841   97.685  77.588  1.00 41.46  ? 327  PHE F O   1 
ATOM   5234  C CB  . PHE H  2 10  ? 8.112   96.151  75.060  1.00 41.46  ? 327  PHE F CB  1 
ATOM   5235  C CG  . PHE H  2 10  ? 9.108   95.357  74.293  1.00 41.46  ? 327  PHE F CG  1 
ATOM   5236  C CD1 . PHE H  2 10  ? 8.872   94.027  74.014  1.00 41.46  ? 327  PHE F CD1 1 
ATOM   5237  C CD2 . PHE H  2 10  ? 10.276  95.950  73.808  1.00 41.46  ? 327  PHE F CD2 1 
ATOM   5238  C CE1 . PHE H  2 10  ? 9.775   93.297  73.262  1.00 41.46  ? 327  PHE F CE1 1 
ATOM   5239  C CE2 . PHE H  2 10  ? 11.188  95.222  73.051  1.00 41.46  ? 327  PHE F CE2 1 
ATOM   5240  C CZ  . PHE H  2 10  ? 10.933  93.895  72.779  1.00 41.46  ? 327  PHE F CZ  1 
ATOM   5241  N N   . LEU H  2 11  ? 8.651   98.715  76.795  1.00 20.32  ? 328  LEU F N   1 
ATOM   5242  C CA  . LEU H  2 11  ? 8.199   100.037 77.180  1.00 20.32  ? 328  LEU F CA  1 
ATOM   5243  C C   . LEU H  2 11  ? 8.795   101.048 76.211  1.00 20.32  ? 328  LEU F C   1 
ATOM   5244  O O   . LEU H  2 11  ? 9.997   101.303 76.227  1.00 20.32  ? 328  LEU F O   1 
ATOM   5245  C CB  . LEU H  2 11  ? 8.624   100.381 78.606  1.00 20.32  ? 328  LEU F CB  1 
ATOM   5246  C CG  . LEU H  2 11  ? 8.415   101.879 78.883  1.00 20.32  ? 328  LEU F CG  1 
ATOM   5247  C CD1 . LEU H  2 11  ? 7.036   102.302 78.371  1.00 20.32  ? 328  LEU F CD1 1 
ATOM   5248  C CD2 . LEU H  2 11  ? 8.519   102.175 80.366  1.00 20.32  ? 328  LEU F CD2 1 
ATOM   5249  N N   . LEU H  2 12  ? 7.954   101.627 75.365  1.00 21.52  ? 329  LEU F N   1 
ATOM   5250  C CA  . LEU H  2 12  ? 8.420   102.607 74.399  1.00 21.52  ? 329  LEU F CA  1 
ATOM   5251  C C   . LEU H  2 12  ? 8.022   103.989 74.874  1.00 21.52  ? 329  LEU F C   1 
ATOM   5252  O O   . LEU H  2 12  ? 6.847   104.220 75.170  1.00 21.52  ? 329  LEU F O   1 
ATOM   5253  C CB  . LEU H  2 12  ? 7.785   102.355 73.046  1.00 21.52  ? 329  LEU F CB  1 
ATOM   5254  C CG  . LEU H  2 12  ? 8.123   103.338 71.929  1.00 21.52  ? 329  LEU F CG  1 
ATOM   5255  C CD1 . LEU H  2 12  ? 9.390   104.112 72.244  1.00 21.52  ? 329  LEU F CD1 1 
ATOM   5256  C CD2 . LEU H  2 12  ? 8.309   102.550 70.649  1.00 21.52  ? 329  LEU F CD2 1 
ATOM   5257  N N   . GLY H  2 13  ? 8.990   104.902 74.944  1.00 22.01  ? 330  GLY F N   1 
ATOM   5258  C CA  . GLY H  2 13  ? 8.703   106.247 75.396  1.00 22.01  ? 330  GLY F CA  1 
ATOM   5259  C C   . GLY H  2 13  ? 8.914   107.234 74.273  1.00 22.01  ? 330  GLY F C   1 
ATOM   5260  O O   . GLY H  2 13  ? 9.975   107.832 74.172  1.00 22.01  ? 330  GLY F O   1 
ATOM   5261  N N   . MET H  2 14  ? 7.914   107.401 73.415  1.00 39.53  ? 331  MET F N   1 
ATOM   5262  C CA  . MET H  2 14  ? 8.020   108.337 72.306  1.00 39.53  ? 331  MET F CA  1 
ATOM   5263  C C   . MET H  2 14  ? 7.952   109.734 72.860  1.00 39.53  ? 331  MET F C   1 
ATOM   5264  O O   . MET H  2 14  ? 7.154   110.000 73.735  1.00 39.53  ? 331  MET F O   1 
ATOM   5265  C CB  . MET H  2 14  ? 6.867   108.141 71.339  1.00 39.53  ? 331  MET F CB  1 
ATOM   5266  C CG  . MET H  2 14  ? 7.033   106.939 70.471  1.00 39.53  ? 331  MET F CG  1 
ATOM   5267  S SD  . MET H  2 14  ? 8.686   106.899 69.832  1.00 39.53  ? 331  MET F SD  1 
ATOM   5268  C CE  . MET H  2 14  ? 8.524   107.856 68.357  1.00 39.53  ? 331  MET F CE  1 
ATOM   5269  N N   . ALA H  2 15  ? 8.783   110.629 72.347  1.00 45.66  ? 332  ALA F N   1 
ATOM   5270  C CA  . ALA H  2 15  ? 8.802   112.008 72.818  1.00 45.66  ? 332  ALA F CA  1 
ATOM   5271  C C   . ALA H  2 15  ? 7.634   112.803 72.251  1.00 45.66  ? 332  ALA F C   1 
ATOM   5272  O O   . ALA H  2 15  ? 7.391   113.933 72.670  1.00 45.66  ? 332  ALA F O   1 
ATOM   5273  C CB  . ALA H  2 15  ? 10.102  112.669 72.414  1.00 45.66  ? 332  ALA F CB  1 
ATOM   5274  N N   . THR H  2 16  ? 6.913   112.213 71.299  1.00 47.39  ? 333  THR F N   1 
ATOM   5275  C CA  . THR H  2 16  ? 5.779   112.883 70.656  1.00 47.39  ? 333  THR F CA  1 
ATOM   5276  C C   . THR H  2 16  ? 4.815   111.927 69.944  1.00 47.39  ? 333  THR F C   1 
ATOM   5277  O O   . THR H  2 16  ? 5.185   110.829 69.521  1.00 47.39  ? 333  THR F O   1 
ATOM   5278  C CB  . THR H  2 16  ? 6.271   113.904 69.600  1.00 47.39  ? 333  THR F CB  1 
ATOM   5279  O OG1 . THR H  2 16  ? 5.152   114.515 68.949  1.00 47.39  ? 333  THR F OG1 1 
ATOM   5280  C CG2 . THR H  2 16  ? 7.105   113.213 68.552  1.00 47.39  ? 333  THR F CG2 1 
ATOM   5281  N N   . VAL H  2 17  ? 3.567   112.350 69.813  1.00 36.58  ? 334  VAL F N   1 
ATOM   5282  C CA  . VAL H  2 17  ? 2.592   111.544 69.117  1.00 36.58  ? 334  VAL F CA  1 
ATOM   5283  C C   . VAL H  2 17  ? 2.998   111.613 67.644  1.00 36.58  ? 334  VAL F C   1 
ATOM   5284  O O   . VAL H  2 17  ? 3.882   112.380 67.291  1.00 36.58  ? 334  VAL F O   1 
ATOM   5285  C CB  . VAL H  2 17  ? 1.206   112.119 69.322  1.00 36.58  ? 334  VAL F CB  1 
ATOM   5286  C CG1 . VAL H  2 17  ? 0.902   112.189 70.805  1.00 36.58  ? 334  VAL F CG1 1 
ATOM   5287  C CG2 . VAL H  2 17  ? 1.135   113.502 68.718  1.00 36.58  ? 334  VAL F CG2 1 
ATOM   5288  N N   . ASN H  2 18  ? 2.357   110.833 66.785  1.00 33.07  ? 335  ASN F N   1 
ATOM   5289  C CA  . ASN H  2 18  ? 2.727   110.815 65.378  1.00 33.07  ? 335  ASN F CA  1 
ATOM   5290  C C   . ASN H  2 18  ? 2.545   112.094 64.578  1.00 33.07  ? 335  ASN F C   1 
ATOM   5291  O O   . ASN H  2 18  ? 1.934   113.053 65.046  1.00 33.07  ? 335  ASN F O   1 
ATOM   5292  C CB  . ASN H  2 18  ? 2.011   109.677 64.671  1.00 33.07  ? 335  ASN F CB  1 
ATOM   5293  C CG  . ASN H  2 18  ? 2.979   108.740 64.004  1.00 33.07  ? 335  ASN F CG  1 
ATOM   5294  O OD1 . ASN H  2 18  ? 3.435   108.988 62.880  1.00 33.07  ? 335  ASN F OD1 1 
ATOM   5295  N ND2 . ASN H  2 18  ? 3.327   107.662 64.699  1.00 33.07  ? 335  ASN F ND2 1 
ATOM   5296  N N   . ASN H  2 19  ? 3.101   112.088 63.367  1.00 66.73  ? 336  ASN F N   1 
ATOM   5297  C CA  . ASN H  2 19  ? 3.058   113.213 62.425  1.00 66.73  ? 336  ASN F CA  1 
ATOM   5298  C C   . ASN H  2 19  ? 3.438   114.576 62.998  1.00 66.73  ? 336  ASN F C   1 
ATOM   5299  O O   . ASN H  2 19  ? 3.307   115.588 62.319  1.00 66.73  ? 336  ASN F O   1 
ATOM   5300  C CB  . ASN H  2 19  ? 1.669   113.321 61.774  1.00 66.73  ? 336  ASN F CB  1 
ATOM   5301  C CG  . ASN H  2 19  ? 0.948   111.984 61.693  1.00 66.73  ? 336  ASN F CG  1 
ATOM   5302  O OD1 . ASN H  2 19  ? 0.282   111.570 62.641  1.00 66.73  ? 336  ASN F OD1 1 
ATOM   5303  N ND2 . ASN H  2 19  ? 1.075   111.305 60.555  1.00 66.73  ? 336  ASN F ND2 1 
ATOM   5304  N N   . CYS H  2 20  ? 3.920   114.612 64.232  1.00 58.46  ? 337  CYS F N   1 
ATOM   5305  C CA  . CYS H  2 20  ? 4.276   115.884 64.844  1.00 58.46  ? 337  CYS F CA  1 
ATOM   5306  C C   . CYS H  2 20  ? 5.752   116.031 65.205  1.00 58.46  ? 337  CYS F C   1 
ATOM   5307  O O   . CYS H  2 20  ? 6.499   115.053 65.298  1.00 58.46  ? 337  CYS F O   1 
ATOM   5308  C CB  . CYS H  2 20  ? 3.434   116.108 66.102  1.00 58.46  ? 337  CYS F CB  1 
ATOM   5309  S SG  . CYS H  2 20  ? 1.664   115.985 65.840  1.00 58.46  ? 337  CYS F SG  1 
ATOM   5310  N N   . VAL H  2 21  ? 6.148   117.278 65.430  1.00 43.78  ? 338  VAL F N   1 
ATOM   5311  C CA  . VAL H  2 21  ? 7.510   117.623 65.788  1.00 43.78  ? 338  VAL F CA  1 
ATOM   5312  C C   . VAL H  2 21  ? 7.707   117.512 67.295  1.00 43.78  ? 338  VAL F C   1 
ATOM   5313  O O   . VAL H  2 21  ? 6.736   117.445 68.048  1.00 43.78  ? 338  VAL F O   1 
ATOM   5314  C CB  . VAL H  2 21  ? 7.802   119.066 65.361  1.00 43.78  ? 338  VAL F CB  1 
ATOM   5315  C CG1 . VAL H  2 21  ? 7.402   119.259 63.905  1.00 43.78  ? 338  VAL F CG1 1 
ATOM   5316  C CG2 . VAL H  2 21  ? 7.010   120.033 66.231  1.00 43.78  ? 338  VAL F CG2 1 
ATOM   5317  N N   . SER H  2 22  ? 8.968   117.462 67.723  1.00 38.52  ? 339  SER F N   1 
ATOM   5318  C CA  . SER H  2 22  ? 9.326   117.425 69.144  1.00 38.52  ? 339  SER F CA  1 
ATOM   5319  C C   . SER H  2 22  ? 10.407  118.494 69.223  1.00 38.52  ? 339  SER F C   1 
ATOM   5320  O O   . SER H  2 22  ? 11.149  118.705 68.251  1.00 38.52  ? 339  SER F O   1 
ATOM   5321  C CB  . SER H  2 22  ? 9.864   116.059 69.579  1.00 38.52  ? 339  SER F CB  1 
ATOM   5322  O OG  . SER H  2 22  ? 10.891  115.609 68.728  1.00 38.52  ? 339  SER F OG  1 
ATOM   5323  N N   . TYR H  2 23  ? 10.489  119.173 70.367  1.00 48.09  ? 340  TYR F N   1 
ATOM   5324  C CA  . TYR H  2 23  ? 11.416  120.289 70.540  1.00 48.09  ? 340  TYR F CA  1 
ATOM   5325  C C   . TYR H  2 23  ? 12.726  120.036 71.226  1.00 48.09  ? 340  TYR F C   1 
ATOM   5326  O O   . TYR H  2 23  ? 12.815  119.274 72.189  1.00 48.09  ? 340  TYR F O   1 
ATOM   5327  C CB  . TYR H  2 23  ? 10.698  121.455 71.234  1.00 48.09  ? 340  TYR F CB  1 
ATOM   5328  C CG  . TYR H  2 23  ? 9.534   121.998 70.411  1.00 48.09  ? 340  TYR F CG  1 
ATOM   5329  C CD1 . TYR H  2 23  ? 8.240   121.488 70.574  1.00 48.09  ? 340  TYR F CD1 1 
ATOM   5330  C CD2 . TYR H  2 23  ? 9.732   122.992 69.439  1.00 48.09  ? 340  TYR F CD2 1 
ATOM   5331  C CE1 . TYR H  2 23  ? 7.180   121.948 69.795  1.00 48.09  ? 340  TYR F CE1 1 
ATOM   5332  C CE2 . TYR H  2 23  ? 8.673   123.458 68.656  1.00 48.09  ? 340  TYR F CE2 1 
ATOM   5333  C CZ  . TYR H  2 23  ? 7.404   122.932 68.838  1.00 48.09  ? 340  TYR F CZ  1 
ATOM   5334  O OH  . TYR H  2 23  ? 6.357   123.381 68.062  1.00 48.09  ? 340  TYR F OH  1 
ATOM   5335  N N   . ARG H  2 24  ? 13.736  120.727 70.705  1.00 32.62  ? 341  ARG F N   1 
ATOM   5336  C CA  . ARG H  2 24  ? 15.116  120.657 71.176  1.00 32.62  ? 341  ARG F CA  1 
ATOM   5337  C C   . ARG H  2 24  ? 15.708  122.057 71.291  1.00 32.62  ? 341  ARG F C   1 
ATOM   5338  O O   . ARG H  2 24  ? 15.943  122.720 70.279  1.00 32.62  ? 341  ARG F O   1 
ATOM   5339  C CB  . ARG H  2 24  ? 15.955  119.840 70.185  1.00 32.62  ? 341  ARG F CB  1 
ATOM   5340  C CG  . ARG H  2 24  ? 17.449  119.794 70.456  1.00 32.62  ? 341  ARG F CG  1 
ATOM   5341  C CD  . ARG H  2 24  ? 18.148  119.236 69.241  1.00 32.62  ? 341  ARG F CD  1 
ATOM   5342  N NE  . ARG H  2 24  ? 18.470  120.314 68.314  1.00 32.62  ? 341  ARG F NE  1 
ATOM   5343  C CZ  . ARG H  2 24  ? 18.158  120.320 67.020  1.00 32.62  ? 341  ARG F CZ  1 
ATOM   5344  N NH1 . ARG H  2 24  ? 17.511  119.308 66.496  1.00 32.62  ? 341  ARG F NH1 1 
ATOM   5345  N NH2 . ARG H  2 24  ? 18.512  121.330 66.232  1.00 32.62  ? 341  ARG F NH2 1 
ATOM   5346  N N   . ASN H  2 25  ? 15.939  122.509 72.521  1.00 52.14  ? 342  ASN F N   1 
ATOM   5347  C CA  . ASN H  2 25  ? 16.528  123.824 72.752  1.00 52.14  ? 342  ASN F CA  1 
ATOM   5348  C C   . ASN H  2 25  ? 18.050  123.671 72.801  1.00 52.14  ? 342  ASN F C   1 
ATOM   5349  O O   . ASN H  2 25  ? 18.593  123.046 73.722  1.00 52.14  ? 342  ASN F O   1 
ATOM   5350  C CB  . ASN H  2 25  ? 16.032  124.398 74.073  1.00 52.14  ? 342  ASN F CB  1 
ATOM   5351  C CG  . ASN H  2 25  ? 16.811  125.612 74.490  1.00 52.14  ? 342  ASN F CG  1 
ATOM   5352  O OD1 . ASN H  2 25  ? 17.560  126.174 73.691  1.00 52.14  ? 342  ASN F OD1 1 
ATOM   5353  N ND2 . ASN H  2 25  ? 16.645  126.031 75.739  1.00 52.14  ? 342  ASN F ND2 1 
ATOM   5354  N N   . PRO H  2 26  ? 18.762  124.253 71.822  1.00 33.06  ? 343  PRO F N   1 
ATOM   5355  C CA  . PRO H  2 26  ? 20.225  124.137 71.802  1.00 33.06  ? 343  PRO F CA  1 
ATOM   5356  C C   . PRO H  2 26  ? 20.848  124.532 73.127  1.00 33.06  ? 343  PRO F C   1 
ATOM   5357  O O   . PRO H  2 26  ? 21.918  124.044 73.501  1.00 33.06  ? 343  PRO F O   1 
ATOM   5358  C CB  . PRO H  2 26  ? 20.647  125.067 70.670  1.00 33.06  ? 343  PRO F CB  1 
ATOM   5359  C CG  . PRO H  2 26  ? 19.452  125.135 69.764  1.00 33.06  ? 343  PRO F CG  1 
ATOM   5360  C CD  . PRO H  2 26  ? 18.255  125.048 70.689  1.00 33.06  ? 343  PRO F CD  1 
ATOM   5361  N N   . ALA H  2 27  ? 20.166  125.406 73.851  1.00 51.76  ? 344  ALA F N   1 
ATOM   5362  C CA  . ALA H  2 27  ? 20.681  125.876 75.130  1.00 51.76  ? 344  ALA F CA  1 
ATOM   5363  C C   . ALA H  2 27  ? 20.638  124.853 76.247  1.00 51.76  ? 344  ALA F C   1 
ATOM   5364  O O   . ALA H  2 27  ? 21.634  124.671 76.922  1.00 51.76  ? 344  ALA F O   1 
ATOM   5365  C CB  . ALA H  2 27  ? 19.945  127.131 75.565  1.00 51.76  ? 344  ALA F CB  1 
ATOM   5366  N N   . GLU H  2 28  ? 19.499  124.194 76.460  1.00 64.31  ? 345  GLU F N   1 
ATOM   5367  C CA  . GLU H  2 28  ? 19.412  123.222 77.551  1.00 64.31  ? 345  GLU F CA  1 
ATOM   5368  C C   . GLU H  2 28  ? 19.082  121.799 77.141  1.00 64.31  ? 345  GLU F C   1 
ATOM   5369  O O   . GLU H  2 28  ? 18.942  120.924 78.006  1.00 64.31  ? 345  GLU F O   1 
ATOM   5370  C CB  . GLU H  2 28  ? 18.393  123.667 78.611  1.00 64.31  ? 345  GLU F CB  1 
ATOM   5371  C CG  . GLU H  2 28  ? 17.427  124.744 78.164  1.00 64.31  ? 345  GLU F CG  1 
ATOM   5372  C CD  . GLU H  2 28  ? 17.566  126.012 78.984  1.00 64.31  ? 345  GLU F CD  1 
ATOM   5373  O OE1 . GLU H  2 28  ? 17.430  127.107 78.401  1.00 64.31  ? 345  GLU F OE1 1 
ATOM   5374  O OE2 . GLU H  2 28  ? 17.816  125.916 80.208  1.00 64.31  ? 345  GLU F OE2 1 
ATOM   5375  N N   . GLY H  2 29  ? 18.964  121.553 75.840  1.00 42.74  ? 346  GLY F N   1 
ATOM   5376  C CA  . GLY H  2 29  ? 18.639  120.211 75.392  1.00 42.74  ? 346  GLY F CA  1 
ATOM   5377  C C   . GLY H  2 29  ? 17.216  120.113 74.871  1.00 42.74  ? 346  GLY F C   1 
ATOM   5378  O O   . GLY H  2 29  ? 16.676  121.078 74.334  1.00 42.74  ? 346  GLY F O   1 
ATOM   5379  N N   . THR H  2 30  ? 16.583  118.962 75.046  1.00 33.87  ? 347  THR F N   1 
ATOM   5380  C CA  . THR H  2 30  ? 15.241  118.790 74.530  1.00 33.87  ? 347  THR F CA  1 
ATOM   5381  C C   . THR H  2 30  ? 14.207  118.683 75.623  1.00 33.87  ? 347  THR F C   1 
ATOM   5382  O O   . THR H  2 30  ? 14.488  118.157 76.705  1.00 33.87  ? 347  THR F O   1 
ATOM   5383  C CB  . THR H  2 30  ? 15.165  117.547 73.717  1.00 33.87  ? 347  THR F CB  1 
ATOM   5384  O OG1 . THR H  2 30  ? 15.476  116.432 74.567  1.00 33.87  ? 347  THR F OG1 1 
ATOM   5385  C CG2 . THR H  2 30  ? 16.149  117.608 72.583  1.00 33.87  ? 347  THR F CG2 1 
ATOM   5386  N N   . TRP H  2 31  ? 12.997  119.149 75.310  1.00 49.77  ? 348  TRP F N   1 
ATOM   5387  C CA  . TRP H  2 31  ? 11.884  119.150 76.245  1.00 49.77  ? 348  TRP F CA  1 
ATOM   5388  C C   . TRP H  2 31  ? 11.634  117.789 76.837  1.00 49.77  ? 348  TRP F C   1 
ATOM   5389  O O   . TRP H  2 31  ? 11.488  117.663 78.053  1.00 49.77  ? 348  TRP F O   1 
ATOM   5390  C CB  . TRP H  2 31  ? 10.602  119.611 75.564  1.00 49.77  ? 348  TRP F CB  1 
ATOM   5391  C CG  . TRP H  2 31  ? 10.574  121.055 75.161  1.00 49.77  ? 348  TRP F CG  1 
ATOM   5392  C CD1 . TRP H  2 31  ? 11.586  121.959 75.262  1.00 49.77  ? 348  TRP F CD1 1 
ATOM   5393  C CD2 . TRP H  2 31  ? 9.477   121.745 74.554  1.00 49.77  ? 348  TRP F CD2 1 
ATOM   5394  N NE1 . TRP H  2 31  ? 11.193  123.173 74.750  1.00 49.77  ? 348  TRP F NE1 1 
ATOM   5395  C CE2 . TRP H  2 31  ? 9.901   123.070 74.305  1.00 49.77  ? 348  TRP F CE2 1 
ATOM   5396  C CE3 . TRP H  2 31  ? 8.174   121.376 74.191  1.00 49.77  ? 348  TRP F CE3 1 
ATOM   5397  C CZ2 . TRP H  2 31  ? 9.076   124.026 73.713  1.00 49.77  ? 348  TRP F CZ2 1 
ATOM   5398  C CZ3 . TRP H  2 31  ? 7.352   122.322 73.598  1.00 49.77  ? 348  TRP F CZ3 1 
ATOM   5399  C CH2 . TRP H  2 31  ? 7.806   123.638 73.371  1.00 49.77  ? 348  TRP F CH2 1 
ATOM   5400  N N   . TYR H  2 32  ? 11.575  116.770 75.982  1.00 36.30  ? 349  TYR F N   1 
ATOM   5401  C CA  . TYR H  2 32  ? 11.305  115.414 76.463  1.00 36.30  ? 349  TYR F CA  1 
ATOM   5402  C C   . TYR H  2 32  ? 12.424  114.778 77.309  1.00 36.30  ? 349  TYR F C   1 
ATOM   5403  O O   . TYR H  2 32  ? 12.222  114.477 78.498  1.00 36.30  ? 349  TYR F O   1 
ATOM   5404  C CB  . TYR H  2 32  ? 10.955  114.502 75.289  1.00 36.30  ? 349  TYR F CB  1 
ATOM   5405  C CG  . TYR H  2 32  ? 10.660  113.065 75.674  1.00 36.30  ? 349  TYR F CG  1 
ATOM   5406  C CD1 . TYR H  2 32  ? 9.711   112.762 76.652  1.00 36.30  ? 349  TYR F CD1 1 
ATOM   5407  C CD2 . TYR H  2 32  ? 11.328  112.002 75.062  1.00 36.30  ? 349  TYR F CD2 1 
ATOM   5408  C CE1 . TYR H  2 32  ? 9.438   111.436 77.004  1.00 36.30  ? 349  TYR F CE1 1 
ATOM   5409  C CE2 . TYR H  2 32  ? 11.058  110.682 75.409  1.00 36.30  ? 349  TYR F CE2 1 
ATOM   5410  C CZ  . TYR H  2 32  ? 10.115  110.403 76.374  1.00 36.30  ? 349  TYR F CZ  1 
ATOM   5411  O OH  . TYR H  2 32  ? 9.836   109.091 76.685  1.00 36.30  ? 349  TYR F OH  1 
ATOM   5412  N N   . ILE H  2 33  ? 13.597  114.573 76.716  1.00 30.64  ? 350  ILE F N   1 
ATOM   5413  C CA  . ILE H  2 33  ? 14.687  113.961 77.453  1.00 30.64  ? 350  ILE F CA  1 
ATOM   5414  C C   . ILE H  2 33  ? 14.948  114.732 78.742  1.00 30.64  ? 350  ILE F C   1 
ATOM   5415  O O   . ILE H  2 33  ? 14.890  114.165 79.825  1.00 30.64  ? 350  ILE F O   1 
ATOM   5416  C CB  . ILE H  2 33  ? 15.982  113.920 76.610  1.00 30.64  ? 350  ILE F CB  1 
ATOM   5417  C CG1 . ILE H  2 33  ? 15.779  113.042 75.370  1.00 30.64  ? 350  ILE F CG1 1 
ATOM   5418  C CG2 . ILE H  2 33  ? 17.136  113.392 77.462  1.00 30.64  ? 350  ILE F CG2 1 
ATOM   5419  C CD1 . ILE H  2 33  ? 15.451  111.620 75.690  1.00 30.64  ? 350  ILE F CD1 1 
ATOM   5420  N N   . GLN H  2 34  ? 15.222  116.025 78.628  1.00 33.00  ? 351  GLN F N   1 
ATOM   5421  C CA  . GLN H  2 34  ? 15.508  116.827 79.798  1.00 33.00  ? 351  GLN F CA  1 
ATOM   5422  C C   . GLN H  2 34  ? 14.475  116.586 80.870  1.00 33.00  ? 351  GLN F C   1 
ATOM   5423  O O   . GLN H  2 34  ? 14.805  116.407 82.048  1.00 33.00  ? 351  GLN F O   1 
ATOM   5424  C CB  . GLN H  2 34  ? 15.514  118.304 79.429  1.00 33.00  ? 351  GLN F CB  1 
ATOM   5425  C CG  . GLN H  2 34  ? 16.809  118.800 78.752  1.00 33.00  ? 351  GLN F CG  1 
ATOM   5426  C CD  . GLN H  2 34  ? 18.074  118.108 79.277  1.00 33.00  ? 351  GLN F CD  1 
ATOM   5427  O OE1 . GLN H  2 34  ? 18.353  118.104 80.486  1.00 33.00  ? 351  GLN F OE1 1 
ATOM   5428  N NE2 . GLN H  2 34  ? 18.843  117.519 78.360  1.00 33.00  ? 351  GLN F NE2 1 
ATOM   5429  N N   . SER H  2 35  ? 13.212  116.568 80.461  1.00 39.44  ? 352  SER F N   1 
ATOM   5430  C CA  . SER H  2 35  ? 12.128  116.373 81.415  1.00 39.44  ? 352  SER F CA  1 
ATOM   5431  C C   . SER H  2 35  ? 12.076  114.962 81.966  1.00 39.44  ? 352  SER F C   1 
ATOM   5432  O O   . SER H  2 35  ? 11.717  114.744 83.125  1.00 39.44  ? 352  SER F O   1 
ATOM   5433  C CB  . SER H  2 35  ? 10.791  116.712 80.785  1.00 39.44  ? 352  SER F CB  1 
ATOM   5434  O OG  . SER H  2 35  ? 9.767   116.331 81.680  1.00 39.44  ? 352  SER F OG  1 
ATOM   5435  N N   . LEU H  2 36  ? 12.437  114.003 81.129  1.00 31.53  ? 353  LEU F N   1 
ATOM   5436  C CA  . LEU H  2 36  ? 12.449  112.610 81.542  1.00 31.53  ? 353  LEU F CA  1 
ATOM   5437  C C   . LEU H  2 36  ? 13.495  112.372 82.634  1.00 31.53  ? 353  LEU F C   1 
ATOM   5438  O O   . LEU H  2 36  ? 13.205  111.768 83.671  1.00 31.53  ? 353  LEU F O   1 
ATOM   5439  C CB  . LEU H  2 36  ? 12.753  111.715 80.343  1.00 31.53  ? 353  LEU F CB  1 
ATOM   5440  C CG  . LEU H  2 36  ? 13.266  110.330 80.710  1.00 31.53  ? 353  LEU F CG  1 
ATOM   5441  C CD1 . LEU H  2 36  ? 12.351  109.722 81.759  1.00 31.53  ? 353  LEU F CD1 1 
ATOM   5442  C CD2 . LEU H  2 36  ? 13.311  109.449 79.471  1.00 31.53  ? 353  LEU F CD2 1 
ATOM   5443  N N   . CYS H  2 37  ? 14.714  112.839 82.391  1.00 47.76  ? 354  CYS F N   1 
ATOM   5444  C CA  . CYS H  2 37  ? 15.785  112.665 83.359  1.00 47.76  ? 354  CYS F CA  1 
ATOM   5445  C C   . CYS H  2 37  ? 15.448  113.396 84.646  1.00 47.76  ? 354  CYS F C   1 
ATOM   5446  O O   . CYS H  2 37  ? 15.416  112.803 85.725  1.00 47.76  ? 354  CYS F O   1 
ATOM   5447  C CB  . CYS H  2 37  ? 17.101  113.211 82.812  1.00 47.76  ? 354  CYS F CB  1 
ATOM   5448  S SG  . CYS H  2 37  ? 17.656  112.435 81.298  1.00 47.76  ? 354  CYS F SG  1 
ATOM   5449  N N   . GLN H  2 38  ? 15.206  114.691 84.524  1.00 54.22  ? 355  GLN F N   1 
ATOM   5450  C CA  . GLN H  2 38  ? 14.871  115.499 85.675  1.00 54.22  ? 355  GLN F CA  1 
ATOM   5451  C C   . GLN H  2 38  ? 13.910  114.757 86.602  1.00 54.22  ? 355  GLN F C   1 
ATOM   5452  O O   . GLN H  2 38  ? 14.173  114.609 87.792  1.00 54.22  ? 355  GLN F O   1 
ATOM   5453  C CB  . GLN H  2 38  ? 14.240  116.794 85.203  1.00 54.22  ? 355  GLN F CB  1 
ATOM   5454  C CG  . GLN H  2 38  ? 13.695  117.637 86.316  1.00 54.22  ? 355  GLN F CG  1 
ATOM   5455  C CD  . GLN H  2 38  ? 13.515  119.057 85.866  1.00 54.22  ? 355  GLN F CD  1 
ATOM   5456  O OE1 . GLN H  2 38  ? 14.434  119.651 85.294  1.00 54.22  ? 355  GLN F OE1 1 
ATOM   5457  N NE2 . GLN H  2 38  ? 12.324  119.615 86.105  1.00 54.22  ? 355  GLN F NE2 1 
ATOM   5458  N N   . SER H  2 39  ? 12.799  114.285 86.052  1.00 46.43  ? 356  SER F N   1 
ATOM   5459  C CA  . SER H  2 39  ? 11.822  113.563 86.847  1.00 46.43  ? 356  SER F CA  1 
ATOM   5460  C C   . SER H  2 39  ? 12.377  112.271 87.406  1.00 46.43  ? 356  SER F C   1 
ATOM   5461  O O   . SER H  2 39  ? 12.127  111.947 88.561  1.00 46.43  ? 356  SER F O   1 
ATOM   5462  C CB  . SER H  2 39  ? 10.605  113.270 86.004  1.00 46.43  ? 356  SER F CB  1 
ATOM   5463  O OG  . SER H  2 39  ? 10.252  114.447 85.310  1.00 46.43  ? 356  SER F OG  1 
ATOM   5464  N N   . LEU H  2 40  ? 13.115  111.520 86.591  1.00 43.75  ? 357  LEU F N   1 
ATOM   5465  C CA  . LEU H  2 40  ? 13.711  110.268 87.065  1.00 43.75  ? 357  LEU F CA  1 
ATOM   5466  C C   . LEU H  2 40  ? 14.519  110.550 88.333  1.00 43.75  ? 357  LEU F C   1 
ATOM   5467  O O   . LEU H  2 40  ? 14.399  109.845 89.334  1.00 43.75  ? 357  LEU F O   1 
ATOM   5468  C CB  . LEU H  2 40  ? 14.638  109.668 86.007  1.00 43.75  ? 357  LEU F CB  1 
ATOM   5469  C CG  . LEU H  2 40  ? 13.966  109.021 84.802  1.00 43.75  ? 357  LEU F CG  1 
ATOM   5470  C CD1 . LEU H  2 40  ? 14.886  109.215 83.624  1.00 43.75  ? 357  LEU F CD1 1 
ATOM   5471  C CD2 . LEU H  2 40  ? 13.698  107.535 85.050  1.00 43.75  ? 357  LEU F CD2 1 
ATOM   5472  N N   . ARG H  2 41  ? 15.339  111.591 88.288  1.00 65.90  ? 358  ARG F N   1 
ATOM   5473  C CA  . ARG H  2 41  ? 16.154  111.944 89.436  1.00 65.90  ? 358  ARG F CA  1 
ATOM   5474  C C   . ARG H  2 41  ? 15.292  112.119 90.668  1.00 65.90  ? 358  ARG F C   1 
ATOM   5475  O O   . ARG H  2 41  ? 15.434  111.390 91.643  1.00 65.90  ? 358  ARG F O   1 
ATOM   5476  C CB  . ARG H  2 41  ? 16.920  113.236 89.165  1.00 65.90  ? 358  ARG F CB  1 
ATOM   5477  C CG  . ARG H  2 41  ? 17.623  113.257 87.807  1.00 65.90  ? 358  ARG F CG  1 
ATOM   5478  C CD  . ARG H  2 41  ? 18.279  114.613 87.513  1.00 65.90  ? 358  ARG F CD  1 
ATOM   5479  N NE  . ARG H  2 41  ? 19.705  114.501 87.191  1.00 65.90  ? 358  ARG F NE  1 
ATOM   5480  C CZ  . ARG H  2 41  ? 20.652  114.157 88.064  1.00 65.90  ? 358  ARG F CZ  1 
ATOM   5481  N NH1 . ARG H  2 41  ? 20.343  113.884 89.329  1.00 65.90  ? 358  ARG F NH1 1 
ATOM   5482  N NH2 . ARG H  2 41  ? 21.919  114.106 87.674  1.00 65.90  ? 358  ARG F NH2 1 
ATOM   5483  N N   . GLU H  2 42  ? 14.384  113.083 90.610  1.00 81.75  ? 359  GLU F N   1 
ATOM   5484  C CA  . GLU H  2 42  ? 13.501  113.379 91.731  1.00 81.75  ? 359  GLU F CA  1 
ATOM   5485  C C   . GLU H  2 42  ? 12.532  112.271 92.142  1.00 81.75  ? 359  GLU F C   1 
ATOM   5486  O O   . GLU H  2 42  ? 12.083  112.238 93.282  1.00 81.75  ? 359  GLU F O   1 
ATOM   5487  C CB  . GLU H  2 42  ? 12.678  114.637 91.429  1.00 81.75  ? 359  GLU F CB  1 
ATOM   5488  C CG  . GLU H  2 42  ? 13.492  115.885 91.132  1.00 81.75  ? 359  GLU F CG  1 
ATOM   5489  C CD  . GLU H  2 42  ? 12.657  116.972 90.472  1.00 81.75  ? 359  GLU F CD  1 
ATOM   5490  O OE1 . GLU H  2 42  ? 11.406  116.916 90.576  1.00 81.75  ? 359  GLU F OE1 1 
ATOM   5491  O OE2 . GLU H  2 42  ? 13.252  117.880 89.846  1.00 81.75  ? 359  GLU F OE2 1 
ATOM   5492  N N   . ARG H  2 43  ? 12.213  111.357 91.235  1.00 58.53  ? 360  ARG F N   1 
ATOM   5493  C CA  . ARG H  2 43  ? 11.231  110.329 91.557  1.00 58.53  ? 360  ARG F CA  1 
ATOM   5494  C C   . ARG H  2 43  ? 11.716  108.959 91.951  1.00 58.53  ? 360  ARG F C   1 
ATOM   5495  O O   . ARG H  2 43  ? 11.271  108.423 92.954  1.00 58.53  ? 360  ARG F O   1 
ATOM   5496  C CB  . ARG H  2 43  ? 10.243  110.158 90.397  1.00 58.53  ? 360  ARG F CB  1 
ATOM   5497  C CG  . ARG H  2 43  ? 9.522   111.427 90.005  1.00 58.53  ? 360  ARG F CG  1 
ATOM   5498  C CD  . ARG H  2 43  ? 8.562   111.867 91.090  1.00 58.53  ? 360  ARG F CD  1 
ATOM   5499  N NE  . ARG H  2 43  ? 7.310   112.361 90.531  1.00 58.53  ? 360  ARG F NE  1 
ATOM   5500  C CZ  . ARG H  2 43  ? 6.133   111.780 90.716  1.00 58.53  ? 360  ARG F CZ  1 
ATOM   5501  N NH1 . ARG H  2 43  ? 6.043   110.675 91.449  1.00 58.53  ? 360  ARG F NH1 1 
ATOM   5502  N NH2 . ARG H  2 43  ? 5.044   112.308 90.175  1.00 58.53  ? 360  ARG F NH2 1 
ATOM   5503  N N   . CYS H  2 44  ? 12.602  108.382 91.149  1.00 60.34  ? 361  CYS F N   1 
ATOM   5504  C CA  . CYS H  2 44  ? 13.103  107.037 91.405  1.00 60.34  ? 361  CYS F CA  1 
ATOM   5505  C C   . CYS H  2 44  ? 13.485  106.788 92.862  1.00 60.34  ? 361  CYS F C   1 
ATOM   5506  O O   . CYS H  2 44  ? 13.123  105.753 93.441  1.00 60.34  ? 361  CYS F O   1 
ATOM   5507  C CB  . CYS H  2 44  ? 14.262  106.733 90.459  1.00 60.34  ? 361  CYS F CB  1 
ATOM   5508  S SG  . CYS H  2 44  ? 13.716  106.671 88.720  1.00 60.34  ? 361  CYS F SG  1 
ATOM   5509  N N   . PRO H  2 45  ? 14.243  107.712 93.473  1.00 77.43  ? 362  PRO F N   1 
ATOM   5510  C CA  . PRO H  2 45  ? 14.592  107.476 94.876  1.00 77.43  ? 362  PRO F CA  1 
ATOM   5511  C C   . PRO H  2 45  ? 13.317  107.182 95.682  1.00 77.43  ? 362  PRO F C   1 
ATOM   5512  O O   . PRO H  2 45  ? 13.239  106.157 96.361  1.00 77.43  ? 362  PRO F O   1 
ATOM   5513  C CB  . PRO H  2 45  ? 15.273  108.774 95.311  1.00 77.43  ? 362  PRO F CB  1 
ATOM   5514  C CG  . PRO H  2 45  ? 15.099  109.739 94.171  1.00 77.43  ? 362  PRO F CG  1 
ATOM   5515  C CD  . PRO H  2 45  ? 14.852  108.942 92.944  1.00 77.43  ? 362  PRO F CD  1 
ATOM   5516  N N   . ARG H  2 46  B 12.324  108.075 95.585  1.00 83.84  ? 362  ARG F N   1 
ATOM   5517  C CA  . ARG H  2 46  B 11.042  107.915 96.283  1.00 83.84  ? 362  ARG F CA  1 
ATOM   5518  C C   . ARG H  2 46  B 10.576  106.483 96.103  1.00 83.84  ? 362  ARG F C   1 
ATOM   5519  O O   . ARG H  2 46  B 10.376  105.759 97.073  1.00 83.84  ? 362  ARG F O   1 
ATOM   5520  C CB  . ARG H  2 46  B 9.973   108.845 95.701  1.00 83.84  ? 362  ARG F CB  1 
ATOM   5521  C CG  . ARG H  2 46  B 10.433  110.259 95.451  1.00 83.84  ? 362  ARG F CG  1 
ATOM   5522  C CD  . ARG H  2 46  B 9.332   111.257 95.771  1.00 83.84  ? 362  ARG F CD  1 
ATOM   5523  N NE  . ARG H  2 46  B 9.764   112.648 95.592  1.00 83.84  ? 362  ARG F NE  1 
ATOM   5524  C CZ  . ARG H  2 46  B 10.597  113.303 96.407  1.00 83.84  ? 362  ARG F CZ  1 
ATOM   5525  N NH1 . ARG H  2 46  B 11.105  112.708 97.481  1.00 83.84  ? 362  ARG F NH1 1 
ATOM   5526  N NH2 . ARG H  2 46  B 10.916  114.568 96.153  1.00 83.84  ? 362  ARG F NH2 1 
ATOM   5527  N N   . GLY H  2 47  ? 10.408  106.086 94.846  1.00 50.92  ? 363  GLY F N   1 
ATOM   5528  C CA  . GLY H  2 47  ? 9.980   104.737 94.543  1.00 50.92  ? 363  GLY F CA  1 
ATOM   5529  C C   . GLY H  2 47  ? 8.939   104.674 93.442  1.00 50.92  ? 363  GLY F C   1 
ATOM   5530  O O   . GLY H  2 47  ? 8.489   103.586 93.078  1.00 50.92  ? 363  GLY F O   1 
ATOM   5531  N N   . ASP H  2 48  ? 8.563   105.834 92.906  1.00 59.30  ? 364  ASP F N   1 
ATOM   5532  C CA  . ASP H  2 48  ? 7.560   105.922 91.845  1.00 59.30  ? 364  ASP F CA  1 
ATOM   5533  C C   . ASP H  2 48  ? 7.781   104.982 90.675  1.00 59.30  ? 364  ASP F C   1 
ATOM   5534  O O   . ASP H  2 48  ? 8.860   104.938 90.098  1.00 59.30  ? 364  ASP F O   1 
ATOM   5535  C CB  . ASP H  2 48  ? 7.489   107.347 91.323  1.00 59.30  ? 364  ASP F CB  1 
ATOM   5536  C CG  . ASP H  2 48  ? 7.291   108.339 92.426  1.00 59.30  ? 364  ASP F CG  1 
ATOM   5537  O OD1 . ASP H  2 48  ? 6.335   108.154 93.205  1.00 59.30  ? 364  ASP F OD1 1 
ATOM   5538  O OD2 . ASP H  2 48  ? 8.090   109.293 92.520  1.00 59.30  ? 364  ASP F OD2 1 
ATOM   5539  N N   . ASP H  2 49  ? 6.741   104.230 90.331  1.00 62.67  ? 365  ASP F N   1 
ATOM   5540  C CA  . ASP H  2 49  ? 6.811   103.297 89.222  1.00 62.67  ? 365  ASP F CA  1 
ATOM   5541  C C   . ASP H  2 49  ? 7.064   104.114 87.953  1.00 62.67  ? 365  ASP F C   1 
ATOM   5542  O O   . ASP H  2 49  ? 6.607   105.253 87.843  1.00 62.67  ? 365  ASP F O   1 
ATOM   5543  C CB  . ASP H  2 49  ? 5.500   102.511 89.139  1.00 62.67  ? 365  ASP F CB  1 
ATOM   5544  C CG  . ASP H  2 49  ? 4.897   102.523 87.757  1.00 62.67  ? 365  ASP F CG  1 
ATOM   5545  O OD1 . ASP H  2 49  ? 3.757   103.026 87.617  1.00 62.67  ? 365  ASP F OD1 1 
ATOM   5546  O OD2 . ASP H  2 49  ? 5.560   102.027 86.816  1.00 62.67  ? 365  ASP F OD2 1 
ATOM   5547  N N   . ILE H  2 50  ? 7.800   103.535 87.007  1.00 57.99  ? 366  ILE F N   1 
ATOM   5548  C CA  . ILE H  2 50  ? 8.140   104.222 85.757  1.00 57.99  ? 366  ILE F CA  1 
ATOM   5549  C C   . ILE H  2 50  ? 6.948   104.814 85.014  1.00 57.99  ? 366  ILE F C   1 
ATOM   5550  O O   . ILE H  2 50  ? 7.071   105.868 84.390  1.00 57.99  ? 366  ILE F O   1 
ATOM   5551  C CB  . ILE H  2 50  ? 8.915   103.281 84.794  1.00 57.99  ? 366  ILE F CB  1 
ATOM   5552  C CG1 . ILE H  2 50  ? 10.159  103.995 84.258  1.00 57.99  ? 366  ILE F CG1 1 
ATOM   5553  C CG2 . ILE H  2 50  ? 8.014   102.816 83.665  1.00 57.99  ? 366  ILE F CG2 1 
ATOM   5554  C CD1 . ILE H  2 50  ? 9.867   105.165 83.372  1.00 57.99  ? 366  ILE F CD1 1 
ATOM   5555  N N   . LEU H  2 51  ? 5.805   104.133 85.060  1.00 44.30  ? 367  LEU F N   1 
ATOM   5556  C CA  . LEU H  2 51  ? 4.610   104.640 84.398  1.00 44.30  ? 367  LEU F CA  1 
ATOM   5557  C C   . LEU H  2 51  ? 4.260   105.974 85.039  1.00 44.30  ? 367  LEU F C   1 
ATOM   5558  O O   . LEU H  2 51  ? 3.952   106.941 84.346  1.00 44.30  ? 367  LEU F O   1 
ATOM   5559  C CB  . LEU H  2 51  ? 3.453   103.659 84.554  1.00 44.30  ? 367  LEU F CB  1 
ATOM   5560  C CG  . LEU H  2 51  ? 3.110   102.796 83.334  1.00 44.30  ? 367  LEU F CG  1 
ATOM   5561  C CD1 . LEU H  2 51  ? 4.101   102.988 82.206  1.00 44.30  ? 367  LEU F CD1 1 
ATOM   5562  C CD2 . LEU H  2 51  ? 3.086   101.361 83.768  1.00 44.30  ? 367  LEU F CD2 1 
ATOM   5563  N N   . THR H  2 52  ? 4.319   106.019 86.367  1.00 43.92  ? 368  THR F N   1 
ATOM   5564  C CA  . THR H  2 52  ? 4.043   107.245 87.111  1.00 43.92  ? 368  THR F CA  1 
ATOM   5565  C C   . THR H  2 52  ? 4.979   108.368 86.630  1.00 43.92  ? 368  THR F C   1 
ATOM   5566  O O   . THR H  2 52  ? 4.527   109.442 86.239  1.00 43.92  ? 368  THR F O   1 
ATOM   5567  C CB  . THR H  2 52  ? 4.278   107.035 88.611  1.00 43.92  ? 368  THR F CB  1 
ATOM   5568  O OG1 . THR H  2 52  ? 3.476   105.943 89.076  1.00 43.92  ? 368  THR F OG1 1 
ATOM   5569  C CG2 . THR H  2 52  ? 3.949   108.300 89.381  1.00 43.92  ? 368  THR F CG2 1 
ATOM   5570  N N   . ILE H  2 53  ? 6.286   108.126 86.656  1.00 47.93  ? 369  ILE F N   1 
ATOM   5571  C CA  . ILE H  2 53  ? 7.229   109.151 86.216  1.00 47.93  ? 369  ILE F CA  1 
ATOM   5572  C C   . ILE H  2 53  ? 6.895   109.573 84.787  1.00 47.93  ? 369  ILE F C   1 
ATOM   5573  O O   . ILE H  2 53  ? 6.775   110.769 84.494  1.00 47.93  ? 369  ILE F O   1 
ATOM   5574  C CB  . ILE H  2 53  ? 8.705   108.647 86.283  1.00 47.93  ? 369  ILE F CB  1 
ATOM   5575  C CG1 . ILE H  2 53  ? 9.115   108.419 87.746  1.00 47.93  ? 369  ILE F CG1 1 
ATOM   5576  C CG2 . ILE H  2 53  ? 9.642   109.662 85.640  1.00 47.93  ? 369  ILE F CG2 1 
ATOM   5577  C CD1 . ILE H  2 53  ? 8.996   106.975 88.195  1.00 47.93  ? 369  ILE F CD1 1 
ATOM   5578  N N   . LEU H  2 54  ? 6.724   108.594 83.904  1.00 39.58  ? 370  LEU F N   1 
ATOM   5579  C CA  . LEU H  2 54  ? 6.409   108.887 82.512  1.00 39.58  ? 370  LEU F CA  1 
ATOM   5580  C C   . LEU H  2 54  ? 5.165   109.759 82.355  1.00 39.58  ? 370  LEU F C   1 
ATOM   5581  O O   . LEU H  2 54  ? 5.075   110.532 81.385  1.00 39.58  ? 370  LEU F O   1 
ATOM   5582  C CB  . LEU H  2 54  ? 6.232   107.594 81.713  1.00 39.58  ? 370  LEU F CB  1 
ATOM   5583  C CG  . LEU H  2 54  ? 7.495   107.060 81.020  1.00 39.58  ? 370  LEU F CG  1 
ATOM   5584  C CD1 . LEU H  2 54  ? 7.157   105.816 80.201  1.00 39.58  ? 370  LEU F CD1 1 
ATOM   5585  C CD2 . LEU H  2 54  ? 8.105   108.141 80.135  1.00 39.58  ? 370  LEU F CD2 1 
ATOM   5586  N N   . THR H  2 55  ? 4.213   109.637 83.294  1.00 39.87  ? 371  THR F N   1 
ATOM   5587  C CA  . THR H  2 55  ? 2.972   110.434 83.279  1.00 39.87  ? 371  THR F CA  1 
ATOM   5588  C C   . THR H  2 55  ? 3.305   111.898 83.573  1.00 39.87  ? 371  THR F C   1 
ATOM   5589  O O   . THR H  2 55  ? 2.857   112.823 82.881  1.00 39.87  ? 371  THR F O   1 
ATOM   5590  C CB  . THR H  2 55  ? 1.958   109.964 84.352  1.00 39.87  ? 371  THR F CB  1 
ATOM   5591  O OG1 . THR H  2 55  ? 1.607   108.603 84.125  1.00 39.87  ? 371  THR F OG1 1 
ATOM   5592  C CG2 . THR H  2 55  ? 0.702   110.788 84.281  1.00 39.87  ? 371  THR F CG2 1 
ATOM   5593  N N   . GLU H  2 56  ? 4.097   112.096 84.614  1.00 56.89  ? 372  GLU F N   1 
ATOM   5594  C CA  . GLU H  2 56  ? 4.491   113.424 84.997  1.00 56.89  ? 372  GLU F CA  1 
ATOM   5595  C C   . GLU H  2 56  ? 5.232   114.074 83.850  1.00 56.89  ? 372  GLU F C   1 
ATOM   5596  O O   . GLU H  2 56  ? 5.072   115.267 83.594  1.00 56.89  ? 372  GLU F O   1 
ATOM   5597  C CB  . GLU H  2 56  ? 5.383   113.356 86.212  1.00 56.89  ? 372  GLU F CB  1 
ATOM   5598  C CG  . GLU H  2 56  ? 6.204   114.599 86.435  1.00 56.89  ? 372  GLU F CG  1 
ATOM   5599  C CD  . GLU H  2 56  ? 6.759   114.639 87.839  1.00 56.89  ? 372  GLU F CD  1 
ATOM   5600  O OE1 . GLU H  2 56  ? 5.940   114.582 88.786  1.00 56.89  ? 372  GLU F OE1 1 
ATOM   5601  O OE2 . GLU H  2 56  ? 8.003   114.716 87.992  1.00 56.89  ? 372  GLU F OE2 1 
ATOM   5602  N N   . VAL H  2 57  ? 6.054   113.293 83.159  1.00 40.17  ? 373  VAL F N   1 
ATOM   5603  C CA  . VAL H  2 57  ? 6.796   113.840 82.026  1.00 40.17  ? 373  VAL F CA  1 
ATOM   5604  C C   . VAL H  2 57  ? 5.809   114.337 80.981  1.00 40.17  ? 373  VAL F C   1 
ATOM   5605  O O   . VAL H  2 57  ? 6.028   115.369 80.347  1.00 40.17  ? 373  VAL F O   1 
ATOM   5606  C CB  . VAL H  2 57  ? 7.702   112.791 81.385  1.00 40.17  ? 373  VAL F CB  1 
ATOM   5607  C CG1 . VAL H  2 57  ? 8.375   113.371 80.140  1.00 40.17  ? 373  VAL F CG1 1 
ATOM   5608  C CG2 . VAL H  2 57  ? 8.730   112.335 82.401  1.00 40.17  ? 373  VAL F CG2 1 
ATOM   5609  N N   . ASN H  2 58  ? 4.723   113.584 80.809  1.00 44.15  ? 374  ASN F N   1 
ATOM   5610  C CA  . ASN H  2 58  ? 3.684   113.956 79.863  1.00 44.15  ? 374  ASN F CA  1 
ATOM   5611  C C   . ASN H  2 58  ? 3.162   115.312 80.348  1.00 44.15  ? 374  ASN F C   1 
ATOM   5612  O O   . ASN H  2 58  ? 2.944   116.237 79.559  1.00 44.15  ? 374  ASN F O   1 
ATOM   5613  C CB  . ASN H  2 58  ? 2.569   112.906 79.860  1.00 44.15  ? 374  ASN F CB  1 
ATOM   5614  C CG  . ASN H  2 58  ? 2.716   111.900 78.726  1.00 44.15  ? 374  ASN F CG  1 
ATOM   5615  O OD1 . ASN H  2 58  ? 3.630   111.998 77.902  1.00 44.15  ? 374  ASN F OD1 1 
ATOM   5616  N ND2 . ASN H  2 58  ? 1.813   110.924 78.679  1.00 44.15  ? 374  ASN F ND2 1 
ATOM   5617  N N   . TYR H  2 59  ? 2.997   115.443 81.659  1.00 66.55  ? 375  TYR F N   1 
ATOM   5618  C CA  . TYR H  2 59  ? 2.512   116.685 82.214  1.00 66.55  ? 375  TYR F CA  1 
ATOM   5619  C C   . TYR H  2 59  ? 3.441   117.862 81.929  1.00 66.55  ? 375  TYR F C   1 
ATOM   5620  O O   . TYR H  2 59  ? 3.095   118.733 81.137  1.00 66.55  ? 375  TYR F O   1 
ATOM   5621  C CB  . TYR H  2 59  ? 2.311   116.536 83.709  1.00 66.55  ? 375  TYR F CB  1 
ATOM   5622  C CG  . TYR H  2 59  ? 1.651   117.732 84.333  1.00 66.55  ? 375  TYR F CG  1 
ATOM   5623  C CD1 . TYR H  2 59  ? 0.808   118.559 83.583  1.00 66.55  ? 375  TYR F CD1 1 
ATOM   5624  C CD2 . TYR H  2 59  ? 1.866   118.044 85.677  1.00 66.55  ? 375  TYR F CD2 1 
ATOM   5625  C CE1 . TYR H  2 59  ? 0.198   119.667 84.154  1.00 66.55  ? 375  TYR F CE1 1 
ATOM   5626  C CE2 . TYR H  2 59  ? 1.259   119.151 86.263  1.00 66.55  ? 375  TYR F CE2 1 
ATOM   5627  C CZ  . TYR H  2 59  ? 0.430   119.955 85.496  1.00 66.55  ? 375  TYR F CZ  1 
ATOM   5628  O OH  . TYR H  2 59  ? -0.151  121.054 86.076  1.00 66.55  ? 375  TYR F OH  1 
ATOM   5629  N N   . GLU H  2 60  ? 4.614   117.881 82.566  1.00 69.54  ? 376  GLU F N   1 
ATOM   5630  C CA  . GLU H  2 60  ? 5.593   118.966 82.396  1.00 69.54  ? 376  GLU F CA  1 
ATOM   5631  C C   . GLU H  2 60  ? 5.780   119.428 80.951  1.00 69.54  ? 376  GLU F C   1 
ATOM   5632  O O   . GLU H  2 60  ? 5.791   120.629 80.659  1.00 69.54  ? 376  GLU F O   1 
ATOM   5633  C CB  . GLU H  2 60  ? 6.955   118.552 82.959  1.00 69.54  ? 376  GLU F CB  1 
ATOM   5634  C CG  . GLU H  2 60  ? 6.888   117.761 84.251  1.00 69.54  ? 376  GLU F CG  1 
ATOM   5635  C CD  . GLU H  2 60  ? 6.329   118.576 85.414  1.00 69.54  ? 376  GLU F CD  1 
ATOM   5636  O OE1 . GLU H  2 60  ? 6.512   119.819 85.409  1.00 69.54  ? 376  GLU F OE1 1 
ATOM   5637  O OE2 . GLU H  2 60  ? 5.711   117.977 86.333  1.00 69.54  ? 376  GLU F OE2 1 
ATOM   5638  N N   . VAL H  2 61  ? 5.934   118.468 80.050  1.00 49.12  ? 377  VAL F N   1 
ATOM   5639  C CA  . VAL H  2 61  ? 6.128   118.773 78.641  1.00 49.12  ? 377  VAL F CA  1 
ATOM   5640  C C   . VAL H  2 61  ? 4.904   119.447 78.017  1.00 49.12  ? 377  VAL F C   1 
ATOM   5641  O O   . VAL H  2 61  ? 5.016   120.233 77.060  1.00 49.12  ? 377  VAL F O   1 
ATOM   5642  C CB  . VAL H  2 61  ? 6.455   117.494 77.855  1.00 49.12  ? 377  VAL F CB  1 
ATOM   5643  C CG1 . VAL H  2 61  ? 6.791   117.837 76.414  1.00 49.12  ? 377  VAL F CG1 1 
ATOM   5644  C CG2 . VAL H  2 61  ? 7.620   116.784 78.516  1.00 49.12  ? 377  VAL F CG2 1 
ATOM   5645  N N   . SER H  2 62  ? 3.736   119.141 78.569  1.00 47.44  ? 378  SER F N   1 
ATOM   5646  C CA  . SER H  2 62  ? 2.484   119.702 78.071  1.00 47.44  ? 378  SER F CA  1 
ATOM   5647  C C   . SER H  2 62  ? 2.363   121.195 78.353  1.00 47.44  ? 378  SER F C   1 
ATOM   5648  O O   . SER H  2 62  ? 1.727   121.926 77.598  1.00 47.44  ? 378  SER F O   1 
ATOM   5649  C CB  . SER H  2 62  ? 1.303   118.949 78.691  1.00 47.44  ? 378  SER F CB  1 
ATOM   5650  O OG  . SER H  2 62  ? 1.249   117.608 78.217  1.00 47.44  ? 378  SER F OG  1 
ATOM   5651  N N   . ASN H  2 63  ? 2.989   121.644 79.433  1.00 72.33  ? 379  ASN F N   1 
ATOM   5652  C CA  . ASN H  2 63  ? 2.941   123.047 79.800  1.00 72.33  ? 379  ASN F CA  1 
ATOM   5653  C C   . ASN H  2 63  ? 3.938   123.888 79.006  1.00 72.33  ? 379  ASN F C   1 
ATOM   5654  O O   . ASN H  2 63  ? 3.844   125.115 78.983  1.00 72.33  ? 379  ASN F O   1 
ATOM   5655  C CB  . ASN H  2 63  ? 3.185   123.188 81.297  1.00 72.33  ? 379  ASN F CB  1 
ATOM   5656  C CG  . ASN H  2 63  ? 2.093   122.520 82.123  1.00 72.33  ? 379  ASN F CG  1 
ATOM   5657  O OD1 . ASN H  2 63  ? 1.138   121.957 81.571  1.00 72.33  ? 379  ASN F OD1 1 
ATOM   5658  N ND2 . ASN H  2 63  ? 2.226   122.576 83.448  1.00 72.33  ? 379  ASN F ND2 1 
ATOM   5659  N N   . LYS H  2 64  ? 4.883   123.225 78.344  1.00 52.20  ? 381  LYS F N   1 
ATOM   5660  C CA  . LYS H  2 64  ? 5.890   123.902 77.531  1.00 52.20  ? 381  LYS F CA  1 
ATOM   5661  C C   . LYS H  2 64  ? 5.227   124.599 76.351  1.00 52.20  ? 381  LYS F C   1 
ATOM   5662  O O   . LYS H  2 64  ? 4.276   124.068 75.778  1.00 52.20  ? 381  LYS F O   1 
ATOM   5663  C CB  . LYS H  2 64  ? 6.900   122.880 77.015  1.00 52.20  ? 381  LYS F CB  1 
ATOM   5664  C CG  . LYS H  2 64  ? 7.884   122.413 78.070  1.00 52.20  ? 381  LYS F CG  1 
ATOM   5665  C CD  . LYS H  2 64  ? 9.285   122.946 77.792  1.00 52.20  ? 381  LYS F CD  1 
ATOM   5666  C CE  . LYS H  2 64  ? 10.061  123.083 79.072  1.00 52.20  ? 381  LYS F CE  1 
ATOM   5667  N NZ  . LYS H  2 64  ? 9.441   122.218 80.122  1.00 52.20  ? 381  LYS F NZ  1 
ATOM   5668  N N   . ASP H  2 65  A 5.744   125.767 75.972  1.00 53.91  ? 381  ASP F N   1 
ATOM   5669  C CA  . ASP H  2 65  A 5.167   126.527 74.861  1.00 53.91  ? 381  ASP F CA  1 
ATOM   5670  C C   . ASP H  2 65  A 6.155   127.038 73.800  1.00 53.91  ? 381  ASP F C   1 
ATOM   5671  O O   . ASP H  2 65  A 7.091   127.753 74.133  1.00 53.91  ? 381  ASP F O   1 
ATOM   5672  C CB  . ASP H  2 65  A 4.400   127.736 75.423  1.00 53.91  ? 381  ASP F CB  1 
ATOM   5673  C CG  . ASP H  2 65  A 2.965   127.398 75.822  1.00 53.91  ? 381  ASP F CG  1 
ATOM   5674  O OD1 . ASP H  2 65  A 2.086   127.418 74.924  1.00 53.91  ? 381  ASP F OD1 1 
ATOM   5675  O OD2 . ASP H  2 65  A 2.715   127.118 77.023  1.00 53.91  ? 381  ASP F OD2 1 
ATOM   5676  N N   . ASP H  2 66  B 5.950   126.670 72.532  1.00 52.90  ? 381  ASP F N   1 
ATOM   5677  C CA  . ASP H  2 66  B 6.799   127.175 71.449  1.00 52.90  ? 381  ASP F CA  1 
ATOM   5678  C C   . ASP H  2 66  B 6.034   128.393 70.930  1.00 52.90  ? 381  ASP F C   1 
ATOM   5679  O O   . ASP H  2 66  B 5.446   128.364 69.836  1.00 52.90  ? 381  ASP F O   1 
ATOM   5680  C CB  . ASP H  2 66  B 6.940   126.164 70.305  1.00 52.90  ? 381  ASP F CB  1 
ATOM   5681  C CG  . ASP H  2 66  B 7.255   126.844 68.960  1.00 52.90  ? 381  ASP F CG  1 
ATOM   5682  O OD1 . ASP H  2 66  B 7.838   127.942 68.987  1.00 52.90  ? 381  ASP F OD1 1 
ATOM   5683  O OD2 . ASP H  2 66  B 6.924   126.308 67.878  1.00 52.90  ? 381  ASP F OD2 1 
ATOM   5684  N N   . LYS H  2 67  C 6.021   129.453 71.731  1.00 73.46  ? 381  LYS F N   1 
ATOM   5685  C CA  . LYS H  2 67  C 5.308   130.684 71.399  1.00 73.46  ? 381  LYS F CA  1 
ATOM   5686  C C   . LYS H  2 67  C 5.161   131.041 69.914  1.00 73.46  ? 381  LYS F C   1 
ATOM   5687  O O   . LYS H  2 67  C 4.059   131.340 69.457  1.00 73.46  ? 381  LYS F O   1 
ATOM   5688  C CB  . LYS H  2 67  C 5.945   131.860 72.140  1.00 73.46  ? 381  LYS F CB  1 
ATOM   5689  C CG  . LYS H  2 67  C 5.178   132.291 73.386  1.00 73.46  ? 381  LYS F CG  1 
ATOM   5690  C CD  . LYS H  2 67  C 5.308   131.260 74.495  1.00 73.46  ? 381  LYS F CD  1 
ATOM   5691  C CE  . LYS H  2 67  C 5.557   131.927 75.840  1.00 73.46  ? 381  LYS F CE  1 
ATOM   5692  N NZ  . LYS H  2 67  C 5.919   130.925 76.890  1.00 73.46  ? 381  LYS F NZ  1 
ATOM   5693  N N   . LYS H  2 68  D 6.258   131.013 69.164  1.00 100.00 ? 381  LYS F N   1 
ATOM   5694  C CA  . LYS H  2 68  D 6.221   131.354 67.741  1.00 100.00 ? 381  LYS F CA  1 
ATOM   5695  C C   . LYS H  2 68  D 5.072   130.713 66.948  1.00 100.00 ? 381  LYS F C   1 
ATOM   5696  O O   . LYS H  2 68  D 4.003   131.312 66.797  1.00 100.00 ? 381  LYS F O   1 
ATOM   5697  C CB  . LYS H  2 68  D 7.559   130.996 67.085  1.00 100.00 ? 381  LYS F CB  1 
ATOM   5698  C CG  . LYS H  2 68  D 7.588   131.213 65.579  1.00 100.00 ? 381  LYS F CG  1 
ATOM   5699  C CD  . LYS H  2 68  D 8.990   131.520 65.085  1.00 100.00 ? 381  LYS F CD  1 
ATOM   5700  C CE  . LYS H  2 68  D 9.224   133.019 65.027  1.00 100.00 ? 381  LYS F CE  1 
ATOM   5701  N NZ  . LYS H  2 68  D 8.546   133.650 63.858  1.00 100.00 ? 381  LYS F NZ  1 
ATOM   5702  N N   . ASN H  2 69  E 5.293   129.504 66.438  1.00 78.77  ? 381  ASN F N   1 
ATOM   5703  C CA  . ASN H  2 69  E 4.271   128.809 65.653  1.00 78.77  ? 381  ASN F CA  1 
ATOM   5704  C C   . ASN H  2 69  E 3.160   128.301 66.556  1.00 78.77  ? 381  ASN F C   1 
ATOM   5705  O O   . ASN H  2 69  E 2.469   127.335 66.229  1.00 78.77  ? 381  ASN F O   1 
ATOM   5706  C CB  . ASN H  2 69  E 4.905   127.642 64.891  1.00 78.77  ? 381  ASN F CB  1 
ATOM   5707  C CG  . ASN H  2 69  E 6.399   127.834 64.678  1.00 78.77  ? 381  ASN F CG  1 
ATOM   5708  O OD1 . ASN H  2 69  E 6.843   128.160 63.571  1.00 78.77  ? 381  ASN F OD1 1 
ATOM   5709  N ND2 . ASN H  2 69  E 7.181   127.637 65.740  1.00 78.77  ? 381  ASN F ND2 1 
ATOM   5710  N N   . MET H  2 70  ? 3.003   128.978 67.692  1.00 100.00 ? 382  MET F N   1 
ATOM   5711  C CA  . MET H  2 70  ? 1.998   128.638 68.681  1.00 100.00 ? 382  MET F CA  1 
ATOM   5712  C C   . MET H  2 70  ? 1.815   127.133 68.656  1.00 100.00 ? 382  MET F C   1 
ATOM   5713  O O   . MET H  2 70  ? 0.750   126.618 68.307  1.00 100.00 ? 382  MET F O   1 
ATOM   5714  C CB  . MET H  2 70  ? 0.682   129.360 68.364  1.00 100.00 ? 382  MET F CB  1 
ATOM   5715  C CG  . MET H  2 70  ? -0.022  129.984 69.582  1.00 100.00 ? 382  MET F CG  1 
ATOM   5716  S SD  . MET H  2 70  ? 1.061   130.905 70.732  1.00 100.00 ? 382  MET F SD  1 
ATOM   5717  C CE  . MET H  2 70  ? 1.587   129.589 71.908  1.00 100.00 ? 382  MET F CE  1 
ATOM   5718  N N   . GLY H  2 71  ? 2.883   126.430 69.011  1.00 61.39  ? 383  GLY F N   1 
ATOM   5719  C CA  . GLY H  2 71  ? 2.836   124.984 69.010  1.00 61.39  ? 383  GLY F CA  1 
ATOM   5720  C C   . GLY H  2 71  ? 3.110   124.361 70.361  1.00 61.39  ? 383  GLY F C   1 
ATOM   5721  O O   . GLY H  2 71  ? 3.575   125.031 71.291  1.00 61.39  ? 383  GLY F O   1 
ATOM   5722  N N   . LYS H  2 72  ? 2.809   123.068 70.459  1.00 40.99  ? 384  LYS F N   1 
ATOM   5723  C CA  . LYS H  2 72  ? 3.014   122.311 71.686  1.00 40.99  ? 384  LYS F CA  1 
ATOM   5724  C C   . LYS H  2 72  ? 3.648   120.952 71.355  1.00 40.99  ? 384  LYS F C   1 
ATOM   5725  O O   . LYS H  2 72  ? 3.916   120.650 70.181  1.00 40.99  ? 384  LYS F O   1 
ATOM   5726  C CB  . LYS H  2 72  ? 1.673   122.117 72.409  1.00 40.99  ? 384  LYS F CB  1 
ATOM   5727  C CG  . LYS H  2 72  ? 1.077   123.395 72.992  1.00 40.99  ? 384  LYS F CG  1 
ATOM   5728  C CD  . LYS H  2 72  ? 0.692   123.199 74.451  1.00 40.99  ? 384  LYS F CD  1 
ATOM   5729  C CE  . LYS H  2 72  ? 1.525   124.066 75.362  1.00 40.99  ? 384  LYS F CE  1 
ATOM   5730  N NZ  . LYS H  2 72  ? 0.945   124.169 76.726  1.00 40.99  ? 384  LYS F NZ  1 
ATOM   5731  N N   . GLN H  2 73  ? 3.901   120.145 72.385  1.00 52.83  ? 385  GLN F N   1 
ATOM   5732  C CA  . GLN H  2 73  ? 4.503   118.827 72.186  1.00 52.83  ? 385  GLN F CA  1 
ATOM   5733  C C   . GLN H  2 73  ? 3.924   117.824 73.179  1.00 52.83  ? 385  GLN F C   1 
ATOM   5734  O O   . GLN H  2 73  ? 3.937   118.067 74.386  1.00 52.83  ? 385  GLN F O   1 
ATOM   5735  C CB  . GLN H  2 73  ? 6.030   118.913 72.341  1.00 52.83  ? 385  GLN F CB  1 
ATOM   5736  C CG  . GLN H  2 73  ? 6.703   117.622 72.801  1.00 52.83  ? 385  GLN F CG  1 
ATOM   5737  C CD  . GLN H  2 73  ? 8.166   117.583 72.456  1.00 52.83  ? 385  GLN F CD  1 
ATOM   5738  O OE1 . GLN H  2 73  ? 8.676   118.488 71.820  1.00 52.83  ? 385  GLN F OE1 1 
ATOM   5739  N NE2 . GLN H  2 73  ? 8.850   116.535 72.876  1.00 52.83  ? 385  GLN F NE2 1 
ATOM   5740  N N   . MET H  2 74  ? 3.427   116.701 72.662  1.00 35.69  ? 386  MET F N   1 
ATOM   5741  C CA  . MET H  2 74  ? 2.818   115.668 73.493  1.00 35.69  ? 386  MET F CA  1 
ATOM   5742  C C   . MET H  2 74  ? 3.513   114.318 73.461  1.00 35.69  ? 386  MET F C   1 
ATOM   5743  O O   . MET H  2 74  ? 3.362   113.554 72.502  1.00 35.69  ? 386  MET F O   1 
ATOM   5744  C CB  . MET H  2 74  ? 1.368   115.432 73.076  1.00 35.69  ? 386  MET F CB  1 
ATOM   5745  C CG  . MET H  2 74  ? 0.667   114.415 73.928  1.00 35.69  ? 386  MET F CG  1 
ATOM   5746  S SD  . MET H  2 74  ? 0.242   115.243 75.453  1.00 35.69  ? 386  MET F SD  1 
ATOM   5747  C CE  . MET H  2 74  ? 0.977   114.202 76.648  1.00 35.69  ? 386  MET F CE  1 
ATOM   5748  N N   . PRO H  2 75  ? 4.307   114.009 74.488  1.00 41.14  ? 387  PRO F N   1 
ATOM   5749  C CA  . PRO H  2 75  ? 4.992   112.710 74.529  1.00 41.14  ? 387  PRO F CA  1 
ATOM   5750  C C   . PRO H  2 75  ? 3.942   111.596 74.538  1.00 41.14  ? 387  PRO F C   1 
ATOM   5751  O O   . PRO H  2 75  ? 2.788   111.846 74.826  1.00 41.14  ? 387  PRO F O   1 
ATOM   5752  C CB  . PRO H  2 75  ? 5.773   112.762 75.834  1.00 41.14  ? 387  PRO F CB  1 
ATOM   5753  C CG  . PRO H  2 75  ? 5.952   114.230 76.089  1.00 41.14  ? 387  PRO F CG  1 
ATOM   5754  C CD  . PRO H  2 75  ? 4.680   114.862 75.620  1.00 41.14  ? 387  PRO F CD  1 
ATOM   5755  N N   . GLN H  2 76  ? 4.330   110.370 74.225  1.00 26.68  ? 388  GLN F N   1 
ATOM   5756  C CA  . GLN H  2 76  ? 3.367   109.289 74.208  1.00 26.68  ? 388  GLN F CA  1 
ATOM   5757  C C   . GLN H  2 76  ? 3.914   107.876 74.424  1.00 26.68  ? 388  GLN F C   1 
ATOM   5758  O O   . GLN H  2 76  ? 4.310   107.198 73.473  1.00 26.68  ? 388  GLN F O   1 
ATOM   5759  C CB  . GLN H  2 76  ? 2.603   109.322 72.904  1.00 26.68  ? 388  GLN F CB  1 
ATOM   5760  C CG  . GLN H  2 76  ? 1.655   108.158 72.749  1.00 26.68  ? 388  GLN F CG  1 
ATOM   5761  C CD  . GLN H  2 76  ? 1.109   108.061 71.353  1.00 26.68  ? 388  GLN F CD  1 
ATOM   5762  O OE1 . GLN H  2 76  ? 1.093   109.039 70.608  1.00 26.68  ? 388  GLN F OE1 1 
ATOM   5763  N NE2 . GLN H  2 76  ? 0.661   106.882 70.982  1.00 26.68  ? 388  GLN F NE2 1 
ATOM   5764  N N   . PRO H  2 77  ? 3.942   107.417 75.686  1.00 25.26  ? 389  PRO F N   1 
ATOM   5765  C CA  . PRO H  2 77  ? 4.424   106.089 76.067  1.00 25.26  ? 389  PRO F CA  1 
ATOM   5766  C C   . PRO H  2 77  ? 3.485   104.995 75.607  1.00 25.26  ? 389  PRO F C   1 
ATOM   5767  O O   . PRO H  2 77  ? 2.278   105.201 75.509  1.00 25.26  ? 389  PRO F O   1 
ATOM   5768  C CB  . PRO H  2 77  ? 4.467   106.140 77.589  1.00 25.26  ? 389  PRO F CB  1 
ATOM   5769  C CG  . PRO H  2 77  ? 4.370   107.576 77.934  1.00 25.26  ? 389  PRO F CG  1 
ATOM   5770  C CD  . PRO H  2 77  ? 3.544   108.191 76.868  1.00 25.26  ? 389  PRO F CD  1 
ATOM   5771  N N   . THR H  2 78  ? 4.039   103.829 75.331  1.00 27.91  ? 390  THR F N   1 
ATOM   5772  C CA  . THR H  2 78  ? 3.250   102.683 74.914  1.00 27.91  ? 390  THR F CA  1 
ATOM   5773  C C   . THR H  2 78  ? 3.931   101.599 75.681  1.00 27.91  ? 390  THR F C   1 
ATOM   5774  O O   . THR H  2 78  ? 5.160   101.581 75.758  1.00 27.91  ? 390  THR F O   1 
ATOM   5775  C CB  . THR H  2 78  ? 3.410   102.383 73.447  1.00 27.91  ? 390  THR F CB  1 
ATOM   5776  O OG1 . THR H  2 78  ? 3.181   103.584 72.693  1.00 27.91  ? 390  THR F OG1 1 
ATOM   5777  C CG2 . THR H  2 78  ? 2.435   101.308 73.036  1.00 27.91  ? 390  THR F CG2 1 
ATOM   5778  N N   . PHE H  2 79  ? 3.172   100.686 76.260  1.00 44.37  ? 392  PHE F N   1 
ATOM   5779  C CA  . PHE H  2 79  ? 3.836   99.686  77.052  1.00 44.37  ? 392  PHE F CA  1 
ATOM   5780  C C   . PHE H  2 79  ? 3.193   98.338  77.052  1.00 44.37  ? 392  PHE F C   1 
ATOM   5781  O O   . PHE H  2 79  ? 1.997   98.202  76.857  1.00 44.37  ? 392  PHE F O   1 
ATOM   5782  C CB  . PHE H  2 79  ? 3.949   100.167 78.479  1.00 44.37  ? 392  PHE F CB  1 
ATOM   5783  C CG  . PHE H  2 79  ? 2.634   100.237 79.189  1.00 44.37  ? 392  PHE F CG  1 
ATOM   5784  C CD1 . PHE H  2 79  ? 2.167   99.144  79.905  1.00 44.37  ? 392  PHE F CD1 1 
ATOM   5785  C CD2 . PHE H  2 79  ? 1.868   101.408 79.169  1.00 44.37  ? 392  PHE F CD2 1 
ATOM   5786  C CE1 . PHE H  2 79  ? 0.955   99.212  80.605  1.00 44.37  ? 392  PHE F CE1 1 
ATOM   5787  C CE2 . PHE H  2 79  ? 0.651   101.492 79.863  1.00 44.37  ? 392  PHE F CE2 1 
ATOM   5788  C CZ  . PHE H  2 79  ? 0.198   100.389 80.586  1.00 44.37  ? 392  PHE F CZ  1 
ATOM   5789  N N   . THR H  2 80  ? 4.032   97.344  77.309  1.00 31.84  ? 393  THR F N   1 
ATOM   5790  C CA  . THR H  2 80  ? 3.655   95.943  77.350  1.00 31.84  ? 393  THR F CA  1 
ATOM   5791  C C   . THR H  2 80  ? 4.123   95.335  78.670  1.00 31.84  ? 393  THR F C   1 
ATOM   5792  O O   . THR H  2 80  ? 3.969   94.152  78.894  1.00 31.84  ? 393  THR F O   1 
ATOM   5793  C CB  . THR H  2 80  ? 4.284   95.203  76.172  1.00 31.84  ? 393  THR F CB  1 
ATOM   5794  O OG1 . THR H  2 80  ? 3.554   95.509  74.982  1.00 31.84  ? 393  THR F OG1 1 
ATOM   5795  C CG2 . THR H  2 80  ? 4.222   93.748  76.376  1.00 31.84  ? 393  THR F CG2 1 
ATOM   5796  N N   . LEU H  2 81  ? 4.681   96.155  79.553  1.00 44.31  ? 394  LEU F N   1 
ATOM   5797  C CA  . LEU H  2 81  ? 5.133   95.670  80.853  1.00 44.31  ? 394  LEU F CA  1 
ATOM   5798  C C   . LEU H  2 81  ? 4.043   94.783  81.481  1.00 44.31  ? 394  LEU F C   1 
ATOM   5799  O O   . LEU H  2 81  ? 2.870   94.899  81.127  1.00 44.31  ? 394  LEU F O   1 
ATOM   5800  C CB  . LEU H  2 81  ? 5.423   96.857  81.773  1.00 44.31  ? 394  LEU F CB  1 
ATOM   5801  C CG  . LEU H  2 81  ? 6.388   97.884  81.192  1.00 44.31  ? 394  LEU F CG  1 
ATOM   5802  C CD1 . LEU H  2 81  ? 6.751   98.924  82.246  1.00 44.31  ? 394  LEU F CD1 1 
ATOM   5803  C CD2 . LEU H  2 81  ? 7.633   97.160  80.689  1.00 44.31  ? 394  LEU F CD2 1 
ATOM   5804  N N   . ARG H  2 82  ? 4.435   93.899  82.401  1.00 59.31  ? 395  ARG F N   1 
ATOM   5805  C CA  . ARG H  2 82  ? 3.494   93.012  83.079  1.00 59.31  ? 395  ARG F CA  1 
ATOM   5806  C C   . ARG H  2 82  ? 3.652   93.149  84.579  1.00 59.31  ? 395  ARG F C   1 
ATOM   5807  O O   . ARG H  2 82  ? 2.962   92.492  85.340  1.00 59.31  ? 395  ARG F O   1 
ATOM   5808  C CB  . ARG H  2 82  ? 3.747   91.563  82.696  1.00 59.31  ? 395  ARG F CB  1 
ATOM   5809  C CG  . ARG H  2 82  ? 3.408   91.229  81.265  1.00 59.31  ? 395  ARG F CG  1 
ATOM   5810  C CD  . ARG H  2 82  ? 3.962   89.863  80.890  1.00 59.31  ? 395  ARG F CD  1 
ATOM   5811  N NE  . ARG H  2 82  ? 5.218   89.591  81.586  1.00 59.31  ? 395  ARG F NE  1 
ATOM   5812  C CZ  . ARG H  2 82  ? 5.361   88.713  82.579  1.00 59.31  ? 395  ARG F CZ  1 
ATOM   5813  N NH1 . ARG H  2 82  ? 4.319   88.003  83.009  1.00 59.31  ? 395  ARG F NH1 1 
ATOM   5814  N NH2 . ARG H  2 82  ? 6.552   88.555  83.153  1.00 59.31  ? 395  ARG F NH2 1 
ATOM   5815  N N   . LYS H  2 83  ? 4.573   94.006  84.993  1.00 40.27  ? 396  LYS F N   1 
ATOM   5816  C CA  . LYS H  2 83  ? 4.836   94.244  86.401  1.00 40.27  ? 396  LYS F CA  1 
ATOM   5817  C C   . LYS H  2 83  ? 5.189   95.715  86.555  1.00 40.27  ? 396  LYS F C   1 
ATOM   5818  O O   . LYS H  2 83  ? 5.588   96.350  85.588  1.00 40.27  ? 396  LYS F O   1 
ATOM   5819  C CB  . LYS H  2 83  ? 6.035   93.416  86.852  1.00 40.27  ? 396  LYS F CB  1 
ATOM   5820  C CG  . LYS H  2 83  ? 5.763   91.950  87.114  1.00 40.27  ? 396  LYS F CG  1 
ATOM   5821  C CD  . LYS H  2 83  ? 7.028   91.274  87.658  1.00 40.27  ? 396  LYS F CD  1 
ATOM   5822  C CE  . LYS H  2 83  ? 7.337   89.979  86.907  1.00 40.27  ? 396  LYS F CE  1 
ATOM   5823  N NZ  . LYS H  2 83  ? 7.527   88.833  87.854  1.00 40.27  ? 396  LYS F NZ  1 
ATOM   5824  N N   . LYS H  2 84  ? 5.061   96.266  87.756  1.00 60.15  ? 397  LYS F N   1 
ATOM   5825  C CA  . LYS H  2 84  ? 5.430   97.662  87.939  1.00 60.15  ? 397  LYS F CA  1 
ATOM   5826  C C   . LYS H  2 84  ? 6.931   97.742  87.680  1.00 60.15  ? 397  LYS F C   1 
ATOM   5827  O O   . LYS H  2 84  ? 7.667   96.792  87.964  1.00 60.15  ? 397  LYS F O   1 
ATOM   5828  C CB  . LYS H  2 84  ? 5.125   98.131  89.363  1.00 60.15  ? 397  LYS F CB  1 
ATOM   5829  C CG  . LYS H  2 84  ? 3.968   99.122  89.435  1.00 60.15  ? 397  LYS F CG  1 
ATOM   5830  C CD  . LYS H  2 84  ? 3.971   99.934  90.728  1.00 60.15  ? 397  LYS F CD  1 
ATOM   5831  C CE  . LYS H  2 84  ? 2.605   100.565 91.016  1.00 60.15  ? 397  LYS F CE  1 
ATOM   5832  N NZ  . LYS H  2 84  ? 1.813   100.779 89.773  1.00 60.15  ? 397  LYS F NZ  1 
ATOM   5833  N N   . LEU H  2 85  ? 7.395   98.851  87.119  1.00 53.59  ? 398  LEU F N   1 
ATOM   5834  C CA  . LEU H  2 85  ? 8.822   98.983  86.863  1.00 53.59  ? 398  LEU F CA  1 
ATOM   5835  C C   . LEU H  2 85  ? 9.427   100.121 87.663  1.00 53.59  ? 398  LEU F C   1 
ATOM   5836  O O   . LEU H  2 85  ? 9.229   101.293 87.345  1.00 53.59  ? 398  LEU F O   1 
ATOM   5837  C CB  . LEU H  2 85  ? 9.102   99.218  85.379  1.00 53.59  ? 398  LEU F CB  1 
ATOM   5838  C CG  . LEU H  2 85  ? 10.562  99.584  85.075  1.00 53.59  ? 398  LEU F CG  1 
ATOM   5839  C CD1 . LEU H  2 85  ? 11.436  98.341  85.075  1.00 53.59  ? 398  LEU F CD1 1 
ATOM   5840  C CD2 . LEU H  2 85  ? 10.633  100.267 83.732  1.00 53.59  ? 398  LEU F CD2 1 
ATOM   5841  N N   . VAL H  2 86  ? 10.166  99.775  88.706  1.00 48.48  ? 399  VAL F N   1 
ATOM   5842  C CA  . VAL H  2 86  ? 10.798  100.792 89.517  1.00 48.48  ? 399  VAL F CA  1 
ATOM   5843  C C   . VAL H  2 86  ? 12.324  100.592 89.489  1.00 48.48  ? 399  VAL F C   1 
ATOM   5844  O O   . VAL H  2 86  ? 12.811  99.482  89.225  1.00 48.48  ? 399  VAL F O   1 
ATOM   5845  C CB  . VAL H  2 86  ? 10.267  100.729 90.950  1.00 48.48  ? 399  VAL F CB  1 
ATOM   5846  C CG1 . VAL H  2 86  ? 10.360  99.302  91.459  1.00 48.48  ? 399  VAL F CG1 1 
ATOM   5847  C CG2 . VAL H  2 86  ? 11.033  101.714 91.845  1.00 48.48  ? 399  VAL F CG2 1 
ATOM   5848  N N   . PHE H  2 87  ? 13.065  101.674 89.745  1.00 35.46  ? 400  PHE F N   1 
ATOM   5849  C CA  . PHE H  2 87  ? 14.526  101.663 89.733  1.00 35.46  ? 400  PHE F CA  1 
ATOM   5850  C C   . PHE H  2 87  ? 15.085  102.031 91.100  1.00 35.46  ? 400  PHE F C   1 
ATOM   5851  O O   . PHE H  2 87  ? 15.347  103.213 91.368  1.00 35.46  ? 400  PHE F O   1 
ATOM   5852  C CB  . PHE H  2 87  ? 15.059  102.685 88.723  1.00 35.46  ? 400  PHE F CB  1 
ATOM   5853  C CG  . PHE H  2 87  ? 14.789  102.339 87.287  1.00 35.46  ? 400  PHE F CG  1 
ATOM   5854  C CD1 . PHE H  2 87  ? 14.376  103.322 86.393  1.00 35.46  ? 400  PHE F CD1 1 
ATOM   5855  C CD2 . PHE H  2 87  ? 14.945  101.037 86.817  1.00 35.46  ? 400  PHE F CD2 1 
ATOM   5856  C CE1 . PHE H  2 87  ? 14.115  103.004 85.030  1.00 35.46  ? 400  PHE F CE1 1 
ATOM   5857  C CE2 . PHE H  2 87  ? 14.690  100.712 85.471  1.00 35.46  ? 400  PHE F CE2 1 
ATOM   5858  C CZ  . PHE H  2 87  ? 14.274  101.692 84.579  1.00 35.46  ? 400  PHE F CZ  1 
ATOM   5859  N N   . PRO H  2 88  ? 15.274  101.041 91.993  1.00 53.65  ? 401  PRO F N   1 
ATOM   5860  C CA  . PRO H  2 88  ? 15.819  101.374 93.320  1.00 53.65  ? 401  PRO F CA  1 
ATOM   5861  C C   . PRO H  2 88  ? 17.155  102.132 93.234  1.00 53.65  ? 401  PRO F C   1 
ATOM   5862  O O   . PRO H  2 88  ? 17.979  101.761 92.369  1.00 53.65  ? 401  PRO F O   1 
ATOM   5863  C CB  . PRO H  2 88  ? 15.959  100.012 94.008  1.00 53.65  ? 401  PRO F CB  1 
ATOM   5864  C CG  . PRO H  2 88  ? 15.005  99.107  93.279  1.00 53.65  ? 401  PRO F CG  1 
ATOM   5865  C CD  . PRO H  2 88  ? 14.980  99.602  91.855  1.00 53.65  ? 401  PRO F CD  1 
ATOM   5866  O OXT . PRO H  2 88  ? 17.359  103.092 94.017  1.00 53.65  ? 401  PRO F OXT 1 
HETATM 5867  C C1  . PHQ I  3 1   ? 13.256  125.843 69.364  1.00 81.86  ? 4300 PHQ V C1  1 
HETATM 5868  O O1  . PHQ I  3 1   ? 12.353  126.371 68.693  1.00 45.13  ? 4300 PHQ V O1  1 
HETATM 5869  O O2  . PHQ I  3 1   ? 13.409  126.166 70.719  0.00 45.13  ? 4300 PHQ V O2  1 
HETATM 5870  C C2  . PHQ I  3 1   ? 12.475  127.131 71.253  0.00 45.13  ? 4300 PHQ V C2  1 
HETATM 5871  C C3  . PHQ I  3 1   ? 12.710  127.369 72.727  0.00 45.13  ? 4300 PHQ V C3  1 
HETATM 5872  C C4  . PHQ I  3 1   ? 14.019  127.621 73.253  0.00 45.13  ? 4300 PHQ V C4  1 
HETATM 5873  C C5  . PHQ I  3 1   ? 14.203  127.843 74.657  0.00 45.13  ? 4300 PHQ V C5  1 
HETATM 5874  C C6  . PHQ I  3 1   ? 13.080  127.815 75.543  0.00 45.13  ? 4300 PHQ V C6  1 
HETATM 5875  C C7  . PHQ I  3 1   ? 11.770  127.564 75.027  0.00 45.13  ? 4300 PHQ V C7  1 
HETATM 5876  C C8  . PHQ I  3 1   ? 11.591  127.344 73.626  0.00 45.13  ? 4300 PHQ V C8  1 
ATOM   5877  N N   . GLU I  3 2   ? 14.160  124.936 68.987  1.00 77.94  ? 4301 GLU V N   1 
ATOM   5878  C CA  . GLU I  3 2   ? 14.214  124.378 67.615  1.00 55.34  ? 4301 GLU V CA  1 
ATOM   5879  C C   . GLU I  3 2   ? 13.576  122.960 67.666  1.00 61.75  ? 4301 GLU V C   1 
ATOM   5880  O O   . GLU I  3 2   ? 13.183  122.485 68.749  1.00 65.76  ? 4301 GLU V O   1 
ATOM   5881  C CB  . GLU I  3 2   ? 15.660  124.226 67.087  1.00 36.45  ? 4301 GLU V CB  1 
ATOM   5882  C CG  . GLU I  3 2   ? 16.491  125.515 66.945  1.00 53.19  ? 4301 GLU V CG  1 
ATOM   5883  C CD  . GLU I  3 2   ? 17.791  125.288 66.134  1.00 74.67  ? 4301 GLU V CD  1 
ATOM   5884  O OE1 . GLU I  3 2   ? 18.169  124.245 65.640  1.00 83.24  ? 4301 GLU V OE1 1 
ATOM   5885  O OE2 . GLU I  3 2   ? 18.477  126.427 66.042  1.00 90.78  ? 4301 GLU V OE2 1 
ATOM   5886  N N   . VAL I  3 3   ? 13.489  122.279 66.492  1.00 54.56  ? 4302 VAL V N   1 
ATOM   5887  C CA  . VAL I  3 3   ? 12.646  121.075 66.272  1.00 57.24  ? 4302 VAL V CA  1 
ATOM   5888  C C   . VAL I  3 3   ? 13.592  120.000 65.689  1.00 66.16  ? 4302 VAL V C   1 
ATOM   5889  O O   . VAL I  3 3   ? 14.614  120.330 65.048  1.00 74.47  ? 4302 VAL V O   1 
ATOM   5890  C CB  . VAL I  3 3   ? 11.427  121.357 65.317  1.00 52.06  ? 4302 VAL V CB  1 
ATOM   5891  C CG1 . VAL I  3 3   ? 10.468  122.393 65.919  1.00 60.34  ? 4302 VAL V CG1 1 
ATOM   5892  C CG2 . VAL I  3 3   ? 11.838  121.899 63.930  1.00 56.81  ? 4302 VAL V CG2 1 
ATOM   5893  N N   . ASP I  3 4   ? 13.237  118.709 65.923  1.00 56.52  ? 4303 ASP V N   1 
ATOM   5894  C CA  . ASP I  3 4   ? 13.989  117.526 65.472  1.00 53.28  ? 4303 ASP V CA  1 
ATOM   5895  C C   . ASP I  3 4   ? 13.215  116.733 64.353  1.00 61.66  ? 4303 ASP V C   1 
ATOM   5896  O O   . ASP I  3 4   ? 13.574  115.672 63.911  1.00 45.13  ? 4303 ASP V O   1 
ATOM   5897  C CB  . ASP I  3 4   ? 14.268  116.596 66.685  1.00 40.10  ? 4303 ASP V CB  1 
ATOM   5898  C CG  . ASP I  3 4   ? 15.366  117.083 67.674  1.00 65.79  ? 4303 ASP V CG  1 
ATOM   5899  O OD1 . ASP I  3 4   ? 16.381  117.649 67.383  1.00 66.78  ? 4303 ASP V OD1 1 
ATOM   5900  O OD2 . ASP I  3 4   ? 15.048  116.777 68.937  1.00 73.27  ? 4303 ASP V OD2 1 
HETATM 5901  C C1  . 0QE I  3 5   ? 12.112  117.377 63.941  1.00 42.55  ? 4304 0QE V C1  1 
ATOM   5902  N N   . LEU J  1 1   ? 1.041   112.059 96.073  1.00 87.14  ? 149  LEU G N   1 
ATOM   5903  C CA  . LEU J  1 1   ? 0.518   113.442 95.870  1.00 87.14  ? 149  LEU G CA  1 
ATOM   5904  C C   . LEU J  1 1   ? 0.764   113.950 94.451  1.00 87.14  ? 149  LEU G C   1 
ATOM   5905  O O   . LEU J  1 1   ? 0.937   115.153 94.223  1.00 87.14  ? 149  LEU G O   1 
ATOM   5906  C CB  . LEU J  1 1   ? 1.146   114.409 96.882  1.00 87.14  ? 149  LEU G CB  1 
ATOM   5907  C CG  . LEU J  1 1   ? 0.298   115.634 97.252  1.00 87.14  ? 149  LEU G CG  1 
ATOM   5908  C CD1 . LEU J  1 1   ? -1.143  115.202 97.534  1.00 87.14  ? 149  LEU G CD1 1 
ATOM   5909  C CD2 . LEU J  1 1   ? 0.901   116.333 98.471  1.00 87.14  ? 149  LEU G CD2 1 
ATOM   5910  N N   . ASP J  1 2   ? 0.797   113.025 93.497  1.00 85.77  ? 150  ASP G N   1 
ATOM   5911  C CA  . ASP J  1 2   ? 0.982   113.406 92.110  1.00 85.77  ? 150  ASP G CA  1 
ATOM   5912  C C   . ASP J  1 2   ? -0.388  113.891 91.674  1.00 85.77  ? 150  ASP G C   1 
ATOM   5913  O O   . ASP J  1 2   ? -1.409  113.497 92.248  1.00 85.77  ? 150  ASP G O   1 
ATOM   5914  C CB  . ASP J  1 2   ? 1.379   112.204 91.251  1.00 85.77  ? 150  ASP G CB  1 
ATOM   5915  C CG  . ASP J  1 2   ? 2.178   111.182 92.015  1.00 85.77  ? 150  ASP G CG  1 
ATOM   5916  O OD1 . ASP J  1 2   ? 3.263   111.545 92.506  1.00 85.77  ? 150  ASP G OD1 1 
ATOM   5917  O OD2 . ASP J  1 2   ? 1.729   110.020 92.122  1.00 85.77  ? 150  ASP G OD2 1 
ATOM   5918  N N   . LYS J  1 3   ? -0.414  114.751 90.668  1.00 56.09  ? 151  LYS G N   1 
ATOM   5919  C CA  . LYS J  1 3   ? -1.669  115.253 90.158  1.00 56.09  ? 151  LYS G CA  1 
ATOM   5920  C C   . LYS J  1 3   ? -2.592  114.070 89.816  1.00 56.09  ? 151  LYS G C   1 
ATOM   5921  O O   . LYS J  1 3   ? -2.127  112.999 89.427  1.00 56.09  ? 151  LYS G O   1 
ATOM   5922  C CB  . LYS J  1 3   ? -1.389  116.099 88.920  1.00 56.09  ? 151  LYS G CB  1 
ATOM   5923  C CG  . LYS J  1 3   ? -0.402  117.238 89.159  1.00 56.09  ? 151  LYS G CG  1 
ATOM   5924  C CD  . LYS J  1 3   ? -1.048  118.351 89.988  1.00 56.09  ? 151  LYS G CD  1 
ATOM   5925  C CE  . LYS J  1 3   ? -0.081  119.504 90.317  1.00 56.09  ? 151  LYS G CE  1 
ATOM   5926  N NZ  . LYS J  1 3   ? -0.668  120.467 91.330  1.00 56.09  ? 151  LYS G NZ  1 
ATOM   5927  N N   . VAL J  1 4   ? -3.900  114.256 89.978  1.00 59.03  ? 152  VAL G N   1 
ATOM   5928  C CA  . VAL J  1 4   ? -4.871  113.200 89.662  1.00 59.03  ? 152  VAL G CA  1 
ATOM   5929  C C   . VAL J  1 4   ? -6.052  113.745 88.861  1.00 59.03  ? 152  VAL G C   1 
ATOM   5930  O O   . VAL J  1 4   ? -6.478  114.884 89.057  1.00 59.03  ? 152  VAL G O   1 
ATOM   5931  C CB  . VAL J  1 4   ? -5.414  112.525 90.939  1.00 59.03  ? 152  VAL G CB  1 
ATOM   5932  C CG1 . VAL J  1 4   ? -6.437  111.475 90.577  1.00 59.03  ? 152  VAL G CG1 1 
ATOM   5933  C CG2 . VAL J  1 4   ? -4.269  111.892 91.711  1.00 59.03  ? 152  VAL G CG2 1 
ATOM   5934  N N   . TYR J  1 5   ? -6.567  112.930 87.944  1.00 48.13  ? 153  TYR G N   1 
ATOM   5935  C CA  . TYR J  1 5   ? -7.706  113.336 87.131  1.00 48.13  ? 153  TYR G CA  1 
ATOM   5936  C C   . TYR J  1 5   ? -8.929  113.346 88.022  1.00 48.13  ? 153  TYR G C   1 
ATOM   5937  O O   . TYR J  1 5   ? -9.211  112.357 88.711  1.00 48.13  ? 153  TYR G O   1 
ATOM   5938  C CB  . TYR J  1 5   ? -7.938  112.354 85.986  1.00 48.13  ? 153  TYR G CB  1 
ATOM   5939  C CG  . TYR J  1 5   ? -7.139  112.663 84.750  1.00 48.13  ? 153  TYR G CG  1 
ATOM   5940  C CD1 . TYR J  1 5   ? -6.415  111.665 84.098  1.00 48.13  ? 153  TYR G CD1 1 
ATOM   5941  C CD2 . TYR J  1 5   ? -7.088  113.955 84.242  1.00 48.13  ? 153  TYR G CD2 1 
ATOM   5942  C CE1 . TYR J  1 5   ? -5.660  111.950 82.975  1.00 48.13  ? 153  TYR G CE1 1 
ATOM   5943  C CE2 . TYR J  1 5   ? -6.333  114.249 83.116  1.00 48.13  ? 153  TYR G CE2 1 
ATOM   5944  C CZ  . TYR J  1 5   ? -5.626  113.244 82.493  1.00 48.13  ? 153  TYR G CZ  1 
ATOM   5945  O OH  . TYR J  1 5   ? -4.905  113.540 81.374  1.00 48.13  ? 153  TYR G OH  1 
ATOM   5946  N N   . GLN J  1 6   ? -9.654  114.458 87.987  1.00 56.52  ? 154  GLN G N   1 
ATOM   5947  C CA  . GLN J  1 6   ? -10.861 114.650 88.781  1.00 56.52  ? 154  GLN G CA  1 
ATOM   5948  C C   . GLN J  1 6   ? -12.002 113.735 88.352  1.00 56.52  ? 154  GLN G C   1 
ATOM   5949  O O   . GLN J  1 6   ? -12.323 113.631 87.162  1.00 56.52  ? 154  GLN G O   1 
ATOM   5950  C CB  . GLN J  1 6   ? -11.296 116.102 88.662  1.00 56.52  ? 154  GLN G CB  1 
ATOM   5951  C CG  . GLN J  1 6   ? -12.478 116.484 89.516  1.00 56.52  ? 154  GLN G CG  1 
ATOM   5952  C CD  . GLN J  1 6   ? -12.635 118.000 89.631  1.00 56.52  ? 154  GLN G CD  1 
ATOM   5953  O OE1 . GLN J  1 6   ? -12.961 118.679 88.656  1.00 56.52  ? 154  GLN G OE1 1 
ATOM   5954  N NE2 . GLN J  1 6   ? -12.399 118.536 90.826  1.00 56.52  ? 154  GLN G NE2 1 
ATOM   5955  N N   . MET J  1 7   ? -12.609 113.068 89.327  1.00 66.68  ? 155  MET G N   1 
ATOM   5956  C CA  . MET J  1 7   ? -13.722 112.161 89.057  1.00 66.68  ? 155  MET G CA  1 
ATOM   5957  C C   . MET J  1 7   ? -14.762 112.214 90.179  1.00 66.68  ? 155  MET G C   1 
ATOM   5958  O O   . MET J  1 7   ? -14.782 111.352 91.062  1.00 66.68  ? 155  MET G O   1 
ATOM   5959  C CB  . MET J  1 7   ? -13.217 110.725 88.920  1.00 66.68  ? 155  MET G CB  1 
ATOM   5960  C CG  . MET J  1 7   ? -12.259 110.518 87.782  1.00 66.68  ? 155  MET G CG  1 
ATOM   5961  S SD  . MET J  1 7   ? -13.096 110.278 86.216  1.00 66.68  ? 155  MET G SD  1 
ATOM   5962  C CE  . MET J  1 7   ? -14.003 108.804 86.554  1.00 66.68  ? 155  MET G CE  1 
ATOM   5963  N N   . LYS J  1 8   ? -15.634 113.216 90.149  1.00 59.30  ? 156  LYS G N   1 
ATOM   5964  C CA  . LYS J  1 8   ? -16.653 113.341 91.186  1.00 59.30  ? 156  LYS G CA  1 
ATOM   5965  C C   . LYS J  1 8   ? -18.061 113.448 90.597  1.00 59.30  ? 156  LYS G C   1 
ATOM   5966  O O   . LYS J  1 8   ? -19.029 112.958 91.192  1.00 59.30  ? 156  LYS G O   1 
ATOM   5967  C CB  . LYS J  1 8   ? -16.356 114.563 92.051  1.00 59.30  ? 156  LYS G CB  1 
ATOM   5968  C CG  . LYS J  1 8   ? -15.843 115.746 91.259  1.00 59.30  ? 156  LYS G CG  1 
ATOM   5969  C CD  . LYS J  1 8   ? -15.430 116.874 92.180  1.00 59.30  ? 156  LYS G CD  1 
ATOM   5970  C CE  . LYS J  1 8   ? -16.240 118.132 91.917  1.00 59.30  ? 156  LYS G CE  1 
ATOM   5971  N NZ  . LYS J  1 8   ? -15.535 119.348 92.421  1.00 59.30  ? 156  LYS G NZ  1 
ATOM   5972  N N   . SER J  1 9   ? -18.154 114.079 89.427  1.00 48.85  ? 157  SER G N   1 
ATOM   5973  C CA  . SER J  1 9   ? -19.413 114.277 88.724  1.00 48.85  ? 157  SER G CA  1 
ATOM   5974  C C   . SER J  1 9   ? -20.436 113.155 88.968  1.00 48.85  ? 157  SER G C   1 
ATOM   5975  O O   . SER J  1 9   ? -20.074 111.974 88.941  1.00 48.85  ? 157  SER G O   1 
ATOM   5976  C CB  . SER J  1 9   ? -19.138 114.400 87.227  1.00 48.85  ? 157  SER G CB  1 
ATOM   5977  O OG  . SER J  1 9   ? -19.384 113.162 86.583  1.00 48.85  ? 157  SER G OG  1 
ATOM   5978  N N   . LYS J  1 10  ? -21.703 113.539 89.201  1.00 96.55  ? 160  LYS G N   1 
ATOM   5979  C CA  . LYS J  1 10  ? -22.793 112.590 89.453  1.00 96.55  ? 160  LYS G CA  1 
ATOM   5980  C C   . LYS J  1 10  ? -22.590 111.416 88.501  1.00 96.55  ? 160  LYS G C   1 
ATOM   5981  O O   . LYS J  1 10  ? -22.157 110.346 88.934  1.00 96.55  ? 160  LYS G O   1 
ATOM   5982  C CB  . LYS J  1 10  ? -24.155 113.265 89.233  1.00 96.55  ? 160  LYS G CB  1 
ATOM   5983  C CG  . LYS J  1 10  ? -24.311 114.617 89.927  1.00 96.55  ? 160  LYS G CG  1 
ATOM   5984  C CD  . LYS J  1 10  ? -25.709 114.793 90.523  1.00 96.55  ? 160  LYS G CD  1 
ATOM   5985  C CE  . LYS J  1 10  ? -25.862 116.161 91.174  1.00 96.55  ? 160  LYS G CE  1 
ATOM   5986  N NZ  . LYS J  1 10  ? -27.197 116.767 90.913  1.00 96.55  ? 160  LYS G NZ  1 
ATOM   5987  N N   . PRO J  1 11  ? -22.932 111.570 87.204  1.00 69.88  ? 161  PRO G N   1 
ATOM   5988  C CA  . PRO J  1 11  ? -22.683 110.418 86.331  1.00 69.88  ? 161  PRO G CA  1 
ATOM   5989  C C   . PRO J  1 11  ? -21.331 110.761 85.691  1.00 69.88  ? 161  PRO G C   1 
ATOM   5990  O O   . PRO J  1 11  ? -21.292 111.520 84.725  1.00 69.88  ? 161  PRO G O   1 
ATOM   5991  C CB  . PRO J  1 11  ? -23.819 110.485 85.315  1.00 69.88  ? 161  PRO G CB  1 
ATOM   5992  C CG  . PRO J  1 11  ? -24.159 111.951 85.245  1.00 69.88  ? 161  PRO G CG  1 
ATOM   5993  C CD  . PRO J  1 11  ? -23.562 112.668 86.451  1.00 69.88  ? 161  PRO G CD  1 
ATOM   5994  N N   . ARG J  1 12  ? -20.231 110.243 86.248  1.00 63.99  ? 162  ARG G N   1 
ATOM   5995  C CA  . ARG J  1 12  ? -18.879 110.538 85.754  1.00 63.99  ? 162  ARG G CA  1 
ATOM   5996  C C   . ARG J  1 12  ? -18.825 110.975 84.302  1.00 63.99  ? 162  ARG G C   1 
ATOM   5997  O O   . ARG J  1 12  ? -18.287 112.032 83.989  1.00 63.99  ? 162  ARG G O   1 
ATOM   5998  C CB  . ARG J  1 12  ? -17.963 109.336 85.951  1.00 63.99  ? 162  ARG G CB  1 
ATOM   5999  C CG  . ARG J  1 12  ? -18.084 108.715 87.323  1.00 63.99  ? 162  ARG G CG  1 
ATOM   6000  C CD  . ARG J  1 12  ? -16.808 108.862 88.129  1.00 63.99  ? 162  ARG G CD  1 
ATOM   6001  N NE  . ARG J  1 12  ? -17.026 108.682 89.565  1.00 63.99  ? 162  ARG G NE  1 
ATOM   6002  C CZ  . ARG J  1 12  ? -17.731 109.519 90.320  1.00 63.99  ? 162  ARG G CZ  1 
ATOM   6003  N NH1 . ARG J  1 12  ? -18.288 110.593 89.775  1.00 63.99  ? 162  ARG G NH1 1 
ATOM   6004  N NH2 . ARG J  1 12  ? -17.870 109.294 91.619  1.00 63.99  ? 162  ARG G NH2 1 
ATOM   6005  N N   . GLY J  1 13  ? -19.385 110.161 83.418  1.00 35.43  ? 163  GLY G N   1 
ATOM   6006  C CA  . GLY J  1 13  ? -19.392 110.481 82.000  1.00 35.43  ? 163  GLY G CA  1 
ATOM   6007  C C   . GLY J  1 13  ? -20.027 109.331 81.247  1.00 35.43  ? 163  GLY G C   1 
ATOM   6008  O O   . GLY J  1 13  ? -20.406 108.321 81.848  1.00 35.43  ? 163  GLY G O   1 
ATOM   6009  N N   . TYR J  1 14  ? -20.157 109.462 79.935  1.00 52.11  ? 164  TYR G N   1 
ATOM   6010  C CA  . TYR J  1 14  ? -20.754 108.395 79.152  1.00 52.11  ? 164  TYR G CA  1 
ATOM   6011  C C   . TYR J  1 14  ? -19.773 107.273 78.891  1.00 52.11  ? 164  TYR G C   1 
ATOM   6012  O O   . TYR J  1 14  ? -18.571 107.494 78.792  1.00 52.11  ? 164  TYR G O   1 
ATOM   6013  C CB  . TYR J  1 14  ? -21.240 108.931 77.825  1.00 52.11  ? 164  TYR G CB  1 
ATOM   6014  C CG  . TYR J  1 14  ? -22.301 109.980 77.973  1.00 52.11  ? 164  TYR G CG  1 
ATOM   6015  C CD1 . TYR J  1 14  ? -22.060 111.293 77.577  1.00 52.11  ? 164  TYR G CD1 1 
ATOM   6016  C CD2 . TYR J  1 14  ? -23.549 109.669 78.519  1.00 52.11  ? 164  TYR G CD2 1 
ATOM   6017  C CE1 . TYR J  1 14  ? -23.037 112.280 77.724  1.00 52.11  ? 164  TYR G CE1 1 
ATOM   6018  C CE2 . TYR J  1 14  ? -24.534 110.650 78.670  1.00 52.11  ? 164  TYR G CE2 1 
ATOM   6019  C CZ  . TYR J  1 14  ? -24.268 111.951 78.271  1.00 52.11  ? 164  TYR G CZ  1 
ATOM   6020  O OH  . TYR J  1 14  ? -25.219 112.929 78.436  1.00 52.11  ? 164  TYR G OH  1 
ATOM   6021  N N   . CYS J  1 15  ? -20.300 106.062 78.778  1.00 45.87  ? 165  CYS G N   1 
ATOM   6022  C CA  . CYS J  1 15  ? -19.475 104.910 78.511  1.00 45.87  ? 165  CYS G CA  1 
ATOM   6023  C C   . CYS J  1 15  ? -19.982 104.190 77.280  1.00 45.87  ? 165  CYS G C   1 
ATOM   6024  O O   . CYS J  1 15  ? -20.641 103.167 77.389  1.00 45.87  ? 165  CYS G O   1 
ATOM   6025  C CB  . CYS J  1 15  ? -19.493 103.959 79.693  1.00 45.87  ? 165  CYS G CB  1 
ATOM   6026  S SG  . CYS J  1 15  ? -18.309 102.624 79.503  1.00 45.87  ? 165  CYS G SG  1 
ATOM   6027  N N   . LEU J  1 16  ? -19.683 104.728 76.106  1.00 36.67  ? 166  LEU G N   1 
ATOM   6028  C CA  . LEU J  1 16  ? -20.112 104.089 74.881  1.00 36.67  ? 166  LEU G CA  1 
ATOM   6029  C C   . LEU J  1 16  ? -19.599 102.668 74.826  1.00 36.67  ? 166  LEU G C   1 
ATOM   6030  O O   . LEU J  1 16  ? -18.460 102.387 75.209  1.00 36.67  ? 166  LEU G O   1 
ATOM   6031  C CB  . LEU J  1 16  ? -19.563 104.824 73.679  1.00 36.67  ? 166  LEU G CB  1 
ATOM   6032  C CG  . LEU J  1 16  ? -20.553 105.812 73.109  1.00 36.67  ? 166  LEU G CG  1 
ATOM   6033  C CD1 . LEU J  1 16  ? -20.509 107.035 73.989  1.00 36.67  ? 166  LEU G CD1 1 
ATOM   6034  C CD2 . LEU J  1 16  ? -20.219 106.137 71.658  1.00 36.67  ? 166  LEU G CD2 1 
ATOM   6035  N N   . ILE J  1 17  ? -20.443 101.771 74.339  1.00 22.65  ? 167  ILE G N   1 
ATOM   6036  C CA  . ILE J  1 17  ? -20.058 100.387 74.202  1.00 22.65  ? 167  ILE G CA  1 
ATOM   6037  C C   . ILE J  1 17  ? -20.517 99.891  72.861  1.00 22.65  ? 167  ILE G C   1 
ATOM   6038  O O   . ILE J  1 17  ? -21.567 99.287  72.773  1.00 22.65  ? 167  ILE G O   1 
ATOM   6039  C CB  . ILE J  1 17  ? -20.713 99.511  75.243  1.00 22.65  ? 167  ILE G CB  1 
ATOM   6040  C CG1 . ILE J  1 17  ? -20.237 99.919  76.631  1.00 22.65  ? 167  ILE G CG1 1 
ATOM   6041  C CG2 . ILE J  1 17  ? -20.389 98.048  74.957  1.00 22.65  ? 167  ILE G CG2 1 
ATOM   6042  C CD1 . ILE J  1 17  ? -20.517 98.855  77.703  1.00 22.65  ? 167  ILE G CD1 1 
ATOM   6043  N N   . ILE J  1 18  ? -19.757 100.159 71.809  1.00 41.24  ? 168  ILE G N   1 
ATOM   6044  C CA  . ILE J  1 18  ? -20.148 99.674  70.499  1.00 41.24  ? 168  ILE G CA  1 
ATOM   6045  C C   . ILE J  1 18  ? -19.817 98.197  70.477  1.00 41.24  ? 168  ILE G C   1 
ATOM   6046  O O   . ILE J  1 18  ? -18.653 97.821  70.537  1.00 41.24  ? 168  ILE G O   1 
ATOM   6047  C CB  . ILE J  1 18  ? -19.385 100.376 69.395  1.00 41.24  ? 168  ILE G CB  1 
ATOM   6048  C CG1 . ILE J  1 18  ? -19.859 101.828 69.317  1.00 41.24  ? 168  ILE G CG1 1 
ATOM   6049  C CG2 . ILE J  1 18  ? -19.570 99.619  68.080  1.00 41.24  ? 168  ILE G CG2 1 
ATOM   6050  C CD1 . ILE J  1 18  ? -19.485 102.548 68.035  1.00 41.24  ? 168  ILE G CD1 1 
ATOM   6051  N N   . ASN J  1 19  ? -20.843 97.363  70.396  1.00 38.89  ? 169  ASN G N   1 
ATOM   6052  C CA  . ASN J  1 19  ? -20.663 95.927  70.403  1.00 38.89  ? 169  ASN G CA  1 
ATOM   6053  C C   . ASN J  1 19  ? -21.213 95.277  69.127  1.00 38.89  ? 169  ASN G C   1 
ATOM   6054  O O   . ASN J  1 19  ? -22.415 95.279  68.891  1.00 38.89  ? 169  ASN G O   1 
ATOM   6055  C CB  . ASN J  1 19  ? -21.344 95.384  71.662  1.00 38.89  ? 169  ASN G CB  1 
ATOM   6056  C CG  . ASN J  1 19  ? -21.511 93.879  71.651  1.00 38.89  ? 169  ASN G CG  1 
ATOM   6057  O OD1 . ASN J  1 19  ? -21.919 93.295  70.650  1.00 38.89  ? 169  ASN G OD1 1 
ATOM   6058  N ND2 . ASN J  1 19  ? -21.202 93.238  72.779  1.00 38.89  ? 169  ASN G ND2 1 
ATOM   6059  N N   . ASN J  1 20  ? -20.321 94.731  68.305  1.00 38.86  ? 170  ASN G N   1 
ATOM   6060  C CA  . ASN J  1 20  ? -20.686 94.061  67.052  1.00 38.86  ? 170  ASN G CA  1 
ATOM   6061  C C   . ASN J  1 20  ? -20.622 92.532  67.181  1.00 38.86  ? 170  ASN G C   1 
ATOM   6062  O O   . ASN J  1 20  ? -19.609 91.974  67.615  1.00 38.86  ? 170  ASN G O   1 
ATOM   6063  C CB  . ASN J  1 20  ? -19.754 94.509  65.932  1.00 38.86  ? 170  ASN G CB  1 
ATOM   6064  C CG  . ASN J  1 20  ? -19.960 95.951  65.572  1.00 38.86  ? 170  ASN G CG  1 
ATOM   6065  O OD1 . ASN J  1 20  ? -20.846 96.602  66.121  1.00 38.86  ? 170  ASN G OD1 1 
ATOM   6066  N ND2 . ASN J  1 20  ? -19.148 96.470  64.648  1.00 38.86  ? 170  ASN G ND2 1 
ATOM   6067  N N   . HIS J  1 21  ? -21.697 91.848  66.798  1.00 70.18  ? 171  HIS G N   1 
ATOM   6068  C CA  . HIS J  1 21  ? -21.734 90.395  66.913  1.00 70.18  ? 171  HIS G CA  1 
ATOM   6069  C C   . HIS J  1 21  ? -22.098 89.735  65.607  1.00 70.18  ? 171  HIS G C   1 
ATOM   6070  O O   . HIS J  1 21  ? -21.403 88.850  65.115  1.00 70.18  ? 171  HIS G O   1 
ATOM   6071  C CB  . HIS J  1 21  ? -22.751 89.977  67.980  1.00 70.18  ? 171  HIS G CB  1 
ATOM   6072  C CG  . HIS J  1 21  ? -23.078 88.514  67.971  1.00 70.18  ? 171  HIS G CG  1 
ATOM   6073  N ND1 . HIS J  1 21  ? -22.994 87.726  69.102  1.00 70.18  ? 171  HIS G ND1 1 
ATOM   6074  C CD2 . HIS J  1 21  ? -23.481 87.696  66.969  1.00 70.18  ? 171  HIS G CD2 1 
ATOM   6075  C CE1 . HIS J  1 21  ? -23.331 86.486  68.794  1.00 70.18  ? 171  HIS G CE1 1 
ATOM   6076  N NE2 . HIS J  1 21  ? -23.629 86.442  67.506  1.00 70.18  ? 171  HIS G NE2 1 
ATOM   6077  N N   . ASN J  1 22  ? -23.233 90.146  65.077  1.00 63.46  ? 172  ASN G N   1 
ATOM   6078  C CA  . ASN J  1 22  ? -23.713 89.592  63.839  1.00 63.46  ? 172  ASN G CA  1 
ATOM   6079  C C   . ASN J  1 22  ? -22.934 90.196  62.673  1.00 63.46  ? 172  ASN G C   1 
ATOM   6080  O O   . ASN J  1 22  ? -23.020 91.400  62.410  1.00 63.46  ? 172  ASN G O   1 
ATOM   6081  C CB  . ASN J  1 22  ? -25.214 89.871  63.712  1.00 63.46  ? 172  ASN G CB  1 
ATOM   6082  C CG  . ASN J  1 22  ? -25.744 89.588  62.327  1.00 63.46  ? 172  ASN G CG  1 
ATOM   6083  O OD1 . ASN J  1 22  ? -25.133 88.844  61.557  1.00 63.46  ? 172  ASN G OD1 1 
ATOM   6084  N ND2 . ASN J  1 22  ? -26.886 90.183  61.997  1.00 63.46  ? 172  ASN G ND2 1 
ATOM   6085  N N   . PHE J  1 23  ? -22.165 89.359  61.983  1.00 51.82  ? 173  PHE G N   1 
ATOM   6086  C CA  . PHE J  1 23  ? -21.381 89.832  60.855  1.00 51.82  ? 173  PHE G CA  1 
ATOM   6087  C C   . PHE J  1 23  ? -21.926 89.307  59.531  1.00 51.82  ? 173  PHE G C   1 
ATOM   6088  O O   . PHE J  1 23  ? -21.192 89.184  58.551  1.00 51.82  ? 173  PHE G O   1 
ATOM   6089  C CB  . PHE J  1 23  ? -19.913 89.430  61.030  1.00 51.82  ? 173  PHE G CB  1 
ATOM   6090  C CG  . PHE J  1 23  ? -19.129 90.384  61.879  1.00 51.82  ? 173  PHE G CG  1 
ATOM   6091  C CD1 . PHE J  1 23  ? -19.016 90.179  63.255  1.00 51.82  ? 173  PHE G CD1 1 
ATOM   6092  C CD2 . PHE J  1 23  ? -18.539 91.512  61.315  1.00 51.82  ? 173  PHE G CD2 1 
ATOM   6093  C CE1 . PHE J  1 23  ? -18.330 91.090  64.056  1.00 51.82  ? 173  PHE G CE1 1 
ATOM   6094  C CE2 . PHE J  1 23  ? -17.850 92.431  62.104  1.00 51.82  ? 173  PHE G CE2 1 
ATOM   6095  C CZ  . PHE J  1 23  ? -17.746 92.221  63.477  1.00 51.82  ? 173  PHE G CZ  1 
ATOM   6096  N N   . ALA J  1 24  ? -23.220 89.009  59.495  1.00 61.57  ? 174  ALA G N   1 
ATOM   6097  C CA  . ALA J  1 24  ? -23.833 88.505  58.271  1.00 61.57  ? 174  ALA G CA  1 
ATOM   6098  C C   . ALA J  1 24  ? -23.633 89.511  57.150  1.00 61.57  ? 174  ALA G C   1 
ATOM   6099  O O   . ALA J  1 24  ? -23.313 89.157  56.012  1.00 61.57  ? 174  ALA G O   1 
ATOM   6100  C CB  . ALA J  1 24  ? -25.313 88.262  58.484  1.00 61.57  ? 174  ALA G CB  1 
ATOM   6101  N N   . LYS J  1 25  ? -23.822 90.777  57.483  1.00 68.95  ? 175  LYS G N   1 
ATOM   6102  C CA  . LYS J  1 25  ? -23.668 91.821  56.489  1.00 68.95  ? 175  LYS G CA  1 
ATOM   6103  C C   . LYS J  1 25  ? -22.302 91.732  55.822  1.00 68.95  ? 175  LYS G C   1 
ATOM   6104  O O   . LYS J  1 25  ? -22.204 91.615  54.608  1.00 68.95  ? 175  LYS G O   1 
ATOM   6105  C CB  . LYS J  1 25  ? -23.858 93.187  57.141  1.00 68.95  ? 175  LYS G CB  1 
ATOM   6106  C CG  . LYS J  1 25  ? -25.317 93.622  57.239  1.00 68.95  ? 175  LYS G CG  1 
ATOM   6107  C CD  . LYS J  1 25  ? -25.911 93.846  55.848  1.00 68.95  ? 175  LYS G CD  1 
ATOM   6108  C CE  . LYS J  1 25  ? -27.081 94.827  55.890  1.00 68.95  ? 175  LYS G CE  1 
ATOM   6109  N NZ  . LYS J  1 25  ? -28.307 94.228  56.496  1.00 68.95  ? 175  LYS G NZ  1 
ATOM   6110  N N   . ALA J  1 26  A -21.247 91.779  56.625  1.00 90.45  ? 175  ALA G N   1 
ATOM   6111  C CA  . ALA J  1 26  A -19.895 91.696  56.094  1.00 90.45  ? 175  ALA G CA  1 
ATOM   6112  C C   . ALA J  1 26  A -19.799 90.486  55.179  1.00 90.45  ? 175  ALA G C   1 
ATOM   6113  O O   . ALA J  1 26  A -19.537 90.611  53.984  1.00 90.45  ? 175  ALA G O   1 
ATOM   6114  C CB  . ALA J  1 26  A -18.888 91.565  57.234  1.00 90.45  ? 175  ALA G CB  1 
ATOM   6115  N N   . ARG J  1 27  B -20.028 89.315  55.760  1.00 49.61  ? 175  ARG G N   1 
ATOM   6116  C CA  . ARG J  1 27  B -19.970 88.052  55.040  1.00 49.61  ? 175  ARG G CA  1 
ATOM   6117  C C   . ARG J  1 27  B -20.693 88.097  53.704  1.00 49.61  ? 175  ARG G C   1 
ATOM   6118  O O   . ARG J  1 27  B -20.225 87.530  52.717  1.00 49.61  ? 175  ARG G O   1 
ATOM   6119  C CB  . ARG J  1 27  B -20.570 86.941  55.899  1.00 49.61  ? 175  ARG G CB  1 
ATOM   6120  C CG  . ARG J  1 27  B -19.552 85.934  56.352  1.00 49.61  ? 175  ARG G CG  1 
ATOM   6121  C CD  . ARG J  1 27  B -20.187 84.854  57.177  1.00 49.61  ? 175  ARG G CD  1 
ATOM   6122  N NE  . ARG J  1 27  B -20.527 85.347  58.500  1.00 49.61  ? 175  ARG G NE  1 
ATOM   6123  C CZ  . ARG J  1 27  B -21.762 85.637  58.874  1.00 49.61  ? 175  ARG G CZ  1 
ATOM   6124  N NH1 . ARG J  1 27  B -22.761 85.482  58.012  1.00 49.61  ? 175  ARG G NH1 1 
ATOM   6125  N NH2 . ARG J  1 27  B -21.994 86.083  60.100  1.00 49.61  ? 175  ARG G NH2 1 
ATOM   6126  N N   . GLU J  1 28  C -21.834 88.776  53.671  1.00 78.32  ? 175  GLU G N   1 
ATOM   6127  C CA  . GLU J  1 28  C -22.613 88.869  52.445  1.00 78.32  ? 175  GLU G CA  1 
ATOM   6128  C C   . GLU J  1 28  C -22.050 89.850  51.415  1.00 78.32  ? 175  GLU G C   1 
ATOM   6129  O O   . GLU J  1 28  C -22.154 89.613  50.215  1.00 78.32  ? 175  GLU G O   1 
ATOM   6130  C CB  . GLU J  1 28  C -24.054 89.247  52.775  1.00 78.32  ? 175  GLU G CB  1 
ATOM   6131  C CG  . GLU J  1 28  C -24.839 89.757  51.581  1.00 78.32  ? 175  GLU G CG  1 
ATOM   6132  C CD  . GLU J  1 28  C -26.006 90.631  51.990  1.00 78.32  ? 175  GLU G CD  1 
ATOM   6133  O OE1 . GLU J  1 28  C -26.313 91.579  51.229  1.00 78.32  ? 175  GLU G OE1 1 
ATOM   6134  O OE2 . GLU J  1 28  C -26.607 90.366  53.068  1.00 78.32  ? 175  GLU G OE2 1 
ATOM   6135  N N   . LYS J  1 29  D -21.454 90.944  51.875  1.00 71.83  ? 175  LYS G N   1 
ATOM   6136  C CA  . LYS J  1 29  D -20.920 91.928  50.949  1.00 71.83  ? 175  LYS G CA  1 
ATOM   6137  C C   . LYS J  1 29  D -19.459 91.708  50.575  1.00 71.83  ? 175  LYS G C   1 
ATOM   6138  O O   . LYS J  1 29  D -19.168 91.168  49.506  1.00 71.83  ? 175  LYS G O   1 
ATOM   6139  C CB  . LYS J  1 29  D -21.110 93.349  51.504  1.00 71.83  ? 175  LYS G CB  1 
ATOM   6140  C CG  . LYS J  1 29  D -22.557 93.704  51.833  1.00 71.83  ? 175  LYS G CG  1 
ATOM   6141  C CD  . LYS J  1 29  D -23.206 94.597  50.773  1.00 71.83  ? 175  LYS G CD  1 
ATOM   6142  C CE  . LYS J  1 29  D -24.695 94.849  51.074  1.00 71.83  ? 175  LYS G CE  1 
ATOM   6143  N NZ  . LYS J  1 29  D -25.623 94.085  50.182  1.00 71.83  ? 175  LYS G NZ  1 
ATOM   6144  N N   . VAL J  1 30  E -18.544 92.117  51.451  1.00 89.19  ? 175  VAL G N   1 
ATOM   6145  C CA  . VAL J  1 30  E -17.107 91.999  51.194  1.00 89.19  ? 175  VAL G CA  1 
ATOM   6146  C C   . VAL J  1 30  E -16.564 90.575  50.959  1.00 89.19  ? 175  VAL G C   1 
ATOM   6147  O O   . VAL J  1 30  E -16.573 89.727  51.859  1.00 89.19  ? 175  VAL G O   1 
ATOM   6148  C CB  . VAL J  1 30  E -16.308 92.670  52.329  1.00 89.19  ? 175  VAL G CB  1 
ATOM   6149  C CG1 . VAL J  1 30  E -16.885 92.269  53.669  1.00 89.19  ? 175  VAL G CG1 1 
ATOM   6150  C CG2 . VAL J  1 30  E -14.838 92.300  52.231  1.00 89.19  ? 175  VAL G CG2 1 
ATOM   6151  N N   . PRO J  1 31  F -16.069 90.308  49.733  1.00 83.52  ? 175  PRO G N   1 
ATOM   6152  C CA  . PRO J  1 31  F -15.522 88.999  49.377  1.00 83.52  ? 175  PRO G CA  1 
ATOM   6153  C C   . PRO J  1 31  F -14.582 88.415  50.423  1.00 83.52  ? 175  PRO G C   1 
ATOM   6154  O O   . PRO J  1 31  F -14.968 87.524  51.173  1.00 83.52  ? 175  PRO G O   1 
ATOM   6155  C CB  . PRO J  1 31  F -14.814 89.260  48.049  1.00 83.52  ? 175  PRO G CB  1 
ATOM   6156  C CG  . PRO J  1 31  F -15.581 90.371  47.439  1.00 83.52  ? 175  PRO G CG  1 
ATOM   6157  C CD  . PRO J  1 31  F -16.005 91.245  48.593  1.00 83.52  ? 175  PRO G CD  1 
ATOM   6158  N N   . LYS J  1 32  G -13.356 88.931  50.475  1.00 68.71  ? 175  LYS G N   1 
ATOM   6159  C CA  . LYS J  1 32  G -12.330 88.442  51.400  1.00 68.71  ? 175  LYS G CA  1 
ATOM   6160  C C   . LYS J  1 32  G -12.741 88.248  52.861  1.00 68.71  ? 175  LYS G C   1 
ATOM   6161  O O   . LYS J  1 32  G -11.918 87.862  53.693  1.00 68.71  ? 175  LYS G O   1 
ATOM   6162  C CB  . LYS J  1 32  G -11.100 89.354  51.341  1.00 68.71  ? 175  LYS G CB  1 
ATOM   6163  C CG  . LYS J  1 32  G -11.362 90.789  51.730  1.00 68.71  ? 175  LYS G CG  1 
ATOM   6164  C CD  . LYS J  1 32  G -10.529 91.169  52.928  1.00 68.71  ? 175  LYS G CD  1 
ATOM   6165  C CE  . LYS J  1 32  G -10.618 92.662  53.187  1.00 68.71  ? 175  LYS G CE  1 
ATOM   6166  N NZ  . LYS J  1 32  G -9.350  93.217  53.741  1.00 68.71  ? 175  LYS G NZ  1 
ATOM   6167  N N   . LEU J  1 33  H -14.005 88.513  53.175  1.00 87.17  ? 175  LEU G N   1 
ATOM   6168  C CA  . LEU J  1 33  H -14.498 88.357  54.540  1.00 87.17  ? 175  LEU G CA  1 
ATOM   6169  C C   . LEU J  1 33  H -15.528 87.258  54.612  1.00 87.17  ? 175  LEU G C   1 
ATOM   6170  O O   . LEU J  1 33  H -16.101 86.995  55.665  1.00 87.17  ? 175  LEU G O   1 
ATOM   6171  C CB  . LEU J  1 33  H -15.121 89.658  55.032  1.00 87.17  ? 175  LEU G CB  1 
ATOM   6172  C CG  . LEU J  1 33  H -14.184 90.869  55.003  1.00 87.17  ? 175  LEU G CG  1 
ATOM   6173  C CD1 . LEU J  1 33  H -14.630 91.869  56.055  1.00 87.17  ? 175  LEU G CD1 1 
ATOM   6174  C CD2 . LEU J  1 33  H -12.734 90.431  55.242  1.00 87.17  ? 175  LEU G CD2 1 
ATOM   6175  N N   . HIS J  1 34  I -15.751 86.624  53.472  1.00 100.00 ? 175  HIS G N   1 
ATOM   6176  C CA  . HIS J  1 34  I -16.707 85.539  53.339  1.00 100.00 ? 175  HIS G CA  1 
ATOM   6177  C C   . HIS J  1 34  I -16.889 84.656  54.579  1.00 100.00 ? 175  HIS G C   1 
ATOM   6178  O O   . HIS J  1 34  I -17.999 84.201  54.855  1.00 100.00 ? 175  HIS G O   1 
ATOM   6179  C CB  . HIS J  1 34  I -16.311 84.657  52.148  1.00 100.00 ? 175  HIS G CB  1 
ATOM   6180  C CG  . HIS J  1 34  I -15.127 83.776  52.416  1.00 100.00 ? 175  HIS G CG  1 
ATOM   6181  N ND1 . HIS J  1 34  I -13.829 84.239  52.350  1.00 100.00 ? 175  HIS G ND1 1 
ATOM   6182  C CD2 . HIS J  1 34  I -15.044 82.474  52.779  1.00 100.00 ? 175  HIS G CD2 1 
ATOM   6183  C CE1 . HIS J  1 34  I -12.998 83.256  52.662  1.00 100.00 ? 175  HIS G CE1 1 
ATOM   6184  N NE2 . HIS J  1 34  I -13.711 82.176  52.926  1.00 100.00 ? 175  HIS G NE2 1 
ATOM   6185  N N   . SER J  1 35  J -15.818 84.418  55.334  1.00 88.93  ? 175  SER G N   1 
ATOM   6186  C CA  . SER J  1 35  J -15.924 83.538  56.496  1.00 88.93  ? 175  SER G CA  1 
ATOM   6187  C C   . SER J  1 35  J -15.786 84.119  57.910  1.00 88.93  ? 175  SER G C   1 
ATOM   6188  O O   . SER J  1 35  J -15.642 83.349  58.870  1.00 88.93  ? 175  SER G O   1 
ATOM   6189  C CB  . SER J  1 35  J -14.951 82.359  56.334  1.00 88.93  ? 175  SER G CB  1 
ATOM   6190  O OG  . SER J  1 35  J -13.603 82.791  56.315  1.00 88.93  ? 175  SER G OG  1 
ATOM   6191  N N   . ILE J  1 36  ? -15.832 85.445  58.068  1.00 75.59  ? 176  ILE G N   1 
ATOM   6192  C CA  . ILE J  1 36  ? -15.723 85.999  59.423  1.00 75.59  ? 176  ILE G CA  1 
ATOM   6193  C C   . ILE J  1 36  ? -16.928 85.491  60.206  1.00 75.59  ? 176  ILE G C   1 
ATOM   6194  O O   . ILE J  1 36  ? -18.075 85.742  59.839  1.00 75.59  ? 176  ILE G O   1 
ATOM   6195  C CB  . ILE J  1 36  ? -15.752 87.559  59.473  1.00 75.59  ? 176  ILE G CB  1 
ATOM   6196  C CG1 . ILE J  1 36  ? -16.486 88.102  58.259  1.00 75.59  ? 176  ILE G CG1 1 
ATOM   6197  C CG2 . ILE J  1 36  ? -14.341 88.123  59.596  1.00 75.59  ? 176  ILE G CG2 1 
ATOM   6198  C CD1 . ILE J  1 36  ? -17.985 88.083  58.424  1.00 75.59  ? 176  ILE G CD1 1 
ATOM   6199  N N   . ARG J  1 37  ? -16.675 84.754  61.273  1.00 78.92  ? 177  ARG G N   1 
ATOM   6200  C CA  . ARG J  1 37  ? -17.775 84.253  62.054  1.00 78.92  ? 177  ARG G CA  1 
ATOM   6201  C C   . ARG J  1 37  ? -18.271 85.381  62.908  1.00 78.92  ? 177  ARG G C   1 
ATOM   6202  O O   . ARG J  1 37  ? -17.563 86.353  63.148  1.00 78.92  ? 177  ARG G O   1 
ATOM   6203  C CB  . ARG J  1 37  ? -17.324 83.109  62.944  1.00 78.92  ? 177  ARG G CB  1 
ATOM   6204  C CG  . ARG J  1 37  ? -16.488 82.091  62.221  1.00 78.92  ? 177  ARG G CG  1 
ATOM   6205  C CD  . ARG J  1 37  ? -16.374 80.822  63.036  1.00 78.92  ? 177  ARG G CD  1 
ATOM   6206  N NE  . ARG J  1 37  ? -15.893 79.700  62.228  1.00 78.92  ? 177  ARG G NE  1 
ATOM   6207  C CZ  . ARG J  1 37  ? -15.774 78.451  62.674  1.00 78.92  ? 177  ARG G CZ  1 
ATOM   6208  N NH1 . ARG J  1 37  ? -16.102 78.153  63.933  1.00 78.92  ? 177  ARG G NH1 1 
ATOM   6209  N NH2 . ARG J  1 37  ? -15.335 77.494  61.858  1.00 78.92  ? 177  ARG G NH2 1 
ATOM   6210  N N   . ASP J  1 38  ? -19.508 85.265  63.351  1.00 55.36  ? 178  ASP G N   1 
ATOM   6211  C CA  . ASP J  1 38  ? -20.063 86.277  64.223  1.00 55.36  ? 178  ASP G CA  1 
ATOM   6212  C C   . ASP J  1 38  ? -19.276 86.117  65.519  1.00 55.36  ? 178  ASP G C   1 
ATOM   6213  O O   . ASP J  1 38  ? -18.684 85.066  65.769  1.00 55.36  ? 178  ASP G O   1 
ATOM   6214  C CB  . ASP J  1 38  ? -21.566 86.037  64.413  1.00 55.36  ? 178  ASP G CB  1 
ATOM   6215  C CG  . ASP J  1 38  ? -22.337 86.122  63.086  1.00 55.36  ? 178  ASP G CG  1 
ATOM   6216  O OD1 . ASP J  1 38  ? -21.936 86.933  62.213  1.00 55.36  ? 178  ASP G OD1 1 
ATOM   6217  O OD2 . ASP J  1 38  ? -23.332 85.380  62.916  1.00 55.36  ? 178  ASP G OD2 1 
ATOM   6218  N N   . ARG J  1 39  ? -19.237 87.161  66.326  1.00 44.47  ? 179  ARG G N   1 
ATOM   6219  C CA  . ARG J  1 39  ? -18.474 87.109  67.562  1.00 44.47  ? 179  ARG G CA  1 
ATOM   6220  C C   . ARG J  1 39  ? -19.261 86.550  68.745  1.00 44.47  ? 179  ARG G C   1 
ATOM   6221  O O   . ARG J  1 39  ? -19.632 87.275  69.664  1.00 44.47  ? 179  ARG G O   1 
ATOM   6222  C CB  . ARG J  1 39  ? -17.928 88.508  67.876  1.00 44.47  ? 179  ARG G CB  1 
ATOM   6223  C CG  . ARG J  1 39  ? -17.618 89.325  66.622  1.00 44.47  ? 179  ARG G CG  1 
ATOM   6224  C CD  . ARG J  1 39  ? -16.270 89.993  66.703  1.00 44.47  ? 179  ARG G CD  1 
ATOM   6225  N NE  . ARG J  1 39  ? -15.765 90.011  68.069  1.00 44.47  ? 179  ARG G NE  1 
ATOM   6226  C CZ  . ARG J  1 39  ? -16.200 90.834  69.014  1.00 44.47  ? 179  ARG G CZ  1 
ATOM   6227  N NH1 . ARG J  1 39  ? -17.148 91.702  68.734  1.00 44.47  ? 179  ARG G NH1 1 
ATOM   6228  N NH2 . ARG J  1 39  ? -15.683 90.801  70.229  1.00 44.47  ? 179  ARG G NH2 1 
ATOM   6229  N N   . ASN J  1 40  ? -19.503 85.248  68.731  1.00 71.33  ? 180  ASN G N   1 
ATOM   6230  C CA  . ASN J  1 40  ? -20.245 84.628  69.820  1.00 71.33  ? 180  ASN G CA  1 
ATOM   6231  C C   . ASN J  1 40  ? -19.508 84.764  71.147  1.00 71.33  ? 180  ASN G C   1 
ATOM   6232  O O   . ASN J  1 40  ? -18.417 84.224  71.333  1.00 71.33  ? 180  ASN G O   1 
ATOM   6233  C CB  . ASN J  1 40  ? -20.500 83.151  69.521  1.00 71.33  ? 180  ASN G CB  1 
ATOM   6234  C CG  . ASN J  1 40  ? -21.338 82.952  68.280  1.00 71.33  ? 180  ASN G CG  1 
ATOM   6235  O OD1 . ASN J  1 40  ? -22.294 83.687  68.045  1.00 71.33  ? 180  ASN G OD1 1 
ATOM   6236  N ND2 . ASN J  1 40  ? -20.985 81.956  67.473  1.00 71.33  ? 180  ASN G ND2 1 
ATOM   6237  N N   . GLY J  1 41  ? -20.108 85.497  72.074  1.00 44.79  ? 181  GLY G N   1 
ATOM   6238  C CA  . GLY J  1 41  ? -19.480 85.674  73.364  1.00 44.79  ? 181  GLY G CA  1 
ATOM   6239  C C   . GLY J  1 41  ? -19.327 87.136  73.724  1.00 44.79  ? 181  GLY G C   1 
ATOM   6240  O O   . GLY J  1 41  ? -19.068 87.447  74.890  1.00 44.79  ? 181  GLY G O   1 
ATOM   6241  N N   . THR J  1 42  ? -19.488 88.027  72.735  1.00 58.29  ? 182  THR G N   1 
ATOM   6242  C CA  . THR J  1 42  ? -19.371 89.476  72.959  1.00 58.29  ? 182  THR G CA  1 
ATOM   6243  C C   . THR J  1 42  ? -20.329 89.908  74.045  1.00 58.29  ? 182  THR G C   1 
ATOM   6244  O O   . THR J  1 42  ? -19.962 90.660  74.944  1.00 58.29  ? 182  THR G O   1 
ATOM   6245  C CB  . THR J  1 42  ? -19.750 90.327  71.717  1.00 58.29  ? 182  THR G CB  1 
ATOM   6246  O OG1 . THR J  1 42  ? -20.064 89.473  70.615  1.00 58.29  ? 182  THR G OG1 1 
ATOM   6247  C CG2 . THR J  1 42  ? -18.620 91.273  71.346  1.00 58.29  ? 182  THR G CG2 1 
ATOM   6248  N N   . HIS J  1 43  ? -21.567 89.439  73.934  1.00 100.00 ? 183  HIS G N   1 
ATOM   6249  C CA  . HIS J  1 43  ? -22.607 89.773  74.891  1.00 100.00 ? 183  HIS G CA  1 
ATOM   6250  C C   . HIS J  1 43  ? -22.086 89.758  76.326  1.00 100.00 ? 183  HIS G C   1 
ATOM   6251  O O   . HIS J  1 43  ? -22.334 90.693  77.088  1.00 100.00 ? 183  HIS G O   1 
ATOM   6252  C CB  . HIS J  1 43  ? -23.775 88.804  74.709  1.00 100.00 ? 183  HIS G CB  1 
ATOM   6253  C CG  . HIS J  1 43  ? -24.300 88.772  73.306  1.00 100.00 ? 183  HIS G CG  1 
ATOM   6254  N ND1 . HIS J  1 43  ? -25.093 89.776  72.784  1.00 100.00 ? 183  HIS G ND1 1 
ATOM   6255  C CD2 . HIS J  1 43  ? -24.112 87.881  72.302  1.00 100.00 ? 183  HIS G CD2 1 
ATOM   6256  C CE1 . HIS J  1 43  ? -25.370 89.503  71.520  1.00 100.00 ? 183  HIS G CE1 1 
ATOM   6257  N NE2 . HIS J  1 43  ? -24.787 88.359  71.203  1.00 100.00 ? 183  HIS G NE2 1 
ATOM   6258  N N   . LEU J  1 44  ? -21.340 88.713  76.681  1.00 61.50  ? 184  LEU G N   1 
ATOM   6259  C CA  . LEU J  1 44  ? -20.776 88.583  78.026  1.00 61.50  ? 184  LEU G CA  1 
ATOM   6260  C C   . LEU J  1 44  ? -19.789 89.700  78.308  1.00 61.50  ? 184  LEU G C   1 
ATOM   6261  O O   . LEU J  1 44  ? -19.736 90.223  79.424  1.00 61.50  ? 184  LEU G O   1 
ATOM   6262  C CB  . LEU J  1 44  ? -20.085 87.235  78.179  1.00 61.50  ? 184  LEU G CB  1 
ATOM   6263  C CG  . LEU J  1 44  ? -21.038 86.040  78.156  1.00 61.50  ? 184  LEU G CG  1 
ATOM   6264  C CD1 . LEU J  1 44  ? -21.559 85.812  76.729  1.00 61.50  ? 184  LEU G CD1 1 
ATOM   6265  C CD2 . LEU J  1 44  ? -20.325 84.808  78.672  1.00 61.50  ? 184  LEU G CD2 1 
ATOM   6266  N N   . ASP J  1 45  ? -18.996 90.053  77.297  1.00 76.99  ? 185  ASP G N   1 
ATOM   6267  C CA  . ASP J  1 45  ? -18.027 91.143  77.420  1.00 76.99  ? 185  ASP G CA  1 
ATOM   6268  C C   . ASP J  1 45  ? -18.861 92.379  77.746  1.00 76.99  ? 185  ASP G C   1 
ATOM   6269  O O   . ASP J  1 45  ? -18.709 93.010  78.799  1.00 76.99  ? 185  ASP G O   1 
ATOM   6270  C CB  . ASP J  1 45  ? -17.301 91.381  76.090  1.00 76.99  ? 185  ASP G CB  1 
ATOM   6271  C CG  . ASP J  1 45  ? -16.102 90.483  75.907  1.00 76.99  ? 185  ASP G CG  1 
ATOM   6272  O OD1 . ASP J  1 45  ? -15.739 89.759  76.855  1.00 76.99  ? 185  ASP G OD1 1 
ATOM   6273  O OD2 . ASP J  1 45  ? -15.517 90.503  74.810  1.00 76.99  ? 185  ASP G OD2 1 
ATOM   6274  N N   . ALA J  1 46  ? -19.757 92.699  76.817  1.00 40.34  ? 186  ALA G N   1 
ATOM   6275  C CA  . ALA J  1 46  ? -20.650 93.835  76.943  1.00 40.34  ? 186  ALA G CA  1 
ATOM   6276  C C   . ALA J  1 46  ? -21.240 93.902  78.350  1.00 40.34  ? 186  ALA G C   1 
ATOM   6277  O O   . ALA J  1 46  ? -21.169 94.944  79.016  1.00 40.34  ? 186  ALA G O   1 
ATOM   6278  C CB  . ALA J  1 46  ? -21.759 93.722  75.896  1.00 40.34  ? 186  ALA G CB  1 
ATOM   6279  N N   . GLY J  1 47  ? -21.805 92.779  78.799  1.00 40.19  ? 187  GLY G N   1 
ATOM   6280  C CA  . GLY J  1 47  ? -22.421 92.720  80.112  1.00 40.19  ? 187  GLY G CA  1 
ATOM   6281  C C   . GLY J  1 47  ? -21.448 93.139  81.185  1.00 40.19  ? 187  GLY G C   1 
ATOM   6282  O O   . GLY J  1 47  ? -21.731 94.029  81.994  1.00 40.19  ? 187  GLY G O   1 
ATOM   6283  N N   . ALA J  1 48  ? -20.286 92.501  81.177  1.00 51.07  ? 188  ALA G N   1 
ATOM   6284  C CA  . ALA J  1 48  ? -19.249 92.796  82.154  1.00 51.07  ? 188  ALA G CA  1 
ATOM   6285  C C   . ALA J  1 48  ? -18.912 94.286  82.182  1.00 51.07  ? 188  ALA G C   1 
ATOM   6286  O O   . ALA J  1 48  ? -18.859 94.907  83.252  1.00 51.07  ? 188  ALA G O   1 
ATOM   6287  C CB  . ALA J  1 48  ? -18.007 91.986  81.837  1.00 51.07  ? 188  ALA G CB  1 
ATOM   6288  N N   . LEU J  1 49  ? -18.683 94.857  81.000  1.00 65.34  ? 189  LEU G N   1 
ATOM   6289  C CA  . LEU J  1 49  ? -18.343 96.275  80.894  1.00 65.34  ? 189  LEU G CA  1 
ATOM   6290  C C   . LEU J  1 49  ? -19.476 97.118  81.449  1.00 65.34  ? 189  LEU G C   1 
ATOM   6291  O O   . LEU J  1 49  ? -19.253 98.070  82.195  1.00 65.34  ? 189  LEU G O   1 
ATOM   6292  C CB  . LEU J  1 49  ? -18.084 96.656  79.439  1.00 65.34  ? 189  LEU G CB  1 
ATOM   6293  C CG  . LEU J  1 49  ? -16.716 96.263  78.882  1.00 65.34  ? 189  LEU G CG  1 
ATOM   6294  C CD1 . LEU J  1 49  ? -16.901 95.773  77.463  1.00 65.34  ? 189  LEU G CD1 1 
ATOM   6295  C CD2 . LEU J  1 49  ? -15.762 97.450  78.920  1.00 65.34  ? 189  LEU G CD2 1 
ATOM   6296  N N   . THR J  1 50  ? -20.696 96.751  81.080  1.00 47.78  ? 190  THR G N   1 
ATOM   6297  C CA  . THR J  1 50  ? -21.878 97.451  81.541  1.00 47.78  ? 190  THR G CA  1 
ATOM   6298  C C   . THR J  1 50  ? -21.916 97.490  83.056  1.00 47.78  ? 190  THR G C   1 
ATOM   6299  O O   . THR J  1 50  ? -21.973 98.559  83.655  1.00 47.78  ? 190  THR G O   1 
ATOM   6300  C CB  . THR J  1 50  ? -23.144 96.759  81.049  1.00 47.78  ? 190  THR G CB  1 
ATOM   6301  O OG1 . THR J  1 50  ? -23.405 97.164  79.701  1.00 47.78  ? 190  THR G OG1 1 
ATOM   6302  C CG2 . THR J  1 50  ? -24.332 97.120  81.937  1.00 47.78  ? 190  THR G CG2 1 
ATOM   6303  N N   . THR J  1 51  ? -21.895 96.318  83.671  1.00 26.85  ? 191  THR G N   1 
ATOM   6304  C CA  . THR J  1 51  ? -21.929 96.235  85.116  1.00 26.85  ? 191  THR G CA  1 
ATOM   6305  C C   . THR J  1 51  ? -20.810 97.032  85.777  1.00 26.85  ? 191  THR G C   1 
ATOM   6306  O O   . THR J  1 51  ? -21.052 98.062  86.418  1.00 26.85  ? 191  THR G O   1 
ATOM   6307  C CB  . THR J  1 51  ? -21.786 94.805  85.577  1.00 26.85  ? 191  THR G CB  1 
ATOM   6308  O OG1 . THR J  1 51  ? -22.845 94.020  85.018  1.00 26.85  ? 191  THR G OG1 1 
ATOM   6309  C CG2 . THR J  1 51  ? -21.808 94.747  87.106  1.00 26.85  ? 191  THR G CG2 1 
ATOM   6310  N N   . THR J  1 52  ? -19.577 96.560  85.611  1.00 56.97  ? 192  THR G N   1 
ATOM   6311  C CA  . THR J  1 52  ? -18.435 97.215  86.233  1.00 56.97  ? 192  THR G CA  1 
ATOM   6312  C C   . THR J  1 52  ? -18.373 98.720  86.013  1.00 56.97  ? 192  THR G C   1 
ATOM   6313  O O   . THR J  1 52  ? -18.061 99.457  86.946  1.00 56.97  ? 192  THR G O   1 
ATOM   6314  C CB  . THR J  1 52  ? -17.084 96.569  85.797  1.00 56.97  ? 192  THR G CB  1 
ATOM   6315  O OG1 . THR J  1 52  ? -16.647 97.132  84.558  1.00 56.97  ? 192  THR G OG1 1 
ATOM   6316  C CG2 . THR J  1 52  ? -17.235 95.068  85.631  1.00 56.97  ? 192  THR G CG2 1 
ATOM   6317  N N   . PHE J  1 53  ? -18.673 99.198  84.811  1.00 65.13  ? 193  PHE G N   1 
ATOM   6318  C CA  . PHE J  1 53  ? -18.605 100.637 84.605  1.00 65.13  ? 193  PHE G CA  1 
ATOM   6319  C C   . PHE J  1 53  ? -19.796 101.380 85.206  1.00 65.13  ? 193  PHE G C   1 
ATOM   6320  O O   . PHE J  1 53  ? -19.674 102.539 85.629  1.00 65.13  ? 193  PHE G O   1 
ATOM   6321  C CB  . PHE J  1 53  ? -18.422 100.956 83.126  1.00 65.13  ? 193  PHE G CB  1 
ATOM   6322  C CG  . PHE J  1 53  ? -16.984 100.966 82.713  1.00 65.13  ? 193  PHE G CG  1 
ATOM   6323  C CD1 . PHE J  1 53  ? -16.465 99.953  81.918  1.00 65.13  ? 193  PHE G CD1 1 
ATOM   6324  C CD2 . PHE J  1 53  ? -16.122 101.940 83.191  1.00 65.13  ? 193  PHE G CD2 1 
ATOM   6325  C CE1 . PHE J  1 53  ? -15.107 99.908  81.612  1.00 65.13  ? 193  PHE G CE1 1 
ATOM   6326  C CE2 . PHE J  1 53  ? -14.765 101.897 82.888  1.00 65.13  ? 193  PHE G CE2 1 
ATOM   6327  C CZ  . PHE J  1 53  ? -14.259 100.880 82.100  1.00 65.13  ? 193  PHE G CZ  1 
ATOM   6328  N N   . GLU J  1 54  ? -20.942 100.713 85.265  1.00 56.89  ? 194  GLU G N   1 
ATOM   6329  C CA  . GLU J  1 54  ? -22.103 101.325 85.865  1.00 56.89  ? 194  GLU G CA  1 
ATOM   6330  C C   . GLU J  1 54  ? -21.713 101.581 87.328  1.00 56.89  ? 194  GLU G C   1 
ATOM   6331  O O   . GLU J  1 54  ? -21.842 102.703 87.824  1.00 56.89  ? 194  GLU G O   1 
ATOM   6332  C CB  . GLU J  1 54  ? -23.297 100.372 85.792  1.00 56.89  ? 194  GLU G CB  1 
ATOM   6333  C CG  . GLU J  1 54  ? -24.464 100.857 84.930  1.00 56.89  ? 194  GLU G CG  1 
ATOM   6334  C CD  . GLU J  1 54  ? -25.543 99.780  84.721  1.00 56.89  ? 194  GLU G CD  1 
ATOM   6335  O OE1 . GLU J  1 54  ? -25.479 98.714  85.377  1.00 56.89  ? 194  GLU G OE1 1 
ATOM   6336  O OE2 . GLU J  1 54  ? -26.459 100.000 83.896  1.00 56.89  ? 194  GLU G OE2 1 
ATOM   6337  N N   . GLU J  1 55  ? -21.201 100.547 88.001  1.00 81.55  ? 195  GLU G N   1 
ATOM   6338  C CA  . GLU J  1 55  ? -20.803 100.651 89.410  1.00 81.55  ? 195  GLU G CA  1 
ATOM   6339  C C   . GLU J  1 55  ? -19.853 101.809 89.684  1.00 81.55  ? 195  GLU G C   1 
ATOM   6340  O O   . GLU J  1 55  ? -19.801 102.345 90.794  1.00 81.55  ? 195  GLU G O   1 
ATOM   6341  C CB  . GLU J  1 55  ? -20.138 99.359  89.875  1.00 81.55  ? 195  GLU G CB  1 
ATOM   6342  C CG  . GLU J  1 55  ? -20.353 98.178  88.969  1.00 81.55  ? 195  GLU G CG  1 
ATOM   6343  C CD  . GLU J  1 55  ? -20.253 96.853  89.717  1.00 81.55  ? 195  GLU G CD  1 
ATOM   6344  O OE1 . GLU J  1 55  ? -19.613 95.904  89.201  1.00 81.55  ? 195  GLU G OE1 1 
ATOM   6345  O OE2 . GLU J  1 55  ? -20.819 96.760  90.831  1.00 81.55  ? 195  GLU G OE2 1 
ATOM   6346  N N   . LEU J  1 56  ? -19.092 102.183 88.666  1.00 63.49  ? 196  LEU G N   1 
ATOM   6347  C CA  . LEU J  1 56  ? -18.142 103.267 88.793  1.00 63.49  ? 196  LEU G CA  1 
ATOM   6348  C C   . LEU J  1 56  ? -18.826 104.575 88.448  1.00 63.49  ? 196  LEU G C   1 
ATOM   6349  O O   . LEU J  1 56  ? -18.179 105.554 88.083  1.00 63.49  ? 196  LEU G O   1 
ATOM   6350  C CB  . LEU J  1 56  ? -16.950 103.015 87.875  1.00 63.49  ? 196  LEU G CB  1 
ATOM   6351  C CG  . LEU J  1 56  ? -16.244 101.686 88.169  1.00 63.49  ? 196  LEU G CG  1 
ATOM   6352  C CD1 . LEU J  1 56  ? -15.550 101.202 86.916  1.00 63.49  ? 196  LEU G CD1 1 
ATOM   6353  C CD2 . LEU J  1 56  ? -15.253 101.863 89.313  1.00 63.49  ? 196  LEU G CD2 1 
ATOM   6354  N N   . HIS J  1 57  ? -20.151 104.564 88.562  1.00 75.03  ? 197  HIS G N   1 
ATOM   6355  C CA  . HIS J  1 57  ? -20.981 105.732 88.308  1.00 75.03  ? 197  HIS G CA  1 
ATOM   6356  C C   . HIS J  1 57  ? -20.825 106.333 86.920  1.00 75.03  ? 197  HIS G C   1 
ATOM   6357  O O   . HIS J  1 57  ? -20.690 107.546 86.751  1.00 75.03  ? 197  HIS G O   1 
ATOM   6358  C CB  . HIS J  1 57  ? -20.717 106.771 89.397  1.00 75.03  ? 197  HIS G CB  1 
ATOM   6359  C CG  . HIS J  1 57  ? -20.813 106.207 90.784  1.00 75.03  ? 197  HIS G CG  1 
ATOM   6360  N ND1 . HIS J  1 57  ? -21.929 105.536 91.235  1.00 75.03  ? 197  HIS G ND1 1 
ATOM   6361  C CD2 . HIS J  1 57  ? -19.918 106.173 91.802  1.00 75.03  ? 197  HIS G CD2 1 
ATOM   6362  C CE1 . HIS J  1 57  ? -21.718 105.113 92.471  1.00 75.03  ? 197  HIS G CE1 1 
ATOM   6363  N NE2 . HIS J  1 57  ? -20.506 105.485 92.838  1.00 75.03  ? 197  HIS G NE2 1 
ATOM   6364  N N   . PHE J  1 58  ? -20.872 105.458 85.925  1.00 53.34  ? 198  PHE G N   1 
ATOM   6365  C CA  . PHE J  1 58  ? -20.758 105.855 84.533  1.00 53.34  ? 198  PHE G CA  1 
ATOM   6366  C C   . PHE J  1 58  ? -22.082 105.569 83.832  1.00 53.34  ? 198  PHE G C   1 
ATOM   6367  O O   . PHE J  1 58  ? -22.740 104.572 84.126  1.00 53.34  ? 198  PHE G O   1 
ATOM   6368  C CB  . PHE J  1 58  ? -19.640 105.061 83.853  1.00 53.34  ? 198  PHE G CB  1 
ATOM   6369  C CG  . PHE J  1 58  ? -18.363 105.827 83.708  1.00 53.34  ? 198  PHE G CG  1 
ATOM   6370  C CD1 . PHE J  1 58  ? -17.466 105.920 84.771  1.00 53.34  ? 198  PHE G CD1 1 
ATOM   6371  C CD2 . PHE J  1 58  ? -18.067 106.484 82.517  1.00 53.34  ? 198  PHE G CD2 1 
ATOM   6372  C CE1 . PHE J  1 58  ? -16.295 106.660 84.653  1.00 53.34  ? 198  PHE G CE1 1 
ATOM   6373  C CE2 . PHE J  1 58  ? -16.897 107.225 82.391  1.00 53.34  ? 198  PHE G CE2 1 
ATOM   6374  C CZ  . PHE J  1 58  ? -16.008 107.314 83.464  1.00 53.34  ? 198  PHE G CZ  1 
ATOM   6375  N N   . GLU J  1 59  ? -22.468 106.438 82.902  1.00 55.80  ? 199  GLU G N   1 
ATOM   6376  C CA  . GLU J  1 59  ? -23.713 106.262 82.168  1.00 55.80  ? 199  GLU G CA  1 
ATOM   6377  C C   . GLU J  1 59  ? -23.476 105.480 80.888  1.00 55.80  ? 199  GLU G C   1 
ATOM   6378  O O   . GLU J  1 59  ? -22.925 106.003 79.926  1.00 55.80  ? 199  GLU G O   1 
ATOM   6379  C CB  . GLU J  1 59  ? -24.317 107.624 81.839  1.00 55.80  ? 199  GLU G CB  1 
ATOM   6380  C CG  . GLU J  1 59  ? -25.704 107.539 81.212  1.00 55.80  ? 199  GLU G CG  1 
ATOM   6381  C CD  . GLU J  1 59  ? -26.709 108.456 81.883  1.00 55.80  ? 199  GLU G CD  1 
ATOM   6382  O OE1 . GLU J  1 59  ? -27.275 109.325 81.179  1.00 55.80  ? 199  GLU G OE1 1 
ATOM   6383  O OE2 . GLU J  1 59  ? -26.928 108.303 83.110  1.00 55.80  ? 199  GLU G OE2 1 
ATOM   6384  N N   . ILE J  1 60  ? -23.906 104.226 80.879  1.00 42.80  ? 200  ILE G N   1 
ATOM   6385  C CA  . ILE J  1 60  ? -23.721 103.356 79.716  1.00 42.80  ? 200  ILE G CA  1 
ATOM   6386  C C   . ILE J  1 60  ? -24.494 103.796 78.478  1.00 42.80  ? 200  ILE G C   1 
ATOM   6387  O O   . ILE J  1 60  ? -25.519 104.458 78.578  1.00 42.80  ? 200  ILE G O   1 
ATOM   6388  C CB  . ILE J  1 60  ? -24.114 101.909 80.055  1.00 42.80  ? 200  ILE G CB  1 
ATOM   6389  C CG1 . ILE J  1 60  ? -23.395 101.461 81.333  1.00 42.80  ? 200  ILE G CG1 1 
ATOM   6390  C CG2 . ILE J  1 60  ? -23.739 100.992 78.925  1.00 42.80  ? 200  ILE G CG2 1 
ATOM   6391  C CD1 . ILE J  1 60  ? -21.961 101.974 81.470  1.00 42.80  ? 200  ILE G CD1 1 
ATOM   6392  N N   . LYS J  1 61  ? -24.000 103.424 77.305  1.00 41.11  ? 201  LYS G N   1 
ATOM   6393  C CA  . LYS J  1 61  ? -24.658 103.802 76.071  1.00 41.11  ? 201  LYS G CA  1 
ATOM   6394  C C   . LYS J  1 61  ? -24.348 102.773 75.016  1.00 41.11  ? 201  LYS G C   1 
ATOM   6395  O O   . LYS J  1 61  ? -23.617 103.043 74.066  1.00 41.11  ? 201  LYS G O   1 
ATOM   6396  C CB  . LYS J  1 61  ? -24.175 105.175 75.616  1.00 41.11  ? 201  LYS G CB  1 
ATOM   6397  C CG  . LYS J  1 61  ? -24.687 106.314 76.475  1.00 41.11  ? 201  LYS G CG  1 
ATOM   6398  C CD  . LYS J  1 61  ? -26.182 106.456 76.331  1.00 41.11  ? 201  LYS G CD  1 
ATOM   6399  C CE  . LYS J  1 61  ? -26.760 107.279 77.466  1.00 41.11  ? 201  LYS G CE  1 
ATOM   6400  N NZ  . LYS J  1 61  ? -28.256 107.293 77.396  1.00 41.11  ? 201  LYS G NZ  1 
ATOM   6401  N N   . PRO J  1 62  ? -24.940 101.584 75.149  1.00 37.77  ? 202  PRO G N   1 
ATOM   6402  C CA  . PRO J  1 62  ? -24.780 100.438 74.256  1.00 37.77  ? 202  PRO G CA  1 
ATOM   6403  C C   . PRO J  1 62  ? -25.289 100.671 72.864  1.00 37.77  ? 202  PRO G C   1 
ATOM   6404  O O   . PRO J  1 62  ? -26.164 101.498 72.662  1.00 37.77  ? 202  PRO G O   1 
ATOM   6405  C CB  . PRO J  1 62  ? -25.575 99.330  74.932  1.00 37.77  ? 202  PRO G CB  1 
ATOM   6406  C CG  . PRO J  1 62  ? -25.845 99.806  76.288  1.00 37.77  ? 202  PRO G CG  1 
ATOM   6407  C CD  . PRO J  1 62  ? -25.887 101.290 76.226  1.00 37.77  ? 202  PRO G CD  1 
ATOM   6408  N N   . HIS J  1 63  ? -24.742 99.915  71.917  1.00 34.24  ? 203  HIS G N   1 
ATOM   6409  C CA  . HIS J  1 63  ? -25.129 99.974  70.505  1.00 34.24  ? 203  HIS G CA  1 
ATOM   6410  C C   . HIS J  1 63  ? -24.695 98.658  69.892  1.00 34.24  ? 203  HIS G C   1 
ATOM   6411  O O   . HIS J  1 63  ? -23.556 98.244  70.079  1.00 34.24  ? 203  HIS G O   1 
ATOM   6412  C CB  . HIS J  1 63  ? -24.433 101.132 69.810  1.00 34.24  ? 203  HIS G CB  1 
ATOM   6413  C CG  . HIS J  1 63  ? -24.976 102.466 70.206  1.00 34.24  ? 203  HIS G CG  1 
ATOM   6414  N ND1 . HIS J  1 63  ? -24.646 103.082 71.397  1.00 34.24  ? 203  HIS G ND1 1 
ATOM   6415  C CD2 . HIS J  1 63  ? -25.889 103.266 69.609  1.00 34.24  ? 203  HIS G CD2 1 
ATOM   6416  C CE1 . HIS J  1 63  ? -25.337 104.202 71.515  1.00 34.24  ? 203  HIS G CE1 1 
ATOM   6417  N NE2 . HIS J  1 63  ? -26.098 104.336 70.443  1.00 34.24  ? 203  HIS G NE2 1 
ATOM   6418  N N   . HIS J  1 64  ? -25.586 97.989  69.170  1.00 43.30  ? 204  HIS G N   1 
ATOM   6419  C CA  . HIS J  1 64  ? -25.221 96.702  68.605  1.00 43.30  ? 204  HIS G CA  1 
ATOM   6420  C C   . HIS J  1 64  ? -25.018 96.652  67.096  1.00 43.30  ? 204  HIS G C   1 
ATOM   6421  O O   . HIS J  1 64  ? -25.582 97.453  66.349  1.00 43.30  ? 204  HIS G O   1 
ATOM   6422  C CB  . HIS J  1 64  ? -26.243 95.674  69.043  1.00 43.30  ? 204  HIS G CB  1 
ATOM   6423  C CG  . HIS J  1 64  ? -26.385 95.578  70.526  1.00 43.30  ? 204  HIS G CG  1 
ATOM   6424  N ND1 . HIS J  1 64  ? -25.895 94.514  71.254  1.00 43.30  ? 204  HIS G ND1 1 
ATOM   6425  C CD2 . HIS J  1 64  ? -26.949 96.420  71.422  1.00 43.30  ? 204  HIS G CD2 1 
ATOM   6426  C CE1 . HIS J  1 64  ? -26.152 94.705  72.537  1.00 43.30  ? 204  HIS G CE1 1 
ATOM   6427  N NE2 . HIS J  1 64  ? -26.790 95.855  72.667  1.00 43.30  ? 204  HIS G NE2 1 
ATOM   6428  N N   . ASP J  1 65  ? -24.206 95.691  66.663  1.00 57.03  ? 205  ASP G N   1 
ATOM   6429  C CA  . ASP J  1 65  ? -23.872 95.514  65.257  1.00 57.03  ? 205  ASP G CA  1 
ATOM   6430  C C   . ASP J  1 65  ? -24.008 96.806  64.458  1.00 57.03  ? 205  ASP G C   1 
ATOM   6431  O O   . ASP J  1 65  ? -24.941 96.971  63.677  1.00 57.03  ? 205  ASP G O   1 
ATOM   6432  C CB  . ASP J  1 65  ? -24.734 94.425  64.608  1.00 57.03  ? 205  ASP G CB  1 
ATOM   6433  C CG  . ASP J  1 65  ? -24.941 93.213  65.511  1.00 57.03  ? 205  ASP G CG  1 
ATOM   6434  O OD1 . ASP J  1 65  ? -24.277 93.113  66.560  1.00 57.03  ? 205  ASP G OD1 1 
ATOM   6435  O OD2 . ASP J  1 65  ? -25.780 92.353  65.174  1.00 57.03  ? 205  ASP G OD2 1 
ATOM   6436  N N   . CYS J  1 66  ? -23.082 97.731  64.667  1.00 50.55  ? 206  CYS G N   1 
ATOM   6437  C CA  . CYS J  1 66  ? -23.122 98.973  63.931  1.00 50.55  ? 206  CYS G CA  1 
ATOM   6438  C C   . CYS J  1 66  ? -22.135 98.898  62.778  1.00 50.55  ? 206  CYS G C   1 
ATOM   6439  O O   . CYS J  1 66  ? -21.000 98.436  62.939  1.00 50.55  ? 206  CYS G O   1 
ATOM   6440  C CB  . CYS J  1 66  ? -22.763 100.151 64.836  1.00 50.55  ? 206  CYS G CB  1 
ATOM   6441  S SG  . CYS J  1 66  ? -23.352 100.029 66.546  1.00 50.55  ? 206  CYS G SG  1 
ATOM   6442  N N   . THR J  1 67  ? -22.578 99.331  61.608  1.00 44.39  ? 207  THR G N   1 
ATOM   6443  C CA  . THR J  1 67  ? -21.718 99.347  60.445  1.00 44.39  ? 207  THR G CA  1 
ATOM   6444  C C   . THR J  1 67  ? -20.690 100.445 60.713  1.00 44.39  ? 207  THR G C   1 
ATOM   6445  O O   . THR J  1 67  ? -20.837 101.210 61.676  1.00 44.39  ? 207  THR G O   1 
ATOM   6446  C CB  . THR J  1 67  ? -22.505 99.733  59.229  1.00 44.39  ? 207  THR G CB  1 
ATOM   6447  O OG1 . THR J  1 67  ? -22.827 101.127 59.317  1.00 44.39  ? 207  THR G OG1 1 
ATOM   6448  C CG2 . THR J  1 67  ? -23.781 98.926  59.160  1.00 44.39  ? 207  THR G CG2 1 
ATOM   6449  N N   . VAL J  1 68  ? -19.660 100.540 59.872  1.00 48.13  ? 208  VAL G N   1 
ATOM   6450  C CA  . VAL J  1 68  ? -18.645 101.573 60.064  1.00 48.13  ? 208  VAL G CA  1 
ATOM   6451  C C   . VAL J  1 68  ? -19.413 102.873 60.163  1.00 48.13  ? 208  VAL G C   1 
ATOM   6452  O O   . VAL J  1 68  ? -19.314 103.600 61.144  1.00 48.13  ? 208  VAL G O   1 
ATOM   6453  C CB  . VAL J  1 68  ? -17.648 101.640 58.870  1.00 48.13  ? 208  VAL G CB  1 
ATOM   6454  C CG1 . VAL J  1 68  ? -17.300 103.072 58.547  1.00 48.13  ? 208  VAL G CG1 1 
ATOM   6455  C CG2 . VAL J  1 68  ? -16.384 100.883 59.209  1.00 48.13  ? 208  VAL G CG2 1 
ATOM   6456  N N   . GLU J  1 69  ? -20.210 103.137 59.145  1.00 81.02  ? 209  GLU G N   1 
ATOM   6457  C CA  . GLU J  1 69  ? -21.010 104.339 59.102  1.00 81.02  ? 209  GLU G CA  1 
ATOM   6458  C C   . GLU J  1 69  ? -21.679 104.651 60.425  1.00 81.02  ? 209  GLU G C   1 
ATOM   6459  O O   . GLU J  1 69  ? -21.493 105.724 60.983  1.00 81.02  ? 209  GLU G O   1 
ATOM   6460  C CB  . GLU J  1 69  ? -22.076 104.184 58.048  1.00 81.02  ? 209  GLU G CB  1 
ATOM   6461  C CG  . GLU J  1 69  ? -22.914 105.406 57.896  1.00 81.02  ? 209  GLU G CG  1 
ATOM   6462  C CD  . GLU J  1 69  ? -23.492 105.507 56.504  1.00 81.02  ? 209  GLU G CD  1 
ATOM   6463  O OE1 . GLU J  1 69  ? -24.576 104.914 56.270  1.00 81.02  ? 209  GLU G OE1 1 
ATOM   6464  O OE2 . GLU J  1 69  ? -22.856 106.172 55.649  1.00 81.02  ? 209  GLU G OE2 1 
ATOM   6465  N N   . GLN J  1 70  ? -22.475 103.710 60.910  1.00 41.09  ? 210  GLN G N   1 
ATOM   6466  C CA  . GLN J  1 70  ? -23.178 103.891 62.164  1.00 41.09  ? 210  GLN G CA  1 
ATOM   6467  C C   . GLN J  1 70  ? -22.221 104.310 63.265  1.00 41.09  ? 210  GLN G C   1 
ATOM   6468  O O   . GLN J  1 70  ? -22.524 105.211 64.039  1.00 41.09  ? 210  GLN G O   1 
ATOM   6469  C CB  . GLN J  1 70  ? -23.862 102.599 62.581  1.00 41.09  ? 210  GLN G CB  1 
ATOM   6470  C CG  . GLN J  1 70  ? -25.323 102.502 62.217  1.00 41.09  ? 210  GLN G CG  1 
ATOM   6471  C CD  . GLN J  1 70  ? -25.640 101.174 61.549  1.00 41.09  ? 210  GLN G CD  1 
ATOM   6472  O OE1 . GLN J  1 70  ? -26.215 100.261 62.165  1.00 41.09  ? 210  GLN G OE1 1 
ATOM   6473  N NE2 . GLN J  1 70  ? -25.255 101.053 60.282  1.00 41.09  ? 210  GLN G NE2 1 
ATOM   6474  N N   . ILE J  1 71  ? -21.072 103.642 63.337  1.00 47.00  ? 211  ILE G N   1 
ATOM   6475  C CA  . ILE J  1 71  ? -20.070 103.948 64.356  1.00 47.00  ? 211  ILE G CA  1 
ATOM   6476  C C   . ILE J  1 71  ? -19.668 105.418 64.298  1.00 47.00  ? 211  ILE G C   1 
ATOM   6477  O O   . ILE J  1 71  ? -19.591 106.093 65.315  1.00 47.00  ? 211  ILE G O   1 
ATOM   6478  C CB  . ILE J  1 71  ? -18.791 103.128 64.169  1.00 47.00  ? 211  ILE G CB  1 
ATOM   6479  C CG1 . ILE J  1 71  ? -19.090 101.634 64.272  1.00 47.00  ? 211  ILE G CG1 1 
ATOM   6480  C CG2 . ILE J  1 71  ? -17.765 103.542 65.212  1.00 47.00  ? 211  ILE G CG2 1 
ATOM   6481  C CD1 . ILE J  1 71  ? -17.916 100.761 63.861  1.00 47.00  ? 211  ILE G CD1 1 
ATOM   6482  N N   . TYR J  1 72  ? -19.398 105.917 63.102  1.00 46.66  ? 212  TYR G N   1 
ATOM   6483  C CA  . TYR J  1 72  ? -19.010 107.307 62.989  1.00 46.66  ? 212  TYR G CA  1 
ATOM   6484  C C   . TYR J  1 72  ? -20.146 108.139 63.509  1.00 46.66  ? 212  TYR G C   1 
ATOM   6485  O O   . TYR J  1 72  ? -19.946 108.975 64.380  1.00 46.66  ? 212  TYR G O   1 
ATOM   6486  C CB  . TYR J  1 72  ? -18.683 107.667 61.539  1.00 46.66  ? 212  TYR G CB  1 
ATOM   6487  C CG  . TYR J  1 72  ? -17.267 107.265 61.166  1.00 46.66  ? 212  TYR G CG  1 
ATOM   6488  C CD1 . TYR J  1 72  ? -17.029 106.210 60.289  1.00 46.66  ? 212  TYR G CD1 1 
ATOM   6489  C CD2 . TYR J  1 72  ? -16.158 107.892 61.753  1.00 46.66  ? 212  TYR G CD2 1 
ATOM   6490  C CE1 . TYR J  1 72  ? -15.724 105.779 60.007  1.00 46.66  ? 212  TYR G CE1 1 
ATOM   6491  C CE2 . TYR J  1 72  ? -14.854 107.470 61.479  1.00 46.66  ? 212  TYR G CE2 1 
ATOM   6492  C CZ  . TYR J  1 72  ? -14.646 106.409 60.606  1.00 46.66  ? 212  TYR G CZ  1 
ATOM   6493  O OH  . TYR J  1 72  ? -13.370 105.963 60.334  1.00 46.66  ? 212  TYR G OH  1 
ATOM   6494  N N   . GLU J  1 73  ? -21.344 107.889 62.993  1.00 47.89  ? 213  GLU G N   1 
ATOM   6495  C CA  . GLU J  1 73  ? -22.529 108.615 63.424  1.00 47.89  ? 213  GLU G CA  1 
ATOM   6496  C C   . GLU J  1 73  ? -22.510 108.707 64.927  1.00 47.89  ? 213  GLU G C   1 
ATOM   6497  O O   . GLU J  1 73  ? -22.539 109.787 65.505  1.00 47.89  ? 213  GLU G O   1 
ATOM   6498  C CB  . GLU J  1 73  ? -23.795 107.869 63.009  1.00 47.89  ? 213  GLU G CB  1 
ATOM   6499  C CG  . GLU J  1 73  ? -24.684 108.625 62.026  1.00 47.89  ? 213  GLU G CG  1 
ATOM   6500  C CD  . GLU J  1 73  ? -25.256 107.721 60.932  1.00 47.89  ? 213  GLU G CD  1 
ATOM   6501  O OE1 . GLU J  1 73  ? -25.914 106.721 61.308  1.00 47.89  ? 213  GLU G OE1 1 
ATOM   6502  O OE2 . GLU J  1 73  ? -25.051 108.002 59.715  1.00 47.89  ? 213  GLU G OE2 1 
ATOM   6503  N N   . ILE J  1 74  ? -22.449 107.547 65.559  1.00 35.14  ? 214  ILE G N   1 
ATOM   6504  C CA  . ILE J  1 74  ? -22.455 107.475 67.013  1.00 35.14  ? 214  ILE G CA  1 
ATOM   6505  C C   . ILE J  1 74  ? -21.416 108.335 67.700  1.00 35.14  ? 214  ILE G C   1 
ATOM   6506  O O   . ILE J  1 74  ? -21.740 109.083 68.624  1.00 35.14  ? 214  ILE G O   1 
ATOM   6507  C CB  . ILE J  1 74  ? -22.275 106.046 67.501  1.00 35.14  ? 214  ILE G CB  1 
ATOM   6508  C CG1 . ILE J  1 74  ? -23.399 105.192 66.921  1.00 35.14  ? 214  ILE G CG1 1 
ATOM   6509  C CG2 . ILE J  1 74  ? -22.211 106.034 69.028  1.00 35.14  ? 214  ILE G CG2 1 
ATOM   6510  C CD1 . ILE J  1 74  ? -23.665 103.910 67.652  1.00 35.14  ? 214  ILE G CD1 1 
ATOM   6511  N N   . LEU J  1 75  ? -20.167 108.225 67.267  1.00 45.19  ? 215  LEU G N   1 
ATOM   6512  C CA  . LEU J  1 75  ? -19.112 109.005 67.887  1.00 45.19  ? 215  LEU G CA  1 
ATOM   6513  C C   . LEU J  1 75  ? -19.423 110.458 67.631  1.00 45.19  ? 215  LEU G C   1 
ATOM   6514  O O   . LEU J  1 75  ? -19.371 111.283 68.547  1.00 45.19  ? 215  LEU G O   1 
ATOM   6515  C CB  . LEU J  1 75  ? -17.746 108.627 67.305  1.00 45.19  ? 215  LEU G CB  1 
ATOM   6516  C CG  . LEU J  1 75  ? -17.321 107.168 67.540  1.00 45.19  ? 215  LEU G CG  1 
ATOM   6517  C CD1 . LEU J  1 75  ? -15.957 106.940 66.920  1.00 45.19  ? 215  LEU G CD1 1 
ATOM   6518  C CD2 . LEU J  1 75  ? -17.319 106.852 69.029  1.00 45.19  ? 215  LEU G CD2 1 
ATOM   6519  N N   . LYS J  1 76  ? -19.775 110.764 66.389  1.00 35.54  ? 216  LYS G N   1 
ATOM   6520  C CA  . LYS J  1 76  ? -20.119 112.131 66.013  1.00 35.54  ? 216  LYS G CA  1 
ATOM   6521  C C   . LYS J  1 76  ? -21.088 112.769 67.014  1.00 35.54  ? 216  LYS G C   1 
ATOM   6522  O O   . LYS J  1 76  ? -20.964 113.946 67.324  1.00 35.54  ? 216  LYS G O   1 
ATOM   6523  C CB  . LYS J  1 76  ? -20.734 112.151 64.620  1.00 35.54  ? 216  LYS G CB  1 
ATOM   6524  C CG  . LYS J  1 76  ? -21.493 113.416 64.306  1.00 35.54  ? 216  LYS G CG  1 
ATOM   6525  C CD  . LYS J  1 76  ? -20.549 114.558 64.006  1.00 35.54  ? 216  LYS G CD  1 
ATOM   6526  C CE  . LYS J  1 76  ? -20.384 114.764 62.501  1.00 35.54  ? 216  LYS G CE  1 
ATOM   6527  N NZ  . LYS J  1 76  ? -19.066 115.408 62.188  1.00 35.54  ? 216  LYS G NZ  1 
ATOM   6528  N N   . ILE J  1 77  ? -22.053 112.001 67.515  1.00 44.06  ? 217  ILE G N   1 
ATOM   6529  C CA  . ILE J  1 77  ? -22.997 112.530 68.496  1.00 44.06  ? 217  ILE G CA  1 
ATOM   6530  C C   . ILE J  1 77  ? -22.239 112.955 69.755  1.00 44.06  ? 217  ILE G C   1 
ATOM   6531  O O   . ILE J  1 77  ? -22.204 114.134 70.127  1.00 44.06  ? 217  ILE G O   1 
ATOM   6532  C CB  . ILE J  1 77  ? -24.046 111.475 68.918  1.00 44.06  ? 217  ILE G CB  1 
ATOM   6533  C CG1 . ILE J  1 77  ? -25.092 111.310 67.820  1.00 44.06  ? 217  ILE G CG1 1 
ATOM   6534  C CG2 . ILE J  1 77  ? -24.728 111.889 70.217  1.00 44.06  ? 217  ILE G CG2 1 
ATOM   6535  C CD1 . ILE J  1 77  ? -26.176 110.312 68.195  1.00 44.06  ? 217  ILE G CD1 1 
ATOM   6536  N N   . TYR J  1 78  ? -21.627 111.979 70.412  1.00 45.20  ? 218  TYR G N   1 
ATOM   6537  C CA  . TYR J  1 78  ? -20.885 112.251 71.635  1.00 45.20  ? 218  TYR G CA  1 
ATOM   6538  C C   . TYR J  1 78  ? -19.784 113.258 71.402  1.00 45.20  ? 218  TYR G C   1 
ATOM   6539  O O   . TYR J  1 78  ? -19.302 113.903 72.323  1.00 45.20  ? 218  TYR G O   1 
ATOM   6540  C CB  . TYR J  1 78  ? -20.335 110.944 72.190  1.00 45.20  ? 218  TYR G CB  1 
ATOM   6541  C CG  . TYR J  1 78  ? -21.463 110.081 72.678  1.00 45.20  ? 218  TYR G CG  1 
ATOM   6542  C CD1 . TYR J  1 78  ? -22.131 109.222 71.812  1.00 45.20  ? 218  TYR G CD1 1 
ATOM   6543  C CD2 . TYR J  1 78  ? -21.932 110.201 73.982  1.00 45.20  ? 218  TYR G CD2 1 
ATOM   6544  C CE1 . TYR J  1 78  ? -23.249 108.506 72.235  1.00 45.20  ? 218  TYR G CE1 1 
ATOM   6545  C CE2 . TYR J  1 78  ? -23.047 109.493 74.423  1.00 45.20  ? 218  TYR G CE2 1 
ATOM   6546  C CZ  . TYR J  1 78  ? -23.706 108.645 73.551  1.00 45.20  ? 218  TYR G CZ  1 
ATOM   6547  O OH  . TYR J  1 78  ? -24.800 107.922 74.000  1.00 45.20  ? 218  TYR G OH  1 
ATOM   6548  N N   . GLN J  1 79  ? -19.413 113.413 70.147  1.00 29.02  ? 219  GLN G N   1 
ATOM   6549  C CA  . GLN J  1 79  ? -18.373 114.349 69.801  1.00 29.02  ? 219  GLN G CA  1 
ATOM   6550  C C   . GLN J  1 79  ? -18.880 115.766 69.953  1.00 29.02  ? 219  GLN G C   1 
ATOM   6551  O O   . GLN J  1 79  ? -18.197 116.618 70.541  1.00 29.02  ? 219  GLN G O   1 
ATOM   6552  C CB  . GLN J  1 79  ? -17.939 114.113 68.365  1.00 29.02  ? 219  GLN G CB  1 
ATOM   6553  C CG  . GLN J  1 79  ? -16.688 114.836 67.978  1.00 29.02  ? 219  GLN G CG  1 
ATOM   6554  C CD  . GLN J  1 79  ? -16.957 115.856 66.913  1.00 29.02  ? 219  GLN G CD  1 
ATOM   6555  O OE1 . GLN J  1 79  ? -16.658 115.653 65.725  1.00 29.02  ? 219  GLN G OE1 1 
ATOM   6556  N NE2 . GLN J  1 79  ? -17.538 116.966 67.325  1.00 29.02  ? 219  GLN G NE2 1 
ATOM   6557  N N   . LEU J  1 80  ? -20.091 115.994 69.431  1.00 38.54  ? 220  LEU G N   1 
ATOM   6558  C CA  . LEU J  1 80  ? -20.754 117.302 69.446  1.00 38.54  ? 220  LEU G CA  1 
ATOM   6559  C C   . LEU J  1 80  ? -21.418 117.659 70.770  1.00 38.54  ? 220  LEU G C   1 
ATOM   6560  O O   . LEU J  1 80  ? -21.770 118.815 71.006  1.00 38.54  ? 220  LEU G O   1 
ATOM   6561  C CB  . LEU J  1 80  ? -21.772 117.366 68.306  1.00 38.54  ? 220  LEU G CB  1 
ATOM   6562  C CG  . LEU J  1 80  ? -21.138 117.215 66.917  1.00 38.54  ? 220  LEU G CG  1 
ATOM   6563  C CD1 . LEU J  1 80  ? -22.185 117.024 65.837  1.00 38.54  ? 220  LEU G CD1 1 
ATOM   6564  C CD2 . LEU J  1 80  ? -20.341 118.456 66.627  1.00 38.54  ? 220  LEU G CD2 1 
ATOM   6565  N N   . MET J  1 81  ? -21.568 116.667 71.636  1.00 37.97  ? 221  MET G N   1 
ATOM   6566  C CA  . MET J  1 81  ? -22.168 116.879 72.938  1.00 37.97  ? 221  MET G CA  1 
ATOM   6567  C C   . MET J  1 81  ? -21.414 117.896 73.791  1.00 37.97  ? 221  MET G C   1 
ATOM   6568  O O   . MET J  1 81  ? -20.349 118.366 73.424  1.00 37.97  ? 221  MET G O   1 
ATOM   6569  C CB  . MET J  1 81  ? -22.219 115.560 73.684  1.00 37.97  ? 221  MET G CB  1 
ATOM   6570  C CG  . MET J  1 81  ? -23.346 114.662 73.272  1.00 37.97  ? 221  MET G CG  1 
ATOM   6571  S SD  . MET J  1 81  ? -23.995 113.900 74.755  1.00 37.97  ? 221  MET G SD  1 
ATOM   6572  C CE  . MET J  1 81  ? -25.473 112.988 74.007  1.00 37.97  ? 221  MET G CE  1 
ATOM   6573  N N   . ASP J  1 82  ? -21.980 118.229 74.942  1.00 45.65  ? 222  ASP G N   1 
ATOM   6574  C CA  . ASP J  1 82  ? -21.353 119.167 75.860  1.00 45.65  ? 222  ASP G CA  1 
ATOM   6575  C C   . ASP J  1 82  ? -21.105 118.404 77.153  1.00 45.65  ? 222  ASP G C   1 
ATOM   6576  O O   . ASP J  1 82  ? -21.995 118.264 78.003  1.00 45.65  ? 222  ASP G O   1 
ATOM   6577  C CB  . ASP J  1 82  ? -22.269 120.365 76.114  1.00 45.65  ? 222  ASP G CB  1 
ATOM   6578  C CG  . ASP J  1 82  ? -21.592 121.472 76.917  1.00 45.65  ? 222  ASP G CG  1 
ATOM   6579  O OD1 . ASP J  1 82  ? -20.612 121.167 77.633  1.00 45.65  ? 222  ASP G OD1 1 
ATOM   6580  O OD2 . ASP J  1 82  ? -22.043 122.646 76.835  1.00 45.65  ? 222  ASP G OD2 1 
ATOM   6581  N N   . HIS J  1 83  ? -19.883 117.895 77.287  1.00 40.74  ? 224  HIS G N   1 
ATOM   6582  C CA  . HIS J  1 83  ? -19.505 117.115 78.461  1.00 40.74  ? 224  HIS G CA  1 
ATOM   6583  C C   . HIS J  1 83  ? -19.065 118.000 79.609  1.00 40.74  ? 224  HIS G C   1 
ATOM   6584  O O   . HIS J  1 83  ? -18.278 117.568 80.453  1.00 40.74  ? 224  HIS G O   1 
ATOM   6585  C CB  . HIS J  1 83  ? -18.359 116.162 78.115  1.00 40.74  ? 224  HIS G CB  1 
ATOM   6586  C CG  . HIS J  1 83  ? -18.665 115.220 76.997  1.00 40.74  ? 224  HIS G CG  1 
ATOM   6587  N ND1 . HIS J  1 83  ? -18.967 113.892 77.208  1.00 40.74  ? 224  HIS G ND1 1 
ATOM   6588  C CD2 . HIS J  1 83  ? -18.704 115.411 75.656  1.00 40.74  ? 224  HIS G CD2 1 
ATOM   6589  C CE1 . HIS J  1 83  ? -19.178 113.305 76.045  1.00 40.74  ? 224  HIS G CE1 1 
ATOM   6590  N NE2 . HIS J  1 83  ? -19.026 114.203 75.088  1.00 40.74  ? 224  HIS G NE2 1 
ATOM   6591  N N   . SER J  1 84  ? -19.568 119.226 79.650  1.00 37.86  ? 225  SER G N   1 
ATOM   6592  C CA  . SER J  1 84  ? -19.170 120.155 80.696  1.00 37.86  ? 225  SER G CA  1 
ATOM   6593  C C   . SER J  1 84  ? -19.337 119.638 82.122  1.00 37.86  ? 225  SER G C   1 
ATOM   6594  O O   . SER J  1 84  ? -18.492 119.922 82.972  1.00 37.86  ? 225  SER G O   1 
ATOM   6595  C CB  . SER J  1 84  ? -19.898 121.483 80.527  1.00 37.86  ? 225  SER G CB  1 
ATOM   6596  O OG  . SER J  1 84  ? -19.376 122.183 79.413  1.00 37.86  ? 225  SER G OG  1 
ATOM   6597  N N   . ASN J  1 85  ? -20.394 118.876 82.401  1.00 58.72  ? 226  ASN G N   1 
ATOM   6598  C CA  . ASN J  1 85  ? -20.589 118.362 83.759  1.00 58.72  ? 226  ASN G CA  1 
ATOM   6599  C C   . ASN J  1 85  ? -20.100 116.935 83.854  1.00 58.72  ? 226  ASN G C   1 
ATOM   6600  O O   . ASN J  1 85  ? -20.435 116.203 84.787  1.00 58.72  ? 226  ASN G O   1 
ATOM   6601  C CB  . ASN J  1 85  ? -22.060 118.438 84.166  1.00 58.72  ? 226  ASN G CB  1 
ATOM   6602  C CG  . ASN J  1 85  ? -22.656 119.800 83.907  1.00 58.72  ? 226  ASN G CG  1 
ATOM   6603  O OD1 . ASN J  1 85  ? -22.065 120.833 84.251  1.00 58.72  ? 226  ASN G OD1 1 
ATOM   6604  N ND2 . ASN J  1 85  ? -23.831 119.818 83.291  1.00 58.72  ? 226  ASN G ND2 1 
ATOM   6605  N N   . MET J  1 86  ? -19.301 116.554 82.867  1.00 65.29  ? 227  MET G N   1 
ATOM   6606  C CA  . MET J  1 86  ? -18.726 115.225 82.796  1.00 65.29  ? 227  MET G CA  1 
ATOM   6607  C C   . MET J  1 86  ? -17.250 115.313 83.196  1.00 65.29  ? 227  MET G C   1 
ATOM   6608  O O   . MET J  1 86  ? -16.556 116.270 82.852  1.00 65.29  ? 227  MET G O   1 
ATOM   6609  C CB  . MET J  1 86  ? -18.855 114.687 81.366  1.00 65.29  ? 227  MET G CB  1 
ATOM   6610  C CG  . MET J  1 86  ? -20.283 114.446 80.915  1.00 65.29  ? 227  MET G CG  1 
ATOM   6611  S SD  . MET J  1 86  ? -21.227 113.596 82.192  1.00 65.29  ? 227  MET G SD  1 
ATOM   6612  C CE  . MET J  1 86  ? -22.561 112.900 81.236  1.00 65.29  ? 227  MET G CE  1 
ATOM   6613  N N   . ASP J  1 87  ? -16.775 114.317 83.931  1.00 49.80  ? 228  ASP G N   1 
ATOM   6614  C CA  . ASP J  1 87  ? -15.391 114.292 84.358  1.00 49.80  ? 228  ASP G CA  1 
ATOM   6615  C C   . ASP J  1 87  ? -14.552 113.364 83.484  1.00 49.80  ? 228  ASP G C   1 
ATOM   6616  O O   . ASP J  1 87  ? -13.326 113.436 83.508  1.00 49.80  ? 228  ASP G O   1 
ATOM   6617  C CB  . ASP J  1 87  ? -15.309 113.809 85.802  1.00 49.80  ? 228  ASP G CB  1 
ATOM   6618  C CG  . ASP J  1 87  ? -15.433 114.932 86.794  1.00 49.80  ? 228  ASP G CG  1 
ATOM   6619  O OD1 . ASP J  1 87  ? -15.331 116.097 86.360  1.00 49.80  ? 228  ASP G OD1 1 
ATOM   6620  O OD2 . ASP J  1 87  ? -15.627 114.657 88.004  1.00 49.80  ? 228  ASP G OD2 1 
ATOM   6621  N N   . CYS J  1 88  ? -15.211 112.494 82.719  1.00 57.59  ? 229  CYS G N   1 
ATOM   6622  C CA  . CYS J  1 88  ? -14.508 111.522 81.884  1.00 57.59  ? 229  CYS G CA  1 
ATOM   6623  C C   . CYS J  1 88  ? -15.373 111.030 80.725  1.00 57.59  ? 229  CYS G C   1 
ATOM   6624  O O   . CYS J  1 88  ? -16.548 111.386 80.615  1.00 57.59  ? 229  CYS G O   1 
ATOM   6625  C CB  . CYS J  1 88  ? -14.095 110.332 82.758  1.00 57.59  ? 229  CYS G CB  1 
ATOM   6626  S SG  . CYS J  1 88  ? -12.980 109.126 82.019  1.00 57.59  ? 229  CYS G SG  1 
ATOM   6627  N N   . PHE J  1 89  ? -14.781 110.199 79.870  1.00 35.76  ? 230  PHE G N   1 
ATOM   6628  C CA  . PHE J  1 89  ? -15.477 109.644 78.714  1.00 35.76  ? 230  PHE G CA  1 
ATOM   6629  C C   . PHE J  1 89  ? -14.813 108.348 78.291  1.00 35.76  ? 230  PHE G C   1 
ATOM   6630  O O   . PHE J  1 89  ? -13.662 108.343 77.894  1.00 35.76  ? 230  PHE G O   1 
ATOM   6631  C CB  . PHE J  1 89  ? -15.443 110.625 77.545  1.00 35.76  ? 230  PHE G CB  1 
ATOM   6632  C CG  . PHE J  1 89  ? -16.047 110.083 76.299  1.00 35.76  ? 230  PHE G CG  1 
ATOM   6633  C CD1 . PHE J  1 89  ? -17.397 109.760 76.252  1.00 35.76  ? 230  PHE G CD1 1 
ATOM   6634  C CD2 . PHE J  1 89  ? -15.277 109.893 75.168  1.00 35.76  ? 230  PHE G CD2 1 
ATOM   6635  C CE1 . PHE J  1 89  ? -17.975 109.255 75.092  1.00 35.76  ? 230  PHE G CE1 1 
ATOM   6636  C CE2 . PHE J  1 89  ? -15.843 109.386 73.992  1.00 35.76  ? 230  PHE G CE2 1 
ATOM   6637  C CZ  . PHE J  1 89  ? -17.194 109.068 73.953  1.00 35.76  ? 230  PHE G CZ  1 
ATOM   6638  N N   . ILE J  1 90  ? -15.541 107.248 78.370  1.00 29.62  ? 231  ILE G N   1 
ATOM   6639  C CA  . ILE J  1 90  ? -15.001 105.954 78.000  1.00 29.62  ? 231  ILE G CA  1 
ATOM   6640  C C   . ILE J  1 90  ? -15.743 105.401 76.805  1.00 29.62  ? 231  ILE G C   1 
ATOM   6641  O O   . ILE J  1 90  ? -16.958 105.533 76.710  1.00 29.62  ? 231  ILE G O   1 
ATOM   6642  C CB  . ILE J  1 90  ? -15.158 104.984 79.153  1.00 29.62  ? 231  ILE G CB  1 
ATOM   6643  C CG1 . ILE J  1 90  ? -14.597 105.644 80.407  1.00 29.62  ? 231  ILE G CG1 1 
ATOM   6644  C CG2 . ILE J  1 90  ? -14.508 103.641 78.815  1.00 29.62  ? 231  ILE G CG2 1 
ATOM   6645  C CD1 . ILE J  1 90  ? -14.710 104.791 81.633  1.00 29.62  ? 231  ILE G CD1 1 
ATOM   6646  N N   . CYS J  1 91  ? -15.017 104.771 75.898  1.00 36.72  ? 232  CYS G N   1 
ATOM   6647  C CA  . CYS J  1 91  ? -15.646 104.201 74.732  1.00 36.72  ? 232  CYS G CA  1 
ATOM   6648  C C   . CYS J  1 91  ? -15.056 102.825 74.496  1.00 36.72  ? 232  CYS G C   1 
ATOM   6649  O O   . CYS J  1 91  ? -13.839 102.671 74.369  1.00 36.72  ? 232  CYS G O   1 
ATOM   6650  C CB  . CYS J  1 91  ? -15.415 105.107 73.523  1.00 36.72  ? 232  CYS G CB  1 
ATOM   6651  S SG  . CYS J  1 91  ? -15.727 104.294 71.939  1.00 36.72  ? 232  CYS G SG  1 
ATOM   6652  N N   . CYS J  1 92  ? -15.911 101.817 74.459  1.00 33.27  ? 233  CYS G N   1 
ATOM   6653  C CA  . CYS J  1 92  ? -15.440 100.466 74.217  1.00 33.27  ? 233  CYS G CA  1 
ATOM   6654  C C   . CYS J  1 92  ? -15.933 99.971  72.892  1.00 33.27  ? 233  CYS G C   1 
ATOM   6655  O O   . CYS J  1 92  ? -17.087 100.195 72.529  1.00 33.27  ? 233  CYS G O   1 
ATOM   6656  C CB  . CYS J  1 92  ? -15.946 99.527  75.278  1.00 33.27  ? 233  CYS G CB  1 
ATOM   6657  S SG  . CYS J  1 92  ? -15.694 100.221 76.856  1.00 33.27  ? 233  CYS G SG  1 
ATOM   6658  N N   . ILE J  1 93  ? -15.061 99.293  72.160  1.00 25.02  ? 234  ILE G N   1 
ATOM   6659  C CA  . ILE J  1 93  ? -15.462 98.748  70.885  1.00 25.02  ? 234  ILE G CA  1 
ATOM   6660  C C   . ILE J  1 93  ? -15.058 97.288  70.876  1.00 25.02  ? 234  ILE G C   1 
ATOM   6661  O O   . ILE J  1 93  ? -13.918 96.938  71.172  1.00 25.02  ? 234  ILE G O   1 
ATOM   6662  C CB  . ILE J  1 93  ? -14.799 99.497  69.728  1.00 25.02  ? 234  ILE G CB  1 
ATOM   6663  C CG1 . ILE J  1 93  ? -15.148 100.981 69.837  1.00 25.02  ? 234  ILE G CG1 1 
ATOM   6664  C CG2 . ILE J  1 93  ? -15.239 98.907  68.384  1.00 25.02  ? 234  ILE G CG2 1 
ATOM   6665  C CD1 . ILE J  1 93  ? -14.269 101.849 69.005  1.00 25.02  ? 234  ILE G CD1 1 
ATOM   6666  N N   . LEU J  1 94  ? -16.024 96.433  70.582  1.00 26.84  ? 235  LEU G N   1 
ATOM   6667  C CA  . LEU J  1 94  ? -15.796 95.006  70.515  1.00 26.84  ? 235  LEU G CA  1 
ATOM   6668  C C   . LEU J  1 94  ? -16.197 94.623  69.100  1.00 26.84  ? 235  LEU G C   1 
ATOM   6669  O O   . LEU J  1 94  ? -17.359 94.761  68.748  1.00 26.84  ? 235  LEU G O   1 
ATOM   6670  C CB  . LEU J  1 94  ? -16.684 94.309  71.535  1.00 26.84  ? 235  LEU G CB  1 
ATOM   6671  C CG  . LEU J  1 94  ? -16.906 95.141  72.798  1.00 26.84  ? 235  LEU G CG  1 
ATOM   6672  C CD1 . LEU J  1 94  ? -17.788 94.369  73.758  1.00 26.84  ? 235  LEU G CD1 1 
ATOM   6673  C CD2 . LEU J  1 94  ? -15.570 95.473  73.438  1.00 26.84  ? 235  LEU G CD2 1 
ATOM   6674  N N   . SER J  1 95  ? -15.252 94.149  68.286  1.00 33.33  ? 236  SER G N   1 
ATOM   6675  C CA  . SER J  1 95  ? -15.559 93.806  66.893  1.00 33.33  ? 236  SER G CA  1 
ATOM   6676  C C   . SER J  1 95  ? -14.355 93.146  66.260  1.00 33.33  ? 236  SER G C   1 
ATOM   6677  O O   . SER J  1 95  ? -13.322 93.049  66.891  1.00 33.33  ? 236  SER G O   1 
ATOM   6678  C CB  . SER J  1 95  ? -15.884 95.091  66.124  1.00 33.33  ? 236  SER G CB  1 
ATOM   6679  O OG  . SER J  1 95  ? -16.194 94.845  64.764  1.00 33.33  ? 236  SER G OG  1 
ATOM   6680  N N   . HIS J  1 96  ? -14.477 92.682  65.026  1.00 40.80  ? 237  HIS G N   1 
ATOM   6681  C CA  . HIS J  1 96  ? -13.324 92.099  64.365  1.00 40.80  ? 237  HIS G CA  1 
ATOM   6682  C C   . HIS J  1 96  ? -12.432 93.278  63.972  1.00 40.80  ? 237  HIS G C   1 
ATOM   6683  O O   . HIS J  1 96  ? -12.901 94.416  63.931  1.00 40.80  ? 237  HIS G O   1 
ATOM   6684  C CB  . HIS J  1 96  ? -13.741 91.354  63.104  1.00 40.80  ? 237  HIS G CB  1 
ATOM   6685  C CG  . HIS J  1 96  ? -14.317 89.996  63.361  1.00 40.80  ? 237  HIS G CG  1 
ATOM   6686  N ND1 . HIS J  1 96  ? -14.053 89.278  64.508  1.00 40.80  ? 237  HIS G ND1 1 
ATOM   6687  C CD2 . HIS J  1 96  ? -15.182 89.245  62.636  1.00 40.80  ? 237  HIS G CD2 1 
ATOM   6688  C CE1 . HIS J  1 96  ? -14.732 88.145  64.478  1.00 40.80  ? 237  HIS G CE1 1 
ATOM   6689  N NE2 . HIS J  1 96  ? -15.426 88.102  63.354  1.00 40.80  ? 237  HIS G NE2 1 
ATOM   6690  N N   . GLY J  1 97  ? -11.160 93.026  63.679  1.00 41.60  ? 238  GLY G N   1 
ATOM   6691  C CA  . GLY J  1 97  ? -10.288 94.122  63.298  1.00 41.60  ? 238  GLY G CA  1 
ATOM   6692  C C   . GLY J  1 97  ? -9.082  93.691  62.502  1.00 41.60  ? 238  GLY G C   1 
ATOM   6693  O O   . GLY J  1 97  ? -8.957  92.535  62.114  1.00 41.60  ? 238  GLY G O   1 
ATOM   6694  N N   . ASP J  1 98  ? -8.189  94.636  62.251  1.00 49.28  ? 239  ASP G N   1 
ATOM   6695  C CA  . ASP J  1 98  ? -6.970  94.357  61.512  1.00 49.28  ? 239  ASP G CA  1 
ATOM   6696  C C   . ASP J  1 98  ? -5.973  95.476  61.806  1.00 49.28  ? 239  ASP G C   1 
ATOM   6697  O O   . ASP J  1 98  ? -6.303  96.435  62.509  1.00 49.28  ? 239  ASP G O   1 
ATOM   6698  C CB  . ASP J  1 98  ? -7.268  94.265  60.014  1.00 49.28  ? 239  ASP G CB  1 
ATOM   6699  C CG  . ASP J  1 98  ? -6.374  93.271  59.308  1.00 49.28  ? 239  ASP G CG  1 
ATOM   6700  O OD1 . ASP J  1 98  ? -5.250  93.068  59.813  1.00 49.28  ? 239  ASP G OD1 1 
ATOM   6701  O OD2 . ASP J  1 98  ? -6.792  92.702  58.264  1.00 49.28  ? 239  ASP G OD2 1 
ATOM   6702  N N   . LYS J  1 99  ? -4.758  95.354  61.278  1.00 62.50  ? 240  LYS G N   1 
ATOM   6703  C CA  . LYS J  1 99  ? -3.711  96.343  61.517  1.00 62.50  ? 240  LYS G CA  1 
ATOM   6704  C C   . LYS J  1 99  ? -4.176  97.798  61.654  1.00 62.50  ? 240  LYS G C   1 
ATOM   6705  O O   . LYS J  1 99  ? -4.389  98.495  60.668  1.00 62.50  ? 240  LYS G O   1 
ATOM   6706  C CB  . LYS J  1 99  ? -2.659  96.244  60.419  1.00 62.50  ? 240  LYS G CB  1 
ATOM   6707  C CG  . LYS J  1 99  ? -2.104  94.845  60.227  1.00 62.50  ? 240  LYS G CG  1 
ATOM   6708  C CD  . LYS J  1 99  ? -0.808  94.886  59.413  1.00 62.50  ? 240  LYS G CD  1 
ATOM   6709  C CE  . LYS J  1 99  ? -0.636  93.632  58.546  1.00 62.50  ? 240  LYS G CE  1 
ATOM   6710  N NZ  . LYS J  1 99  ? 0.520   93.748  57.594  1.00 62.50  ? 240  LYS G NZ  1 
ATOM   6711  N N   . GLY J  1 100 ? -4.329  98.245  62.894  1.00 60.92  ? 241  GLY G N   1 
ATOM   6712  C CA  . GLY J  1 100 ? -4.733  99.613  63.148  1.00 60.92  ? 241  GLY G CA  1 
ATOM   6713  C C   . GLY J  1 100 ? -6.152  99.978  62.756  1.00 60.92  ? 241  GLY G C   1 
ATOM   6714  O O   . GLY J  1 100 ? -6.475  101.165 62.637  1.00 60.92  ? 241  GLY G O   1 
ATOM   6715  N N   . ILE J  1 101 ? -7.010  98.979  62.569  1.00 38.71  ? 242  ILE G N   1 
ATOM   6716  C CA  . ILE J  1 101 ? -8.388  99.242  62.176  1.00 38.71  ? 242  ILE G CA  1 
ATOM   6717  C C   . ILE J  1 101 ? -9.385  98.231  62.709  1.00 38.71  ? 242  ILE G C   1 
ATOM   6718  O O   . ILE J  1 101 ? -9.092  97.043  62.779  1.00 38.71  ? 242  ILE G O   1 
ATOM   6719  C CB  . ILE J  1 101 ? -8.542  99.256  60.634  1.00 38.71  ? 242  ILE G CB  1 
ATOM   6720  C CG1 . ILE J  1 101 ? -8.481  97.837  60.077  1.00 38.71  ? 242  ILE G CG1 1 
ATOM   6721  C CG2 . ILE J  1 101 ? -7.423  100.046 60.003  1.00 38.71  ? 242  ILE G CG2 1 
ATOM   6722  C CD1 . ILE J  1 101 ? -9.816  97.175  59.940  1.00 38.71  ? 242  ILE G CD1 1 
ATOM   6723  N N   . ILE J  1 102 ? -10.567 98.704  63.087  1.00 42.15  ? 243  ILE G N   1 
ATOM   6724  C CA  . ILE J  1 102 ? -11.602 97.799  63.548  1.00 42.15  ? 243  ILE G CA  1 
ATOM   6725  C C   . ILE J  1 102 ? -12.565 97.699  62.376  1.00 42.15  ? 243  ILE G C   1 
ATOM   6726  O O   . ILE J  1 102 ? -12.558 98.563  61.474  1.00 42.15  ? 243  ILE G O   1 
ATOM   6727  C CB  . ILE J  1 102 ? -12.363 98.319  64.774  1.00 42.15  ? 243  ILE G CB  1 
ATOM   6728  C CG1 . ILE J  1 102 ? -12.774 99.759  64.538  1.00 42.15  ? 243  ILE G CG1 1 
ATOM   6729  C CG2 . ILE J  1 102 ? -11.518 98.177  66.027  1.00 42.15  ? 243  ILE G CG2 1 
ATOM   6730  C CD1 . ILE J  1 102 ? -14.232 99.909  64.245  1.00 42.15  ? 243  ILE G CD1 1 
ATOM   6731  N N   . TYR J  1 103 ? -13.383 96.650  62.393  1.00 38.02  ? 244  TYR G N   1 
ATOM   6732  C CA  . TYR J  1 103 ? -14.334 96.385  61.329  1.00 38.02  ? 244  TYR G CA  1 
ATOM   6733  C C   . TYR J  1 103 ? -15.740 96.769  61.679  1.00 38.02  ? 244  TYR G C   1 
ATOM   6734  O O   . TYR J  1 103 ? -16.199 96.526  62.800  1.00 38.02  ? 244  TYR G O   1 
ATOM   6735  C CB  . TYR J  1 103 ? -14.340 94.902  61.005  1.00 38.02  ? 244  TYR G CB  1 
ATOM   6736  C CG  . TYR J  1 103 ? -13.350 94.521  59.960  1.00 38.02  ? 244  TYR G CG  1 
ATOM   6737  C CD1 . TYR J  1 103 ? -12.273 93.698  60.266  1.00 38.02  ? 244  TYR G CD1 1 
ATOM   6738  C CD2 . TYR J  1 103 ? -13.473 95.010  58.661  1.00 38.02  ? 244  TYR G CD2 1 
ATOM   6739  C CE1 . TYR J  1 103 ? -11.338 93.377  59.303  1.00 38.02  ? 244  TYR G CE1 1 
ATOM   6740  C CE2 . TYR J  1 103 ? -12.542 94.696  57.689  1.00 38.02  ? 244  TYR G CE2 1 
ATOM   6741  C CZ  . TYR J  1 103 ? -11.481 93.884  58.019  1.00 38.02  ? 244  TYR G CZ  1 
ATOM   6742  O OH  . TYR J  1 103 ? -10.549 93.605  57.061  1.00 38.02  ? 244  TYR G OH  1 
ATOM   6743  N N   . GLY J  1 104 ? -16.428 97.354  60.708  1.00 46.42  ? 245  GLY G N   1 
ATOM   6744  C CA  . GLY J  1 104 ? -17.813 97.708  60.926  1.00 46.42  ? 245  GLY G CA  1 
ATOM   6745  C C   . GLY J  1 104 ? -18.521 96.384  60.742  1.00 46.42  ? 245  GLY G C   1 
ATOM   6746  O O   . GLY J  1 104 ? -17.895 95.425  60.283  1.00 46.42  ? 245  GLY G O   1 
ATOM   6747  N N   . THR J  1 105 ? -19.799 96.307  61.097  1.00 73.38  ? 246  THR G N   1 
ATOM   6748  C CA  . THR J  1 105 ? -20.530 95.055  60.942  1.00 73.38  ? 246  THR G CA  1 
ATOM   6749  C C   . THR J  1 105 ? -20.776 94.789  59.465  1.00 73.38  ? 246  THR G C   1 
ATOM   6750  O O   . THR J  1 105 ? -21.226 93.712  59.083  1.00 73.38  ? 246  THR G O   1 
ATOM   6751  C CB  . THR J  1 105 ? -21.881 95.079  61.700  1.00 73.38  ? 246  THR G CB  1 
ATOM   6752  O OG1 . THR J  1 105 ? -22.100 93.803  62.311  1.00 73.38  ? 246  THR G OG1 1 
ATOM   6753  C CG2 . THR J  1 105 ? -23.033 95.396  60.754  1.00 73.38  ? 246  THR G CG2 1 
ATOM   6754  N N   . ASP J  1 106 ? -20.458 95.780  58.643  1.00 66.76  ? 247  ASP G N   1 
ATOM   6755  C CA  . ASP J  1 106 ? -20.642 95.684  57.201  1.00 66.76  ? 247  ASP G CA  1 
ATOM   6756  C C   . ASP J  1 106 ? -19.357 95.261  56.503  1.00 66.76  ? 247  ASP G C   1 
ATOM   6757  O O   . ASP J  1 106 ? -19.316 95.157  55.279  1.00 66.76  ? 247  ASP G O   1 
ATOM   6758  C CB  . ASP J  1 106 ? -21.096 97.034  56.641  1.00 66.76  ? 247  ASP G CB  1 
ATOM   6759  C CG  . ASP J  1 106 ? -20.342 98.205  57.261  1.00 66.76  ? 247  ASP G CG  1 
ATOM   6760  O OD1 . ASP J  1 106 ? -19.449 97.960  58.109  1.00 66.76  ? 247  ASP G OD1 1 
ATOM   6761  O OD2 . ASP J  1 106 ? -20.642 99.369  56.901  1.00 66.76  ? 247  ASP G OD2 1 
ATOM   6762  N N   . GLY J  1 107 ? -18.305 95.023  57.275  1.00 62.08  ? 248  GLY G N   1 
ATOM   6763  C CA  . GLY J  1 107 ? -17.048 94.616  56.670  1.00 62.08  ? 248  GLY G CA  1 
ATOM   6764  C C   . GLY J  1 107 ? -16.188 95.804  56.280  1.00 62.08  ? 248  GLY G C   1 
ATOM   6765  O O   . GLY J  1 107 ? -15.105 95.649  55.702  1.00 62.08  ? 248  GLY G O   1 
ATOM   6766  N N   . GLN J  1 108 ? -16.676 96.998  56.602  1.00 77.04  ? 254  GLN G N   1 
ATOM   6767  C CA  . GLN J  1 108 ? -15.960 98.225  56.301  1.00 77.04  ? 254  GLN G CA  1 
ATOM   6768  C C   . GLN J  1 108 ? -14.885 98.460  57.352  1.00 77.04  ? 254  GLN G C   1 
ATOM   6769  O O   . GLN J  1 108 ? -14.961 97.939  58.477  1.00 77.04  ? 254  GLN G O   1 
ATOM   6770  C CB  . GLN J  1 108 ? -16.930 99.398  56.260  1.00 77.04  ? 254  GLN G CB  1 
ATOM   6771  C CG  . GLN J  1 108 ? -17.800 99.411  55.020  1.00 77.04  ? 254  GLN G CG  1 
ATOM   6772  C CD  . GLN J  1 108 ? -16.978 99.410  53.752  1.00 77.04  ? 254  GLN G CD  1 
ATOM   6773  O OE1 . GLN J  1 108 ? -15.855 99.919  53.732  1.00 77.04  ? 254  GLN G OE1 1 
ATOM   6774  N NE2 . GLN J  1 108 ? -17.528 98.836  52.683  1.00 77.04  ? 254  GLN G NE2 1 
ATOM   6775  N N   . GLU J  1 109 ? -13.888 99.255  56.981  1.00 71.39  ? 255  GLU G N   1 
ATOM   6776  C CA  . GLU J  1 109 ? -12.773 99.527  57.866  1.00 71.39  ? 255  GLU G CA  1 
ATOM   6777  C C   . GLU J  1 109 ? -12.808 100.874 58.565  1.00 71.39  ? 255  GLU G C   1 
ATOM   6778  O O   . GLU J  1 109 ? -13.128 101.889 57.952  1.00 71.39  ? 255  GLU G O   1 
ATOM   6779  C CB  . GLU J  1 109 ? -11.477 99.398  57.075  1.00 71.39  ? 255  GLU G CB  1 
ATOM   6780  C CG  . GLU J  1 109 ? -11.371 98.102  56.309  1.00 71.39  ? 255  GLU G CG  1 
ATOM   6781  C CD  . GLU J  1 109 ? -9.950  97.797  55.898  1.00 71.39  ? 255  GLU G CD  1 
ATOM   6782  O OE1 . GLU J  1 109 ? -9.088  98.703  56.016  1.00 71.39  ? 255  GLU G OE1 1 
ATOM   6783  O OE2 . GLU J  1 109 ? -9.697  96.653  55.458  1.00 71.39  ? 255  GLU G OE2 1 
ATOM   6784  N N   . ALA J  1 110 ? -12.467 100.870 59.853  1.00 50.42  ? 256  ALA G N   1 
ATOM   6785  C CA  . ALA J  1 110 ? -12.429 102.094 60.640  1.00 50.42  ? 256  ALA G CA  1 
ATOM   6786  C C   . ALA J  1 110 ? -11.082 102.216 61.348  1.00 50.42  ? 256  ALA G C   1 
ATOM   6787  O O   . ALA J  1 110 ? -10.823 101.507 62.318  1.00 50.42  ? 256  ALA G O   1 
ATOM   6788  C CB  . ALA J  1 110 ? -13.546 102.089 61.662  1.00 50.42  ? 256  ALA G CB  1 
ATOM   6789  N N   . PRO J  1 111 ? -10.196 103.103 60.865  1.00 32.50  ? 257  PRO G N   1 
ATOM   6790  C CA  . PRO J  1 111 ? -8.891  103.258 61.513  1.00 32.50  ? 257  PRO G CA  1 
ATOM   6791  C C   . PRO J  1 111 ? -9.082  103.700 62.942  1.00 32.50  ? 257  PRO G C   1 
ATOM   6792  O O   . PRO J  1 111 ? -9.709  104.719 63.206  1.00 32.50  ? 257  PRO G O   1 
ATOM   6793  C CB  . PRO J  1 111 ? -8.199  104.326 60.677  1.00 32.50  ? 257  PRO G CB  1 
ATOM   6794  C CG  . PRO J  1 111 ? -8.880  104.243 59.352  1.00 32.50  ? 257  PRO G CG  1 
ATOM   6795  C CD  . PRO J  1 111 ? -10.320 103.983 59.696  1.00 32.50  ? 257  PRO G CD  1 
ATOM   6796  N N   . ILE J  1 112 ? -8.552  102.925 63.872  1.00 36.35  ? 258  ILE G N   1 
ATOM   6797  C CA  . ILE J  1 112 ? -8.698  103.261 65.274  1.00 36.35  ? 258  ILE G CA  1 
ATOM   6798  C C   . ILE J  1 112 ? -8.361  104.722 65.485  1.00 36.35  ? 258  ILE G C   1 
ATOM   6799  O O   . ILE J  1 112 ? -9.044  105.421 66.219  1.00 36.35  ? 258  ILE G O   1 
ATOM   6800  C CB  . ILE J  1 112 ? -7.791  102.396 66.121  1.00 36.35  ? 258  ILE G CB  1 
ATOM   6801  C CG1 . ILE J  1 112 ? -8.065  100.934 65.787  1.00 36.35  ? 258  ILE G CG1 1 
ATOM   6802  C CG2 . ILE J  1 112 ? -8.012  102.682 67.589  1.00 36.35  ? 258  ILE G CG2 1 
ATOM   6803  C CD1 . ILE J  1 112 ? -7.336  99.962  66.679  1.00 36.35  ? 258  ILE G CD1 1 
ATOM   6804  N N   . TYR J  1 113 ? -7.311  105.184 64.821  1.00 46.37  ? 259  TYR G N   1 
ATOM   6805  C CA  . TYR J  1 113 ? -6.909  106.567 64.941  1.00 46.37  ? 259  TYR G CA  1 
ATOM   6806  C C   . TYR J  1 113 ? -8.071  107.481 64.577  1.00 46.37  ? 259  TYR G C   1 
ATOM   6807  O O   . TYR J  1 113 ? -8.326  108.464 65.261  1.00 46.37  ? 259  TYR G O   1 
ATOM   6808  C CB  . TYR J  1 113 ? -5.738  106.847 64.017  1.00 46.37  ? 259  TYR G CB  1 
ATOM   6809  C CG  . TYR J  1 113 ? -5.330  108.291 64.027  1.00 46.37  ? 259  TYR G CG  1 
ATOM   6810  C CD1 . TYR J  1 113 ? -4.654  108.829 65.123  1.00 46.37  ? 259  TYR G CD1 1 
ATOM   6811  C CD2 . TYR J  1 113 ? -5.633  109.134 62.954  1.00 46.37  ? 259  TYR G CD2 1 
ATOM   6812  C CE1 . TYR J  1 113 ? -4.288  110.180 65.158  1.00 46.37  ? 259  TYR G CE1 1 
ATOM   6813  C CE2 . TYR J  1 113 ? -5.270  110.495 62.978  1.00 46.37  ? 259  TYR G CE2 1 
ATOM   6814  C CZ  . TYR J  1 113 ? -4.599  111.010 64.088  1.00 46.37  ? 259  TYR G CZ  1 
ATOM   6815  O OH  . TYR J  1 113 ? -4.263  112.350 64.144  1.00 46.37  ? 259  TYR G OH  1 
ATOM   6816  N N   . GLU J  1 114 ? -8.758  107.153 63.487  1.00 52.66  ? 260  GLU G N   1 
ATOM   6817  C CA  . GLU J  1 114 ? -9.898  107.930 63.017  1.00 52.66  ? 260  GLU G CA  1 
ATOM   6818  C C   . GLU J  1 114 ? -10.908 108.106 64.121  1.00 52.66  ? 260  GLU G C   1 
ATOM   6819  O O   . GLU J  1 114 ? -11.495 109.169 64.285  1.00 52.66  ? 260  GLU G O   1 
ATOM   6820  C CB  . GLU J  1 114 ? -10.584 107.213 61.865  1.00 52.66  ? 260  GLU G CB  1 
ATOM   6821  C CG  . GLU J  1 114 ? -9.843  107.293 60.574  1.00 52.66  ? 260  GLU G CG  1 
ATOM   6822  C CD  . GLU J  1 114 ? -9.834  108.696 60.027  1.00 52.66  ? 260  GLU G CD  1 
ATOM   6823  O OE1 . GLU J  1 114 ? -9.617  109.633 60.832  1.00 52.66  ? 260  GLU G OE1 1 
ATOM   6824  O OE2 . GLU J  1 114 ? -10.040 108.863 58.800  1.00 52.66  ? 260  GLU G OE2 1 
ATOM   6825  N N   . LEU J  1 115 ? -11.121 107.036 64.867  1.00 33.44  ? 261  LEU G N   1 
ATOM   6826  C CA  . LEU J  1 115 ? -12.071 107.057 65.955  1.00 33.44  ? 261  LEU G CA  1 
ATOM   6827  C C   . LEU J  1 115 ? -11.588 107.952 67.088  1.00 33.44  ? 261  LEU G C   1 
ATOM   6828  O O   . LEU J  1 115 ? -12.152 109.016 67.335  1.00 33.44  ? 261  LEU G O   1 
ATOM   6829  C CB  . LEU J  1 115 ? -12.297 105.633 66.456  1.00 33.44  ? 261  LEU G CB  1 
ATOM   6830  C CG  . LEU J  1 115 ? -12.519 104.600 65.342  1.00 33.44  ? 261  LEU G CG  1 
ATOM   6831  C CD1 . LEU J  1 115 ? -13.009 103.311 65.980  1.00 33.44  ? 261  LEU G CD1 1 
ATOM   6832  C CD2 . LEU J  1 115 ? -13.537 105.106 64.310  1.00 33.44  ? 261  LEU G CD2 1 
ATOM   6833  N N   . THR J  1 116 ? -10.536 107.531 67.776  1.00 38.61  ? 262  THR G N   1 
ATOM   6834  C CA  . THR J  1 116 ? -10.006 108.308 68.882  1.00 38.61  ? 262  THR G CA  1 
ATOM   6835  C C   . THR J  1 116 ? -9.878  109.785 68.573  1.00 38.61  ? 262  THR G C   1 
ATOM   6836  O O   . THR J  1 116 ? -10.279 110.622 69.379  1.00 38.61  ? 262  THR G O   1 
ATOM   6837  C CB  . THR J  1 116 ? -8.646  107.810 69.287  1.00 38.61  ? 262  THR G CB  1 
ATOM   6838  O OG1 . THR J  1 116 ? -7.869  107.576 68.106  1.00 38.61  ? 262  THR G OG1 1 
ATOM   6839  C CG2 . THR J  1 116 ? -8.788  106.532 70.103  1.00 38.61  ? 262  THR G CG2 1 
ATOM   6840  N N   . SER J  1 117 ? -9.336  110.109 67.406  1.00 40.43  ? 263  SER G N   1 
ATOM   6841  C CA  . SER J  1 117 ? -9.143  111.509 67.029  1.00 40.43  ? 263  SER G CA  1 
ATOM   6842  C C   . SER J  1 117 ? -10.415 112.352 67.031  1.00 40.43  ? 263  SER G C   1 
ATOM   6843  O O   . SER J  1 117 ? -10.351 113.582 67.024  1.00 40.43  ? 263  SER G O   1 
ATOM   6844  C CB  . SER J  1 117 ? -8.477  111.601 65.650  1.00 40.43  ? 263  SER G CB  1 
ATOM   6845  O OG  . SER J  1 117 ? -9.349  111.183 64.611  1.00 40.43  ? 263  SER G OG  1 
ATOM   6846  N N   . GLN J  1 118 ? -11.568 111.691 67.046  1.00 54.60  ? 264  GLN G N   1 
ATOM   6847  C CA  . GLN J  1 118 ? -12.848 112.386 67.021  1.00 54.60  ? 264  GLN G CA  1 
ATOM   6848  C C   . GLN J  1 118 ? -13.021 113.226 68.255  1.00 54.60  ? 264  GLN G C   1 
ATOM   6849  O O   . GLN J  1 118 ? -13.781 114.194 68.251  1.00 54.60  ? 264  GLN G O   1 
ATOM   6850  C CB  . GLN J  1 118 ? -13.999 111.378 66.940  1.00 54.60  ? 264  GLN G CB  1 
ATOM   6851  C CG  . GLN J  1 118 ? -14.244 110.808 65.543  1.00 54.60  ? 264  GLN G CG  1 
ATOM   6852  C CD  . GLN J  1 118 ? -14.045 111.848 64.460  1.00 54.60  ? 264  GLN G CD  1 
ATOM   6853  O OE1 . GLN J  1 118 ? -13.233 111.674 63.542  1.00 54.60  ? 264  GLN G OE1 1 
ATOM   6854  N NE2 . GLN J  1 118 ? -14.781 112.950 64.568  1.00 54.60  ? 264  GLN G NE2 1 
ATOM   6855  N N   . PHE J  1 119 ? -12.289 112.869 69.306  1.00 38.42  ? 265  PHE G N   1 
ATOM   6856  C CA  . PHE J  1 119 ? -12.421 113.569 70.582  1.00 38.42  ? 265  PHE G CA  1 
ATOM   6857  C C   . PHE J  1 119 ? -11.235 114.381 71.106  1.00 38.42  ? 265  PHE G C   1 
ATOM   6858  O O   . PHE J  1 119 ? -11.016 114.478 72.319  1.00 38.42  ? 265  PHE G O   1 
ATOM   6859  C CB  . PHE J  1 119 ? -12.876 112.560 71.638  1.00 38.42  ? 265  PHE G CB  1 
ATOM   6860  C CG  . PHE J  1 119 ? -14.106 111.797 71.237  1.00 38.42  ? 265  PHE G CG  1 
ATOM   6861  C CD1 . PHE J  1 119 ? -14.014 110.728 70.345  1.00 38.42  ? 265  PHE G CD1 1 
ATOM   6862  C CD2 . PHE J  1 119 ? -15.359 112.145 71.746  1.00 38.42  ? 265  PHE G CD2 1 
ATOM   6863  C CE1 . PHE J  1 119 ? -15.153 110.014 69.967  1.00 38.42  ? 265  PHE G CE1 1 
ATOM   6864  C CE2 . PHE J  1 119 ? -16.502 111.443 71.377  1.00 38.42  ? 265  PHE G CE2 1 
ATOM   6865  C CZ  . PHE J  1 119 ? -16.401 110.374 70.488  1.00 38.42  ? 265  PHE G CZ  1 
ATOM   6866  N N   . THR J  1 120 ? -10.482 114.986 70.201  1.00 41.80  ? 266  THR G N   1 
ATOM   6867  C CA  . THR J  1 120 ? -9.348  115.791 70.620  1.00 41.80  ? 266  THR G CA  1 
ATOM   6868  C C   . THR J  1 120 ? -9.846  116.986 71.449  1.00 41.80  ? 266  THR G C   1 
ATOM   6869  O O   . THR J  1 120 ? -10.908 116.930 72.071  1.00 41.80  ? 266  THR G O   1 
ATOM   6870  C CB  . THR J  1 120 ? -8.582  116.297 69.409  1.00 41.80  ? 266  THR G CB  1 
ATOM   6871  O OG1 . THR J  1 120 ? -9.363  117.292 68.737  1.00 41.80  ? 266  THR G OG1 1 
ATOM   6872  C CG2 . THR J  1 120 ? -8.289  115.150 68.464  1.00 41.80  ? 266  THR G CG2 1 
ATOM   6873  N N   . GLY J  1 121 ? -9.076  118.060 71.481  1.00 40.54  ? 267  GLY G N   1 
ATOM   6874  C CA  . GLY J  1 121 ? -9.506  119.216 72.242  1.00 40.54  ? 267  GLY G CA  1 
ATOM   6875  C C   . GLY J  1 121 ? -10.282 120.134 71.320  1.00 40.54  ? 267  GLY G C   1 
ATOM   6876  O O   . GLY J  1 121 ? -11.341 120.659 71.682  1.00 40.54  ? 267  GLY G O   1 
ATOM   6877  N N   . LEU J  1 122 ? -9.749  120.321 70.116  1.00 44.45  ? 268  LEU G N   1 
ATOM   6878  C CA  . LEU J  1 122 ? -10.380 121.170 69.129  1.00 44.45  ? 268  LEU G CA  1 
ATOM   6879  C C   . LEU J  1 122 ? -11.707 120.539 68.768  1.00 44.45  ? 268  LEU G C   1 
ATOM   6880  O O   . LEU J  1 122 ? -12.740 121.205 68.784  1.00 44.45  ? 268  LEU G O   1 
ATOM   6881  C CB  . LEU J  1 122 ? -9.496  121.278 67.894  1.00 44.45  ? 268  LEU G CB  1 
ATOM   6882  C CG  . LEU J  1 122 ? -8.130  121.919 68.127  1.00 44.45  ? 268  LEU G CG  1 
ATOM   6883  C CD1 . LEU J  1 122 ? -7.562  122.358 66.794  1.00 44.45  ? 268  LEU G CD1 1 
ATOM   6884  C CD2 . LEU J  1 122 ? -8.256  123.112 69.076  1.00 44.45  ? 268  LEU G CD2 1 
ATOM   6885  N N   . LYS J  1 123 ? -11.681 119.241 68.472  1.00 48.99  ? 269  LYS G N   1 
ATOM   6886  C CA  . LYS J  1 123 ? -12.891 118.513 68.113  1.00 48.99  ? 269  LYS G CA  1 
ATOM   6887  C C   . LYS J  1 123 ? -13.886 118.347 69.262  1.00 48.99  ? 269  LYS G C   1 
ATOM   6888  O O   . LYS J  1 123 ? -14.995 117.886 69.053  1.00 48.99  ? 269  LYS G O   1 
ATOM   6889  C CB  . LYS J  1 123 ? -12.526 117.134 67.577  1.00 48.99  ? 269  LYS G CB  1 
ATOM   6890  C CG  . LYS J  1 123 ? -12.078 117.141 66.131  1.00 48.99  ? 269  LYS G CG  1 
ATOM   6891  C CD  . LYS J  1 123 ? -12.939 116.202 65.264  1.00 48.99  ? 269  LYS G CD  1 
ATOM   6892  C CE  . LYS J  1 123 ? -12.620 116.332 63.749  1.00 48.99  ? 269  LYS G CE  1 
ATOM   6893  N NZ  . LYS J  1 123 ? -13.294 115.300 62.858  1.00 48.99  ? 269  LYS G NZ  1 
ATOM   6894  N N   . CYS J  1 124 ? -13.515 118.722 70.474  1.00 29.95  ? 270  CYS G N   1 
ATOM   6895  C CA  . CYS J  1 124 ? -14.438 118.539 71.564  1.00 29.95  ? 270  CYS G CA  1 
ATOM   6896  C C   . CYS J  1 124 ? -14.034 119.256 72.843  1.00 29.95  ? 270  CYS G C   1 
ATOM   6897  O O   . CYS J  1 124 ? -13.724 118.631 73.861  1.00 29.95  ? 270  CYS G O   1 
ATOM   6898  C CB  . CYS J  1 124 ? -14.609 117.054 71.828  1.00 29.95  ? 270  CYS G CB  1 
ATOM   6899  S SG  . CYS J  1 124 ? -15.785 116.709 73.123  1.00 29.95  ? 270  CYS G SG  1 
ATOM   6900  N N   . PRO J  1 125 ? -14.012 120.593 72.795  1.00 21.28  ? 271  PRO G N   1 
ATOM   6901  C CA  . PRO J  1 125 ? -13.660 121.441 73.929  1.00 21.28  ? 271  PRO G CA  1 
ATOM   6902  C C   . PRO J  1 125 ? -14.316 120.997 75.219  1.00 21.28  ? 271  PRO G C   1 
ATOM   6903  O O   . PRO J  1 125 ? -13.671 121.003 76.263  1.00 21.28  ? 271  PRO G O   1 
ATOM   6904  C CB  . PRO J  1 125 ? -14.151 122.804 73.510  1.00 21.28  ? 271  PRO G CB  1 
ATOM   6905  C CG  . PRO J  1 125 ? -13.992 122.782 72.010  1.00 21.28  ? 271  PRO G CG  1 
ATOM   6906  C CD  . PRO J  1 125 ? -14.286 121.384 71.580  1.00 21.28  ? 271  PRO G CD  1 
ATOM   6907  N N   . SER J  1 126 ? -15.590 120.609 75.165  1.00 34.78  ? 272  SER G N   1 
ATOM   6908  C CA  . SER J  1 126 ? -16.295 120.183 76.377  1.00 34.78  ? 272  SER G CA  1 
ATOM   6909  C C   . SER J  1 126 ? -15.505 119.131 77.144  1.00 34.78  ? 272  SER G C   1 
ATOM   6910  O O   . SER J  1 126 ? -15.747 118.924 78.330  1.00 34.78  ? 272  SER G O   1 
ATOM   6911  C CB  . SER J  1 126 ? -17.682 119.639 76.025  1.00 34.78  ? 272  SER G CB  1 
ATOM   6912  O OG  . SER J  1 126 ? -17.960 119.848 74.643  1.00 34.78  ? 272  SER G OG  1 
ATOM   6913  N N   . LEU J  1 127 ? -14.553 118.480 76.472  1.00 43.82  ? 273  LEU G N   1 
ATOM   6914  C CA  . LEU J  1 127 ? -13.733 117.435 77.099  1.00 43.82  ? 273  LEU G CA  1 
ATOM   6915  C C   . LEU J  1 127 ? -12.263 117.783 77.290  1.00 43.82  ? 273  LEU G C   1 
ATOM   6916  O O   . LEU J  1 127 ? -11.489 116.962 77.771  1.00 43.82  ? 273  LEU G O   1 
ATOM   6917  C CB  . LEU J  1 127 ? -13.814 116.144 76.292  1.00 43.82  ? 273  LEU G CB  1 
ATOM   6918  C CG  . LEU J  1 127 ? -14.987 115.242 76.651  1.00 43.82  ? 273  LEU G CG  1 
ATOM   6919  C CD1 . LEU J  1 127 ? -15.150 114.212 75.550  1.00 43.82  ? 273  LEU G CD1 1 
ATOM   6920  C CD2 . LEU J  1 127 ? -14.761 114.583 78.003  1.00 43.82  ? 273  LEU G CD2 1 
ATOM   6921  N N   . ALA J  1 128 ? -11.875 118.987 76.895  1.00 37.41  ? 274  ALA G N   1 
ATOM   6922  C CA  . ALA J  1 128 ? -10.497 119.430 77.055  1.00 37.41  ? 274  ALA G CA  1 
ATOM   6923  C C   . ALA J  1 128 ? -10.018 119.163 78.487  1.00 37.41  ? 274  ALA G C   1 
ATOM   6924  O O   . ALA J  1 128 ? -10.771 119.326 79.437  1.00 37.41  ? 274  ALA G O   1 
ATOM   6925  C CB  . ALA J  1 128 ? -10.394 120.903 76.743  1.00 37.41  ? 274  ALA G CB  1 
ATOM   6926  N N   . GLY J  1 129 ? -8.774  118.725 78.640  1.00 56.49  ? 275  GLY G N   1 
ATOM   6927  C CA  . GLY J  1 129 ? -8.258  118.461 79.969  1.00 56.49  ? 275  GLY G CA  1 
ATOM   6928  C C   . GLY J  1 129 ? -8.919  117.311 80.708  1.00 56.49  ? 275  GLY G C   1 
ATOM   6929  O O   . GLY J  1 129 ? -8.640  117.089 81.888  1.00 56.49  ? 275  GLY G O   1 
ATOM   6930  N N   . LYS J  1 130 ? -9.784  116.563 80.030  1.00 37.72  ? 276  LYS G N   1 
ATOM   6931  C CA  . LYS J  1 130 ? -10.466 115.443 80.681  1.00 37.72  ? 276  LYS G CA  1 
ATOM   6932  C C   . LYS J  1 130 ? -10.093 114.108 80.063  1.00 37.72  ? 276  LYS G C   1 
ATOM   6933  O O   . LYS J  1 130 ? -9.938  113.992 78.845  1.00 37.72  ? 276  LYS G O   1 
ATOM   6934  C CB  . LYS J  1 130 ? -11.992 115.626 80.622  1.00 37.72  ? 276  LYS G CB  1 
ATOM   6935  C CG  . LYS J  1 130 ? -12.490 117.023 81.018  1.00 37.72  ? 276  LYS G CG  1 
ATOM   6936  C CD  . LYS J  1 130 ? -14.007 117.180 80.791  1.00 37.72  ? 276  LYS G CD  1 
ATOM   6937  C CE  . LYS J  1 130 ? -14.671 118.089 81.842  1.00 37.72  ? 276  LYS G CE  1 
ATOM   6938  N NZ  . LYS J  1 130 ? -15.533 119.154 81.237  1.00 37.72  ? 276  LYS G NZ  1 
ATOM   6939  N N   . PRO J  1 131 ? -9.959  113.071 80.900  1.00 33.46  ? 277  PRO G N   1 
ATOM   6940  C CA  . PRO J  1 131 ? -9.597  111.728 80.435  1.00 33.46  ? 277  PRO G CA  1 
ATOM   6941  C C   . PRO J  1 131 ? -10.524 111.179 79.384  1.00 33.46  ? 277  PRO G C   1 
ATOM   6942  O O   . PRO J  1 131 ? -11.738 111.197 79.552  1.00 33.46  ? 277  PRO G O   1 
ATOM   6943  C CB  . PRO J  1 131 ? -9.640  110.865 81.700  1.00 33.46  ? 277  PRO G CB  1 
ATOM   6944  C CG  . PRO J  1 131 ? -10.389 111.660 82.696  1.00 33.46  ? 277  PRO G CG  1 
ATOM   6945  C CD  . PRO J  1 131 ? -10.134 113.110 82.359  1.00 33.46  ? 277  PRO G CD  1 
ATOM   6946  N N   . LYS J  1 132 ? -9.950  110.688 78.299  1.00 32.11  ? 278  LYS G N   1 
ATOM   6947  C CA  . LYS J  1 132 ? -10.741 110.089 77.238  1.00 32.11  ? 278  LYS G CA  1 
ATOM   6948  C C   . LYS J  1 132 ? -10.179 108.675 77.057  1.00 32.11  ? 278  LYS G C   1 
ATOM   6949  O O   . LYS J  1 132 ? -9.095  108.482 76.505  1.00 32.11  ? 278  LYS G O   1 
ATOM   6950  C CB  . LYS J  1 132 ? -10.614 110.901 75.948  1.00 32.11  ? 278  LYS G CB  1 
ATOM   6951  C CG  . LYS J  1 132 ? -10.626 112.394 76.179  1.00 32.11  ? 278  LYS G CG  1 
ATOM   6952  C CD  . LYS J  1 132 ? -10.550 113.153 74.860  1.00 32.11  ? 278  LYS G CD  1 
ATOM   6953  C CE  . LYS J  1 132 ? -9.873  114.533 75.000  1.00 32.11  ? 278  LYS G CE  1 
ATOM   6954  N NZ  . LYS J  1 132 ? -9.747  115.010 76.412  1.00 32.11  ? 278  LYS G NZ  1 
ATOM   6955  N N   . VAL J  1 133 ? -10.921 107.689 77.537  1.00 42.29  ? 279  VAL G N   1 
ATOM   6956  C CA  . VAL J  1 133 ? -10.492 106.311 77.446  1.00 42.29  ? 279  VAL G CA  1 
ATOM   6957  C C   . VAL J  1 133 ? -11.115 105.543 76.295  1.00 42.29  ? 279  VAL G C   1 
ATOM   6958  O O   . VAL J  1 133 ? -12.270 105.754 75.966  1.00 42.29  ? 279  VAL G O   1 
ATOM   6959  C CB  . VAL J  1 133 ? -10.825 105.597 78.736  1.00 42.29  ? 279  VAL G CB  1 
ATOM   6960  C CG1 . VAL J  1 133 ? -10.371 104.158 78.674  1.00 42.29  ? 279  VAL G CG1 1 
ATOM   6961  C CG2 . VAL J  1 133 ? -10.159 106.316 79.880  1.00 42.29  ? 279  VAL G CG2 1 
ATOM   6962  N N   . PHE J  1 134 ? -10.353 104.637 75.697  1.00 38.43  ? 280  PHE G N   1 
ATOM   6963  C CA  . PHE J  1 134 ? -10.848 103.819 74.602  1.00 38.43  ? 280  PHE G CA  1 
ATOM   6964  C C   . PHE J  1 134 ? -10.397 102.406 74.802  1.00 38.43  ? 280  PHE G C   1 
ATOM   6965  O O   . PHE J  1 134 ? -9.208  102.159 74.948  1.00 38.43  ? 280  PHE G O   1 
ATOM   6966  C CB  . PHE J  1 134 ? -10.269 104.284 73.285  1.00 38.43  ? 280  PHE G CB  1 
ATOM   6967  C CG  . PHE J  1 134 ? -10.938 105.471 72.737  1.00 38.43  ? 280  PHE G CG  1 
ATOM   6968  C CD1 . PHE J  1 134 ? -10.693 106.722 73.273  1.00 38.43  ? 280  PHE G CD1 1 
ATOM   6969  C CD2 . PHE J  1 134 ? -11.835 105.345 71.680  1.00 38.43  ? 280  PHE G CD2 1 
ATOM   6970  C CE1 . PHE J  1 134 ? -11.338 107.846 72.756  1.00 38.43  ? 280  PHE G CE1 1 
ATOM   6971  C CE2 . PHE J  1 134 ? -12.491 106.459 71.148  1.00 38.43  ? 280  PHE G CE2 1 
ATOM   6972  C CZ  . PHE J  1 134 ? -12.243 107.710 71.685  1.00 38.43  ? 280  PHE G CZ  1 
ATOM   6973  N N   . PHE J  1 135 ? -11.319 101.465 74.800  1.00 24.88  ? 281  PHE G N   1 
ATOM   6974  C CA  . PHE J  1 135 ? -10.907 100.083 74.947  1.00 24.88  ? 281  PHE G CA  1 
ATOM   6975  C C   . PHE J  1 135 ? -11.303 99.363  73.688  1.00 24.88  ? 281  PHE G C   1 
ATOM   6976  O O   . PHE J  1 135 ? -12.488 99.204  73.406  1.00 24.88  ? 281  PHE G O   1 
ATOM   6977  C CB  . PHE J  1 135 ? -11.579 99.444  76.141  1.00 24.88  ? 281  PHE G CB  1 
ATOM   6978  C CG  . PHE J  1 135 ? -11.108 99.986  77.427  1.00 24.88  ? 281  PHE G CG  1 
ATOM   6979  C CD1 . PHE J  1 135 ? -12.000 100.464 78.360  1.00 24.88  ? 281  PHE G CD1 1 
ATOM   6980  C CD2 . PHE J  1 135 ? -9.758  100.037 77.705  1.00 24.88  ? 281  PHE G CD2 1 
ATOM   6981  C CE1 . PHE J  1 135 ? -11.550 100.997 79.578  1.00 24.88  ? 281  PHE G CE1 1 
ATOM   6982  C CE2 . PHE J  1 135 ? -9.287  100.558 78.905  1.00 24.88  ? 281  PHE G CE2 1 
ATOM   6983  C CZ  . PHE J  1 135 ? -10.188 101.042 79.849  1.00 24.88  ? 281  PHE G CZ  1 
ATOM   6984  N N   . ILE J  1 136 ? -10.321 98.955  72.900  1.00 30.18  ? 282  ILE G N   1 
ATOM   6985  C CA  . ILE J  1 136 ? -10.638 98.256  71.674  1.00 30.18  ? 282  ILE G CA  1 
ATOM   6986  C C   . ILE J  1 136 ? -10.377 96.783  71.849  1.00 30.18  ? 282  ILE G C   1 
ATOM   6987  O O   . ILE J  1 136 ? -9.322  96.384  72.311  1.00 30.18  ? 282  ILE G O   1 
ATOM   6988  C CB  . ILE J  1 136 ? -9.813  98.757  70.478  1.00 30.18  ? 282  ILE G CB  1 
ATOM   6989  C CG1 . ILE J  1 136 ? -10.307 100.134 70.060  1.00 30.18  ? 282  ILE G CG1 1 
ATOM   6990  C CG2 . ILE J  1 136 ? -9.978  97.802  69.302  1.00 30.18  ? 282  ILE G CG2 1 
ATOM   6991  C CD1 . ILE J  1 136 ? -10.144 101.151 71.138  1.00 30.18  ? 282  ILE G CD1 1 
ATOM   6992  N N   . GLN J  1 137 ? -11.354 95.976  71.475  1.00 43.99  ? 283  GLN G N   1 
ATOM   6993  C CA  . GLN J  1 137 ? -11.221 94.542  71.588  1.00 43.99  ? 283  GLN G CA  1 
ATOM   6994  C C   . GLN J  1 137 ? -11.499 93.970  70.214  1.00 43.99  ? 283  GLN G C   1 
ATOM   6995  O O   . GLN J  1 137 ? -12.621 93.600  69.887  1.00 43.99  ? 283  GLN G O   1 
ATOM   6996  C CB  . GLN J  1 137 ? -12.211 93.999  72.624  1.00 43.99  ? 283  GLN G CB  1 
ATOM   6997  C CG  . GLN J  1 137 ? -12.479 92.497  72.563  1.00 43.99  ? 283  GLN G CG  1 
ATOM   6998  C CD  . GLN J  1 137 ? -11.210 91.676  72.570  1.00 43.99  ? 283  GLN G CD  1 
ATOM   6999  O OE1 . GLN J  1 137 ? -10.740 91.227  73.624  1.00 43.99  ? 283  GLN G OE1 1 
ATOM   7000  N NE2 . GLN J  1 137 ? -10.644 91.471  71.390  1.00 43.99  ? 283  GLN G NE2 1 
ATOM   7001  N N   . ALA J  1 138 ? -10.455 93.929  69.402  1.00 51.81  ? 284  ALA G N   1 
ATOM   7002  C CA  . ALA J  1 138 ? -10.550 93.398  68.058  1.00 51.81  ? 284  ALA G CA  1 
ATOM   7003  C C   . ALA J  1 138 ? -9.245  92.697  67.747  1.00 51.81  ? 284  ALA G C   1 
ATOM   7004  O O   . ALA J  1 138 ? -8.415  92.467  68.633  1.00 51.81  ? 284  ALA G O   1 
ATOM   7005  C CB  . ALA J  1 138 ? -10.782 94.524  67.058  1.00 51.81  ? 284  ALA G CB  1 
ATOM   7006  N N   . CYS J  1 139 ? -9.071  92.351  66.483  1.00 61.27  ? 285  CYS G N   1 
ATOM   7007  C CA  . CYS J  1 139 ? -7.851  91.712  66.051  1.00 61.27  ? 285  CYS G CA  1 
ATOM   7008  C C   . CYS J  1 139 ? -7.071  92.802  65.356  1.00 61.27  ? 285  CYS G C   1 
ATOM   7009  O O   . CYS J  1 139 ? -7.662  93.784  64.902  1.00 61.27  ? 285  CYS G O   1 
ATOM   7010  C CB  . CYS J  1 139 ? -8.157  90.600  65.059  1.00 61.27  ? 285  CYS G CB  1 
ATOM   7011  S SG  . CYS J  1 139 ? -8.428  89.028  65.859  1.00 61.27  ? 285  CYS G SG  1 
ATOM   7012  N N   . GLN J  1 140 ? -5.755  92.642  65.274  1.00 47.07  ? 286  GLN G N   1 
ATOM   7013  C CA  . GLN J  1 140 ? -4.934  93.626  64.603  1.00 47.07  ? 286  GLN G CA  1 
ATOM   7014  C C   . GLN J  1 140 ? -4.115  92.956  63.505  1.00 47.07  ? 286  GLN G C   1 
ATOM   7015  O O   . GLN J  1 140 ? -3.154  93.526  62.975  1.00 47.07  ? 286  GLN G O   1 
ATOM   7016  C CB  . GLN J  1 140 ? -4.041  94.318  65.618  1.00 47.07  ? 286  GLN G CB  1 
ATOM   7017  C CG  . GLN J  1 140 ? -4.819  95.283  66.503  1.00 47.07  ? 286  GLN G CG  1 
ATOM   7018  C CD  . GLN J  1 140 ? -5.436  96.418  65.720  1.00 47.07  ? 286  GLN G CD  1 
ATOM   7019  O OE1 . GLN J  1 140 ? -6.583  96.336  65.289  1.00 47.07  ? 286  GLN G OE1 1 
ATOM   7020  N NE2 . GLN J  1 140 ? -4.673  97.486  65.526  1.00 47.07  ? 286  GLN G NE2 1 
ATOM   7021  N N   . GLY J  1 141 ? -4.533  91.748  63.149  1.00 67.84  ? 287  GLY G N   1 
ATOM   7022  C CA  . GLY J  1 141 ? -3.844  90.981  62.130  1.00 67.84  ? 287  GLY G CA  1 
ATOM   7023  C C   . GLY J  1 141 ? -4.202  89.516  62.315  1.00 67.84  ? 287  GLY G C   1 
ATOM   7024  O O   . GLY J  1 141 ? -5.065  89.198  63.142  1.00 67.84  ? 287  GLY G O   1 
ATOM   7025  N N   . ASP J  1 142 ? -3.559  88.618  61.565  1.00 77.88  ? 288  ASP G N   1 
ATOM   7026  C CA  . ASP J  1 142 ? -3.853  87.190  61.692  1.00 77.88  ? 288  ASP G CA  1 
ATOM   7027  C C   . ASP J  1 142 ? -2.691  86.342  62.220  1.00 77.88  ? 288  ASP G C   1 
ATOM   7028  O O   . ASP J  1 142 ? -2.661  85.132  62.020  1.00 77.88  ? 288  ASP G O   1 
ATOM   7029  C CB  . ASP J  1 142 ? -4.348  86.616  60.353  1.00 77.88  ? 288  ASP G CB  1 
ATOM   7030  C CG  . ASP J  1 142 ? -3.451  86.982  59.182  1.00 77.88  ? 288  ASP G CG  1 
ATOM   7031  O OD1 . ASP J  1 142 ? -2.280  87.360  59.411  1.00 77.88  ? 288  ASP G OD1 1 
ATOM   7032  O OD2 . ASP J  1 142 ? -3.920  86.887  58.025  1.00 77.88  ? 288  ASP G OD2 1 
ATOM   7033  N N   . ASN J  1 143 ? -1.744  86.979  62.901  1.00 67.34  ? 289  ASN G N   1 
ATOM   7034  C CA  . ASN J  1 143 ? -0.600  86.275  63.471  1.00 67.34  ? 289  ASN G CA  1 
ATOM   7035  C C   . ASN J  1 143 ? -0.990  85.697  64.830  1.00 67.34  ? 289  ASN G C   1 
ATOM   7036  O O   . ASN J  1 143 ? -2.069  85.981  65.345  1.00 67.34  ? 289  ASN G O   1 
ATOM   7037  C CB  . ASN J  1 143 ? 0.575   87.237  63.664  1.00 67.34  ? 289  ASN G CB  1 
ATOM   7038  C CG  . ASN J  1 143 ? 1.320   87.521  62.377  1.00 67.34  ? 289  ASN G CG  1 
ATOM   7039  O OD1 . ASN J  1 143 ? 0.773   87.382  61.274  1.00 67.34  ? 289  ASN G OD1 1 
ATOM   7040  N ND2 . ASN J  1 143 ? 2.581   87.932  62.509  1.00 67.34  ? 289  ASN G ND2 1 
ATOM   7041  N N   . TYR J  1 144 ? -0.109  84.878  65.400  1.00 65.04  ? 290  TYR G N   1 
ATOM   7042  C CA  . TYR J  1 144 ? -0.328  84.280  66.718  1.00 65.04  ? 290  TYR G CA  1 
ATOM   7043  C C   . TYR J  1 144 ? 0.879   84.627  67.574  1.00 65.04  ? 290  TYR G C   1 
ATOM   7044  O O   . TYR J  1 144 ? 2.016   84.319  67.214  1.00 65.04  ? 290  TYR G O   1 
ATOM   7045  C CB  . TYR J  1 144 ? -0.459  82.766  66.613  1.00 65.04  ? 290  TYR G CB  1 
ATOM   7046  C CG  . TYR J  1 144 ? -1.796  82.329  66.073  1.00 65.04  ? 290  TYR G CG  1 
ATOM   7047  C CD1 . TYR J  1 144 ? -2.060  82.383  64.705  1.00 65.04  ? 290  TYR G CD1 1 
ATOM   7048  C CD2 . TYR J  1 144 ? -2.811  81.895  66.929  1.00 65.04  ? 290  TYR G CD2 1 
ATOM   7049  C CE1 . TYR J  1 144 ? -3.307  82.020  64.193  1.00 65.04  ? 290  TYR G CE1 1 
ATOM   7050  C CE2 . TYR J  1 144 ? -4.066  81.526  66.430  1.00 65.04  ? 290  TYR G CE2 1 
ATOM   7051  C CZ  . TYR J  1 144 ? -4.305  81.595  65.058  1.00 65.04  ? 290  TYR G CZ  1 
ATOM   7052  O OH  . TYR J  1 144 ? -5.534  81.256  64.539  1.00 65.04  ? 290  TYR G OH  1 
ATOM   7053  N N   . GLN J  1 145 ? 0.638   85.289  68.697  1.00 59.99  ? 291  GLN G N   1 
ATOM   7054  C CA  . GLN J  1 145 ? 1.732   85.675  69.561  1.00 59.99  ? 291  GLN G CA  1 
ATOM   7055  C C   . GLN J  1 145 ? 2.412   84.432  70.065  1.00 59.99  ? 291  GLN G C   1 
ATOM   7056  O O   . GLN J  1 145 ? 1.890   83.754  70.945  1.00 59.99  ? 291  GLN G O   1 
ATOM   7057  C CB  . GLN J  1 145 ? 1.233   86.483  70.755  1.00 59.99  ? 291  GLN G CB  1 
ATOM   7058  C CG  . GLN J  1 145 ? 2.358   87.137  71.547  1.00 59.99  ? 291  GLN G CG  1 
ATOM   7059  C CD  . GLN J  1 145 ? 3.139   88.142  70.714  1.00 59.99  ? 291  GLN G CD  1 
ATOM   7060  O OE1 . GLN J  1 145 ? 2.917   88.274  69.512  1.00 59.99  ? 291  GLN G OE1 1 
ATOM   7061  N NE2 . GLN J  1 145 ? 4.052   88.861  71.353  1.00 59.99  ? 291  GLN G NE2 1 
ATOM   7062  N N   . LYS J  1 146 ? 3.571   84.120  69.503  1.00 93.33  ? 292  LYS G N   1 
ATOM   7063  C CA  . LYS J  1 146 ? 4.291   82.949  69.954  1.00 93.33  ? 292  LYS G CA  1 
ATOM   7064  C C   . LYS J  1 146 ? 4.752   83.245  71.373  1.00 93.33  ? 292  LYS G C   1 
ATOM   7065  O O   . LYS J  1 146 ? 5.090   84.379  71.694  1.00 93.33  ? 292  LYS G O   1 
ATOM   7066  C CB  . LYS J  1 146 ? 5.490   82.675  69.048  1.00 93.33  ? 292  LYS G CB  1 
ATOM   7067  C CG  . LYS J  1 146 ? 6.166   81.347  69.345  1.00 93.33  ? 292  LYS G CG  1 
ATOM   7068  C CD  . LYS J  1 146 ? 6.857   80.767  68.119  1.00 93.33  ? 292  LYS G CD  1 
ATOM   7069  C CE  . LYS J  1 146 ? 7.433   79.380  68.417  1.00 93.33  ? 292  LYS G CE  1 
ATOM   7070  N NZ  . LYS J  1 146 ? 8.634   79.071  67.580  1.00 93.33  ? 292  LYS G NZ  1 
ATOM   7071  N N   . GLY J  1 147 ? 4.739   82.233  72.230  1.00 88.24  ? 293  GLY G N   1 
ATOM   7072  C CA  . GLY J  1 147 ? 5.169   82.432  73.604  1.00 88.24  ? 293  GLY G CA  1 
ATOM   7073  C C   . GLY J  1 147 ? 6.584   81.930  73.850  1.00 88.24  ? 293  GLY G C   1 
ATOM   7074  O O   . GLY J  1 147 ? 7.102   81.105  73.095  1.00 88.24  ? 293  GLY G O   1 
ATOM   7075  N N   . ILE J  1 148 ? 7.220   82.434  74.902  1.00 67.54  ? 294  ILE G N   1 
ATOM   7076  C CA  . ILE J  1 148 ? 8.573   82.018  75.237  1.00 67.54  ? 294  ILE G CA  1 
ATOM   7077  C C   . ILE J  1 148 ? 8.619   81.646  76.722  1.00 67.54  ? 294  ILE G C   1 
ATOM   7078  O O   . ILE J  1 148 ? 7.892   82.226  77.537  1.00 67.54  ? 294  ILE G O   1 
ATOM   7079  C CB  . ILE J  1 148 ? 9.601   83.139  74.913  1.00 67.54  ? 294  ILE G CB  1 
ATOM   7080  C CG1 . ILE J  1 148 ? 9.528   84.246  75.965  1.00 67.54  ? 294  ILE G CG1 1 
ATOM   7081  C CG2 . ILE J  1 148 ? 9.366   83.664  73.492  1.00 67.54  ? 294  ILE G CG2 1 
ATOM   7082  C CD1 . ILE J  1 148 ? 8.789   85.472  75.519  1.00 67.54  ? 294  ILE G CD1 1 
ATOM   7083  N N   . PRO J  1 149 ? 9.481   80.682  77.096  1.00 63.13  ? 295  PRO G N   1 
ATOM   7084  C CA  . PRO J  1 149 ? 9.589   80.245  78.495  1.00 63.13  ? 295  PRO G CA  1 
ATOM   7085  C C   . PRO J  1 149 ? 10.386  81.177  79.403  1.00 63.13  ? 295  PRO G C   1 
ATOM   7086  O O   . PRO J  1 149 ? 11.117  82.037  78.915  1.00 63.13  ? 295  PRO G O   1 
ATOM   7087  C CB  . PRO J  1 149 ? 10.219  78.848  78.388  1.00 63.13  ? 295  PRO G CB  1 
ATOM   7088  C CG  . PRO J  1 149 ? 10.528  78.630  76.883  1.00 63.13  ? 295  PRO G CG  1 
ATOM   7089  C CD  . PRO J  1 149 ? 10.421  79.964  76.220  1.00 63.13  ? 295  PRO G CD  1 
ATOM   7090  N N   . VAL J  1 150 ? 10.234  81.011  80.719  1.00 57.15  ? 296  VAL G N   1 
ATOM   7091  C CA  . VAL J  1 150 ? 10.961  81.847  81.677  1.00 57.15  ? 296  VAL G CA  1 
ATOM   7092  C C   . VAL J  1 150 ? 10.818  81.486  83.163  1.00 57.15  ? 296  VAL G C   1 
ATOM   7093  O O   . VAL J  1 150 ? 11.809  81.228  83.865  1.00 57.15  ? 296  VAL G O   1 
ATOM   7094  C CB  . VAL J  1 150 ? 10.582  83.359  81.518  1.00 57.15  ? 296  VAL G CB  1 
ATOM   7095  C CG1 . VAL J  1 150 ? 9.085   83.552  81.670  1.00 57.15  ? 296  VAL G CG1 1 
ATOM   7096  C CG2 . VAL J  1 150 ? 11.325  84.207  82.547  1.00 57.15  ? 296  VAL G CG2 1 
ATOM   7097  N N   . GLU J  1 151 ? 9.577   81.467  83.635  1.00 100.00 ? 297  GLU G N   1 
ATOM   7098  C CA  . GLU J  1 151 ? 9.279   81.217  85.043  1.00 100.00 ? 297  GLU G CA  1 
ATOM   7099  C C   . GLU J  1 151 ? 10.073  82.118  85.985  1.00 100.00 ? 297  GLU G C   1 
ATOM   7100  O O   . GLU J  1 151 ? 11.001  81.685  86.688  1.00 100.00 ? 297  GLU G O   1 
ATOM   7101  C CB  . GLU J  1 151 ? 9.503   79.767  85.453  1.00 100.00 ? 297  GLU G CB  1 
ATOM   7102  C CG  . GLU J  1 151 ? 8.907   79.428  86.853  1.00 100.00 ? 297  GLU G CG  1 
ATOM   7103  C CD  . GLU J  1 151 ? 8.173   80.610  87.538  1.00 100.00 ? 297  GLU G CD  1 
ATOM   7104  O OE1 . GLU J  1 151 ? 7.199   81.138  86.953  1.00 100.00 ? 297  GLU G OE1 1 
ATOM   7105  O OE2 . GLU J  1 151 ? 8.569   81.004  88.664  1.00 100.00 ? 297  GLU G OE2 1 
ATOM   7106  N N   . THR J  1 152 ? 9.690   83.389  85.965  1.00 100.00 ? 298  THR G N   1 
ATOM   7107  C CA  . THR J  1 152 ? 10.253  84.416  86.820  1.00 100.00 ? 298  THR G CA  1 
ATOM   7108  C C   . THR J  1 152 ? 9.027   84.643  87.724  1.00 100.00 ? 298  THR G C   1 
ATOM   7109  O O   . THR J  1 152 ? 8.749   83.817  88.607  1.00 100.00 ? 298  THR G O   1 
ATOM   7110  C CB  . THR J  1 152 ? 10.646  85.695  85.985  1.00 100.00 ? 298  THR G CB  1 
ATOM   7111  O OG1 . THR J  1 152 ? 9.825   85.795  84.806  1.00 100.00 ? 298  THR G OG1 1 
ATOM   7112  C CG2 . THR J  1 152 ? 12.111  85.611  85.542  1.00 100.00 ? 298  THR G CG2 1 
ATOM   7113  N N   . ASP J  1 153 ? 8.281   85.718  87.467  1.00 100.00 ? 299  ASP G N   1 
ATOM   7114  C CA  . ASP J  1 153 ? 7.049   86.053  88.195  1.00 100.00 ? 299  ASP G CA  1 
ATOM   7115  C C   . ASP J  1 153 ? 6.886   85.409  89.576  1.00 100.00 ? 299  ASP G C   1 
ATOM   7116  O O   . ASP J  1 153 ? 7.173   86.098  90.581  1.00 100.00 ? 299  ASP G O   1 
ATOM   7117  C CB  . ASP J  1 153 ? 5.838   85.691  87.321  1.00 100.00 ? 299  ASP G CB  1 
ATOM   7118  C CG  . ASP J  1 153 ? 6.215   85.436  85.860  1.00 100.00 ? 299  ASP G CG  1 
ATOM   7119  O OD1 . ASP J  1 153 ? 6.788   86.351  85.217  1.00 100.00 ? 299  ASP G OD1 1 
ATOM   7120  O OD2 . ASP J  1 153 ? 5.936   84.321  85.357  1.00 100.00 ? 299  ASP G OD2 1 
ATOM   7121  O OXT . ASP J  1 153 ? 6.460   84.230  89.639  1.00 100.00 ? 299  ASP G OXT 1 
ATOM   7122  N N   . THR K  2 1   ? -6.271  130.083 83.193  1.00 87.04  ? 318  THR H N   1 
ATOM   7123  C CA  . THR K  2 1   ? -6.393  129.505 81.820  1.00 87.04  ? 318  THR H CA  1 
ATOM   7124  C C   . THR K  2 1   ? -5.033  129.138 81.241  1.00 87.04  ? 318  THR H C   1 
ATOM   7125  O O   . THR K  2 1   ? -4.246  130.014 80.883  1.00 87.04  ? 318  THR H O   1 
ATOM   7126  C CB  . THR K  2 1   ? -7.072  130.497 80.840  1.00 87.04  ? 318  THR H CB  1 
ATOM   7127  O OG1 . THR K  2 1   ? -8.493  130.470 81.037  1.00 87.04  ? 318  THR H OG1 1 
ATOM   7128  C CG2 . THR K  2 1   ? -6.750  130.131 79.385  1.00 87.04  ? 318  THR H CG2 1 
ATOM   7129  N N   . ARG K  2 2   ? -4.758  127.845 81.140  1.00 81.59  ? 319  ARG H N   1 
ATOM   7130  C CA  . ARG K  2 2   ? -3.491  127.404 80.592  1.00 81.59  ? 319  ARG H CA  1 
ATOM   7131  C C   . ARG K  2 2   ? -3.718  126.718 79.268  1.00 81.59  ? 319  ARG H C   1 
ATOM   7132  O O   . ARG K  2 2   ? -4.835  126.674 78.762  1.00 81.59  ? 319  ARG H O   1 
ATOM   7133  C CB  . ARG K  2 2   ? -2.806  126.446 81.559  1.00 81.59  ? 319  ARG H CB  1 
ATOM   7134  C CG  . ARG K  2 2   ? -2.403  127.101 82.859  1.00 81.59  ? 319  ARG H CG  1 
ATOM   7135  C CD  . ARG K  2 2   ? -2.152  126.075 83.963  1.00 81.59  ? 319  ARG H CD  1 
ATOM   7136  N NE  . ARG K  2 2   ? -1.605  126.703 85.173  1.00 81.59  ? 319  ARG H NE  1 
ATOM   7137  C CZ  . ARG K  2 2   ? -0.804  126.095 86.049  1.00 81.59  ? 319  ARG H CZ  1 
ATOM   7138  N NH1 . ARG K  2 2   ? -0.448  124.827 85.856  1.00 81.59  ? 319  ARG H NH1 1 
ATOM   7139  N NH2 . ARG K  2 2   ? -0.350  126.756 87.114  1.00 81.59  ? 319  ARG H NH2 1 
ATOM   7140  N N   . TYR K  2 3   ? -2.646  126.181 78.709  1.00 71.03  ? 320  TYR H N   1 
ATOM   7141  C CA  . TYR K  2 3   ? -2.729  125.475 77.444  1.00 71.03  ? 320  TYR H CA  1 
ATOM   7142  C C   . TYR K  2 3   ? -2.166  124.064 77.553  1.00 71.03  ? 320  TYR H C   1 
ATOM   7143  O O   . TYR K  2 3   ? -1.303  123.785 78.388  1.00 71.03  ? 320  TYR H O   1 
ATOM   7144  C CB  . TYR K  2 3   ? -1.984  126.247 76.361  1.00 71.03  ? 320  TYR H CB  1 
ATOM   7145  C CG  . TYR K  2 3   ? -2.850  127.266 75.668  1.00 71.03  ? 320  TYR H CG  1 
ATOM   7146  C CD1 . TYR K  2 3   ? -3.396  128.342 76.372  1.00 71.03  ? 320  TYR H CD1 1 
ATOM   7147  C CD2 . TYR K  2 3   ? -3.128  127.155 74.311  1.00 71.03  ? 320  TYR H CD2 1 
ATOM   7148  C CE1 . TYR K  2 3   ? -4.204  129.287 75.734  1.00 71.03  ? 320  TYR H CE1 1 
ATOM   7149  C CE2 . TYR K  2 3   ? -3.931  128.087 73.660  1.00 71.03  ? 320  TYR H CE2 1 
ATOM   7150  C CZ  . TYR K  2 3   ? -4.469  129.154 74.374  1.00 71.03  ? 320  TYR H CZ  1 
ATOM   7151  O OH  . TYR K  2 3   ? -5.272  130.072 73.719  1.00 71.03  ? 320  TYR H OH  1 
ATOM   7152  N N   . ILE K  2 4   ? -2.680  123.179 76.710  1.00 40.26  ? 321  ILE H N   1 
ATOM   7153  C CA  . ILE K  2 4   ? -2.238  121.795 76.677  1.00 40.26  ? 321  ILE H CA  1 
ATOM   7154  C C   . ILE K  2 4   ? -2.316  121.304 75.232  1.00 40.26  ? 321  ILE H C   1 
ATOM   7155  O O   . ILE K  2 4   ? -3.050  121.867 74.421  1.00 40.26  ? 321  ILE H O   1 
ATOM   7156  C CB  . ILE K  2 4   ? -3.108  120.909 77.585  1.00 40.26  ? 321  ILE H CB  1 
ATOM   7157  C CG1 . ILE K  2 4   ? -4.586  121.208 77.362  1.00 40.26  ? 321  ILE H CG1 1 
ATOM   7158  C CG2 . ILE K  2 4   ? -2.754  121.156 79.028  1.00 40.26  ? 321  ILE H CG2 1 
ATOM   7159  C CD1 . ILE K  2 4   ? -5.488  120.119 77.875  1.00 40.26  ? 321  ILE H CD1 1 
ATOM   7160  N N   . PRO K  2 5   ? -1.551  120.255 74.884  1.00 50.27  ? 322  PRO H N   1 
ATOM   7161  C CA  . PRO K  2 5   ? -1.574  119.743 73.513  1.00 50.27  ? 322  PRO H CA  1 
ATOM   7162  C C   . PRO K  2 5   ? -2.905  119.170 73.108  1.00 50.27  ? 322  PRO H C   1 
ATOM   7163  O O   . PRO K  2 5   ? -3.562  118.494 73.892  1.00 50.27  ? 322  PRO H O   1 
ATOM   7164  C CB  . PRO K  2 5   ? -0.479  118.683 73.504  1.00 50.27  ? 322  PRO H CB  1 
ATOM   7165  C CG  . PRO K  2 5   ? -0.380  118.249 74.924  1.00 50.27  ? 322  PRO H CG  1 
ATOM   7166  C CD  . PRO K  2 5   ? -0.631  119.483 75.737  1.00 50.27  ? 322  PRO H CD  1 
ATOM   7167  N N   . ASP K  2 6   ? -3.278  119.444 71.866  1.00 49.85  ? 323  ASP H N   1 
ATOM   7168  C CA  . ASP K  2 6   ? -4.524  118.978 71.271  1.00 49.85  ? 323  ASP H CA  1 
ATOM   7169  C C   . ASP K  2 6   ? -4.853  117.521 71.581  1.00 49.85  ? 323  ASP H C   1 
ATOM   7170  O O   . ASP K  2 6   ? -6.009  117.188 71.806  1.00 49.85  ? 323  ASP H O   1 
ATOM   7171  C CB  . ASP K  2 6   ? -4.447  119.167 69.758  1.00 49.85  ? 323  ASP H CB  1 
ATOM   7172  C CG  . ASP K  2 6   ? -5.772  118.973 69.078  1.00 49.85  ? 323  ASP H CG  1 
ATOM   7173  O OD1 . ASP K  2 6   ? -6.790  118.830 69.780  1.00 49.85  ? 323  ASP H OD1 1 
ATOM   7174  O OD2 . ASP K  2 6   ? -5.800  118.966 67.834  1.00 49.85  ? 323  ASP H OD2 1 
ATOM   7175  N N   . GLU K  2 7   ? -3.835  116.664 71.603  1.00 37.00  ? 324  GLU H N   1 
ATOM   7176  C CA  . GLU K  2 7   ? -4.000  115.232 71.859  1.00 37.00  ? 324  GLU H CA  1 
ATOM   7177  C C   . GLU K  2 7   ? -3.870  114.722 73.296  1.00 37.00  ? 324  GLU H C   1 
ATOM   7178  O O   . GLU K  2 7   ? -3.861  113.514 73.522  1.00 37.00  ? 324  GLU H O   1 
ATOM   7179  C CB  . GLU K  2 7   ? -3.013  114.471 71.001  1.00 37.00  ? 324  GLU H CB  1 
ATOM   7180  C CG  . GLU K  2 7   ? -3.636  113.834 69.813  1.00 37.00  ? 324  GLU H CG  1 
ATOM   7181  C CD  . GLU K  2 7   ? -2.915  114.199 68.542  1.00 37.00  ? 324  GLU H CD  1 
ATOM   7182  O OE1 . GLU K  2 7   ? -2.762  115.417 68.289  1.00 37.00  ? 324  GLU H OE1 1 
ATOM   7183  O OE2 . GLU K  2 7   ? -2.505  113.270 67.801  1.00 37.00  ? 324  GLU H OE2 1 
ATOM   7184  N N   . ALA K  2 8   ? -3.790  115.614 74.271  1.00 28.74  ? 325  ALA H N   1 
ATOM   7185  C CA  . ALA K  2 8   ? -3.625  115.188 75.660  1.00 28.74  ? 325  ALA H CA  1 
ATOM   7186  C C   . ALA K  2 8   ? -4.713  114.283 76.282  1.00 28.74  ? 325  ALA H C   1 
ATOM   7187  O O   . ALA K  2 8   ? -5.708  113.926 75.650  1.00 28.74  ? 325  ALA H O   1 
ATOM   7188  C CB  . ALA K  2 8   ? -3.412  116.419 76.550  1.00 28.74  ? 325  ALA H CB  1 
ATOM   7189  N N   . ASP K  2 9   ? -4.474  113.900 77.533  1.00 27.47  ? 326  ASP H N   1 
ATOM   7190  C CA  . ASP K  2 9   ? -5.386  113.084 78.318  1.00 27.47  ? 326  ASP H CA  1 
ATOM   7191  C C   . ASP K  2 9   ? -6.104  111.898 77.678  1.00 27.47  ? 326  ASP H C   1 
ATOM   7192  O O   . ASP K  2 9   ? -7.228  111.582 78.052  1.00 27.47  ? 326  ASP H O   1 
ATOM   7193  C CB  . ASP K  2 9   ? -6.390  114.016 78.950  1.00 27.47  ? 326  ASP H CB  1 
ATOM   7194  C CG  . ASP K  2 9   ? -5.786  115.362 79.262  1.00 27.47  ? 326  ASP H CG  1 
ATOM   7195  O OD1 . ASP K  2 9   ? -4.946  115.424 80.178  1.00 27.47  ? 326  ASP H OD1 1 
ATOM   7196  O OD2 . ASP K  2 9   ? -6.140  116.359 78.585  1.00 27.47  ? 326  ASP H OD2 1 
ATOM   7197  N N   . PHE K  2 10  ? -5.448  111.221 76.743  1.00 32.16  ? 327  PHE H N   1 
ATOM   7198  C CA  . PHE K  2 10  ? -6.027  110.059 76.083  1.00 32.16  ? 327  PHE H CA  1 
ATOM   7199  C C   . PHE K  2 10  ? -5.499  108.765 76.689  1.00 32.16  ? 327  PHE H C   1 
ATOM   7200  O O   . PHE K  2 10  ? -4.562  108.771 77.481  1.00 32.16  ? 327  PHE H O   1 
ATOM   7201  C CB  . PHE K  2 10  ? -5.650  110.066 74.623  1.00 32.16  ? 327  PHE H CB  1 
ATOM   7202  C CG  . PHE K  2 10  ? -6.668  110.698 73.731  1.00 32.16  ? 327  PHE H CG  1 
ATOM   7203  C CD1 . PHE K  2 10  ? -6.478  112.000 73.253  1.00 32.16  ? 327  PHE H CD1 1 
ATOM   7204  C CD2 . PHE K  2 10  ? -7.766  109.964 73.273  1.00 32.16  ? 327  PHE H CD2 1 
ATOM   7205  C CE1 . PHE K  2 10  ? -7.352  112.557 72.328  1.00 32.16  ? 327  PHE H CE1 1 
ATOM   7206  C CE2 . PHE K  2 10  ? -8.649  110.512 72.345  1.00 32.16  ? 327  PHE H CE2 1 
ATOM   7207  C CZ  . PHE K  2 10  ? -8.435  111.813 71.872  1.00 32.16  ? 327  PHE H CZ  1 
ATOM   7208  N N   . LEU K  2 11  ? -6.101  107.648 76.310  1.00 19.90  ? 328  LEU H N   1 
ATOM   7209  C CA  . LEU K  2 11  ? -5.658  106.359 76.806  1.00 19.90  ? 328  LEU H CA  1 
ATOM   7210  C C   . LEU K  2 11  ? -6.289  105.277 75.981  1.00 19.90  ? 328  LEU H C   1 
ATOM   7211  O O   . LEU K  2 11  ? -7.474  105.023 76.086  1.00 19.90  ? 328  LEU H O   1 
ATOM   7212  C CB  . LEU K  2 11  ? -6.036  106.146 78.269  1.00 19.90  ? 328  LEU H CB  1 
ATOM   7213  C CG  . LEU K  2 11  ? -5.887  104.677 78.714  1.00 19.90  ? 328  LEU H CG  1 
ATOM   7214  C CD1 . LEU K  2 11  ? -4.600  104.065 78.151  1.00 19.90  ? 328  LEU H CD1 1 
ATOM   7215  C CD2 . LEU K  2 11  ? -5.881  104.605 80.230  1.00 19.90  ? 328  LEU H CD2 1 
ATOM   7216  N N   . LEU K  2 12  ? -5.486  104.635 75.159  1.00 28.74  ? 329  LEU H N   1 
ATOM   7217  C CA  . LEU K  2 12  ? -5.976  103.588 74.301  1.00 28.74  ? 329  LEU H CA  1 
ATOM   7218  C C   . LEU K  2 12  ? -5.721  102.264 74.986  1.00 28.74  ? 329  LEU H C   1 
ATOM   7219  O O   . LEU K  2 12  ? -4.623  102.015 75.465  1.00 28.74  ? 329  LEU H O   1 
ATOM   7220  C CB  . LEU K  2 12  ? -5.230  103.631 72.979  1.00 28.74  ? 329  LEU H CB  1 
ATOM   7221  C CG  . LEU K  2 12  ? -5.755  102.667 71.941  1.00 28.74  ? 329  LEU H CG  1 
ATOM   7222  C CD1 . LEU K  2 12  ? -7.285  102.579 72.073  1.00 28.74  ? 329  LEU H CD1 1 
ATOM   7223  C CD2 . LEU K  2 12  ? -5.356  103.175 70.568  1.00 28.74  ? 329  LEU H CD2 1 
ATOM   7224  N N   . GLY K  2 13  ? -6.740  101.417 75.043  1.00 58.75  ? 330  GLY H N   1 
ATOM   7225  C CA  . GLY K  2 13  ? -6.577  100.120 75.668  1.00 58.75  ? 330  GLY H CA  1 
ATOM   7226  C C   . GLY K  2 13  ? -6.652  99.060  74.590  1.00 58.75  ? 330  GLY H C   1 
ATOM   7227  O O   . GLY K  2 13  ? -7.700  98.454  74.391  1.00 58.75  ? 330  GLY H O   1 
ATOM   7228  N N   . MET K  2 14  ? -5.556  98.860  73.866  1.00 38.56  ? 331  MET H N   1 
ATOM   7229  C CA  . MET K  2 14  ? -5.517  97.856  72.815  1.00 38.56  ? 331  MET H CA  1 
ATOM   7230  C C   . MET K  2 14  ? -5.544  96.480  73.465  1.00 38.56  ? 331  MET H C   1 
ATOM   7231  O O   . MET K  2 14  ? -4.917  96.258  74.516  1.00 38.56  ? 331  MET H O   1 
ATOM   7232  C CB  . MET K  2 14  ? -4.249  98.005  71.990  1.00 38.56  ? 331  MET H CB  1 
ATOM   7233  C CG  . MET K  2 14  ? -4.297  99.162  71.053  1.00 38.56  ? 331  MET H CG  1 
ATOM   7234  S SD  . MET K  2 14  ? -5.911  99.235  70.326  1.00 38.56  ? 331  MET H SD  1 
ATOM   7235  C CE  . MET K  2 14  ? -5.759  98.009  69.013  1.00 38.56  ? 331  MET H CE  1 
ATOM   7236  N N   . ALA K  2 15  ? -6.279  95.560  72.846  1.00 71.00  ? 332  ALA H N   1 
ATOM   7237  C CA  . ALA K  2 15  ? -6.415  94.207  73.365  1.00 71.00  ? 332  ALA H CA  1 
ATOM   7238  C C   . ALA K  2 15  ? -5.237  93.349  72.939  1.00 71.00  ? 332  ALA H C   1 
ATOM   7239  O O   . ALA K  2 15  ? -4.880  92.376  73.604  1.00 71.00  ? 332  ALA H O   1 
ATOM   7240  C CB  . ALA K  2 15  ? -7.706  93.597  72.861  1.00 71.00  ? 332  ALA H CB  1 
ATOM   7241  N N   . THR K  2 16  ? -4.629  93.726  71.822  1.00 82.92  ? 333  THR H N   1 
ATOM   7242  C CA  . THR K  2 16  ? -3.504  92.983  71.291  1.00 82.92  ? 333  THR H CA  1 
ATOM   7243  C C   . THR K  2 16  ? -2.510  93.901  70.582  1.00 82.92  ? 333  THR H C   1 
ATOM   7244  O O   . THR K  2 16  ? -2.865  94.998  70.144  1.00 82.92  ? 333  THR H O   1 
ATOM   7245  C CB  . THR K  2 16  ? -4.005  91.917  70.297  1.00 82.92  ? 333  THR H CB  1 
ATOM   7246  O OG1 . THR K  2 16  ? -2.891  91.357  69.594  1.00 82.92  ? 333  THR H OG1 1 
ATOM   7247  C CG2 . THR K  2 16  ? -4.982  92.534  69.296  1.00 82.92  ? 333  THR H CG2 1 
ATOM   7248  N N   . VAL K  2 17  ? -1.259  93.455  70.492  1.00 64.19  ? 334  VAL H N   1 
ATOM   7249  C CA  . VAL K  2 17  ? -0.213  94.208  69.802  1.00 64.19  ? 334  VAL H CA  1 
ATOM   7250  C C   . VAL K  2 17  ? -0.515  94.064  68.307  1.00 64.19  ? 334  VAL H C   1 
ATOM   7251  O O   . VAL K  2 17  ? -1.155  93.100  67.903  1.00 64.19  ? 334  VAL H O   1 
ATOM   7252  C CB  . VAL K  2 17  ? 1.187   93.633  70.119  1.00 64.19  ? 334  VAL H CB  1 
ATOM   7253  C CG1 . VAL K  2 17  ? 1.511   93.838  71.593  1.00 64.19  ? 334  VAL H CG1 1 
ATOM   7254  C CG2 . VAL K  2 17  ? 1.236   92.153  69.782  1.00 64.19  ? 334  VAL H CG2 1 
ATOM   7255  N N   . ASN K  2 18  ? -0.068  95.002  67.480  1.00 63.96  ? 335  ASN H N   1 
ATOM   7256  C CA  . ASN K  2 18  ? -0.376  94.924  66.053  1.00 63.96  ? 335  ASN H CA  1 
ATOM   7257  C C   . ASN K  2 18  ? -0.028  93.609  65.367  1.00 63.96  ? 335  ASN H C   1 
ATOM   7258  O O   . ASN K  2 18  ? 0.767   92.826  65.877  1.00 63.96  ? 335  ASN H O   1 
ATOM   7259  C CB  . ASN K  2 18  ? 0.290   96.069  65.284  1.00 63.96  ? 335  ASN H CB  1 
ATOM   7260  C CG  . ASN K  2 18  ? -0.569  96.557  64.117  1.00 63.96  ? 335  ASN H CG  1 
ATOM   7261  O OD1 . ASN K  2 18  ? -0.063  96.996  63.074  1.00 63.96  ? 335  ASN H OD1 1 
ATOM   7262  N ND2 . ASN K  2 18  ? -1.880  96.476  64.292  1.00 63.96  ? 335  ASN H ND2 1 
ATOM   7263  N N   . ASN K  2 19  ? -0.645  93.386  64.207  1.00 77.88  ? 336  ASN H N   1 
ATOM   7264  C CA  . ASN K  2 19  ? -0.426  92.195  63.382  1.00 77.88  ? 336  ASN H CA  1 
ATOM   7265  C C   . ASN K  2 19  ? -0.875  90.861  63.958  1.00 77.88  ? 336  ASN H C   1 
ATOM   7266  O O   . ASN K  2 19  ? -0.875  89.859  63.245  1.00 77.88  ? 336  ASN H O   1 
ATOM   7267  C CB  . ASN K  2 19  ? 1.052   92.071  63.012  1.00 77.88  ? 336  ASN H CB  1 
ATOM   7268  C CG  . ASN K  2 19  ? 1.644   93.374  62.529  1.00 77.88  ? 336  ASN H CG  1 
ATOM   7269  O OD1 . ASN K  2 19  ? 2.426   94.015  63.239  1.00 77.88  ? 336  ASN H OD1 1 
ATOM   7270  N ND2 . ASN K  2 19  ? 1.279   93.779  61.316  1.00 77.88  ? 336  ASN H ND2 1 
ATOM   7271  N N   . CYS K  2 20  ? -1.252  90.842  65.235  1.00 72.23  ? 337  CYS H N   1 
ATOM   7272  C CA  . CYS K  2 20  ? -1.671  89.603  65.891  1.00 72.23  ? 337  CYS H CA  1 
ATOM   7273  C C   . CYS K  2 20  ? -3.165  89.496  66.191  1.00 72.23  ? 337  CYS H C   1 
ATOM   7274  O O   . CYS K  2 20  ? -3.910  90.462  66.029  1.00 72.23  ? 337  CYS H O   1 
ATOM   7275  C CB  . CYS K  2 20  ? -0.880  89.406  67.186  1.00 72.23  ? 337  CYS H CB  1 
ATOM   7276  S SG  . CYS K  2 20  ? 0.922   89.320  66.956  1.00 72.23  ? 337  CYS H SG  1 
ATOM   7277  N N   . VAL K  2 21  ? -3.588  88.312  66.639  1.00 50.88  ? 338  VAL H N   1 
ATOM   7278  C CA  . VAL K  2 21  ? -4.992  88.048  66.954  1.00 50.88  ? 338  VAL H CA  1 
ATOM   7279  C C   . VAL K  2 21  ? -5.391  88.272  68.416  1.00 50.88  ? 338  VAL H C   1 
ATOM   7280  O O   . VAL K  2 21  ? -4.551  88.505  69.294  1.00 50.88  ? 338  VAL H O   1 
ATOM   7281  C CB  . VAL K  2 21  ? -5.408  86.591  66.555  1.00 50.88  ? 338  VAL H CB  1 
ATOM   7282  C CG1 . VAL K  2 21  ? -5.060  86.321  65.091  1.00 50.88  ? 338  VAL H CG1 1 
ATOM   7283  C CG2 . VAL K  2 21  ? -4.744  85.577  67.477  1.00 50.88  ? 338  VAL H CG2 1 
ATOM   7284  N N   . SER K  2 22  ? -6.698  88.201  68.651  1.00 49.35  ? 339  SER H N   1 
ATOM   7285  C CA  . SER K  2 22  ? -7.263  88.381  69.972  1.00 49.35  ? 339  SER H CA  1 
ATOM   7286  C C   . SER K  2 22  ? -8.116  87.172  70.295  1.00 49.35  ? 339  SER H C   1 
ATOM   7287  O O   . SER K  2 22  ? -8.699  86.577  69.400  1.00 49.35  ? 339  SER H O   1 
ATOM   7288  C CB  . SER K  2 22  ? -8.114  89.634  69.989  1.00 49.35  ? 339  SER H CB  1 
ATOM   7289  O OG  . SER K  2 22  ? -7.817  90.401  71.142  1.00 49.35  ? 339  SER H OG  1 
ATOM   7290  N N   . TYR K  2 23  ? -8.207  86.810  71.568  1.00 61.14  ? 340  TYR H N   1 
ATOM   7291  C CA  . TYR K  2 23  ? -8.993  85.640  71.940  1.00 61.14  ? 340  TYR H CA  1 
ATOM   7292  C C   . TYR K  2 23  ? -10.313 85.892  72.670  1.00 61.14  ? 340  TYR H C   1 
ATOM   7293  O O   . TYR K  2 23  ? -10.384 86.645  73.644  1.00 61.14  ? 340  TYR H O   1 
ATOM   7294  C CB  . TYR K  2 23  ? -8.130  84.678  72.758  1.00 61.14  ? 340  TYR H CB  1 
ATOM   7295  C CG  . TYR K  2 23  ? -7.060  84.009  71.935  1.00 61.14  ? 340  TYR H CG  1 
ATOM   7296  C CD1 . TYR K  2 23  ? -5.714  84.293  72.154  1.00 61.14  ? 340  TYR H CD1 1 
ATOM   7297  C CD2 . TYR K  2 23  ? -7.394  83.110  70.918  1.00 61.14  ? 340  TYR H CD2 1 
ATOM   7298  C CE1 . TYR K  2 23  ? -4.719  83.702  71.380  1.00 61.14  ? 340  TYR H CE1 1 
ATOM   7299  C CE2 . TYR K  2 23  ? -6.411  82.512  70.138  1.00 61.14  ? 340  TYR H CE2 1 
ATOM   7300  C CZ  . TYR K  2 23  ? -5.069  82.811  70.370  1.00 61.14  ? 340  TYR H CZ  1 
ATOM   7301  O OH  . TYR K  2 23  ? -4.080  82.227  69.595  1.00 61.14  ? 340  TYR H OH  1 
ATOM   7302  N N   . ARG K  2 24  ? -11.358 85.228  72.189  1.00 43.91  ? 341  ARG H N   1 
ATOM   7303  C CA  . ARG K  2 24  ? -12.692 85.339  72.761  1.00 43.91  ? 341  ARG H CA  1 
ATOM   7304  C C   . ARG K  2 24  ? -13.336 83.963  72.906  1.00 43.91  ? 341  ARG H C   1 
ATOM   7305  O O   . ARG K  2 24  ? -13.662 83.298  71.909  1.00 43.91  ? 341  ARG H O   1 
ATOM   7306  C CB  . ARG K  2 24  ? -13.562 86.227  71.875  1.00 43.91  ? 341  ARG H CB  1 
ATOM   7307  C CG  . ARG K  2 24  ? -14.907 85.647  71.533  1.00 43.91  ? 341  ARG H CG  1 
ATOM   7308  C CD  . ARG K  2 24  ? -15.398 86.219  70.254  1.00 43.91  ? 341  ARG H CD  1 
ATOM   7309  N NE  . ARG K  2 24  ? -15.615 85.194  69.250  1.00 43.91  ? 341  ARG H NE  1 
ATOM   7310  C CZ  . ARG K  2 24  ? -15.547 85.432  67.944  1.00 43.91  ? 341  ARG H CZ  1 
ATOM   7311  N NH1 . ARG K  2 24  ? -15.269 86.651  67.508  1.00 43.91  ? 341  ARG H NH1 1 
ATOM   7312  N NH2 . ARG K  2 24  ? -15.781 84.477  67.057  1.00 43.91  ? 341  ARG H NH2 1 
ATOM   7313  N N   . ASN K  2 25  ? -13.495 83.536  74.153  1.00 67.06  ? 342  ASN H N   1 
ATOM   7314  C CA  . ASN K  2 25  ? -14.124 82.255  74.430  1.00 67.06  ? 342  ASN H CA  1 
ATOM   7315  C C   . ASN K  2 25  ? -15.628 82.497  74.284  1.00 67.06  ? 342  ASN H C   1 
ATOM   7316  O O   . ASN K  2 25  ? -16.231 83.265  75.049  1.00 67.06  ? 342  ASN H O   1 
ATOM   7317  C CB  . ASN K  2 25  ? -13.790 81.785  75.849  1.00 67.06  ? 342  ASN H CB  1 
ATOM   7318  C CG  . ASN K  2 25  ? -14.516 80.511  76.214  1.00 67.06  ? 342  ASN H CG  1 
ATOM   7319  O OD1 . ASN K  2 25  ? -15.152 79.887  75.359  1.00 67.06  ? 342  ASN H OD1 1 
ATOM   7320  N ND2 . ASN K  2 25  ? -14.429 80.114  77.481  1.00 67.06  ? 342  ASN H ND2 1 
ATOM   7321  N N   . PRO K  2 26  ? -16.258 81.851  73.293  1.00 49.77  ? 343  PRO H N   1 
ATOM   7322  C CA  . PRO K  2 26  ? -17.697 82.061  73.115  1.00 49.77  ? 343  PRO H CA  1 
ATOM   7323  C C   . PRO K  2 26  ? -18.491 81.676  74.340  1.00 49.77  ? 343  PRO H C   1 
ATOM   7324  O O   . PRO K  2 26  ? -19.706 81.800  74.345  1.00 49.77  ? 343  PRO H O   1 
ATOM   7325  C CB  . PRO K  2 26  ? -18.055 81.183  71.916  1.00 49.77  ? 343  PRO H CB  1 
ATOM   7326  C CG  . PRO K  2 26  ? -16.941 80.210  71.795  1.00 49.77  ? 343  PRO H CG  1 
ATOM   7327  C CD  . PRO K  2 26  ? -15.705 80.902  72.314  1.00 49.77  ? 343  PRO H CD  1 
ATOM   7328  N N   . ALA K  2 27  ? -17.811 81.217  75.385  1.00 47.81  ? 344  ALA H N   1 
ATOM   7329  C CA  . ALA K  2 27  ? -18.505 80.789  76.598  1.00 47.81  ? 344  ALA H CA  1 
ATOM   7330  C C   . ALA K  2 27  ? -18.265 81.643  77.850  1.00 47.81  ? 344  ALA H C   1 
ATOM   7331  O O   . ALA K  2 27  ? -18.718 81.286  78.943  1.00 47.81  ? 344  ALA H O   1 
ATOM   7332  C CB  . ALA K  2 27  ? -18.164 79.314  76.899  1.00 47.81  ? 344  ALA H CB  1 
ATOM   7333  N N   . GLU K  2 28  ? -17.559 82.759  77.708  1.00 93.73  ? 345  GLU H N   1 
ATOM   7334  C CA  . GLU K  2 28  ? -17.314 83.622  78.862  1.00 93.73  ? 345  GLU H CA  1 
ATOM   7335  C C   . GLU K  2 28  ? -16.730 84.973  78.480  1.00 93.73  ? 345  GLU H C   1 
ATOM   7336  O O   . GLU K  2 28  ? -16.429 85.780  79.362  1.00 93.73  ? 345  GLU H O   1 
ATOM   7337  C CB  . GLU K  2 28  ? -16.393 82.930  79.873  1.00 93.73  ? 345  GLU H CB  1 
ATOM   7338  C CG  . GLU K  2 28  ? -15.347 82.031  79.233  1.00 93.73  ? 345  GLU H CG  1 
ATOM   7339  C CD  . GLU K  2 28  ? -14.399 81.406  80.242  1.00 93.73  ? 345  GLU H CD  1 
ATOM   7340  O OE1 . GLU K  2 28  ? -14.887 80.804  81.224  1.00 93.73  ? 345  GLU H OE1 1 
ATOM   7341  O OE2 . GLU K  2 28  ? -13.166 81.517  80.049  1.00 93.73  ? 345  GLU H OE2 1 
ATOM   7342  N N   . GLY K  2 29  ? -16.565 85.212  77.177  1.00 79.78  ? 346  GLY H N   1 
ATOM   7343  C CA  . GLY K  2 29  ? -16.036 86.486  76.713  1.00 79.78  ? 346  GLY H CA  1 
ATOM   7344  C C   . GLY K  2 29  ? -14.591 86.486  76.242  1.00 79.78  ? 346  GLY H C   1 
ATOM   7345  O O   . GLY K  2 29  ? -13.956 85.436  76.130  1.00 79.78  ? 346  GLY H O   1 
ATOM   7346  N N   . THR K  2 30  ? -14.071 87.676  75.956  1.00 73.68  ? 347  THR H N   1 
ATOM   7347  C CA  . THR K  2 30  ? -12.698 87.810  75.497  1.00 73.68  ? 347  THR H CA  1 
ATOM   7348  C C   . THR K  2 30  ? -11.769 87.907  76.696  1.00 73.68  ? 347  THR H C   1 
ATOM   7349  O O   . THR K  2 30  ? -12.120 88.499  77.720  1.00 73.68  ? 347  THR H O   1 
ATOM   7350  C CB  . THR K  2 30  ? -12.502 89.071  74.617  1.00 73.68  ? 347  THR H CB  1 
ATOM   7351  O OG1 . THR K  2 30  ? -12.684 90.255  75.404  1.00 73.68  ? 347  THR H OG1 1 
ATOM   7352  C CG2 . THR K  2 30  ? -13.489 89.080  73.480  1.00 73.68  ? 347  THR H CG2 1 
ATOM   7353  N N   . TRP K  2 31  ? -10.586 87.321  76.565  1.00 66.81  ? 348  TRP H N   1 
ATOM   7354  C CA  . TRP K  2 31  ? -9.601  87.342  77.635  1.00 66.81  ? 348  TRP H CA  1 
ATOM   7355  C C   . TRP K  2 31  ? -9.385  88.768  78.131  1.00 66.81  ? 348  TRP H C   1 
ATOM   7356  O O   . TRP K  2 31  ? -9.488  89.044  79.326  1.00 66.81  ? 348  TRP H O   1 
ATOM   7357  C CB  . TRP K  2 31  ? -8.253  86.800  77.149  1.00 66.81  ? 348  TRP H CB  1 
ATOM   7358  C CG  . TRP K  2 31  ? -8.263  85.404  76.584  1.00 66.81  ? 348  TRP H CG  1 
ATOM   7359  C CD1 . TRP K  2 31  ? -9.342  84.580  76.420  1.00 66.81  ? 348  TRP H CD1 1 
ATOM   7360  C CD2 . TRP K  2 31  ? -7.126  84.669  76.107  1.00 66.81  ? 348  TRP H CD2 1 
ATOM   7361  N NE1 . TRP K  2 31  ? -8.948  83.377  75.871  1.00 66.81  ? 348  TRP H NE1 1 
ATOM   7362  C CE2 . TRP K  2 31  ? -7.594  83.406  75.671  1.00 66.81  ? 348  TRP H CE2 1 
ATOM   7363  C CE3 . TRP K  2 31  ? -5.757  84.956  76.007  1.00 66.81  ? 348  TRP H CE3 1 
ATOM   7364  C CZ2 . TRP K  2 31  ? -6.745  82.435  75.143  1.00 66.81  ? 348  TRP H CZ2 1 
ATOM   7365  C CZ3 . TRP K  2 31  ? -4.911  83.987  75.481  1.00 66.81  ? 348  TRP H CZ3 1 
ATOM   7366  C CH2 . TRP K  2 31  ? -5.411  82.740  75.056  1.00 66.81  ? 348  TRP H CH2 1 
ATOM   7367  N N   . TYR K  2 32  ? -9.081  89.666  77.198  1.00 46.76  ? 349  TYR H N   1 
ATOM   7368  C CA  . TYR K  2 32  ? -8.818  91.060  77.520  1.00 46.76  ? 349  TYR H CA  1 
ATOM   7369  C C   . TYR K  2 32  ? -9.931  91.703  78.322  1.00 46.76  ? 349  TYR H C   1 
ATOM   7370  O O   . TYR K  2 32  ? -9.743  92.089  79.484  1.00 46.76  ? 349  TYR H O   1 
ATOM   7371  C CB  . TYR K  2 32  ? -8.602  91.873  76.238  1.00 46.76  ? 349  TYR H CB  1 
ATOM   7372  C CG  . TYR K  2 32  ? -8.259  93.335  76.486  1.00 46.76  ? 349  TYR H CG  1 
ATOM   7373  C CD1 . TYR K  2 32  ? -7.248  93.697  77.383  1.00 46.76  ? 349  TYR H CD1 1 
ATOM   7374  C CD2 . TYR K  2 32  ? -8.948  94.359  75.830  1.00 46.76  ? 349  TYR H CD2 1 
ATOM   7375  C CE1 . TYR K  2 32  ? -6.933  95.044  77.620  1.00 46.76  ? 349  TYR H CE1 1 
ATOM   7376  C CE2 . TYR K  2 32  ? -8.641  95.706  76.061  1.00 46.76  ? 349  TYR H CE2 1 
ATOM   7377  C CZ  . TYR K  2 32  ? -7.633  96.042  76.956  1.00 46.76  ? 349  TYR H CZ  1 
ATOM   7378  O OH  . TYR K  2 32  ? -7.327  97.370  77.187  1.00 46.76  ? 349  TYR H OH  1 
ATOM   7379  N N   . ILE K  2 33  ? -11.098 91.814  77.693  1.00 37.23  ? 350  ILE H N   1 
ATOM   7380  C CA  . ILE K  2 33  ? -12.228 92.451  78.332  1.00 37.23  ? 350  ILE H CA  1 
ATOM   7381  C C   . ILE K  2 33  ? -12.539 91.845  79.681  1.00 37.23  ? 350  ILE H C   1 
ATOM   7382  O O   . ILE K  2 33  ? -12.713 92.569  80.673  1.00 37.23  ? 350  ILE H O   1 
ATOM   7383  C CB  . ILE K  2 33  ? -13.464 92.372  77.470  1.00 37.23  ? 350  ILE H CB  1 
ATOM   7384  C CG1 . ILE K  2 33  ? -13.254 93.173  76.175  1.00 37.23  ? 350  ILE H CG1 1 
ATOM   7385  C CG2 . ILE K  2 33  ? -14.636 92.900  78.256  1.00 37.23  ? 350  ILE H CG2 1 
ATOM   7386  C CD1 . ILE K  2 33  ? -13.011 94.676  76.388  1.00 37.23  ? 350  ILE H CD1 1 
ATOM   7387  N N   . GLN K  2 34  ? -12.605 90.519  79.722  1.00 43.94  ? 351  GLN H N   1 
ATOM   7388  C CA  . GLN K  2 34  ? -12.902 89.822  80.965  1.00 43.94  ? 351  GLN H CA  1 
ATOM   7389  C C   . GLN K  2 34  ? -11.902 90.182  82.054  1.00 43.94  ? 351  GLN H C   1 
ATOM   7390  O O   . GLN K  2 34  ? -12.281 90.496  83.182  1.00 43.94  ? 351  GLN H O   1 
ATOM   7391  C CB  . GLN K  2 34  ? -12.899 88.317  80.726  1.00 43.94  ? 351  GLN H CB  1 
ATOM   7392  C CG  . GLN K  2 34  ? -14.034 87.850  79.824  1.00 43.94  ? 351  GLN H CG  1 
ATOM   7393  C CD  . GLN K  2 34  ? -15.399 88.261  80.359  1.00 43.94  ? 351  GLN H CD  1 
ATOM   7394  O OE1 . GLN K  2 34  ? -15.710 88.043  81.537  1.00 43.94  ? 351  GLN H OE1 1 
ATOM   7395  N NE2 . GLN K  2 34  ? -16.221 88.865  79.494  1.00 43.94  ? 351  GLN H NE2 1 
ATOM   7396  N N   . SER K  2 35  ? -10.620 90.142  81.722  1.00 46.98  ? 352  SER H N   1 
ATOM   7397  C CA  . SER K  2 35  ? -9.606  90.482  82.707  1.00 46.98  ? 352  SER H CA  1 
ATOM   7398  C C   . SER K  2 35  ? -9.711  91.964  83.029  1.00 46.98  ? 352  SER H C   1 
ATOM   7399  O O   . SER K  2 35  ? -9.601  92.363  84.192  1.00 46.98  ? 352  SER H O   1 
ATOM   7400  C CB  . SER K  2 35  ? -8.216  90.157  82.166  1.00 46.98  ? 352  SER H CB  1 
ATOM   7401  O OG  . SER K  2 35  ? -8.255  88.972  81.386  1.00 46.98  ? 352  SER H OG  1 
ATOM   7402  N N   . LEU K  2 36  ? -9.937  92.774  81.992  1.00 31.80  ? 353  LEU H N   1 
ATOM   7403  C CA  . LEU K  2 36  ? -10.050 94.218  82.162  1.00 31.80  ? 353  LEU H CA  1 
ATOM   7404  C C   . LEU K  2 36  ? -11.029 94.556  83.265  1.00 31.80  ? 353  LEU H C   1 
ATOM   7405  O O   . LEU K  2 36  ? -10.756 95.409  84.124  1.00 31.80  ? 353  LEU H O   1 
ATOM   7406  C CB  . LEU K  2 36  ? -10.523 94.876  80.873  1.00 31.80  ? 353  LEU H CB  1 
ATOM   7407  C CG  . LEU K  2 36  ? -10.725 96.378  81.065  1.00 31.80  ? 353  LEU H CG  1 
ATOM   7408  C CD1 . LEU K  2 36  ? -9.580  96.941  81.881  1.00 31.80  ? 353  LEU H CD1 1 
ATOM   7409  C CD2 . LEU K  2 36  ? -10.797 97.078  79.711  1.00 31.80  ? 353  LEU H CD2 1 
ATOM   7410  N N   . CYS K  2 37  ? -12.180 93.887  83.213  1.00 47.34  ? 354  CYS H N   1 
ATOM   7411  C CA  . CYS K  2 37  ? -13.243 94.080  84.187  1.00 47.34  ? 354  CYS H CA  1 
ATOM   7412  C C   . CYS K  2 37  ? -12.823 93.559  85.542  1.00 47.34  ? 354  CYS H C   1 
ATOM   7413  O O   . CYS K  2 37  ? -12.709 94.324  86.498  1.00 47.34  ? 354  CYS H O   1 
ATOM   7414  C CB  . CYS K  2 37  ? -14.505 93.367  83.731  1.00 47.34  ? 354  CYS H CB  1 
ATOM   7415  S SG  . CYS K  2 37  ? -15.325 94.252  82.414  1.00 47.34  ? 354  CYS H SG  1 
ATOM   7416  N N   . GLN K  2 38  ? -12.591 92.256  85.624  1.00 97.63  ? 355  GLN H N   1 
ATOM   7417  C CA  . GLN K  2 38  ? -12.175 91.649  86.875  1.00 97.63  ? 355  GLN H CA  1 
ATOM   7418  C C   . GLN K  2 38  ? -11.197 92.557  87.626  1.00 97.63  ? 355  GLN H C   1 
ATOM   7419  O O   . GLN K  2 38  ? -11.408 92.876  88.794  1.00 97.63  ? 355  GLN H O   1 
ATOM   7420  C CB  . GLN K  2 38  ? -11.536 90.301  86.591  1.00 97.63  ? 355  GLN H CB  1 
ATOM   7421  C CG  . GLN K  2 38  ? -11.903 89.244  87.587  1.00 97.63  ? 355  GLN H CG  1 
ATOM   7422  C CD  . GLN K  2 38  ? -10.893 88.119  87.603  1.00 97.63  ? 355  GLN H CD  1 
ATOM   7423  O OE1 . GLN K  2 38  ? -9.895  88.172  88.329  1.00 97.63  ? 355  GLN H OE1 1 
ATOM   7424  N NE2 . GLN K  2 38  ? -11.139 87.093  86.794  1.00 97.63  ? 355  GLN H NE2 1 
ATOM   7425  N N   . SER K  2 39  ? -10.142 92.996  86.946  1.00 83.85  ? 356  SER H N   1 
ATOM   7426  C CA  . SER K  2 39  ? -9.148  93.868  87.568  1.00 83.85  ? 356  SER H CA  1 
ATOM   7427  C C   . SER K  2 39  ? -9.726  95.213  87.961  1.00 83.85  ? 356  SER H C   1 
ATOM   7428  O O   . SER K  2 39  ? -9.386  95.765  89.005  1.00 83.85  ? 356  SER H O   1 
ATOM   7429  C CB  . SER K  2 39  ? -7.979  94.094  86.624  1.00 83.85  ? 356  SER H CB  1 
ATOM   7430  O OG  . SER K  2 39  ? -6.886  93.301  87.027  1.00 83.85  ? 356  SER H OG  1 
ATOM   7431  N N   . LEU K  2 40  ? -10.591 95.745  87.106  1.00 43.64  ? 357  LEU H N   1 
ATOM   7432  C CA  . LEU K  2 40  ? -11.241 97.028  87.360  1.00 43.64  ? 357  LEU H CA  1 
ATOM   7433  C C   . LEU K  2 40  ? -12.045 96.990  88.656  1.00 43.64  ? 357  LEU H C   1 
ATOM   7434  O O   . LEU K  2 40  ? -11.830 97.814  89.551  1.00 43.64  ? 357  LEU H O   1 
ATOM   7435  C CB  . LEU K  2 40  ? -12.162 97.387  86.196  1.00 43.64  ? 357  LEU H CB  1 
ATOM   7436  C CG  . LEU K  2 40  ? -11.488 98.344  85.227  1.00 43.64  ? 357  LEU H CG  1 
ATOM   7437  C CD1 . LEU K  2 40  ? -12.310 98.474  83.956  1.00 43.64  ? 357  LEU H CD1 1 
ATOM   7438  C CD2 . LEU K  2 40  ? -11.317 99.683  85.930  1.00 43.64  ? 357  LEU H CD2 1 
ATOM   7439  N N   . ARG K  2 41  ? -12.960 96.027  88.753  1.00 76.50  ? 358  ARG H N   1 
ATOM   7440  C CA  . ARG K  2 41  ? -13.788 95.894  89.942  1.00 76.50  ? 358  ARG H CA  1 
ATOM   7441  C C   . ARG K  2 41  ? -12.953 95.596  91.169  1.00 76.50  ? 358  ARG H C   1 
ATOM   7442  O O   . ARG K  2 41  ? -13.310 95.991  92.272  1.00 76.50  ? 358  ARG H O   1 
ATOM   7443  C CB  . ARG K  2 41  ? -14.833 94.788  89.771  1.00 76.50  ? 358  ARG H CB  1 
ATOM   7444  C CG  . ARG K  2 41  ? -14.622 93.882  88.586  1.00 76.50  ? 358  ARG H CG  1 
ATOM   7445  C CD  . ARG K  2 41  ? -15.376 92.569  88.755  1.00 76.50  ? 358  ARG H CD  1 
ATOM   7446  N NE  . ARG K  2 41  ? -16.656 92.548  88.047  1.00 76.50  ? 358  ARG H NE  1 
ATOM   7447  C CZ  . ARG K  2 41  ? -17.770 93.124  88.491  1.00 76.50  ? 358  ARG H CZ  1 
ATOM   7448  N NH1 . ARG K  2 41  ? -17.772 93.775  89.650  1.00 76.50  ? 358  ARG H NH1 1 
ATOM   7449  N NH2 . ARG K  2 41  ? -18.891 93.032  87.784  1.00 76.50  ? 358  ARG H NH2 1 
ATOM   7450  N N   . GLU K  2 42  ? -11.837 94.904  90.980  1.00 66.55  ? 359  GLU H N   1 
ATOM   7451  C CA  . GLU K  2 42  ? -10.969 94.556  92.101  1.00 66.55  ? 359  GLU H CA  1 
ATOM   7452  C C   . GLU K  2 42  ? -10.084 95.707  92.579  1.00 66.55  ? 359  GLU H C   1 
ATOM   7453  O O   . GLU K  2 42  ? -10.189 96.146  93.720  1.00 66.55  ? 359  GLU H O   1 
ATOM   7454  C CB  . GLU K  2 42  ? -10.080 93.363  91.733  1.00 66.55  ? 359  GLU H CB  1 
ATOM   7455  C CG  . GLU K  2 42  ? -10.711 91.986  91.957  1.00 66.55  ? 359  GLU H CG  1 
ATOM   7456  C CD  . GLU K  2 42  ? -9.852  90.856  91.381  1.00 66.55  ? 359  GLU H CD  1 
ATOM   7457  O OE1 . GLU K  2 42  ? -8.616  91.057  91.253  1.00 66.55  ? 359  GLU H OE1 1 
ATOM   7458  O OE2 . GLU K  2 42  ? -10.407 89.776  91.058  1.00 66.55  ? 359  GLU H OE2 1 
ATOM   7459  N N   . ARG K  2 43  ? -9.215  96.196  91.702  1.00 90.42  ? 360  ARG H N   1 
ATOM   7460  C CA  . ARG K  2 43  ? -8.297  97.272  92.060  1.00 90.42  ? 360  ARG H CA  1 
ATOM   7461  C C   . ARG K  2 43  ? -8.937  98.643  92.315  1.00 90.42  ? 360  ARG H C   1 
ATOM   7462  O O   . ARG K  2 43  ? -8.549  99.345  93.255  1.00 90.42  ? 360  ARG H O   1 
ATOM   7463  C CB  . ARG K  2 43  ? -7.219  97.419  90.978  1.00 90.42  ? 360  ARG H CB  1 
ATOM   7464  C CG  . ARG K  2 43  ? -6.841  96.126  90.267  1.00 90.42  ? 360  ARG H CG  1 
ATOM   7465  C CD  . ARG K  2 43  ? -6.362  95.080  91.256  1.00 90.42  ? 360  ARG H CD  1 
ATOM   7466  N NE  . ARG K  2 43  ? -4.910  94.909  91.243  1.00 90.42  ? 360  ARG H NE  1 
ATOM   7467  C CZ  . ARG K  2 43  ? -4.031  95.868  91.514  1.00 90.42  ? 360  ARG H CZ  1 
ATOM   7468  N NH1 . ARG K  2 43  ? -4.445  97.086  91.824  1.00 90.42  ? 360  ARG H NH1 1 
ATOM   7469  N NH2 . ARG K  2 43  ? -2.730  95.605  91.485  1.00 90.42  ? 360  ARG H NH2 1 
ATOM   7470  N N   . CYS K  2 44  ? -9.907  99.026  91.487  1.00 64.37  ? 361  CYS H N   1 
ATOM   7471  C CA  . CYS K  2 44  ? -10.555 100.331 91.621  1.00 64.37  ? 361  CYS H CA  1 
ATOM   7472  C C   . CYS K  2 44  ? -10.966 100.698 93.047  1.00 64.37  ? 361  CYS H C   1 
ATOM   7473  O O   . CYS K  2 44  ? -10.679 101.799 93.518  1.00 64.37  ? 361  CYS H O   1 
ATOM   7474  C CB  . CYS K  2 44  ? -11.759 100.417 90.683  1.00 64.37  ? 361  CYS H CB  1 
ATOM   7475  S SG  . CYS K  2 44  ? -11.337 101.111 89.073  1.00 64.37  ? 361  CYS H SG  1 
ATOM   7476  N N   . PRO K  2 45  ? -11.660 99.791  93.749  1.00 71.61  ? 362  PRO H N   1 
ATOM   7477  C CA  . PRO K  2 45  ? -12.064 100.106 95.124  1.00 71.61  ? 362  PRO H CA  1 
ATOM   7478  C C   . PRO K  2 45  ? -10.833 100.368 95.988  1.00 71.61  ? 362  PRO H C   1 
ATOM   7479  O O   . PRO K  2 45  ? -10.848 101.246 96.845  1.00 71.61  ? 362  PRO H O   1 
ATOM   7480  C CB  . PRO K  2 45  ? -12.819 98.860  95.573  1.00 71.61  ? 362  PRO H CB  1 
ATOM   7481  C CG  . PRO K  2 45  ? -13.234 98.184  94.295  1.00 71.61  ? 362  PRO H CG  1 
ATOM   7482  C CD  . PRO K  2 45  ? -12.131 98.461  93.326  1.00 71.61  ? 362  PRO H CD  1 
ATOM   7483  N N   . ARG K  2 46  B -9.769  99.604  95.753  1.00 84.72  ? 362  ARG H N   1 
ATOM   7484  C CA  . ARG K  2 46  B -8.526  99.765  96.497  1.00 84.72  ? 362  ARG H CA  1 
ATOM   7485  C C   . ARG K  2 46  B -7.882  101.103 96.129  1.00 84.72  ? 362  ARG H C   1 
ATOM   7486  O O   . ARG K  2 46  B -6.835  101.470 96.669  1.00 84.72  ? 362  ARG H O   1 
ATOM   7487  C CB  . ARG K  2 46  B -7.567  98.614  96.182  1.00 84.72  ? 362  ARG H CB  1 
ATOM   7488  C CG  . ARG K  2 46  B -8.257  97.277  95.945  1.00 84.72  ? 362  ARG H CG  1 
ATOM   7489  C CD  . ARG K  2 46  B -7.912  96.263  97.031  1.00 84.72  ? 362  ARG H CD  1 
ATOM   7490  N NE  . ARG K  2 46  B -8.437  94.921  96.747  1.00 84.72  ? 362  ARG H NE  1 
ATOM   7491  C CZ  . ARG K  2 46  B -8.848  94.055  97.677  1.00 84.72  ? 362  ARG H CZ  1 
ATOM   7492  N NH1 . ARG K  2 46  B -8.800  94.382  98.964  1.00 84.72  ? 362  ARG H NH1 1 
ATOM   7493  N NH2 . ARG K  2 46  B -9.295  92.853  97.325  1.00 84.72  ? 362  ARG H NH2 1 
ATOM   7494  N N   . GLY K  2 47  ? -8.519  101.816 95.200  1.00 69.39  ? 363  GLY H N   1 
ATOM   7495  C CA  . GLY K  2 47  ? -8.040  103.120 94.766  1.00 69.39  ? 363  GLY H CA  1 
ATOM   7496  C C   . GLY K  2 47  ? -6.848  103.109 93.831  1.00 69.39  ? 363  GLY H C   1 
ATOM   7497  O O   . GLY K  2 47  ? -6.168  104.127 93.686  1.00 69.39  ? 363  GLY H O   1 
ATOM   7498  N N   . ASP K  2 48  ? -6.606  101.967 93.189  1.00 61.87  ? 364  ASP H N   1 
ATOM   7499  C CA  . ASP K  2 48  ? -5.482  101.805 92.269  1.00 61.87  ? 364  ASP H CA  1 
ATOM   7500  C C   . ASP K  2 48  ? -5.622  102.527 90.931  1.00 61.87  ? 364  ASP H C   1 
ATOM   7501  O O   . ASP K  2 48  ? -6.668  102.451 90.281  1.00 61.87  ? 364  ASP H O   1 
ATOM   7502  C CB  . ASP K  2 48  ? -5.244  100.319 92.009  1.00 61.87  ? 364  ASP H CB  1 
ATOM   7503  C CG  . ASP K  2 48  ? -4.470  99.664  93.123  1.00 61.87  ? 364  ASP H CG  1 
ATOM   7504  O OD1 . ASP K  2 48  ? -3.469  100.266 93.558  1.00 61.87  ? 364  ASP H OD1 1 
ATOM   7505  O OD2 . ASP K  2 48  ? -4.862  98.560  93.569  1.00 61.87  ? 364  ASP H OD2 1 
ATOM   7506  N N   . ASP K  2 49  ? -4.545  103.209 90.528  1.00 60.54  ? 365  ASP H N   1 
ATOM   7507  C CA  . ASP K  2 49  ? -4.485  103.949 89.267  1.00 60.54  ? 365  ASP H CA  1 
ATOM   7508  C C   . ASP K  2 49  ? -4.781  103.042 88.070  1.00 60.54  ? 365  ASP H C   1 
ATOM   7509  O O   . ASP K  2 49  ? -4.511  101.846 88.092  1.00 60.54  ? 365  ASP H O   1 
ATOM   7510  C CB  . ASP K  2 49  ? -3.105  104.583 89.111  1.00 60.54  ? 365  ASP H CB  1 
ATOM   7511  C CG  . ASP K  2 49  ? -2.600  104.541 87.680  1.00 60.54  ? 365  ASP H CG  1 
ATOM   7512  O OD1 . ASP K  2 49  ? -1.948  103.543 87.313  1.00 60.54  ? 365  ASP H OD1 1 
ATOM   7513  O OD2 . ASP K  2 49  ? -2.851  105.502 86.919  1.00 60.54  ? 365  ASP H OD2 1 
ATOM   7514  N N   . ILE K  2 50  ? -5.328  103.623 87.016  1.00 42.38  ? 366  ILE H N   1 
ATOM   7515  C CA  . ILE K  2 50  ? -5.678  102.846 85.839  1.00 42.38  ? 366  ILE H CA  1 
ATOM   7516  C C   . ILE K  2 50  ? -4.471  102.217 85.148  1.00 42.38  ? 366  ILE H C   1 
ATOM   7517  O O   . ILE K  2 50  ? -4.555  101.087 84.654  1.00 42.38  ? 366  ILE H O   1 
ATOM   7518  C CB  . ILE K  2 50  ? -6.494  103.709 84.816  1.00 42.38  ? 366  ILE H CB  1 
ATOM   7519  C CG1 . ILE K  2 50  ? -7.642  102.878 84.239  1.00 42.38  ? 366  ILE H CG1 1 
ATOM   7520  C CG2 . ILE K  2 50  ? -5.589  104.245 83.712  1.00 42.38  ? 366  ILE H CG2 1 
ATOM   7521  C CD1 . ILE K  2 50  ? -7.189  101.614 83.573  1.00 42.38  ? 366  ILE H CD1 1 
ATOM   7522  N N   . LEU K  2 51  ? -3.352  102.934 85.101  1.00 32.94  ? 367  LEU H N   1 
ATOM   7523  C CA  . LEU K  2 51  ? -2.187  102.368 84.456  1.00 32.94  ? 367  LEU H CA  1 
ATOM   7524  C C   . LEU K  2 51  ? -1.835  101.108 85.214  1.00 32.94  ? 367  LEU H C   1 
ATOM   7525  O O   . LEU K  2 51  ? -1.589  100.061 84.615  1.00 32.94  ? 367  LEU H O   1 
ATOM   7526  C CB  . LEU K  2 51  ? -1.035  103.365 84.455  1.00 32.94  ? 367  LEU H CB  1 
ATOM   7527  C CG  . LEU K  2 51  ? -0.741  103.895 83.043  1.00 32.94  ? 367  LEU H CG  1 
ATOM   7528  C CD1 . LEU K  2 51  ? -1.990  103.847 82.166  1.00 32.94  ? 367  LEU H CD1 1 
ATOM   7529  C CD2 . LEU K  2 51  ? -0.224  105.313 83.136  1.00 32.94  ? 367  LEU H CD2 1 
ATOM   7530  N N   . THR K  2 52  ? -1.851  101.206 86.539  1.00 34.57  ? 368  THR H N   1 
ATOM   7531  C CA  . THR K  2 52  ? -1.563  100.067 87.410  1.00 34.57  ? 368  THR H CA  1 
ATOM   7532  C C   . THR K  2 52  ? -2.463  98.893  87.028  1.00 34.57  ? 368  THR H C   1 
ATOM   7533  O O   . THR K  2 52  ? -1.984  97.799  86.771  1.00 34.57  ? 368  THR H O   1 
ATOM   7534  C CB  . THR K  2 52  ? -1.834  100.407 88.891  1.00 34.57  ? 368  THR H CB  1 
ATOM   7535  O OG1 . THR K  2 52  ? -0.961  101.461 89.328  1.00 34.57  ? 368  THR H OG1 1 
ATOM   7536  C CG2 . THR K  2 52  ? -1.627  99.182  89.754  1.00 34.57  ? 368  THR H CG2 1 
ATOM   7537  N N   . ILE K  2 53  ? -3.772  99.123  86.992  1.00 42.61  ? 369  ILE H N   1 
ATOM   7538  C CA  . ILE K  2 53  ? -4.715  98.068  86.629  1.00 42.61  ? 369  ILE H CA  1 
ATOM   7539  C C   . ILE K  2 53  ? -4.349  97.483  85.272  1.00 42.61  ? 369  ILE H C   1 
ATOM   7540  O O   . ILE K  2 53  ? -4.144  96.281  85.135  1.00 42.61  ? 369  ILE H O   1 
ATOM   7541  C CB  . ILE K  2 53  ? -6.184  98.606  86.540  1.00 42.61  ? 369  ILE H CB  1 
ATOM   7542  C CG1 . ILE K  2 53  ? -6.706  98.961  87.935  1.00 42.61  ? 369  ILE H CG1 1 
ATOM   7543  C CG2 . ILE K  2 53  ? -7.107  97.566  85.876  1.00 42.61  ? 369  ILE H CG2 1 
ATOM   7544  C CD1 . ILE K  2 53  ? -7.152  100.419 88.071  1.00 42.61  ? 369  ILE H CD1 1 
ATOM   7545  N N   . LEU K  2 54  ? -4.284  98.352  84.272  1.00 42.13  ? 370  LEU H N   1 
ATOM   7546  C CA  . LEU K  2 54  ? -3.966  97.948  82.913  1.00 42.13  ? 370  LEU H CA  1 
ATOM   7547  C C   . LEU K  2 54  ? -2.681  97.129  82.856  1.00 42.13  ? 370  LEU H C   1 
ATOM   7548  O O   . LEU K  2 54  ? -2.536  96.242  82.005  1.00 42.13  ? 370  LEU H O   1 
ATOM   7549  C CB  . LEU K  2 54  ? -3.853  99.184  82.021  1.00 42.13  ? 370  LEU H CB  1 
ATOM   7550  C CG  . LEU K  2 54  ? -5.154  99.567  81.316  1.00 42.13  ? 370  LEU H CG  1 
ATOM   7551  C CD1 . LEU K  2 54  ? -4.926  100.748 80.412  1.00 42.13  ? 370  LEU H CD1 1 
ATOM   7552  C CD2 . LEU K  2 54  ? -5.651  98.394  80.495  1.00 42.13  ? 370  LEU H CD2 1 
ATOM   7553  N N   . THR K  2 55  ? -1.741  97.425  83.749  1.00 35.11  ? 371  THR H N   1 
ATOM   7554  C CA  . THR K  2 55  ? -0.497  96.668  83.779  1.00 35.11  ? 371  THR H CA  1 
ATOM   7555  C C   . THR K  2 55  ? -0.841  95.234  84.201  1.00 35.11  ? 371  THR H C   1 
ATOM   7556  O O   . THR K  2 55  ? -0.384  94.266  83.587  1.00 35.11  ? 371  THR H O   1 
ATOM   7557  C CB  . THR K  2 55  ? 0.504   97.257  84.791  1.00 35.11  ? 371  THR H CB  1 
ATOM   7558  O OG1 . THR K  2 55  ? 1.190   98.367  84.205  1.00 35.11  ? 371  THR H OG1 1 
ATOM   7559  C CG2 . THR K  2 55  ? 1.512   96.212  85.185  1.00 35.11  ? 371  THR H CG2 1 
ATOM   7560  N N   . GLU K  2 56  ? -1.658  95.107  85.247  1.00 61.07  ? 372  GLU H N   1 
ATOM   7561  C CA  . GLU K  2 56  ? -2.073  93.803  85.760  1.00 61.07  ? 372  GLU H CA  1 
ATOM   7562  C C   . GLU K  2 56  ? -2.822  93.002  84.700  1.00 61.07  ? 372  GLU H C   1 
ATOM   7563  O O   . GLU K  2 56  ? -2.622  91.796  84.562  1.00 61.07  ? 372  GLU H O   1 
ATOM   7564  C CB  . GLU K  2 56  ? -2.962  93.980  86.985  1.00 61.07  ? 372  GLU H CB  1 
ATOM   7565  C CG  . GLU K  2 56  ? -3.544  92.689  87.530  1.00 61.07  ? 372  GLU H CG  1 
ATOM   7566  C CD  . GLU K  2 56  ? -4.216  92.902  88.875  1.00 61.07  ? 372  GLU H CD  1 
ATOM   7567  O OE1 . GLU K  2 56  ? -3.590  93.536  89.750  1.00 61.07  ? 372  GLU H OE1 1 
ATOM   7568  O OE2 . GLU K  2 56  ? -5.369  92.448  89.065  1.00 61.07  ? 372  GLU H OE2 1 
ATOM   7569  N N   . VAL K  2 57  ? -3.698  93.676  83.963  1.00 39.95  ? 373  VAL H N   1 
ATOM   7570  C CA  . VAL K  2 57  ? -4.451  93.016  82.906  1.00 39.95  ? 373  VAL H CA  1 
ATOM   7571  C C   . VAL K  2 57  ? -3.456  92.430  81.918  1.00 39.95  ? 373  VAL H C   1 
ATOM   7572  O O   . VAL K  2 57  ? -3.694  91.368  81.344  1.00 39.95  ? 373  VAL H O   1 
ATOM   7573  C CB  . VAL K  2 57  ? -5.346  94.010  82.168  1.00 39.95  ? 373  VAL H CB  1 
ATOM   7574  C CG1 . VAL K  2 57  ? -6.015  93.333  80.984  1.00 39.95  ? 373  VAL H CG1 1 
ATOM   7575  C CG2 . VAL K  2 57  ? -6.367  94.573  83.126  1.00 39.95  ? 373  VAL H CG2 1 
ATOM   7576  N N   . ASN K  2 58  ? -2.343  93.144  81.727  1.00 45.86  ? 374  ASN H N   1 
ATOM   7577  C CA  . ASN K  2 58  ? -1.272  92.720  80.826  1.00 45.86  ? 374  ASN H CA  1 
ATOM   7578  C C   . ASN K  2 58  ? -0.704  91.442  81.398  1.00 45.86  ? 374  ASN H C   1 
ATOM   7579  O O   . ASN K  2 58  ? -0.393  90.505  80.670  1.00 45.86  ? 374  ASN H O   1 
ATOM   7580  C CB  . ASN K  2 58  ? -0.172  93.779  80.757  1.00 45.86  ? 374  ASN H CB  1 
ATOM   7581  C CG  . ASN K  2 58  ? -0.370  94.763  79.612  1.00 45.86  ? 374  ASN H CG  1 
ATOM   7582  O OD1 . ASN K  2 58  ? -1.290  94.622  78.806  1.00 45.86  ? 374  ASN H OD1 1 
ATOM   7583  N ND2 . ASN K  2 58  ? 0.499   95.769  79.537  1.00 45.86  ? 374  ASN H ND2 1 
ATOM   7584  N N   . TYR K  2 59  ? -0.575  91.400  82.714  1.00 68.02  ? 375  TYR H N   1 
ATOM   7585  C CA  . TYR K  2 59  ? -0.071  90.206  83.349  1.00 68.02  ? 375  TYR H CA  1 
ATOM   7586  C C   . TYR K  2 59  ? -1.043  89.036  83.103  1.00 68.02  ? 375  TYR H C   1 
ATOM   7587  O O   . TYR K  2 59  ? -0.739  88.116  82.343  1.00 68.02  ? 375  TYR H O   1 
ATOM   7588  C CB  . TYR K  2 59  ? 0.097   90.456  84.840  1.00 68.02  ? 375  TYR H CB  1 
ATOM   7589  C CG  . TYR K  2 59  ? 0.745   89.306  85.557  1.00 68.02  ? 375  TYR H CG  1 
ATOM   7590  C CD1 . TYR K  2 59  ? 2.104   89.327  85.866  1.00 68.02  ? 375  TYR H CD1 1 
ATOM   7591  C CD2 . TYR K  2 59  ? -0.002  88.190  85.934  1.00 68.02  ? 375  TYR H CD2 1 
ATOM   7592  C CE1 . TYR K  2 59  ? 2.706   88.263  86.537  1.00 68.02  ? 375  TYR H CE1 1 
ATOM   7593  C CE2 . TYR K  2 59  ? 0.588   87.117  86.606  1.00 68.02  ? 375  TYR H CE2 1 
ATOM   7594  C CZ  . TYR K  2 59  ? 1.939   87.161  86.905  1.00 68.02  ? 375  TYR H CZ  1 
ATOM   7595  O OH  . TYR K  2 59  ? 2.508   86.099  87.572  1.00 68.02  ? 375  TYR H OH  1 
ATOM   7596  N N   . GLU K  2 60  ? -2.217  89.096  83.730  1.00 69.03  ? 376  GLU H N   1 
ATOM   7597  C CA  . GLU K  2 60  ? -3.233  88.049  83.614  1.00 69.03  ? 376  GLU H CA  1 
ATOM   7598  C C   . GLU K  2 60  ? -3.371  87.469  82.224  1.00 69.03  ? 376  GLU H C   1 
ATOM   7599  O O   . GLU K  2 60  ? -3.381  86.256  82.039  1.00 69.03  ? 376  GLU H O   1 
ATOM   7600  C CB  . GLU K  2 60  ? -4.598  88.576  84.057  1.00 69.03  ? 376  GLU H CB  1 
ATOM   7601  C CG  . GLU K  2 60  ? -4.586  89.300  85.395  1.00 69.03  ? 376  GLU H CG  1 
ATOM   7602  C CD  . GLU K  2 60  ? -3.959  88.478  86.519  1.00 69.03  ? 376  GLU H CD  1 
ATOM   7603  O OE1 . GLU K  2 60  ? -4.228  87.259  86.585  1.00 69.03  ? 376  GLU H OE1 1 
ATOM   7604  O OE2 . GLU K  2 60  ? -3.200  89.051  87.338  1.00 69.03  ? 376  GLU H OE2 1 
ATOM   7605  N N   . VAL K  2 61  ? -3.480  88.341  81.238  1.00 37.71  ? 377  VAL H N   1 
ATOM   7606  C CA  . VAL K  2 61  ? -3.650  87.889  79.865  1.00 37.71  ? 377  VAL H CA  1 
ATOM   7607  C C   . VAL K  2 61  ? -2.434  87.141  79.361  1.00 37.71  ? 377  VAL H C   1 
ATOM   7608  O O   . VAL K  2 61  ? -2.559  86.205  78.576  1.00 37.71  ? 377  VAL H O   1 
ATOM   7609  C CB  . VAL K  2 61  ? -3.921  89.070  78.908  1.00 37.71  ? 377  VAL H CB  1 
ATOM   7610  C CG1 . VAL K  2 61  ? -4.061  88.575  77.482  1.00 37.71  ? 377  VAL H CG1 1 
ATOM   7611  C CG2 . VAL K  2 61  ? -5.173  89.788  79.330  1.00 37.71  ? 377  VAL H CG2 1 
ATOM   7612  N N   . SER K  2 62  ? -1.253  87.551  79.810  1.00 53.22  ? 378  SER H N   1 
ATOM   7613  C CA  . SER K  2 62  ? -0.024  86.906  79.369  1.00 53.22  ? 378  SER H CA  1 
ATOM   7614  C C   . SER K  2 62  ? -0.004  85.424  79.690  1.00 53.22  ? 378  SER H C   1 
ATOM   7615  O O   . SER K  2 62  ? 0.585   84.636  78.950  1.00 53.22  ? 378  SER H O   1 
ATOM   7616  C CB  . SER K  2 62  ? 1.187   87.560  80.030  1.00 53.22  ? 378  SER H CB  1 
ATOM   7617  O OG  . SER K  2 62  ? 1.507   88.789  79.405  1.00 53.22  ? 378  SER H OG  1 
ATOM   7618  N N   . ASN K  2 63  ? -0.665  85.049  80.785  1.00 77.07  ? 379  ASN H N   1 
ATOM   7619  C CA  . ASN K  2 63  ? -0.687  83.666  81.248  1.00 77.07  ? 379  ASN H CA  1 
ATOM   7620  C C   . ASN K  2 63  ? -1.734  82.742  80.654  1.00 77.07  ? 379  ASN H C   1 
ATOM   7621  O O   . ASN K  2 63  ? -1.769  81.556  80.972  1.00 77.07  ? 379  ASN H O   1 
ATOM   7622  C CB  . ASN K  2 63  ? -0.796  83.650  82.766  1.00 77.07  ? 379  ASN H CB  1 
ATOM   7623  C CG  . ASN K  2 63  ? 0.331   84.417  83.432  1.00 77.07  ? 379  ASN H CG  1 
ATOM   7624  O OD1 . ASN K  2 63  ? 1.287   84.836  82.775  1.00 77.07  ? 379  ASN H OD1 1 
ATOM   7625  N ND2 . ASN K  2 63  ? 0.227   84.605  84.742  1.00 77.07  ? 379  ASN H ND2 1 
ATOM   7626  N N   . LYS K  2 64  ? -2.589  83.267  79.791  1.00 57.25  ? 381  LYS H N   1 
ATOM   7627  C CA  . LYS K  2 64  ? -3.609  82.433  79.167  1.00 57.25  ? 381  LYS H CA  1 
ATOM   7628  C C   . LYS K  2 64  ? -2.999  81.720  77.955  1.00 57.25  ? 381  LYS H C   1 
ATOM   7629  O O   . LYS K  2 64  ? -2.101  82.256  77.316  1.00 57.25  ? 381  LYS H O   1 
ATOM   7630  C CB  . LYS K  2 64  ? -4.797  83.310  78.757  1.00 57.25  ? 381  LYS H CB  1 
ATOM   7631  C CG  . LYS K  2 64  ? -5.151  84.369  79.801  1.00 57.25  ? 381  LYS H CG  1 
ATOM   7632  C CD  . LYS K  2 64  ? -6.668  84.521  79.938  1.00 57.25  ? 381  LYS H CD  1 
ATOM   7633  C CE  . LYS K  2 64  ? -7.144  84.459  81.402  1.00 57.25  ? 381  LYS H CE  1 
ATOM   7634  N NZ  . LYS K  2 64  ? -8.227  83.445  81.601  1.00 57.25  ? 381  LYS H NZ  1 
ATOM   7635  N N   . ASP K  2 65  A -3.469  80.517  77.641  1.00 79.53  ? 381  ASP H N   1 
ATOM   7636  C CA  . ASP K  2 65  A -2.921  79.781  76.501  1.00 79.53  ? 381  ASP H CA  1 
ATOM   7637  C C   . ASP K  2 65  A -3.960  79.220  75.549  1.00 79.53  ? 381  ASP H C   1 
ATOM   7638  O O   . ASP K  2 65  A -5.078  78.903  75.939  1.00 79.53  ? 381  ASP H O   1 
ATOM   7639  C CB  . ASP K  2 65  A -2.057  78.604  76.972  1.00 79.53  ? 381  ASP H CB  1 
ATOM   7640  C CG  . ASP K  2 65  A -0.869  79.041  77.792  1.00 79.53  ? 381  ASP H CG  1 
ATOM   7641  O OD1 . ASP K  2 65  A 0.242   79.144  77.220  1.00 79.53  ? 381  ASP H OD1 1 
ATOM   7642  O OD2 . ASP K  2 65  A -1.052  79.277  79.010  1.00 79.53  ? 381  ASP H OD2 1 
ATOM   7643  N N   . ASP K  2 66  B -3.555  79.093  74.293  1.00 100.00 ? 381  ASP H N   1 
ATOM   7644  C CA  . ASP K  2 66  B -4.383  78.519  73.248  1.00 100.00 ? 381  ASP H CA  1 
ATOM   7645  C C   . ASP K  2 66  B -3.518  77.358  72.770  1.00 100.00 ? 381  ASP H C   1 
ATOM   7646  O O   . ASP K  2 66  B -2.703  77.512  71.852  1.00 100.00 ? 381  ASP H O   1 
ATOM   7647  C CB  . ASP K  2 66  B -4.602  79.523  72.108  1.00 100.00 ? 381  ASP H CB  1 
ATOM   7648  C CG  . ASP K  2 66  B -5.041  78.852  70.802  1.00 100.00 ? 381  ASP H CG  1 
ATOM   7649  O OD1 . ASP K  2 66  B -5.728  77.806  70.858  1.00 100.00 ? 381  ASP H OD1 1 
ATOM   7650  O OD2 . ASP K  2 66  B -4.700  79.372  69.714  1.00 100.00 ? 381  ASP H OD2 1 
ATOM   7651  N N   . LYS K  2 67  C -3.675  76.201  73.401  1.00 99.17  ? 381  LYS H N   1 
ATOM   7652  C CA  . LYS K  2 67  C -2.862  75.047  73.039  1.00 99.17  ? 381  LYS H CA  1 
ATOM   7653  C C   . LYS K  2 67  C -2.949  74.605  71.579  1.00 99.17  ? 381  LYS H C   1 
ATOM   7654  O O   . LYS K  2 67  C -1.929  74.250  70.987  1.00 99.17  ? 381  LYS H O   1 
ATOM   7655  C CB  . LYS K  2 67  C -3.183  73.876  73.969  1.00 99.17  ? 381  LYS H CB  1 
ATOM   7656  C CG  . LYS K  2 67  C -2.470  73.960  75.319  1.00 99.17  ? 381  LYS H CG  1 
ATOM   7657  C CD  . LYS K  2 67  C -1.006  74.384  75.159  1.00 99.17  ? 381  LYS H CD  1 
ATOM   7658  C CE  . LYS K  2 67  C -0.417  74.896  76.466  1.00 99.17  ? 381  LYS H CE  1 
ATOM   7659  N NZ  . LYS K  2 67  C 1.064   74.733  76.507  1.00 99.17  ? 381  LYS H NZ  1 
ATOM   7660  N N   . LYS K  2 68  D -4.149  74.628  71.000  1.00 81.98  ? 381  LYS H N   1 
ATOM   7661  C CA  . LYS K  2 68  D -4.339  74.225  69.601  1.00 81.98  ? 381  LYS H CA  1 
ATOM   7662  C C   . LYS K  2 68  D -3.152  74.660  68.729  1.00 81.98  ? 381  LYS H C   1 
ATOM   7663  O O   . LYS K  2 68  D -2.484  73.823  68.112  1.00 81.98  ? 381  LYS H O   1 
ATOM   7664  C CB  . LYS K  2 68  D -5.647  74.822  69.041  1.00 81.98  ? 381  LYS H CB  1 
ATOM   7665  C CG  . LYS K  2 68  D -5.934  74.479  67.570  1.00 81.98  ? 381  LYS H CG  1 
ATOM   7666  C CD  . LYS K  2 68  D -7.256  75.084  67.070  1.00 81.98  ? 381  LYS H CD  1 
ATOM   7667  C CE  . LYS K  2 68  D -7.420  74.885  65.557  1.00 81.98  ? 381  LYS H CE  1 
ATOM   7668  N NZ  . LYS K  2 68  D -8.419  75.813  64.946  1.00 81.98  ? 381  LYS H NZ  1 
ATOM   7669  N N   . ASN K  2 69  E -2.890  75.968  68.685  1.00 99.51  ? 381  ASN H N   1 
ATOM   7670  C CA  . ASN K  2 69  E -1.778  76.509  67.897  1.00 99.51  ? 381  ASN H CA  1 
ATOM   7671  C C   . ASN K  2 69  E -0.725  77.176  68.790  1.00 99.51  ? 381  ASN H C   1 
ATOM   7672  O O   . ASN K  2 69  E -0.081  78.148  68.380  1.00 99.51  ? 381  ASN H O   1 
ATOM   7673  C CB  . ASN K  2 69  E -2.293  77.525  66.864  1.00 99.51  ? 381  ASN H CB  1 
ATOM   7674  C CG  . ASN K  2 69  E -3.777  77.376  66.584  1.00 99.51  ? 381  ASN H CG  1 
ATOM   7675  O OD1 . ASN K  2 69  E -4.178  76.745  65.605  1.00 99.51  ? 381  ASN H OD1 1 
ATOM   7676  N ND2 . ASN K  2 69  E -4.601  77.958  67.448  1.00 99.51  ? 381  ASN H ND2 1 
ATOM   7677  N N   . MET K  2 70  ? -0.550  76.642  70.000  1.00 100.00 ? 382  MET H N   1 
ATOM   7678  C CA  . MET K  2 70  ? 0.421   77.170  70.967  1.00 100.00 ? 382  MET H CA  1 
ATOM   7679  C C   . MET K  2 70  ? 0.502   78.701  70.901  1.00 100.00 ? 382  MET H C   1 
ATOM   7680  O O   . MET K  2 70  ? 1.588   79.281  70.765  1.00 100.00 ? 382  MET H O   1 
ATOM   7681  C CB  . MET K  2 70  ? 1.817   76.555  70.725  1.00 100.00 ? 382  MET H CB  1 
ATOM   7682  C CG  . MET K  2 70  ? 2.234   76.422  69.244  1.00 100.00 ? 382  MET H CG  1 
ATOM   7683  S SD  . MET K  2 70  ? 3.706   75.356  68.899  1.00 100.00 ? 382  MET H SD  1 
ATOM   7684  C CE  . MET K  2 70  ? 5.072   76.507  69.357  1.00 100.00 ? 382  MET H CE  1 
ATOM   7685  N N   . GLY K  2 71  ? -0.660  79.343  71.004  1.00 84.45  ? 383  GLY H N   1 
ATOM   7686  C CA  . GLY K  2 71  ? -0.721  80.791  70.934  1.00 84.45  ? 383  GLY H CA  1 
ATOM   7687  C C   . GLY K  2 71  ? -0.895  81.530  72.246  1.00 84.45  ? 383  GLY H C   1 
ATOM   7688  O O   . GLY K  2 71  ? -1.265  80.967  73.277  1.00 84.45  ? 383  GLY H O   1 
ATOM   7689  N N   . LYS K  2 72  ? -0.616  82.823  72.186  1.00 55.05  ? 384  LYS H N   1 
ATOM   7690  C CA  . LYS K  2 72  ? -0.723  83.719  73.328  1.00 55.05  ? 384  LYS H CA  1 
ATOM   7691  C C   . LYS K  2 72  ? -1.311  85.044  72.829  1.00 55.05  ? 384  LYS H C   1 
ATOM   7692  O O   . LYS K  2 72  ? -1.645  85.186  71.643  1.00 55.05  ? 384  LYS H O   1 
ATOM   7693  C CB  . LYS K  2 72  ? 0.659   83.954  73.940  1.00 55.05  ? 384  LYS H CB  1 
ATOM   7694  C CG  . LYS K  2 72  ? 1.350   82.683  74.384  1.00 55.05  ? 384  LYS H CG  1 
ATOM   7695  C CD  . LYS K  2 72  ? 1.900   82.824  75.789  1.00 55.05  ? 384  LYS H CD  1 
ATOM   7696  C CE  . LYS K  2 72  ? 0.840   82.519  76.838  1.00 55.05  ? 384  LYS H CE  1 
ATOM   7697  N NZ  . LYS K  2 72  ? 1.387   81.760  78.012  1.00 55.05  ? 384  LYS H NZ  1 
ATOM   7698  N N   . GLN K  2 73  ? -1.424  86.018  73.722  1.00 53.27  ? 385  GLN H N   1 
ATOM   7699  C CA  . GLN K  2 73  ? -1.998  87.298  73.349  1.00 53.27  ? 385  GLN H CA  1 
ATOM   7700  C C   . GLN K  2 73  ? -1.381  88.377  74.222  1.00 53.27  ? 385  GLN H C   1 
ATOM   7701  O O   . GLN K  2 73  ? -1.329  88.233  75.443  1.00 53.27  ? 385  GLN H O   1 
ATOM   7702  C CB  . GLN K  2 73  ? -3.530  87.224  73.520  1.00 53.27  ? 385  GLN H CB  1 
ATOM   7703  C CG  . GLN K  2 73  ? -4.229  88.466  74.057  1.00 53.27  ? 385  GLN H CG  1 
ATOM   7704  C CD  . GLN K  2 73  ? -5.675  88.553  73.612  1.00 53.27  ? 385  GLN H CD  1 
ATOM   7705  O OE1 . GLN K  2 73  ? -6.155  87.715  72.849  1.00 53.27  ? 385  GLN H OE1 1 
ATOM   7706  N NE2 . GLN K  2 73  ? -6.378  89.572  74.086  1.00 53.27  ? 385  GLN H NE2 1 
ATOM   7707  N N   . MET K  2 74  ? -0.913  89.455  73.590  1.00 48.60  ? 386  MET H N   1 
ATOM   7708  C CA  . MET K  2 74  ? -0.284  90.565  74.308  1.00 48.60  ? 386  MET H CA  1 
ATOM   7709  C C   . MET K  2 74  ? -1.006  91.914  74.196  1.00 48.60  ? 386  MET H C   1 
ATOM   7710  O O   . MET K  2 74  ? -0.866  92.625  73.195  1.00 48.60  ? 386  MET H O   1 
ATOM   7711  C CB  . MET K  2 74  ? 1.164   90.739  73.826  1.00 48.60  ? 386  MET H CB  1 
ATOM   7712  C CG  . MET K  2 74  ? 1.991   91.677  74.673  1.00 48.60  ? 386  MET H CG  1 
ATOM   7713  S SD  . MET K  2 74  ? 2.214   90.980  76.310  1.00 48.60  ? 386  MET H SD  1 
ATOM   7714  C CE  . MET K  2 74  ? 1.560   92.230  77.350  1.00 48.60  ? 386  MET H CE  1 
ATOM   7715  N N   . PRO K  2 75  ? -1.809  92.272  75.209  1.00 46.08  ? 387  PRO H N   1 
ATOM   7716  C CA  . PRO K  2 75  ? -2.525  93.555  75.187  1.00 46.08  ? 387  PRO H CA  1 
ATOM   7717  C C   . PRO K  2 75  ? -1.489  94.675  75.254  1.00 46.08  ? 387  PRO H C   1 
ATOM   7718  O O   . PRO K  2 75  ? -0.410  94.477  75.813  1.00 46.08  ? 387  PRO H O   1 
ATOM   7719  C CB  . PRO K  2 75  ? -3.416  93.502  76.427  1.00 46.08  ? 387  PRO H CB  1 
ATOM   7720  C CG  . PRO K  2 75  ? -3.484  92.017  76.788  1.00 46.08  ? 387  PRO H CG  1 
ATOM   7721  C CD  . PRO K  2 75  ? -2.147  91.468  76.393  1.00 46.08  ? 387  PRO H CD  1 
ATOM   7722  N N   . GLN K  2 76  ? -1.815  95.843  74.694  1.00 46.11  ? 388  GLN H N   1 
ATOM   7723  C CA  . GLN K  2 76  ? -0.876  96.953  74.655  1.00 46.11  ? 388  GLN H CA  1 
ATOM   7724  C C   . GLN K  2 76  ? -1.478  98.340  74.723  1.00 46.11  ? 388  GLN H C   1 
ATOM   7725  O O   . GLN K  2 76  ? -1.856  98.927  73.708  1.00 46.11  ? 388  GLN H O   1 
ATOM   7726  C CB  . GLN K  2 76  ? -0.031  96.849  73.395  1.00 46.11  ? 388  GLN H CB  1 
ATOM   7727  C CG  . GLN K  2 76  ? 0.873   98.025  73.178  1.00 46.11  ? 388  GLN H CG  1 
ATOM   7728  C CD  . GLN K  2 76  ? 1.474   98.009  71.803  1.00 46.11  ? 388  GLN H CD  1 
ATOM   7729  O OE1 . GLN K  2 76  ? 1.758   96.944  71.253  1.00 46.11  ? 388  GLN H OE1 1 
ATOM   7730  N NE2 . GLN K  2 76  ? 1.672   99.188  71.227  1.00 46.11  ? 388  GLN H NE2 1 
ATOM   7731  N N   . PRO K  2 77  ? -1.560  98.891  75.929  1.00 33.13  ? 389  PRO H N   1 
ATOM   7732  C CA  . PRO K  2 77  ? -2.101  100.222 76.199  1.00 33.13  ? 389  PRO H CA  1 
ATOM   7733  C C   . PRO K  2 77  ? -1.128  101.350 75.869  1.00 33.13  ? 389  PRO H C   1 
ATOM   7734  O O   . PRO K  2 77  ? 0.050   101.288 76.215  1.00 33.13  ? 389  PRO H O   1 
ATOM   7735  C CB  . PRO K  2 77  ? -2.400  100.178 77.688  1.00 33.13  ? 389  PRO H CB  1 
ATOM   7736  C CG  . PRO K  2 77  ? -1.389  99.254  78.225  1.00 33.13  ? 389  PRO H CG  1 
ATOM   7737  C CD  . PRO K  2 77  ? -1.158  98.208  77.168  1.00 33.13  ? 389  PRO H CD  1 
ATOM   7738  N N   . THR K  2 78  ? -1.641  102.384 75.210  1.00 26.15  ? 390  THR H N   1 
ATOM   7739  C CA  . THR K  2 78  ? -0.860  103.551 74.825  1.00 26.15  ? 390  THR H CA  1 
ATOM   7740  C C   . THR K  2 78  ? -1.502  104.697 75.544  1.00 26.15  ? 390  THR H C   1 
ATOM   7741  O O   . THR K  2 78  ? -2.701  104.653 75.801  1.00 26.15  ? 390  THR H O   1 
ATOM   7742  C CB  . THR K  2 78  ? -1.000  103.848 73.352  1.00 26.15  ? 390  THR H CB  1 
ATOM   7743  O OG1 . THR K  2 78  ? -1.042  102.624 72.621  1.00 26.15  ? 390  THR H OG1 1 
ATOM   7744  C CG2 . THR K  2 78  ? 0.148   104.674 72.890  1.00 26.15  ? 390  THR H CG2 1 
ATOM   7745  N N   . PHE K  2 79  ? -0.756  105.741 75.857  1.00 35.49  ? 392  PHE H N   1 
ATOM   7746  C CA  . PHE K  2 79  ? -1.424  106.815 76.546  1.00 35.49  ? 392  PHE H CA  1 
ATOM   7747  C C   . PHE K  2 79  ? -0.777  108.192 76.506  1.00 35.49  ? 392  PHE H C   1 
ATOM   7748  O O   . PHE K  2 79  ? 0.418   108.344 76.263  1.00 35.49  ? 392  PHE H O   1 
ATOM   7749  C CB  . PHE K  2 79  ? -1.639  106.405 77.985  1.00 35.49  ? 392  PHE H CB  1 
ATOM   7750  C CG  . PHE K  2 79  ? -0.402  106.474 78.799  1.00 35.49  ? 392  PHE H CG  1 
ATOM   7751  C CD1 . PHE K  2 79  ? -0.029  107.667 79.420  1.00 35.49  ? 392  PHE H CD1 1 
ATOM   7752  C CD2 . PHE K  2 79  ? 0.389   105.351 78.972  1.00 35.49  ? 392  PHE H CD2 1 
ATOM   7753  C CE1 . PHE K  2 79  ? 1.117   107.744 80.212  1.00 35.49  ? 392  PHE H CE1 1 
ATOM   7754  C CE2 . PHE K  2 79  ? 1.538   105.414 79.762  1.00 35.49  ? 392  PHE H CE2 1 
ATOM   7755  C CZ  . PHE K  2 79  ? 1.900   106.622 80.388  1.00 35.49  ? 392  PHE H CZ  1 
ATOM   7756  N N   . THR K  2 80  ? -1.605  109.196 76.774  1.00 21.29  ? 393  THR H N   1 
ATOM   7757  C CA  . THR K  2 80  ? -1.188  110.580 76.806  1.00 21.29  ? 393  THR H CA  1 
ATOM   7758  C C   . THR K  2 80  ? -1.695  111.225 78.109  1.00 21.29  ? 393  THR H C   1 
ATOM   7759  O O   . THR K  2 80  ? -1.612  112.449 78.290  1.00 21.29  ? 393  THR H O   1 
ATOM   7760  C CB  . THR K  2 80  ? -1.741  111.278 75.592  1.00 21.29  ? 393  THR H CB  1 
ATOM   7761  O OG1 . THR K  2 80  ? -1.032  110.826 74.445  1.00 21.29  ? 393  THR H OG1 1 
ATOM   7762  C CG2 . THR K  2 80  ? -1.555  112.724 75.692  1.00 21.29  ? 393  THR H CG2 1 
ATOM   7763  N N   . LEU K  2 81  ? -2.194  110.397 79.026  1.00 31.23  ? 394  LEU H N   1 
ATOM   7764  C CA  . LEU K  2 81  ? -2.680  110.917 80.291  1.00 31.23  ? 394  LEU H CA  1 
ATOM   7765  C C   . LEU K  2 81  ? -1.608  111.843 80.892  1.00 31.23  ? 394  LEU H C   1 
ATOM   7766  O O   . LEU K  2 81  ? -0.415  111.613 80.715  1.00 31.23  ? 394  LEU H O   1 
ATOM   7767  C CB  . LEU K  2 81  ? -3.010  109.768 81.254  1.00 31.23  ? 394  LEU H CB  1 
ATOM   7768  C CG  . LEU K  2 81  ? -4.071  108.776 80.760  1.00 31.23  ? 394  LEU H CG  1 
ATOM   7769  C CD1 . LEU K  2 81  ? -4.584  107.916 81.929  1.00 31.23  ? 394  LEU H CD1 1 
ATOM   7770  C CD2 . LEU K  2 81  ? -5.201  109.544 80.086  1.00 31.23  ? 394  LEU H CD2 1 
ATOM   7771  N N   . ARG K  2 82  ? -2.038  112.891 81.593  1.00 40.87  ? 395  ARG H N   1 
ATOM   7772  C CA  . ARG K  2 82  ? -1.122  113.837 82.204  1.00 40.87  ? 395  ARG H CA  1 
ATOM   7773  C C   . ARG K  2 82  ? -1.137  113.756 83.719  1.00 40.87  ? 395  ARG H C   1 
ATOM   7774  O O   . ARG K  2 82  ? -0.406  114.482 84.383  1.00 40.87  ? 395  ARG H O   1 
ATOM   7775  C CB  . ARG K  2 82  ? -1.471  115.250 81.760  1.00 40.87  ? 395  ARG H CB  1 
ATOM   7776  C CG  . ARG K  2 82  ? -0.843  115.606 80.436  1.00 40.87  ? 395  ARG H CG  1 
ATOM   7777  C CD  . ARG K  2 82  ? -1.678  116.582 79.625  1.00 40.87  ? 395  ARG H CD  1 
ATOM   7778  N NE  . ARG K  2 82  ? -2.887  116.980 80.324  1.00 40.87  ? 395  ARG H NE  1 
ATOM   7779  C CZ  . ARG K  2 82  ? -2.966  118.033 81.122  1.00 40.87  ? 395  ARG H CZ  1 
ATOM   7780  N NH1 . ARG K  2 82  ? -1.901  118.807 81.329  1.00 40.87  ? 395  ARG H NH1 1 
ATOM   7781  N NH2 . ARG K  2 82  ? -4.113  118.308 81.715  1.00 40.87  ? 395  ARG H NH2 1 
ATOM   7782  N N   . LYS K  2 83  ? -1.990  112.893 84.260  1.00 39.96  ? 396  LYS H N   1 
ATOM   7783  C CA  . LYS K  2 83  ? -2.069  112.690 85.701  1.00 39.96  ? 396  LYS H CA  1 
ATOM   7784  C C   . LYS K  2 83  ? -2.629  111.322 85.974  1.00 39.96  ? 396  LYS H C   1 
ATOM   7785  O O   . LYS K  2 83  ? -3.123  110.664 85.077  1.00 39.96  ? 396  LYS H O   1 
ATOM   7786  C CB  . LYS K  2 83  ? -2.951  113.733 86.398  1.00 39.96  ? 396  LYS H CB  1 
ATOM   7787  C CG  . LYS K  2 83  ? -4.066  114.368 85.567  1.00 39.96  ? 396  LYS H CG  1 
ATOM   7788  C CD  . LYS K  2 83  ? -3.892  115.908 85.516  1.00 39.96  ? 396  LYS H CD  1 
ATOM   7789  C CE  . LYS K  2 83  ? -5.184  116.685 85.777  1.00 39.96  ? 396  LYS H CE  1 
ATOM   7790  N NZ  . LYS K  2 83  ? -5.038  117.658 86.903  1.00 39.96  ? 396  LYS H NZ  1 
ATOM   7791  N N   . LYS K  2 84  ? -2.537  110.884 87.217  1.00 51.23  ? 397  LYS H N   1 
ATOM   7792  C CA  . LYS K  2 84  ? -3.056  109.584 87.561  1.00 51.23  ? 397  LYS H CA  1 
ATOM   7793  C C   . LYS K  2 84  ? -4.542  109.614 87.230  1.00 51.23  ? 397  LYS H C   1 
ATOM   7794  O O   . LYS K  2 84  ? -5.206  110.637 87.386  1.00 51.23  ? 397  LYS H O   1 
ATOM   7795  C CB  . LYS K  2 84  ? -2.852  109.315 89.054  1.00 51.23  ? 397  LYS H CB  1 
ATOM   7796  C CG  . LYS K  2 84  ? -1.486  108.750 89.433  1.00 51.23  ? 397  LYS H CG  1 
ATOM   7797  C CD  . LYS K  2 84  ? -1.318  107.300 88.988  1.00 51.23  ? 397  LYS H CD  1 
ATOM   7798  C CE  . LYS K  2 84  ? 0.158   106.853 89.047  1.00 51.23  ? 397  LYS H CE  1 
ATOM   7799  N NZ  . LYS K  2 84  ? 0.472   105.685 88.142  1.00 51.23  ? 397  LYS H NZ  1 
ATOM   7800  N N   . LEU K  2 85  ? -5.061  108.500 86.742  1.00 36.90  ? 398  LEU H N   1 
ATOM   7801  C CA  . LEU K  2 85  ? -6.478  108.415 86.422  1.00 36.90  ? 398  LEU H CA  1 
ATOM   7802  C C   . LEU K  2 85  ? -7.111  107.316 87.252  1.00 36.90  ? 398  LEU H C   1 
ATOM   7803  O O   . LEU K  2 85  ? -7.120  106.149 86.854  1.00 36.90  ? 398  LEU H O   1 
ATOM   7804  C CB  . LEU K  2 85  ? -6.722  108.084 84.955  1.00 36.90  ? 398  LEU H CB  1 
ATOM   7805  C CG  . LEU K  2 85  ? -8.226  107.832 84.761  1.00 36.90  ? 398  LEU H CG  1 
ATOM   7806  C CD1 . LEU K  2 85  ? -8.946  109.185 84.733  1.00 36.90  ? 398  LEU H CD1 1 
ATOM   7807  C CD2 . LEU K  2 85  ? -8.503  107.039 83.485  1.00 36.90  ? 398  LEU H CD2 1 
ATOM   7808  N N   . VAL K  2 86  ? -7.638  107.691 88.408  1.00 69.60  ? 399  VAL H N   1 
ATOM   7809  C CA  . VAL K  2 86  ? -8.284  106.723 89.266  1.00 69.60  ? 399  VAL H CA  1 
ATOM   7810  C C   . VAL K  2 86  ? -9.782  106.905 89.106  1.00 69.60  ? 399  VAL H C   1 
ATOM   7811  O O   . VAL K  2 86  ? -10.250 107.994 88.765  1.00 69.60  ? 399  VAL H O   1 
ATOM   7812  C CB  . VAL K  2 86  ? -7.907  106.942 90.729  1.00 69.60  ? 399  VAL H CB  1 
ATOM   7813  C CG1 . VAL K  2 86  ? -8.319  108.344 91.163  1.00 69.60  ? 399  VAL H CG1 1 
ATOM   7814  C CG2 . VAL K  2 86  ? -8.570  105.880 91.600  1.00 69.60  ? 399  VAL H CG2 1 
ATOM   7815  N N   . PHE K  2 87  ? -10.518 105.824 89.329  1.00 48.17  ? 400  PHE H N   1 
ATOM   7816  C CA  . PHE K  2 87  ? -11.970 105.827 89.237  1.00 48.17  ? 400  PHE H CA  1 
ATOM   7817  C C   . PHE K  2 87  ? -12.513 105.590 90.635  1.00 48.17  ? 400  PHE H C   1 
ATOM   7818  O O   . PHE K  2 87  ? -12.770 104.442 91.009  1.00 48.17  ? 400  PHE H O   1 
ATOM   7819  C CB  . PHE K  2 87  ? -12.455 104.684 88.365  1.00 48.17  ? 400  PHE H CB  1 
ATOM   7820  C CG  . PHE K  2 87  ? -12.216 104.888 86.916  1.00 48.17  ? 400  PHE H CG  1 
ATOM   7821  C CD1 . PHE K  2 87  ? -11.994 103.797 86.081  1.00 48.17  ? 400  PHE H CD1 1 
ATOM   7822  C CD2 . PHE K  2 87  ? -12.249 106.157 86.365  1.00 48.17  ? 400  PHE H CD2 1 
ATOM   7823  C CE1 . PHE K  2 87  ? -11.814 103.969 84.704  1.00 48.17  ? 400  PHE H CE1 1 
ATOM   7824  C CE2 . PHE K  2 87  ? -12.073 106.343 84.990  1.00 48.17  ? 400  PHE H CE2 1 
ATOM   7825  C CZ  . PHE K  2 87  ? -11.854 105.247 84.157  1.00 48.17  ? 400  PHE H CZ  1 
ATOM   7826  N N   . PRO K  2 88  ? -12.694 106.658 91.434  1.00 55.34  ? 401  PRO H N   1 
ATOM   7827  C CA  . PRO K  2 88  ? -13.222 106.396 92.776  1.00 55.34  ? 401  PRO H CA  1 
ATOM   7828  C C   . PRO K  2 88  ? -14.601 105.746 92.657  1.00 55.34  ? 401  PRO H C   1 
ATOM   7829  O O   . PRO K  2 88  ? -15.425 106.251 91.852  1.00 55.34  ? 401  PRO H O   1 
ATOM   7830  C CB  . PRO K  2 88  ? -13.280 107.780 93.425  1.00 55.34  ? 401  PRO H CB  1 
ATOM   7831  C CG  . PRO K  2 88  ? -12.384 108.646 92.587  1.00 55.34  ? 401  PRO H CG  1 
ATOM   7832  C CD  . PRO K  2 88  ? -12.469 108.093 91.196  1.00 55.34  ? 401  PRO H CD  1 
ATOM   7833  O OXT . PRO K  2 88  ? -14.825 104.727 93.349  1.00 55.34  ? 401  PRO H OXT 1 
HETATM 7834  C C1  . PHQ L  3 1   ? -10.535 80.567  71.287  1.00 78.34  ? 4400 PHQ W C1  1 
HETATM 7835  O O1  . PHQ L  3 1   ? -9.647  79.970  70.656  1.00 45.13  ? 4400 PHQ W O1  1 
HETATM 7836  O O2  . PHQ L  3 1   ? -10.632 80.428  72.678  0.00 45.13  ? 4400 PHQ W O2  1 
HETATM 7837  C C2  . PHQ L  3 1   ? -9.664  79.556  73.303  0.00 45.13  ? 4400 PHQ W C2  1 
HETATM 7838  C C3  . PHQ L  3 1   ? -9.840  79.526  74.806  0.00 45.13  ? 4400 PHQ W C3  1 
HETATM 7839  C C4  . PHQ L  3 1   ? -11.126 79.373  75.420  0.00 45.13  ? 4400 PHQ W C4  1 
HETATM 7840  C C5  . PHQ L  3 1   ? -11.246 79.353  76.850  0.00 45.13  ? 4400 PHQ W C5  1 
HETATM 7841  C C6  . PHQ L  3 1   ? -10.082 79.486  77.671  0.00 45.13  ? 4400 PHQ W C6  1 
HETATM 7842  C C7  . PHQ L  3 1   ? -8.797  79.637  77.066  0.00 45.13  ? 4400 PHQ W C7  1 
HETATM 7843  C C8  . PHQ L  3 1   ? -8.682  79.657  75.642  0.00 45.13  ? 4400 PHQ W C8  1 
ATOM   7844  N N   . GLU L  3 2   ? -11.465 81.399  70.824  1.00 83.34  ? 4401 GLU W N   1 
ATOM   7845  C CA  . GLU L  3 2   ? -11.577 81.764  69.387  1.00 60.32  ? 4401 GLU W CA  1 
ATOM   7846  C C   . GLU L  3 2   ? -10.924 83.168  69.196  1.00 76.59  ? 4401 GLU W C   1 
ATOM   7847  O O   . GLU L  3 2   ? -10.459 83.789  70.169  1.00 83.18  ? 4401 GLU W O   1 
ATOM   7848  C CB  . GLU L  3 2   ? -13.035 81.862  68.917  1.00 43.70  ? 4401 GLU W CB  1 
ATOM   7849  C CG  . GLU L  3 2   ? -13.871 80.578  69.009  1.00 61.39  ? 4401 GLU W CG  1 
ATOM   7850  C CD  . GLU L  3 2   ? -15.196 80.707  68.218  1.00 80.92  ? 4401 GLU W CD  1 
ATOM   7851  O OE1 . GLU L  3 2   ? -15.577 81.668  67.591  1.00 79.15  ? 4401 GLU W OE1 1 
ATOM   7852  O OE2 . GLU L  3 2   ? -15.899 79.580  68.312  1.00 100.00 ? 4401 GLU W OE2 1 
ATOM   7853  N N   . VAL L  3 3   ? -10.895 83.667  67.937  1.00 66.82  ? 4402 VAL W N   1 
ATOM   7854  C CA  . VAL L  3 3   ? -10.051 84.808  67.512  1.00 70.15  ? 4402 VAL W CA  1 
ATOM   7855  C C   . VAL L  3 3   ? -11.011 85.803  66.832  1.00 71.81  ? 4402 VAL W C   1 
ATOM   7856  O O   . VAL L  3 3   ? -12.061 85.391  66.297  1.00 78.52  ? 4402 VAL W O   1 
ATOM   7857  C CB  . VAL L  3 3   ? -8.874  84.378  66.550  1.00 65.88  ? 4402 VAL W CB  1 
ATOM   7858  C CG1 . VAL L  3 3   ? -7.891  83.421  67.249  1.00 59.55  ? 4402 VAL W CG1 1 
ATOM   7859  C CG2 . VAL L  3 3   ? -9.353  83.670  65.257  1.00 54.42  ? 4402 VAL W CG2 1 
ATOM   7860  N N   . ASP L  3 4   ? -10.633 87.119  66.861  1.00 66.74  ? 4403 ASP W N   1 
ATOM   7861  C CA  . ASP L  3 4   ? -11.391 88.252  66.284  1.00 61.38  ? 4403 ASP W CA  1 
ATOM   7862  C C   . ASP L  3 4   ? -10.670 88.863  65.016  1.00 75.89  ? 4403 ASP W C   1 
ATOM   7863  O O   . ASP L  3 4   ? -11.083 89.819  64.403  1.00 45.13  ? 4403 ASP W O   1 
ATOM   7864  C CB  . ASP L  3 4   ? -11.577 89.346  67.369  1.00 44.29  ? 4403 ASP W CB  1 
ATOM   7865  C CG  . ASP L  3 4   ? -12.625 89.014  68.455  1.00 53.97  ? 4403 ASP W CG  1 
ATOM   7866  O OD1 . ASP L  3 4   ? -13.660 88.417  68.287  1.00 64.66  ? 4403 ASP W OD1 1 
ATOM   7867  O OD2 . ASP L  3 4   ? -12.241 89.493  69.641  1.00 41.72  ? 4403 ASP W OD2 1 
HETATM 7868  C C1  . 0QE L  3 5   ? -9.539  88.198  64.699  1.00 61.76  ? 4404 0QE W C1  1 
ATOM   7869  N N   . LEU M  1 1   ? 40.914  53.827  57.933  1.00 100.00 ? 149  LEU I N   1 
ATOM   7870  C CA  . LEU M  1 1   ? 42.342  53.653  57.528  1.00 100.00 ? 149  LEU I CA  1 
ATOM   7871  C C   . LEU M  1 1   ? 43.153  54.959  57.610  1.00 100.00 ? 149  LEU I C   1 
ATOM   7872  O O   . LEU M  1 1   ? 42.654  56.047  57.307  1.00 100.00 ? 149  LEU I O   1 
ATOM   7873  C CB  . LEU M  1 1   ? 42.423  53.086  56.102  1.00 100.00 ? 149  LEU I CB  1 
ATOM   7874  C CG  . LEU M  1 1   ? 43.804  53.050  55.436  1.00 100.00 ? 149  LEU I CG  1 
ATOM   7875  C CD1 . LEU M  1 1   ? 43.874  51.864  54.485  1.00 100.00 ? 149  LEU I CD1 1 
ATOM   7876  C CD2 . LEU M  1 1   ? 44.060  54.355  54.693  1.00 100.00 ? 149  LEU I CD2 1 
ATOM   7877  N N   . ASP M  1 2   ? 44.406  54.821  58.031  1.00 69.73  ? 150  ASP I N   1 
ATOM   7878  C CA  . ASP M  1 2   ? 45.361  55.913  58.181  1.00 69.73  ? 150  ASP I CA  1 
ATOM   7879  C C   . ASP M  1 2   ? 46.555  55.296  58.896  1.00 69.73  ? 150  ASP I C   1 
ATOM   7880  O O   . ASP M  1 2   ? 46.426  54.248  59.536  1.00 69.73  ? 150  ASP I O   1 
ATOM   7881  C CB  . ASP M  1 2   ? 44.790  57.078  59.005  1.00 69.73  ? 150  ASP I CB  1 
ATOM   7882  C CG  . ASP M  1 2   ? 43.794  56.634  60.069  1.00 69.73  ? 150  ASP I CG  1 
ATOM   7883  O OD1 . ASP M  1 2   ? 43.628  55.421  60.300  1.00 69.73  ? 150  ASP I OD1 1 
ATOM   7884  O OD2 . ASP M  1 2   ? 43.168  57.516  60.686  1.00 69.73  ? 150  ASP I OD2 1 
ATOM   7885  N N   . LYS M  1 3   ? 47.714  55.934  58.807  1.00 70.59  ? 151  LYS I N   1 
ATOM   7886  C CA  . LYS M  1 3   ? 48.908  55.373  59.425  1.00 70.59  ? 151  LYS I CA  1 
ATOM   7887  C C   . LYS M  1 3   ? 48.857  55.099  60.925  1.00 70.59  ? 151  LYS I C   1 
ATOM   7888  O O   . LYS M  1 3   ? 48.310  55.872  61.713  1.00 70.59  ? 151  LYS I O   1 
ATOM   7889  C CB  . LYS M  1 3   ? 50.127  56.239  59.099  1.00 70.59  ? 151  LYS I CB  1 
ATOM   7890  C CG  . LYS M  1 3   ? 51.429  55.443  58.893  1.00 70.59  ? 151  LYS I CG  1 
ATOM   7891  C CD  . LYS M  1 3   ? 51.204  53.924  58.742  1.00 70.59  ? 151  LYS I CD  1 
ATOM   7892  C CE  . LYS M  1 3   ? 52.522  53.155  58.752  1.00 70.59  ? 151  LYS I CE  1 
ATOM   7893  N NZ  . LYS M  1 3   ? 52.288  51.687  58.805  1.00 70.59  ? 151  LYS I NZ  1 
ATOM   7894  N N   . VAL M  1 4   ? 49.442  53.971  61.305  1.00 42.53  ? 152  VAL I N   1 
ATOM   7895  C CA  . VAL M  1 4   ? 49.486  53.575  62.696  1.00 42.53  ? 152  VAL I CA  1 
ATOM   7896  C C   . VAL M  1 4   ? 50.902  53.230  63.100  1.00 42.53  ? 152  VAL I C   1 
ATOM   7897  O O   . VAL M  1 4   ? 51.689  52.741  62.286  1.00 42.53  ? 152  VAL I O   1 
ATOM   7898  C CB  . VAL M  1 4   ? 48.607  52.361  62.959  1.00 42.53  ? 152  VAL I CB  1 
ATOM   7899  C CG1 . VAL M  1 4   ? 48.778  51.907  64.398  1.00 42.53  ? 152  VAL I CG1 1 
ATOM   7900  C CG2 . VAL M  1 4   ? 47.163  52.715  62.674  1.00 42.53  ? 152  VAL I CG2 1 
ATOM   7901  N N   . TYR M  1 5   ? 51.213  53.495  64.365  1.00 38.20  ? 153  TYR I N   1 
ATOM   7902  C CA  . TYR M  1 5   ? 52.526  53.226  64.913  1.00 38.20  ? 153  TYR I CA  1 
ATOM   7903  C C   . TYR M  1 5   ? 52.694  51.731  65.049  1.00 38.20  ? 153  TYR I C   1 
ATOM   7904  O O   . TYR M  1 5   ? 51.873  51.079  65.687  1.00 38.20  ? 153  TYR I O   1 
ATOM   7905  C CB  . TYR M  1 5   ? 52.634  53.879  66.279  1.00 38.20  ? 153  TYR I CB  1 
ATOM   7906  C CG  . TYR M  1 5   ? 53.070  55.319  66.217  1.00 38.20  ? 153  TYR I CG  1 
ATOM   7907  C CD1 . TYR M  1 5   ? 52.359  56.317  66.881  1.00 38.20  ? 153  TYR I CD1 1 
ATOM   7908  C CD2 . TYR M  1 5   ? 54.223  55.678  65.530  1.00 38.20  ? 153  TYR I CD2 1 
ATOM   7909  C CE1 . TYR M  1 5   ? 52.797  57.630  66.866  1.00 38.20  ? 153  TYR I CE1 1 
ATOM   7910  C CE2 . TYR M  1 5   ? 54.665  56.978  65.510  1.00 38.20  ? 153  TYR I CE2 1 
ATOM   7911  C CZ  . TYR M  1 5   ? 53.957  57.948  66.179  1.00 38.20  ? 153  TYR I CZ  1 
ATOM   7912  O OH  . TYR M  1 5   ? 54.455  59.223  66.175  1.00 38.20  ? 153  TYR I OH  1 
ATOM   7913  N N   . GLN M  1 6   ? 53.752  51.188  64.461  1.00 52.72  ? 154  GLN I N   1 
ATOM   7914  C CA  . GLN M  1 6   ? 53.999  49.758  64.533  1.00 52.72  ? 154  GLN I CA  1 
ATOM   7915  C C   . GLN M  1 6   ? 54.084  49.274  65.984  1.00 52.72  ? 154  GLN I C   1 
ATOM   7916  O O   . GLN M  1 6   ? 54.890  49.786  66.760  1.00 52.72  ? 154  GLN I O   1 
ATOM   7917  C CB  . GLN M  1 6   ? 55.301  49.434  63.797  1.00 52.72  ? 154  GLN I CB  1 
ATOM   7918  C CG  . GLN M  1 6   ? 55.962  48.112  64.213  1.00 52.72  ? 154  GLN I CG  1 
ATOM   7919  C CD  . GLN M  1 6   ? 56.403  47.271  63.022  1.00 52.72  ? 154  GLN I CD  1 
ATOM   7920  O OE1 . GLN M  1 6   ? 57.224  47.704  62.215  1.00 52.72  ? 154  GLN I OE1 1 
ATOM   7921  N NE2 . GLN M  1 6   ? 55.857  46.059  62.910  1.00 52.72  ? 154  GLN I NE2 1 
ATOM   7922  N N   . MET M  1 7   ? 53.250  48.299  66.348  1.00 47.60  ? 155  MET I N   1 
ATOM   7923  C CA  . MET M  1 7   ? 53.258  47.742  67.705  1.00 47.60  ? 155  MET I CA  1 
ATOM   7924  C C   . MET M  1 7   ? 53.301  46.212  67.691  1.00 47.60  ? 155  MET I C   1 
ATOM   7925  O O   . MET M  1 7   ? 52.424  45.569  68.260  1.00 47.60  ? 155  MET I O   1 
ATOM   7926  C CB  . MET M  1 7   ? 52.026  48.195  68.483  1.00 47.60  ? 155  MET I CB  1 
ATOM   7927  C CG  . MET M  1 7   ? 52.073  49.639  68.901  1.00 47.60  ? 155  MET I CG  1 
ATOM   7928  S SD  . MET M  1 7   ? 53.395  49.926  70.092  1.00 47.60  ? 155  MET I SD  1 
ATOM   7929  C CE  . MET M  1 7   ? 52.801  48.967  71.451  1.00 47.60  ? 155  MET I CE  1 
ATOM   7930  N N   . LYS M  1 8   ? 54.338  45.649  67.059  1.00 63.05  ? 156  LYS I N   1 
ATOM   7931  C CA  . LYS M  1 8   ? 54.536  44.193  66.920  1.00 63.05  ? 156  LYS I CA  1 
ATOM   7932  C C   . LYS M  1 8   ? 55.539  43.583  67.901  1.00 63.05  ? 156  LYS I C   1 
ATOM   7933  O O   . LYS M  1 8   ? 55.322  42.512  68.442  1.00 63.05  ? 156  LYS I O   1 
ATOM   7934  C CB  . LYS M  1 8   ? 55.003  43.867  65.496  1.00 63.05  ? 156  LYS I CB  1 
ATOM   7935  C CG  . LYS M  1 8   ? 53.934  43.271  64.584  1.00 63.05  ? 156  LYS I CG  1 
ATOM   7936  C CD  . LYS M  1 8   ? 54.504  42.884  63.213  1.00 63.05  ? 156  LYS I CD  1 
ATOM   7937  C CE  . LYS M  1 8   ? 54.390  41.367  62.945  1.00 63.05  ? 156  LYS I CE  1 
ATOM   7938  N NZ  . LYS M  1 8   ? 55.638  40.761  62.346  1.00 63.05  ? 156  LYS I NZ  1 
ATOM   7939  N N   . SER M  1 9   ? 56.648  44.270  68.109  1.00 44.35  ? 157  SER I N   1 
ATOM   7940  C CA  . SER M  1 9   ? 57.713  43.828  68.999  1.00 44.35  ? 157  SER I CA  1 
ATOM   7941  C C   . SER M  1 9   ? 57.330  42.839  70.137  1.00 44.35  ? 157  SER I C   1 
ATOM   7942  O O   . SER M  1 9   ? 56.209  42.865  70.660  1.00 44.35  ? 157  SER I O   1 
ATOM   7943  C CB  . SER M  1 9   ? 58.413  45.085  69.560  1.00 44.35  ? 157  SER I CB  1 
ATOM   7944  O OG  . SER M  1 9   ? 58.782  44.950  70.925  1.00 44.35  ? 157  SER I OG  1 
ATOM   7945  N N   . LYS M  1 10  ? 58.287  41.972  70.500  1.00 74.31  ? 160  LYS I N   1 
ATOM   7946  C CA  . LYS M  1 10  ? 58.111  40.978  71.562  1.00 74.31  ? 160  LYS I CA  1 
ATOM   7947  C C   . LYS M  1 10  ? 57.825  41.645  72.896  1.00 74.31  ? 160  LYS I C   1 
ATOM   7948  O O   . LYS M  1 10  ? 56.750  41.470  73.460  1.00 74.31  ? 160  LYS I O   1 
ATOM   7949  C CB  . LYS M  1 10  ? 59.350  40.097  71.715  1.00 74.31  ? 160  LYS I CB  1 
ATOM   7950  C CG  . LYS M  1 10  ? 60.519  40.474  70.837  1.00 74.31  ? 160  LYS I CG  1 
ATOM   7951  C CD  . LYS M  1 10  ? 61.468  39.297  70.693  1.00 74.31  ? 160  LYS I CD  1 
ATOM   7952  C CE  . LYS M  1 10  ? 60.815  38.161  69.912  1.00 74.31  ? 160  LYS I CE  1 
ATOM   7953  N NZ  . LYS M  1 10  ? 60.187  37.130  70.796  1.00 74.31  ? 160  LYS I NZ  1 
ATOM   7954  N N   . PRO M  1 11  ? 58.788  42.400  73.444  1.00 62.58  ? 161  PRO I N   1 
ATOM   7955  C CA  . PRO M  1 11  ? 58.414  43.005  74.718  1.00 62.58  ? 161  PRO I CA  1 
ATOM   7956  C C   . PRO M  1 11  ? 57.699  44.337  74.457  1.00 62.58  ? 161  PRO I C   1 
ATOM   7957  O O   . PRO M  1 11  ? 57.171  44.954  75.390  1.00 62.58  ? 161  PRO I O   1 
ATOM   7958  C CB  . PRO M  1 11  ? 59.747  43.182  75.430  1.00 62.58  ? 161  PRO I CB  1 
ATOM   7959  C CG  . PRO M  1 11  ? 60.734  43.382  74.304  1.00 62.58  ? 161  PRO I CG  1 
ATOM   7960  C CD  . PRO M  1 11  ? 60.158  42.762  73.046  1.00 62.58  ? 161  PRO I CD  1 
ATOM   7961  N N   . ARG M  1 12  ? 57.678  44.766  73.187  1.00 50.28  ? 162  ARG I N   1 
ATOM   7962  C CA  . ARG M  1 12  ? 57.041  46.032  72.773  1.00 50.28  ? 162  ARG I CA  1 
ATOM   7963  C C   . ARG M  1 12  ? 57.889  47.238  73.149  1.00 50.28  ? 162  ARG I C   1 
ATOM   7964  O O   . ARG M  1 12  ? 58.104  48.127  72.330  1.00 50.28  ? 162  ARG I O   1 
ATOM   7965  C CB  . ARG M  1 12  ? 55.661  46.201  73.412  1.00 50.28  ? 162  ARG I CB  1 
ATOM   7966  C CG  . ARG M  1 12  ? 54.641  45.185  72.984  1.00 50.28  ? 162  ARG I CG  1 
ATOM   7967  C CD  . ARG M  1 12  ? 53.438  45.878  72.395  1.00 50.28  ? 162  ARG I CD  1 
ATOM   7968  N NE  . ARG M  1 12  ? 52.452  44.926  71.897  1.00 50.28  ? 162  ARG I NE  1 
ATOM   7969  C CZ  . ARG M  1 12  ? 52.685  44.051  70.921  1.00 50.28  ? 162  ARG I CZ  1 
ATOM   7970  N NH1 . ARG M  1 12  ? 53.878  44.004  70.334  1.00 50.28  ? 162  ARG I NH1 1 
ATOM   7971  N NH2 . ARG M  1 12  ? 51.728  43.221  70.527  1.00 50.28  ? 162  ARG I NH2 1 
ATOM   7972  N N   . GLY M  1 13  ? 58.342  47.257  74.403  1.00 32.78  ? 163  GLY I N   1 
ATOM   7973  C CA  . GLY M  1 13  ? 59.173  48.333  74.926  1.00 32.78  ? 163  GLY I CA  1 
ATOM   7974  C C   . GLY M  1 13  ? 59.095  48.348  76.442  1.00 32.78  ? 163  GLY I C   1 
ATOM   7975  O O   . GLY M  1 13  ? 58.296  47.614  77.017  1.00 32.78  ? 163  GLY I O   1 
ATOM   7976  N N   . TYR M  1 14  ? 59.903  49.166  77.101  1.00 48.14  ? 164  TYR I N   1 
ATOM   7977  C CA  . TYR M  1 14  ? 59.859  49.208  78.548  1.00 48.14  ? 164  TYR I CA  1 
ATOM   7978  C C   . TYR M  1 14  ? 58.761  50.128  79.002  1.00 48.14  ? 164  TYR I C   1 
ATOM   7979  O O   . TYR M  1 14  ? 58.325  51.006  78.251  1.00 48.14  ? 164  TYR I O   1 
ATOM   7980  C CB  . TYR M  1 14  ? 61.181  49.696  79.097  1.00 48.14  ? 164  TYR I CB  1 
ATOM   7981  C CG  . TYR M  1 14  ? 62.301  48.731  78.830  1.00 48.14  ? 164  TYR I CG  1 
ATOM   7982  C CD1 . TYR M  1 14  ? 63.453  49.136  78.157  1.00 48.14  ? 164  TYR I CD1 1 
ATOM   7983  C CD2 . TYR M  1 14  ? 62.200  47.392  79.224  1.00 48.14  ? 164  TYR I CD2 1 
ATOM   7984  C CE1 . TYR M  1 14  ? 64.482  48.229  77.877  1.00 48.14  ? 164  TYR I CE1 1 
ATOM   7985  C CE2 . TYR M  1 14  ? 63.224  46.475  78.950  1.00 48.14  ? 164  TYR I CE2 1 
ATOM   7986  C CZ  . TYR M  1 14  ? 64.360  46.902  78.275  1.00 48.14  ? 164  TYR I CZ  1 
ATOM   7987  O OH  . TYR M  1 14  ? 65.376  46.014  77.995  1.00 48.14  ? 164  TYR I OH  1 
ATOM   7988  N N   . CYS M  1 15  ? 58.313  49.917  80.235  1.00 40.73  ? 165  CYS I N   1 
ATOM   7989  C CA  . CYS M  1 15  ? 57.267  50.734  80.826  1.00 40.73  ? 165  CYS I CA  1 
ATOM   7990  C C   . CYS M  1 15  ? 57.676  51.102  82.236  1.00 40.73  ? 165  CYS I C   1 
ATOM   7991  O O   . CYS M  1 15  ? 57.347  50.405  83.180  1.00 40.73  ? 165  CYS I O   1 
ATOM   7992  C CB  . CYS M  1 15  ? 55.940  49.971  80.843  1.00 40.73  ? 165  CYS I CB  1 
ATOM   7993  S SG  . CYS M  1 15  ? 54.566  50.828  81.701  1.00 40.73  ? 165  CYS I SG  1 
ATOM   7994  N N   . LEU M  1 16  ? 58.405  52.201  82.366  1.00 51.77  ? 166  LEU I N   1 
ATOM   7995  C CA  . LEU M  1 16  ? 58.862  52.682  83.666  1.00 51.77  ? 166  LEU I CA  1 
ATOM   7996  C C   . LEU M  1 16  ? 57.721  53.046  84.592  1.00 51.77  ? 166  LEU I C   1 
ATOM   7997  O O   . LEU M  1 16  ? 56.681  53.517  84.147  1.00 51.77  ? 166  LEU I O   1 
ATOM   7998  C CB  . LEU M  1 16  ? 59.715  53.928  83.496  1.00 51.77  ? 166  LEU I CB  1 
ATOM   7999  C CG  . LEU M  1 16  ? 61.005  53.785  82.719  1.00 51.77  ? 166  LEU I CG  1 
ATOM   8000  C CD1 . LEU M  1 16  ? 62.067  54.596  83.436  1.00 51.77  ? 166  LEU I CD1 1 
ATOM   8001  C CD2 . LEU M  1 16  ? 61.400  52.323  82.619  1.00 51.77  ? 166  LEU I CD2 1 
ATOM   8002  N N   . ILE M  1 17  ? 57.926  52.858  85.887  1.00 24.16  ? 167  ILE I N   1 
ATOM   8003  C CA  . ILE M  1 17  ? 56.898  53.202  86.846  1.00 24.16  ? 167  ILE I CA  1 
ATOM   8004  C C   . ILE M  1 17  ? 57.558  53.749  88.084  1.00 24.16  ? 167  ILE I C   1 
ATOM   8005  O O   . ILE M  1 17  ? 57.773  53.023  89.051  1.00 24.16  ? 167  ILE I O   1 
ATOM   8006  C CB  . ILE M  1 17  ? 56.052  51.991  87.244  1.00 24.16  ? 167  ILE I CB  1 
ATOM   8007  C CG1 . ILE M  1 17  ? 55.271  51.486  86.033  1.00 24.16  ? 167  ILE I CG1 1 
ATOM   8008  C CG2 . ILE M  1 17  ? 55.076  52.376  88.325  1.00 24.16  ? 167  ILE I CG2 1 
ATOM   8009  C CD1 . ILE M  1 17  ? 54.310  50.374  86.360  1.00 24.16  ? 167  ILE I CD1 1 
ATOM   8010  N N   . ILE M  1 18  ? 57.908  55.029  88.045  1.00 31.28  ? 168  ILE I N   1 
ATOM   8011  C CA  . ILE M  1 18  ? 58.525  55.666  89.186  1.00 31.28  ? 168  ILE I CA  1 
ATOM   8012  C C   . ILE M  1 18  ? 57.373  55.992  90.090  1.00 31.28  ? 168  ILE I C   1 
ATOM   8013  O O   . ILE M  1 18  ? 56.603  56.887  89.811  1.00 31.28  ? 168  ILE I O   1 
ATOM   8014  C CB  . ILE M  1 18  ? 59.247  56.937  88.778  1.00 31.28  ? 168  ILE I CB  1 
ATOM   8015  C CG1 . ILE M  1 18  ? 60.430  56.560  87.889  1.00 31.28  ? 168  ILE I CG1 1 
ATOM   8016  C CG2 . ILE M  1 18  ? 59.700  57.713  90.020  1.00 31.28  ? 168  ILE I CG2 1 
ATOM   8017  C CD1 . ILE M  1 18  ? 61.079  57.740  87.229  1.00 31.28  ? 168  ILE I CD1 1 
ATOM   8018  N N   . ASN M  1 19  ? 57.270  55.250  91.177  1.00 47.31  ? 169  ASN I N   1 
ATOM   8019  C CA  . ASN M  1 19  ? 56.182  55.403  92.122  1.00 47.31  ? 169  ASN I CA  1 
ATOM   8020  C C   . ASN M  1 19  ? 56.627  55.912  93.501  1.00 47.31  ? 169  ASN I C   1 
ATOM   8021  O O   . ASN M  1 19  ? 57.087  55.137  94.326  1.00 47.31  ? 169  ASN I O   1 
ATOM   8022  C CB  . ASN M  1 19  ? 55.492  54.041  92.231  1.00 47.31  ? 169  ASN I CB  1 
ATOM   8023  C CG  . ASN M  1 19  ? 54.700  53.891  93.488  1.00 47.31  ? 169  ASN I CG  1 
ATOM   8024  O OD1 . ASN M  1 19  ? 53.997  54.807  93.890  1.00 47.31  ? 169  ASN I OD1 1 
ATOM   8025  N ND2 . ASN M  1 19  ? 54.806  52.730  94.128  1.00 47.31  ? 169  ASN I ND2 1 
ATOM   8026  N N   . ASN M  1 20  ? 56.482  57.208  93.754  1.00 41.50  ? 170  ASN I N   1 
ATOM   8027  C CA  . ASN M  1 20  ? 56.884  57.778  95.037  1.00 41.50  ? 170  ASN I CA  1 
ATOM   8028  C C   . ASN M  1 20  ? 55.789  57.733  96.099  1.00 41.50  ? 170  ASN I C   1 
ATOM   8029  O O   . ASN M  1 20  ? 54.655  58.086  95.826  1.00 41.50  ? 170  ASN I O   1 
ATOM   8030  C CB  . ASN M  1 20  ? 57.336  59.216  94.832  1.00 41.50  ? 170  ASN I CB  1 
ATOM   8031  C CG  . ASN M  1 20  ? 58.585  59.305  93.988  1.00 41.50  ? 170  ASN I CG  1 
ATOM   8032  O OD1 . ASN M  1 20  ? 59.193  58.283  93.655  1.00 41.50  ? 170  ASN I OD1 1 
ATOM   8033  N ND2 . ASN M  1 20  ? 58.980  60.526  93.633  1.00 41.50  ? 170  ASN I ND2 1 
ATOM   8034  N N   . HIS M  1 21  ? 56.131  57.318  97.316  1.00 48.31  ? 171  HIS I N   1 
ATOM   8035  C CA  . HIS M  1 21  ? 55.151  57.221  98.400  1.00 48.31  ? 171  HIS I CA  1 
ATOM   8036  C C   . HIS M  1 21  ? 55.684  57.782  99.699  1.00 48.31  ? 171  HIS I C   1 
ATOM   8037  O O   . HIS M  1 21  ? 55.035  58.605  100.337 1.00 48.31  ? 171  HIS I O   1 
ATOM   8038  C CB  . HIS M  1 21  ? 54.752  55.761  98.620  1.00 48.31  ? 171  HIS I CB  1 
ATOM   8039  C CG  . HIS M  1 21  ? 53.947  55.526  99.865  1.00 48.31  ? 171  HIS I CG  1 
ATOM   8040  N ND1 . HIS M  1 21  ? 52.651  55.054  99.833  1.00 48.31  ? 171  HIS I ND1 1 
ATOM   8041  C CD2 . HIS M  1 21  ? 54.250  55.700  101.174 1.00 48.31  ? 171  HIS I CD2 1 
ATOM   8042  C CE1 . HIS M  1 21  ? 52.190  54.951  101.069 1.00 48.31  ? 171  HIS I CE1 1 
ATOM   8043  N NE2 . HIS M  1 21  ? 53.142  55.336  101.901 1.00 48.31  ? 171  HIS I NE2 1 
ATOM   8044  N N   . ASN M  1 22  ? 56.850  57.309  100.119 1.00 52.79  ? 172  ASN I N   1 
ATOM   8045  C CA  . ASN M  1 22  ? 57.400  57.808  101.360 1.00 52.79  ? 172  ASN I CA  1 
ATOM   8046  C C   . ASN M  1 22  ? 58.068  59.164  101.209 1.00 52.79  ? 172  ASN I C   1 
ATOM   8047  O O   . ASN M  1 22  ? 59.222  59.268  100.820 1.00 52.79  ? 172  ASN I O   1 
ATOM   8048  C CB  . ASN M  1 22  ? 58.390  56.829  101.969 1.00 52.79  ? 172  ASN I CB  1 
ATOM   8049  C CG  . ASN M  1 22  ? 58.824  57.271  103.344 1.00 52.79  ? 172  ASN I CG  1 
ATOM   8050  O OD1 . ASN M  1 22  ? 59.160  58.443  103.544 1.00 52.79  ? 172  ASN I OD1 1 
ATOM   8051  N ND2 . ASN M  1 22  ? 58.799  56.357  104.309 1.00 52.79  ? 172  ASN I ND2 1 
ATOM   8052  N N   . PHE M  1 23  ? 57.333  60.213  101.541 1.00 39.35  ? 173  PHE I N   1 
ATOM   8053  C CA  . PHE M  1 23  ? 57.864  61.554  101.438 1.00 39.35  ? 173  PHE I CA  1 
ATOM   8054  C C   . PHE M  1 23  ? 58.367  62.072  102.770 1.00 39.35  ? 173  PHE I C   1 
ATOM   8055  O O   . PHE M  1 23  ? 58.161  63.242  103.090 1.00 39.35  ? 173  PHE I O   1 
ATOM   8056  C CB  . PHE M  1 23  ? 56.793  62.494  100.872 1.00 39.35  ? 173  PHE I CB  1 
ATOM   8057  C CG  . PHE M  1 23  ? 56.637  62.390  99.374  1.00 39.35  ? 173  PHE I CG  1 
ATOM   8058  C CD1 . PHE M  1 23  ? 56.012  61.290  98.806  1.00 39.35  ? 173  PHE I CD1 1 
ATOM   8059  C CD2 . PHE M  1 23  ? 57.167  63.363  98.530  1.00 39.35  ? 173  PHE I CD2 1 
ATOM   8060  C CE1 . PHE M  1 23  ? 55.920  61.155  97.422  1.00 39.35  ? 173  PHE I CE1 1 
ATOM   8061  C CE2 . PHE M  1 23  ? 57.079  63.237  97.143  1.00 39.35  ? 173  PHE I CE2 1 
ATOM   8062  C CZ  . PHE M  1 23  ? 56.456  62.132  96.590  1.00 39.35  ? 173  PHE I CZ  1 
ATOM   8063  N N   . ALA M  1 24  ? 59.041  61.217  103.540 1.00 54.63  ? 174  ALA I N   1 
ATOM   8064  C CA  . ALA M  1 24  ? 59.560  61.625  104.845 1.00 54.63  ? 174  ALA I CA  1 
ATOM   8065  C C   . ALA M  1 24  ? 60.812  62.486  104.721 1.00 54.63  ? 174  ALA I C   1 
ATOM   8066  O O   . ALA M  1 24  ? 61.007  63.429  105.496 1.00 54.63  ? 174  ALA I O   1 
ATOM   8067  C CB  . ALA M  1 24  ? 59.853  60.412  105.698 1.00 54.63  ? 174  ALA I CB  1 
ATOM   8068  N N   . LYS M  1 25  ? 61.666  62.160  103.758 1.00 57.70  ? 175  LYS I N   1 
ATOM   8069  C CA  . LYS M  1 25  ? 62.880  62.936  103.569 1.00 57.70  ? 175  LYS I CA  1 
ATOM   8070  C C   . LYS M  1 25  ? 62.402  64.345  103.337 1.00 57.70  ? 175  LYS I C   1 
ATOM   8071  O O   . LYS M  1 25  ? 62.762  65.269  104.066 1.00 57.70  ? 175  LYS I O   1 
ATOM   8072  C CB  . LYS M  1 25  ? 63.649  62.471  102.338 1.00 57.70  ? 175  LYS I CB  1 
ATOM   8073  C CG  . LYS M  1 25  ? 64.944  61.762  102.644 1.00 57.70  ? 175  LYS I CG  1 
ATOM   8074  C CD  . LYS M  1 25  ? 65.921  62.657  103.373 1.00 57.70  ? 175  LYS I CD  1 
ATOM   8075  C CE  . LYS M  1 25  ? 67.185  61.875  103.714 1.00 57.70  ? 175  LYS I CE  1 
ATOM   8076  N NZ  . LYS M  1 25  ? 67.636  62.070  105.119 1.00 57.70  ? 175  LYS I NZ  1 
ATOM   8077  N N   . ALA M  1 26  A 61.572  64.493  102.311 1.00 36.11  ? 175  ALA I N   1 
ATOM   8078  C CA  . ALA M  1 26  A 61.034  65.787  101.962 1.00 36.11  ? 175  ALA I CA  1 
ATOM   8079  C C   . ALA M  1 26  A 60.650  66.537  103.233 1.00 36.11  ? 175  ALA I C   1 
ATOM   8080  O O   . ALA M  1 26  A 61.119  67.643  103.491 1.00 36.11  ? 175  ALA I O   1 
ATOM   8081  C CB  . ALA M  1 26  A 59.840  65.592  101.094 1.00 36.11  ? 175  ALA I CB  1 
ATOM   8082  N N   . ARG M  1 27  B 59.803  65.917  104.037 1.00 38.36  ? 175  ARG I N   1 
ATOM   8083  C CA  . ARG M  1 27  B 59.356  66.538  105.272 1.00 38.36  ? 175  ARG I CA  1 
ATOM   8084  C C   . ARG M  1 27  B 60.520  67.065  106.097 1.00 38.36  ? 175  ARG I C   1 
ATOM   8085  O O   . ARG M  1 27  B 60.483  68.198  106.576 1.00 38.36  ? 175  ARG I O   1 
ATOM   8086  C CB  . ARG M  1 27  B 58.547  65.540  106.089 1.00 38.36  ? 175  ARG I CB  1 
ATOM   8087  C CG  . ARG M  1 27  B 57.063  65.799  106.015 1.00 38.36  ? 175  ARG I CG  1 
ATOM   8088  C CD  . ARG M  1 27  B 56.278  64.606  106.473 1.00 38.36  ? 175  ARG I CD  1 
ATOM   8089  N NE  . ARG M  1 27  B 55.865  63.775  105.348 1.00 38.36  ? 175  ARG I NE  1 
ATOM   8090  C CZ  . ARG M  1 27  B 56.083  62.463  105.257 1.00 38.36  ? 175  ARG I CZ  1 
ATOM   8091  N NH1 . ARG M  1 27  B 56.717  61.820  106.232 1.00 38.36  ? 175  ARG I NH1 1 
ATOM   8092  N NH2 . ARG M  1 27  B 55.662  61.790  104.189 1.00 38.36  ? 175  ARG I NH2 1 
ATOM   8093  N N   . GLU M  1 28  C 61.553  66.243  106.254 1.00 68.47  ? 175  GLU I N   1 
ATOM   8094  C CA  . GLU M  1 28  C 62.748  66.618  107.014 1.00 68.47  ? 175  GLU I CA  1 
ATOM   8095  C C   . GLU M  1 28  C 63.425  67.850  106.423 1.00 68.47  ? 175  GLU I C   1 
ATOM   8096  O O   . GLU M  1 28  C 63.519  68.897  107.064 1.00 68.47  ? 175  GLU I O   1 
ATOM   8097  C CB  . GLU M  1 28  C 63.762  65.491  106.970 1.00 68.47  ? 175  GLU I CB  1 
ATOM   8098  C CG  . GLU M  1 28  C 63.943  64.721  108.231 1.00 68.47  ? 175  GLU I CG  1 
ATOM   8099  C CD  . GLU M  1 28  C 64.871  63.543  107.996 1.00 68.47  ? 175  GLU I CD  1 
ATOM   8100  O OE1 . GLU M  1 28  C 66.103  63.774  107.940 1.00 68.47  ? 175  GLU I OE1 1 
ATOM   8101  O OE2 . GLU M  1 28  C 64.369  62.398  107.851 1.00 68.47  ? 175  GLU I OE2 1 
ATOM   8102  N N   . LYS M  1 29  D 63.913  67.683  105.196 1.00 73.47  ? 175  LYS I N   1 
ATOM   8103  C CA  . LYS M  1 29  D 64.618  68.720  104.443 1.00 73.47  ? 175  LYS I CA  1 
ATOM   8104  C C   . LYS M  1 29  D 63.766  69.952  104.141 1.00 73.47  ? 175  LYS I C   1 
ATOM   8105  O O   . LYS M  1 29  D 63.614  70.842  104.987 1.00 73.47  ? 175  LYS I O   1 
ATOM   8106  C CB  . LYS M  1 29  D 65.134  68.123  103.131 1.00 73.47  ? 175  LYS I CB  1 
ATOM   8107  C CG  . LYS M  1 29  D 65.918  66.848  103.323 1.00 73.47  ? 175  LYS I CG  1 
ATOM   8108  C CD  . LYS M  1 29  D 67.039  67.111  104.303 1.00 73.47  ? 175  LYS I CD  1 
ATOM   8109  C CE  . LYS M  1 29  D 67.917  65.902  104.526 1.00 73.47  ? 175  LYS I CE  1 
ATOM   8110  N NZ  . LYS M  1 29  D 69.314  66.334  104.824 1.00 73.47  ? 175  LYS I NZ  1 
ATOM   8111  N N   . VAL M  1 30  E 63.228  69.996  102.924 1.00 60.74  ? 175  VAL I N   1 
ATOM   8112  C CA  . VAL M  1 30  E 62.385  71.098  102.479 1.00 60.74  ? 175  VAL I CA  1 
ATOM   8113  C C   . VAL M  1 30  E 61.435  71.580  103.557 1.00 60.74  ? 175  VAL I C   1 
ATOM   8114  O O   . VAL M  1 30  E 60.511  70.862  103.956 1.00 60.74  ? 175  VAL I O   1 
ATOM   8115  C CB  . VAL M  1 30  E 61.530  70.701  101.295 1.00 60.74  ? 175  VAL I CB  1 
ATOM   8116  C CG1 . VAL M  1 30  E 60.827  71.931  100.753 1.00 60.74  ? 175  VAL I CG1 1 
ATOM   8117  C CG2 . VAL M  1 30  E 62.391  70.030  100.247 1.00 60.74  ? 175  VAL I CG2 1 
ATOM   8118  N N   . PRO M  1 31  F 61.637  72.819  104.029 1.00 64.51  ? 175  PRO I N   1 
ATOM   8119  C CA  . PRO M  1 31  F 60.781  73.390  105.070 1.00 64.51  ? 175  PRO I CA  1 
ATOM   8120  C C   . PRO M  1 31  F 59.354  73.484  104.577 1.00 64.51  ? 175  PRO I C   1 
ATOM   8121  O O   . PRO M  1 31  F 58.453  72.852  105.120 1.00 64.51  ? 175  PRO I O   1 
ATOM   8122  C CB  . PRO M  1 31  F 61.390  74.770  105.317 1.00 64.51  ? 175  PRO I CB  1 
ATOM   8123  C CG  . PRO M  1 31  F 62.112  75.099  104.042 1.00 64.51  ? 175  PRO I CG  1 
ATOM   8124  C CD  . PRO M  1 31  F 62.669  73.775  103.590 1.00 64.51  ? 175  PRO I CD  1 
ATOM   8125  N N   . LYS M  1 32  G 59.171  74.269  103.526 1.00 63.07  ? 175  LYS I N   1 
ATOM   8126  C CA  . LYS M  1 32  G 57.861  74.486  102.950 1.00 63.07  ? 175  LYS I CA  1 
ATOM   8127  C C   . LYS M  1 32  G 57.094  73.193  102.737 1.00 63.07  ? 175  LYS I C   1 
ATOM   8128  O O   . LYS M  1 32  G 55.888  73.215  102.494 1.00 63.07  ? 175  LYS I O   1 
ATOM   8129  C CB  . LYS M  1 32  G 57.994  75.244  101.631 1.00 63.07  ? 175  LYS I CB  1 
ATOM   8130  C CG  . LYS M  1 32  G 58.058  74.360  100.408 1.00 63.07  ? 175  LYS I CG  1 
ATOM   8131  C CD  . LYS M  1 32  G 57.087  74.850  99.341  1.00 63.07  ? 175  LYS I CD  1 
ATOM   8132  C CE  . LYS M  1 32  G 57.636  74.611  97.937  1.00 63.07  ? 175  LYS I CE  1 
ATOM   8133  N NZ  . LYS M  1 32  G 58.101  75.862  97.262  1.00 63.07  ? 175  LYS I NZ  1 
ATOM   8134  N N   . LEU M  1 33  H 57.783  72.064  102.835 1.00 60.89  ? 175  LEU I N   1 
ATOM   8135  C CA  . LEU M  1 33  H 57.118  70.787  102.641 1.00 60.89  ? 175  LEU I CA  1 
ATOM   8136  C C   . LEU M  1 33  H 56.843  70.057  103.935 1.00 60.89  ? 175  LEU I C   1 
ATOM   8137  O O   . LEU M  1 33  H 56.241  68.990  103.935 1.00 60.89  ? 175  LEU I O   1 
ATOM   8138  C CB  . LEU M  1 33  H 57.958  69.921  101.729 1.00 60.89  ? 175  LEU I CB  1 
ATOM   8139  C CG  . LEU M  1 33  H 58.092  70.557  100.359 1.00 60.89  ? 175  LEU I CG  1 
ATOM   8140  C CD1 . LEU M  1 33  H 58.464  69.502  99.360  1.00 60.89  ? 175  LEU I CD1 1 
ATOM   8141  C CD2 . LEU M  1 33  H 56.792  71.199  99.962  1.00 60.89  ? 175  LEU I CD2 1 
ATOM   8142  N N   . HIS M  1 34  I 57.273  70.648  105.037 1.00 91.52  ? 175  HIS I N   1 
ATOM   8143  C CA  . HIS M  1 34  I 57.097  70.047  106.340 1.00 91.52  ? 175  HIS I CA  1 
ATOM   8144  C C   . HIS M  1 34  I 55.858  69.171  106.515 1.00 91.52  ? 175  HIS I C   1 
ATOM   8145  O O   . HIS M  1 34  I 55.870  68.237  107.317 1.00 91.52  ? 175  HIS I O   1 
ATOM   8146  C CB  . HIS M  1 34  I 57.092  71.129  107.403 1.00 91.52  ? 175  HIS I CB  1 
ATOM   8147  C CG  . HIS M  1 34  I 57.034  70.591  108.793 1.00 91.52  ? 175  HIS I CG  1 
ATOM   8148  N ND1 . HIS M  1 34  I 56.331  71.211  109.803 1.00 91.52  ? 175  HIS I ND1 1 
ATOM   8149  C CD2 . HIS M  1 34  I 57.573  69.473  109.338 1.00 91.52  ? 175  HIS I CD2 1 
ATOM   8150  C CE1 . HIS M  1 34  I 56.438  70.497  110.911 1.00 91.52  ? 175  HIS I CE1 1 
ATOM   8151  N NE2 . HIS M  1 34  I 57.186  69.438  110.655 1.00 91.52  ? 175  HIS I NE2 1 
ATOM   8152  N N   . SER M  1 35  J 54.792  69.440  105.773 1.00 63.66  ? 175  SER I N   1 
ATOM   8153  C CA  . SER M  1 35  J 53.605  68.625  105.954 1.00 63.66  ? 175  SER I CA  1 
ATOM   8154  C C   . SER M  1 35  J 53.078  67.840  104.749 1.00 63.66  ? 175  SER I C   1 
ATOM   8155  O O   . SER M  1 35  J 51.896  67.471  104.732 1.00 63.66  ? 175  SER I O   1 
ATOM   8156  C CB  . SER M  1 35  J 52.487  69.488  106.547 1.00 63.66  ? 175  SER I CB  1 
ATOM   8157  O OG  . SER M  1 35  J 51.875  70.288  105.554 1.00 63.66  ? 175  SER I OG  1 
ATOM   8158  N N   . ILE M  1 36  ? 53.921  67.565  103.747 1.00 52.95  ? 176  ILE I N   1 
ATOM   8159  C CA  . ILE M  1 36  ? 53.438  66.783  102.597 1.00 52.95  ? 176  ILE I CA  1 
ATOM   8160  C C   . ILE M  1 36  ? 53.119  65.376  103.061 1.00 52.95  ? 176  ILE I C   1 
ATOM   8161  O O   . ILE M  1 36  ? 53.960  64.696  103.646 1.00 52.95  ? 176  ILE I O   1 
ATOM   8162  C CB  . ILE M  1 36  ? 54.456  66.613  101.439 1.00 52.95  ? 176  ILE I CB  1 
ATOM   8163  C CG1 . ILE M  1 36  ? 55.837  67.068  101.872 1.00 52.95  ? 176  ILE I CG1 1 
ATOM   8164  C CG2 . ILE M  1 36  ? 53.977  67.343  100.212 1.00 52.95  ? 176  ILE I CG2 1 
ATOM   8165  C CD1 . ILE M  1 36  ? 56.654  65.955  102.481 1.00 52.95  ? 176  ILE I CD1 1 
ATOM   8166  N N   . ARG M  1 37  ? 51.897  64.949  102.787 1.00 74.27  ? 177  ARG I N   1 
ATOM   8167  C CA  . ARG M  1 37  ? 51.451  63.624  103.164 1.00 74.27  ? 177  ARG I CA  1 
ATOM   8168  C C   . ARG M  1 37  ? 52.101  62.526  102.311 1.00 74.27  ? 177  ARG I C   1 
ATOM   8169  O O   . ARG M  1 37  ? 52.518  62.759  101.173 1.00 74.27  ? 177  ARG I O   1 
ATOM   8170  C CB  . ARG M  1 37  ? 49.929  63.546  103.025 1.00 74.27  ? 177  ARG I CB  1 
ATOM   8171  C CG  . ARG M  1 37  ? 49.154  64.186  104.164 1.00 74.27  ? 177  ARG I CG  1 
ATOM   8172  C CD  . ARG M  1 37  ? 47.835  63.451  104.371 1.00 74.27  ? 177  ARG I CD  1 
ATOM   8173  N NE  . ARG M  1 37  ? 47.206  63.784  105.643 1.00 74.27  ? 177  ARG I NE  1 
ATOM   8174  C CZ  . ARG M  1 37  ? 45.923  64.103  105.784 1.00 74.27  ? 177  ARG I CZ  1 
ATOM   8175  N NH1 . ARG M  1 37  ? 45.122  64.137  104.726 1.00 74.27  ? 177  ARG I NH1 1 
ATOM   8176  N NH2 . ARG M  1 37  ? 45.438  64.389  106.989 1.00 74.27  ? 177  ARG I NH2 1 
ATOM   8177  N N   . ASP M  1 38  ? 52.200  61.332  102.887 1.00 43.32  ? 178  ASP I N   1 
ATOM   8178  C CA  . ASP M  1 38  ? 52.743  60.181  102.183 1.00 43.32  ? 178  ASP I CA  1 
ATOM   8179  C C   . ASP M  1 38  ? 51.622  59.818  101.224 1.00 43.32  ? 178  ASP I C   1 
ATOM   8180  O O   . ASP M  1 38  ? 50.453  59.765  101.619 1.00 43.32  ? 178  ASP I O   1 
ATOM   8181  C CB  . ASP M  1 38  ? 53.005  59.033  103.161 1.00 43.32  ? 178  ASP I CB  1 
ATOM   8182  C CG  . ASP M  1 38  ? 54.395  59.075  103.740 1.00 43.32  ? 178  ASP I CG  1 
ATOM   8183  O OD1 . ASP M  1 38  ? 55.338  59.240  102.950 1.00 43.32  ? 178  ASP I OD1 1 
ATOM   8184  O OD2 . ASP M  1 38  ? 54.546  58.947  104.971 1.00 43.32  ? 178  ASP I OD2 1 
ATOM   8185  N N   . ARG M  1 39  ? 51.971  59.578  99.968  1.00 41.06  ? 179  ARG I N   1 
ATOM   8186  C CA  . ARG M  1 39  ? 50.975  59.264  98.954  1.00 41.06  ? 179  ARG I CA  1 
ATOM   8187  C C   . ARG M  1 39  ? 50.295  57.898  99.070  1.00 41.06  ? 179  ARG I C   1 
ATOM   8188  O O   . ARG M  1 39  ? 50.488  57.008  98.236  1.00 41.06  ? 179  ARG I O   1 
ATOM   8189  C CB  . ARG M  1 39  ? 51.601  59.447  97.569  1.00 41.06  ? 179  ARG I CB  1 
ATOM   8190  C CG  . ARG M  1 39  ? 52.013  60.896  97.303  1.00 41.06  ? 179  ARG I CG  1 
ATOM   8191  C CD  . ARG M  1 39  ? 52.547  61.118  95.895  1.00 41.06  ? 179  ARG I CD  1 
ATOM   8192  N NE  . ARG M  1 39  ? 51.551  60.869  94.861  1.00 41.06  ? 179  ARG I NE  1 
ATOM   8193  C CZ  . ARG M  1 39  ? 51.398  59.696  94.263  1.00 41.06  ? 179  ARG I CZ  1 
ATOM   8194  N NH1 . ARG M  1 39  ? 52.174  58.687  94.600  1.00 41.06  ? 179  ARG I NH1 1 
ATOM   8195  N NH2 . ARG M  1 39  ? 50.475  59.525  93.332  1.00 41.06  ? 179  ARG I NH2 1 
ATOM   8196  N N   . ASN M  1 40  ? 49.482  57.733  100.107 1.00 67.13  ? 180  ASN I N   1 
ATOM   8197  C CA  . ASN M  1 40  ? 48.778  56.475  100.286 1.00 67.13  ? 180  ASN I CA  1 
ATOM   8198  C C   . ASN M  1 40  ? 47.823  56.281  99.140  1.00 67.13  ? 180  ASN I C   1 
ATOM   8199  O O   . ASN M  1 40  ? 47.067  57.175  98.777  1.00 67.13  ? 180  ASN I O   1 
ATOM   8200  C CB  . ASN M  1 40  ? 48.007  56.469  101.592 1.00 67.13  ? 180  ASN I CB  1 
ATOM   8201  C CG  . ASN M  1 40  ? 48.916  56.555  102.778 1.00 67.13  ? 180  ASN I CG  1 
ATOM   8202  O OD1 . ASN M  1 40  ? 48.889  57.535  103.520 1.00 67.13  ? 180  ASN I OD1 1 
ATOM   8203  N ND2 . ASN M  1 40  ? 49.748  55.537  102.960 1.00 67.13  ? 180  ASN I ND2 1 
ATOM   8204  N N   . GLY M  1 41  ? 47.868  55.098  98.564  1.00 37.62  ? 181  GLY I N   1 
ATOM   8205  C CA  . GLY M  1 41  ? 46.999  54.809  97.450  1.00 37.62  ? 181  GLY I CA  1 
ATOM   8206  C C   . GLY M  1 41  ? 47.800  54.452  96.219  1.00 37.62  ? 181  GLY I C   1 
ATOM   8207  O O   . GLY M  1 41  ? 47.320  53.678  95.388  1.00 37.62  ? 181  GLY I O   1 
ATOM   8208  N N   . THR M  1 42  ? 49.021  54.984  96.105  1.00 40.47  ? 182  THR I N   1 
ATOM   8209  C CA  . THR M  1 42  ? 49.864  54.700  94.930  1.00 40.47  ? 182  THR I CA  1 
ATOM   8210  C C   . THR M  1 42  ? 50.108  53.233  94.653  1.00 40.47  ? 182  THR I C   1 
ATOM   8211  O O   . THR M  1 42  ? 50.073  52.800  93.495  1.00 40.47  ? 182  THR I O   1 
ATOM   8212  C CB  . THR M  1 42  ? 51.252  55.358  94.988  1.00 40.47  ? 182  THR I CB  1 
ATOM   8213  O OG1 . THR M  1 42  ? 51.370  56.179  96.154  1.00 40.47  ? 182  THR I OG1 1 
ATOM   8214  C CG2 . THR M  1 42  ? 51.463  56.194  93.739  1.00 40.47  ? 182  THR I CG2 1 
ATOM   8215  N N   . HIS M  1 43  ? 50.378  52.469  95.703  1.00 80.71  ? 183  HIS I N   1 
ATOM   8216  C CA  . HIS M  1 43  ? 50.595  51.053  95.516  1.00 80.71  ? 183  HIS I CA  1 
ATOM   8217  C C   . HIS M  1 43  ? 49.580  50.583  94.441  1.00 80.71  ? 183  HIS I C   1 
ATOM   8218  O O   . HIS M  1 43  ? 49.968  50.021  93.414  1.00 80.71  ? 183  HIS I O   1 
ATOM   8219  C CB  . HIS M  1 43  ? 50.427  50.282  96.852  1.00 80.71  ? 183  HIS I CB  1 
ATOM   8220  C CG  . HIS M  1 43  ? 49.805  51.069  97.982  1.00 80.71  ? 183  HIS I CG  1 
ATOM   8221  N ND1 . HIS M  1 43  ? 50.376  52.205  98.517  1.00 80.71  ? 183  HIS I ND1 1 
ATOM   8222  C CD2 . HIS M  1 43  ? 48.702  50.819  98.737  1.00 80.71  ? 183  HIS I CD2 1 
ATOM   8223  C CE1 . HIS M  1 43  ? 49.656  52.619  99.548  1.00 80.71  ? 183  HIS I CE1 1 
ATOM   8224  N NE2 . HIS M  1 43  ? 48.636  51.795  99.704  1.00 80.71  ? 183  HIS I NE2 1 
ATOM   8225  N N   . LEU M  1 44  ? 48.295  50.870  94.665  1.00 30.88  ? 184  LEU I N   1 
ATOM   8226  C CA  . LEU M  1 44  ? 47.202  50.511  93.752  1.00 30.88  ? 184  LEU I CA  1 
ATOM   8227  C C   . LEU M  1 44  ? 47.411  51.023  92.321  1.00 30.88  ? 184  LEU I C   1 
ATOM   8228  O O   . LEU M  1 44  ? 47.137  50.328  91.343  1.00 30.88  ? 184  LEU I O   1 
ATOM   8229  C CB  . LEU M  1 44  ? 45.887  51.068  94.303  1.00 30.88  ? 184  LEU I CB  1 
ATOM   8230  C CG  . LEU M  1 44  ? 45.206  50.235  95.402  1.00 30.88  ? 184  LEU I CG  1 
ATOM   8231  C CD1 . LEU M  1 44  ? 46.249  49.477  96.213  1.00 30.88  ? 184  LEU I CD1 1 
ATOM   8232  C CD2 . LEU M  1 44  ? 44.384  51.137  96.332  1.00 30.88  ? 184  LEU I CD2 1 
ATOM   8233  N N   . ASP M  1 45  ? 47.889  52.253  92.207  1.00 44.49  ? 185  ASP I N   1 
ATOM   8234  C CA  . ASP M  1 45  ? 48.128  52.856  90.909  1.00 44.49  ? 185  ASP I CA  1 
ATOM   8235  C C   . ASP M  1 45  ? 49.201  52.031  90.211  1.00 44.49  ? 185  ASP I C   1 
ATOM   8236  O O   . ASP M  1 45  ? 49.066  51.660  89.047  1.00 44.49  ? 185  ASP I O   1 
ATOM   8237  C CB  . ASP M  1 45  ? 48.624  54.300  91.071  1.00 44.49  ? 185  ASP I CB  1 
ATOM   8238  C CG  . ASP M  1 45  ? 47.491  55.312  91.319  1.00 44.49  ? 185  ASP I CG  1 
ATOM   8239  O OD1 . ASP M  1 45  ? 46.302  54.920  91.241  1.00 44.49  ? 185  ASP I OD1 1 
ATOM   8240  O OD2 . ASP M  1 45  ? 47.800  56.506  91.591  1.00 44.49  ? 185  ASP I OD2 1 
ATOM   8241  N N   . ALA M  1 46  ? 50.276  51.744  90.934  1.00 28.65  ? 186  ALA I N   1 
ATOM   8242  C CA  . ALA M  1 46  ? 51.368  50.966  90.360  1.00 28.65  ? 186  ALA I CA  1 
ATOM   8243  C C   . ALA M  1 46  ? 50.886  49.567  89.992  1.00 28.65  ? 186  ALA I C   1 
ATOM   8244  O O   . ALA M  1 46  ? 51.219  49.030  88.919  1.00 28.65  ? 186  ALA I O   1 
ATOM   8245  C CB  . ALA M  1 46  ? 52.506  50.884  91.337  1.00 28.65  ? 186  ALA I CB  1 
ATOM   8246  N N   . GLY M  1 47  ? 50.097  48.975  90.880  1.00 37.21  ? 187  GLY I N   1 
ATOM   8247  C CA  . GLY M  1 47  ? 49.585  47.653  90.597  1.00 37.21  ? 187  GLY I CA  1 
ATOM   8248  C C   . GLY M  1 47  ? 48.844  47.697  89.278  1.00 37.21  ? 187  GLY I C   1 
ATOM   8249  O O   . GLY M  1 47  ? 49.238  47.054  88.288  1.00 37.21  ? 187  GLY I O   1 
ATOM   8250  N N   . ALA M  1 48  ? 47.779  48.496  89.270  1.00 32.39  ? 188  ALA I N   1 
ATOM   8251  C CA  . ALA M  1 48  ? 46.932  48.668  88.103  1.00 32.39  ? 188  ALA I CA  1 
ATOM   8252  C C   . ALA M  1 48  ? 47.757  48.895  86.844  1.00 32.39  ? 188  ALA I C   1 
ATOM   8253  O O   . ALA M  1 48  ? 47.517  48.265  85.811  1.00 32.39  ? 188  ALA I O   1 
ATOM   8254  C CB  . ALA M  1 48  ? 45.987  49.829  88.331  1.00 32.39  ? 188  ALA I CB  1 
ATOM   8255  N N   . LEU M  1 49  ? 48.734  49.792  86.933  1.00 32.43  ? 189  LEU I N   1 
ATOM   8256  C CA  . LEU M  1 49  ? 49.609  50.098  85.797  1.00 32.43  ? 189  LEU I CA  1 
ATOM   8257  C C   . LEU M  1 49  ? 50.334  48.827  85.369  1.00 32.43  ? 189  LEU I C   1 
ATOM   8258  O O   . LEU M  1 49  ? 50.288  48.415  84.199  1.00 32.43  ? 189  LEU I O   1 
ATOM   8259  C CB  . LEU M  1 49  ? 50.638  51.153  86.205  1.00 32.43  ? 189  LEU I CB  1 
ATOM   8260  C CG  . LEU M  1 49  ? 50.439  52.618  85.827  1.00 32.43  ? 189  LEU I CG  1 
ATOM   8261  C CD1 . LEU M  1 49  ? 49.206  52.802  84.980  1.00 32.43  ? 189  LEU I CD1 1 
ATOM   8262  C CD2 . LEU M  1 49  ? 50.342  53.414  87.094  1.00 32.43  ? 189  LEU I CD2 1 
ATOM   8263  N N   . THR M  1 50  ? 50.992  48.206  86.342  1.00 41.58  ? 190  THR I N   1 
ATOM   8264  C CA  . THR M  1 50  ? 51.733  46.983  86.100  1.00 41.58  ? 190  THR I CA  1 
ATOM   8265  C C   . THR M  1 50  ? 50.943  45.982  85.273  1.00 41.58  ? 190  THR I C   1 
ATOM   8266  O O   . THR M  1 50  ? 51.344  45.612  84.166  1.00 41.58  ? 190  THR I O   1 
ATOM   8267  C CB  . THR M  1 50  ? 52.120  46.321  87.417  1.00 41.58  ? 190  THR I CB  1 
ATOM   8268  O OG1 . THR M  1 50  ? 53.370  46.857  87.861  1.00 41.58  ? 190  THR I OG1 1 
ATOM   8269  C CG2 . THR M  1 50  ? 52.274  44.824  87.235  1.00 41.58  ? 190  THR I CG2 1 
ATOM   8270  N N   . THR M  1 51  ? 49.816  45.549  85.820  1.00 50.09  ? 191  THR I N   1 
ATOM   8271  C CA  . THR M  1 51  ? 48.966  44.578  85.147  1.00 50.09  ? 191  THR I CA  1 
ATOM   8272  C C   . THR M  1 51  ? 48.607  45.010  83.736  1.00 50.09  ? 191  THR I C   1 
ATOM   8273  O O   . THR M  1 51  ? 49.051  44.409  82.760  1.00 50.09  ? 191  THR I O   1 
ATOM   8274  C CB  . THR M  1 51  ? 47.642  44.348  85.915  1.00 50.09  ? 191  THR I CB  1 
ATOM   8275  O OG1 . THR M  1 51  ? 47.899  44.318  87.320  1.00 50.09  ? 191  THR I OG1 1 
ATOM   8276  C CG2 . THR M  1 51  ? 47.003  43.032  85.505  1.00 50.09  ? 191  THR I CG2 1 
ATOM   8277  N N   . THR M  1 52  ? 47.797  46.057  83.642  1.00 43.81  ? 192  THR I N   1 
ATOM   8278  C CA  . THR M  1 52  ? 47.328  46.566  82.364  1.00 43.81  ? 192  THR I CA  1 
ATOM   8279  C C   . THR M  1 52  ? 48.415  46.697  81.296  1.00 43.81  ? 192  THR I C   1 
ATOM   8280  O O   . THR M  1 52  ? 48.176  46.403  80.112  1.00 43.81  ? 192  THR I O   1 
ATOM   8281  C CB  . THR M  1 52  ? 46.640  47.912  82.560  1.00 43.81  ? 192  THR I CB  1 
ATOM   8282  O OG1 . THR M  1 52  ? 47.550  48.803  83.201  1.00 43.81  ? 192  THR I OG1 1 
ATOM   8283  C CG2 . THR M  1 52  ? 45.414  47.755  83.437  1.00 43.81  ? 192  THR I CG2 1 
ATOM   8284  N N   . PHE M  1 53  ? 49.610  47.122  81.695  1.00 54.35  ? 193  PHE I N   1 
ATOM   8285  C CA  . PHE M  1 53  ? 50.661  47.265  80.706  1.00 54.35  ? 193  PHE I CA  1 
ATOM   8286  C C   . PHE M  1 53  ? 51.376  45.938  80.464  1.00 54.35  ? 193  PHE I C   1 
ATOM   8287  O O   . PHE M  1 53  ? 51.955  45.707  79.385  1.00 54.35  ? 193  PHE I O   1 
ATOM   8288  C CB  . PHE M  1 53  ? 51.615  48.391  81.116  1.00 54.35  ? 193  PHE I CB  1 
ATOM   8289  C CG  . PHE M  1 53  ? 51.105  49.752  80.736  1.00 54.35  ? 193  PHE I CG  1 
ATOM   8290  C CD1 . PHE M  1 53  ? 50.687  50.654  81.707  1.00 54.35  ? 193  PHE I CD1 1 
ATOM   8291  C CD2 . PHE M  1 53  ? 50.936  50.090  79.399  1.00 54.35  ? 193  PHE I CD2 1 
ATOM   8292  C CE1 . PHE M  1 53  ? 50.096  51.872  81.349  1.00 54.35  ? 193  PHE I CE1 1 
ATOM   8293  C CE2 . PHE M  1 53  ? 50.348  51.304  79.032  1.00 54.35  ? 193  PHE I CE2 1 
ATOM   8294  C CZ  . PHE M  1 53  ? 49.926  52.194  80.009  1.00 54.35  ? 193  PHE I CZ  1 
ATOM   8295  N N   . GLU M  1 54  ? 51.316  45.057  81.461  1.00 67.60  ? 194  GLU I N   1 
ATOM   8296  C CA  . GLU M  1 54  ? 51.909  43.729  81.337  1.00 67.60  ? 194  GLU I CA  1 
ATOM   8297  C C   . GLU M  1 54  ? 51.086  43.018  80.263  1.00 67.60  ? 194  GLU I C   1 
ATOM   8298  O O   . GLU M  1 54  ? 51.625  42.530  79.269  1.00 67.60  ? 194  GLU I O   1 
ATOM   8299  C CB  . GLU M  1 54  ? 51.785  42.975  82.655  1.00 67.60  ? 194  GLU I CB  1 
ATOM   8300  C CG  . GLU M  1 54  ? 53.084  42.403  83.179  1.00 67.60  ? 194  GLU I CG  1 
ATOM   8301  C CD  . GLU M  1 54  ? 53.036  42.091  84.676  1.00 67.60  ? 194  GLU I CD  1 
ATOM   8302  O OE1 . GLU M  1 54  ? 51.941  41.813  85.229  1.00 67.60  ? 194  GLU I OE1 1 
ATOM   8303  O OE2 . GLU M  1 54  ? 54.113  42.124  85.301  1.00 67.60  ? 194  GLU I OE2 1 
ATOM   8304  N N   . GLU M  1 55  ? 49.771  42.990  80.470  1.00 69.72  ? 195  GLU I N   1 
ATOM   8305  C CA  . GLU M  1 55  ? 48.847  42.359  79.540  1.00 69.72  ? 195  GLU I CA  1 
ATOM   8306  C C   . GLU M  1 55  ? 48.977  42.948  78.152  1.00 69.72  ? 195  GLU I C   1 
ATOM   8307  O O   . GLU M  1 55  ? 48.517  42.365  77.173  1.00 69.72  ? 195  GLU I O   1 
ATOM   8308  C CB  . GLU M  1 55  ? 47.411  42.546  80.007  1.00 69.72  ? 195  GLU I CB  1 
ATOM   8309  C CG  . GLU M  1 55  ? 47.233  42.545  81.498  1.00 69.72  ? 195  GLU I CG  1 
ATOM   8310  C CD  . GLU M  1 55  ? 45.781  42.381  81.881  1.00 69.72  ? 195  GLU I CD  1 
ATOM   8311  O OE1 . GLU M  1 55  ? 44.929  43.097  81.301  1.00 69.72  ? 195  GLU I OE1 1 
ATOM   8312  O OE2 . GLU M  1 55  ? 45.493  41.533  82.759  1.00 69.72  ? 195  GLU I OE2 1 
ATOM   8313  N N   . LEU M  1 56  ? 49.589  44.118  78.064  1.00 58.12  ? 196  LEU I N   1 
ATOM   8314  C CA  . LEU M  1 56  ? 49.758  44.749  76.771  1.00 58.12  ? 196  LEU I CA  1 
ATOM   8315  C C   . LEU M  1 56  ? 51.124  44.431  76.207  1.00 58.12  ? 196  LEU I C   1 
ATOM   8316  O O   . LEU M  1 56  ? 51.567  45.053  75.239  1.00 58.12  ? 196  LEU I O   1 
ATOM   8317  C CB  . LEU M  1 56  ? 49.572  46.250  76.887  1.00 58.12  ? 196  LEU I CB  1 
ATOM   8318  C CG  . LEU M  1 56  ? 48.100  46.645  76.816  1.00 58.12  ? 196  LEU I CG  1 
ATOM   8319  C CD1 . LEU M  1 56  ? 47.935  48.107  77.213  1.00 58.12  ? 196  LEU I CD1 1 
ATOM   8320  C CD2 . LEU M  1 56  ? 47.593  46.394  75.401  1.00 58.12  ? 196  LEU I CD2 1 
ATOM   8321  N N   . HIS M  1 57  ? 51.786  43.457  76.828  1.00 58.62  ? 197  HIS I N   1 
ATOM   8322  C CA  . HIS M  1 57  ? 53.102  42.990  76.394  1.00 58.62  ? 197  HIS I CA  1 
ATOM   8323  C C   . HIS M  1 57  ? 54.229  44.002  76.518  1.00 58.62  ? 197  HIS I C   1 
ATOM   8324  O O   . HIS M  1 57  ? 55.047  44.150  75.614  1.00 58.62  ? 197  HIS I O   1 
ATOM   8325  C CB  . HIS M  1 57  ? 53.018  42.480  74.954  1.00 58.62  ? 197  HIS I CB  1 
ATOM   8326  C CG  . HIS M  1 57  ? 51.877  41.541  74.726  1.00 58.62  ? 197  HIS I CG  1 
ATOM   8327  N ND1 . HIS M  1 57  ? 51.437  40.663  75.694  1.00 58.62  ? 197  HIS I ND1 1 
ATOM   8328  C CD2 . HIS M  1 57  ? 51.048  41.381  73.669  1.00 58.62  ? 197  HIS I CD2 1 
ATOM   8329  C CE1 . HIS M  1 57  ? 50.383  40.005  75.244  1.00 58.62  ? 197  HIS I CE1 1 
ATOM   8330  N NE2 . HIS M  1 57  ? 50.125  40.422  74.017  1.00 58.62  ? 197  HIS I NE2 1 
ATOM   8331  N N   . PHE M  1 58  ? 54.257  44.688  77.654  1.00 49.19  ? 198  PHE I N   1 
ATOM   8332  C CA  . PHE M  1 58  ? 55.275  45.678  77.942  1.00 49.19  ? 198  PHE I CA  1 
ATOM   8333  C C   . PHE M  1 58  ? 56.089  45.108  79.077  1.00 49.19  ? 198  PHE I C   1 
ATOM   8334  O O   . PHE M  1 58  ? 55.564  44.339  79.883  1.00 49.19  ? 198  PHE I O   1 
ATOM   8335  C CB  . PHE M  1 58  ? 54.629  46.988  78.381  1.00 49.19  ? 198  PHE I CB  1 
ATOM   8336  C CG  . PHE M  1 58  ? 54.479  47.966  77.273  1.00 49.19  ? 198  PHE I CG  1 
ATOM   8337  C CD1 . PHE M  1 58  ? 53.413  47.874  76.391  1.00 49.19  ? 198  PHE I CD1 1 
ATOM   8338  C CD2 . PHE M  1 58  ? 55.436  48.941  77.067  1.00 49.19  ? 198  PHE I CD2 1 
ATOM   8339  C CE1 . PHE M  1 58  ? 53.305  48.737  75.313  1.00 49.19  ? 198  PHE I CE1 1 
ATOM   8340  C CE2 . PHE M  1 58  ? 55.337  49.810  75.990  1.00 49.19  ? 198  PHE I CE2 1 
ATOM   8341  C CZ  . PHE M  1 58  ? 54.266  49.705  75.106  1.00 49.19  ? 198  PHE I CZ  1 
ATOM   8342  N N   . GLU M  1 59  ? 57.364  45.464  79.144  1.00 61.35  ? 199  GLU I N   1 
ATOM   8343  C CA  . GLU M  1 59  ? 58.193  44.961  80.216  1.00 61.35  ? 199  GLU I CA  1 
ATOM   8344  C C   . GLU M  1 59  ? 58.324  46.005  81.298  1.00 61.35  ? 199  GLU I C   1 
ATOM   8345  O O   . GLU M  1 59  ? 59.091  46.953  81.178  1.00 61.35  ? 199  GLU I O   1 
ATOM   8346  C CB  . GLU M  1 59  ? 59.557  44.568  79.687  1.00 61.35  ? 199  GLU I CB  1 
ATOM   8347  C CG  . GLU M  1 59  ? 60.125  43.356  80.399  1.00 61.35  ? 199  GLU I CG  1 
ATOM   8348  C CD  . GLU M  1 59  ? 61.629  43.349  80.369  1.00 61.35  ? 199  GLU I CD  1 
ATOM   8349  O OE1 . GLU M  1 59  ? 62.190  43.052  79.284  1.00 61.35  ? 199  GLU I OE1 1 
ATOM   8350  O OE2 . GLU M  1 59  ? 62.240  43.651  81.425  1.00 61.35  ? 199  GLU I OE2 1 
ATOM   8351  N N   . ILE M  1 60  ? 57.560  45.810  82.361  1.00 47.05  ? 200  ILE I N   1 
ATOM   8352  C CA  . ILE M  1 60  ? 57.539  46.738  83.482  1.00 47.05  ? 200  ILE I CA  1 
ATOM   8353  C C   . ILE M  1 60  ? 58.882  46.840  84.216  1.00 47.05  ? 200  ILE I C   1 
ATOM   8354  O O   . ILE M  1 60  ? 59.607  45.853  84.359  1.00 47.05  ? 200  ILE I O   1 
ATOM   8355  C CB  . ILE M  1 60  ? 56.408  46.351  84.497  1.00 47.05  ? 200  ILE I CB  1 
ATOM   8356  C CG1 . ILE M  1 60  ? 55.203  45.748  83.756  1.00 47.05  ? 200  ILE I CG1 1 
ATOM   8357  C CG2 . ILE M  1 60  ? 55.973  47.567  85.309  1.00 47.05  ? 200  ILE I CG2 1 
ATOM   8358  C CD1 . ILE M  1 60  ? 54.674  46.561  82.597  1.00 47.05  ? 200  ILE I CD1 1 
ATOM   8359  N N   . LYS M  1 61  ? 59.206  48.048  84.665  1.00 52.48  ? 201  LYS I N   1 
ATOM   8360  C CA  . LYS M  1 61  ? 60.444  48.309  85.390  1.00 52.48  ? 201  LYS I CA  1 
ATOM   8361  C C   . LYS M  1 61  ? 60.098  49.279  86.502  1.00 52.48  ? 201  LYS I C   1 
ATOM   8362  O O   . LYS M  1 61  ? 60.270  50.482  86.383  1.00 52.48  ? 201  LYS I O   1 
ATOM   8363  C CB  . LYS M  1 61  ? 61.504  48.918  84.464  1.00 52.48  ? 201  LYS I CB  1 
ATOM   8364  C CG  . LYS M  1 61  ? 62.052  47.963  83.406  1.00 52.48  ? 201  LYS I CG  1 
ATOM   8365  C CD  . LYS M  1 61  ? 62.808  46.803  84.034  1.00 52.48  ? 201  LYS I CD  1 
ATOM   8366  C CE  . LYS M  1 61  ? 63.755  46.157  83.028  1.00 52.48  ? 201  LYS I CE  1 
ATOM   8367  N NZ  . LYS M  1 61  ? 64.688  45.179  83.671  1.00 52.48  ? 201  LYS I NZ  1 
ATOM   8368  N N   . PRO M  1 62  ? 59.592  48.751  87.609  1.00 33.95  ? 202  PRO I N   1 
ATOM   8369  C CA  . PRO M  1 62  ? 59.193  49.534  88.782  1.00 33.95  ? 202  PRO I CA  1 
ATOM   8370  C C   . PRO M  1 62  ? 60.353  50.142  89.535  1.00 33.95  ? 202  PRO I C   1 
ATOM   8371  O O   . PRO M  1 62  ? 61.473  49.665  89.440  1.00 33.95  ? 202  PRO I O   1 
ATOM   8372  C CB  . PRO M  1 62  ? 58.435  48.537  89.655  1.00 33.95  ? 202  PRO I CB  1 
ATOM   8373  C CG  . PRO M  1 62  ? 58.330  47.259  88.835  1.00 33.95  ? 202  PRO I CG  1 
ATOM   8374  C CD  . PRO M  1 62  ? 59.376  47.307  87.787  1.00 33.95  ? 202  PRO I CD  1 
ATOM   8375  N N   . HIS M  1 63  ? 60.069  51.189  90.297  1.00 52.02  ? 203  HIS I N   1 
ATOM   8376  C CA  . HIS M  1 63  ? 61.073  51.866  91.098  1.00 52.02  ? 203  HIS I CA  1 
ATOM   8377  C C   . HIS M  1 63  ? 60.286  52.562  92.180  1.00 52.02  ? 203  HIS I C   1 
ATOM   8378  O O   . HIS M  1 63  ? 59.219  53.079  91.908  1.00 52.02  ? 203  HIS I O   1 
ATOM   8379  C CB  . HIS M  1 63  ? 61.843  52.861  90.241  1.00 52.02  ? 203  HIS I CB  1 
ATOM   8380  C CG  . HIS M  1 63  ? 62.828  52.209  89.317  1.00 52.02  ? 203  HIS I CG  1 
ATOM   8381  N ND1 . HIS M  1 63  ? 64.085  51.818  89.727  1.00 52.02  ? 203  HIS I ND1 1 
ATOM   8382  C CD2 . HIS M  1 63  ? 62.727  51.844  88.015  1.00 52.02  ? 203  HIS I CD2 1 
ATOM   8383  C CE1 . HIS M  1 63  ? 64.717  51.239  88.718  1.00 52.02  ? 203  HIS I CE1 1 
ATOM   8384  N NE2 . HIS M  1 63  ? 63.916  51.242  87.667  1.00 52.02  ? 203  HIS I NE2 1 
ATOM   8385  N N   . HIS M  1 64  ? 60.789  52.574  93.406  1.00 63.11  ? 204  HIS I N   1 
ATOM   8386  C CA  . HIS M  1 64  ? 60.033  53.195  94.476  1.00 63.11  ? 204  HIS I CA  1 
ATOM   8387  C C   . HIS M  1 64  ? 60.752  54.253  95.279  1.00 63.11  ? 204  HIS I C   1 
ATOM   8388  O O   . HIS M  1 64  ? 61.966  54.208  95.439  1.00 63.11  ? 204  HIS I O   1 
ATOM   8389  C CB  . HIS M  1 64  ? 59.497  52.105  95.393  1.00 63.11  ? 204  HIS I CB  1 
ATOM   8390  C CG  . HIS M  1 64  ? 58.820  51.000  94.650  1.00 63.11  ? 204  HIS I CG  1 
ATOM   8391  N ND1 . HIS M  1 64  ? 57.493  51.062  94.279  1.00 63.11  ? 204  HIS I ND1 1 
ATOM   8392  C CD2 . HIS M  1 64  ? 59.297  49.837  94.149  1.00 63.11  ? 204  HIS I CD2 1 
ATOM   8393  C CE1 . HIS M  1 64  ? 57.183  49.983  93.580  1.00 63.11  ? 204  HIS I CE1 1 
ATOM   8394  N NE2 . HIS M  1 64  ? 58.260  49.225  93.486  1.00 63.11  ? 204  HIS I NE2 1 
ATOM   8395  N N   . ASP M  1 65  ? 59.974  55.212  95.770  1.00 59.24  ? 205  ASP I N   1 
ATOM   8396  C CA  . ASP M  1 65  ? 60.481  56.313  96.570  1.00 59.24  ? 205  ASP I CA  1 
ATOM   8397  C C   . ASP M  1 65  ? 61.804  56.874  96.051  1.00 59.24  ? 205  ASP I C   1 
ATOM   8398  O O   . ASP M  1 65  ? 62.829  56.751  96.715  1.00 59.24  ? 205  ASP I O   1 
ATOM   8399  C CB  . ASP M  1 65  ? 60.642  55.858  98.018  1.00 59.24  ? 205  ASP I CB  1 
ATOM   8400  C CG  . ASP M  1 65  ? 59.359  55.292  98.594  1.00 59.24  ? 205  ASP I CG  1 
ATOM   8401  O OD1 . ASP M  1 65  ? 58.280  55.786  98.233  1.00 59.24  ? 205  ASP I OD1 1 
ATOM   8402  O OD2 . ASP M  1 65  ? 59.418  54.357  99.413  1.00 59.24  ? 205  ASP I OD2 1 
ATOM   8403  N N   . CYS M  1 66  ? 61.782  57.499  94.875  1.00 40.80  ? 206  CYS I N   1 
ATOM   8404  C CA  . CYS M  1 66  ? 63.001  58.069  94.307  1.00 40.80  ? 206  CYS I CA  1 
ATOM   8405  C C   . CYS M  1 66  ? 63.187  59.563  94.475  1.00 40.80  ? 206  CYS I C   1 
ATOM   8406  O O   . CYS M  1 66  ? 62.312  60.361  94.132  1.00 40.80  ? 206  CYS I O   1 
ATOM   8407  C CB  . CYS M  1 66  ? 63.090  57.780  92.823  1.00 40.80  ? 206  CYS I CB  1 
ATOM   8408  S SG  . CYS M  1 66  ? 62.364  56.256  92.424  1.00 40.80  ? 206  CYS I SG  1 
ATOM   8409  N N   . THR M  1 67  ? 64.353  59.929  94.987  1.00 45.24  ? 207  THR I N   1 
ATOM   8410  C CA  . THR M  1 67  ? 64.726  61.317  95.155  1.00 45.24  ? 207  THR I CA  1 
ATOM   8411  C C   . THR M  1 67  ? 64.803  61.851  93.720  1.00 45.24  ? 207  THR I C   1 
ATOM   8412  O O   . THR M  1 67  ? 64.755  61.069  92.760  1.00 45.24  ? 207  THR I O   1 
ATOM   8413  C CB  . THR M  1 67  ? 66.104  61.408  95.767  1.00 45.24  ? 207  THR I CB  1 
ATOM   8414  O OG1 . THR M  1 67  ? 67.067  60.922  94.818  1.00 45.24  ? 207  THR I OG1 1 
ATOM   8415  C CG2 . THR M  1 67  ? 66.169  60.565  97.021  1.00 45.24  ? 207  THR I CG2 1 
ATOM   8416  N N   . VAL M  1 68  ? 64.927  63.165  93.559  1.00 44.67  ? 208  VAL I N   1 
ATOM   8417  C CA  . VAL M  1 68  ? 64.999  63.713  92.216  1.00 44.67  ? 208  VAL I CA  1 
ATOM   8418  C C   . VAL M  1 68  ? 66.184  63.104  91.491  1.00 44.67  ? 208  VAL I C   1 
ATOM   8419  O O   . VAL M  1 68  ? 66.079  62.664  90.346  1.00 44.67  ? 208  VAL I O   1 
ATOM   8420  C CB  . VAL M  1 68  ? 65.166  65.228  92.243  1.00 44.67  ? 208  VAL I CB  1 
ATOM   8421  C CG1 . VAL M  1 68  ? 65.742  65.705  90.922  1.00 44.67  ? 208  VAL I CG1 1 
ATOM   8422  C CG2 . VAL M  1 68  ? 63.839  65.874  92.503  1.00 44.67  ? 208  VAL I CG2 1 
ATOM   8423  N N   . GLU M  1 69  ? 67.317  63.068  92.173  1.00 67.15  ? 209  GLU I N   1 
ATOM   8424  C CA  . GLU M  1 69  ? 68.518  62.520  91.580  1.00 67.15  ? 209  GLU I CA  1 
ATOM   8425  C C   . GLU M  1 69  ? 68.313  61.095  91.102  1.00 67.15  ? 209  GLU I C   1 
ATOM   8426  O O   . GLU M  1 69  ? 68.733  60.737  90.006  1.00 67.15  ? 209  GLU I O   1 
ATOM   8427  C CB  . GLU M  1 69  ? 69.656  62.568  92.583  1.00 67.15  ? 209  GLU I CB  1 
ATOM   8428  C CG  . GLU M  1 69  ? 70.973  62.118  92.000  1.00 67.15  ? 209  GLU I CG  1 
ATOM   8429  C CD  . GLU M  1 69  ? 72.087  62.094  93.034  1.00 67.15  ? 209  GLU I CD  1 
ATOM   8430  O OE1 . GLU M  1 69  ? 71.897  61.457  94.100  1.00 67.15  ? 209  GLU I OE1 1 
ATOM   8431  O OE2 . GLU M  1 69  ? 73.148  62.710  92.781  1.00 67.15  ? 209  GLU I OE2 1 
ATOM   8432  N N   . GLN M  1 70  ? 67.667  60.281  91.924  1.00 34.77  ? 210  GLN I N   1 
ATOM   8433  C CA  . GLN M  1 70  ? 67.420  58.899  91.542  1.00 34.77  ? 210  GLN I CA  1 
ATOM   8434  C C   . GLN M  1 70  ? 66.603  58.853  90.246  1.00 34.77  ? 210  GLN I C   1 
ATOM   8435  O O   . GLN M  1 70  ? 66.821  58.003  89.367  1.00 34.77  ? 210  GLN I O   1 
ATOM   8436  C CB  . GLN M  1 70  ? 66.639  58.175  92.634  1.00 34.77  ? 210  GLN I CB  1 
ATOM   8437  C CG  . GLN M  1 70  ? 67.454  57.367  93.603  1.00 34.77  ? 210  GLN I CG  1 
ATOM   8438  C CD  . GLN M  1 70  ? 66.813  57.342  94.978  1.00 34.77  ? 210  GLN I CD  1 
ATOM   8439  O OE1 . GLN M  1 70  ? 67.125  56.493  95.820  1.00 34.77  ? 210  GLN I OE1 1 
ATOM   8440  N NE2 . GLN M  1 70  ? 65.907  58.281  95.215  1.00 34.77  ? 210  GLN I NE2 1 
ATOM   8441  N N   . ILE M  1 71  ? 65.649  59.774  90.136  1.00 41.92  ? 211  ILE I N   1 
ATOM   8442  C CA  . ILE M  1 71  ? 64.775  59.818  88.966  1.00 41.92  ? 211  ILE I CA  1 
ATOM   8443  C C   . ILE M  1 71  ? 65.581  60.069  87.711  1.00 41.92  ? 211  ILE I C   1 
ATOM   8444  O O   . ILE M  1 71  ? 65.398  59.409  86.690  1.00 41.92  ? 211  ILE I O   1 
ATOM   8445  C CB  . ILE M  1 71  ? 63.683  60.919  89.100  1.00 41.92  ? 211  ILE I CB  1 
ATOM   8446  C CG1 . ILE M  1 71  ? 63.008  60.834  90.485  1.00 41.92  ? 211  ILE I CG1 1 
ATOM   8447  C CG2 . ILE M  1 71  ? 62.683  60.780  87.955  1.00 41.92  ? 211  ILE I CG2 1 
ATOM   8448  C CD1 . ILE M  1 71  ? 61.487  60.945  90.477  1.00 41.92  ? 211  ILE I CD1 1 
ATOM   8449  N N   . TYR M  1 72  ? 66.488  61.025  87.792  1.00 42.17  ? 212  TYR I N   1 
ATOM   8450  C CA  . TYR M  1 72  ? 67.301  61.342  86.640  1.00 42.17  ? 212  TYR I CA  1 
ATOM   8451  C C   . TYR M  1 72  ? 68.210  60.180  86.307  1.00 42.17  ? 212  TYR I C   1 
ATOM   8452  O O   . TYR M  1 72  ? 68.328  59.783  85.149  1.00 42.17  ? 212  TYR I O   1 
ATOM   8453  C CB  . TYR M  1 72  ? 68.107  62.593  86.922  1.00 42.17  ? 212  TYR I CB  1 
ATOM   8454  C CG  . TYR M  1 72  ? 67.300  63.855  86.744  1.00 42.17  ? 212  TYR I CG  1 
ATOM   8455  C CD1 . TYR M  1 72  ? 67.187  64.784  87.776  1.00 42.17  ? 212  TYR I CD1 1 
ATOM   8456  C CD2 . TYR M  1 72  ? 66.685  64.142  85.523  1.00 42.17  ? 212  TYR I CD2 1 
ATOM   8457  C CE1 . TYR M  1 72  ? 66.490  65.969  87.595  1.00 42.17  ? 212  TYR I CE1 1 
ATOM   8458  C CE2 . TYR M  1 72  ? 65.987  65.327  85.335  1.00 42.17  ? 212  TYR I CE2 1 
ATOM   8459  C CZ  . TYR M  1 72  ? 65.896  66.239  86.371  1.00 42.17  ? 212  TYR I CZ  1 
ATOM   8460  O OH  . TYR M  1 72  ? 65.255  67.444  86.167  1.00 42.17  ? 212  TYR I OH  1 
ATOM   8461  N N   . GLU M  1 73  ? 68.849  59.635  87.332  1.00 56.85  ? 213  GLU I N   1 
ATOM   8462  C CA  . GLU M  1 73  ? 69.735  58.493  87.158  1.00 56.85  ? 213  GLU I CA  1 
ATOM   8463  C C   . GLU M  1 73  ? 69.001  57.416  86.357  1.00 56.85  ? 213  GLU I C   1 
ATOM   8464  O O   . GLU M  1 73  ? 69.528  56.878  85.386  1.00 56.85  ? 213  GLU I O   1 
ATOM   8465  C CB  . GLU M  1 73  ? 70.123  57.925  88.526  1.00 56.85  ? 213  GLU I CB  1 
ATOM   8466  C CG  . GLU M  1 73  ? 71.604  57.723  88.750  1.00 56.85  ? 213  GLU I CG  1 
ATOM   8467  C CD  . GLU M  1 73  ? 71.995  57.835  90.226  1.00 56.85  ? 213  GLU I CD  1 
ATOM   8468  O OE1 . GLU M  1 73  ? 71.407  57.107  91.065  1.00 56.85  ? 213  GLU I OE1 1 
ATOM   8469  O OE2 . GLU M  1 73  ? 72.898  58.651  90.545  1.00 56.85  ? 213  GLU I OE2 1 
ATOM   8470  N N   . ILE M  1 74  ? 67.771  57.115  86.768  1.00 34.68  ? 214  ILE I N   1 
ATOM   8471  C CA  . ILE M  1 74  ? 66.963  56.092  86.114  1.00 34.68  ? 214  ILE I CA  1 
ATOM   8472  C C   . ILE M  1 74  ? 66.629  56.425  84.664  1.00 34.68  ? 214  ILE I C   1 
ATOM   8473  O O   . ILE M  1 74  ? 66.763  55.585  83.771  1.00 34.68  ? 214  ILE I O   1 
ATOM   8474  C CB  . ILE M  1 74  ? 65.653  55.875  86.884  1.00 34.68  ? 214  ILE I CB  1 
ATOM   8475  C CG1 . ILE M  1 74  ? 65.966  55.357  88.284  1.00 34.68  ? 214  ILE I CG1 1 
ATOM   8476  C CG2 . ILE M  1 74  ? 64.752  54.920  86.137  1.00 34.68  ? 214  ILE I CG2 1 
ATOM   8477  C CD1 . ILE M  1 74  ? 64.741  55.030  89.107  1.00 34.68  ? 214  ILE I CD1 1 
ATOM   8478  N N   . LEU M  1 75  ? 66.183  57.646  84.419  1.00 32.56  ? 215  LEU I N   1 
ATOM   8479  C CA  . LEU M  1 75  ? 65.834  58.005  83.067  1.00 32.56  ? 215  LEU I CA  1 
ATOM   8480  C C   . LEU M  1 75  ? 67.094  57.987  82.219  1.00 32.56  ? 215  LEU I C   1 
ATOM   8481  O O   . LEU M  1 75  ? 67.071  57.548  81.071  1.00 32.56  ? 215  LEU I O   1 
ATOM   8482  C CB  . LEU M  1 75  ? 65.170  59.377  83.042  1.00 32.56  ? 215  LEU I CB  1 
ATOM   8483  C CG  . LEU M  1 75  ? 63.803  59.464  83.725  1.00 32.56  ? 215  LEU I CG  1 
ATOM   8484  C CD1 . LEU M  1 75  ? 63.285  60.887  83.638  1.00 32.56  ? 215  LEU I CD1 1 
ATOM   8485  C CD2 . LEU M  1 75  ? 62.839  58.505  83.057  1.00 32.56  ? 215  LEU I CD2 1 
ATOM   8486  N N   . LYS M  1 76  ? 68.206  58.437  82.785  1.00 46.59  ? 216  LYS I N   1 
ATOM   8487  C CA  . LYS M  1 76  ? 69.446  58.438  82.035  1.00 46.59  ? 216  LYS I CA  1 
ATOM   8488  C C   . LYS M  1 76  ? 69.765  57.034  81.552  1.00 46.59  ? 216  LYS I C   1 
ATOM   8489  O O   . LYS M  1 76  ? 70.342  56.868  80.484  1.00 46.59  ? 216  LYS I O   1 
ATOM   8490  C CB  . LYS M  1 76  ? 70.591  58.947  82.888  1.00 46.59  ? 216  LYS I CB  1 
ATOM   8491  C CG  . LYS M  1 76  ? 71.926  58.853  82.192  1.00 46.59  ? 216  LYS I CG  1 
ATOM   8492  C CD  . LYS M  1 76  ? 72.940  59.843  82.793  1.00 46.59  ? 216  LYS I CD  1 
ATOM   8493  C CE  . LYS M  1 76  ? 74.061  60.244  81.795  1.00 46.59  ? 216  LYS I CE  1 
ATOM   8494  N NZ  . LYS M  1 76  ? 75.327  60.729  82.466  1.00 46.59  ? 216  LYS I NZ  1 
ATOM   8495  N N   . ILE M  1 77  ? 69.395  56.019  82.332  1.00 39.93  ? 217  ILE I N   1 
ATOM   8496  C CA  . ILE M  1 77  ? 69.667  54.644  81.921  1.00 39.93  ? 217  ILE I CA  1 
ATOM   8497  C C   . ILE M  1 77  ? 68.897  54.321  80.642  1.00 39.93  ? 217  ILE I C   1 
ATOM   8498  O O   . ILE M  1 77  ? 69.493  54.041  79.595  1.00 39.93  ? 217  ILE I O   1 
ATOM   8499  C CB  . ILE M  1 77  ? 69.250  53.614  83.001  1.00 39.93  ? 217  ILE I CB  1 
ATOM   8500  C CG1 . ILE M  1 77  ? 70.203  53.681  84.193  1.00 39.93  ? 217  ILE I CG1 1 
ATOM   8501  C CG2 . ILE M  1 77  ? 69.247  52.197  82.405  1.00 39.93  ? 217  ILE I CG2 1 
ATOM   8502  C CD1 . ILE M  1 77  ? 69.910  52.623  85.252  1.00 39.93  ? 217  ILE I CD1 1 
ATOM   8503  N N   . TYR M  1 78  ? 67.566  54.378  80.733  1.00 37.39  ? 218  TYR I N   1 
ATOM   8504  C CA  . TYR M  1 78  ? 66.713  54.068  79.596  1.00 37.39  ? 218  TYR I CA  1 
ATOM   8505  C C   . TYR M  1 78  ? 66.939  55.047  78.470  1.00 37.39  ? 218  TYR I C   1 
ATOM   8506  O O   . TYR M  1 78  ? 66.640  54.778  77.307  1.00 37.39  ? 218  TYR I O   1 
ATOM   8507  C CB  . TYR M  1 78  ? 65.263  54.042  80.056  1.00 37.39  ? 218  TYR I CB  1 
ATOM   8508  C CG  . TYR M  1 78  ? 65.017  52.883  81.002  1.00 37.39  ? 218  TYR I CG  1 
ATOM   8509  C CD1 . TYR M  1 78  ? 65.275  53.012  82.367  1.00 37.39  ? 218  TYR I CD1 1 
ATOM   8510  C CD2 . TYR M  1 78  ? 64.596  51.636  80.520  1.00 37.39  ? 218  TYR I CD2 1 
ATOM   8511  C CE1 . TYR M  1 78  ? 65.128  51.930  83.233  1.00 37.39  ? 218  TYR I CE1 1 
ATOM   8512  C CE2 . TYR M  1 78  ? 64.445  50.549  81.375  1.00 37.39  ? 218  TYR I CE2 1 
ATOM   8513  C CZ  . TYR M  1 78  ? 64.714  50.704  82.729  1.00 37.39  ? 218  TYR I CZ  1 
ATOM   8514  O OH  . TYR M  1 78  ? 64.566  49.631  83.581  1.00 37.39  ? 218  TYR I OH  1 
ATOM   8515  N N   . GLN M  1 79  ? 67.512  56.182  78.826  1.00 39.34  ? 219  GLN I N   1 
ATOM   8516  C CA  . GLN M  1 79  ? 67.813  57.198  77.845  1.00 39.34  ? 219  GLN I CA  1 
ATOM   8517  C C   . GLN M  1 79  ? 68.995  56.737  77.013  1.00 39.34  ? 219  GLN I C   1 
ATOM   8518  O O   . GLN M  1 79  ? 69.093  57.087  75.842  1.00 39.34  ? 219  GLN I O   1 
ATOM   8519  C CB  . GLN M  1 79  ? 68.158  58.506  78.540  1.00 39.34  ? 219  GLN I CB  1 
ATOM   8520  C CG  . GLN M  1 79  ? 68.331  59.637  77.586  1.00 39.34  ? 219  GLN I CG  1 
ATOM   8521  C CD  . GLN M  1 79  ? 69.767  59.997  77.420  1.00 39.34  ? 219  GLN I CD  1 
ATOM   8522  O OE1 . GLN M  1 79  ? 70.347  60.678  78.269  1.00 39.34  ? 219  GLN I OE1 1 
ATOM   8523  N NE2 . GLN M  1 79  ? 70.369  59.541  76.325  1.00 39.34  ? 219  GLN I NE2 1 
ATOM   8524  N N   . LEU M  1 80  ? 69.877  55.933  77.617  1.00 39.37  ? 220  LEU I N   1 
ATOM   8525  C CA  . LEU M  1 80  ? 71.089  55.436  76.942  1.00 39.37  ? 220  LEU I CA  1 
ATOM   8526  C C   . LEU M  1 80  ? 70.984  54.054  76.303  1.00 39.37  ? 220  LEU I C   1 
ATOM   8527  O O   . LEU M  1 80  ? 71.883  53.642  75.565  1.00 39.37  ? 220  LEU I O   1 
ATOM   8528  C CB  . LEU M  1 80  ? 72.267  55.440  77.919  1.00 39.37  ? 220  LEU I CB  1 
ATOM   8529  C CG  . LEU M  1 80  ? 72.637  56.854  78.347  1.00 39.37  ? 220  LEU I CG  1 
ATOM   8530  C CD1 . LEU M  1 80  ? 73.619  56.845  79.501  1.00 39.37  ? 220  LEU I CD1 1 
ATOM   8531  C CD2 . LEU M  1 80  ? 73.198  57.575  77.127  1.00 39.37  ? 220  LEU I CD2 1 
ATOM   8532  N N   . MET M  1 81  ? 69.890  53.352  76.585  1.00 39.98  ? 221  MET I N   1 
ATOM   8533  C CA  . MET M  1 81  ? 69.668  52.010  76.047  1.00 39.98  ? 221  MET I CA  1 
ATOM   8534  C C   . MET M  1 81  ? 69.464  51.936  74.546  1.00 39.98  ? 221  MET I C   1 
ATOM   8535  O O   . MET M  1 81  ? 69.268  52.942  73.866  1.00 39.98  ? 221  MET I O   1 
ATOM   8536  C CB  . MET M  1 81  ? 68.440  51.386  76.682  1.00 39.98  ? 221  MET I CB  1 
ATOM   8537  C CG  . MET M  1 81  ? 68.658  50.922  78.057  1.00 39.98  ? 221  MET I CG  1 
ATOM   8538  S SD  . MET M  1 81  ? 67.445  49.725  78.333  1.00 39.98  ? 221  MET I SD  1 
ATOM   8539  C CE  . MET M  1 81  ? 67.977  49.176  79.970  1.00 39.98  ? 221  MET I CE  1 
ATOM   8540  N N   . ASP M  1 82  ? 69.492  50.716  74.033  1.00 44.96  ? 222  ASP I N   1 
ATOM   8541  C CA  . ASP M  1 82  ? 69.270  50.530  72.627  1.00 44.96  ? 222  ASP I CA  1 
ATOM   8542  C C   . ASP M  1 82  ? 67.881  49.958  72.501  1.00 44.96  ? 222  ASP I C   1 
ATOM   8543  O O   . ASP M  1 82  ? 67.690  48.760  72.674  1.00 44.96  ? 222  ASP I O   1 
ATOM   8544  C CB  . ASP M  1 82  ? 70.267  49.557  72.035  1.00 44.96  ? 222  ASP I CB  1 
ATOM   8545  C CG  . ASP M  1 82  ? 70.058  49.374  70.550  1.00 44.96  ? 222  ASP I CG  1 
ATOM   8546  O OD1 . ASP M  1 82  ? 69.072  49.930  70.030  1.00 44.96  ? 222  ASP I OD1 1 
ATOM   8547  O OD2 . ASP M  1 82  ? 70.870  48.686  69.899  1.00 44.96  ? 222  ASP I OD2 1 
ATOM   8548  N N   . HIS M  1 83  ? 66.913  50.821  72.215  1.00 31.87  ? 224  HIS I N   1 
ATOM   8549  C CA  . HIS M  1 83  ? 65.527  50.405  72.071  1.00 31.87  ? 224  HIS I CA  1 
ATOM   8550  C C   . HIS M  1 83  ? 65.298  49.931  70.640  1.00 31.87  ? 224  HIS I C   1 
ATOM   8551  O O   . HIS M  1 83  ? 64.147  49.809  70.196  1.00 31.87  ? 224  HIS I O   1 
ATOM   8552  C CB  . HIS M  1 83  ? 64.588  51.581  72.381  1.00 31.87  ? 224  HIS I CB  1 
ATOM   8553  C CG  . HIS M  1 83  ? 64.731  52.119  73.774  1.00 31.87  ? 224  HIS I CG  1 
ATOM   8554  N ND1 . HIS M  1 83  ? 63.857  51.800  74.792  1.00 31.87  ? 224  HIS I ND1 1 
ATOM   8555  C CD2 . HIS M  1 83  ? 65.677  52.918  74.327  1.00 31.87  ? 224  HIS I CD2 1 
ATOM   8556  C CE1 . HIS M  1 83  ? 64.258  52.374  75.912  1.00 31.87  ? 224  HIS I CE1 1 
ATOM   8557  N NE2 . HIS M  1 83  ? 65.359  53.058  75.658  1.00 31.87  ? 224  HIS I NE2 1 
ATOM   8558  N N   . SER M  1 84  ? 66.385  49.656  69.916  1.00 38.74  ? 225  SER I N   1 
ATOM   8559  C CA  . SER M  1 84  ? 66.279  49.226  68.520  1.00 38.74  ? 225  SER I CA  1 
ATOM   8560  C C   . SER M  1 84  ? 65.276  48.109  68.288  1.00 38.74  ? 225  SER I C   1 
ATOM   8561  O O   . SER M  1 84  ? 64.572  48.106  67.281  1.00 38.74  ? 225  SER I O   1 
ATOM   8562  C CB  . SER M  1 84  ? 67.649  48.818  67.980  1.00 38.74  ? 225  SER I CB  1 
ATOM   8563  O OG  . SER M  1 84  ? 68.265  49.936  67.363  1.00 38.74  ? 225  SER I OG  1 
ATOM   8564  N N   . ASN M  1 85  ? 65.190  47.164  69.212  1.00 49.59  ? 226  ASN I N   1 
ATOM   8565  C CA  . ASN M  1 85  ? 64.243  46.074  69.034  1.00 49.59  ? 226  ASN I CA  1 
ATOM   8566  C C   . ASN M  1 85  ? 62.885  46.408  69.657  1.00 49.59  ? 226  ASN I C   1 
ATOM   8567  O O   . ASN M  1 85  ? 61.920  45.647  69.538  1.00 49.59  ? 226  ASN I O   1 
ATOM   8568  C CB  . ASN M  1 85  ? 64.823  44.790  69.625  1.00 49.59  ? 226  ASN I CB  1 
ATOM   8569  C CG  . ASN M  1 85  ? 65.834  44.140  68.697  1.00 49.59  ? 226  ASN I CG  1 
ATOM   8570  O OD1 . ASN M  1 85  ? 66.086  44.639  67.597  1.00 49.59  ? 226  ASN I OD1 1 
ATOM   8571  N ND2 . ASN M  1 85  ? 66.418  43.022  69.129  1.00 49.59  ? 226  ASN I ND2 1 
ATOM   8572  N N   . MET M  1 86  ? 62.820  47.564  70.311  1.00 58.07  ? 227  MET I N   1 
ATOM   8573  C CA  . MET M  1 86  ? 61.591  48.020  70.942  1.00 58.07  ? 227  MET I CA  1 
ATOM   8574  C C   . MET M  1 86  ? 60.747  48.797  69.937  1.00 58.07  ? 227  MET I C   1 
ATOM   8575  O O   . MET M  1 86  ? 61.268  49.341  68.955  1.00 58.07  ? 227  MET I O   1 
ATOM   8576  C CB  . MET M  1 86  ? 61.911  48.895  72.146  1.00 58.07  ? 227  MET I CB  1 
ATOM   8577  C CG  . MET M  1 86  ? 62.757  48.181  73.162  1.00 58.07  ? 227  MET I CG  1 
ATOM   8578  S SD  . MET M  1 86  ? 62.141  46.515  73.498  1.00 58.07  ? 227  MET I SD  1 
ATOM   8579  C CE  . MET M  1 86  ? 62.760  46.277  75.219  1.00 58.07  ? 227  MET I CE  1 
ATOM   8580  N N   . ASP M  1 87  ? 59.439  48.838  70.198  1.00 42.19  ? 228  ASP I N   1 
ATOM   8581  C CA  . ASP M  1 87  ? 58.478  49.517  69.334  1.00 42.19  ? 228  ASP I CA  1 
ATOM   8582  C C   . ASP M  1 87  ? 57.852  50.738  69.974  1.00 42.19  ? 228  ASP I C   1 
ATOM   8583  O O   . ASP M  1 87  ? 57.248  51.551  69.278  1.00 42.19  ? 228  ASP I O   1 
ATOM   8584  C CB  . ASP M  1 87  ? 57.370  48.551  68.940  1.00 42.19  ? 228  ASP I CB  1 
ATOM   8585  C CG  . ASP M  1 87  ? 57.657  47.862  67.637  1.00 42.19  ? 228  ASP I CG  1 
ATOM   8586  O OD1 . ASP M  1 87  ? 58.545  48.351  66.906  1.00 42.19  ? 228  ASP I OD1 1 
ATOM   8587  O OD2 . ASP M  1 87  ? 57.003  46.843  67.338  1.00 42.19  ? 228  ASP I OD2 1 
ATOM   8588  N N   . CYS M  1 88  ? 57.993  50.855  71.293  1.00 41.97  ? 229  CYS I N   1 
ATOM   8589  C CA  . CYS M  1 88  ? 57.433  51.971  72.054  1.00 41.97  ? 229  CYS I CA  1 
ATOM   8590  C C   . CYS M  1 88  ? 58.071  52.032  73.447  1.00 41.97  ? 229  CYS I C   1 
ATOM   8591  O O   . CYS M  1 88  ? 58.720  51.078  73.876  1.00 41.97  ? 229  CYS I O   1 
ATOM   8592  C CB  . CYS M  1 88  ? 55.901  51.800  72.160  1.00 41.97  ? 229  CYS I CB  1 
ATOM   8593  S SG  . CYS M  1 88  ? 55.023  52.699  73.500  1.00 41.97  ? 229  CYS I SG  1 
ATOM   8594  N N   . PHE M  1 89  ? 57.899  53.154  74.145  1.00 36.58  ? 230  PHE I N   1 
ATOM   8595  C CA  . PHE M  1 89  ? 58.460  53.326  75.489  1.00 36.58  ? 230  PHE I CA  1 
ATOM   8596  C C   . PHE M  1 89  ? 57.470  54.097  76.326  1.00 36.58  ? 230  PHE I C   1 
ATOM   8597  O O   . PHE M  1 89  ? 56.952  55.121  75.892  1.00 36.58  ? 230  PHE I O   1 
ATOM   8598  C CB  . PHE M  1 89  ? 59.788  54.104  75.430  1.00 36.58  ? 230  PHE I CB  1 
ATOM   8599  C CG  . PHE M  1 89  ? 60.317  54.539  76.788  1.00 36.58  ? 230  PHE I CG  1 
ATOM   8600  C CD1 . PHE M  1 89  ? 60.763  53.601  77.713  1.00 36.58  ? 230  PHE I CD1 1 
ATOM   8601  C CD2 . PHE M  1 89  ? 60.391  55.885  77.127  1.00 36.58  ? 230  PHE I CD2 1 
ATOM   8602  C CE1 . PHE M  1 89  ? 61.271  53.995  78.938  1.00 36.58  ? 230  PHE I CE1 1 
ATOM   8603  C CE2 . PHE M  1 89  ? 60.901  56.279  78.356  1.00 36.58  ? 230  PHE I CE2 1 
ATOM   8604  C CZ  . PHE M  1 89  ? 61.339  55.336  79.255  1.00 36.58  ? 230  PHE I CZ  1 
ATOM   8605  N N   . ILE M  1 90  ? 57.208  53.615  77.529  1.00 29.89  ? 231  ILE I N   1 
ATOM   8606  C CA  . ILE M  1 90  ? 56.260  54.295  78.392  1.00 29.89  ? 231  ILE I CA  1 
ATOM   8607  C C   . ILE M  1 90  ? 56.878  54.590  79.729  1.00 29.89  ? 231  ILE I C   1 
ATOM   8608  O O   . ILE M  1 90  ? 57.500  53.728  80.328  1.00 29.89  ? 231  ILE I O   1 
ATOM   8609  C CB  . ILE M  1 90  ? 55.018  53.427  78.620  1.00 29.89  ? 231  ILE I CB  1 
ATOM   8610  C CG1 . ILE M  1 90  ? 54.390  53.098  77.265  1.00 29.89  ? 231  ILE I CG1 1 
ATOM   8611  C CG2 . ILE M  1 90  ? 54.044  54.132  79.581  1.00 29.89  ? 231  ILE I CG2 1 
ATOM   8612  C CD1 . ILE M  1 90  ? 53.123  52.301  77.375  1.00 29.89  ? 231  ILE I CD1 1 
ATOM   8613  N N   . CYS M  1 91  ? 56.701  55.802  80.213  1.00 30.52  ? 232  CYS I N   1 
ATOM   8614  C CA  . CYS M  1 91  ? 57.265  56.135  81.496  1.00 30.52  ? 232  CYS I CA  1 
ATOM   8615  C C   . CYS M  1 91  ? 56.194  56.735  82.388  1.00 30.52  ? 232  CYS I C   1 
ATOM   8616  O O   . CYS M  1 91  ? 55.614  57.756  82.053  1.00 30.52  ? 232  CYS I O   1 
ATOM   8617  C CB  . CYS M  1 91  ? 58.408  57.118  81.313  1.00 30.52  ? 232  CYS I CB  1 
ATOM   8618  S SG  . CYS M  1 91  ? 58.907  57.837  82.865  1.00 30.52  ? 232  CYS I SG  1 
ATOM   8619  N N   . CYS M  1 92  ? 55.938  56.104  83.524  1.00 31.63  ? 233  CYS I N   1 
ATOM   8620  C CA  . CYS M  1 92  ? 54.922  56.587  84.435  1.00 31.63  ? 233  CYS I CA  1 
ATOM   8621  C C   . CYS M  1 92  ? 55.505  57.188  85.700  1.00 31.63  ? 233  CYS I C   1 
ATOM   8622  O O   . CYS M  1 92  ? 56.446  56.652  86.276  1.00 31.63  ? 233  CYS I O   1 
ATOM   8623  C CB  . CYS M  1 92  ? 53.987  55.446  84.797  1.00 31.63  ? 233  CYS I CB  1 
ATOM   8624  S SG  . CYS M  1 92  ? 53.458  54.578  83.347  1.00 31.63  ? 233  CYS I SG  1 
ATOM   8625  N N   . ILE M  1 93  ? 54.939  58.300  86.147  1.00 33.85  ? 234  ILE I N   1 
ATOM   8626  C CA  . ILE M  1 93  ? 55.424  58.944  87.353  1.00 33.85  ? 234  ILE I CA  1 
ATOM   8627  C C   . ILE M  1 93  ? 54.239  59.270  88.260  1.00 33.85  ? 234  ILE I C   1 
ATOM   8628  O O   . ILE M  1 93  ? 53.266  59.912  87.857  1.00 33.85  ? 234  ILE I O   1 
ATOM   8629  C CB  . ILE M  1 93  ? 56.211  60.217  87.006  1.00 33.85  ? 234  ILE I CB  1 
ATOM   8630  C CG1 . ILE M  1 93  ? 57.324  59.861  86.012  1.00 33.85  ? 234  ILE I CG1 1 
ATOM   8631  C CG2 . ILE M  1 93  ? 56.774  60.848  88.261  1.00 33.85  ? 234  ILE I CG2 1 
ATOM   8632  C CD1 . ILE M  1 93  ? 58.330  60.964  85.753  1.00 33.85  ? 234  ILE I CD1 1 
ATOM   8633  N N   . LEU M  1 94  ? 54.318  58.787  89.487  1.00 23.12  ? 235  LEU I N   1 
ATOM   8634  C CA  . LEU M  1 94  ? 53.277  58.996  90.454  1.00 23.12  ? 235  LEU I CA  1 
ATOM   8635  C C   . LEU M  1 94  ? 53.993  59.619  91.618  1.00 23.12  ? 235  LEU I C   1 
ATOM   8636  O O   . LEU M  1 94  ? 54.828  58.972  92.242  1.00 23.12  ? 235  LEU I O   1 
ATOM   8637  C CB  . LEU M  1 94  ? 52.663  57.650  90.848  1.00 23.12  ? 235  LEU I CB  1 
ATOM   8638  C CG  . LEU M  1 94  ? 52.673  56.557  89.766  1.00 23.12  ? 235  LEU I CG  1 
ATOM   8639  C CD1 . LEU M  1 94  ? 51.971  55.325  90.258  1.00 23.12  ? 235  LEU I CD1 1 
ATOM   8640  C CD2 . LEU M  1 94  ? 51.984  57.035  88.522  1.00 23.12  ? 235  LEU I CD2 1 
ATOM   8641  N N   . SER M  1 95  ? 53.689  60.885  91.886  1.00 34.42  ? 236  SER I N   1 
ATOM   8642  C CA  . SER M  1 95  ? 54.313  61.614  92.977  1.00 34.42  ? 236  SER I CA  1 
ATOM   8643  C C   . SER M  1 95  ? 53.603  62.953  93.167  1.00 34.42  ? 236  SER I C   1 
ATOM   8644  O O   . SER M  1 95  ? 52.643  63.240  92.461  1.00 34.42  ? 236  SER I O   1 
ATOM   8645  C CB  . SER M  1 95  ? 55.775  61.854  92.656  1.00 34.42  ? 236  SER I CB  1 
ATOM   8646  O OG  . SER M  1 95  ? 56.284  62.868  93.493  1.00 34.42  ? 236  SER I OG  1 
ATOM   8647  N N   . HIS M  1 96  ? 54.050  63.755  94.135  1.00 37.34  ? 237  HIS I N   1 
ATOM   8648  C CA  . HIS M  1 96  ? 53.450  65.064  94.379  1.00 37.34  ? 237  HIS I CA  1 
ATOM   8649  C C   . HIS M  1 96  ? 54.027  65.953  93.290  1.00 37.34  ? 237  HIS I C   1 
ATOM   8650  O O   . HIS M  1 96  ? 54.864  65.503  92.500  1.00 37.34  ? 237  HIS I O   1 
ATOM   8651  C CB  . HIS M  1 96  ? 53.850  65.609  95.750  1.00 37.34  ? 237  HIS I CB  1 
ATOM   8652  C CG  . HIS M  1 96  ? 53.139  64.961  96.900  1.00 37.34  ? 237  HIS I CG  1 
ATOM   8653  N ND1 . HIS M  1 96  ? 51.874  64.426  96.792  1.00 37.34  ? 237  HIS I ND1 1 
ATOM   8654  C CD2 . HIS M  1 96  ? 53.510  64.786  98.190  1.00 37.34  ? 237  HIS I CD2 1 
ATOM   8655  C CE1 . HIS M  1 96  ? 51.492  63.953  97.965  1.00 37.34  ? 237  HIS I CE1 1 
ATOM   8656  N NE2 . HIS M  1 96  ? 52.468  64.157  98.830  1.00 37.34  ? 237  HIS I NE2 1 
ATOM   8657  N N   . GLY M  1 97  ? 53.587  67.206  93.241  1.00 41.34  ? 238  GLY I N   1 
ATOM   8658  C CA  . GLY M  1 97  ? 54.083  68.108  92.219  1.00 41.34  ? 238  GLY I CA  1 
ATOM   8659  C C   . GLY M  1 97  ? 53.510  69.502  92.309  1.00 41.34  ? 238  GLY I C   1 
ATOM   8660  O O   . GLY M  1 97  ? 52.671  69.791  93.162  1.00 41.34  ? 238  GLY I O   1 
ATOM   8661  N N   . ASP M  1 98  ? 53.981  70.363  91.416  1.00 43.61  ? 239  ASP I N   1 
ATOM   8662  C CA  . ASP M  1 98  ? 53.549  71.746  91.362  1.00 43.61  ? 239  ASP I CA  1 
ATOM   8663  C C   . ASP M  1 98  ? 53.572  72.226  89.920  1.00 43.61  ? 239  ASP I C   1 
ATOM   8664  O O   . ASP M  1 98  ? 53.786  71.432  88.996  1.00 43.61  ? 239  ASP I O   1 
ATOM   8665  C CB  . ASP M  1 98  ? 54.478  72.618  92.199  1.00 43.61  ? 239  ASP I CB  1 
ATOM   8666  C CG  . ASP M  1 98  ? 53.733  73.673  92.980  1.00 43.61  ? 239  ASP I CG  1 
ATOM   8667  O OD1 . ASP M  1 98  ? 52.775  74.253  92.427  1.00 43.61  ? 239  ASP I OD1 1 
ATOM   8668  O OD2 . ASP M  1 98  ? 54.095  73.920  94.153  1.00 43.61  ? 239  ASP I OD2 1 
ATOM   8669  N N   . LYS M  1 99  ? 53.352  73.522  89.732  1.00 81.71  ? 240  LYS I N   1 
ATOM   8670  C CA  . LYS M  1 99  ? 53.348  74.128  88.406  1.00 81.71  ? 240  LYS I CA  1 
ATOM   8671  C C   . LYS M  1 99  ? 54.452  73.547  87.524  1.00 81.71  ? 240  LYS I C   1 
ATOM   8672  O O   . LYS M  1 99  ? 55.625  73.883  87.678  1.00 81.71  ? 240  LYS I O   1 
ATOM   8673  C CB  . LYS M  1 99  ? 53.550  75.630  88.539  1.00 81.71  ? 240  LYS I CB  1 
ATOM   8674  C CG  . LYS M  1 99  ? 54.806  75.961  89.342  1.00 81.71  ? 240  LYS I CG  1 
ATOM   8675  C CD  . LYS M  1 99  ? 54.875  77.421  89.755  1.00 81.71  ? 240  LYS I CD  1 
ATOM   8676  C CE  . LYS M  1 99  ? 56.315  77.929  89.735  1.00 81.71  ? 240  LYS I CE  1 
ATOM   8677  N NZ  . LYS M  1 99  ? 56.396  79.382  89.387  1.00 81.71  ? 240  LYS I NZ  1 
ATOM   8678  N N   . GLY M  1 100 ? 54.069  72.656  86.616  1.00 46.72  ? 241  GLY I N   1 
ATOM   8679  C CA  . GLY M  1 100 ? 55.022  72.063  85.698  1.00 46.72  ? 241  GLY I CA  1 
ATOM   8680  C C   . GLY M  1 100 ? 56.218  71.305  86.250  1.00 46.72  ? 241  GLY I C   1 
ATOM   8681  O O   . GLY M  1 100 ? 57.264  71.238  85.599  1.00 46.72  ? 241  GLY I O   1 
ATOM   8682  N N   . ILE M  1 101 ? 56.086  70.728  87.441  1.00 46.79  ? 242  ILE I N   1 
ATOM   8683  C CA  . ILE M  1 101 ? 57.183  69.961  88.028  1.00 46.79  ? 242  ILE I CA  1 
ATOM   8684  C C   . ILE M  1 101 ? 56.674  68.770  88.801  1.00 46.79  ? 242  ILE I C   1 
ATOM   8685  O O   . ILE M  1 101 ? 55.516  68.725  89.224  1.00 46.79  ? 242  ILE I O   1 
ATOM   8686  C CB  . ILE M  1 101 ? 58.005  70.785  89.010  1.00 46.79  ? 242  ILE I CB  1 
ATOM   8687  C CG1 . ILE M  1 101 ? 57.177  71.034  90.271  1.00 46.79  ? 242  ILE I CG1 1 
ATOM   8688  C CG2 . ILE M  1 101 ? 58.439  72.075  88.362  1.00 46.79  ? 242  ILE I CG2 1 
ATOM   8689  C CD1 . ILE M  1 101 ? 57.980  71.087  91.550  1.00 46.79  ? 242  ILE I CD1 1 
ATOM   8690  N N   . ILE M  1 102 ? 57.569  67.817  88.994  1.00 47.52  ? 243  ILE I N   1 
ATOM   8691  C CA  . ILE M  1 102 ? 57.264  66.616  89.732  1.00 47.52  ? 243  ILE I CA  1 
ATOM   8692  C C   . ILE M  1 102 ? 58.147  66.678  90.952  1.00 47.52  ? 243  ILE I C   1 
ATOM   8693  O O   . ILE M  1 102 ? 59.182  67.325  90.930  1.00 47.52  ? 243  ILE I O   1 
ATOM   8694  C CB  . ILE M  1 102 ? 57.577  65.374  88.878  1.00 47.52  ? 243  ILE I CB  1 
ATOM   8695  C CG1 . ILE M  1 102 ? 56.270  64.662  88.527  1.00 47.52  ? 243  ILE I CG1 1 
ATOM   8696  C CG2 . ILE M  1 102 ? 58.523  64.436  89.604  1.00 47.52  ? 243  ILE I CG2 1 
ATOM   8697  C CD1 . ILE M  1 102 ? 55.037  65.589  88.485  1.00 47.52  ? 243  ILE I CD1 1 
ATOM   8698  N N   . TYR M  1 103 ? 57.751  66.013  92.019  1.00 39.88  ? 244  TYR I N   1 
ATOM   8699  C CA  . TYR M  1 103 ? 58.548  66.063  93.223  1.00 39.88  ? 244  TYR I CA  1 
ATOM   8700  C C   . TYR M  1 103 ? 59.318  64.805  93.533  1.00 39.88  ? 244  TYR I C   1 
ATOM   8701  O O   . TYR M  1 103 ? 58.774  63.703  93.543  1.00 39.88  ? 244  TYR I O   1 
ATOM   8702  C CB  . TYR M  1 103 ? 57.672  66.388  94.414  1.00 39.88  ? 244  TYR I CB  1 
ATOM   8703  C CG  . TYR M  1 103 ? 57.590  67.853  94.698  1.00 39.88  ? 244  TYR I CG  1 
ATOM   8704  C CD1 . TYR M  1 103 ? 56.370  68.527  94.652  1.00 39.88  ? 244  TYR I CD1 1 
ATOM   8705  C CD2 . TYR M  1 103 ? 58.727  68.571  95.038  1.00 39.88  ? 244  TYR I CD2 1 
ATOM   8706  C CE1 . TYR M  1 103 ? 56.291  69.896  94.946  1.00 39.88  ? 244  TYR I CE1 1 
ATOM   8707  C CE2 . TYR M  1 103 ? 58.660  69.938  95.332  1.00 39.88  ? 244  TYR I CE2 1 
ATOM   8708  C CZ  . TYR M  1 103 ? 57.446  70.592  95.287  1.00 39.88  ? 244  TYR I CZ  1 
ATOM   8709  O OH  . TYR M  1 103 ? 57.401  71.932  95.598  1.00 39.88  ? 244  TYR I OH  1 
ATOM   8710  N N   . GLY M  1 104 ? 60.605  64.978  93.786  1.00 53.14  ? 245  GLY I N   1 
ATOM   8711  C CA  . GLY M  1 104 ? 61.409  63.837  94.148  1.00 53.14  ? 245  GLY I CA  1 
ATOM   8712  C C   . GLY M  1 104 ? 60.930  63.471  95.541  1.00 53.14  ? 245  GLY I C   1 
ATOM   8713  O O   . GLY M  1 104 ? 60.283  64.276  96.225  1.00 53.14  ? 245  GLY I O   1 
ATOM   8714  N N   . THR M  1 105 ? 61.250  62.261  95.974  1.00 52.23  ? 246  THR I N   1 
ATOM   8715  C CA  . THR M  1 105 ? 60.830  61.799  97.280  1.00 52.23  ? 246  THR I CA  1 
ATOM   8716  C C   . THR M  1 105 ? 61.555  62.551  98.397  1.00 52.23  ? 246  THR I C   1 
ATOM   8717  O O   . THR M  1 105 ? 61.298  62.325  99.575  1.00 52.23  ? 246  THR I O   1 
ATOM   8718  C CB  . THR M  1 105 ? 61.055  60.270  97.371  1.00 52.23  ? 246  THR I CB  1 
ATOM   8719  O OG1 . THR M  1 105 ? 60.054  59.693  98.212  1.00 52.23  ? 246  THR I OG1 1 
ATOM   8720  C CG2 . THR M  1 105 ? 62.443  59.949  97.888  1.00 52.23  ? 246  THR I CG2 1 
ATOM   8721  N N   . ASP M  1 106 ? 62.431  63.473  98.012  1.00 44.55  ? 247  ASP I N   1 
ATOM   8722  C CA  . ASP M  1 106 ? 63.217  64.252  98.965  1.00 44.55  ? 247  ASP I CA  1 
ATOM   8723  C C   . ASP M  1 106 ? 62.839  65.730  99.032  1.00 44.55  ? 247  ASP I C   1 
ATOM   8724  O O   . ASP M  1 106 ? 63.440  66.507  99.781  1.00 44.55  ? 247  ASP I O   1 
ATOM   8725  C CB  . ASP M  1 106 ? 64.710  64.135  98.615  1.00 44.55  ? 247  ASP I CB  1 
ATOM   8726  C CG  . ASP M  1 106 ? 65.014  64.497  97.152  1.00 44.55  ? 247  ASP I CG  1 
ATOM   8727  O OD1 . ASP M  1 106 ? 64.069  64.569  96.342  1.00 44.55  ? 247  ASP I OD1 1 
ATOM   8728  O OD2 . ASP M  1 106 ? 66.199  64.711  96.804  1.00 44.55  ? 247  ASP I OD2 1 
ATOM   8729  N N   . GLY M  1 107 ? 61.852  66.122  98.239  1.00 69.68  ? 248  GLY I N   1 
ATOM   8730  C CA  . GLY M  1 107 ? 61.436  67.514  98.229  1.00 69.68  ? 248  GLY I CA  1 
ATOM   8731  C C   . GLY M  1 107 ? 62.033  68.269  97.058  1.00 69.68  ? 248  GLY I C   1 
ATOM   8732  O O   . GLY M  1 107 ? 61.527  69.314  96.641  1.00 69.68  ? 248  GLY I O   1 
ATOM   8733  N N   . GLN M  1 108 ? 63.136  67.747  96.535  1.00 71.72  ? 254  GLN I N   1 
ATOM   8734  C CA  . GLN M  1 108 ? 63.785  68.368  95.391  1.00 71.72  ? 254  GLN I CA  1 
ATOM   8735  C C   . GLN M  1 108 ? 62.753  68.305  94.276  1.00 71.72  ? 254  GLN I C   1 
ATOM   8736  O O   . GLN M  1 108 ? 61.824  67.500  94.342  1.00 71.72  ? 254  GLN I O   1 
ATOM   8737  C CB  . GLN M  1 108 ? 65.041  67.576  95.006  1.00 71.72  ? 254  GLN I CB  1 
ATOM   8738  C CG  . GLN M  1 108 ? 66.252  67.928  95.846  1.00 71.72  ? 254  GLN I CG  1 
ATOM   8739  C CD  . GLN M  1 108 ? 66.449  69.429  95.946  1.00 71.72  ? 254  GLN I CD  1 
ATOM   8740  O OE1 . GLN M  1 108 ? 66.539  70.117  94.928  1.00 71.72  ? 254  GLN I OE1 1 
ATOM   8741  N NE2 . GLN M  1 108 ? 66.509  69.946  97.171  1.00 71.72  ? 254  GLN I NE2 1 
ATOM   8742  N N   . GLU M  1 109 ? 62.888  69.143  93.258  1.00 66.39  ? 255  GLU I N   1 
ATOM   8743  C CA  . GLU M  1 109 ? 61.917  69.099  92.176  1.00 66.39  ? 255  GLU I CA  1 
ATOM   8744  C C   . GLU M  1 109 ? 62.531  68.921  90.796  1.00 66.39  ? 255  GLU I C   1 
ATOM   8745  O O   . GLU M  1 109 ? 63.686  69.274  90.569  1.00 66.39  ? 255  GLU I O   1 
ATOM   8746  C CB  . GLU M  1 109 ? 61.057  70.352  92.194  1.00 66.39  ? 255  GLU I CB  1 
ATOM   8747  C CG  . GLU M  1 109 ? 61.796  71.628  92.511  1.00 66.39  ? 255  GLU I CG  1 
ATOM   8748  C CD  . GLU M  1 109 ? 60.858  72.826  92.589  1.00 66.39  ? 255  GLU I CD  1 
ATOM   8749  O OE1 . GLU M  1 109 ? 60.920  73.690  91.681  1.00 66.39  ? 255  GLU I OE1 1 
ATOM   8750  O OE2 . GLU M  1 109 ? 60.057  72.896  93.558  1.00 66.39  ? 255  GLU I OE2 1 
ATOM   8751  N N   . ALA M  1 110 ? 61.748  68.370  89.876  1.00 56.18  ? 256  ALA I N   1 
ATOM   8752  C CA  . ALA M  1 110 ? 62.210  68.139  88.516  1.00 56.18  ? 256  ALA I CA  1 
ATOM   8753  C C   . ALA M  1 110 ? 61.159  68.571  87.511  1.00 56.18  ? 256  ALA I C   1 
ATOM   8754  O O   . ALA M  1 110 ? 60.063  68.008  87.478  1.00 56.18  ? 256  ALA I O   1 
ATOM   8755  C CB  . ALA M  1 110 ? 62.518  66.671  88.315  1.00 56.18  ? 256  ALA I CB  1 
ATOM   8756  N N   . PRO M  1 111 ? 61.467  69.583  86.681  1.00 31.44  ? 257  PRO I N   1 
ATOM   8757  C CA  . PRO M  1 111 ? 60.476  70.026  85.690  1.00 31.44  ? 257  PRO I CA  1 
ATOM   8758  C C   . PRO M  1 111 ? 60.033  68.861  84.807  1.00 31.44  ? 257  PRO I C   1 
ATOM   8759  O O   . PRO M  1 111 ? 60.848  68.016  84.446  1.00 31.44  ? 257  PRO I O   1 
ATOM   8760  C CB  . PRO M  1 111 ? 61.215  71.102  84.894  1.00 31.44  ? 257  PRO I CB  1 
ATOM   8761  C CG  . PRO M  1 111 ? 62.288  71.586  85.817  1.00 31.44  ? 257  PRO I CG  1 
ATOM   8762  C CD  . PRO M  1 111 ? 62.704  70.381  86.616  1.00 31.44  ? 257  PRO I CD  1 
ATOM   8763  N N   . ILE M  1 112 ? 58.748  68.798  84.478  1.00 41.75  ? 258  ILE I N   1 
ATOM   8764  C CA  . ILE M  1 112 ? 58.262  67.718  83.631  1.00 41.75  ? 258  ILE I CA  1 
ATOM   8765  C C   . ILE M  1 112 ? 59.086  67.729  82.356  1.00 41.75  ? 258  ILE I C   1 
ATOM   8766  O O   . ILE M  1 112 ? 59.435  66.684  81.807  1.00 41.75  ? 258  ILE I O   1 
ATOM   8767  C CB  . ILE M  1 112 ? 56.787  67.899  83.235  1.00 41.75  ? 258  ILE I CB  1 
ATOM   8768  C CG1 . ILE M  1 112 ? 55.907  67.984  84.482  1.00 41.75  ? 258  ILE I CG1 1 
ATOM   8769  C CG2 . ILE M  1 112 ? 56.356  66.754  82.359  1.00 41.75  ? 258  ILE I CG2 1 
ATOM   8770  C CD1 . ILE M  1 112 ? 55.657  66.665  85.163  1.00 41.75  ? 258  ILE I CD1 1 
ATOM   8771  N N   . TYR M  1 113 ? 59.413  68.921  81.891  1.00 55.39  ? 259  TYR I N   1 
ATOM   8772  C CA  . TYR M  1 113 ? 60.186  69.049  80.678  1.00 55.39  ? 259  TYR I CA  1 
ATOM   8773  C C   . TYR M  1 113 ? 61.543  68.374  80.723  1.00 55.39  ? 259  TYR I C   1 
ATOM   8774  O O   . TYR M  1 113 ? 61.983  67.825  79.727  1.00 55.39  ? 259  TYR I O   1 
ATOM   8775  C CB  . TYR M  1 113 ? 60.389  70.513  80.343  1.00 55.39  ? 259  TYR I CB  1 
ATOM   8776  C CG  . TYR M  1 113 ? 61.103  70.714  79.034  1.00 55.39  ? 259  TYR I CG  1 
ATOM   8777  C CD1 . TYR M  1 113 ? 60.422  70.565  77.821  1.00 55.39  ? 259  TYR I CD1 1 
ATOM   8778  C CD2 . TYR M  1 113 ? 62.468  71.035  78.995  1.00 55.39  ? 259  TYR I CD2 1 
ATOM   8779  C CE1 . TYR M  1 113 ? 61.080  70.727  76.595  1.00 55.39  ? 259  TYR I CE1 1 
ATOM   8780  C CE2 . TYR M  1 113 ? 63.142  71.200  77.772  1.00 55.39  ? 259  TYR I CE2 1 
ATOM   8781  C CZ  . TYR M  1 113 ? 62.436  71.041  76.580  1.00 55.39  ? 259  TYR I CZ  1 
ATOM   8782  O OH  . TYR M  1 113 ? 63.076  71.181  75.376  1.00 55.39  ? 259  TYR I OH  1 
ATOM   8783  N N   . GLU M  1 114 ? 62.221  68.432  81.862  1.00 68.08  ? 260  GLU I N   1 
ATOM   8784  C CA  . GLU M  1 114 ? 63.545  67.820  81.982  1.00 68.08  ? 260  GLU I CA  1 
ATOM   8785  C C   . GLU M  1 114 ? 63.470  66.333  81.739  1.00 68.08  ? 260  GLU I C   1 
ATOM   8786  O O   . GLU M  1 114 ? 64.269  65.766  80.998  1.00 68.08  ? 260  GLU I O   1 
ATOM   8787  C CB  . GLU M  1 114 ? 64.129  68.022  83.380  1.00 68.08  ? 260  GLU I CB  1 
ATOM   8788  C CG  . GLU M  1 114 ? 64.438  69.445  83.741  1.00 68.08  ? 260  GLU I CG  1 
ATOM   8789  C CD  . GLU M  1 114 ? 65.608  69.974  82.971  1.00 68.08  ? 260  GLU I CD  1 
ATOM   8790  O OE1 . GLU M  1 114 ? 65.626  69.785  81.733  1.00 68.08  ? 260  GLU I OE1 1 
ATOM   8791  O OE2 . GLU M  1 114 ? 66.505  70.571  83.607  1.00 68.08  ? 260  GLU I OE2 1 
ATOM   8792  N N   . LEU M  1 115 ? 62.511  65.697  82.389  1.00 40.77  ? 261  LEU I N   1 
ATOM   8793  C CA  . LEU M  1 115 ? 62.354  64.269  82.254  1.00 40.77  ? 261  LEU I CA  1 
ATOM   8794  C C   . LEU M  1 115 ? 61.923  63.922  80.843  1.00 40.77  ? 261  LEU I C   1 
ATOM   8795  O O   . LEU M  1 115 ? 62.494  63.041  80.208  1.00 40.77  ? 261  LEU I O   1 
ATOM   8796  C CB  . LEU M  1 115 ? 61.319  63.777  83.256  1.00 40.77  ? 261  LEU I CB  1 
ATOM   8797  C CG  . LEU M  1 115 ? 61.316  64.545  84.578  1.00 40.77  ? 261  LEU I CG  1 
ATOM   8798  C CD1 . LEU M  1 115 ? 60.245  63.994  85.500  1.00 40.77  ? 261  LEU I CD1 1 
ATOM   8799  C CD2 . LEU M  1 115 ? 62.692  64.435  85.231  1.00 40.77  ? 261  LEU I CD2 1 
ATOM   8800  N N   . THR M  1 116 ? 60.914  64.633  80.359  1.00 33.09  ? 262  THR I N   1 
ATOM   8801  C CA  . THR M  1 116 ? 60.361  64.407  79.037  1.00 33.09  ? 262  THR I CA  1 
ATOM   8802  C C   . THR M  1 116 ? 61.378  64.571  77.922  1.00 33.09  ? 262  THR I C   1 
ATOM   8803  O O   . THR M  1 116 ? 61.480  63.718  77.054  1.00 33.09  ? 262  THR I O   1 
ATOM   8804  C CB  . THR M  1 116 ? 59.184  65.359  78.803  1.00 33.09  ? 262  THR I CB  1 
ATOM   8805  O OG1 . THR M  1 116 ? 58.015  64.581  78.572  1.00 33.09  ? 262  THR I OG1 1 
ATOM   8806  C CG2 . THR M  1 116 ? 59.426  66.268  77.593  1.00 33.09  ? 262  THR I CG2 1 
ATOM   8807  N N   . SER M  1 117 ? 62.118  65.679  77.964  1.00 45.35  ? 263  SER I N   1 
ATOM   8808  C CA  . SER M  1 117 ? 63.116  66.027  76.956  1.00 45.35  ? 263  SER I CA  1 
ATOM   8809  C C   . SER M  1 117 ? 64.332  65.126  76.931  1.00 45.35  ? 263  SER I C   1 
ATOM   8810  O O   . SER M  1 117 ? 65.249  65.337  76.140  1.00 45.35  ? 263  SER I O   1 
ATOM   8811  C CB  . SER M  1 117 ? 63.562  67.482  77.150  1.00 45.35  ? 263  SER I CB  1 
ATOM   8812  O OG  . SER M  1 117 ? 64.615  67.605  78.096  1.00 45.35  ? 263  SER I OG  1 
ATOM   8813  N N   . GLN M  1 118 ? 64.334  64.115  77.786  1.00 55.00  ? 264  GLN I N   1 
ATOM   8814  C CA  . GLN M  1 118 ? 65.454  63.199  77.866  1.00 55.00  ? 264  GLN I CA  1 
ATOM   8815  C C   . GLN M  1 118 ? 65.459  62.151  76.768  1.00 55.00  ? 264  GLN I C   1 
ATOM   8816  O O   . GLN M  1 118 ? 66.509  61.602  76.435  1.00 55.00  ? 264  GLN I O   1 
ATOM   8817  C CB  . GLN M  1 118 ? 65.427  62.495  79.201  1.00 55.00  ? 264  GLN I CB  1 
ATOM   8818  C CG  . GLN M  1 118 ? 66.783  62.238  79.744  1.00 55.00  ? 264  GLN I CG  1 
ATOM   8819  C CD  . GLN M  1 118 ? 67.023  63.065  80.961  1.00 55.00  ? 264  GLN I CD  1 
ATOM   8820  O OE1 . GLN M  1 118 ? 66.717  64.264  80.955  1.00 55.00  ? 264  GLN I OE1 1 
ATOM   8821  N NE2 . GLN M  1 118 ? 67.559  62.441  82.031  1.00 55.00  ? 264  GLN I NE2 1 
ATOM   8822  N N   . PHE M  1 119 ? 64.288  61.876  76.201  1.00 28.87  ? 265  PHE I N   1 
ATOM   8823  C CA  . PHE M  1 119 ? 64.176  60.857  75.164  1.00 28.87  ? 265  PHE I CA  1 
ATOM   8824  C C   . PHE M  1 119 ? 63.866  61.365  73.756  1.00 28.87  ? 265  PHE I C   1 
ATOM   8825  O O   . PHE M  1 119 ? 63.188  60.692  72.971  1.00 28.87  ? 265  PHE I O   1 
ATOM   8826  C CB  . PHE M  1 119 ? 63.131  59.847  75.580  1.00 28.87  ? 265  PHE I CB  1 
ATOM   8827  C CG  . PHE M  1 119 ? 63.391  59.238  76.911  1.00 28.87  ? 265  PHE I CG  1 
ATOM   8828  C CD1 . PHE M  1 119 ? 63.178  59.971  78.070  1.00 28.87  ? 265  PHE I CD1 1 
ATOM   8829  C CD2 . PHE M  1 119 ? 63.811  57.916  77.011  1.00 28.87  ? 265  PHE I CD2 1 
ATOM   8830  C CE1 . PHE M  1 119 ? 63.373  59.402  79.325  1.00 28.87  ? 265  PHE I CE1 1 
ATOM   8831  C CE2 . PHE M  1 119 ? 64.009  57.327  78.257  1.00 28.87  ? 265  PHE I CE2 1 
ATOM   8832  C CZ  . PHE M  1 119 ? 63.789  58.071  79.421  1.00 28.87  ? 265  PHE I CZ  1 
ATOM   8833  N N   . THR M  1 120 ? 64.379  62.543  73.426  1.00 29.48  ? 266  THR I N   1 
ATOM   8834  C CA  . THR M  1 120 ? 64.135  63.103  72.111  1.00 29.48  ? 266  THR I CA  1 
ATOM   8835  C C   . THR M  1 120 ? 64.726  62.156  71.071  1.00 29.48  ? 266  THR I C   1 
ATOM   8836  O O   . THR M  1 120 ? 65.035  61.003  71.376  1.00 29.48  ? 266  THR I O   1 
ATOM   8837  C CB  . THR M  1 120 ? 64.739  64.537  71.977  1.00 29.48  ? 266  THR I CB  1 
ATOM   8838  O OG1 . THR M  1 120 ? 66.122  64.460  71.598  1.00 29.48  ? 266  THR I OG1 1 
ATOM   8839  C CG2 . THR M  1 120 ? 64.618  65.280  73.298  1.00 29.48  ? 266  THR I CG2 1 
ATOM   8840  N N   . GLY M  1 121 ? 64.860  62.635  69.840  1.00 37.92  ? 267  GLY I N   1 
ATOM   8841  C CA  . GLY M  1 121 ? 65.389  61.801  68.782  1.00 37.92  ? 267  GLY I CA  1 
ATOM   8842  C C   . GLY M  1 121 ? 66.894  61.863  68.752  1.00 37.92  ? 267  GLY I C   1 
ATOM   8843  O O   . GLY M  1 121 ? 67.552  60.921  68.304  1.00 37.92  ? 267  GLY I O   1 
ATOM   8844  N N   . LEU M  1 122 ? 67.450  62.979  69.204  1.00 39.77  ? 268  LEU I N   1 
ATOM   8845  C CA  . LEU M  1 122 ? 68.899  63.100  69.228  1.00 39.77  ? 268  LEU I CA  1 
ATOM   8846  C C   . LEU M  1 122 ? 69.343  62.406  70.498  1.00 39.77  ? 268  LEU I C   1 
ATOM   8847  O O   . LEU M  1 122 ? 70.211  61.534  70.450  1.00 39.77  ? 268  LEU I O   1 
ATOM   8848  C CB  . LEU M  1 122 ? 69.363  64.562  69.242  1.00 39.77  ? 268  LEU I CB  1 
ATOM   8849  C CG  . LEU M  1 122 ? 69.137  65.389  67.964  1.00 39.77  ? 268  LEU I CG  1 
ATOM   8850  C CD1 . LEU M  1 122 ? 69.443  66.839  68.252  1.00 39.77  ? 268  LEU I CD1 1 
ATOM   8851  C CD2 . LEU M  1 122 ? 70.004  64.897  66.821  1.00 39.77  ? 268  LEU I CD2 1 
ATOM   8852  N N   . LYS M  1 123 ? 68.715  62.756  71.623  1.00 38.85  ? 269  LYS I N   1 
ATOM   8853  C CA  . LYS M  1 123 ? 69.075  62.174  72.908  1.00 38.85  ? 269  LYS I CA  1 
ATOM   8854  C C   . LYS M  1 123 ? 69.040  60.662  72.929  1.00 38.85  ? 269  LYS I C   1 
ATOM   8855  O O   . LYS M  1 123 ? 69.873  60.045  73.585  1.00 38.85  ? 269  LYS I O   1 
ATOM   8856  C CB  . LYS M  1 123 ? 68.175  62.711  74.014  1.00 38.85  ? 269  LYS I CB  1 
ATOM   8857  C CG  . LYS M  1 123 ? 68.664  64.020  74.606  1.00 38.85  ? 269  LYS I CG  1 
ATOM   8858  C CD  . LYS M  1 123 ? 68.830  63.935  76.130  1.00 38.85  ? 269  LYS I CD  1 
ATOM   8859  C CE  . LYS M  1 123 ? 69.673  65.106  76.702  1.00 38.85  ? 269  LYS I CE  1 
ATOM   8860  N NZ  . LYS M  1 123 ? 70.109  64.910  78.134  1.00 38.85  ? 269  LYS I NZ  1 
ATOM   8861  N N   . CYS M  1 124 ? 68.100  60.065  72.199  1.00 30.28  ? 270  CYS I N   1 
ATOM   8862  C CA  . CYS M  1 124 ? 67.953  58.606  72.177  1.00 30.28  ? 270  CYS I CA  1 
ATOM   8863  C C   . CYS M  1 124 ? 67.509  58.111  70.803  1.00 30.28  ? 270  CYS I C   1 
ATOM   8864  O O   . CYS M  1 124 ? 66.392  57.628  70.632  1.00 30.28  ? 270  CYS I O   1 
ATOM   8865  C CB  . CYS M  1 124 ? 66.934  58.194  73.241  1.00 30.28  ? 270  CYS I CB  1 
ATOM   8866  S SG  . CYS M  1 124 ? 66.307  56.511  73.138  1.00 30.28  ? 270  CYS I SG  1 
ATOM   8867  N N   . PRO M  1 125 ? 68.398  58.194  69.806  1.00 26.33  ? 271  PRO I N   1 
ATOM   8868  C CA  . PRO M  1 125 ? 68.079  57.761  68.441  1.00 26.33  ? 271  PRO I CA  1 
ATOM   8869  C C   . PRO M  1 125 ? 67.550  56.352  68.318  1.00 26.33  ? 271  PRO I C   1 
ATOM   8870  O O   . PRO M  1 125 ? 66.865  56.028  67.351  1.00 26.33  ? 271  PRO I O   1 
ATOM   8871  C CB  . PRO M  1 125 ? 69.392  57.937  67.681  1.00 26.33  ? 271  PRO I CB  1 
ATOM   8872  C CG  . PRO M  1 125 ? 70.432  58.028  68.727  1.00 26.33  ? 271  PRO I CG  1 
ATOM   8873  C CD  . PRO M  1 125 ? 69.781  58.673  69.912  1.00 26.33  ? 271  PRO I CD  1 
ATOM   8874  N N   . SER M  1 126 ? 67.867  55.512  69.293  1.00 44.03  ? 272  SER I N   1 
ATOM   8875  C CA  . SER M  1 126 ? 67.415  54.131  69.248  1.00 44.03  ? 272  SER I CA  1 
ATOM   8876  C C   . SER M  1 126 ? 65.910  54.096  69.445  1.00 44.03  ? 272  SER I C   1 
ATOM   8877  O O   . SER M  1 126 ? 65.284  53.044  69.380  1.00 44.03  ? 272  SER I O   1 
ATOM   8878  C CB  . SER M  1 126 ? 68.132  53.305  70.323  1.00 44.03  ? 272  SER I CB  1 
ATOM   8879  O OG  . SER M  1 126 ? 67.576  53.539  71.604  1.00 44.03  ? 272  SER I OG  1 
ATOM   8880  N N   . LEU M  1 127 ? 65.333  55.266  69.681  1.00 33.02  ? 273  LEU I N   1 
ATOM   8881  C CA  . LEU M  1 127 ? 63.892  55.383  69.871  1.00 33.02  ? 273  LEU I CA  1 
ATOM   8882  C C   . LEU M  1 127 ? 63.256  56.266  68.805  1.00 33.02  ? 273  LEU I C   1 
ATOM   8883  O O   . LEU M  1 127 ? 62.037  56.245  68.620  1.00 33.02  ? 273  LEU I O   1 
ATOM   8884  C CB  . LEU M  1 127 ? 63.578  55.970  71.239  1.00 33.02  ? 273  LEU I CB  1 
ATOM   8885  C CG  . LEU M  1 127 ? 63.155  54.931  72.258  1.00 33.02  ? 273  LEU I CG  1 
ATOM   8886  C CD1 . LEU M  1 127 ? 62.929  55.598  73.601  1.00 33.02  ? 273  LEU I CD1 1 
ATOM   8887  C CD2 . LEU M  1 127 ? 61.897  54.231  71.763  1.00 33.02  ? 273  LEU I CD2 1 
ATOM   8888  N N   . ALA M  1 128 ? 64.085  57.051  68.120  1.00 29.89  ? 274  ALA I N   1 
ATOM   8889  C CA  . ALA M  1 128 ? 63.622  57.943  67.061  1.00 29.89  ? 274  ALA I CA  1 
ATOM   8890  C C   . ALA M  1 128 ? 62.558  57.311  66.158  1.00 29.89  ? 274  ALA I C   1 
ATOM   8891  O O   . ALA M  1 128 ? 62.772  56.237  65.603  1.00 29.89  ? 274  ALA I O   1 
ATOM   8892  C CB  . ALA M  1 128 ? 64.808  58.384  66.213  1.00 29.89  ? 274  ALA I CB  1 
ATOM   8893  N N   . GLY M  1 129 ? 61.421  57.994  66.007  1.00 59.77  ? 275  GLY I N   1 
ATOM   8894  C CA  . GLY M  1 129 ? 60.343  57.501  65.162  1.00 59.77  ? 275  GLY I CA  1 
ATOM   8895  C C   . GLY M  1 129 ? 59.356  56.588  65.864  1.00 59.77  ? 275  GLY I C   1 
ATOM   8896  O O   . GLY M  1 129 ? 58.358  56.172  65.277  1.00 59.77  ? 275  GLY I O   1 
ATOM   8897  N N   . LYS M  1 130 ? 59.630  56.273  67.124  1.00 32.43  ? 276  LYS I N   1 
ATOM   8898  C CA  . LYS M  1 130 ? 58.762  55.395  67.891  1.00 32.43  ? 276  LYS I CA  1 
ATOM   8899  C C   . LYS M  1 130 ? 58.114  56.227  68.967  1.00 32.43  ? 276  LYS I C   1 
ATOM   8900  O O   . LYS M  1 130 ? 58.714  57.176  69.455  1.00 32.43  ? 276  LYS I O   1 
ATOM   8901  C CB  . LYS M  1 130 ? 59.572  54.262  68.540  1.00 32.43  ? 276  LYS I CB  1 
ATOM   8902  C CG  . LYS M  1 130 ? 60.581  53.546  67.601  1.00 32.43  ? 276  LYS I CG  1 
ATOM   8903  C CD  . LYS M  1 130 ? 60.969  52.141  68.099  1.00 32.43  ? 276  LYS I CD  1 
ATOM   8904  C CE  . LYS M  1 130 ? 62.110  51.531  67.278  1.00 32.43  ? 276  LYS I CE  1 
ATOM   8905  N NZ  . LYS M  1 130 ? 63.440  51.583  67.961  1.00 32.43  ? 276  LYS I NZ  1 
ATOM   8906  N N   . PRO M  1 131 ? 56.877  55.881  69.354  1.00 42.36  ? 277  PRO I N   1 
ATOM   8907  C CA  . PRO M  1 131 ? 56.093  56.571  70.383  1.00 42.36  ? 277  PRO I CA  1 
ATOM   8908  C C   . PRO M  1 131 ? 56.752  56.583  71.742  1.00 42.36  ? 277  PRO I C   1 
ATOM   8909  O O   . PRO M  1 131 ? 57.205  55.553  72.225  1.00 42.36  ? 277  PRO I O   1 
ATOM   8910  C CB  . PRO M  1 131 ? 54.791  55.789  70.432  1.00 42.36  ? 277  PRO I CB  1 
ATOM   8911  C CG  . PRO M  1 131 ? 55.123  54.470  69.868  1.00 42.36  ? 277  PRO I CG  1 
ATOM   8912  C CD  . PRO M  1 131 ? 56.134  54.740  68.800  1.00 42.36  ? 277  PRO I CD  1 
ATOM   8913  N N   . LYS M  1 132 ? 56.792  57.755  72.360  1.00 31.61  ? 278  LYS I N   1 
ATOM   8914  C CA  . LYS M  1 132 ? 57.376  57.912  73.685  1.00 31.61  ? 278  LYS I CA  1 
ATOM   8915  C C   . LYS M  1 132 ? 56.279  58.501  74.556  1.00 31.61  ? 278  LYS I C   1 
ATOM   8916  O O   . LYS M  1 132 ? 55.998  59.686  74.485  1.00 31.61  ? 278  LYS I O   1 
ATOM   8917  C CB  . LYS M  1 132 ? 58.574  58.852  73.615  1.00 31.61  ? 278  LYS I CB  1 
ATOM   8918  C CG  . LYS M  1 132 ? 59.574  58.468  72.546  1.00 31.61  ? 278  LYS I CG  1 
ATOM   8919  C CD  . LYS M  1 132 ? 60.689  59.481  72.445  1.00 31.61  ? 278  LYS I CD  1 
ATOM   8920  C CE  . LYS M  1 132 ? 60.908  59.922  71.003  1.00 31.61  ? 278  LYS I CE  1 
ATOM   8921  N NZ  . LYS M  1 132 ? 60.830  58.795  70.029  1.00 31.61  ? 278  LYS I NZ  1 
ATOM   8922  N N   . VAL M  1 133 ? 55.662  57.661  75.377  1.00 17.57  ? 279  VAL I N   1 
ATOM   8923  C CA  . VAL M  1 133 ? 54.551  58.059  76.232  1.00 17.57  ? 279  VAL I CA  1 
ATOM   8924  C C   . VAL M  1 133 ? 54.916  58.298  77.681  1.00 17.57  ? 279  VAL I C   1 
ATOM   8925  O O   . VAL M  1 133 ? 55.654  57.520  78.248  1.00 17.57  ? 279  VAL I O   1 
ATOM   8926  C CB  . VAL M  1 133 ? 53.485  56.973  76.196  1.00 17.57  ? 279  VAL I CB  1 
ATOM   8927  C CG1 . VAL M  1 133 ? 52.326  57.343  77.106  1.00 17.57  ? 279  VAL I CG1 1 
ATOM   8928  C CG2 . VAL M  1 133 ? 53.045  56.748  74.737  1.00 17.57  ? 279  VAL I CG2 1 
ATOM   8929  N N   . PHE M  1 134 ? 54.378  59.355  78.283  1.00 31.07  ? 280  PHE I N   1 
ATOM   8930  C CA  . PHE M  1 134 ? 54.633  59.692  79.690  1.00 31.07  ? 280  PHE I CA  1 
ATOM   8931  C C   . PHE M  1 134 ? 53.315  59.902  80.399  1.00 31.07  ? 280  PHE I C   1 
ATOM   8932  O O   . PHE M  1 134 ? 52.430  60.546  79.867  1.00 31.07  ? 280  PHE I O   1 
ATOM   8933  C CB  . PHE M  1 134 ? 55.440  60.978  79.798  1.00 31.07  ? 280  PHE I CB  1 
ATOM   8934  C CG  . PHE M  1 134 ? 56.847  60.815  79.406  1.00 31.07  ? 280  PHE I CG  1 
ATOM   8935  C CD1 . PHE M  1 134 ? 57.179  60.536  78.081  1.00 31.07  ? 280  PHE I CD1 1 
ATOM   8936  C CD2 . PHE M  1 134 ? 57.852  60.855  80.367  1.00 31.07  ? 280  PHE I CD2 1 
ATOM   8937  C CE1 . PHE M  1 134 ? 58.512  60.288  77.714  1.00 31.07  ? 280  PHE I CE1 1 
ATOM   8938  C CE2 . PHE M  1 134 ? 59.182  60.612  80.022  1.00 31.07  ? 280  PHE I CE2 1 
ATOM   8939  C CZ  . PHE M  1 134 ? 59.517  60.324  78.690  1.00 31.07  ? 280  PHE I CZ  1 
ATOM   8940  N N   . PHE M  1 135 ? 53.185  59.385  81.605  1.00 28.60  ? 281  PHE I N   1 
ATOM   8941  C CA  . PHE M  1 135 ? 51.949  59.545  82.324  1.00 28.60  ? 281  PHE I CA  1 
ATOM   8942  C C   . PHE M  1 135 ? 52.242  60.120  83.671  1.00 28.60  ? 281  PHE I C   1 
ATOM   8943  O O   . PHE M  1 135 ? 52.402  59.376  84.628  1.00 28.60  ? 281  PHE I O   1 
ATOM   8944  C CB  . PHE M  1 135 ? 51.275  58.197  82.509  1.00 28.60  ? 281  PHE I CB  1 
ATOM   8945  C CG  . PHE M  1 135 ? 50.666  57.647  81.248  1.00 28.60  ? 281  PHE I CG  1 
ATOM   8946  C CD1 . PHE M  1 135 ? 51.079  56.418  80.740  1.00 28.60  ? 281  PHE I CD1 1 
ATOM   8947  C CD2 . PHE M  1 135 ? 49.674  58.350  80.564  1.00 28.60  ? 281  PHE I CD2 1 
ATOM   8948  C CE1 . PHE M  1 135 ? 50.515  55.888  79.565  1.00 28.60  ? 281  PHE I CE1 1 
ATOM   8949  C CE2 . PHE M  1 135 ? 49.107  57.829  79.395  1.00 28.60  ? 281  PHE I CE2 1 
ATOM   8950  C CZ  . PHE M  1 135 ? 49.534  56.591  78.897  1.00 28.60  ? 281  PHE I CZ  1 
ATOM   8951  N N   . ILE M  1 136 ? 52.323  61.440  83.763  1.00 32.21  ? 282  ILE I N   1 
ATOM   8952  C CA  . ILE M  1 136 ? 52.608  62.066  85.045  1.00 32.21  ? 282  ILE I CA  1 
ATOM   8953  C C   . ILE M  1 136 ? 51.330  62.180  85.852  1.00 32.21  ? 282  ILE I C   1 
ATOM   8954  O O   . ILE M  1 136 ? 50.313  62.663  85.357  1.00 32.21  ? 282  ILE I O   1 
ATOM   8955  C CB  . ILE M  1 136 ? 53.184  63.463  84.885  1.00 32.21  ? 282  ILE I CB  1 
ATOM   8956  C CG1 . ILE M  1 136 ? 54.640  63.379  84.443  1.00 32.21  ? 282  ILE I CG1 1 
ATOM   8957  C CG2 . ILE M  1 136 ? 53.085  64.198  86.207  1.00 32.21  ? 282  ILE I CG2 1 
ATOM   8958  C CD1 . ILE M  1 136 ? 54.859  62.578  83.192  1.00 32.21  ? 282  ILE I CD1 1 
ATOM   8959  N N   . GLN M  1 137 ? 51.376  61.722  87.093  1.00 35.30  ? 283  GLN I N   1 
ATOM   8960  C CA  . GLN M  1 137 ? 50.210  61.784  87.958  1.00 35.30  ? 283  GLN I CA  1 
ATOM   8961  C C   . GLN M  1 137 ? 50.685  62.433  89.214  1.00 35.30  ? 283  GLN I C   1 
ATOM   8962  O O   . GLN M  1 137 ? 51.233  61.787  90.095  1.00 35.30  ? 283  GLN I O   1 
ATOM   8963  C CB  . GLN M  1 137 ? 49.645  60.385  88.250  1.00 35.30  ? 283  GLN I CB  1 
ATOM   8964  C CG  . GLN M  1 137 ? 49.024  60.172  89.623  1.00 35.30  ? 283  GLN I CG  1 
ATOM   8965  C CD  . GLN M  1 137 ? 47.875  61.103  89.915  1.00 35.30  ? 283  GLN I CD  1 
ATOM   8966  O OE1 . GLN M  1 137 ? 47.986  62.299  89.726  1.00 35.30  ? 283  GLN I OE1 1 
ATOM   8967  N NE2 . GLN M  1 137 ? 46.768  60.563  90.392  1.00 35.30  ? 283  GLN I NE2 1 
ATOM   8968  N N   . ALA M  1 138 ? 50.490  63.738  89.273  1.00 37.31  ? 284  ALA I N   1 
ATOM   8969  C CA  . ALA M  1 138 ? 50.887  64.526  90.424  1.00 37.31  ? 284  ALA I CA  1 
ATOM   8970  C C   . ALA M  1 138 ? 50.031  65.763  90.382  1.00 37.31  ? 284  ALA I C   1 
ATOM   8971  O O   . ALA M  1 138 ? 49.284  65.971  89.426  1.00 37.31  ? 284  ALA I O   1 
ATOM   8972  C CB  . ALA M  1 138 ? 52.364  64.924  90.315  1.00 37.31  ? 284  ALA I CB  1 
ATOM   8973  N N   . CYS M  1 139 ? 50.141  66.580  91.417  1.00 53.06  ? 285  CYS I N   1 
ATOM   8974  C CA  . CYS M  1 139 ? 49.403  67.818  91.447  1.00 53.06  ? 285  CYS I CA  1 
ATOM   8975  C C   . CYS M  1 139 ? 50.200  68.783  90.618  1.00 53.06  ? 285  CYS I C   1 
ATOM   8976  O O   . CYS M  1 139 ? 51.389  68.570  90.367  1.00 53.06  ? 285  CYS I O   1 
ATOM   8977  C CB  . CYS M  1 139 ? 49.321  68.370  92.851  1.00 53.06  ? 285  CYS I CB  1 
ATOM   8978  S SG  . CYS M  1 139 ? 47.925  67.759  93.742  1.00 53.06  ? 285  CYS I SG  1 
ATOM   8979  N N   . GLN M  1 140 ? 49.549  69.859  90.204  1.00 46.29  ? 286  GLN I N   1 
ATOM   8980  C CA  . GLN M  1 140 ? 50.233  70.861  89.419  1.00 46.29  ? 286  GLN I CA  1 
ATOM   8981  C C   . GLN M  1 140 ? 50.010  72.247  90.012  1.00 46.29  ? 286  GLN I C   1 
ATOM   8982  O O   . GLN M  1 140 ? 50.277  73.251  89.364  1.00 46.29  ? 286  GLN I O   1 
ATOM   8983  C CB  . GLN M  1 140 ? 49.762  70.785  87.969  1.00 46.29  ? 286  GLN I CB  1 
ATOM   8984  C CG  . GLN M  1 140 ? 50.406  69.637  87.182  1.00 46.29  ? 286  GLN I CG  1 
ATOM   8985  C CD  . GLN M  1 140 ? 51.882  69.869  86.931  1.00 46.29  ? 286  GLN I CD  1 
ATOM   8986  O OE1 . GLN M  1 140 ? 52.723  69.449  87.723  1.00 46.29  ? 286  GLN I OE1 1 
ATOM   8987  N NE2 . GLN M  1 140 ? 52.203  70.549  85.834  1.00 46.29  ? 286  GLN I NE2 1 
ATOM   8988  N N   . GLY M  1 141 ? 49.540  72.281  91.258  1.00 38.48  ? 287  GLY I N   1 
ATOM   8989  C CA  . GLY M  1 141 ? 49.298  73.533  91.952  1.00 38.48  ? 287  GLY I CA  1 
ATOM   8990  C C   . GLY M  1 141 ? 48.518  73.229  93.214  1.00 38.48  ? 287  GLY I C   1 
ATOM   8991  O O   . GLY M  1 141 ? 48.464  72.074  93.644  1.00 38.48  ? 287  GLY I O   1 
ATOM   8992  N N   . ASP M  1 142 ? 47.910  74.249  93.810  1.00 61.50  ? 288  ASP I N   1 
ATOM   8993  C CA  . ASP M  1 142 ? 47.119  74.062  95.029  1.00 61.50  ? 288  ASP I CA  1 
ATOM   8994  C C   . ASP M  1 142 ? 45.684  74.582  94.869  1.00 61.50  ? 288  ASP I C   1 
ATOM   8995  O O   . ASP M  1 142 ? 44.955  74.723  95.849  1.00 61.50  ? 288  ASP I O   1 
ATOM   8996  C CB  . ASP M  1 142 ? 47.787  74.768  96.210  1.00 61.50  ? 288  ASP I CB  1 
ATOM   8997  C CG  . ASP M  1 142 ? 47.926  76.263  95.991  1.00 61.50  ? 288  ASP I CG  1 
ATOM   8998  O OD1 . ASP M  1 142 ? 47.843  76.704  94.820  1.00 61.50  ? 288  ASP I OD1 1 
ATOM   8999  O OD2 . ASP M  1 142 ? 48.121  77.003  96.985  1.00 61.50  ? 288  ASP I OD2 1 
ATOM   9000  N N   . ASN M  1 143 ? 45.284  74.855  93.629  1.00 54.96  ? 289  ASN I N   1 
ATOM   9001  C CA  . ASN M  1 143 ? 43.940  75.353  93.335  1.00 54.96  ? 289  ASN I CA  1 
ATOM   9002  C C   . ASN M  1 143 ? 43.004  74.200  93.019  1.00 54.96  ? 289  ASN I C   1 
ATOM   9003  O O   . ASN M  1 143 ? 43.254  73.450  92.083  1.00 54.96  ? 289  ASN I O   1 
ATOM   9004  C CB  . ASN M  1 143 ? 43.955  76.298  92.122  1.00 54.96  ? 289  ASN I CB  1 
ATOM   9005  C CG  . ASN M  1 143 ? 44.966  77.436  92.262  1.00 54.96  ? 289  ASN I CG  1 
ATOM   9006  O OD1 . ASN M  1 143 ? 45.508  77.681  93.343  1.00 54.96  ? 289  ASN I OD1 1 
ATOM   9007  N ND2 . ASN M  1 143 ? 45.221  78.135  91.162  1.00 54.96  ? 289  ASN I ND2 1 
ATOM   9008  N N   . TYR M  1 144 ? 41.935  74.053  93.800  1.00 75.87  ? 290  TYR I N   1 
ATOM   9009  C CA  . TYR M  1 144 ? 40.955  72.996  93.551  1.00 75.87  ? 290  TYR I CA  1 
ATOM   9010  C C   . TYR M  1 144 ? 40.192  73.470  92.335  1.00 75.87  ? 290  TYR I C   1 
ATOM   9011  O O   . TYR M  1 144 ? 39.617  74.558  92.352  1.00 75.87  ? 290  TYR I O   1 
ATOM   9012  C CB  . TYR M  1 144 ? 39.993  72.839  94.736  1.00 75.87  ? 290  TYR I CB  1 
ATOM   9013  C CG  . TYR M  1 144 ? 40.679  72.341  95.986  1.00 75.87  ? 290  TYR I CG  1 
ATOM   9014  C CD1 . TYR M  1 144 ? 41.401  73.215  96.799  1.00 75.87  ? 290  TYR I CD1 1 
ATOM   9015  C CD2 . TYR M  1 144 ? 40.657  70.991  96.326  1.00 75.87  ? 290  TYR I CD2 1 
ATOM   9016  C CE1 . TYR M  1 144 ? 42.091  72.758  97.918  1.00 75.87  ? 290  TYR I CE1 1 
ATOM   9017  C CE2 . TYR M  1 144 ? 41.341  70.524  97.440  1.00 75.87  ? 290  TYR I CE2 1 
ATOM   9018  C CZ  . TYR M  1 144 ? 42.058  71.413  98.231  1.00 75.87  ? 290  TYR I CZ  1 
ATOM   9019  O OH  . TYR M  1 144 ? 42.748  70.956  99.327  1.00 75.87  ? 290  TYR I OH  1 
ATOM   9020  N N   . GLN M  1 145 ? 40.202  72.674  91.271  1.00 55.38  ? 291  GLN I N   1 
ATOM   9021  C CA  . GLN M  1 145 ? 39.502  73.059  90.051  1.00 55.38  ? 291  GLN I CA  1 
ATOM   9022  C C   . GLN M  1 145 ? 38.095  73.510  90.394  1.00 55.38  ? 291  GLN I C   1 
ATOM   9023  O O   . GLN M  1 145 ? 37.482  72.999  91.330  1.00 55.38  ? 291  GLN I O   1 
ATOM   9024  C CB  . GLN M  1 145 ? 39.432  71.888  89.086  1.00 55.38  ? 291  GLN I CB  1 
ATOM   9025  C CG  . GLN M  1 145 ? 38.612  72.179  87.853  1.00 55.38  ? 291  GLN I CG  1 
ATOM   9026  C CD  . GLN M  1 145 ? 39.362  73.032  86.874  1.00 55.38  ? 291  GLN I CD  1 
ATOM   9027  O OE1 . GLN M  1 145 ? 40.275  73.756  87.250  1.00 55.38  ? 291  GLN I OE1 1 
ATOM   9028  N NE2 . GLN M  1 145 ? 38.989  72.951  85.606  1.00 55.38  ? 291  GLN I NE2 1 
ATOM   9029  N N   . LYS M  1 146 ? 37.576  74.454  89.621  1.00 100.00 ? 292  LYS I N   1 
ATOM   9030  C CA  . LYS M  1 146 ? 36.247  75.004  89.864  1.00 100.00 ? 292  LYS I CA  1 
ATOM   9031  C C   . LYS M  1 146 ? 35.054  74.076  89.654  1.00 100.00 ? 292  LYS I C   1 
ATOM   9032  O O   . LYS M  1 146 ? 34.453  73.612  90.618  1.00 100.00 ? 292  LYS I O   1 
ATOM   9033  C CB  . LYS M  1 146 ? 36.063  76.266  89.025  1.00 100.00 ? 292  LYS I CB  1 
ATOM   9034  C CG  . LYS M  1 146 ? 37.059  77.360  89.355  1.00 100.00 ? 292  LYS I CG  1 
ATOM   9035  C CD  . LYS M  1 146 ? 37.024  77.681  90.837  1.00 100.00 ? 292  LYS I CD  1 
ATOM   9036  C CE  . LYS M  1 146 ? 37.964  78.826  91.174  1.00 100.00 ? 292  LYS I CE  1 
ATOM   9037  N NZ  . LYS M  1 146 ? 37.753  79.317  92.566  1.00 100.00 ? 292  LYS I NZ  1 
ATOM   9038  N N   . GLY M  1 147 ? 34.696  73.815  88.403  1.00 59.54  ? 293  GLY I N   1 
ATOM   9039  C CA  . GLY M  1 147 ? 33.553  72.955  88.151  1.00 59.54  ? 293  GLY I CA  1 
ATOM   9040  C C   . GLY M  1 147 ? 32.247  73.738  88.083  1.00 59.54  ? 293  GLY I C   1 
ATOM   9041  O O   . GLY M  1 147 ? 31.793  74.310  89.082  1.00 59.54  ? 293  GLY I O   1 
ATOM   9042  N N   . ILE M  1 148 ? 31.648  73.758  86.893  1.00 74.48  ? 294  ILE I N   1 
ATOM   9043  C CA  . ILE M  1 148 ? 30.395  74.459  86.646  1.00 74.48  ? 294  ILE I CA  1 
ATOM   9044  C C   . ILE M  1 148 ? 29.330  73.438  86.221  1.00 74.48  ? 294  ILE I C   1 
ATOM   9045  O O   . ILE M  1 148 ? 29.663  72.330  85.803  1.00 74.48  ? 294  ILE I O   1 
ATOM   9046  C CB  . ILE M  1 148 ? 30.584  75.547  85.554  1.00 74.48  ? 294  ILE I CB  1 
ATOM   9047  C CG1 . ILE M  1 148 ? 30.120  75.024  84.187  1.00 74.48  ? 294  ILE I CG1 1 
ATOM   9048  C CG2 . ILE M  1 148 ? 32.048  76.000  85.517  1.00 74.48  ? 294  ILE I CG2 1 
ATOM   9049  C CD1 . ILE M  1 148 ? 31.070  74.027  83.546  1.00 74.48  ? 294  ILE I CD1 1 
ATOM   9050  N N   . PRO M  1 149 ? 28.037  73.805  86.310  1.00 70.87  ? 295  PRO I N   1 
ATOM   9051  C CA  . PRO M  1 149 ? 26.920  72.921  85.951  1.00 70.87  ? 295  PRO I CA  1 
ATOM   9052  C C   . PRO M  1 149 ? 26.471  72.952  84.499  1.00 70.87  ? 295  PRO I C   1 
ATOM   9053  O O   . PRO M  1 149 ? 26.755  73.903  83.784  1.00 70.87  ? 295  PRO I O   1 
ATOM   9054  C CB  . PRO M  1 149 ? 25.800  73.367  86.887  1.00 70.87  ? 295  PRO I CB  1 
ATOM   9055  C CG  . PRO M  1 149 ? 26.195  74.780  87.335  1.00 70.87  ? 295  PRO I CG  1 
ATOM   9056  C CD  . PRO M  1 149 ? 27.546  75.116  86.759  1.00 70.87  ? 295  PRO I CD  1 
ATOM   9057  N N   . VAL M  1 150 ? 25.768  71.895  84.090  1.00 100.00 ? 296  VAL I N   1 
ATOM   9058  C CA  . VAL M  1 150 ? 25.231  71.734  82.735  1.00 100.00 ? 296  VAL I CA  1 
ATOM   9059  C C   . VAL M  1 150 ? 24.873  70.290  82.483  1.00 100.00 ? 296  VAL I C   1 
ATOM   9060  O O   . VAL M  1 150 ? 25.707  69.408  82.691  1.00 100.00 ? 296  VAL I O   1 
ATOM   9061  C CB  . VAL M  1 150 ? 26.247  72.065  81.613  1.00 100.00 ? 296  VAL I CB  1 
ATOM   9062  C CG1 . VAL M  1 150 ? 26.137  73.523  81.211  1.00 100.00 ? 296  VAL I CG1 1 
ATOM   9063  C CG2 . VAL M  1 150 ? 27.649  71.682  82.043  1.00 100.00 ? 296  VAL I CG2 1 
ATOM   9064  N N   . GLU M  1 151 ? 23.651  70.030  82.030  1.00 100.00 ? 297  GLU I N   1 
ATOM   9065  C CA  . GLU M  1 151 ? 23.303  68.653  81.709  1.00 100.00 ? 297  GLU I CA  1 
ATOM   9066  C C   . GLU M  1 151 ? 23.326  68.462  80.200  1.00 100.00 ? 297  GLU I C   1 
ATOM   9067  O O   . GLU M  1 151 ? 22.403  68.865  79.488  1.00 100.00 ? 297  GLU I O   1 
ATOM   9068  C CB  . GLU M  1 151 ? 21.928  68.252  82.250  1.00 100.00 ? 297  GLU I CB  1 
ATOM   9069  C CG  . GLU M  1 151 ? 21.400  66.877  81.733  1.00 100.00 ? 297  GLU I CG  1 
ATOM   9070  C CD  . GLU M  1 151 ? 22.497  65.858  81.364  1.00 100.00 ? 297  GLU I CD  1 
ATOM   9071  O OE1 . GLU M  1 151 ? 23.538  65.800  82.054  1.00 100.00 ? 297  GLU I OE1 1 
ATOM   9072  O OE2 . GLU M  1 151 ? 22.305  65.106  80.379  1.00 100.00 ? 297  GLU I OE2 1 
ATOM   9073  N N   . THR M  1 152 ? 24.417  67.865  79.732  1.00 100.00 ? 298  THR I N   1 
ATOM   9074  C CA  . THR M  1 152 ? 24.631  67.540  78.327  1.00 100.00 ? 298  THR I CA  1 
ATOM   9075  C C   . THR M  1 152 ? 24.976  66.035  78.427  1.00 100.00 ? 298  THR I C   1 
ATOM   9076  O O   . THR M  1 152 ? 24.251  65.292  79.102  1.00 100.00 ? 298  THR I O   1 
ATOM   9077  C CB  . THR M  1 152 ? 25.809  68.396  77.719  1.00 100.00 ? 298  THR I CB  1 
ATOM   9078  O OG1 . THR M  1 152 ? 26.839  68.581  78.703  1.00 100.00 ? 298  THR I OG1 1 
ATOM   9079  C CG2 . THR M  1 152 ? 25.295  69.785  77.271  1.00 100.00 ? 298  THR I CG2 1 
ATOM   9080  N N   . ASP M  1 153 ? 26.058  65.587  77.788  1.00 97.49  ? 299  ASP I N   1 
ATOM   9081  C CA  . ASP M  1 153 ? 26.482  64.181  77.858  1.00 97.49  ? 299  ASP I CA  1 
ATOM   9082  C C   . ASP M  1 153 ? 25.362  63.124  77.861  1.00 97.49  ? 299  ASP I C   1 
ATOM   9083  O O   . ASP M  1 153 ? 25.304  62.349  76.883  1.00 97.49  ? 299  ASP I O   1 
ATOM   9084  C CB  . ASP M  1 153 ? 27.361  63.984  79.100  1.00 97.49  ? 299  ASP I CB  1 
ATOM   9085  C CG  . ASP M  1 153 ? 27.607  65.285  79.858  1.00 97.49  ? 299  ASP I CG  1 
ATOM   9086  O OD1 . ASP M  1 153 ? 28.073  66.260  79.227  1.00 97.49  ? 299  ASP I OD1 1 
ATOM   9087  O OD2 . ASP M  1 153 ? 27.333  65.334  81.081  1.00 97.49  ? 299  ASP I OD2 1 
ATOM   9088  O OXT . ASP M  1 153 ? 24.569  63.052  78.831  1.00 97.49  ? 299  ASP I OXT 1 
ATOM   9089  N N   . THR N  2 1   ? 65.980  56.696  53.436  1.00 90.01  ? 318  THR J N   1 
ATOM   9090  C CA  . THR N  2 1   ? 65.785  57.271  54.804  1.00 90.01  ? 318  THR J CA  1 
ATOM   9091  C C   . THR N  2 1   ? 65.309  58.723  54.729  1.00 90.01  ? 318  THR J C   1 
ATOM   9092  O O   . THR N  2 1   ? 65.616  59.424  53.761  1.00 90.01  ? 318  THR J O   1 
ATOM   9093  C CB  . THR N  2 1   ? 67.088  57.237  55.626  1.00 90.01  ? 318  THR J CB  1 
ATOM   9094  O OG1 . THR N  2 1   ? 67.988  58.232  55.126  1.00 90.01  ? 318  THR J OG1 1 
ATOM   9095  C CG2 . THR N  2 1   ? 67.741  55.860  55.546  1.00 90.01  ? 318  THR J CG2 1 
ATOM   9096  N N   . ARG N  2 2   ? 64.573  59.176  55.752  1.00 85.64  ? 319  ARG J N   1 
ATOM   9097  C CA  . ARG N  2 2   ? 64.040  60.542  55.780  1.00 85.64  ? 319  ARG J CA  1 
ATOM   9098  C C   . ARG N  2 2   ? 64.264  61.262  57.098  1.00 85.64  ? 319  ARG J C   1 
ATOM   9099  O O   . ARG N  2 2   ? 64.880  60.720  58.013  1.00 85.64  ? 319  ARG J O   1 
ATOM   9100  C CB  . ARG N  2 2   ? 62.538  60.531  55.481  1.00 85.64  ? 319  ARG J CB  1 
ATOM   9101  C CG  . ARG N  2 2   ? 62.141  59.719  54.250  1.00 85.64  ? 319  ARG J CG  1 
ATOM   9102  C CD  . ARG N  2 2   ? 60.622  59.479  54.175  1.00 85.64  ? 319  ARG J CD  1 
ATOM   9103  N NE  . ARG N  2 2   ? 60.238  58.669  53.013  1.00 85.64  ? 319  ARG J NE  1 
ATOM   9104  C CZ  . ARG N  2 2   ? 59.034  58.124  52.831  1.00 85.64  ? 319  ARG J CZ  1 
ATOM   9105  N NH1 . ARG N  2 2   ? 58.079  58.299  53.736  1.00 85.64  ? 319  ARG J NH1 1 
ATOM   9106  N NH2 . ARG N  2 2   ? 58.783  57.399  51.742  1.00 85.64  ? 319  ARG J NH2 1 
ATOM   9107  N N   . TYR N  2 3   ? 63.738  62.482  57.192  1.00 56.93  ? 320  TYR J N   1 
ATOM   9108  C CA  . TYR N  2 3   ? 63.884  63.292  58.399  1.00 56.93  ? 320  TYR J CA  1 
ATOM   9109  C C   . TYR N  2 3   ? 62.589  63.755  59.056  1.00 56.93  ? 320  TYR J C   1 
ATOM   9110  O O   . TYR N  2 3   ? 61.633  64.128  58.378  1.00 56.93  ? 320  TYR J O   1 
ATOM   9111  C CB  . TYR N  2 3   ? 64.719  64.527  58.097  1.00 56.93  ? 320  TYR J CB  1 
ATOM   9112  C CG  . TYR N  2 3   ? 66.176  64.225  57.986  1.00 56.93  ? 320  TYR J CG  1 
ATOM   9113  C CD1 . TYR N  2 3   ? 66.822  64.274  56.751  1.00 56.93  ? 320  TYR J CD1 1 
ATOM   9114  C CD2 . TYR N  2 3   ? 66.904  63.830  59.106  1.00 56.93  ? 320  TYR J CD2 1 
ATOM   9115  C CE1 . TYR N  2 3   ? 68.156  63.931  56.632  1.00 56.93  ? 320  TYR J CE1 1 
ATOM   9116  C CE2 . TYR N  2 3   ? 68.241  63.484  59.000  1.00 56.93  ? 320  TYR J CE2 1 
ATOM   9117  C CZ  . TYR N  2 3   ? 68.859  63.534  57.757  1.00 56.93  ? 320  TYR J CZ  1 
ATOM   9118  O OH  . TYR N  2 3   ? 70.180  63.173  57.632  1.00 56.93  ? 320  TYR J OH  1 
ATOM   9119  N N   . ILE N  2 4   ? 62.583  63.739  60.390  1.00 46.39  ? 321  ILE J N   1 
ATOM   9120  C CA  . ILE N  2 4   ? 61.435  64.179  61.202  1.00 46.39  ? 321  ILE J CA  1 
ATOM   9121  C C   . ILE N  2 4   ? 61.940  64.997  62.392  1.00 46.39  ? 321  ILE J C   1 
ATOM   9122  O O   . ILE N  2 4   ? 63.049  64.790  62.875  1.00 46.39  ? 321  ILE J O   1 
ATOM   9123  C CB  . ILE N  2 4   ? 60.569  62.985  61.747  1.00 46.39  ? 321  ILE J CB  1 
ATOM   9124  C CG1 . ILE N  2 4   ? 61.400  62.098  62.670  1.00 46.39  ? 321  ILE J CG1 1 
ATOM   9125  C CG2 . ILE N  2 4   ? 59.993  62.179  60.588  1.00 46.39  ? 321  ILE J CG2 1 
ATOM   9126  C CD1 . ILE N  2 4   ? 60.634  60.914  63.228  1.00 46.39  ? 321  ILE J CD1 1 
ATOM   9127  N N   . PRO N  2 5   ? 61.117  65.935  62.883  1.00 42.84  ? 322  PRO J N   1 
ATOM   9128  C CA  . PRO N  2 5   ? 61.503  66.782  64.015  1.00 42.84  ? 322  PRO J CA  1 
ATOM   9129  C C   . PRO N  2 5   ? 61.999  66.031  65.224  1.00 42.84  ? 322  PRO J C   1 
ATOM   9130  O O   . PRO N  2 5   ? 61.492  64.973  65.561  1.00 42.84  ? 322  PRO J O   1 
ATOM   9131  C CB  . PRO N  2 5   ? 60.239  67.585  64.335  1.00 42.84  ? 322  PRO J CB  1 
ATOM   9132  C CG  . PRO N  2 5   ? 59.142  66.897  63.601  1.00 42.84  ? 322  PRO J CG  1 
ATOM   9133  C CD  . PRO N  2 5   ? 59.756  66.241  62.411  1.00 42.84  ? 322  PRO J CD  1 
ATOM   9134  N N   . ASP N  2 6   ? 63.001  66.612  65.866  1.00 45.98  ? 323  ASP J N   1 
ATOM   9135  C CA  . ASP N  2 6   ? 63.617  66.069  67.064  1.00 45.98  ? 323  ASP J CA  1 
ATOM   9136  C C   . ASP N  2 6   ? 62.573  65.643  68.111  1.00 45.98  ? 323  ASP J C   1 
ATOM   9137  O O   . ASP N  2 6   ? 62.700  64.582  68.715  1.00 45.98  ? 323  ASP J O   1 
ATOM   9138  C CB  . ASP N  2 6   ? 64.575  67.138  67.632  1.00 45.98  ? 323  ASP J CB  1 
ATOM   9139  C CG  . ASP N  2 6   ? 65.423  66.632  68.796  1.00 45.98  ? 323  ASP J CG  1 
ATOM   9140  O OD1 . ASP N  2 6   ? 65.637  65.405  68.901  1.00 45.98  ? 323  ASP J OD1 1 
ATOM   9141  O OD2 . ASP N  2 6   ? 65.879  67.471  69.613  1.00 45.98  ? 323  ASP J OD2 1 
ATOM   9142  N N   . GLU N  2 7   ? 61.531  66.456  68.294  1.00 45.94  ? 324  GLU J N   1 
ATOM   9143  C CA  . GLU N  2 7   ? 60.488  66.198  69.295  1.00 45.94  ? 324  GLU J CA  1 
ATOM   9144  C C   . GLU N  2 7   ? 59.209  65.465  68.865  1.00 45.94  ? 324  GLU J C   1 
ATOM   9145  O O   . GLU N  2 7   ? 58.190  65.486  69.566  1.00 45.94  ? 324  GLU J O   1 
ATOM   9146  C CB  . GLU N  2 7   ? 60.101  67.512  69.957  1.00 45.94  ? 324  GLU J CB  1 
ATOM   9147  C CG  . GLU N  2 7   ? 60.896  67.797  71.199  1.00 45.94  ? 324  GLU J CG  1 
ATOM   9148  C CD  . GLU N  2 7   ? 60.968  69.266  71.500  1.00 45.94  ? 324  GLU J CD  1 
ATOM   9149  O OE1 . GLU N  2 7   ? 61.549  70.010  70.688  1.00 45.94  ? 324  GLU J OE1 1 
ATOM   9150  O OE2 . GLU N  2 7   ? 60.444  69.680  72.549  1.00 45.94  ? 324  GLU J OE2 1 
ATOM   9151  N N   . ALA N  2 8   ? 59.266  64.806  67.718  1.00 30.55  ? 325  ALA J N   1 
ATOM   9152  C CA  . ALA N  2 8   ? 58.137  64.050  67.221  1.00 30.55  ? 325  ALA J CA  1 
ATOM   9153  C C   . ALA N  2 8   ? 57.834  62.850  68.129  1.00 30.55  ? 325  ALA J C   1 
ATOM   9154  O O   . ALA N  2 8   ? 58.598  62.511  69.044  1.00 30.55  ? 325  ALA J O   1 
ATOM   9155  C CB  . ALA N  2 8   ? 58.436  63.571  65.826  1.00 30.55  ? 325  ALA J CB  1 
ATOM   9156  N N   . ASP N  2 9   ? 56.683  62.240  67.874  1.00 45.65  ? 326  ASP J N   1 
ATOM   9157  C CA  . ASP N  2 9   ? 56.205  61.047  68.564  1.00 45.65  ? 326  ASP J CA  1 
ATOM   9158  C C   . ASP N  2 9   ? 56.154  61.001  70.090  1.00 45.65  ? 326  ASP J C   1 
ATOM   9159  O O   . ASP N  2 9   ? 56.382  59.950  70.683  1.00 45.65  ? 326  ASP J O   1 
ATOM   9160  C CB  . ASP N  2 9   ? 56.985  59.872  68.009  1.00 45.65  ? 326  ASP J CB  1 
ATOM   9161  C CG  . ASP N  2 9   ? 57.434  60.122  66.570  1.00 45.65  ? 326  ASP J CG  1 
ATOM   9162  O OD1 . ASP N  2 9   ? 56.627  59.881  65.632  1.00 45.65  ? 326  ASP J OD1 1 
ATOM   9163  O OD2 . ASP N  2 9   ? 58.588  60.577  66.372  1.00 45.65  ? 326  ASP J OD2 1 
ATOM   9164  N N   . PHE N  2 10  ? 55.833  62.127  70.724  1.00 30.65  ? 327  PHE J N   1 
ATOM   9165  C CA  . PHE N  2 10  ? 55.710  62.181  72.181  1.00 30.65  ? 327  PHE J CA  1 
ATOM   9166  C C   . PHE N  2 10  ? 54.237  62.242  72.558  1.00 30.65  ? 327  PHE J C   1 
ATOM   9167  O O   . PHE N  2 10  ? 53.400  62.682  71.762  1.00 30.65  ? 327  PHE J O   1 
ATOM   9168  C CB  . PHE N  2 10  ? 56.369  63.437  72.736  1.00 30.65  ? 327  PHE J CB  1 
ATOM   9169  C CG  . PHE N  2 10  ? 57.828  63.276  73.048  1.00 30.65  ? 327  PHE J CG  1 
ATOM   9170  C CD1 . PHE N  2 10  ? 58.794  63.577  72.092  1.00 30.65  ? 327  PHE J CD1 1 
ATOM   9171  C CD2 . PHE N  2 10  ? 58.242  62.832  74.296  1.00 30.65  ? 327  PHE J CD2 1 
ATOM   9172  C CE1 . PHE N  2 10  ? 60.144  63.437  72.374  1.00 30.65  ? 327  PHE J CE1 1 
ATOM   9173  C CE2 . PHE N  2 10  ? 59.602  62.688  74.587  1.00 30.65  ? 327  PHE J CE2 1 
ATOM   9174  C CZ  . PHE N  2 10  ? 60.548  62.992  73.621  1.00 30.65  ? 327  PHE J CZ  1 
ATOM   9175  N N   . LEU N  2 11  ? 53.915  61.787  73.765  1.00 26.83  ? 328  LEU J N   1 
ATOM   9176  C CA  . LEU N  2 11  ? 52.547  61.858  74.261  1.00 26.83  ? 328  LEU J CA  1 
ATOM   9177  C C   . LEU N  2 11  ? 52.617  62.047  75.754  1.00 26.83  ? 328  LEU J C   1 
ATOM   9178  O O   . LEU N  2 11  ? 53.058  61.163  76.464  1.00 26.83  ? 328  LEU J O   1 
ATOM   9179  C CB  . LEU N  2 11  ? 51.748  60.595  73.953  1.00 26.83  ? 328  LEU J CB  1 
ATOM   9180  C CG  . LEU N  2 11  ? 50.411  60.535  74.719  1.00 26.83  ? 328  LEU J CG  1 
ATOM   9181  C CD1 . LEU N  2 11  ? 49.671  61.856  74.606  1.00 26.83  ? 328  LEU J CD1 1 
ATOM   9182  C CD2 . LEU N  2 11  ? 49.547  59.423  74.168  1.00 26.83  ? 328  LEU J CD2 1 
ATOM   9183  N N   . LEU N  2 12  ? 52.206  63.213  76.225  1.00 28.57  ? 329  LEU J N   1 
ATOM   9184  C CA  . LEU N  2 12  ? 52.211  63.497  77.650  1.00 28.57  ? 329  LEU J CA  1 
ATOM   9185  C C   . LEU N  2 12  ? 50.763  63.420  78.200  1.00 28.57  ? 329  LEU J C   1 
ATOM   9186  O O   . LEU N  2 12  ? 49.848  64.052  77.673  1.00 28.57  ? 329  LEU J O   1 
ATOM   9187  C CB  . LEU N  2 12  ? 52.789  64.888  77.881  1.00 28.57  ? 329  LEU J CB  1 
ATOM   9188  C CG  . LEU N  2 12  ? 52.853  65.401  79.312  1.00 28.57  ? 329  LEU J CG  1 
ATOM   9189  C CD1 . LEU N  2 12  ? 52.875  64.252  80.292  1.00 28.57  ? 329  LEU J CD1 1 
ATOM   9190  C CD2 . LEU N  2 12  ? 54.112  66.216  79.467  1.00 28.57  ? 329  LEU J CD2 1 
ATOM   9191  N N   . GLY N  2 13  ? 50.551  62.632  79.244  1.00 27.41  ? 330  GLY J N   1 
ATOM   9192  C CA  . GLY N  2 13  ? 49.224  62.537  79.812  1.00 27.41  ? 330  GLY J CA  1 
ATOM   9193  C C   . GLY N  2 13  ? 49.210  63.123  81.221  1.00 27.41  ? 330  GLY J C   1 
ATOM   9194  O O   . GLY N  2 13  ? 49.402  62.400  82.203  1.00 27.41  ? 330  GLY J O   1 
ATOM   9195  N N   . MET N  2 14  ? 49.005  64.430  81.343  1.00 39.23  ? 331  MET J N   1 
ATOM   9196  C CA  . MET N  2 14  ? 48.962  65.077  82.650  1.00 39.23  ? 331  MET J CA  1 
ATOM   9197  C C   . MET N  2 14  ? 47.658  64.698  83.311  1.00 39.23  ? 331  MET J C   1 
ATOM   9198  O O   . MET N  2 14  ? 46.625  64.648  82.655  1.00 39.23  ? 331  MET J O   1 
ATOM   9199  C CB  . MET N  2 14  ? 48.991  66.586  82.498  1.00 39.23  ? 331  MET J CB  1 
ATOM   9200  C CG  . MET N  2 14  ? 50.332  67.137  82.137  1.00 39.23  ? 331  MET J CG  1 
ATOM   9201  S SD  . MET N  2 14  ? 51.560  66.443  83.178  1.00 39.23  ? 331  MET J SD  1 
ATOM   9202  C CE  . MET N  2 14  ? 51.444  67.464  84.647  1.00 39.23  ? 331  MET J CE  1 
ATOM   9203  N N   . ALA N  2 15  ? 47.690  64.440  84.610  1.00 41.44  ? 332  ALA J N   1 
ATOM   9204  C CA  . ALA N  2 15  ? 46.473  64.068  85.327  1.00 41.44  ? 332  ALA J CA  1 
ATOM   9205  C C   . ALA N  2 15  ? 45.615  65.278  85.636  1.00 41.44  ? 332  ALA J C   1 
ATOM   9206  O O   . ALA N  2 15  ? 44.501  65.137  86.133  1.00 41.44  ? 332  ALA J O   1 
ATOM   9207  C CB  . ALA N  2 15  ? 46.819  63.367  86.624  1.00 41.44  ? 332  ALA J CB  1 
ATOM   9208  N N   . THR N  2 16  ? 46.140  66.463  85.347  1.00 61.68  ? 333  THR J N   1 
ATOM   9209  C CA  . THR N  2 16  ? 45.430  67.703  85.637  1.00 61.68  ? 333  THR J CA  1 
ATOM   9210  C C   . THR N  2 16  ? 46.000  68.909  84.894  1.00 61.68  ? 333  THR J C   1 
ATOM   9211  O O   . THR N  2 16  ? 47.156  68.906  84.471  1.00 61.68  ? 333  THR J O   1 
ATOM   9212  C CB  . THR N  2 16  ? 45.489  68.031  87.139  1.00 61.68  ? 333  THR J CB  1 
ATOM   9213  O OG1 . THR N  2 16  ? 44.932  69.329  87.367  1.00 61.68  ? 333  THR J OG1 1 
ATOM   9214  C CG2 . THR N  2 16  ? 46.918  68.043  87.622  1.00 61.68  ? 333  THR J CG2 1 
ATOM   9215  N N   . VAL N  2 17  ? 45.186  69.946  84.730  1.00 33.48  ? 334  VAL J N   1 
ATOM   9216  C CA  . VAL N  2 17  ? 45.662  71.152  84.062  1.00 33.48  ? 334  VAL J CA  1 
ATOM   9217  C C   . VAL N  2 17  ? 46.567  71.818  85.109  1.00 33.48  ? 334  VAL J C   1 
ATOM   9218  O O   . VAL N  2 17  ? 46.653  71.336  86.249  1.00 33.48  ? 334  VAL J O   1 
ATOM   9219  C CB  . VAL N  2 17  ? 44.482  72.099  83.644  1.00 33.48  ? 334  VAL J CB  1 
ATOM   9220  C CG1 . VAL N  2 17  ? 43.540  71.379  82.709  1.00 33.48  ? 334  VAL J CG1 1 
ATOM   9221  C CG2 . VAL N  2 17  ? 43.711  72.571  84.865  1.00 33.48  ? 334  VAL J CG2 1 
ATOM   9222  N N   . ASN N  2 18  ? 47.230  72.913  84.740  1.00 38.63  ? 335  ASN J N   1 
ATOM   9223  C CA  . ASN N  2 18  ? 48.147  73.583  85.656  1.00 38.63  ? 335  ASN J CA  1 
ATOM   9224  C C   . ASN N  2 18  ? 47.548  74.220  86.910  1.00 38.63  ? 335  ASN J C   1 
ATOM   9225  O O   . ASN N  2 18  ? 46.342  74.351  87.040  1.00 38.63  ? 335  ASN J O   1 
ATOM   9226  C CB  . ASN N  2 18  ? 48.950  74.627  84.894  1.00 38.63  ? 335  ASN J CB  1 
ATOM   9227  C CG  . ASN N  2 18  ? 50.433  74.416  85.032  1.00 38.63  ? 335  ASN J CG  1 
ATOM   9228  O OD1 . ASN N  2 18  ? 51.078  74.996  85.908  1.00 38.63  ? 335  ASN J OD1 1 
ATOM   9229  N ND2 . ASN N  2 18  ? 50.985  73.573  84.174  1.00 38.63  ? 335  ASN J ND2 1 
ATOM   9230  N N   . ASN N  2 19  ? 48.421  74.612  87.833  1.00 59.64  ? 336  ASN J N   1 
ATOM   9231  C CA  . ASN N  2 19  ? 48.034  75.242  89.100  1.00 59.64  ? 336  ASN J CA  1 
ATOM   9232  C C   . ASN N  2 19  ? 46.923  74.544  89.866  1.00 59.64  ? 336  ASN J C   1 
ATOM   9233  O O   . ASN N  2 19  ? 46.423  75.088  90.843  1.00 59.64  ? 336  ASN J O   1 
ATOM   9234  C CB  . ASN N  2 19  ? 47.633  76.701  88.880  1.00 59.64  ? 336  ASN J CB  1 
ATOM   9235  C CG  . ASN N  2 19  ? 48.286  77.298  87.659  1.00 59.64  ? 336  ASN J CG  1 
ATOM   9236  O OD1 . ASN N  2 19  ? 47.784  77.151  86.544  1.00 59.64  ? 336  ASN J OD1 1 
ATOM   9237  N ND2 . ASN N  2 19  ? 49.420  77.971  87.856  1.00 59.64  ? 336  ASN J ND2 1 
ATOM   9238  N N   . CYS N  2 20  ? 46.532  73.349  89.439  1.00 42.84  ? 337  CYS J N   1 
ATOM   9239  C CA  . CYS N  2 20  ? 45.465  72.623  90.129  1.00 42.84  ? 337  CYS J CA  1 
ATOM   9240  C C   . CYS N  2 20  ? 45.923  71.302  90.751  1.00 42.84  ? 337  CYS J C   1 
ATOM   9241  O O   . CYS N  2 20  ? 46.969  70.746  90.383  1.00 42.84  ? 337  CYS J O   1 
ATOM   9242  C CB  . CYS N  2 20  ? 44.294  72.340  89.179  1.00 42.84  ? 337  CYS J CB  1 
ATOM   9243  S SG  . CYS N  2 20  ? 43.426  73.788  88.595  1.00 42.84  ? 337  CYS J SG  1 
ATOM   9244  N N   . VAL N  2 21  ? 45.111  70.810  91.692  1.00 44.37  ? 338  VAL J N   1 
ATOM   9245  C CA  . VAL N  2 21  ? 45.378  69.567  92.408  1.00 44.37  ? 338  VAL J CA  1 
ATOM   9246  C C   . VAL N  2 21  ? 44.798  68.403  91.628  1.00 44.37  ? 338  VAL J C   1 
ATOM   9247  O O   . VAL N  2 21  ? 43.966  68.605  90.750  1.00 44.37  ? 338  VAL J O   1 
ATOM   9248  C CB  . VAL N  2 21  ? 44.700  69.580  93.787  1.00 44.37  ? 338  VAL J CB  1 
ATOM   9249  C CG1 . VAL N  2 21  ? 45.112  70.796  94.556  1.00 44.37  ? 338  VAL J CG1 1 
ATOM   9250  C CG2 . VAL N  2 21  ? 43.206  69.601  93.619  1.00 44.37  ? 338  VAL J CG2 1 
ATOM   9251  N N   . SER N  2 22  ? 45.268  67.194  91.923  1.00 34.75  ? 339  SER J N   1 
ATOM   9252  C CA  . SER N  2 22  ? 44.717  65.990  91.304  1.00 34.75  ? 339  SER J CA  1 
ATOM   9253  C C   . SER N  2 22  ? 44.403  65.124  92.511  1.00 34.75  ? 339  SER J C   1 
ATOM   9254  O O   . SER N  2 22  ? 45.076  65.229  93.538  1.00 34.75  ? 339  SER J O   1 
ATOM   9255  C CB  . SER N  2 22  ? 45.705  65.292  90.362  1.00 34.75  ? 339  SER J CB  1 
ATOM   9256  O OG  . SER N  2 22  ? 46.829  64.790  91.049  1.00 34.75  ? 339  SER J OG  1 
ATOM   9257  N N   . TYR N  2 23  ? 43.381  64.285  92.396  1.00 38.37  ? 340  TYR J N   1 
ATOM   9258  C CA  . TYR N  2 23  ? 42.955  63.472  93.519  1.00 38.37  ? 340  TYR J CA  1 
ATOM   9259  C C   . TYR N  2 23  ? 43.416  62.034  93.566  1.00 38.37  ? 340  TYR J C   1 
ATOM   9260  O O   . TYR N  2 23  ? 43.497  61.334  92.549  1.00 38.37  ? 340  TYR J O   1 
ATOM   9261  C CB  . TYR N  2 23  ? 41.432  63.526  93.644  1.00 38.37  ? 340  TYR J CB  1 
ATOM   9262  C CG  . TYR N  2 23  ? 40.912  64.928  93.895  1.00 38.37  ? 340  TYR J CG  1 
ATOM   9263  C CD1 . TYR N  2 23  ? 40.462  65.728  92.839  1.00 38.37  ? 340  TYR J CD1 1 
ATOM   9264  C CD2 . TYR N  2 23  ? 40.887  65.465  95.184  1.00 38.37  ? 340  TYR J CD2 1 
ATOM   9265  C CE1 . TYR N  2 23  ? 40.003  67.024  93.061  1.00 38.37  ? 340  TYR J CE1 1 
ATOM   9266  C CE2 . TYR N  2 23  ? 40.428  66.763  95.417  1.00 38.37  ? 340  TYR J CE2 1 
ATOM   9267  C CZ  . TYR N  2 23  ? 39.991  67.535  94.355  1.00 38.37  ? 340  TYR J CZ  1 
ATOM   9268  O OH  . TYR N  2 23  ? 39.566  68.825  94.583  1.00 38.37  ? 340  TYR J OH  1 
ATOM   9269  N N   . ARG N  2 24  ? 43.691  61.616  94.797  1.00 35.23  ? 341  ARG J N   1 
ATOM   9270  C CA  . ARG N  2 24  ? 44.180  60.287  95.126  1.00 35.23  ? 341  ARG J CA  1 
ATOM   9271  C C   . ARG N  2 24  ? 43.399  59.726  96.319  1.00 35.23  ? 341  ARG J C   1 
ATOM   9272  O O   . ARG N  2 24  ? 43.546  60.214  97.444  1.00 35.23  ? 341  ARG J O   1 
ATOM   9273  C CB  . ARG N  2 24  ? 45.666  60.387  95.486  1.00 35.23  ? 341  ARG J CB  1 
ATOM   9274  C CG  . ARG N  2 24  ? 46.343  59.092  95.833  1.00 35.23  ? 341  ARG J CG  1 
ATOM   9275  C CD  . ARG N  2 24  ? 47.656  59.384  96.488  1.00 35.23  ? 341  ARG J CD  1 
ATOM   9276  N NE  . ARG N  2 24  ? 47.462  59.709  97.895  1.00 35.23  ? 341  ARG J NE  1 
ATOM   9277  C CZ  . ARG N  2 24  ? 47.980  60.775  98.496  1.00 35.23  ? 341  ARG J CZ  1 
ATOM   9278  N NH1 . ARG N  2 24  ? 48.727  61.620  97.807  1.00 35.23  ? 341  ARG J NH1 1 
ATOM   9279  N NH2 . ARG N  2 24  ? 47.755  60.996  99.787  1.00 35.23  ? 341  ARG J NH2 1 
ATOM   9280  N N   . ASN N  2 25  ? 42.564  58.719  96.076  1.00 52.34  ? 342  ASN J N   1 
ATOM   9281  C CA  . ASN N  2 25  ? 41.805  58.106  97.158  1.00 52.34  ? 342  ASN J CA  1 
ATOM   9282  C C   . ASN N  2 25  ? 42.631  56.944  97.699  1.00 52.34  ? 342  ASN J C   1 
ATOM   9283  O O   . ASN N  2 25  ? 42.893  55.963  96.985  1.00 52.34  ? 342  ASN J O   1 
ATOM   9284  C CB  . ASN N  2 25  ? 40.459  57.587  96.655  1.00 52.34  ? 342  ASN J CB  1 
ATOM   9285  C CG  . ASN N  2 25  ? 39.743  56.709  97.682  1.00 52.34  ? 342  ASN J CG  1 
ATOM   9286  O OD1 . ASN N  2 25  ? 40.102  56.679  98.871  1.00 52.34  ? 342  ASN J OD1 1 
ATOM   9287  N ND2 . ASN N  2 25  ? 38.718  55.992  97.221  1.00 52.34  ? 342  ASN J ND2 1 
ATOM   9288  N N   . PRO N  2 26  ? 43.059  57.039  98.968  1.00 50.83  ? 343  PRO J N   1 
ATOM   9289  C CA  . PRO N  2 26  ? 43.860  55.960  99.564  1.00 50.83  ? 343  PRO J CA  1 
ATOM   9290  C C   . PRO N  2 26  ? 43.165  54.600  99.428  1.00 50.83  ? 343  PRO J C   1 
ATOM   9291  O O   . PRO N  2 26  ? 43.816  53.553  99.366  1.00 50.83  ? 343  PRO J O   1 
ATOM   9292  C CB  . PRO N  2 26  ? 44.018  56.390  101.020 1.00 50.83  ? 343  PRO J CB  1 
ATOM   9293  C CG  . PRO N  2 26  ? 43.828  57.879  100.993 1.00 50.83  ? 343  PRO J CG  1 
ATOM   9294  C CD  . PRO N  2 26  ? 42.825  58.148  99.908  1.00 50.83  ? 343  PRO J CD  1 
ATOM   9295  N N   . ALA N  2 27  ? 41.837  54.630  99.356  1.00 49.38  ? 344  ALA J N   1 
ATOM   9296  C CA  . ALA N  2 27  ? 41.047  53.416  99.234  1.00 49.38  ? 344  ALA J CA  1 
ATOM   9297  C C   . ALA N  2 27  ? 41.208  52.699  97.901  1.00 49.38  ? 344  ALA J C   1 
ATOM   9298  O O   . ALA N  2 27  ? 41.496  51.509  97.881  1.00 49.38  ? 344  ALA J O   1 
ATOM   9299  C CB  . ALA N  2 27  ? 39.594  53.731  99.463  1.00 49.38  ? 344  ALA J CB  1 
ATOM   9300  N N   . GLU N  2 28  ? 41.028  53.411  96.788  1.00 59.54  ? 345  GLU J N   1 
ATOM   9301  C CA  . GLU N  2 28  ? 41.122  52.773  95.467  1.00 59.54  ? 345  GLU J CA  1 
ATOM   9302  C C   . GLU N  2 28  ? 42.199  53.298  94.527  1.00 59.54  ? 345  GLU J C   1 
ATOM   9303  O O   . GLU N  2 28  ? 42.350  52.802  93.408  1.00 59.54  ? 345  GLU J O   1 
ATOM   9304  C CB  . GLU N  2 28  ? 39.765  52.836  94.739  1.00 59.54  ? 345  GLU J CB  1 
ATOM   9305  C CG  . GLU N  2 28  ? 38.771  53.872  95.285  1.00 59.54  ? 345  GLU J CG  1 
ATOM   9306  C CD  . GLU N  2 28  ? 37.494  53.234  95.827  1.00 59.54  ? 345  GLU J CD  1 
ATOM   9307  O OE1 . GLU N  2 28  ? 37.022  53.648  96.912  1.00 59.54  ? 345  GLU J OE1 1 
ATOM   9308  O OE2 . GLU N  2 28  ? 36.963  52.315  95.166  1.00 59.54  ? 345  GLU J OE2 1 
ATOM   9309  N N   . GLY N  2 29  ? 42.954  54.289  94.973  1.00 65.84  ? 346  GLY J N   1 
ATOM   9310  C CA  . GLY N  2 29  ? 43.986  54.829  94.112  1.00 65.84  ? 346  GLY J CA  1 
ATOM   9311  C C   . GLY N  2 29  ? 43.640  56.242  93.687  1.00 65.84  ? 346  GLY J C   1 
ATOM   9312  O O   . GLY N  2 29  ? 42.924  56.950  94.401  1.00 65.84  ? 346  GLY J O   1 
ATOM   9313  N N   . THR N  2 30  ? 44.133  56.658  92.524  1.00 61.61  ? 347  THR J N   1 
ATOM   9314  C CA  . THR N  2 30  ? 43.876  58.010  92.040  1.00 61.61  ? 347  THR J CA  1 
ATOM   9315  C C   . THR N  2 30  ? 42.901  58.068  90.885  1.00 61.61  ? 347  THR J C   1 
ATOM   9316  O O   . THR N  2 30  ? 42.896  57.191  90.016  1.00 61.61  ? 347  THR J O   1 
ATOM   9317  C CB  . THR N  2 30  ? 45.143  58.679  91.564  1.00 61.61  ? 347  THR J CB  1 
ATOM   9318  O OG1 . THR N  2 30  ? 45.634  57.982  90.414  1.00 61.61  ? 347  THR J OG1 1 
ATOM   9319  C CG2 . THR N  2 30  ? 46.186  58.661  92.653  1.00 61.61  ? 347  THR J CG2 1 
ATOM   9320  N N   . TRP N  2 31  ? 42.099  59.129  90.869  1.00 49.50  ? 348  TRP J N   1 
ATOM   9321  C CA  . TRP N  2 31  ? 41.098  59.323  89.836  1.00 49.50  ? 348  TRP J CA  1 
ATOM   9322  C C   . TRP N  2 31  ? 41.669  59.100  88.439  1.00 49.50  ? 348  TRP J C   1 
ATOM   9323  O O   . TRP N  2 31  ? 41.098  58.373  87.626  1.00 49.50  ? 348  TRP J O   1 
ATOM   9324  C CB  . TRP N  2 31  ? 40.533  60.739  89.926  1.00 49.50  ? 348  TRP J CB  1 
ATOM   9325  C CG  . TRP N  2 31  ? 39.704  61.015  91.151  1.00 49.50  ? 348  TRP J CG  1 
ATOM   9326  C CD1 . TRP N  2 31  ? 39.493  60.178  92.210  1.00 49.50  ? 348  TRP J CD1 1 
ATOM   9327  C CD2 . TRP N  2 31  ? 38.988  62.226  91.449  1.00 49.50  ? 348  TRP J CD2 1 
ATOM   9328  N NE1 . TRP N  2 31  ? 38.692  60.794  93.153  1.00 49.50  ? 348  TRP J NE1 1 
ATOM   9329  C CE2 . TRP N  2 31  ? 38.370  62.053  92.711  1.00 49.50  ? 348  TRP J CE2 1 
ATOM   9330  C CE3 . TRP N  2 31  ? 38.809  63.446  90.776  1.00 49.50  ? 348  TRP J CE3 1 
ATOM   9331  C CZ2 . TRP N  2 31  ? 37.589  63.048  93.310  1.00 49.50  ? 348  TRP J CZ2 1 
ATOM   9332  C CZ3 . TRP N  2 31  ? 38.030  64.437  91.374  1.00 49.50  ? 348  TRP J CZ3 1 
ATOM   9333  C CH2 . TRP N  2 31  ? 37.429  64.229  92.626  1.00 49.50  ? 348  TRP J CH2 1 
ATOM   9334  N N   . TYR N  2 32  ? 42.813  59.724  88.178  1.00 31.78  ? 349  TYR J N   1 
ATOM   9335  C CA  . TYR N  2 32  ? 43.452  59.640  86.871  1.00 31.78  ? 349  TYR J CA  1 
ATOM   9336  C C   . TYR N  2 32  ? 43.973  58.267  86.465  1.00 31.78  ? 349  TYR J C   1 
ATOM   9337  O O   . TYR N  2 32  ? 43.525  57.677  85.474  1.00 31.78  ? 349  TYR J O   1 
ATOM   9338  C CB  . TYR N  2 32  ? 44.599  60.646  86.783  1.00 31.78  ? 349  TYR J CB  1 
ATOM   9339  C CG  . TYR N  2 32  ? 45.213  60.689  85.399  1.00 31.78  ? 349  TYR J CG  1 
ATOM   9340  C CD1 . TYR N  2 32  ? 44.418  60.829  84.260  1.00 31.78  ? 349  TYR J CD1 1 
ATOM   9341  C CD2 . TYR N  2 32  ? 46.590  60.593  85.224  1.00 31.78  ? 349  TYR J CD2 1 
ATOM   9342  C CE1 . TYR N  2 32  ? 44.990  60.869  82.985  1.00 31.78  ? 349  TYR J CE1 1 
ATOM   9343  C CE2 . TYR N  2 32  ? 47.167  60.633  83.953  1.00 31.78  ? 349  TYR J CE2 1 
ATOM   9344  C CZ  . TYR N  2 32  ? 46.364  60.766  82.845  1.00 31.78  ? 349  TYR J CZ  1 
ATOM   9345  O OH  . TYR N  2 32  ? 46.926  60.744  81.593  1.00 31.78  ? 349  TYR J OH  1 
ATOM   9346  N N   . ILE N  2 33  ? 44.936  57.770  87.225  1.00 30.55  ? 350  ILE J N   1 
ATOM   9347  C CA  . ILE N  2 33  ? 45.539  56.477  86.920  1.00 30.55  ? 350  ILE J CA  1 
ATOM   9348  C C   . ILE N  2 33  ? 44.483  55.377  86.841  1.00 30.55  ? 350  ILE J C   1 
ATOM   9349  O O   . ILE N  2 33  ? 44.324  54.700  85.817  1.00 30.55  ? 350  ILE J O   1 
ATOM   9350  C CB  . ILE N  2 33  ? 46.592  56.106  87.982  1.00 30.55  ? 350  ILE J CB  1 
ATOM   9351  C CG1 . ILE N  2 33  ? 47.816  57.011  87.826  1.00 30.55  ? 350  ILE J CG1 1 
ATOM   9352  C CG2 . ILE N  2 33  ? 46.981  54.659  87.836  1.00 30.55  ? 350  ILE J CG2 1 
ATOM   9353  C CD1 . ILE N  2 33  ? 48.265  57.186  86.379  1.00 30.55  ? 350  ILE J CD1 1 
ATOM   9354  N N   . GLN N  2 34  ? 43.755  55.212  87.931  1.00 50.31  ? 351  GLN J N   1 
ATOM   9355  C CA  . GLN N  2 34  ? 42.714  54.214  87.978  1.00 50.31  ? 351  GLN J CA  1 
ATOM   9356  C C   . GLN N  2 34  ? 41.838  54.292  86.735  1.00 50.31  ? 351  GLN J C   1 
ATOM   9357  O O   . GLN N  2 34  ? 41.523  53.278  86.116  1.00 50.31  ? 351  GLN J O   1 
ATOM   9358  C CB  . GLN N  2 34  ? 41.864  54.434  89.218  1.00 50.31  ? 351  GLN J CB  1 
ATOM   9359  C CG  . GLN N  2 34  ? 42.563  54.048  90.512  1.00 50.31  ? 351  GLN J CG  1 
ATOM   9360  C CD  . GLN N  2 34  ? 43.395  52.778  90.385  1.00 50.31  ? 351  GLN J CD  1 
ATOM   9361  O OE1 . GLN N  2 34  ? 42.915  51.739  89.914  1.00 50.31  ? 351  GLN J OE1 1 
ATOM   9362  N NE2 . GLN N  2 34  ? 44.653  52.858  90.809  1.00 50.31  ? 351  GLN J NE2 1 
ATOM   9363  N N   . SER N  2 35  ? 41.457  55.507  86.362  1.00 38.99  ? 352  SER J N   1 
ATOM   9364  C CA  . SER N  2 35  ? 40.596  55.706  85.204  1.00 38.99  ? 352  SER J CA  1 
ATOM   9365  C C   . SER N  2 35  ? 41.310  55.440  83.895  1.00 38.99  ? 352  SER J C   1 
ATOM   9366  O O   . SER N  2 35  ? 40.705  55.006  82.921  1.00 38.99  ? 352  SER J O   1 
ATOM   9367  C CB  . SER N  2 35  ? 40.053  57.127  85.195  1.00 38.99  ? 352  SER J CB  1 
ATOM   9368  O OG  . SER N  2 35  ? 39.355  57.359  83.990  1.00 38.99  ? 352  SER J OG  1 
ATOM   9369  N N   . LEU N  2 36  ? 42.604  55.707  83.873  1.00 24.94  ? 353  LEU J N   1 
ATOM   9370  C CA  . LEU N  2 36  ? 43.356  55.486  82.660  1.00 24.94  ? 353  LEU J CA  1 
ATOM   9371  C C   . LEU N  2 36  ? 43.446  53.994  82.399  1.00 24.94  ? 353  LEU J C   1 
ATOM   9372  O O   . LEU N  2 36  ? 43.147  53.521  81.302  1.00 24.94  ? 353  LEU J O   1 
ATOM   9373  C CB  . LEU N  2 36  ? 44.757  56.100  82.783  1.00 24.94  ? 353  LEU J CB  1 
ATOM   9374  C CG  . LEU N  2 36  ? 45.851  55.589  81.825  1.00 24.94  ? 353  LEU J CG  1 
ATOM   9375  C CD1 . LEU N  2 36  ? 45.353  55.617  80.366  1.00 24.94  ? 353  LEU J CD1 1 
ATOM   9376  C CD2 . LEU N  2 36  ? 47.111  56.443  81.997  1.00 24.94  ? 353  LEU J CD2 1 
ATOM   9377  N N   . CYS N  2 37  ? 43.855  53.252  83.420  1.00 58.98  ? 354  CYS J N   1 
ATOM   9378  C CA  . CYS N  2 37  ? 44.000  51.805  83.295  1.00 58.98  ? 354  CYS J CA  1 
ATOM   9379  C C   . CYS N  2 37  ? 42.678  51.187  82.930  1.00 58.98  ? 354  CYS J C   1 
ATOM   9380  O O   . CYS N  2 37  ? 42.544  50.552  81.892  1.00 58.98  ? 354  CYS J O   1 
ATOM   9381  C CB  . CYS N  2 37  ? 44.485  51.206  84.606  1.00 58.98  ? 354  CYS J CB  1 
ATOM   9382  S SG  . CYS N  2 37  ? 46.010  51.938  85.162  1.00 58.98  ? 354  CYS J SG  1 
ATOM   9383  N N   . GLN N  2 38  ? 41.701  51.378  83.799  1.00 60.53  ? 355  GLN J N   1 
ATOM   9384  C CA  . GLN N  2 38  ? 40.385  50.844  83.566  1.00 60.53  ? 355  GLN J CA  1 
ATOM   9385  C C   . GLN N  2 38  ? 39.969  50.973  82.110  1.00 60.53  ? 355  GLN J C   1 
ATOM   9386  O O   . GLN N  2 38  ? 39.500  50.016  81.507  1.00 60.53  ? 355  GLN J O   1 
ATOM   9387  C CB  . GLN N  2 38  ? 39.398  51.580  84.431  1.00 60.53  ? 355  GLN J CB  1 
ATOM   9388  C CG  . GLN N  2 38  ? 37.973  51.208  84.150  1.00 60.53  ? 355  GLN J CG  1 
ATOM   9389  C CD  . GLN N  2 38  ? 37.072  51.670  85.266  1.00 60.53  ? 355  GLN J CD  1 
ATOM   9390  O OE1 . GLN N  2 38  ? 37.312  51.360  86.446  1.00 60.53  ? 355  GLN J OE1 1 
ATOM   9391  N NE2 . GLN N  2 38  ? 36.034  52.433  84.913  1.00 60.53  ? 355  GLN J NE2 1 
ATOM   9392  N N   . SER N  2 39  ? 40.144  52.163  81.551  1.00 45.68  ? 356  SER J N   1 
ATOM   9393  C CA  . SER N  2 39  ? 39.777  52.411  80.164  1.00 45.68  ? 356  SER J CA  1 
ATOM   9394  C C   . SER N  2 39  ? 40.649  51.603  79.248  1.00 45.68  ? 356  SER J C   1 
ATOM   9395  O O   . SER N  2 39  ? 40.158  50.945  78.346  1.00 45.68  ? 356  SER J O   1 
ATOM   9396  C CB  . SER N  2 39  ? 39.933  53.897  79.814  1.00 45.68  ? 356  SER J CB  1 
ATOM   9397  O OG  . SER N  2 39  ? 39.226  54.734  80.725  1.00 45.68  ? 356  SER J OG  1 
ATOM   9398  N N   . LEU N  2 40  ? 41.953  51.664  79.481  1.00 55.14  ? 357  LEU J N   1 
ATOM   9399  C CA  . LEU N  2 40  ? 42.899  50.920  78.663  1.00 55.14  ? 357  LEU J CA  1 
ATOM   9400  C C   . LEU N  2 40  ? 42.443  49.471  78.509  1.00 55.14  ? 357  LEU J C   1 
ATOM   9401  O O   . LEU N  2 40  ? 42.405  48.937  77.399  1.00 55.14  ? 357  LEU J O   1 
ATOM   9402  C CB  . LEU N  2 40  ? 44.281  50.932  79.306  1.00 55.14  ? 357  LEU J CB  1 
ATOM   9403  C CG  . LEU N  2 40  ? 45.097  52.208  79.178  1.00 55.14  ? 357  LEU J CG  1 
ATOM   9404  C CD1 . LEU N  2 40  ? 46.013  52.310  80.370  1.00 55.14  ? 357  LEU J CD1 1 
ATOM   9405  C CD2 . LEU N  2 40  ? 45.904  52.190  77.892  1.00 55.14  ? 357  LEU J CD2 1 
ATOM   9406  N N   . ARG N  2 41  ? 42.099  48.844  79.632  1.00 66.19  ? 358  ARG J N   1 
ATOM   9407  C CA  . ARG N  2 41  ? 41.653  47.461  79.632  1.00 66.19  ? 358  ARG J CA  1 
ATOM   9408  C C   . ARG N  2 41  ? 40.442  47.253  78.731  1.00 66.19  ? 358  ARG J C   1 
ATOM   9409  O O   . ARG N  2 41  ? 40.483  46.434  77.816  1.00 66.19  ? 358  ARG J O   1 
ATOM   9410  C CB  . ARG N  2 41  ? 41.304  47.007  81.048  1.00 66.19  ? 358  ARG J CB  1 
ATOM   9411  C CG  . ARG N  2 41  ? 42.311  47.381  82.105  1.00 66.19  ? 358  ARG J CG  1 
ATOM   9412  C CD  . ARG N  2 41  ? 41.738  47.153  83.501  1.00 66.19  ? 358  ARG J CD  1 
ATOM   9413  N NE  . ARG N  2 41  ? 42.614  46.302  84.297  1.00 66.19  ? 358  ARG J NE  1 
ATOM   9414  C CZ  . ARG N  2 41  ? 42.876  45.028  84.012  1.00 66.19  ? 358  ARG J CZ  1 
ATOM   9415  N NH1 . ARG N  2 41  ? 42.329  44.450  82.946  1.00 66.19  ? 358  ARG J NH1 1 
ATOM   9416  N NH2 . ARG N  2 41  ? 43.699  44.334  84.790  1.00 66.19  ? 358  ARG J NH2 1 
ATOM   9417  N N   . GLU N  2 42  ? 39.368  47.996  78.981  1.00 51.52  ? 359  GLU J N   1 
ATOM   9418  C CA  . GLU N  2 42  ? 38.149  47.845  78.190  1.00 51.52  ? 359  GLU J CA  1 
ATOM   9419  C C   . GLU N  2 42  ? 38.274  48.280  76.741  1.00 51.52  ? 359  GLU J C   1 
ATOM   9420  O O   . GLU N  2 42  ? 37.533  47.786  75.897  1.00 51.52  ? 359  GLU J O   1 
ATOM   9421  C CB  . GLU N  2 42  ? 36.987  48.631  78.811  1.00 51.52  ? 359  GLU J CB  1 
ATOM   9422  C CG  . GLU N  2 42  ? 36.497  48.136  80.165  1.00 51.52  ? 359  GLU J CG  1 
ATOM   9423  C CD  . GLU N  2 42  ? 35.733  49.227  80.931  1.00 51.52  ? 359  GLU J CD  1 
ATOM   9424  O OE1 . GLU N  2 42  ? 35.172  50.122  80.252  1.00 51.52  ? 359  GLU J OE1 1 
ATOM   9425  O OE2 . GLU N  2 42  ? 35.696  49.196  82.195  1.00 51.52  ? 359  GLU J OE2 1 
ATOM   9426  N N   . ARG N  2 43  ? 39.207  49.185  76.442  1.00 72.85  ? 360  ARG J N   1 
ATOM   9427  C CA  . ARG N  2 43  ? 39.343  49.709  75.080  1.00 72.85  ? 360  ARG J CA  1 
ATOM   9428  C C   . ARG N  2 43  ? 40.395  49.144  74.134  1.00 72.85  ? 360  ARG J C   1 
ATOM   9429  O O   . ARG N  2 43  ? 40.091  48.860  72.978  1.00 72.85  ? 360  ARG J O   1 
ATOM   9430  C CB  . ARG N  2 43  ? 39.517  51.230  75.130  1.00 72.85  ? 360  ARG J CB  1 
ATOM   9431  C CG  . ARG N  2 43  ? 38.456  51.959  75.946  1.00 72.85  ? 360  ARG J CG  1 
ATOM   9432  C CD  . ARG N  2 43  ? 37.133  52.020  75.201  1.00 72.85  ? 360  ARG J CD  1 
ATOM   9433  N NE  . ARG N  2 43  ? 36.511  53.345  75.256  1.00 72.85  ? 360  ARG J NE  1 
ATOM   9434  C CZ  . ARG N  2 43  ? 36.239  54.095  74.190  1.00 72.85  ? 360  ARG J CZ  1 
ATOM   9435  N NH1 . ARG N  2 43  ? 36.534  53.660  72.968  1.00 72.85  ? 360  ARG J NH1 1 
ATOM   9436  N NH2 . ARG N  2 43  ? 35.660  55.279  74.344  1.00 72.85  ? 360  ARG J NH2 1 
ATOM   9437  N N   . CYS N  2 44  ? 41.628  48.998  74.600  1.00 54.87  ? 361  CYS J N   1 
ATOM   9438  C CA  . CYS N  2 44  ? 42.699  48.499  73.742  1.00 54.87  ? 361  CYS J CA  1 
ATOM   9439  C C   . CYS N  2 44  ? 42.327  47.249  72.944  1.00 54.87  ? 361  CYS J C   1 
ATOM   9440  O O   . CYS N  2 44  ? 42.636  47.149  71.750  1.00 54.87  ? 361  CYS J O   1 
ATOM   9441  C CB  . CYS N  2 44  ? 43.958  48.257  74.571  1.00 54.87  ? 361  CYS J CB  1 
ATOM   9442  S SG  . CYS N  2 44  ? 44.724  49.795  75.153  1.00 54.87  ? 361  CYS J SG  1 
ATOM   9443  N N   . PRO N  2 45  ? 41.695  46.261  73.598  1.00 79.24  ? 362  PRO J N   1 
ATOM   9444  C CA  . PRO N  2 45  ? 41.315  45.065  72.841  1.00 79.24  ? 362  PRO J CA  1 
ATOM   9445  C C   . PRO N  2 45  ? 40.509  45.477  71.603  1.00 79.24  ? 362  PRO J C   1 
ATOM   9446  O O   . PRO N  2 45  ? 40.875  45.110  70.487  1.00 79.24  ? 362  PRO J O   1 
ATOM   9447  C CB  . PRO N  2 45  ? 40.479  44.245  73.831  1.00 79.24  ? 362  PRO J CB  1 
ATOM   9448  C CG  . PRO N  2 45  ? 40.216  45.147  75.002  1.00 79.24  ? 362  PRO J CG  1 
ATOM   9449  C CD  . PRO N  2 45  ? 41.335  46.149  75.019  1.00 79.24  ? 362  PRO J CD  1 
ATOM   9450  N N   . ARG N  2 46  B 39.425  46.241  71.810  1.00 65.87  ? 362  ARG J N   1 
ATOM   9451  C CA  . ARG N  2 46  B 38.576  46.733  70.715  1.00 65.87  ? 362  ARG J CA  1 
ATOM   9452  C C   . ARG N  2 46  B 39.441  47.259  69.580  1.00 65.87  ? 362  ARG J C   1 
ATOM   9453  O O   . ARG N  2 46  B 39.341  46.794  68.455  1.00 65.87  ? 362  ARG J O   1 
ATOM   9454  C CB  . ARG N  2 46  B 37.669  47.869  71.185  1.00 65.87  ? 362  ARG J CB  1 
ATOM   9455  C CG  . ARG N  2 46  B 36.955  47.610  72.488  1.00 65.87  ? 362  ARG J CG  1 
ATOM   9456  C CD  . ARG N  2 46  B 35.615  48.345  72.525  1.00 65.87  ? 362  ARG J CD  1 
ATOM   9457  N NE  . ARG N  2 46  B 34.870  48.124  73.771  1.00 65.87  ? 362  ARG J NE  1 
ATOM   9458  C CZ  . ARG N  2 46  B 34.488  46.929  74.236  1.00 65.87  ? 362  ARG J CZ  1 
ATOM   9459  N NH1 . ARG N  2 46  B 34.776  45.812  73.565  1.00 65.87  ? 362  ARG J NH1 1 
ATOM   9460  N NH2 . ARG N  2 46  B 33.805  46.849  75.376  1.00 65.87  ? 362  ARG J NH2 1 
ATOM   9461  N N   . GLY N  2 47  ? 40.288  48.238  69.882  1.00 60.65  ? 363  GLY J N   1 
ATOM   9462  C CA  . GLY N  2 47  ? 41.174  48.795  68.871  1.00 60.65  ? 363  GLY J CA  1 
ATOM   9463  C C   . GLY N  2 47  ? 41.321  50.305  68.955  1.00 60.65  ? 363  GLY J C   1 
ATOM   9464  O O   . GLY N  2 47  ? 42.075  50.903  68.184  1.00 60.65  ? 363  GLY J O   1 
ATOM   9465  N N   . ASP N  2 48  ? 40.608  50.912  69.902  1.00 64.42  ? 364  ASP J N   1 
ATOM   9466  C CA  . ASP N  2 48  ? 40.615  52.358  70.100  1.00 64.42  ? 364  ASP J CA  1 
ATOM   9467  C C   . ASP N  2 48  ? 41.994  52.980  70.218  1.00 64.42  ? 364  ASP J C   1 
ATOM   9468  O O   . ASP N  2 48  ? 42.817  52.568  71.026  1.00 64.42  ? 364  ASP J O   1 
ATOM   9469  C CB  . ASP N  2 48  ? 39.784  52.714  71.333  1.00 64.42  ? 364  ASP J CB  1 
ATOM   9470  C CG  . ASP N  2 48  ? 38.409  52.082  71.302  1.00 64.42  ? 364  ASP J CG  1 
ATOM   9471  O OD1 . ASP N  2 48  ? 37.675  52.305  70.313  1.00 64.42  ? 364  ASP J OD1 1 
ATOM   9472  O OD2 . ASP N  2 48  ? 38.064  51.358  72.260  1.00 64.42  ? 364  ASP J OD2 1 
ATOM   9473  N N   . ASP N  2 49  ? 42.235  53.987  69.394  1.00 61.81  ? 365  ASP J N   1 
ATOM   9474  C CA  . ASP N  2 49  ? 43.500  54.690  69.398  1.00 61.81  ? 365  ASP J CA  1 
ATOM   9475  C C   . ASP N  2 49  ? 43.655  55.339  70.756  1.00 61.81  ? 365  ASP J C   1 
ATOM   9476  O O   . ASP N  2 49  ? 42.676  55.744  71.365  1.00 61.81  ? 365  ASP J O   1 
ATOM   9477  C CB  . ASP N  2 49  ? 43.500  55.751  68.305  1.00 61.81  ? 365  ASP J CB  1 
ATOM   9478  C CG  . ASP N  2 49  ? 43.773  57.133  68.841  1.00 61.81  ? 365  ASP J CG  1 
ATOM   9479  O OD1 . ASP N  2 49  ? 42.883  58.002  68.712  1.00 61.81  ? 365  ASP J OD1 1 
ATOM   9480  O OD2 . ASP N  2 49  ? 44.880  57.342  69.390  1.00 61.81  ? 365  ASP J OD2 1 
ATOM   9481  N N   . ILE N  2 50  ? 44.891  55.456  71.219  1.00 41.44  ? 366  ILE J N   1 
ATOM   9482  C CA  . ILE N  2 50  ? 45.183  56.026  72.533  1.00 41.44  ? 366  ILE J CA  1 
ATOM   9483  C C   . ILE N  2 50  ? 44.584  57.400  72.807  1.00 41.44  ? 366  ILE J C   1 
ATOM   9484  O O   . ILE N  2 50  ? 44.266  57.734  73.956  1.00 41.44  ? 366  ILE J O   1 
ATOM   9485  C CB  . ILE N  2 50  ? 46.715  56.067  72.777  1.00 41.44  ? 366  ILE J CB  1 
ATOM   9486  C CG1 . ILE N  2 50  ? 47.027  55.523  74.175  1.00 41.44  ? 366  ILE J CG1 1 
ATOM   9487  C CG2 . ILE N  2 50  ? 47.260  57.477  72.587  1.00 41.44  ? 366  ILE J CG2 1 
ATOM   9488  C CD1 . ILE N  2 50  ? 46.514  56.376  75.322  1.00 41.44  ? 366  ILE J CD1 1 
ATOM   9489  N N   . LEU N  2 51  ? 44.441  58.207  71.762  1.00 45.70  ? 367  LEU J N   1 
ATOM   9490  C CA  . LEU N  2 51  ? 43.857  59.530  71.934  1.00 45.70  ? 367  LEU J CA  1 
ATOM   9491  C C   . LEU N  2 51  ? 42.407  59.318  72.370  1.00 45.70  ? 367  LEU J C   1 
ATOM   9492  O O   . LEU N  2 51  ? 41.935  59.934  73.329  1.00 45.70  ? 367  LEU J O   1 
ATOM   9493  C CB  . LEU N  2 51  ? 43.926  60.319  70.623  1.00 45.70  ? 367  LEU J CB  1 
ATOM   9494  C CG  . LEU N  2 51  ? 45.054  61.351  70.476  1.00 45.70  ? 367  LEU J CG  1 
ATOM   9495  C CD1 . LEU N  2 51  ? 45.928  61.372  71.717  1.00 45.70  ? 367  LEU J CD1 1 
ATOM   9496  C CD2 . LEU N  2 51  ? 45.872  61.026  69.233  1.00 45.70  ? 367  LEU J CD2 1 
ATOM   9497  N N   . THR N  2 52  ? 41.715  58.425  71.671  1.00 46.74  ? 368  THR J N   1 
ATOM   9498  C CA  . THR N  2 52  ? 40.343  58.102  72.013  1.00 46.74  ? 368  THR J CA  1 
ATOM   9499  C C   . THR N  2 52  ? 40.259  57.696  73.485  1.00 46.74  ? 368  THR J C   1 
ATOM   9500  O O   . THR N  2 52  ? 39.507  58.280  74.258  1.00 46.74  ? 368  THR J O   1 
ATOM   9501  C CB  . THR N  2 52  ? 39.831  56.952  71.168  1.00 46.74  ? 368  THR J CB  1 
ATOM   9502  O OG1 . THR N  2 52  ? 39.908  57.321  69.784  1.00 46.74  ? 368  THR J OG1 1 
ATOM   9503  C CG2 . THR N  2 52  ? 38.387  56.604  71.560  1.00 46.74  ? 368  THR J CG2 1 
ATOM   9504  N N   . ILE N  2 53  ? 41.031  56.699  73.891  1.00 60.63  ? 369  ILE J N   1 
ATOM   9505  C CA  . ILE N  2 53  ? 40.989  56.284  75.291  1.00 60.63  ? 369  ILE J CA  1 
ATOM   9506  C C   . ILE N  2 53  ? 41.253  57.487  76.192  1.00 60.63  ? 369  ILE J C   1 
ATOM   9507  O O   . ILE N  2 53  ? 40.538  57.725  77.165  1.00 60.63  ? 369  ILE J O   1 
ATOM   9508  C CB  . ILE N  2 53  ? 42.059  55.196  75.622  1.00 60.63  ? 369  ILE J CB  1 
ATOM   9509  C CG1 . ILE N  2 53  ? 41.754  53.888  74.883  1.00 60.63  ? 369  ILE J CG1 1 
ATOM   9510  C CG2 . ILE N  2 53  ? 42.071  54.925  77.123  1.00 60.63  ? 369  ILE J CG2 1 
ATOM   9511  C CD1 . ILE N  2 53  ? 42.509  53.721  73.585  1.00 60.63  ? 369  ILE J CD1 1 
ATOM   9512  N N   . LEU N  2 54  ? 42.279  58.255  75.851  1.00 35.90  ? 370  LEU J N   1 
ATOM   9513  C CA  . LEU N  2 54  ? 42.629  59.396  76.669  1.00 35.90  ? 370  LEU J CA  1 
ATOM   9514  C C   . LEU N  2 54  ? 41.490  60.391  76.788  1.00 35.90  ? 370  LEU J C   1 
ATOM   9515  O O   . LEU N  2 54  ? 41.355  61.062  77.817  1.00 35.90  ? 370  LEU J O   1 
ATOM   9516  C CB  . LEU N  2 54  ? 43.891  60.075  76.130  1.00 35.90  ? 370  LEU J CB  1 
ATOM   9517  C CG  . LEU N  2 54  ? 45.215  59.659  76.799  1.00 35.90  ? 370  LEU J CG  1 
ATOM   9518  C CD1 . LEU N  2 54  ? 46.354  60.477  76.231  1.00 35.90  ? 370  LEU J CD1 1 
ATOM   9519  C CD2 . LEU N  2 54  ? 45.149  59.871  78.309  1.00 35.90  ? 370  LEU J CD2 1 
ATOM   9520  N N   . THR N  2 55  ? 40.662  60.476  75.750  1.00 40.22  ? 371  THR J N   1 
ATOM   9521  C CA  . THR N  2 55  ? 39.521  61.407  75.765  1.00 40.22  ? 371  THR J CA  1 
ATOM   9522  C C   . THR N  2 55  ? 38.494  60.960  76.807  1.00 40.22  ? 371  THR J C   1 
ATOM   9523  O O   . THR N  2 55  ? 38.035  61.749  77.638  1.00 40.22  ? 371  THR J O   1 
ATOM   9524  C CB  . THR N  2 55  ? 38.791  61.485  74.392  1.00 40.22  ? 371  THR J CB  1 
ATOM   9525  O OG1 . THR N  2 55  ? 39.701  61.869  73.355  1.00 40.22  ? 371  THR J OG1 1 
ATOM   9526  C CG2 . THR N  2 55  ? 37.709  62.511  74.455  1.00 40.22  ? 371  THR J CG2 1 
ATOM   9527  N N   . GLU N  2 56  ? 38.141  59.682  76.741  1.00 52.26  ? 372  GLU J N   1 
ATOM   9528  C CA  . GLU N  2 56  ? 37.188  59.094  77.658  1.00 52.26  ? 372  GLU J CA  1 
ATOM   9529  C C   . GLU N  2 56  ? 37.680  59.272  79.079  1.00 52.26  ? 372  GLU J C   1 
ATOM   9530  O O   . GLU N  2 56  ? 36.891  59.494  79.992  1.00 52.26  ? 372  GLU J O   1 
ATOM   9531  C CB  . GLU N  2 56  ? 37.030  57.612  77.343  1.00 52.26  ? 372  GLU J CB  1 
ATOM   9532  C CG  . GLU N  2 56  ? 36.473  56.776  78.470  1.00 52.26  ? 372  GLU J CG  1 
ATOM   9533  C CD  . GLU N  2 56  ? 36.041  55.410  77.977  1.00 52.26  ? 372  GLU J CD  1 
ATOM   9534  O OE1 . GLU N  2 56  ? 35.157  55.367  77.086  1.00 52.26  ? 372  GLU J OE1 1 
ATOM   9535  O OE2 . GLU N  2 56  ? 36.589  54.387  78.464  1.00 52.26  ? 372  GLU J OE2 1 
ATOM   9536  N N   . VAL N  2 57  ? 38.990  59.171  79.272  1.00 38.57  ? 373  VAL J N   1 
ATOM   9537  C CA  . VAL N  2 57  ? 39.538  59.334  80.605  1.00 38.57  ? 373  VAL J CA  1 
ATOM   9538  C C   . VAL N  2 57  ? 39.216  60.748  81.022  1.00 38.57  ? 373  VAL J C   1 
ATOM   9539  O O   . VAL N  2 57  ? 38.870  60.996  82.181  1.00 38.57  ? 373  VAL J O   1 
ATOM   9540  C CB  . VAL N  2 57  ? 41.073  59.118  80.642  1.00 38.57  ? 373  VAL J CB  1 
ATOM   9541  C CG1 . VAL N  2 57  ? 41.607  59.384  82.062  1.00 38.57  ? 373  VAL J CG1 1 
ATOM   9542  C CG2 . VAL N  2 57  ? 41.405  57.703  80.205  1.00 38.57  ? 373  VAL J CG2 1 
ATOM   9543  N N   . ASN N  2 58  ? 39.325  61.675  80.072  1.00 36.26  ? 374  ASN J N   1 
ATOM   9544  C CA  . ASN N  2 58  ? 39.027  63.069  80.366  1.00 36.26  ? 374  ASN J CA  1 
ATOM   9545  C C   . ASN N  2 58  ? 37.586  63.109  80.813  1.00 36.26  ? 374  ASN J C   1 
ATOM   9546  O O   . ASN N  2 58  ? 37.229  63.820  81.747  1.00 36.26  ? 374  ASN J O   1 
ATOM   9547  C CB  . ASN N  2 58  ? 39.214  63.945  79.130  1.00 36.26  ? 374  ASN J CB  1 
ATOM   9548  C CG  . ASN N  2 58  ? 40.593  64.559  79.068  1.00 36.26  ? 374  ASN J CG  1 
ATOM   9549  O OD1 . ASN N  2 58  ? 41.371  64.426  80.010  1.00 36.26  ? 374  ASN J OD1 1 
ATOM   9550  N ND2 . ASN N  2 58  ? 40.910  65.226  77.958  1.00 36.26  ? 374  ASN J ND2 1 
ATOM   9551  N N   . TYR N  2 59  ? 36.759  62.317  80.154  1.00 43.11  ? 375  TYR J N   1 
ATOM   9552  C CA  . TYR N  2 59  ? 35.352  62.259  80.498  1.00 43.11  ? 375  TYR J CA  1 
ATOM   9553  C C   . TYR N  2 59  ? 35.123  61.744  81.914  1.00 43.11  ? 375  TYR J C   1 
ATOM   9554  O O   . TYR N  2 59  ? 34.749  62.509  82.792  1.00 43.11  ? 375  TYR J O   1 
ATOM   9555  C CB  . TYR N  2 59  ? 34.607  61.374  79.504  1.00 43.11  ? 375  TYR J CB  1 
ATOM   9556  C CG  . TYR N  2 59  ? 33.123  61.444  79.678  1.00 43.11  ? 375  TYR J CG  1 
ATOM   9557  C CD1 . TYR N  2 59  ? 32.522  62.593  80.181  1.00 43.11  ? 375  TYR J CD1 1 
ATOM   9558  C CD2 . TYR N  2 59  ? 32.311  60.375  79.327  1.00 43.11  ? 375  TYR J CD2 1 
ATOM   9559  C CE1 . TYR N  2 59  ? 31.155  62.683  80.327  1.00 43.11  ? 375  TYR J CE1 1 
ATOM   9560  C CE2 . TYR N  2 59  ? 30.926  60.450  79.468  1.00 43.11  ? 375  TYR J CE2 1 
ATOM   9561  C CZ  . TYR N  2 59  ? 30.359  61.613  79.969  1.00 43.11  ? 375  TYR J CZ  1 
ATOM   9562  O OH  . TYR N  2 59  ? 28.992  61.718  80.112  1.00 43.11  ? 375  TYR J OH  1 
ATOM   9563  N N   . GLU N  2 60  ? 35.362  60.450  82.119  1.00 62.58  ? 376  GLU J N   1 
ATOM   9564  C CA  . GLU N  2 60  ? 35.177  59.794  83.416  1.00 62.58  ? 376  GLU J CA  1 
ATOM   9565  C C   . GLU N  2 60  ? 35.665  60.613  84.600  1.00 62.58  ? 376  GLU J C   1 
ATOM   9566  O O   . GLU N  2 60  ? 34.967  60.762  85.602  1.00 62.58  ? 376  GLU J O   1 
ATOM   9567  C CB  . GLU N  2 60  ? 35.889  58.431  83.451  1.00 62.58  ? 376  GLU J CB  1 
ATOM   9568  C CG  . GLU N  2 60  ? 35.797  57.602  82.177  1.00 62.58  ? 376  GLU J CG  1 
ATOM   9569  C CD  . GLU N  2 60  ? 34.370  57.192  81.842  1.00 62.58  ? 376  GLU J CD  1 
ATOM   9570  O OE1 . GLU N  2 60  ? 33.569  57.012  82.794  1.00 62.58  ? 376  GLU J OE1 1 
ATOM   9571  O OE2 . GLU N  2 60  ? 34.051  57.052  80.631  1.00 62.58  ? 376  GLU J OE2 1 
ATOM   9572  N N   . VAL N  2 61  ? 36.877  61.133  84.495  1.00 43.61  ? 377  VAL J N   1 
ATOM   9573  C CA  . VAL N  2 61  ? 37.447  61.929  85.578  1.00 43.61  ? 377  VAL J CA  1 
ATOM   9574  C C   . VAL N  2 61  ? 36.674  63.234  85.799  1.00 43.61  ? 377  VAL J C   1 
ATOM   9575  O O   . VAL N  2 61  ? 36.655  63.780  86.904  1.00 43.61  ? 377  VAL J O   1 
ATOM   9576  C CB  . VAL N  2 61  ? 38.912  62.271  85.285  1.00 43.61  ? 377  VAL J CB  1 
ATOM   9577  C CG1 . VAL N  2 61  ? 39.565  62.836  86.511  1.00 43.61  ? 377  VAL J CG1 1 
ATOM   9578  C CG2 . VAL N  2 61  ? 39.640  61.035  84.825  1.00 43.61  ? 377  VAL J CG2 1 
ATOM   9579  N N   . SER N  2 62  ? 36.034  63.730  84.744  1.00 43.51  ? 378  SER J N   1 
ATOM   9580  C CA  . SER N  2 62  ? 35.269  64.964  84.832  1.00 43.51  ? 378  SER J CA  1 
ATOM   9581  C C   . SER N  2 62  ? 34.001  64.832  85.681  1.00 43.51  ? 378  SER J C   1 
ATOM   9582  O O   . SER N  2 62  ? 33.554  65.798  86.290  1.00 43.51  ? 378  SER J O   1 
ATOM   9583  C CB  . SER N  2 62  ? 34.916  65.435  83.422  1.00 43.51  ? 378  SER J CB  1 
ATOM   9584  O OG  . SER N  2 62  ? 36.094  65.789  82.715  1.00 43.51  ? 378  SER J OG  1 
ATOM   9585  N N   . ASN N  2 63  ? 33.430  63.635  85.744  1.00 45.53  ? 379  ASN J N   1 
ATOM   9586  C CA  . ASN N  2 63  ? 32.220  63.438  86.528  1.00 45.53  ? 379  ASN J CA  1 
ATOM   9587  C C   . ASN N  2 63  ? 32.478  63.110  87.988  1.00 45.53  ? 379  ASN J C   1 
ATOM   9588  O O   . ASN N  2 63  ? 31.539  63.027  88.783  1.00 45.53  ? 379  ASN J O   1 
ATOM   9589  C CB  . ASN N  2 63  ? 31.353  62.373  85.878  1.00 45.53  ? 379  ASN J CB  1 
ATOM   9590  C CG  . ASN N  2 63  ? 30.925  62.780  84.486  1.00 45.53  ? 379  ASN J CG  1 
ATOM   9591  O OD1 . ASN N  2 63  ? 30.803  63.974  84.193  1.00 45.53  ? 379  ASN J OD1 1 
ATOM   9592  N ND2 . ASN N  2 63  ? 30.710  61.800  83.612  1.00 45.53  ? 379  ASN J ND2 1 
ATOM   9593  N N   . LYS N  2 64  ? 33.751  62.930  88.338  1.00 62.63  ? 381  LYS J N   1 
ATOM   9594  C CA  . LYS N  2 64  ? 34.135  62.653  89.719  1.00 62.63  ? 381  LYS J CA  1 
ATOM   9595  C C   . LYS N  2 64  ? 33.920  63.942  90.489  1.00 62.63  ? 381  LYS J C   1 
ATOM   9596  O O   . LYS N  2 64  ? 33.988  65.018  89.902  1.00 62.63  ? 381  LYS J O   1 
ATOM   9597  C CB  . LYS N  2 64  ? 35.604  62.264  89.795  1.00 62.63  ? 381  LYS J CB  1 
ATOM   9598  C CG  . LYS N  2 64  ? 35.867  60.817  89.451  1.00 62.63  ? 381  LYS J CG  1 
ATOM   9599  C CD  . LYS N  2 64  ? 36.271  60.017  90.682  1.00 62.63  ? 381  LYS J CD  1 
ATOM   9600  C CE  . LYS N  2 64  ? 36.189  58.526  90.402  1.00 62.63  ? 381  LYS J CE  1 
ATOM   9601  N NZ  . LYS N  2 64  ? 36.181  58.242  88.930  1.00 62.63  ? 381  LYS J NZ  1 
ATOM   9602  N N   . ASP N  2 65  A 33.680  63.848  91.793  1.00 82.33  ? 381  ASP J N   1 
ATOM   9603  C CA  . ASP N  2 65  A 33.438  65.043  92.591  1.00 82.33  ? 381  ASP J CA  1 
ATOM   9604  C C   . ASP N  2 65  A 34.064  64.980  93.971  1.00 82.33  ? 381  ASP J C   1 
ATOM   9605  O O   . ASP N  2 65  A 33.831  64.036  94.716  1.00 82.33  ? 381  ASP J O   1 
ATOM   9606  C CB  . ASP N  2 65  A 31.925  65.270  92.739  1.00 82.33  ? 381  ASP J CB  1 
ATOM   9607  C CG  . ASP N  2 65  A 31.346  66.180  91.643  1.00 82.33  ? 381  ASP J CG  1 
ATOM   9608  O OD1 . ASP N  2 65  A 31.279  67.413  91.864  1.00 82.33  ? 381  ASP J OD1 1 
ATOM   9609  O OD2 . ASP N  2 65  A 30.951  65.667  90.566  1.00 82.33  ? 381  ASP J OD2 1 
ATOM   9610  N N   . ASP N  2 66  B 34.864  65.986  94.306  1.00 73.37  ? 381  ASP J N   1 
ATOM   9611  C CA  . ASP N  2 66  B 35.483  66.054  95.625  1.00 73.37  ? 381  ASP J CA  1 
ATOM   9612  C C   . ASP N  2 66  B 34.533  66.908  96.470  1.00 73.37  ? 381  ASP J C   1 
ATOM   9613  O O   . ASP N  2 66  B 34.880  68.015  96.898  1.00 73.37  ? 381  ASP J O   1 
ATOM   9614  C CB  . ASP N  2 66  B 36.873  66.700  95.538  1.00 73.37  ? 381  ASP J CB  1 
ATOM   9615  C CG  . ASP N  2 66  B 37.349  67.258  96.872  1.00 73.37  ? 381  ASP J CG  1 
ATOM   9616  O OD1 . ASP N  2 66  B 37.029  66.663  97.923  1.00 73.37  ? 381  ASP J OD1 1 
ATOM   9617  O OD2 . ASP N  2 66  B 38.044  68.295  96.872  1.00 73.37  ? 381  ASP J OD2 1 
ATOM   9618  N N   . LYS N  2 67  C 33.327  66.378  96.681  1.00 85.85  ? 381  LYS J N   1 
ATOM   9619  C CA  . LYS N  2 67  C 32.257  67.033  97.443  1.00 85.85  ? 381  LYS J CA  1 
ATOM   9620  C C   . LYS N  2 67  C 32.675  68.158  98.401  1.00 85.85  ? 381  LYS J C   1 
ATOM   9621  O O   . LYS N  2 67  C 32.167  69.272  98.300  1.00 85.85  ? 381  LYS J O   1 
ATOM   9622  C CB  . LYS N  2 67  C 31.453  65.974  98.217  1.00 85.85  ? 381  LYS J CB  1 
ATOM   9623  C CG  . LYS N  2 67  C 30.133  65.574  97.559  1.00 85.85  ? 381  LYS J CG  1 
ATOM   9624  C CD  . LYS N  2 67  C 30.356  64.718  96.322  1.00 85.85  ? 381  LYS J CD  1 
ATOM   9625  C CE  . LYS N  2 67  C 29.124  63.882  96.002  1.00 85.85  ? 381  LYS J CE  1 
ATOM   9626  N NZ  . LYS N  2 67  C 29.401  62.803  95.009  1.00 85.85  ? 381  LYS J NZ  1 
ATOM   9627  N N   . LYS N  2 68  D 33.597  67.877  99.317  1.00 73.77  ? 381  LYS J N   1 
ATOM   9628  C CA  . LYS N  2 68  D 34.050  68.874  100.293 1.00 73.77  ? 381  LYS J CA  1 
ATOM   9629  C C   . LYS N  2 68  D 34.344  70.280  99.744  1.00 73.77  ? 381  LYS J C   1 
ATOM   9630  O O   . LYS N  2 68  D 33.469  71.147  99.738  1.00 73.77  ? 381  LYS J O   1 
ATOM   9631  C CB  . LYS N  2 68  D 35.287  68.361  101.043 1.00 73.77  ? 381  LYS J CB  1 
ATOM   9632  C CG  . LYS N  2 68  D 35.744  69.295  102.165 1.00 73.77  ? 381  LYS J CG  1 
ATOM   9633  C CD  . LYS N  2 68  D 36.160  68.529  103.408 1.00 73.77  ? 381  LYS J CD  1 
ATOM   9634  C CE  . LYS N  2 68  D 34.997  68.370  104.372 1.00 73.77  ? 381  LYS J CE  1 
ATOM   9635  N NZ  . LYS N  2 68  D 34.491  69.679  104.852 1.00 73.77  ? 381  LYS J NZ  1 
ATOM   9636  N N   . ASN N  2 69  E 35.578  70.512  99.305  1.00 95.73  ? 381  ASN J N   1 
ATOM   9637  C CA  . ASN N  2 69  E 35.959  71.818  98.769  1.00 95.73  ? 381  ASN J CA  1 
ATOM   9638  C C   . ASN N  2 69  E 35.344  71.996  97.400  1.00 95.73  ? 381  ASN J C   1 
ATOM   9639  O O   . ASN N  2 69  E 35.928  72.642  96.532  1.00 95.73  ? 381  ASN J O   1 
ATOM   9640  C CB  . ASN N  2 69  E 37.482  71.941  98.642  1.00 95.73  ? 381  ASN J CB  1 
ATOM   9641  C CG  . ASN N  2 69  E 38.221  70.961  99.523  1.00 95.73  ? 381  ASN J CG  1 
ATOM   9642  O OD1 . ASN N  2 69  E 38.762  71.332  100.568 1.00 95.73  ? 381  ASN J OD1 1 
ATOM   9643  N ND2 . ASN N  2 69  E 38.249  69.698  99.108  1.00 95.73  ? 381  ASN J ND2 1 
ATOM   9644  N N   . MET N  2 70  ? 34.158  71.422  97.215  1.00 98.35  ? 382  MET J N   1 
ATOM   9645  C CA  . MET N  2 70  ? 33.455  71.492  95.941  1.00 98.35  ? 382  MET J CA  1 
ATOM   9646  C C   . MET N  2 70  ? 34.446  71.711  94.813  1.00 98.35  ? 382  MET J C   1 
ATOM   9647  O O   . MET N  2 70  ? 34.565  72.808  94.260  1.00 98.35  ? 382  MET J O   1 
ATOM   9648  C CB  . MET N  2 70  ? 32.411  72.609  95.948  1.00 98.35  ? 382  MET J CB  1 
ATOM   9649  C CG  . MET N  2 70  ? 31.129  72.209  95.233  1.00 98.35  ? 382  MET J CG  1 
ATOM   9650  S SD  . MET N  2 70  ? 30.675  70.452  95.503  1.00 98.35  ? 382  MET J SD  1 
ATOM   9651  C CE  . MET N  2 70  ? 31.442  69.600  94.084  1.00 98.35  ? 382  MET J CE  1 
ATOM   9652  N N   . GLY N  2 71  ? 35.179  70.649  94.504  1.00 80.14  ? 383  GLY J N   1 
ATOM   9653  C CA  . GLY N  2 71  ? 36.173  70.715  93.456  1.00 80.14  ? 383  GLY J CA  1 
ATOM   9654  C C   . GLY N  2 71  ? 36.087  69.545  92.496  1.00 80.14  ? 383  GLY J C   1 
ATOM   9655  O O   . GLY N  2 71  ? 35.393  68.553  92.751  1.00 80.14  ? 383  GLY J O   1 
ATOM   9656  N N   . LYS N  2 72  ? 36.793  69.685  91.378  1.00 60.27  ? 384  LYS J N   1 
ATOM   9657  C CA  . LYS N  2 72  ? 36.845  68.667  90.340  1.00 60.27  ? 384  LYS J CA  1 
ATOM   9658  C C   . LYS N  2 72  ? 38.304  68.480  89.946  1.00 60.27  ? 384  LYS J C   1 
ATOM   9659  O O   . LYS N  2 72  ? 39.220  68.985  90.622  1.00 60.27  ? 384  LYS J O   1 
ATOM   9660  C CB  . LYS N  2 72  ? 36.058  69.103  89.104  1.00 60.27  ? 384  LYS J CB  1 
ATOM   9661  C CG  . LYS N  2 72  ? 34.578  69.308  89.321  1.00 60.27  ? 384  LYS J CG  1 
ATOM   9662  C CD  . LYS N  2 72  ? 33.780  68.502  88.323  1.00 60.27  ? 384  LYS J CD  1 
ATOM   9663  C CE  . LYS N  2 72  ? 33.043  67.391  89.026  1.00 60.27  ? 384  LYS J CE  1 
ATOM   9664  N NZ  . LYS N  2 72  ? 31.837  66.948  88.294  1.00 60.27  ? 384  LYS J NZ  1 
ATOM   9665  N N   . GLN N  2 73  ? 38.510  67.761  88.842  1.00 53.54  ? 385  GLN J N   1 
ATOM   9666  C CA  . GLN N  2 73  ? 39.853  67.483  88.330  1.00 53.54  ? 385  GLN J CA  1 
ATOM   9667  C C   . GLN N  2 73  ? 39.800  67.280  86.820  1.00 53.54  ? 385  GLN J C   1 
ATOM   9668  O O   . GLN N  2 73  ? 39.086  66.395  86.342  1.00 53.54  ? 385  GLN J O   1 
ATOM   9669  C CB  . GLN N  2 73  ? 40.441  66.221  89.004  1.00 53.54  ? 385  GLN J CB  1 
ATOM   9670  C CG  . GLN N  2 73  ? 41.404  65.408  88.129  1.00 53.54  ? 385  GLN J CG  1 
ATOM   9671  C CD  . GLN N  2 73  ? 42.383  64.618  88.943  1.00 53.54  ? 385  GLN J CD  1 
ATOM   9672  O OE1 . GLN N  2 73  ? 42.337  64.644  90.166  1.00 53.54  ? 385  GLN J OE1 1 
ATOM   9673  N NE2 . GLN N  2 73  ? 43.277  63.904  88.272  1.00 53.54  ? 385  GLN J NE2 1 
ATOM   9674  N N   . MET N  2 74  ? 40.571  68.083  86.082  1.00 46.74  ? 386  MET J N   1 
ATOM   9675  C CA  . MET N  2 74  ? 40.596  67.995  84.629  1.00 46.74  ? 386  MET J CA  1 
ATOM   9676  C C   . MET N  2 74  ? 41.910  67.522  84.049  1.00 46.74  ? 386  MET J C   1 
ATOM   9677  O O   . MET N  2 74  ? 42.855  68.288  83.935  1.00 46.74  ? 386  MET J O   1 
ATOM   9678  C CB  . MET N  2 74  ? 40.268  69.347  84.020  1.00 46.74  ? 386  MET J CB  1 
ATOM   9679  C CG  . MET N  2 74  ? 40.195  69.293  82.512  1.00 46.74  ? 386  MET J CG  1 
ATOM   9680  S SD  . MET N  2 74  ? 38.689  68.435  81.978  1.00 46.74  ? 386  MET J SD  1 
ATOM   9681  C CE  . MET N  2 74  ? 39.359  67.035  81.013  1.00 46.74  ? 386  MET J CE  1 
ATOM   9682  N N   . PRO N  2 75  ? 41.996  66.246  83.685  1.00 33.16  ? 387  PRO J N   1 
ATOM   9683  C CA  . PRO N  2 75  ? 43.248  65.748  83.108  1.00 33.16  ? 387  PRO J CA  1 
ATOM   9684  C C   . PRO N  2 75  ? 43.523  66.543  81.828  1.00 33.16  ? 387  PRO J C   1 
ATOM   9685  O O   . PRO N  2 75  ? 42.626  67.225  81.326  1.00 33.16  ? 387  PRO J O   1 
ATOM   9686  C CB  . PRO N  2 75  ? 42.950  64.278  82.822  1.00 33.16  ? 387  PRO J CB  1 
ATOM   9687  C CG  . PRO N  2 75  ? 41.777  63.943  83.712  1.00 33.16  ? 387  PRO J CG  1 
ATOM   9688  C CD  . PRO N  2 75  ? 40.978  65.198  83.812  1.00 33.16  ? 387  PRO J CD  1 
ATOM   9689  N N   . GLN N  2 76  ? 44.740  66.447  81.294  1.00 55.97  ? 388  GLN J N   1 
ATOM   9690  C CA  . GLN N  2 76  ? 45.071  67.184  80.086  1.00 55.97  ? 388  GLN J CA  1 
ATOM   9691  C C   . GLN N  2 76  ? 46.238  66.679  79.227  1.00 55.97  ? 388  GLN J C   1 
ATOM   9692  O O   . GLN N  2 76  ? 47.394  67.069  79.408  1.00 55.97  ? 388  GLN J O   1 
ATOM   9693  C CB  . GLN N  2 76  ? 45.316  68.636  80.454  1.00 55.97  ? 388  GLN J CB  1 
ATOM   9694  C CG  . GLN N  2 76  ? 45.748  69.475  79.276  1.00 55.97  ? 388  GLN J CG  1 
ATOM   9695  C CD  . GLN N  2 76  ? 46.312  70.803  79.702  1.00 55.97  ? 388  GLN J CD  1 
ATOM   9696  O OE1 . GLN N  2 76  ? 45.990  71.315  80.776  1.00 55.97  ? 388  GLN J OE1 1 
ATOM   9697  N NE2 . GLN N  2 76  ? 47.161  71.373  78.866  1.00 55.97  ? 388  GLN J NE2 1 
ATOM   9698  N N   . PRO N  2 77  ? 45.941  65.831  78.245  1.00 37.01  ? 389  PRO J N   1 
ATOM   9699  C CA  . PRO N  2 77  ? 46.965  65.282  77.356  1.00 37.01  ? 389  PRO J CA  1 
ATOM   9700  C C   . PRO N  2 77  ? 47.548  66.321  76.429  1.00 37.01  ? 389  PRO J C   1 
ATOM   9701  O O   . PRO N  2 77  ? 46.907  67.303  76.104  1.00 37.01  ? 389  PRO J O   1 
ATOM   9702  C CB  . PRO N  2 77  ? 46.225  64.211  76.563  1.00 37.01  ? 389  PRO J CB  1 
ATOM   9703  C CG  . PRO N  2 77  ? 44.910  64.039  77.245  1.00 37.01  ? 389  PRO J CG  1 
ATOM   9704  C CD  . PRO N  2 77  ? 44.604  65.330  77.911  1.00 37.01  ? 389  PRO J CD  1 
ATOM   9705  N N   . THR N  2 78  ? 48.774  66.096  75.996  1.00 38.66  ? 390  THR J N   1 
ATOM   9706  C CA  . THR N  2 78  ? 49.440  66.997  75.071  1.00 38.66  ? 390  THR J CA  1 
ATOM   9707  C C   . THR N  2 78  ? 50.151  66.009  74.199  1.00 38.66  ? 390  THR J C   1 
ATOM   9708  O O   . THR N  2 78  ? 50.758  65.077  74.717  1.00 38.66  ? 390  THR J O   1 
ATOM   9709  C CB  . THR N  2 78  ? 50.458  67.859  75.783  1.00 38.66  ? 390  THR J CB  1 
ATOM   9710  O OG1 . THR N  2 78  ? 49.837  68.450  76.928  1.00 38.66  ? 390  THR J OG1 1 
ATOM   9711  C CG2 . THR N  2 78  ? 50.972  68.947  74.867  1.00 38.66  ? 390  THR J CG2 1 
ATOM   9712  N N   . PHE N  2 79  ? 50.095  66.183  72.887  1.00 36.97  ? 392  PHE J N   1 
ATOM   9713  C CA  . PHE N  2 79  ? 50.738  65.193  72.049  1.00 36.97  ? 392  PHE J CA  1 
ATOM   9714  C C   . PHE N  2 79  ? 51.447  65.656  70.801  1.00 36.97  ? 392  PHE J C   1 
ATOM   9715  O O   . PHE N  2 79  ? 51.087  66.653  70.192  1.00 36.97  ? 392  PHE J O   1 
ATOM   9716  C CB  . PHE N  2 79  ? 49.720  64.133  71.670  1.00 36.97  ? 392  PHE J CB  1 
ATOM   9717  C CG  . PHE N  2 79  ? 48.707  64.600  70.665  1.00 36.97  ? 392  PHE J CG  1 
ATOM   9718  C CD1 . PHE N  2 79  ? 48.969  64.517  69.295  1.00 36.97  ? 392  PHE J CD1 1 
ATOM   9719  C CD2 . PHE N  2 79  ? 47.464  65.079  71.089  1.00 36.97  ? 392  PHE J CD2 1 
ATOM   9720  C CE1 . PHE N  2 79  ? 48.012  64.895  68.371  1.00 36.97  ? 392  PHE J CE1 1 
ATOM   9721  C CE2 . PHE N  2 79  ? 46.486  65.466  70.167  1.00 36.97  ? 392  PHE J CE2 1 
ATOM   9722  C CZ  . PHE N  2 79  ? 46.758  65.372  68.809  1.00 36.97  ? 392  PHE J CZ  1 
ATOM   9723  N N   . THR N  2 80  ? 52.449  64.880  70.414  1.00 31.76  ? 393  THR J N   1 
ATOM   9724  C CA  . THR N  2 80  ? 53.246  65.160  69.242  1.00 31.76  ? 393  THR J CA  1 
ATOM   9725  C C   . THR N  2 80  ? 53.184  63.967  68.274  1.00 31.76  ? 393  THR J C   1 
ATOM   9726  O O   . THR N  2 80  ? 53.835  63.964  67.225  1.00 31.76  ? 393  THR J O   1 
ATOM   9727  C CB  . THR N  2 80  ? 54.699  65.436  69.671  1.00 31.76  ? 393  THR J CB  1 
ATOM   9728  O OG1 . THR N  2 80  ? 54.739  66.666  70.389  1.00 31.76  ? 393  THR J OG1 1 
ATOM   9729  C CG2 . THR N  2 80  ? 55.620  65.563  68.474  1.00 31.76  ? 393  THR J CG2 1 
ATOM   9730  N N   . LEU N  2 81  ? 52.396  62.953  68.621  1.00 35.91  ? 394  LEU J N   1 
ATOM   9731  C CA  . LEU N  2 81  ? 52.266  61.776  67.767  1.00 35.91  ? 394  LEU J CA  1 
ATOM   9732  C C   . LEU N  2 81  ? 52.062  62.176  66.327  1.00 35.91  ? 394  LEU J C   1 
ATOM   9733  O O   . LEU N  2 81  ? 51.530  63.245  66.064  1.00 35.91  ? 394  LEU J O   1 
ATOM   9734  C CB  . LEU N  2 81  ? 51.083  60.929  68.197  1.00 35.91  ? 394  LEU J CB  1 
ATOM   9735  C CG  . LEU N  2 81  ? 51.161  60.453  69.635  1.00 35.91  ? 394  LEU J CG  1 
ATOM   9736  C CD1 . LEU N  2 81  ? 50.014  59.497  69.889  1.00 35.91  ? 394  LEU J CD1 1 
ATOM   9737  C CD2 . LEU N  2 81  ? 52.511  59.781  69.892  1.00 35.91  ? 394  LEU J CD2 1 
ATOM   9738  N N   . ARG N  2 82  ? 52.478  61.311  65.405  1.00 56.76  ? 395  ARG J N   1 
ATOM   9739  C CA  . ARG N  2 82  ? 52.338  61.550  63.974  1.00 56.76  ? 395  ARG J CA  1 
ATOM   9740  C C   . ARG N  2 82  ? 51.568  60.420  63.314  1.00 56.76  ? 395  ARG J C   1 
ATOM   9741  O O   . ARG N  2 82  ? 51.315  60.444  62.108  1.00 56.76  ? 395  ARG J O   1 
ATOM   9742  C CB  . ARG N  2 82  ? 53.704  61.644  63.331  1.00 56.76  ? 395  ARG J CB  1 
ATOM   9743  C CG  . ARG N  2 82  ? 54.487  62.837  63.773  1.00 56.76  ? 395  ARG J CG  1 
ATOM   9744  C CD  . ARG N  2 82  ? 55.869  62.735  63.223  1.00 56.76  ? 395  ARG J CD  1 
ATOM   9745  N NE  . ARG N  2 82  ? 56.313  61.351  63.242  1.00 56.76  ? 395  ARG J NE  1 
ATOM   9746  C CZ  . ARG N  2 82  ? 56.540  60.637  62.152  1.00 56.76  ? 395  ARG J CZ  1 
ATOM   9747  N NH1 . ARG N  2 82  ? 56.364  61.186  60.943  1.00 56.76  ? 395  ARG J NH1 1 
ATOM   9748  N NH2 . ARG N  2 82  ? 56.942  59.376  62.274  1.00 56.76  ? 395  ARG J NH2 1 
ATOM   9749  N N   . LYS N  2 83  ? 51.205  59.430  64.125  1.00 42.39  ? 396  LYS J N   1 
ATOM   9750  C CA  . LYS N  2 83  ? 50.473  58.260  63.664  1.00 42.39  ? 396  LYS J CA  1 
ATOM   9751  C C   . LYS N  2 83  ? 49.520  57.855  64.762  1.00 42.39  ? 396  LYS J C   1 
ATOM   9752  O O   . LYS N  2 83  ? 49.744  58.189  65.920  1.00 42.39  ? 396  LYS J O   1 
ATOM   9753  C CB  . LYS N  2 83  ? 51.433  57.099  63.419  1.00 42.39  ? 396  LYS J CB  1 
ATOM   9754  C CG  . LYS N  2 83  ? 52.231  57.178  62.138  1.00 42.39  ? 396  LYS J CG  1 
ATOM   9755  C CD  . LYS N  2 83  ? 53.079  55.931  61.985  1.00 42.39  ? 396  LYS J CD  1 
ATOM   9756  C CE  . LYS N  2 83  ? 54.507  56.287  61.639  1.00 42.39  ? 396  LYS J CE  1 
ATOM   9757  N NZ  . LYS N  2 83  ? 54.959  55.402  60.537  1.00 42.39  ? 396  LYS J NZ  1 
ATOM   9758  N N   . LYS N  2 84  ? 48.468  57.126  64.411  1.00 48.90  ? 397  LYS J N   1 
ATOM   9759  C CA  . LYS N  2 84  ? 47.531  56.692  65.432  1.00 48.90  ? 397  LYS J CA  1 
ATOM   9760  C C   . LYS N  2 84  ? 48.296  55.753  66.334  1.00 48.90  ? 397  LYS J C   1 
ATOM   9761  O O   . LYS N  2 84  ? 49.137  54.986  65.863  1.00 48.90  ? 397  LYS J O   1 
ATOM   9762  C CB  . LYS N  2 84  ? 46.333  55.975  64.807  1.00 48.90  ? 397  LYS J CB  1 
ATOM   9763  C CG  . LYS N  2 84  ? 45.039  56.780  64.901  1.00 48.90  ? 397  LYS J CG  1 
ATOM   9764  C CD  . LYS N  2 84  ? 43.807  55.880  64.885  1.00 48.90  ? 397  LYS J CD  1 
ATOM   9765  C CE  . LYS N  2 84  ? 42.548  56.675  64.515  1.00 48.90  ? 397  LYS J CE  1 
ATOM   9766  N NZ  . LYS N  2 84  ? 42.741  58.133  64.790  1.00 48.90  ? 397  LYS J NZ  1 
ATOM   9767  N N   . LEU N  2 85  ? 48.029  55.820  67.631  1.00 37.64  ? 398  LEU J N   1 
ATOM   9768  C CA  . LEU N  2 85  ? 48.739  54.943  68.546  1.00 37.64  ? 398  LEU J CA  1 
ATOM   9769  C C   . LEU N  2 85  ? 47.811  53.957  69.221  1.00 37.64  ? 398  LEU J C   1 
ATOM   9770  O O   . LEU N  2 85  ? 47.078  54.321  70.149  1.00 37.64  ? 398  LEU J O   1 
ATOM   9771  C CB  . LEU N  2 85  ? 49.483  55.738  69.612  1.00 37.64  ? 398  LEU J CB  1 
ATOM   9772  C CG  . LEU N  2 85  ? 50.133  54.849  70.680  1.00 37.64  ? 398  LEU J CG  1 
ATOM   9773  C CD1 . LEU N  2 85  ? 51.497  54.408  70.204  1.00 37.64  ? 398  LEU J CD1 1 
ATOM   9774  C CD2 . LEU N  2 85  ? 50.250  55.606  72.000  1.00 37.64  ? 398  LEU J CD2 1 
ATOM   9775  N N   . VAL N  2 86  ? 47.858  52.710  68.748  1.00 46.19  ? 399  VAL J N   1 
ATOM   9776  C CA  . VAL N  2 86  ? 47.029  51.641  69.289  1.00 46.19  ? 399  VAL J CA  1 
ATOM   9777  C C   . VAL N  2 86  ? 47.940  50.547  69.852  1.00 46.19  ? 399  VAL J C   1 
ATOM   9778  O O   . VAL N  2 86  ? 49.098  50.414  69.429  1.00 46.19  ? 399  VAL J O   1 
ATOM   9779  C CB  . VAL N  2 86  ? 46.097  51.069  68.191  1.00 46.19  ? 399  VAL J CB  1 
ATOM   9780  C CG1 . VAL N  2 86  ? 46.917  50.661  66.998  1.00 46.19  ? 399  VAL J CG1 1 
ATOM   9781  C CG2 . VAL N  2 86  ? 45.279  49.907  68.725  1.00 46.19  ? 399  VAL J CG2 1 
ATOM   9782  N N   . PHE N  2 87  ? 47.409  49.794  70.818  1.00 46.40  ? 400  PHE J N   1 
ATOM   9783  C CA  . PHE N  2 87  ? 48.114  48.705  71.493  1.00 46.40  ? 400  PHE J CA  1 
ATOM   9784  C C   . PHE N  2 87  ? 47.398  47.367  71.278  1.00 46.40  ? 400  PHE J C   1 
ATOM   9785  O O   . PHE N  2 87  ? 46.499  47.002  72.049  1.00 46.40  ? 400  PHE J O   1 
ATOM   9786  C CB  . PHE N  2 87  ? 48.160  48.975  72.995  1.00 46.40  ? 400  PHE J CB  1 
ATOM   9787  C CG  . PHE N  2 87  ? 48.940  50.176  73.368  1.00 46.40  ? 400  PHE J CG  1 
ATOM   9788  C CD1 . PHE N  2 87  ? 48.491  51.018  74.369  1.00 46.40  ? 400  PHE J CD1 1 
ATOM   9789  C CD2 . PHE N  2 87  ? 50.145  50.450  72.748  1.00 46.40  ? 400  PHE J CD2 1 
ATOM   9790  C CE1 . PHE N  2 87  ? 49.239  52.114  74.749  1.00 46.40  ? 400  PHE J CE1 1 
ATOM   9791  C CE2 . PHE N  2 87  ? 50.901  51.541  73.117  1.00 46.40  ? 400  PHE J CE2 1 
ATOM   9792  C CZ  . PHE N  2 87  ? 50.451  52.378  74.121  1.00 46.40  ? 400  PHE J CZ  1 
ATOM   9793  N N   . PRO N  2 88  ? 47.779  46.609  70.239  1.00 48.20  ? 401  PRO J N   1 
ATOM   9794  C CA  . PRO N  2 88  ? 47.102  45.323  70.022  1.00 48.20  ? 401  PRO J CA  1 
ATOM   9795  C C   . PRO N  2 88  ? 47.319  44.361  71.189  1.00 48.20  ? 401  PRO J C   1 
ATOM   9796  O O   . PRO N  2 88  ? 48.426  44.405  71.771  1.00 48.20  ? 401  PRO J O   1 
ATOM   9797  C CB  . PRO N  2 88  ? 47.717  44.803  68.725  1.00 48.20  ? 401  PRO J CB  1 
ATOM   9798  C CG  . PRO N  2 88  ? 48.337  46.008  68.080  1.00 48.20  ? 401  PRO J CG  1 
ATOM   9799  C CD  . PRO N  2 88  ? 48.802  46.871  69.218  1.00 48.20  ? 401  PRO J CD  1 
ATOM   9800  O OXT . PRO N  2 88  ? 46.387  43.586  71.513  1.00 48.20  ? 401  PRO J OXT 1 
HETATM 9801  C C1  . PHQ O  3 1   ? 40.548  62.615  98.611  1.00 75.08  ? 4500 PHQ X C1  1 
HETATM 9802  O O1  . PHQ O  3 1   ? 40.078  63.709  98.978  1.00 45.13  ? 4500 PHQ X O1  1 
HETATM 9803  O O2  . PHQ O  3 1   ? 39.702  61.615  98.114  0.00 45.13  ? 4500 PHQ X O2  1 
HETATM 9804  C C2  . PHQ O  3 1   ? 38.296  61.936  98.075  0.00 45.13  ? 4500 PHQ X C2  1 
HETATM 9805  C C3  . PHQ O  3 1   ? 37.487  60.806  97.478  0.00 45.13  ? 4500 PHQ X C3  1 
HETATM 9806  C C4  . PHQ O  3 1   ? 37.668  59.445  97.883  0.00 45.13  ? 4500 PHQ X C4  1 
HETATM 9807  C C5  . PHQ O  3 1   ? 36.881  58.405  97.289  0.00 45.13  ? 4500 PHQ X C5  1 
HETATM 9808  C C6  . PHQ O  3 1   ? 35.909  58.719  96.289  0.00 45.13  ? 4500 PHQ X C6  1 
HETATM 9809  C C7  . PHQ O  3 1   ? 35.722  60.075  95.880  0.00 45.13  ? 4500 PHQ X C7  1 
HETATM 9810  C C8  . PHQ O  3 1   ? 36.508  61.109  96.474  0.00 45.13  ? 4500 PHQ X C8  1 
ATOM   9811  N N   . GLU O  3 2   ? 41.819  62.214  98.588  1.00 81.87  ? 4501 GLU X N   1 
ATOM   9812  C CA  . GLU O  3 2   ? 42.948  63.082  99.018  1.00 64.15  ? 4501 GLU X CA  1 
ATOM   9813  C C   . GLU O  3 2   ? 43.626  63.651  97.729  1.00 67.59  ? 4501 GLU X C   1 
ATOM   9814  O O   . GLU O  3 2   ? 43.234  63.301  96.594  1.00 64.78  ? 4501 GLU X O   1 
ATOM   9815  C CB  . GLU O  3 2   ? 44.030  62.306  99.808  1.00 53.00  ? 4501 GLU X CB  1 
ATOM   9816  C CG  . GLU O  3 2   ? 43.601  61.653  101.135 1.00 68.44  ? 4501 GLU X CG  1 
ATOM   9817  C CD  . GLU O  3 2   ? 44.819  61.160  101.964 1.00 71.25  ? 4501 GLU X CD  1 
ATOM   9818  O OE1 . GLU O  3 2   ? 45.985  61.250  101.659 1.00 78.48  ? 4501 GLU X OE1 1 
ATOM   9819  O OE2 . GLU O  3 2   ? 44.413  60.600  103.102 1.00 80.55  ? 4501 GLU X OE2 1 
ATOM   9820  N N   . VAL O  3 3   ? 44.662  64.510  97.910  1.00 54.10  ? 4502 VAL X N   1 
ATOM   9821  C CA  . VAL O  3 3   ? 45.222  65.387  96.857  1.00 61.32  ? 4502 VAL X CA  1 
ATOM   9822  C C   . VAL O  3 3   ? 46.745  65.104  96.837  1.00 76.16  ? 4502 VAL X C   1 
ATOM   9823  O O   . VAL O  3 3   ? 47.338  64.706  97.868  1.00 71.53  ? 4502 VAL X O   1 
ATOM   9824  C CB  . VAL O  3 3   ? 44.914  66.904  97.117  1.00 47.89  ? 4502 VAL X CB  1 
ATOM   9825  C CG1 . VAL O  3 3   ? 43.406  67.187  97.090  1.00 61.38  ? 4502 VAL X CG1 1 
ATOM   9826  C CG2 . VAL O  3 3   ? 45.438  67.414  98.478  1.00 53.89  ? 4502 VAL X CG2 1 
ATOM   9827  N N   . ASP O  3 4   ? 47.369  65.321  95.647  1.00 60.41  ? 4503 ASP X N   1 
ATOM   9828  C CA  . ASP O  3 4   ? 48.803  65.118  95.382  1.00 60.18  ? 4503 ASP X CA  1 
ATOM   9829  C C   . ASP O  3 4   ? 49.570  66.493  95.166  1.00 74.05  ? 4503 ASP X C   1 
ATOM   9830  O O   . ASP O  3 4   ? 50.750  66.574  94.864  1.00 45.13  ? 4503 ASP X O   1 
ATOM   9831  C CB  . ASP O  3 4   ? 48.966  64.217  94.130  1.00 60.99  ? 4503 ASP X CB  1 
ATOM   9832  C CG  . ASP O  3 4   ? 48.667  62.718  94.350  1.00 65.71  ? 4503 ASP X CG  1 
ATOM   9833  O OD1 . ASP O  3 4   ? 48.921  62.076  95.345  1.00 68.90  ? 4503 ASP X OD1 1 
ATOM   9834  O OD2 . ASP O  3 4   ? 48.081  62.197  93.263  1.00 74.85  ? 4503 ASP X OD2 1 
HETATM 9835  C C1  . 0QE O  3 5   ? 48.764  67.567  95.352  1.00 45.01  ? 4504 0QE X C1  1 
ATOM   9836  N N   . LEU P  1 1   ? 30.952  54.194  69.031  1.00 91.20  ? 149  LEU K N   1 
ATOM   9837  C CA  . LEU P  1 1   ? 29.809  54.672  69.861  1.00 91.20  ? 149  LEU K CA  1 
ATOM   9838  C C   . LEU P  1 1   ? 30.280  55.413  71.107  1.00 91.20  ? 149  LEU K C   1 
ATOM   9839  O O   . LEU P  1 1   ? 29.644  55.362  72.164  1.00 91.20  ? 149  LEU K O   1 
ATOM   9840  C CB  . LEU P  1 1   ? 28.923  53.496  70.268  1.00 91.20  ? 149  LEU K CB  1 
ATOM   9841  C CG  . LEU P  1 1   ? 27.450  53.847  70.474  1.00 91.20  ? 149  LEU K CG  1 
ATOM   9842  C CD1 . LEU P  1 1   ? 26.945  54.703  69.316  1.00 91.20  ? 149  LEU K CD1 1 
ATOM   9843  C CD2 . LEU P  1 1   ? 26.651  52.562  70.592  1.00 91.20  ? 149  LEU K CD2 1 
ATOM   9844  N N   . ASP P  1 2   ? 31.416  56.086  70.979  1.00 100.00 ? 150  ASP K N   1 
ATOM   9845  C CA  . ASP P  1 2   ? 31.947  56.861  72.082  1.00 100.00 ? 150  ASP K CA  1 
ATOM   9846  C C   . ASP P  1 2   ? 31.156  58.154  72.031  1.00 100.00 ? 150  ASP K C   1 
ATOM   9847  O O   . ASP P  1 2   ? 30.637  58.524  70.980  1.00 100.00 ? 150  ASP K O   1 
ATOM   9848  C CB  . ASP P  1 2   ? 33.440  57.157  71.875  1.00 100.00 ? 150  ASP K CB  1 
ATOM   9849  C CG  . ASP P  1 2   ? 34.159  56.052  71.118  1.00 100.00 ? 150  ASP K CG  1 
ATOM   9850  O OD1 . ASP P  1 2   ? 34.279  54.934  71.664  1.00 100.00 ? 150  ASP K OD1 1 
ATOM   9851  O OD2 . ASP P  1 2   ? 34.606  56.305  69.979  1.00 100.00 ? 150  ASP K OD2 1 
ATOM   9852  N N   . LYS P  1 3   ? 31.046  58.833  73.164  1.00 57.04  ? 151  LYS K N   1 
ATOM   9853  C CA  . LYS P  1 3   ? 30.327  60.091  73.208  1.00 57.04  ? 151  LYS K CA  1 
ATOM   9854  C C   . LYS P  1 3   ? 30.927  61.015  72.153  1.00 57.04  ? 151  LYS K C   1 
ATOM   9855  O O   . LYS P  1 3   ? 32.111  60.927  71.847  1.00 57.04  ? 151  LYS K O   1 
ATOM   9856  C CB  . LYS P  1 3   ? 30.467  60.713  74.594  1.00 57.04  ? 151  LYS K CB  1 
ATOM   9857  C CG  . LYS P  1 3   ? 30.001  59.807  75.735  1.00 57.04  ? 151  LYS K CG  1 
ATOM   9858  C CD  . LYS P  1 3   ? 28.489  59.843  75.861  1.00 57.04  ? 151  LYS K CD  1 
ATOM   9859  C CE  . LYS P  1 3   ? 27.983  58.770  76.809  1.00 57.04  ? 151  LYS K CE  1 
ATOM   9860  N NZ  . LYS P  1 3   ? 26.503  58.565  76.660  1.00 57.04  ? 151  LYS K NZ  1 
ATOM   9861  N N   . VAL P  1 4   ? 30.106  61.887  71.584  1.00 39.13  ? 152  VAL K N   1 
ATOM   9862  C CA  . VAL P  1 4   ? 30.563  62.825  70.564  1.00 39.13  ? 152  VAL K CA  1 
ATOM   9863  C C   . VAL P  1 4   ? 29.996  64.219  70.829  1.00 39.13  ? 152  VAL K C   1 
ATOM   9864  O O   . VAL P  1 4   ? 28.864  64.368  71.301  1.00 39.13  ? 152  VAL K O   1 
ATOM   9865  C CB  . VAL P  1 4   ? 30.117  62.381  69.161  1.00 39.13  ? 152  VAL K CB  1 
ATOM   9866  C CG1 . VAL P  1 4   ? 30.586  63.381  68.120  1.00 39.13  ? 152  VAL K CG1 1 
ATOM   9867  C CG2 . VAL P  1 4   ? 30.663  61.014  68.868  1.00 39.13  ? 152  VAL K CG2 1 
ATOM   9868  N N   . TYR P  1 5   ? 30.785  65.246  70.545  1.00 40.68  ? 153  TYR K N   1 
ATOM   9869  C CA  . TYR P  1 5   ? 30.318  66.606  70.740  1.00 40.68  ? 153  TYR K CA  1 
ATOM   9870  C C   . TYR P  1 5   ? 29.281  66.896  69.661  1.00 40.68  ? 153  TYR K C   1 
ATOM   9871  O O   . TYR P  1 5   ? 29.506  66.607  68.476  1.00 40.68  ? 153  TYR K O   1 
ATOM   9872  C CB  . TYR P  1 5   ? 31.477  67.588  70.612  1.00 40.68  ? 153  TYR K CB  1 
ATOM   9873  C CG  . TYR P  1 5   ? 32.266  67.761  71.879  1.00 40.68  ? 153  TYR K CG  1 
ATOM   9874  C CD1 . TYR P  1 5   ? 33.645  67.617  71.878  1.00 40.68  ? 153  TYR K CD1 1 
ATOM   9875  C CD2 . TYR P  1 5   ? 31.640  68.080  73.078  1.00 40.68  ? 153  TYR K CD2 1 
ATOM   9876  C CE1 . TYR P  1 5   ? 34.393  67.793  73.046  1.00 40.68  ? 153  TYR K CE1 1 
ATOM   9877  C CE2 . TYR P  1 5   ? 32.375  68.258  74.251  1.00 40.68  ? 153  TYR K CE2 1 
ATOM   9878  C CZ  . TYR P  1 5   ? 33.752  68.116  74.224  1.00 40.68  ? 153  TYR K CZ  1 
ATOM   9879  O OH  . TYR P  1 5   ? 34.515  68.332  75.347  1.00 40.68  ? 153  TYR K OH  1 
ATOM   9880  N N   . GLN P  1 6   ? 28.157  67.470  70.092  1.00 51.84  ? 154  GLN K N   1 
ATOM   9881  C CA  . GLN P  1 6   ? 27.043  67.826  69.220  1.00 51.84  ? 154  GLN K CA  1 
ATOM   9882  C C   . GLN P  1 6   ? 27.363  68.993  68.291  1.00 51.84  ? 154  GLN K C   1 
ATOM   9883  O O   . GLN P  1 6   ? 27.845  70.031  68.731  1.00 51.84  ? 154  GLN K O   1 
ATOM   9884  C CB  . GLN P  1 6   ? 25.836  68.176  70.074  1.00 51.84  ? 154  GLN K CB  1 
ATOM   9885  C CG  . GLN P  1 6   ? 24.605  68.523  69.274  1.00 51.84  ? 154  GLN K CG  1 
ATOM   9886  C CD  . GLN P  1 6   ? 23.365  68.577  70.141  1.00 51.84  ? 154  GLN K CD  1 
ATOM   9887  O OE1 . GLN P  1 6   ? 23.180  69.512  70.923  1.00 51.84  ? 154  GLN K OE1 1 
ATOM   9888  N NE2 . GLN P  1 6   ? 22.507  67.570  70.010  1.00 51.84  ? 154  GLN K NE2 1 
ATOM   9889  N N   . MET P  1 7   ? 27.079  68.809  67.007  1.00 44.17  ? 155  MET K N   1 
ATOM   9890  C CA  . MET P  1 7   ? 27.336  69.820  65.996  1.00 44.17  ? 155  MET K CA  1 
ATOM   9891  C C   . MET P  1 7   ? 26.230  69.826  64.945  1.00 44.17  ? 155  MET K C   1 
ATOM   9892  O O   . MET P  1 7   ? 26.381  69.227  63.873  1.00 44.17  ? 155  MET K O   1 
ATOM   9893  C CB  . MET P  1 7   ? 28.671  69.532  65.314  1.00 44.17  ? 155  MET K CB  1 
ATOM   9894  C CG  . MET P  1 7   ? 29.849  69.607  66.250  1.00 44.17  ? 155  MET K CG  1 
ATOM   9895  S SD  . MET P  1 7   ? 30.358  71.316  66.582  1.00 44.17  ? 155  MET K SD  1 
ATOM   9896  C CE  . MET P  1 7   ? 30.733  71.821  64.937  1.00 44.17  ? 155  MET K CE  1 
ATOM   9897  N N   . LYS P  1 8   ? 25.127  70.507  65.237  1.00 63.94  ? 156  LYS K N   1 
ATOM   9898  C CA  . LYS P  1 8   ? 24.019  70.557  64.300  1.00 63.94  ? 156  LYS K CA  1 
ATOM   9899  C C   . LYS P  1 8   ? 23.533  71.970  64.046  1.00 63.94  ? 156  LYS K C   1 
ATOM   9900  O O   . LYS P  1 8   ? 23.095  72.279  62.942  1.00 63.94  ? 156  LYS K O   1 
ATOM   9901  C CB  . LYS P  1 8   ? 22.862  69.722  64.822  1.00 63.94  ? 156  LYS K CB  1 
ATOM   9902  C CG  . LYS P  1 8   ? 22.605  69.925  66.289  1.00 63.94  ? 156  LYS K CG  1 
ATOM   9903  C CD  . LYS P  1 8   ? 21.585  68.919  66.789  1.00 63.94  ? 156  LYS K CD  1 
ATOM   9904  C CE  . LYS P  1 8   ? 20.431  69.620  67.505  1.00 63.94  ? 156  LYS K CE  1 
ATOM   9905  N NZ  . LYS P  1 8   ? 19.628  68.664  68.322  1.00 63.94  ? 156  LYS K NZ  1 
ATOM   9906  N N   . SER P  1 9   ? 23.612  72.816  65.071  1.00 68.33  ? 157  SER K N   1 
ATOM   9907  C CA  . SER P  1 9   ? 23.178  74.213  64.991  1.00 68.33  ? 157  SER K CA  1 
ATOM   9908  C C   . SER P  1 9   ? 23.375  74.838  63.609  1.00 68.33  ? 157  SER K C   1 
ATOM   9909  O O   . SER P  1 9   ? 24.432  74.662  63.005  1.00 68.33  ? 157  SER K O   1 
ATOM   9910  C CB  . SER P  1 9   ? 23.940  75.043  66.016  1.00 68.33  ? 157  SER K CB  1 
ATOM   9911  O OG  . SER P  1 9   ? 25.033  75.694  65.395  1.00 68.33  ? 157  SER K OG  1 
ATOM   9912  N N   . LYS P  1 10  ? 22.364  75.571  63.127  1.00 95.23  ? 160  LYS K N   1 
ATOM   9913  C CA  . LYS P  1 10  ? 22.420  76.221  61.817  1.00 95.23  ? 160  LYS K CA  1 
ATOM   9914  C C   . LYS P  1 10  ? 23.832  76.756  61.619  1.00 95.23  ? 160  LYS K C   1 
ATOM   9915  O O   . LYS P  1 10  ? 24.598  76.198  60.837  1.00 95.23  ? 160  LYS K O   1 
ATOM   9916  C CB  . LYS P  1 10  ? 21.378  77.335  61.743  1.00 95.23  ? 160  LYS K CB  1 
ATOM   9917  C CG  . LYS P  1 10  ? 19.992  76.884  62.191  1.00 95.23  ? 160  LYS K CG  1 
ATOM   9918  C CD  . LYS P  1 10  ? 18.881  77.511  61.349  1.00 95.23  ? 160  LYS K CD  1 
ATOM   9919  C CE  . LYS P  1 10  ? 17.518  77.253  61.973  1.00 95.23  ? 160  LYS K CE  1 
ATOM   9920  N NZ  . LYS P  1 10  ? 16.639  78.452  61.901  1.00 95.23  ? 160  LYS K NZ  1 
ATOM   9921  N N   . PRO P  1 11  ? 24.194  77.862  62.283  1.00 84.71  ? 161  PRO K N   1 
ATOM   9922  C CA  . PRO P  1 11  ? 25.573  78.296  62.065  1.00 84.71  ? 161  PRO K CA  1 
ATOM   9923  C C   . PRO P  1 11  ? 26.315  77.740  63.288  1.00 84.71  ? 161  PRO K C   1 
ATOM   9924  O O   . PRO P  1 11  ? 26.325  78.387  64.337  1.00 84.71  ? 161  PRO K O   1 
ATOM   9925  C CB  . PRO P  1 11  ? 25.476  79.815  62.108  1.00 84.71  ? 161  PRO K CB  1 
ATOM   9926  C CG  . PRO P  1 11  ? 24.268  80.085  63.009  1.00 84.71  ? 161  PRO K CG  1 
ATOM   9927  C CD  . PRO P  1 11  ? 23.479  78.793  63.174  1.00 84.71  ? 161  PRO K CD  1 
ATOM   9928  N N   . ARG P  1 12  ? 26.894  76.539  63.168  1.00 59.18  ? 162  ARG K N   1 
ATOM   9929  C CA  . ARG P  1 12  ? 27.601  75.878  64.276  1.00 59.18  ? 162  ARG K CA  1 
ATOM   9930  C C   . ARG P  1 12  ? 28.086  76.823  65.366  1.00 59.18  ? 162  ARG K C   1 
ATOM   9931  O O   . ARG P  1 12  ? 27.797  76.618  66.543  1.00 59.18  ? 162  ARG K O   1 
ATOM   9932  C CB  . ARG P  1 12  ? 28.781  75.079  63.749  1.00 59.18  ? 162  ARG K CB  1 
ATOM   9933  C CG  . ARG P  1 12  ? 28.449  74.289  62.521  1.00 59.18  ? 162  ARG K CG  1 
ATOM   9934  C CD  . ARG P  1 12  ? 28.660  72.810  62.750  1.00 59.18  ? 162  ARG K CD  1 
ATOM   9935  N NE  . ARG P  1 12  ? 28.006  72.007  61.721  1.00 59.18  ? 162  ARG K NE  1 
ATOM   9936  C CZ  . ARG P  1 12  ? 26.687  71.927  61.582  1.00 59.18  ? 162  ARG K CZ  1 
ATOM   9937  N NH1 . ARG P  1 12  ? 25.894  72.598  62.413  1.00 59.18  ? 162  ARG K NH1 1 
ATOM   9938  N NH2 . ARG P  1 12  ? 26.165  71.186  60.612  1.00 59.18  ? 162  ARG K NH2 1 
ATOM   9939  N N   . GLY P  1 13  ? 28.819  77.859  64.968  1.00 38.67  ? 163  GLY K N   1 
ATOM   9940  C CA  . GLY P  1 13  ? 29.326  78.837  65.917  1.00 38.67  ? 163  GLY K CA  1 
ATOM   9941  C C   . GLY P  1 13  ? 30.235  79.828  65.217  1.00 38.67  ? 163  GLY K C   1 
ATOM   9942  O O   . GLY P  1 13  ? 30.479  79.723  64.014  1.00 38.67  ? 163  GLY K O   1 
ATOM   9943  N N   . TYR P  1 14  ? 30.741  80.802  65.956  1.00 32.57  ? 164  TYR K N   1 
ATOM   9944  C CA  . TYR P  1 14  ? 31.624  81.781  65.354  1.00 32.57  ? 164  TYR K CA  1 
ATOM   9945  C C   . TYR P  1 14  ? 33.023  81.225  65.236  1.00 32.57  ? 164  TYR K C   1 
ATOM   9946  O O   . TYR P  1 14  ? 33.435  80.368  66.019  1.00 32.57  ? 164  TYR K O   1 
ATOM   9947  C CB  . TYR P  1 14  ? 31.677  83.062  66.190  1.00 32.57  ? 164  TYR K CB  1 
ATOM   9948  C CG  . TYR P  1 14  ? 30.329  83.705  66.406  1.00 32.57  ? 164  TYR K CG  1 
ATOM   9949  C CD1 . TYR P  1 14  ? 29.700  83.631  67.654  1.00 32.57  ? 164  TYR K CD1 1 
ATOM   9950  C CD2 . TYR P  1 14  ? 29.667  84.367  65.368  1.00 32.57  ? 164  TYR K CD2 1 
ATOM   9951  C CE1 . TYR P  1 14  ? 28.442  84.195  67.874  1.00 32.57  ? 164  TYR K CE1 1 
ATOM   9952  C CE2 . TYR P  1 14  ? 28.404  84.934  65.570  1.00 32.57  ? 164  TYR K CE2 1 
ATOM   9953  C CZ  . TYR P  1 14  ? 27.794  84.840  66.837  1.00 32.57  ? 164  TYR K CZ  1 
ATOM   9954  O OH  . TYR P  1 14  ? 26.534  85.356  67.097  1.00 32.57  ? 164  TYR K OH  1 
ATOM   9955  N N   . CYS P  1 15  ? 33.749  81.724  64.244  1.00 40.39  ? 165  CYS K N   1 
ATOM   9956  C CA  . CYS P  1 15  ? 35.128  81.323  64.023  1.00 40.39  ? 165  CYS K CA  1 
ATOM   9957  C C   . CYS P  1 15  ? 35.995  82.564  63.960  1.00 40.39  ? 165  CYS K C   1 
ATOM   9958  O O   . CYS P  1 15  ? 36.352  83.018  62.880  1.00 40.39  ? 165  CYS K O   1 
ATOM   9959  C CB  . CYS P  1 15  ? 35.270  80.555  62.708  1.00 40.39  ? 165  CYS K CB  1 
ATOM   9960  S SG  . CYS P  1 15  ? 37.002  80.120  62.253  1.00 40.39  ? 165  CYS K SG  1 
ATOM   9961  N N   . LEU P  1 16  ? 36.317  83.136  65.104  1.00 48.92  ? 166  LEU K N   1 
ATOM   9962  C CA  . LEU P  1 16  ? 37.160  84.310  65.094  1.00 48.92  ? 166  LEU K CA  1 
ATOM   9963  C C   . LEU P  1 16  ? 38.456  84.031  64.337  1.00 48.92  ? 166  LEU K C   1 
ATOM   9964  O O   . LEU P  1 16  ? 39.034  82.949  64.464  1.00 48.92  ? 166  LEU K O   1 
ATOM   9965  C CB  . LEU P  1 16  ? 37.532  84.686  66.504  1.00 48.92  ? 166  LEU K CB  1 
ATOM   9966  C CG  . LEU P  1 16  ? 36.638  85.713  67.146  1.00 48.92  ? 166  LEU K CG  1 
ATOM   9967  C CD1 . LEU P  1 16  ? 35.343  85.033  67.520  1.00 48.92  ? 166  LEU K CD1 1 
ATOM   9968  C CD2 . LEU P  1 16  ? 37.331  86.304  68.368  1.00 48.92  ? 166  LEU K CD2 1 
ATOM   9969  N N   . ILE P  1 17  ? 38.924  84.997  63.555  1.00 32.57  ? 167  ILE K N   1 
ATOM   9970  C CA  . ILE P  1 17  ? 40.182  84.818  62.851  1.00 32.57  ? 167  ILE K CA  1 
ATOM   9971  C C   . ILE P  1 17  ? 41.012  86.070  63.042  1.00 32.57  ? 167  ILE K C   1 
ATOM   9972  O O   . ILE P  1 17  ? 40.983  86.951  62.192  1.00 32.57  ? 167  ILE K O   1 
ATOM   9973  C CB  . ILE P  1 17  ? 40.001  84.615  61.328  1.00 32.57  ? 167  ILE K CB  1 
ATOM   9974  C CG1 . ILE P  1 17  ? 39.348  83.265  61.044  1.00 32.57  ? 167  ILE K CG1 1 
ATOM   9975  C CG2 . ILE P  1 17  ? 41.355  84.652  60.639  1.00 32.57  ? 167  ILE K CG2 1 
ATOM   9976  C CD1 . ILE P  1 17  ? 39.291  82.896  59.555  1.00 32.57  ? 167  ILE K CD1 1 
ATOM   9977  N N   . ILE P  1 18  ? 41.737  86.176  64.149  1.00 30.12  ? 168  ILE K N   1 
ATOM   9978  C CA  . ILE P  1 18  ? 42.565  87.353  64.365  1.00 30.12  ? 168  ILE K CA  1 
ATOM   9979  C C   . ILE P  1 18  ? 43.837  87.202  63.544  1.00 30.12  ? 168  ILE K C   1 
ATOM   9980  O O   . ILE P  1 18  ? 44.734  86.463  63.903  1.00 30.12  ? 168  ILE K O   1 
ATOM   9981  C CB  . ILE P  1 18  ? 42.959  87.494  65.825  1.00 30.12  ? 168  ILE K CB  1 
ATOM   9982  C CG1 . ILE P  1 18  ? 41.728  87.882  66.654  1.00 30.12  ? 168  ILE K CG1 1 
ATOM   9983  C CG2 . ILE P  1 18  ? 44.128  88.495  65.944  1.00 30.12  ? 168  ILE K CG2 1 
ATOM   9984  C CD1 . ILE P  1 18  ? 42.041  88.290  68.085  1.00 30.12  ? 168  ILE K CD1 1 
ATOM   9985  N N   . ASN P  1 19  ? 43.915  87.927  62.447  1.00 30.73  ? 169  ASN K N   1 
ATOM   9986  C CA  . ASN P  1 19  ? 45.057  87.850  61.561  1.00 30.73  ? 169  ASN K CA  1 
ATOM   9987  C C   . ASN P  1 19  ? 45.899  89.138  61.575  1.00 30.73  ? 169  ASN K C   1 
ATOM   9988  O O   . ASN P  1 19  ? 45.422  90.211  61.208  1.00 30.73  ? 169  ASN K O   1 
ATOM   9989  C CB  . ASN P  1 19  ? 44.530  87.540  60.167  1.00 30.73  ? 169  ASN K CB  1 
ATOM   9990  C CG  . ASN P  1 19  ? 45.539  87.799  59.093  1.00 30.73  ? 169  ASN K CG  1 
ATOM   9991  O OD1 . ASN P  1 19  ? 46.110  88.873  59.032  1.00 30.73  ? 169  ASN K OD1 1 
ATOM   9992  N ND2 . ASN P  1 19  ? 45.765  86.812  58.223  1.00 30.73  ? 169  ASN K ND2 1 
ATOM   9993  N N   . ASN P  1 20  ? 47.152  89.014  62.016  1.00 35.55  ? 170  ASN K N   1 
ATOM   9994  C CA  . ASN P  1 20  ? 48.097  90.134  62.094  1.00 35.55  ? 170  ASN K CA  1 
ATOM   9995  C C   . ASN P  1 20  ? 49.149  90.053  60.983  1.00 35.55  ? 170  ASN K C   1 
ATOM   9996  O O   . ASN P  1 20  ? 49.819  89.030  60.828  1.00 35.55  ? 170  ASN K O   1 
ATOM   9997  C CB  . ASN P  1 20  ? 48.795  90.130  63.440  1.00 35.55  ? 170  ASN K CB  1 
ATOM   9998  C CG  . ASN P  1 20  ? 47.863  90.477  64.551  1.00 35.55  ? 170  ASN K CG  1 
ATOM   9999  O OD1 . ASN P  1 20  ? 46.711  90.836  64.309  1.00 35.55  ? 170  ASN K OD1 1 
ATOM   10000 N ND2 . ASN P  1 20  ? 48.341  90.375  65.785  1.00 35.55  ? 170  ASN K ND2 1 
ATOM   10001 N N   . HIS P  1 21  ? 49.294  91.133  60.215  1.00 64.53  ? 171  HIS K N   1 
ATOM   10002 C CA  . HIS P  1 21  ? 50.247  91.165  59.113  1.00 64.53  ? 171  HIS K CA  1 
ATOM   10003 C C   . HIS P  1 21  ? 51.246  92.304  59.226  1.00 64.53  ? 171  HIS K C   1 
ATOM   10004 O O   . HIS P  1 21  ? 52.431  92.090  59.035  1.00 64.53  ? 171  HIS K O   1 
ATOM   10005 C CB  . HIS P  1 21  ? 49.503  91.264  57.772  1.00 64.53  ? 171  HIS K CB  1 
ATOM   10006 C CG  . HIS P  1 21  ? 50.396  91.543  56.599  1.00 64.53  ? 171  HIS K CG  1 
ATOM   10007 N ND1 . HIS P  1 21  ? 50.430  90.737  55.478  1.00 64.53  ? 171  HIS K ND1 1 
ATOM   10008 C CD2 . HIS P  1 21  ? 51.291  92.537  56.373  1.00 64.53  ? 171  HIS K CD2 1 
ATOM   10009 C CE1 . HIS P  1 21  ? 51.309  91.221  54.616  1.00 64.53  ? 171  HIS K CE1 1 
ATOM   10010 N NE2 . HIS P  1 21  ? 51.845  92.312  55.134  1.00 64.53  ? 171  HIS K NE2 1 
ATOM   10011 N N   . ASN P  1 22  ? 50.780  93.510  59.537  1.00 51.41  ? 172  ASN K N   1 
ATOM   10012 C CA  . ASN P  1 22  ? 51.672  94.674  59.637  1.00 51.41  ? 172  ASN K CA  1 
ATOM   10013 C C   . ASN P  1 22  ? 52.216  94.939  61.036  1.00 51.41  ? 172  ASN K C   1 
ATOM   10014 O O   . ASN P  1 22  ? 51.491  95.393  61.915  1.00 51.41  ? 172  ASN K O   1 
ATOM   10015 C CB  . ASN P  1 22  ? 50.964  95.941  59.132  1.00 51.41  ? 172  ASN K CB  1 
ATOM   10016 C CG  . ASN P  1 22  ? 51.748  97.207  59.435  1.00 51.41  ? 172  ASN K CG  1 
ATOM   10017 O OD1 . ASN P  1 22  ? 52.972  97.238  59.300  1.00 51.41  ? 172  ASN K OD1 1 
ATOM   10018 N ND2 . ASN P  1 22  ? 51.048  98.255  59.848  1.00 51.41  ? 172  ASN K ND2 1 
ATOM   10019 N N   . PHE P  1 23  ? 53.507  94.689  61.221  1.00 35.18  ? 173  PHE K N   1 
ATOM   10020 C CA  . PHE P  1 23  ? 54.140  94.887  62.522  1.00 35.18  ? 173  PHE K CA  1 
ATOM   10021 C C   . PHE P  1 23  ? 54.952  96.182  62.625  1.00 35.18  ? 173  PHE K C   1 
ATOM   10022 O O   . PHE P  1 23  ? 55.855  96.291  63.449  1.00 35.18  ? 173  PHE K O   1 
ATOM   10023 C CB  . PHE P  1 23  ? 55.030  93.670  62.864  1.00 35.18  ? 173  PHE K CB  1 
ATOM   10024 C CG  . PHE P  1 23  ? 54.253  92.469  63.374  1.00 35.18  ? 173  PHE K CG  1 
ATOM   10025 C CD1 . PHE P  1 23  ? 53.696  91.550  62.484  1.00 35.18  ? 173  PHE K CD1 1 
ATOM   10026 C CD2 . PHE P  1 23  ? 54.005  92.312  64.742  1.00 35.18  ? 173  PHE K CD2 1 
ATOM   10027 C CE1 . PHE P  1 23  ? 52.893  90.501  62.934  1.00 35.18  ? 173  PHE K CE1 1 
ATOM   10028 C CE2 . PHE P  1 23  ? 53.201  91.264  65.208  1.00 35.18  ? 173  PHE K CE2 1 
ATOM   10029 C CZ  . PHE P  1 23  ? 52.641  90.354  64.294  1.00 35.18  ? 173  PHE K CZ  1 
ATOM   10030 N N   . ALA P  1 24  ? 54.637  97.168  61.791  1.00 37.31  ? 174  ALA K N   1 
ATOM   10031 C CA  . ALA P  1 24  ? 55.367  98.434  61.830  1.00 37.31  ? 174  ALA K CA  1 
ATOM   10032 C C   . ALA P  1 24  ? 55.129  99.088  63.175  1.00 37.31  ? 174  ALA K C   1 
ATOM   10033 O O   . ALA P  1 24  ? 55.927  99.887  63.629  1.00 37.31  ? 174  ALA K O   1 
ATOM   10034 C CB  . ALA P  1 24  ? 54.903  99.361  60.706  1.00 37.31  ? 174  ALA K CB  1 
ATOM   10035 N N   . LYS P  1 25  ? 54.018  98.748  63.813  1.00 74.15  ? 175  LYS K N   1 
ATOM   10036 C CA  . LYS P  1 25  ? 53.702  99.324  65.110  1.00 74.15  ? 175  LYS K CA  1 
ATOM   10037 C C   . LYS P  1 25  ? 54.757  98.883  66.110  1.00 74.15  ? 175  LYS K C   1 
ATOM   10038 O O   . LYS P  1 25  ? 55.459  99.708  66.687  1.00 74.15  ? 175  LYS K O   1 
ATOM   10039 C CB  . LYS P  1 25  ? 52.316  98.864  65.567  1.00 74.15  ? 175  LYS K CB  1 
ATOM   10040 C CG  . LYS P  1 25  ? 51.203  99.866  65.290  1.00 74.15  ? 175  LYS K CG  1 
ATOM   10041 C CD  . LYS P  1 25  ? 51.472  101.198 66.000  1.00 74.15  ? 175  LYS K CD  1 
ATOM   10042 C CE  . LYS P  1 25  ? 50.182  101.973 66.230  1.00 74.15  ? 175  LYS K CE  1 
ATOM   10043 N NZ  . LYS P  1 25  ? 49.672  102.548 64.958  1.00 74.15  ? 175  LYS K NZ  1 
ATOM   10044 N N   . ALA P  1 26  A 54.866  97.570  66.297  1.00 44.75  ? 175  ALA K N   1 
ATOM   10045 C CA  . ALA P  1 26  A 55.833  96.978  67.224  1.00 44.75  ? 175  ALA K CA  1 
ATOM   10046 C C   . ALA P  1 26  A 57.227  97.497  66.931  1.00 44.75  ? 175  ALA K C   1 
ATOM   10047 O O   . ALA P  1 26  A 57.932  97.970  67.822  1.00 44.75  ? 175  ALA K O   1 
ATOM   10048 C CB  . ALA P  1 26  A 55.817  95.475  67.084  1.00 44.75  ? 175  ALA K CB  1 
ATOM   10049 N N   . ARG P  1 27  B 57.613  97.389  65.663  1.00 37.87  ? 175  ARG K N   1 
ATOM   10050 C CA  . ARG P  1 27  B 58.913  97.839  65.184  1.00 37.87  ? 175  ARG K CA  1 
ATOM   10051 C C   . ARG P  1 27  B 59.168  99.274  65.613  1.00 37.87  ? 175  ARG K C   1 
ATOM   10052 O O   . ARG P  1 27  B 60.255  99.613  66.048  1.00 37.87  ? 175  ARG K O   1 
ATOM   10053 C CB  . ARG P  1 27  B 58.962  97.741  63.662  1.00 37.87  ? 175  ARG K CB  1 
ATOM   10054 C CG  . ARG P  1 27  B 59.870  96.664  63.165  1.00 37.87  ? 175  ARG K CG  1 
ATOM   10055 C CD  . ARG P  1 27  B 59.906  96.644  61.662  1.00 37.87  ? 175  ARG K CD  1 
ATOM   10056 N NE  . ARG P  1 27  B 58.746  95.952  61.126  1.00 37.87  ? 175  ARG K NE  1 
ATOM   10057 C CZ  . ARG P  1 27  B 57.747  96.559  60.500  1.00 37.87  ? 175  ARG K CZ  1 
ATOM   10058 N NH1 . ARG P  1 27  B 57.766  97.874  60.330  1.00 37.87  ? 175  ARG K NH1 1 
ATOM   10059 N NH2 . ARG P  1 27  B 56.729  95.848  60.040  1.00 37.87  ? 175  ARG K NH2 1 
ATOM   10060 N N   . GLU P  1 28  C 58.155  100.117 65.502  1.00 59.73  ? 175  GLU K N   1 
ATOM   10061 C CA  . GLU P  1 28  C 58.312  101.510 65.871  1.00 59.73  ? 175  GLU K CA  1 
ATOM   10062 C C   . GLU P  1 28  C 58.434  101.745 67.365  1.00 59.73  ? 175  GLU K C   1 
ATOM   10063 O O   . GLU P  1 28  C 59.092  102.692 67.778  1.00 59.73  ? 175  GLU K O   1 
ATOM   10064 C CB  . GLU P  1 28  C 57.139  102.350 65.332  1.00 59.73  ? 175  GLU K CB  1 
ATOM   10065 C CG  . GLU P  1 28  C 57.089  103.795 65.892  1.00 59.73  ? 175  GLU K CG  1 
ATOM   10066 C CD  . GLU P  1 28  C 55.721  104.467 65.749  1.00 59.73  ? 175  GLU K CD  1 
ATOM   10067 O OE1 . GLU P  1 28  C 55.366  105.297 66.620  1.00 59.73  ? 175  GLU K OE1 1 
ATOM   10068 O OE2 . GLU P  1 28  C 55.007  104.167 64.766  1.00 59.73  ? 175  GLU K OE2 1 
ATOM   10069 N N   . LYS P  1 29  D 57.826  100.891 68.180  1.00 77.46  ? 175  LYS K N   1 
ATOM   10070 C CA  . LYS P  1 29  D 57.860  101.111 69.622  1.00 77.46  ? 175  LYS K CA  1 
ATOM   10071 C C   . LYS P  1 29  D 58.819  100.278 70.474  1.00 77.46  ? 175  LYS K C   1 
ATOM   10072 O O   . LYS P  1 29  D 59.767  100.813 71.047  1.00 77.46  ? 175  LYS K O   1 
ATOM   10073 C CB  . LYS P  1 29  D 56.440  100.985 70.192  1.00 77.46  ? 175  LYS K CB  1 
ATOM   10074 C CG  . LYS P  1 29  D 55.360  101.695 69.368  1.00 77.46  ? 175  LYS K CG  1 
ATOM   10075 C CD  . LYS P  1 29  D 54.802  102.945 70.074  1.00 77.46  ? 175  LYS K CD  1 
ATOM   10076 C CE  . LYS P  1 29  D 54.006  103.847 69.107  1.00 77.46  ? 175  LYS K CE  1 
ATOM   10077 N NZ  . LYS P  1 29  D 54.254  105.309 69.329  1.00 77.46  ? 175  LYS K NZ  1 
ATOM   10078 N N   . VAL P  1 30  E 58.566  98.977  70.569  1.00 53.19  ? 175  VAL K N   1 
ATOM   10079 C CA  . VAL P  1 30  E 59.385  98.077  71.384  1.00 53.19  ? 175  VAL K CA  1 
ATOM   10080 C C   . VAL P  1 30  E 60.780  97.875  70.798  1.00 53.19  ? 175  VAL K C   1 
ATOM   10081 O O   . VAL P  1 30  E 60.937  97.305  69.721  1.00 53.19  ? 175  VAL K O   1 
ATOM   10082 C CB  . VAL P  1 30  E 58.666  96.700  71.570  1.00 53.19  ? 175  VAL K CB  1 
ATOM   10083 C CG1 . VAL P  1 30  E 57.983  96.284  70.274  1.00 53.19  ? 175  VAL K CG1 1 
ATOM   10084 C CG2 . VAL P  1 30  E 59.642  95.643  72.027  1.00 53.19  ? 175  VAL K CG2 1 
ATOM   10085 N N   . PRO P  1 31  F 61.817  98.355  71.501  1.00 69.12  ? 175  PRO K N   1 
ATOM   10086 C CA  . PRO P  1 31  F 63.215  98.239  71.064  1.00 69.12  ? 175  PRO K CA  1 
ATOM   10087 C C   . PRO P  1 31  F 63.659  96.888  70.527  1.00 69.12  ? 175  PRO K C   1 
ATOM   10088 O O   . PRO P  1 31  F 63.980  96.762  69.349  1.00 69.12  ? 175  PRO K O   1 
ATOM   10089 C CB  . PRO P  1 31  F 64.013  98.643  72.302  1.00 69.12  ? 175  PRO K CB  1 
ATOM   10090 C CG  . PRO P  1 31  F 63.105  99.592  73.025  1.00 69.12  ? 175  PRO K CG  1 
ATOM   10091 C CD  . PRO P  1 31  F 61.700  99.086  72.778  1.00 69.12  ? 175  PRO K CD  1 
ATOM   10092 N N   . LYS P  1 32  G 63.671  95.880  71.389  1.00 43.76  ? 175  LYS K N   1 
ATOM   10093 C CA  . LYS P  1 32  G 64.128  94.546  70.998  1.00 43.76  ? 175  LYS K CA  1 
ATOM   10094 C C   . LYS P  1 32  G 63.440  93.886  69.793  1.00 43.76  ? 175  LYS K C   1 
ATOM   10095 O O   . LYS P  1 32  G 63.876  92.816  69.338  1.00 43.76  ? 175  LYS K O   1 
ATOM   10096 C CB  . LYS P  1 32  G 64.046  93.605  72.204  1.00 43.76  ? 175  LYS K CB  1 
ATOM   10097 C CG  . LYS P  1 32  G 62.646  93.382  72.728  1.00 43.76  ? 175  LYS K CG  1 
ATOM   10098 C CD  . LYS P  1 32  G 62.353  91.883  72.857  1.00 43.76  ? 175  LYS K CD  1 
ATOM   10099 C CE  . LYS P  1 32  G 61.244  91.612  73.886  1.00 43.76  ? 175  LYS K CE  1 
ATOM   10100 N NZ  . LYS P  1 32  G 61.054  90.169  74.221  1.00 43.76  ? 175  LYS K NZ  1 
ATOM   10101 N N   . LEU P  1 33  H 62.391  94.526  69.271  1.00 38.46  ? 175  LEU K N   1 
ATOM   10102 C CA  . LEU P  1 33  H 61.641  93.977  68.146  1.00 38.46  ? 175  LEU K CA  1 
ATOM   10103 C C   . LEU P  1 33  H 61.861  94.720  66.837  1.00 38.46  ? 175  LEU K C   1 
ATOM   10104 O O   . LEU P  1 33  H 61.344  94.336  65.792  1.00 38.46  ? 175  LEU K O   1 
ATOM   10105 C CB  . LEU P  1 33  H 60.156  93.925  68.516  1.00 38.46  ? 175  LEU K CB  1 
ATOM   10106 C CG  . LEU P  1 33  H 59.828  93.173  69.828  1.00 38.46  ? 175  LEU K CG  1 
ATOM   10107 C CD1 . LEU P  1 33  H 58.340  92.911  69.893  1.00 38.46  ? 175  LEU K CD1 1 
ATOM   10108 C CD2 . LEU P  1 33  H 60.565  91.846  69.925  1.00 38.46  ? 175  LEU K CD2 1 
ATOM   10109 N N   . HIS P  1 34  I 62.657  95.775  66.913  1.00 95.81  ? 175  HIS K N   1 
ATOM   10110 C CA  . HIS P  1 34  I 63.031  96.615  65.778  1.00 95.81  ? 175  HIS K CA  1 
ATOM   10111 C C   . HIS P  1 34  I 63.043  95.921  64.404  1.00 95.81  ? 175  HIS K C   1 
ATOM   10112 O O   . HIS P  1 34  I 62.803  96.575  63.389  1.00 95.81  ? 175  HIS K O   1 
ATOM   10113 C CB  . HIS P  1 34  I 64.434  97.114  66.011  1.00 95.81  ? 175  HIS K CB  1 
ATOM   10114 C CG  . HIS P  1 34  I 65.432  96.015  65.875  1.00 95.81  ? 175  HIS K CG  1 
ATOM   10115 N ND1 . HIS P  1 34  I 65.466  94.953  66.752  1.00 95.81  ? 175  HIS K ND1 1 
ATOM   10116 C CD2 . HIS P  1 34  I 66.264  95.689  64.854  1.00 95.81  ? 175  HIS K CD2 1 
ATOM   10117 C CE1 . HIS P  1 34  I 66.266  94.017  66.280  1.00 95.81  ? 175  HIS K CE1 1 
ATOM   10118 N NE2 . HIS P  1 34  I 66.762  94.436  65.129  1.00 95.81  ? 175  HIS K NE2 1 
ATOM   10119 N N   . SER P  1 35  J 63.362  94.623  64.358  1.00 38.15  ? 175  SER K N   1 
ATOM   10120 C CA  . SER P  1 35  J 63.446  93.927  63.071  1.00 38.15  ? 175  SER K CA  1 
ATOM   10121 C C   . SER P  1 35  J 62.419  92.839  62.757  1.00 38.15  ? 175  SER K C   1 
ATOM   10122 O O   . SER P  1 35  J 62.590  92.086  61.788  1.00 38.15  ? 175  SER K O   1 
ATOM   10123 C CB  . SER P  1 35  J 64.857  93.357  62.876  1.00 38.15  ? 175  SER K CB  1 
ATOM   10124 O OG  . SER P  1 35  J 65.104  92.280  63.754  1.00 38.15  ? 175  SER K OG  1 
ATOM   10125 N N   . ILE P  1 36  ? 61.350  92.744  63.540  1.00 52.81  ? 176  ILE K N   1 
ATOM   10126 C CA  . ILE P  1 36  ? 60.357  91.725  63.231  1.00 52.81  ? 176  ILE K CA  1 
ATOM   10127 C C   . ILE P  1 36  ? 59.711  92.083  61.901  1.00 52.81  ? 176  ILE K C   1 
ATOM   10128 O O   . ILE P  1 36  ? 59.196  93.183  61.719  1.00 52.81  ? 176  ILE K O   1 
ATOM   10129 C CB  . ILE P  1 36  ? 59.264  91.632  64.299  1.00 52.81  ? 176  ILE K CB  1 
ATOM   10130 C CG1 . ILE P  1 36  ? 59.151  92.963  65.028  1.00 52.81  ? 176  ILE K CG1 1 
ATOM   10131 C CG2 . ILE P  1 36  ? 59.569  90.499  65.268  1.00 52.81  ? 176  ILE K CG2 1 
ATOM   10132 C CD1 . ILE P  1 36  ? 58.282  93.977  64.314  1.00 52.81  ? 176  ILE K CD1 1 
ATOM   10133 N N   . ARG P  1 37  ? 59.749  91.161  60.958  1.00 63.65  ? 177  ARG K N   1 
ATOM   10134 C CA  . ARG P  1 37  ? 59.156  91.436  59.674  1.00 63.65  ? 177  ARG K CA  1 
ATOM   10135 C C   . ARG P  1 37  ? 57.646  91.281  59.705  1.00 63.65  ? 177  ARG K C   1 
ATOM   10136 O O   . ARG P  1 37  ? 57.073  90.707  60.625  1.00 63.65  ? 177  ARG K O   1 
ATOM   10137 C CB  . ARG P  1 37  ? 59.730  90.494  58.615  1.00 63.65  ? 177  ARG K CB  1 
ATOM   10138 C CG  . ARG P  1 37  ? 61.231  90.596  58.436  1.00 63.65  ? 177  ARG K CG  1 
ATOM   10139 C CD  . ARG P  1 37  ? 61.676  90.075  57.072  1.00 63.65  ? 177  ARG K CD  1 
ATOM   10140 N NE  . ARG P  1 37  ? 63.133  90.107  56.965  1.00 63.65  ? 177  ARG K NE  1 
ATOM   10141 C CZ  . ARG P  1 37  ? 63.822  89.750  55.882  1.00 63.65  ? 177  ARG K CZ  1 
ATOM   10142 N NH1 . ARG P  1 37  ? 63.176  89.327  54.794  1.00 63.65  ? 177  ARG K NH1 1 
ATOM   10143 N NH2 . ARG P  1 37  ? 65.159  89.807  55.889  1.00 63.65  ? 177  ARG K NH2 1 
ATOM   10144 N N   . ASP P  1 38  ? 57.007  91.813  58.682  1.00 42.65  ? 178  ASP K N   1 
ATOM   10145 C CA  . ASP P  1 38  ? 55.578  91.684  58.553  1.00 42.65  ? 178  ASP K CA  1 
ATOM   10146 C C   . ASP P  1 38  ? 55.325  90.244  58.091  1.00 42.65  ? 178  ASP K C   1 
ATOM   10147 O O   . ASP P  1 38  ? 56.160  89.649  57.423  1.00 42.65  ? 178  ASP K O   1 
ATOM   10148 C CB  . ASP P  1 38  ? 55.071  92.676  57.507  1.00 42.65  ? 178  ASP K CB  1 
ATOM   10149 C CG  . ASP P  1 38  ? 55.113  94.117  57.999  1.00 42.65  ? 178  ASP K CG  1 
ATOM   10150 O OD1 . ASP P  1 38  ? 55.248  94.314  59.239  1.00 42.65  ? 178  ASP K OD1 1 
ATOM   10151 O OD2 . ASP P  1 38  ? 55.008  95.035  57.145  1.00 42.65  ? 178  ASP K OD2 1 
ATOM   10152 N N   . ARG P  1 39  ? 54.169  89.691  58.418  1.00 40.34  ? 179  ARG K N   1 
ATOM   10153 C CA  . ARG P  1 39  ? 53.886  88.317  58.041  1.00 40.34  ? 179  ARG K CA  1 
ATOM   10154 C C   . ARG P  1 39  ? 53.317  88.148  56.634  1.00 40.34  ? 179  ARG K C   1 
ATOM   10155 O O   . ARG P  1 39  ? 52.143  87.793  56.453  1.00 40.34  ? 179  ARG K O   1 
ATOM   10156 C CB  . ARG P  1 39  ? 52.948  87.692  59.073  1.00 40.34  ? 179  ARG K CB  1 
ATOM   10157 C CG  . ARG P  1 39  ? 53.097  88.298  60.464  1.00 40.34  ? 179  ARG K CG  1 
ATOM   10158 C CD  . ARG P  1 39  ? 53.290  87.232  61.527  1.00 40.34  ? 179  ARG K CD  1 
ATOM   10159 N NE  . ARG P  1 39  ? 52.832  85.930  61.067  1.00 40.34  ? 179  ARG K NE  1 
ATOM   10160 C CZ  . ARG P  1 39  ? 51.558  85.608  60.886  1.00 40.34  ? 179  ARG K CZ  1 
ATOM   10161 N NH1 . ARG P  1 39  ? 50.608  86.506  61.131  1.00 40.34  ? 179  ARG K NH1 1 
ATOM   10162 N NH2 . ARG P  1 39  ? 51.228  84.398  60.446  1.00 40.34  ? 179  ARG K NH2 1 
ATOM   10163 N N   . ASN P  1 40  ? 54.154  88.380  55.630  1.00 49.51  ? 180  ASN K N   1 
ATOM   10164 C CA  . ASN P  1 40  ? 53.703  88.253  54.256  1.00 49.51  ? 180  ASN K CA  1 
ATOM   10165 C C   . ASN P  1 40  ? 53.260  86.841  53.937  1.00 49.51  ? 180  ASN K C   1 
ATOM   10166 O O   . ASN P  1 40  ? 54.065  85.923  53.951  1.00 49.51  ? 180  ASN K O   1 
ATOM   10167 C CB  . ASN P  1 40  ? 54.813  88.695  53.316  1.00 49.51  ? 180  ASN K CB  1 
ATOM   10168 C CG  . ASN P  1 40  ? 55.195  90.147  53.531  1.00 49.51  ? 180  ASN K CG  1 
ATOM   10169 O OD1 . ASN P  1 40  ? 54.359  90.965  53.916  1.00 49.51  ? 180  ASN K OD1 1 
ATOM   10170 N ND2 . ASN P  1 40  ? 56.455  90.475  53.288  1.00 49.51  ? 180  ASN K ND2 1 
ATOM   10171 N N   . GLY P  1 41  ? 51.967  86.679  53.669  1.00 50.88  ? 181  GLY K N   1 
ATOM   10172 C CA  . GLY P  1 41  ? 51.442  85.372  53.339  1.00 50.88  ? 181  GLY K CA  1 
ATOM   10173 C C   . GLY P  1 41  ? 50.293  84.967  54.229  1.00 50.88  ? 181  GLY K C   1 
ATOM   10174 O O   . GLY P  1 41  ? 49.626  83.983  53.924  1.00 50.88  ? 181  GLY K O   1 
ATOM   10175 N N   . THR P  1 42  ? 50.052  85.711  55.311  1.00 56.96  ? 182  THR K N   1 
ATOM   10176 C CA  . THR P  1 42  ? 48.965  85.379  56.240  1.00 56.96  ? 182  THR K CA  1 
ATOM   10177 C C   . THR P  1 42  ? 47.624  85.374  55.535  1.00 56.96  ? 182  THR K C   1 
ATOM   10178 O O   . THR P  1 42  ? 46.781  84.506  55.755  1.00 56.96  ? 182  THR K O   1 
ATOM   10179 C CB  . THR P  1 42  ? 48.856  86.382  57.374  1.00 56.96  ? 182  THR K CB  1 
ATOM   10180 O OG1 . THR P  1 42  ? 49.817  87.424  57.184  1.00 56.96  ? 182  THR K OG1 1 
ATOM   10181 C CG2 . THR P  1 42  ? 49.077  85.693  58.701  1.00 56.96  ? 182  THR K CG2 1 
ATOM   10182 N N   . HIS P  1 43  ? 47.433  86.370  54.690  1.00 71.04  ? 183  HIS K N   1 
ATOM   10183 C CA  . HIS P  1 43  ? 46.207  86.498  53.943  1.00 71.04  ? 183  HIS K CA  1 
ATOM   10184 C C   . HIS P  1 43  ? 45.756  85.148  53.432  1.00 71.04  ? 183  HIS K C   1 
ATOM   10185 O O   . HIS P  1 43  ? 44.601  84.768  53.611  1.00 71.04  ? 183  HIS K O   1 
ATOM   10186 C CB  . HIS P  1 43  ? 46.444  87.497  52.819  1.00 71.04  ? 183  HIS K CB  1 
ATOM   10187 C CG  . HIS P  1 43  ? 46.961  88.809  53.321  1.00 71.04  ? 183  HIS K CG  1 
ATOM   10188 N ND1 . HIS P  1 43  ? 46.171  89.693  54.030  1.00 71.04  ? 183  HIS K ND1 1 
ATOM   10189 C CD2 . HIS P  1 43  ? 48.206  89.342  53.311  1.00 71.04  ? 183  HIS K CD2 1 
ATOM   10190 C CE1 . HIS P  1 43  ? 46.906  90.714  54.436  1.00 71.04  ? 183  HIS K CE1 1 
ATOM   10191 N NE2 . HIS P  1 43  ? 48.145  90.525  54.014  1.00 71.04  ? 183  HIS K NE2 1 
ATOM   10192 N N   . LEU P  1 44  ? 46.680  84.406  52.835  1.00 47.63  ? 184  LEU K N   1 
ATOM   10193 C CA  . LEU P  1 44  ? 46.359  83.090  52.307  1.00 47.63  ? 184  LEU K CA  1 
ATOM   10194 C C   . LEU P  1 44  ? 45.918  82.139  53.415  1.00 47.63  ? 184  LEU K C   1 
ATOM   10195 O O   . LEU P  1 44  ? 45.022  81.318  53.216  1.00 47.63  ? 184  LEU K O   1 
ATOM   10196 C CB  . LEU P  1 44  ? 47.552  82.513  51.558  1.00 47.63  ? 184  LEU K CB  1 
ATOM   10197 C CG  . LEU P  1 44  ? 47.891  83.295  50.296  1.00 47.63  ? 184  LEU K CG  1 
ATOM   10198 C CD1 . LEU P  1 44  ? 48.465  84.659  50.679  1.00 47.63  ? 184  LEU K CD1 1 
ATOM   10199 C CD2 . LEU P  1 44  ? 48.880  82.508  49.467  1.00 47.63  ? 184  LEU K CD2 1 
ATOM   10200 N N   . ASP P  1 45  ? 46.542  82.235  54.581  1.00 49.71  ? 185  ASP K N   1 
ATOM   10201 C CA  . ASP P  1 45  ? 46.144  81.388  55.698  1.00 49.71  ? 185  ASP K CA  1 
ATOM   10202 C C   . ASP P  1 45  ? 44.687  81.745  55.975  1.00 49.71  ? 185  ASP K C   1 
ATOM   10203 O O   . ASP P  1 45  ? 43.788  80.904  55.919  1.00 49.71  ? 185  ASP K O   1 
ATOM   10204 C CB  . ASP P  1 45  ? 46.959  81.723  56.944  1.00 49.71  ? 185  ASP K CB  1 
ATOM   10205 C CG  . ASP P  1 45  ? 48.223  80.926  57.047  1.00 49.71  ? 185  ASP K CG  1 
ATOM   10206 O OD1 . ASP P  1 45  ? 48.383  79.964  56.266  1.00 49.71  ? 185  ASP K OD1 1 
ATOM   10207 O OD2 . ASP P  1 45  ? 49.054  81.270  57.918  1.00 49.71  ? 185  ASP K OD2 1 
ATOM   10208 N N   . ALA P  1 46  ? 44.480  83.026  56.270  1.00 36.40  ? 186  ALA K N   1 
ATOM   10209 C CA  . ALA P  1 46  ? 43.166  83.569  56.581  1.00 36.40  ? 186  ALA K CA  1 
ATOM   10210 C C   . ALA P  1 46  ? 42.131  83.080  55.594  1.00 36.40  ? 186  ALA K C   1 
ATOM   10211 O O   . ALA P  1 46  ? 41.077  82.573  55.984  1.00 36.40  ? 186  ALA K O   1 
ATOM   10212 C CB  . ALA P  1 46  ? 43.220  85.070  56.557  1.00 36.40  ? 186  ALA K CB  1 
ATOM   10213 N N   . GLY P  1 47  ? 42.434  83.234  54.311  1.00 34.32  ? 187  GLY K N   1 
ATOM   10214 C CA  . GLY P  1 47  ? 41.505  82.796  53.293  1.00 34.32  ? 187  GLY K CA  1 
ATOM   10215 C C   . GLY P  1 47  ? 41.163  81.327  53.461  1.00 34.32  ? 187  GLY K C   1 
ATOM   10216 O O   . GLY P  1 47  ? 39.990  80.951  53.550  1.00 34.32  ? 187  GLY K O   1 
ATOM   10217 N N   . ALA P  1 48  ? 42.192  80.493  53.520  1.00 29.89  ? 188  ALA K N   1 
ATOM   10218 C CA  . ALA P  1 48  ? 41.997  79.061  53.658  1.00 29.89  ? 188  ALA K CA  1 
ATOM   10219 C C   . ALA P  1 48  ? 41.124  78.769  54.850  1.00 29.89  ? 188  ALA K C   1 
ATOM   10220 O O   . ALA P  1 48  ? 40.174  78.000  54.749  1.00 29.89  ? 188  ALA K O   1 
ATOM   10221 C CB  . ALA P  1 48  ? 43.336  78.366  53.819  1.00 29.89  ? 188  ALA K CB  1 
ATOM   10222 N N   . LEU P  1 49  ? 41.456  79.378  55.980  1.00 48.52  ? 189  LEU K N   1 
ATOM   10223 C CA  . LEU P  1 49  ? 40.689  79.162  57.193  1.00 48.52  ? 189  LEU K CA  1 
ATOM   10224 C C   . LEU P  1 49  ? 39.258  79.609  56.934  1.00 48.52  ? 189  LEU K C   1 
ATOM   10225 O O   . LEU P  1 49  ? 38.295  78.913  57.291  1.00 48.52  ? 189  LEU K O   1 
ATOM   10226 C CB  . LEU P  1 49  ? 41.291  79.952  58.353  1.00 48.52  ? 189  LEU K CB  1 
ATOM   10227 C CG  . LEU P  1 49  ? 42.468  79.298  59.086  1.00 48.52  ? 189  LEU K CG  1 
ATOM   10228 C CD1 . LEU P  1 49  ? 43.536  80.349  59.337  1.00 48.52  ? 189  LEU K CD1 1 
ATOM   10229 C CD2 . LEU P  1 49  ? 41.997  78.687  60.405  1.00 48.52  ? 189  LEU K CD2 1 
ATOM   10230 N N   . THR P  1 50  ? 39.123  80.765  56.293  1.00 41.32  ? 190  THR K N   1 
ATOM   10231 C CA  . THR P  1 50  ? 37.811  81.302  55.960  1.00 41.32  ? 190  THR K CA  1 
ATOM   10232 C C   . THR P  1 50  ? 36.991  80.300  55.129  1.00 41.32  ? 190  THR K C   1 
ATOM   10233 O O   . THR P  1 50  ? 35.884  79.897  55.510  1.00 41.32  ? 190  THR K O   1 
ATOM   10234 C CB  . THR P  1 50  ? 37.971  82.610  55.193  1.00 41.32  ? 190  THR K CB  1 
ATOM   10235 O OG1 . THR P  1 50  ? 38.171  83.674  56.132  1.00 41.32  ? 190  THR K OG1 1 
ATOM   10236 C CG2 . THR P  1 50  ? 36.753  82.892  54.343  1.00 41.32  ? 190  THR K CG2 1 
ATOM   10237 N N   . THR P  1 51  ? 37.539  79.894  53.996  1.00 43.85  ? 191  THR K N   1 
ATOM   10238 C CA  . THR P  1 51  ? 36.849  78.944  53.150  1.00 43.85  ? 191  THR K CA  1 
ATOM   10239 C C   . THR P  1 51  ? 36.440  77.689  53.907  1.00 43.85  ? 191  THR K C   1 
ATOM   10240 O O   . THR P  1 51  ? 35.256  77.474  54.168  1.00 43.85  ? 191  THR K O   1 
ATOM   10241 C CB  . THR P  1 51  ? 37.723  78.489  51.968  1.00 43.85  ? 191  THR K CB  1 
ATOM   10242 O OG1 . THR P  1 51  ? 38.063  79.613  51.153  1.00 43.85  ? 191  THR K OG1 1 
ATOM   10243 C CG2 . THR P  1 51  ? 36.972  77.474  51.119  1.00 43.85  ? 191  THR K CG2 1 
ATOM   10244 N N   . THR P  1 52  ? 37.429  76.869  54.261  1.00 50.55  ? 192  THR K N   1 
ATOM   10245 C CA  . THR P  1 52  ? 37.170  75.606  54.938  1.00 50.55  ? 192  THR K CA  1 
ATOM   10246 C C   . THR P  1 52  ? 36.246  75.668  56.141  1.00 50.55  ? 192  THR K C   1 
ATOM   10247 O O   . THR P  1 52  ? 35.406  74.791  56.316  1.00 50.55  ? 192  THR K O   1 
ATOM   10248 C CB  . THR P  1 52  ? 38.466  74.912  55.373  1.00 50.55  ? 192  THR K CB  1 
ATOM   10249 O OG1 . THR P  1 52  ? 38.910  75.477  56.603  1.00 50.55  ? 192  THR K OG1 1 
ATOM   10250 C CG2 . THR P  1 52  ? 39.536  75.071  54.323  1.00 50.55  ? 192  THR K CG2 1 
ATOM   10251 N N   . PHE P  1 53  ? 36.369  76.681  56.981  1.00 45.63  ? 193  PHE K N   1 
ATOM   10252 C CA  . PHE P  1 53  ? 35.462  76.707  58.118  1.00 45.63  ? 193  PHE K CA  1 
ATOM   10253 C C   . PHE P  1 53  ? 34.046  77.165  57.752  1.00 45.63  ? 193  PHE K C   1 
ATOM   10254 O O   . PHE P  1 53  ? 33.066  76.790  58.415  1.00 45.63  ? 193  PHE K O   1 
ATOM   10255 C CB  . PHE P  1 53  ? 36.052  77.535  59.262  1.00 45.63  ? 193  PHE K CB  1 
ATOM   10256 C CG  . PHE P  1 53  ? 36.965  76.733  60.153  1.00 45.63  ? 193  PHE K CG  1 
ATOM   10257 C CD1 . PHE P  1 53  ? 38.353  76.894  60.085  1.00 45.63  ? 193  PHE K CD1 1 
ATOM   10258 C CD2 . PHE P  1 53  ? 36.443  75.744  60.989  1.00 45.63  ? 193  PHE K CD2 1 
ATOM   10259 C CE1 . PHE P  1 53  ? 39.203  76.079  60.823  1.00 45.63  ? 193  PHE K CE1 1 
ATOM   10260 C CE2 . PHE P  1 53  ? 37.287  74.923  61.730  1.00 45.63  ? 193  PHE K CE2 1 
ATOM   10261 C CZ  . PHE P  1 53  ? 38.670  75.089  61.647  1.00 45.63  ? 193  PHE K CZ  1 
ATOM   10262 N N   . GLU P  1 54  ? 33.938  77.958  56.688  1.00 64.57  ? 194  GLU K N   1 
ATOM   10263 C CA  . GLU P  1 54  ? 32.639  78.413  56.218  1.00 64.57  ? 194  GLU K CA  1 
ATOM   10264 C C   . GLU P  1 54  ? 31.898  77.159  55.746  1.00 64.57  ? 194  GLU K C   1 
ATOM   10265 O O   . GLU P  1 54  ? 30.745  76.938  56.114  1.00 64.57  ? 194  GLU K O   1 
ATOM   10266 C CB  . GLU P  1 54  ? 32.802  79.403  55.061  1.00 64.57  ? 194  GLU K CB  1 
ATOM   10267 C CG  . GLU P  1 54  ? 32.278  80.806  55.369  1.00 64.57  ? 194  GLU K CG  1 
ATOM   10268 C CD  . GLU P  1 54  ? 32.632  81.812  54.286  1.00 64.57  ? 194  GLU K CD  1 
ATOM   10269 O OE1 . GLU P  1 54  ? 33.055  81.370  53.196  1.00 64.57  ? 194  GLU K OE1 1 
ATOM   10270 O OE2 . GLU P  1 54  ? 32.492  83.036  54.520  1.00 64.57  ? 194  GLU K OE2 1 
ATOM   10271 N N   . GLU P  1 55  ? 32.579  76.330  54.955  1.00 56.15  ? 195  GLU K N   1 
ATOM   10272 C CA  . GLU P  1 55  ? 32.000  75.086  54.443  1.00 56.15  ? 195  GLU K CA  1 
ATOM   10273 C C   . GLU P  1 55  ? 31.500  74.173  55.556  1.00 56.15  ? 195  GLU K C   1 
ATOM   10274 O O   . GLU P  1 55  ? 30.597  73.362  55.348  1.00 56.15  ? 195  GLU K O   1 
ATOM   10275 C CB  . GLU P  1 55  ? 33.023  74.322  53.614  1.00 56.15  ? 195  GLU K CB  1 
ATOM   10276 C CG  . GLU P  1 55  ? 34.160  75.167  53.120  1.00 56.15  ? 195  GLU K CG  1 
ATOM   10277 C CD  . GLU P  1 55  ? 34.726  74.648  51.816  1.00 56.15  ? 195  GLU K CD  1 
ATOM   10278 O OE1 . GLU P  1 55  ? 35.968  74.614  51.652  1.00 56.15  ? 195  GLU K OE1 1 
ATOM   10279 O OE2 . GLU P  1 55  ? 33.925  74.264  50.943  1.00 56.15  ? 195  GLU K OE2 1 
ATOM   10280 N N   . LEU P  1 56  ? 32.102  74.292  56.733  1.00 49.93  ? 196  LEU K N   1 
ATOM   10281 C CA  . LEU P  1 56  ? 31.689  73.484  57.869  1.00 49.93  ? 196  LEU K CA  1 
ATOM   10282 C C   . LEU P  1 56  ? 30.616  74.229  58.652  1.00 49.93  ? 196  LEU K C   1 
ATOM   10283 O O   . LEU P  1 56  ? 30.460  74.032  59.854  1.00 49.93  ? 196  LEU K O   1 
ATOM   10284 C CB  . LEU P  1 56  ? 32.880  73.184  58.771  1.00 49.93  ? 196  LEU K CB  1 
ATOM   10285 C CG  . LEU P  1 56  ? 34.038  72.503  58.047  1.00 49.93  ? 196  LEU K CG  1 
ATOM   10286 C CD1 . LEU P  1 56  ? 35.323  72.887  58.723  1.00 49.93  ? 196  LEU K CD1 1 
ATOM   10287 C CD2 . LEU P  1 56  ? 33.872  70.998  58.058  1.00 49.93  ? 196  LEU K CD2 1 
ATOM   10288 N N   . HIS P  1 57  ? 29.890  75.094  57.953  1.00 49.80  ? 197  HIS K N   1 
ATOM   10289 C CA  . HIS P  1 57  ? 28.798  75.871  58.537  1.00 49.80  ? 197  HIS K CA  1 
ATOM   10290 C C   . HIS P  1 57  ? 29.146  76.670  59.783  1.00 49.80  ? 197  HIS K C   1 
ATOM   10291 O O   . HIS P  1 57  ? 28.407  76.662  60.757  1.00 49.80  ? 197  HIS K O   1 
ATOM   10292 C CB  . HIS P  1 57  ? 27.602  74.948  58.806  1.00 49.80  ? 197  HIS K CB  1 
ATOM   10293 C CG  . HIS P  1 57  ? 27.219  74.109  57.620  1.00 49.80  ? 197  HIS K CG  1 
ATOM   10294 N ND1 . HIS P  1 57  ? 26.933  74.655  56.385  1.00 49.80  ? 197  HIS K ND1 1 
ATOM   10295 C CD2 . HIS P  1 57  ? 27.157  72.764  57.458  1.00 49.80  ? 197  HIS K CD2 1 
ATOM   10296 C CE1 . HIS P  1 57  ? 26.715  73.685  55.515  1.00 49.80  ? 197  HIS K CE1 1 
ATOM   10297 N NE2 . HIS P  1 57  ? 26.845  72.528  56.139  1.00 49.80  ? 197  HIS K NE2 1 
ATOM   10298 N N   . PHE P  1 58  ? 30.275  77.372  59.720  1.00 53.45  ? 198  PHE K N   1 
ATOM   10299 C CA  . PHE P  1 58  ? 30.769  78.219  60.810  1.00 53.45  ? 198  PHE K CA  1 
ATOM   10300 C C   . PHE P  1 58  ? 30.701  79.672  60.367  1.00 53.45  ? 198  PHE K C   1 
ATOM   10301 O O   . PHE P  1 58  ? 30.976  79.984  59.205  1.00 53.45  ? 198  PHE K O   1 
ATOM   10302 C CB  . PHE P  1 58  ? 32.221  77.882  61.137  1.00 53.45  ? 198  PHE K CB  1 
ATOM   10303 C CG  . PHE P  1 58  ? 32.374  77.034  62.344  1.00 53.45  ? 198  PHE K CG  1 
ATOM   10304 C CD1 . PHE P  1 58  ? 32.268  75.654  62.250  1.00 53.45  ? 198  PHE K CD1 1 
ATOM   10305 C CD2 . PHE P  1 58  ? 32.580  77.612  63.588  1.00 53.45  ? 198  PHE K CD2 1 
ATOM   10306 C CE1 . PHE P  1 58  ? 32.355  74.851  63.383  1.00 53.45  ? 198  PHE K CE1 1 
ATOM   10307 C CE2 . PHE P  1 58  ? 32.670  76.817  64.735  1.00 53.45  ? 198  PHE K CE2 1 
ATOM   10308 C CZ  . PHE P  1 58  ? 32.556  75.431  64.631  1.00 53.45  ? 198  PHE K CZ  1 
ATOM   10309 N N   . GLU P  1 59  ? 30.351  80.562  61.288  1.00 51.92  ? 199  GLU K N   1 
ATOM   10310 C CA  . GLU P  1 59  ? 30.248  81.976  60.953  1.00 51.92  ? 199  GLU K CA  1 
ATOM   10311 C C   . GLU P  1 59  ? 31.576  82.687  61.204  1.00 51.92  ? 199  GLU K C   1 
ATOM   10312 O O   . GLU P  1 59  ? 31.967  82.910  62.347  1.00 51.92  ? 199  GLU K O   1 
ATOM   10313 C CB  . GLU P  1 59  ? 29.126  82.619  61.771  1.00 51.92  ? 199  GLU K CB  1 
ATOM   10314 C CG  . GLU P  1 59  ? 28.842  84.066  61.399  1.00 51.92  ? 199  GLU K CG  1 
ATOM   10315 C CD  . GLU P  1 59  ? 27.367  84.339  61.165  1.00 51.92  ? 199  GLU K CD  1 
ATOM   10316 O OE1 . GLU P  1 59  ? 26.789  85.149  61.918  1.00 51.92  ? 199  GLU K OE1 1 
ATOM   10317 O OE2 . GLU P  1 59  ? 26.791  83.746  60.227  1.00 51.92  ? 199  GLU K OE2 1 
ATOM   10318 N N   . ILE P  1 60  ? 32.263  83.046  60.127  1.00 37.53  ? 200  ILE K N   1 
ATOM   10319 C CA  . ILE P  1 60  ? 33.556  83.705  60.244  1.00 37.53  ? 200  ILE K CA  1 
ATOM   10320 C C   . ILE P  1 60  ? 33.457  85.076  60.872  1.00 37.53  ? 200  ILE K C   1 
ATOM   10321 O O   . ILE P  1 60  ? 32.415  85.697  60.833  1.00 37.53  ? 200  ILE K O   1 
ATOM   10322 C CB  . ILE P  1 60  ? 34.230  83.849  58.883  1.00 37.53  ? 200  ILE K CB  1 
ATOM   10323 C CG1 . ILE P  1 60  ? 34.175  82.526  58.137  1.00 37.53  ? 200  ILE K CG1 1 
ATOM   10324 C CG2 . ILE P  1 60  ? 35.662  84.221  59.061  1.00 37.53  ? 200  ILE K CG2 1 
ATOM   10325 C CD1 . ILE P  1 60  ? 34.473  81.342  59.008  1.00 37.53  ? 200  ILE K CD1 1 
ATOM   10326 N N   . LYS P  1 61  ? 34.547  85.542  61.464  1.00 55.02  ? 201  LYS K N   1 
ATOM   10327 C CA  . LYS P  1 61  ? 34.576  86.856  62.097  1.00 55.02  ? 201  LYS K CA  1 
ATOM   10328 C C   . LYS P  1 61  ? 36.018  87.340  62.081  1.00 55.02  ? 201  LYS K C   1 
ATOM   10329 O O   . LYS P  1 61  ? 36.686  87.379  63.107  1.00 55.02  ? 201  LYS K O   1 
ATOM   10330 C CB  . LYS P  1 61  ? 34.070  86.766  63.538  1.00 55.02  ? 201  LYS K CB  1 
ATOM   10331 C CG  . LYS P  1 61  ? 32.568  86.540  63.659  1.00 55.02  ? 201  LYS K CG  1 
ATOM   10332 C CD  . LYS P  1 61  ? 31.795  87.756  63.170  1.00 55.02  ? 201  LYS K CD  1 
ATOM   10333 C CE  . LYS P  1 61  ? 30.332  87.432  62.879  1.00 55.02  ? 201  LYS K CE  1 
ATOM   10334 N NZ  . LYS P  1 61  ? 29.690  88.508  62.069  1.00 55.02  ? 201  LYS K NZ  1 
ATOM   10335 N N   . PRO P  1 62  ? 36.519  87.704  60.898  1.00 40.44  ? 202  PRO K N   1 
ATOM   10336 C CA  . PRO P  1 62  ? 37.883  88.186  60.698  1.00 40.44  ? 202  PRO K CA  1 
ATOM   10337 C C   . PRO P  1 62  ? 38.175  89.513  61.369  1.00 40.44  ? 202  PRO K C   1 
ATOM   10338 O O   . PRO P  1 62  ? 37.257  90.289  61.639  1.00 40.44  ? 202  PRO K O   1 
ATOM   10339 C CB  . PRO P  1 62  ? 38.012  88.298  59.177  1.00 40.44  ? 202  PRO K CB  1 
ATOM   10340 C CG  . PRO P  1 62  ? 36.855  87.564  58.613  1.00 40.44  ? 202  PRO K CG  1 
ATOM   10341 C CD  . PRO P  1 62  ? 35.771  87.668  59.635  1.00 40.44  ? 202  PRO K CD  1 
ATOM   10342 N N   . HIS P  1 63  ? 39.464  89.754  61.615  1.00 46.39  ? 203  HIS K N   1 
ATOM   10343 C CA  . HIS P  1 63  ? 39.956  90.978  62.223  1.00 46.39  ? 203  HIS K CA  1 
ATOM   10344 C C   . HIS P  1 63  ? 41.409  91.102  61.826  1.00 46.39  ? 203  HIS K C   1 
ATOM   10345 O O   . HIS P  1 63  ? 42.144  90.137  61.935  1.00 46.39  ? 203  HIS K O   1 
ATOM   10346 C CB  . HIS P  1 63  ? 39.827  90.902  63.731  1.00 46.39  ? 203  HIS K CB  1 
ATOM   10347 C CG  . HIS P  1 63  ? 38.429  91.108  64.205  1.00 46.39  ? 203  HIS K CG  1 
ATOM   10348 N ND1 . HIS P  1 63  ? 37.468  90.125  64.114  1.00 46.39  ? 203  HIS K ND1 1 
ATOM   10349 C CD2 . HIS P  1 63  ? 37.802  92.204  64.694  1.00 46.39  ? 203  HIS K CD2 1 
ATOM   10350 C CE1 . HIS P  1 63  ? 36.307  90.606  64.524  1.00 46.39  ? 203  HIS K CE1 1 
ATOM   10351 N NE2 . HIS P  1 63  ? 36.482  91.865  64.882  1.00 46.39  ? 203  HIS K NE2 1 
ATOM   10352 N N   . HIS P  1 64  ? 41.824  92.283  61.369  1.00 75.15  ? 204  HIS K N   1 
ATOM   10353 C CA  . HIS P  1 64  ? 43.196  92.486  60.921  1.00 75.15  ? 204  HIS K CA  1 
ATOM   10354 C C   . HIS P  1 64  ? 44.065  93.335  61.817  1.00 75.15  ? 204  HIS K C   1 
ATOM   10355 O O   . HIS P  1 64  ? 43.580  94.209  62.523  1.00 75.15  ? 204  HIS K O   1 
ATOM   10356 C CB  . HIS P  1 64  ? 43.181  93.075  59.515  1.00 75.15  ? 204  HIS K CB  1 
ATOM   10357 C CG  . HIS P  1 64  ? 42.440  92.221  58.537  1.00 75.15  ? 204  HIS K CG  1 
ATOM   10358 N ND1 . HIS P  1 64  ? 43.076  91.362  57.664  1.00 75.15  ? 204  HIS K ND1 1 
ATOM   10359 C CD2 . HIS P  1 64  ? 41.111  92.017  58.368  1.00 75.15  ? 204  HIS K CD2 1 
ATOM   10360 C CE1 . HIS P  1 64  ? 42.168  90.661  57.000  1.00 75.15  ? 204  HIS K CE1 1 
ATOM   10361 N NE2 . HIS P  1 64  ? 40.970  91.040  57.410  1.00 75.15  ? 204  HIS K NE2 1 
ATOM   10362 N N   . ASP P  1 65  ? 45.363  93.062  61.778  1.00 52.60  ? 205  ASP K N   1 
ATOM   10363 C CA  . ASP P  1 65  ? 46.358  93.790  62.566  1.00 52.60  ? 205  ASP K CA  1 
ATOM   10364 C C   . ASP P  1 65  ? 45.826  94.337  63.884  1.00 52.60  ? 205  ASP K C   1 
ATOM   10365 O O   . ASP P  1 65  ? 45.708  95.549  64.050  1.00 52.60  ? 205  ASP K O   1 
ATOM   10366 C CB  . ASP P  1 65  ? 46.934  94.956  61.751  1.00 52.60  ? 205  ASP K CB  1 
ATOM   10367 C CG  . ASP P  1 65  ? 47.323  94.554  60.333  1.00 52.60  ? 205  ASP K CG  1 
ATOM   10368 O OD1 . ASP P  1 65  ? 47.391  93.338  60.058  1.00 52.60  ? 205  ASP K OD1 1 
ATOM   10369 O OD2 . ASP P  1 65  ? 47.563  95.448  59.489  1.00 52.60  ? 205  ASP K OD2 1 
ATOM   10370 N N   . CYS P  1 66  ? 45.507  93.457  64.823  1.00 47.15  ? 206  CYS K N   1 
ATOM   10371 C CA  . CYS P  1 66  ? 45.001  93.915  66.107  1.00 47.15  ? 206  CYS K CA  1 
ATOM   10372 C C   . CYS P  1 66  ? 46.099  93.977  67.148  1.00 47.15  ? 206  CYS K C   1 
ATOM   10373 O O   . CYS P  1 66  ? 46.846  93.020  67.337  1.00 47.15  ? 206  CYS K O   1 
ATOM   10374 C CB  . CYS P  1 66  ? 43.904  92.992  66.637  1.00 47.15  ? 206  CYS K CB  1 
ATOM   10375 S SG  . CYS P  1 66  ? 42.762  92.427  65.397  1.00 47.15  ? 206  CYS K SG  1 
ATOM   10376 N N   . THR P  1 67  ? 46.192  95.109  67.830  1.00 33.16  ? 207  THR K N   1 
ATOM   10377 C CA  . THR P  1 67  ? 47.176  95.252  68.883  1.00 33.16  ? 207  THR K CA  1 
ATOM   10378 C C   . THR P  1 67  ? 46.768  94.281  69.966  1.00 33.16  ? 207  THR K C   1 
ATOM   10379 O O   . THR P  1 67  ? 45.707  93.682  69.900  1.00 33.16  ? 207  THR K O   1 
ATOM   10380 C CB  . THR P  1 67  ? 47.132  96.636  69.472  1.00 33.16  ? 207  THR K CB  1 
ATOM   10381 O OG1 . THR P  1 67  ? 45.904  96.793  70.188  1.00 33.16  ? 207  THR K OG1 1 
ATOM   10382 C CG2 . THR P  1 67  ? 47.203  97.675  68.371  1.00 33.16  ? 207  THR K CG2 1 
ATOM   10383 N N   . VAL P  1 68  ? 47.601  94.118  70.975  1.00 45.36  ? 208  VAL K N   1 
ATOM   10384 C CA  . VAL P  1 68  ? 47.253  93.199  72.045  1.00 45.36  ? 208  VAL K CA  1 
ATOM   10385 C C   . VAL P  1 68  ? 45.885  93.635  72.515  1.00 45.36  ? 208  VAL K C   1 
ATOM   10386 O O   . VAL P  1 68  ? 44.939  92.851  72.536  1.00 45.36  ? 208  VAL K O   1 
ATOM   10387 C CB  . VAL P  1 68  ? 48.275  93.279  73.222  1.00 45.36  ? 208  VAL K CB  1 
ATOM   10388 C CG1 . VAL P  1 68  ? 47.573  93.094  74.567  1.00 45.36  ? 208  VAL K CG1 1 
ATOM   10389 C CG2 . VAL P  1 68  ? 49.342  92.219  73.048  1.00 45.36  ? 208  VAL K CG2 1 
ATOM   10390 N N   . GLU P  1 69  ? 45.790  94.913  72.859  1.00 55.48  ? 209  GLU K N   1 
ATOM   10391 C CA  . GLU P  1 69  ? 44.553  95.502  73.347  1.00 55.48  ? 209  GLU K CA  1 
ATOM   10392 C C   . GLU P  1 69  ? 43.336  95.110  72.507  1.00 55.48  ? 209  GLU K C   1 
ATOM   10393 O O   . GLU P  1 69  ? 42.348  94.600  73.032  1.00 55.48  ? 209  GLU K O   1 
ATOM   10394 C CB  . GLU P  1 69  ? 44.703  97.011  73.369  1.00 55.48  ? 209  GLU K CB  1 
ATOM   10395 C CG  . GLU P  1 69  ? 43.586  97.699  74.056  1.00 55.48  ? 209  GLU K CG  1 
ATOM   10396 C CD  . GLU P  1 69  ? 43.981  99.070  74.501  1.00 55.48  ? 209  GLU K CD  1 
ATOM   10397 O OE1 . GLU P  1 69  ? 44.095  99.969  73.634  1.00 55.48  ? 209  GLU K OE1 1 
ATOM   10398 O OE2 . GLU P  1 69  ? 44.187  99.243  75.719  1.00 55.48  ? 209  GLU K OE2 1 
ATOM   10399 N N   . GLN P  1 70  ? 43.410  95.356  71.204  1.00 42.93  ? 210  GLN K N   1 
ATOM   10400 C CA  . GLN P  1 70  ? 42.314  95.020  70.309  1.00 42.93  ? 210  GLN K CA  1 
ATOM   10401 C C   . GLN P  1 70  ? 41.895  93.573  70.482  1.00 42.93  ? 210  GLN K C   1 
ATOM   10402 O O   . GLN P  1 70  ? 40.704  93.265  70.565  1.00 42.93  ? 210  GLN K O   1 
ATOM   10403 C CB  . GLN P  1 70  ? 42.723  95.224  68.859  1.00 42.93  ? 210  GLN K CB  1 
ATOM   10404 C CG  . GLN P  1 70  ? 42.325  96.555  68.304  1.00 42.93  ? 210  GLN K CG  1 
ATOM   10405 C CD  . GLN P  1 70  ? 43.498  97.294  67.726  1.00 42.93  ? 210  GLN K CD  1 
ATOM   10406 O OE1 . GLN P  1 70  ? 43.693  97.331  66.504  1.00 42.93  ? 210  GLN K OE1 1 
ATOM   10407 N NE2 . GLN P  1 70  ? 44.300  97.893  68.604  1.00 42.93  ? 210  GLN K NE2 1 
ATOM   10408 N N   . ILE P  1 71  ? 42.881  92.685  70.518  1.00 38.06  ? 211  ILE K N   1 
ATOM   10409 C CA  . ILE P  1 71  ? 42.636  91.254  70.677  1.00 38.06  ? 211  ILE K CA  1 
ATOM   10410 C C   . ILE P  1 71  ? 41.771  90.979  71.889  1.00 38.06  ? 211  ILE K C   1 
ATOM   10411 O O   . ILE P  1 71  ? 40.766  90.278  71.794  1.00 38.06  ? 211  ILE K O   1 
ATOM   10412 C CB  . ILE P  1 71  ? 43.954  90.471  70.848  1.00 38.06  ? 211  ILE K CB  1 
ATOM   10413 C CG1 . ILE P  1 71  ? 44.776  90.551  69.564  1.00 38.06  ? 211  ILE K CG1 1 
ATOM   10414 C CG2 . ILE P  1 71  ? 43.666  89.026  71.180  1.00 38.06  ? 211  ILE K CG2 1 
ATOM   10415 C CD1 . ILE P  1 71  ? 46.138  89.955  69.697  1.00 38.06  ? 211  ILE K CD1 1 
ATOM   10416 N N   . TYR P  1 72  ? 42.160  91.526  73.031  1.00 49.74  ? 212  TYR K N   1 
ATOM   10417 C CA  . TYR P  1 72  ? 41.384  91.303  74.231  1.00 49.74  ? 212  TYR K CA  1 
ATOM   10418 C C   . TYR P  1 72  ? 39.956  91.809  74.029  1.00 49.74  ? 212  TYR K C   1 
ATOM   10419 O O   . TYR P  1 72  ? 38.998  91.078  74.277  1.00 49.74  ? 212  TYR K O   1 
ATOM   10420 C CB  . TYR P  1 72  ? 42.054  91.988  75.425  1.00 49.74  ? 212  TYR K CB  1 
ATOM   10421 C CG  . TYR P  1 72  ? 43.217  91.193  76.000  1.00 49.74  ? 212  TYR K CG  1 
ATOM   10422 C CD1 . TYR P  1 72  ? 44.540  91.624  75.829  1.00 49.74  ? 212  TYR K CD1 1 
ATOM   10423 C CD2 . TYR P  1 72  ? 42.998  90.009  76.724  1.00 49.74  ? 212  TYR K CD2 1 
ATOM   10424 C CE1 . TYR P  1 72  ? 45.616  90.896  76.365  1.00 49.74  ? 212  TYR K CE1 1 
ATOM   10425 C CE2 . TYR P  1 72  ? 44.070  89.276  77.263  1.00 49.74  ? 212  TYR K CE2 1 
ATOM   10426 C CZ  . TYR P  1 72  ? 45.369  89.731  77.078  1.00 49.74  ? 212  TYR K CZ  1 
ATOM   10427 O OH  . TYR P  1 72  ? 46.420  89.036  77.619  1.00 49.74  ? 212  TYR K OH  1 
ATOM   10428 N N   . GLU P  1 73  ? 39.817  93.049  73.567  1.00 56.84  ? 213  GLU K N   1 
ATOM   10429 C CA  . GLU P  1 73  ? 38.506  93.644  73.315  1.00 56.84  ? 213  GLU K CA  1 
ATOM   10430 C C   . GLU P  1 73  ? 37.677  92.642  72.546  1.00 56.84  ? 213  GLU K C   1 
ATOM   10431 O O   . GLU P  1 73  ? 36.557  92.310  72.922  1.00 56.84  ? 213  GLU K O   1 
ATOM   10432 C CB  . GLU P  1 73  ? 38.651  94.911  72.468  1.00 56.84  ? 213  GLU K CB  1 
ATOM   10433 C CG  . GLU P  1 73  ? 38.262  96.214  73.173  1.00 56.84  ? 213  GLU K CG  1 
ATOM   10434 C CD  . GLU P  1 73  ? 39.230  97.371  72.856  1.00 56.84  ? 213  GLU K CD  1 
ATOM   10435 O OE1 . GLU P  1 73  ? 39.577  97.548  71.660  1.00 56.84  ? 213  GLU K OE1 1 
ATOM   10436 O OE2 . GLU P  1 73  ? 39.644  98.099  73.798  1.00 56.84  ? 213  GLU K OE2 1 
ATOM   10437 N N   . ILE P  1 74  ? 38.254  92.162  71.458  1.00 23.33  ? 214  ILE K N   1 
ATOM   10438 C CA  . ILE P  1 74  ? 37.593  91.196  70.607  1.00 23.33  ? 214  ILE K CA  1 
ATOM   10439 C C   . ILE P  1 74  ? 37.123  89.942  71.320  1.00 23.33  ? 214  ILE K C   1 
ATOM   10440 O O   . ILE P  1 74  ? 35.952  89.570  71.234  1.00 23.33  ? 214  ILE K O   1 
ATOM   10441 C CB  . ILE P  1 74  ? 38.503  90.787  69.475  1.00 23.33  ? 214  ILE K CB  1 
ATOM   10442 C CG1 . ILE P  1 74  ? 38.798  92.035  68.643  1.00 23.33  ? 214  ILE K CG1 1 
ATOM   10443 C CG2 . ILE P  1 74  ? 37.872  89.624  68.689  1.00 23.33  ? 214  ILE K CG2 1 
ATOM   10444 C CD1 . ILE P  1 74  ? 39.454  91.775  67.324  1.00 23.33  ? 214  ILE K CD1 1 
ATOM   10445 N N   . LEU P  1 75  ? 38.032  89.267  72.002  1.00 35.12  ? 215  LEU K N   1 
ATOM   10446 C CA  . LEU P  1 75  ? 37.639  88.068  72.718  1.00 35.12  ? 215  LEU K CA  1 
ATOM   10447 C C   . LEU P  1 75  ? 36.585  88.459  73.738  1.00 35.12  ? 215  LEU K C   1 
ATOM   10448 O O   . LEU P  1 75  ? 35.561  87.796  73.850  1.00 35.12  ? 215  LEU K O   1 
ATOM   10449 C CB  . LEU P  1 75  ? 38.845  87.429  73.414  1.00 35.12  ? 215  LEU K CB  1 
ATOM   10450 C CG  . LEU P  1 75  ? 39.987  87.071  72.458  1.00 35.12  ? 215  LEU K CG  1 
ATOM   10451 C CD1 . LEU P  1 75  ? 41.184  86.582  73.232  1.00 35.12  ? 215  LEU K CD1 1 
ATOM   10452 C CD2 . LEU P  1 75  ? 39.516  86.020  71.497  1.00 35.12  ? 215  LEU K CD2 1 
ATOM   10453 N N   . LYS P  1 76  ? 36.829  89.549  74.462  1.00 41.60  ? 216  LYS K N   1 
ATOM   10454 C CA  . LYS P  1 76  ? 35.887  90.016  75.471  1.00 41.60  ? 216  LYS K CA  1 
ATOM   10455 C C   . LYS P  1 76  ? 34.473  90.054  74.928  1.00 41.60  ? 216  LYS K C   1 
ATOM   10456 O O   . LYS P  1 76  ? 33.524  89.751  75.644  1.00 41.60  ? 216  LYS K O   1 
ATOM   10457 C CB  . LYS P  1 76  ? 36.253  91.407  75.961  1.00 41.60  ? 216  LYS K CB  1 
ATOM   10458 C CG  . LYS P  1 76  ? 35.097  92.134  76.620  1.00 41.60  ? 216  LYS K CG  1 
ATOM   10459 C CD  . LYS P  1 76  ? 34.819  91.565  77.987  1.00 41.60  ? 216  LYS K CD  1 
ATOM   10460 C CE  . LYS P  1 76  ? 35.510  92.374  79.072  1.00 41.60  ? 216  LYS K CE  1 
ATOM   10461 N NZ  . LYS P  1 76  ? 36.038  91.463  80.142  1.00 41.60  ? 216  LYS K NZ  1 
ATOM   10462 N N   . ILE P  1 77  ? 34.327  90.444  73.670  1.00 31.98  ? 217  ILE K N   1 
ATOM   10463 C CA  . ILE P  1 77  ? 33.005  90.493  73.059  1.00 31.98  ? 217  ILE K CA  1 
ATOM   10464 C C   . ILE P  1 77  ? 32.421  89.085  73.032  1.00 31.98  ? 217  ILE K C   1 
ATOM   10465 O O   . ILE P  1 77  ? 31.430  88.780  73.702  1.00 31.98  ? 217  ILE K O   1 
ATOM   10466 C CB  . ILE P  1 77  ? 33.061  91.021  71.610  1.00 31.98  ? 217  ILE K CB  1 
ATOM   10467 C CG1 . ILE P  1 77  ? 33.282  92.533  71.626  1.00 31.98  ? 217  ILE K CG1 1 
ATOM   10468 C CG2 . ILE P  1 77  ? 31.767  90.681  70.880  1.00 31.98  ? 217  ILE K CG2 1 
ATOM   10469 C CD1 . ILE P  1 77  ? 33.416  93.155  70.250  1.00 31.98  ? 217  ILE K CD1 1 
ATOM   10470 N N   . TYR P  1 78  ? 33.046  88.214  72.256  1.00 34.42  ? 218  TYR K N   1 
ATOM   10471 C CA  . TYR P  1 78  ? 32.558  86.856  72.154  1.00 34.42  ? 218  TYR K CA  1 
ATOM   10472 C C   . TYR P  1 78  ? 32.464  86.195  73.503  1.00 34.42  ? 218  TYR K C   1 
ATOM   10473 O O   . TYR P  1 78  ? 31.726  85.243  73.692  1.00 34.42  ? 218  TYR K O   1 
ATOM   10474 C CB  . TYR P  1 78  ? 33.464  86.091  71.223  1.00 34.42  ? 218  TYR K CB  1 
ATOM   10475 C CG  . TYR P  1 78  ? 33.311  86.645  69.852  1.00 34.42  ? 218  TYR K CG  1 
ATOM   10476 C CD1 . TYR P  1 78  ? 34.026  87.761  69.454  1.00 34.42  ? 218  TYR K CD1 1 
ATOM   10477 C CD2 . TYR P  1 78  ? 32.378  86.107  68.975  1.00 34.42  ? 218  TYR K CD2 1 
ATOM   10478 C CE1 . TYR P  1 78  ? 33.813  88.336  68.201  1.00 34.42  ? 218  TYR K CE1 1 
ATOM   10479 C CE2 . TYR P  1 78  ? 32.150  86.668  67.718  1.00 34.42  ? 218  TYR K CE2 1 
ATOM   10480 C CZ  . TYR P  1 78  ? 32.870  87.786  67.334  1.00 34.42  ? 218  TYR K CZ  1 
ATOM   10481 O OH  . TYR P  1 78  ? 32.652  88.354  66.093  1.00 34.42  ? 218  TYR K OH  1 
ATOM   10482 N N   . GLN P  1 79  ? 33.197  86.739  74.451  1.00 41.22  ? 219  GLN K N   1 
ATOM   10483 C CA  . GLN P  1 79  ? 33.206  86.192  75.775  1.00 41.22  ? 219  GLN K CA  1 
ATOM   10484 C C   . GLN P  1 79  ? 31.870  86.435  76.442  1.00 41.22  ? 219  GLN K C   1 
ATOM   10485 O O   . GLN P  1 79  ? 31.315  85.534  77.067  1.00 41.22  ? 219  GLN K O   1 
ATOM   10486 C CB  . GLN P  1 79  ? 34.325  86.839  76.563  1.00 41.22  ? 219  GLN K CB  1 
ATOM   10487 C CG  . GLN P  1 79  ? 34.616  86.163  77.836  1.00 41.22  ? 219  GLN K CG  1 
ATOM   10488 C CD  . GLN P  1 79  ? 34.347  87.076  78.977  1.00 41.22  ? 219  GLN K CD  1 
ATOM   10489 O OE1 . GLN P  1 79  ? 35.257  87.720  79.504  1.00 41.22  ? 219  GLN K OE1 1 
ATOM   10490 N NE2 . GLN P  1 79  ? 33.086  87.165  79.366  1.00 41.22  ? 219  GLN K NE2 1 
ATOM   10491 N N   . LEU P  1 80  ? 31.351  87.656  76.282  1.00 33.04  ? 220  LEU K N   1 
ATOM   10492 C CA  . LEU P  1 80  ? 30.076  88.093  76.872  1.00 33.04  ? 220  LEU K CA  1 
ATOM   10493 C C   . LEU P  1 80  ? 28.836  87.679  76.068  1.00 33.04  ? 220  LEU K C   1 
ATOM   10494 O O   . LEU P  1 80  ? 27.696  87.740  76.555  1.00 33.04  ? 220  LEU K O   1 
ATOM   10495 C CB  . LEU P  1 80  ? 30.092  89.608  77.021  1.00 33.04  ? 220  LEU K CB  1 
ATOM   10496 C CG  . LEU P  1 80  ? 31.175  90.109  77.970  1.00 33.04  ? 220  LEU K CG  1 
ATOM   10497 C CD1 . LEU P  1 80  ? 31.210  91.622  77.919  1.00 33.04  ? 220  LEU K CD1 1 
ATOM   10498 C CD2 . LEU P  1 80  ? 30.903  89.607  79.392  1.00 33.04  ? 220  LEU K CD2 1 
ATOM   10499 N N   . MET P  1 81  ? 29.063  87.269  74.828  1.00 37.53  ? 221  MET K N   1 
ATOM   10500 C CA  . MET P  1 81  ? 27.991  86.830  73.958  1.00 37.53  ? 221  MET K CA  1 
ATOM   10501 C C   . MET P  1 81  ? 27.234  85.632  74.543  1.00 37.53  ? 221  MET K C   1 
ATOM   10502 O O   . MET P  1 81  ? 27.682  84.993  75.501  1.00 37.53  ? 221  MET K O   1 
ATOM   10503 C CB  . MET P  1 81  ? 28.569  86.433  72.615  1.00 37.53  ? 221  MET K CB  1 
ATOM   10504 C CG  . MET P  1 81  ? 28.745  87.574  71.658  1.00 37.53  ? 221  MET K CG  1 
ATOM   10505 S SD  . MET P  1 81  ? 28.404  87.048  69.927  1.00 37.53  ? 221  MET K SD  1 
ATOM   10506 C CE  . MET P  1 81  ? 28.669  88.610  69.091  1.00 37.53  ? 221  MET K CE  1 
ATOM   10507 N N   . ASP P  1 82  ? 26.088  85.323  73.945  1.00 46.19  ? 222  ASP K N   1 
ATOM   10508 C CA  . ASP P  1 82  ? 25.259  84.210  74.389  1.00 46.19  ? 222  ASP K CA  1 
ATOM   10509 C C   . ASP P  1 82  ? 25.310  83.143  73.320  1.00 46.19  ? 222  ASP K C   1 
ATOM   10510 O O   . ASP P  1 82  ? 24.585  83.221  72.326  1.00 46.19  ? 222  ASP K O   1 
ATOM   10511 C CB  . ASP P  1 82  ? 23.807  84.665  74.593  1.00 46.19  ? 222  ASP K CB  1 
ATOM   10512 C CG  . ASP P  1 82  ? 22.926  83.577  75.214  1.00 46.19  ? 222  ASP K CG  1 
ATOM   10513 O OD1 . ASP P  1 82  ? 23.154  82.384  74.927  1.00 46.19  ? 222  ASP K OD1 1 
ATOM   10514 O OD2 . ASP P  1 82  ? 22.001  83.912  75.990  1.00 46.19  ? 222  ASP K OD2 1 
ATOM   10515 N N   . HIS P  1 83  ? 26.172  82.149  73.533  1.00 32.86  ? 224  HIS K N   1 
ATOM   10516 C CA  . HIS P  1 83  ? 26.342  81.048  72.581  1.00 32.86  ? 224  HIS K CA  1 
ATOM   10517 C C   . HIS P  1 83  ? 25.351  79.905  72.784  1.00 32.86  ? 224  HIS K C   1 
ATOM   10518 O O   . HIS P  1 83  ? 25.641  78.751  72.428  1.00 32.86  ? 224  HIS K O   1 
ATOM   10519 C CB  . HIS P  1 83  ? 27.770  80.492  72.647  1.00 32.86  ? 224  HIS K CB  1 
ATOM   10520 C CG  . HIS P  1 83  ? 28.832  81.513  72.379  1.00 32.86  ? 224  HIS K CG  1 
ATOM   10521 N ND1 . HIS P  1 83  ? 29.470  81.625  71.161  1.00 32.86  ? 224  HIS K ND1 1 
ATOM   10522 C CD2 . HIS P  1 83  ? 29.386  82.452  73.182  1.00 32.86  ? 224  HIS K CD2 1 
ATOM   10523 C CE1 . HIS P  1 83  ? 30.374  82.586  71.228  1.00 32.86  ? 224  HIS K CE1 1 
ATOM   10524 N NE2 . HIS P  1 83  ? 30.342  83.103  72.443  1.00 32.86  ? 224  HIS K NE2 1 
ATOM   10525 N N   . SER P  1 84  ? 24.179  80.230  73.326  1.00 35.06  ? 225  SER K N   1 
ATOM   10526 C CA  . SER P  1 84  ? 23.142  79.230  73.577  1.00 35.06  ? 225  SER K CA  1 
ATOM   10527 C C   . SER P  1 84  ? 22.727  78.415  72.355  1.00 35.06  ? 225  SER K C   1 
ATOM   10528 O O   . SER P  1 84  ? 22.470  77.228  72.473  1.00 35.06  ? 225  SER K O   1 
ATOM   10529 C CB  . SER P  1 84  ? 21.896  79.884  74.174  1.00 35.06  ? 225  SER K CB  1 
ATOM   10530 O OG  . SER P  1 84  ? 22.105  80.204  75.534  1.00 35.06  ? 225  SER K OG  1 
ATOM   10531 N N   . ASN P  1 85  ? 22.650  79.025  71.183  1.00 46.39  ? 226  ASN K N   1 
ATOM   10532 C CA  . ASN P  1 85  ? 22.233  78.267  70.016  1.00 46.39  ? 226  ASN K CA  1 
ATOM   10533 C C   . ASN P  1 85  ? 23.445  77.925  69.181  1.00 46.39  ? 226  ASN K C   1 
ATOM   10534 O O   . ASN P  1 85  ? 23.351  77.614  67.993  1.00 46.39  ? 226  ASN K O   1 
ATOM   10535 C CB  . ASN P  1 85  ? 21.216  79.069  69.207  1.00 46.39  ? 226  ASN K CB  1 
ATOM   10536 C CG  . ASN P  1 85  ? 20.108  79.659  70.081  1.00 46.39  ? 226  ASN K CG  1 
ATOM   10537 O OD1 . ASN P  1 85  ? 19.498  78.950  70.903  1.00 46.39  ? 226  ASN K OD1 1 
ATOM   10538 N ND2 . ASN P  1 85  ? 19.844  80.968  69.909  1.00 46.39  ? 226  ASN K ND2 1 
ATOM   10539 N N   . MET P  1 86  ? 24.600  77.984  69.824  1.00 59.14  ? 227  MET K N   1 
ATOM   10540 C CA  . MET P  1 86  ? 25.846  77.666  69.159  1.00 59.14  ? 227  MET K CA  1 
ATOM   10541 C C   . MET P  1 86  ? 26.293  76.322  69.708  1.00 59.14  ? 227  MET K C   1 
ATOM   10542 O O   . MET P  1 86  ? 26.082  76.037  70.887  1.00 59.14  ? 227  MET K O   1 
ATOM   10543 C CB  . MET P  1 86  ? 26.880  78.745  69.465  1.00 59.14  ? 227  MET K CB  1 
ATOM   10544 C CG  . MET P  1 86  ? 26.526  80.121  68.897  1.00 59.14  ? 227  MET K CG  1 
ATOM   10545 S SD  . MET P  1 86  ? 25.949  80.034  67.168  1.00 59.14  ? 227  MET K SD  1 
ATOM   10546 C CE  . MET P  1 86  ? 26.521  81.557  66.509  1.00 59.14  ? 227  MET K CE  1 
ATOM   10547 N N   . ASP P  1 87  ? 26.890  75.492  68.855  1.00 65.80  ? 228  ASP K N   1 
ATOM   10548 C CA  . ASP P  1 87  ? 27.361  74.167  69.259  1.00 65.80  ? 228  ASP K CA  1 
ATOM   10549 C C   . ASP P  1 87  ? 28.869  74.137  69.469  1.00 65.80  ? 228  ASP K C   1 
ATOM   10550 O O   . ASP P  1 87  ? 29.390  73.204  70.076  1.00 65.80  ? 228  ASP K O   1 
ATOM   10551 C CB  . ASP P  1 87  ? 27.008  73.131  68.191  1.00 65.80  ? 228  ASP K CB  1 
ATOM   10552 C CG  . ASP P  1 87  ? 25.621  72.562  68.363  1.00 65.80  ? 228  ASP K CG  1 
ATOM   10553 O OD1 . ASP P  1 87  ? 24.999  72.817  69.418  1.00 65.80  ? 228  ASP K OD1 1 
ATOM   10554 O OD2 . ASP P  1 87  ? 25.153  71.857  67.439  1.00 65.80  ? 228  ASP K OD2 1 
ATOM   10555 N N   . CYS P  1 88  ? 29.563  75.165  68.986  1.00 44.52  ? 229  CYS K N   1 
ATOM   10556 C CA  . CYS P  1 88  ? 31.018  75.219  69.078  1.00 44.52  ? 229  CYS K CA  1 
ATOM   10557 C C   . CYS P  1 88  ? 31.540  76.644  68.996  1.00 44.52  ? 229  CYS K C   1 
ATOM   10558 O O   . CYS P  1 88  ? 30.770  77.573  68.841  1.00 44.52  ? 229  CYS K O   1 
ATOM   10559 C CB  . CYS P  1 88  ? 31.600  74.381  67.935  1.00 44.52  ? 229  CYS K CB  1 
ATOM   10560 S SG  . CYS P  1 88  ? 33.371  74.180  67.928  1.00 44.52  ? 229  CYS K SG  1 
ATOM   10561 N N   . PHE P  1 89  ? 32.852  76.806  69.102  1.00 32.18  ? 230  PHE K N   1 
ATOM   10562 C CA  . PHE P  1 89  ? 33.494  78.116  69.033  1.00 32.18  ? 230  PHE K CA  1 
ATOM   10563 C C   . PHE P  1 89  ? 34.961  77.929  68.683  1.00 32.18  ? 230  PHE K C   1 
ATOM   10564 O O   . PHE P  1 89  ? 35.713  77.337  69.454  1.00 32.18  ? 230  PHE K O   1 
ATOM   10565 C CB  . PHE P  1 89  ? 33.385  78.849  70.375  1.00 32.18  ? 230  PHE K CB  1 
ATOM   10566 C CG  . PHE P  1 89  ? 34.116  80.165  70.408  1.00 32.18  ? 230  PHE K CG  1 
ATOM   10567 C CD1 . PHE P  1 89  ? 33.787  81.177  69.515  1.00 32.18  ? 230  PHE K CD1 1 
ATOM   10568 C CD2 . PHE P  1 89  ? 35.120  80.401  71.352  1.00 32.18  ? 230  PHE K CD2 1 
ATOM   10569 C CE1 . PHE P  1 89  ? 34.447  82.416  69.558  1.00 32.18  ? 230  PHE K CE1 1 
ATOM   10570 C CE2 . PHE P  1 89  ? 35.797  81.640  71.414  1.00 32.18  ? 230  PHE K CE2 1 
ATOM   10571 C CZ  . PHE P  1 89  ? 35.461  82.654  70.518  1.00 32.18  ? 230  PHE K CZ  1 
ATOM   10572 N N   . ILE P  1 90  ? 35.355  78.443  67.521  1.00 21.97  ? 231  ILE K N   1 
ATOM   10573 C CA  . ILE P  1 90  ? 36.733  78.346  67.028  1.00 21.97  ? 231  ILE K CA  1 
ATOM   10574 C C   . ILE P  1 90  ? 37.436  79.693  66.943  1.00 21.97  ? 231  ILE K C   1 
ATOM   10575 O O   . ILE P  1 90  ? 36.886  80.641  66.382  1.00 21.97  ? 231  ILE K O   1 
ATOM   10576 C CB  . ILE P  1 90  ? 36.740  77.762  65.636  1.00 21.97  ? 231  ILE K CB  1 
ATOM   10577 C CG1 . ILE P  1 90  ? 35.885  76.502  65.636  1.00 21.97  ? 231  ILE K CG1 1 
ATOM   10578 C CG2 . ILE P  1 90  ? 38.182  77.565  65.161  1.00 21.97  ? 231  ILE K CG2 1 
ATOM   10579 C CD1 . ILE P  1 90  ? 36.076  75.636  64.429  1.00 21.97  ? 231  ILE K CD1 1 
ATOM   10580 N N   . CYS P  1 91  ? 38.644  79.788  67.480  1.00 40.23  ? 232  CYS K N   1 
ATOM   10581 C CA  . CYS P  1 91  ? 39.377  81.046  67.433  1.00 40.23  ? 232  CYS K CA  1 
ATOM   10582 C C   . CYS P  1 91  ? 40.767  80.841  66.865  1.00 40.23  ? 232  CYS K C   1 
ATOM   10583 O O   . CYS P  1 91  ? 41.567  80.114  67.439  1.00 40.23  ? 232  CYS K O   1 
ATOM   10584 C CB  . CYS P  1 91  ? 39.494  81.647  68.827  1.00 40.23  ? 232  CYS K CB  1 
ATOM   10585 S SG  . CYS P  1 91  ? 40.562  83.101  68.909  1.00 40.23  ? 232  CYS K SG  1 
ATOM   10586 N N   . CYS P  1 92  ? 41.058  81.483  65.742  1.00 36.88  ? 233  CYS K N   1 
ATOM   10587 C CA  . CYS P  1 92  ? 42.361  81.340  65.131  1.00 36.88  ? 233  CYS K CA  1 
ATOM   10588 C C   . CYS P  1 92  ? 43.132  82.629  65.225  1.00 36.88  ? 233  CYS K C   1 
ATOM   10589 O O   . CYS P  1 92  ? 42.597  83.706  64.968  1.00 36.88  ? 233  CYS K O   1 
ATOM   10590 C CB  . CYS P  1 92  ? 42.216  80.944  63.679  1.00 36.88  ? 233  CYS K CB  1 
ATOM   10591 S SG  . CYS P  1 92  ? 41.048  79.605  63.491  1.00 36.88  ? 233  CYS K SG  1 
ATOM   10592 N N   . ILE P  1 93  ? 44.393  82.515  65.607  1.00 24.40  ? 234  ILE K N   1 
ATOM   10593 C CA  . ILE P  1 93  ? 45.245  83.677  65.730  1.00 24.40  ? 234  ILE K CA  1 
ATOM   10594 C C   . ILE P  1 93  ? 46.493  83.439  64.906  1.00 24.40  ? 234  ILE K C   1 
ATOM   10595 O O   . ILE P  1 93  ? 47.167  82.424  65.048  1.00 24.40  ? 234  ILE K O   1 
ATOM   10596 C CB  . ILE P  1 93  ? 45.621  83.934  67.196  1.00 24.40  ? 234  ILE K CB  1 
ATOM   10597 C CG1 . ILE P  1 93  ? 44.352  84.181  68.005  1.00 24.40  ? 234  ILE K CG1 1 
ATOM   10598 C CG2 . ILE P  1 93  ? 46.532  85.144  67.310  1.00 24.40  ? 234  ILE K CG2 1 
ATOM   10599 C CD1 . ILE P  1 93  ? 44.575  84.162  69.492  1.00 24.40  ? 234  ILE K CD1 1 
ATOM   10600 N N   . LEU P  1 94  ? 46.779  84.358  64.004  1.00 29.13  ? 235  LEU K N   1 
ATOM   10601 C CA  . LEU P  1 94  ? 47.963  84.234  63.192  1.00 29.13  ? 235  LEU K CA  1 
ATOM   10602 C C   . LEU P  1 94  ? 48.753  85.496  63.492  1.00 29.13  ? 235  LEU K C   1 
ATOM   10603 O O   . LEU P  1 94  ? 48.291  86.597  63.210  1.00 29.13  ? 235  LEU K O   1 
ATOM   10604 C CB  . LEU P  1 94  ? 47.578  84.162  61.721  1.00 29.13  ? 235  LEU K CB  1 
ATOM   10605 C CG  . LEU P  1 94  ? 46.252  83.454  61.478  1.00 29.13  ? 235  LEU K CG  1 
ATOM   10606 C CD1 . LEU P  1 94  ? 45.894  83.510  59.984  1.00 29.13  ? 235  LEU K CD1 1 
ATOM   10607 C CD2 . LEU P  1 94  ? 46.360  82.022  61.973  1.00 29.13  ? 235  LEU K CD2 1 
ATOM   10608 N N   . SER P  1 95  ? 49.935  85.339  64.078  1.00 30.68  ? 236  SER K N   1 
ATOM   10609 C CA  . SER P  1 95  ? 50.763  86.490  64.424  1.00 30.68  ? 236  SER K CA  1 
ATOM   10610 C C   . SER P  1 95  ? 52.139  86.007  64.866  1.00 30.68  ? 236  SER K C   1 
ATOM   10611 O O   . SER P  1 95  ? 52.379  84.801  64.908  1.00 30.68  ? 236  SER K O   1 
ATOM   10612 C CB  . SER P  1 95  ? 50.093  87.266  65.560  1.00 30.68  ? 236  SER K CB  1 
ATOM   10613 O OG  . SER P  1 95  ? 50.795  88.457  65.848  1.00 30.68  ? 236  SER K OG  1 
ATOM   10614 N N   . HIS P  1 96  ? 53.048  86.934  65.173  1.00 29.45  ? 237  HIS K N   1 
ATOM   10615 C CA  . HIS P  1 96  ? 54.370  86.537  65.660  1.00 29.45  ? 237  HIS K CA  1 
ATOM   10616 C C   . HIS P  1 96  ? 54.134  86.133  67.104  1.00 29.45  ? 237  HIS K C   1 
ATOM   10617 O O   . HIS P  1 96  ? 53.087  86.462  67.694  1.00 29.45  ? 237  HIS K O   1 
ATOM   10618 C CB  . HIS P  1 96  ? 55.366  87.690  65.644  1.00 29.45  ? 237  HIS K CB  1 
ATOM   10619 C CG  . HIS P  1 96  ? 55.894  88.005  64.284  1.00 29.45  ? 237  HIS K CG  1 
ATOM   10620 N ND1 . HIS P  1 96  ? 56.055  87.044  63.313  1.00 29.45  ? 237  HIS K ND1 1 
ATOM   10621 C CD2 . HIS P  1 96  ? 56.223  89.183  63.705  1.00 29.45  ? 237  HIS K CD2 1 
ATOM   10622 C CE1 . HIS P  1 96  ? 56.456  87.614  62.192  1.00 29.45  ? 237  HIS K CE1 1 
ATOM   10623 N NE2 . HIS P  1 96  ? 56.564  88.913  62.402  1.00 29.45  ? 237  HIS K NE2 1 
ATOM   10624 N N   . GLY P  1 97  ? 55.093  85.426  67.687  1.00 35.11  ? 238  GLY K N   1 
ATOM   10625 C CA  . GLY P  1 97  ? 54.924  85.003  69.063  1.00 35.11  ? 238  GLY K CA  1 
ATOM   10626 C C   . GLY P  1 97  ? 56.223  84.636  69.731  1.00 35.11  ? 238  GLY K C   1 
ATOM   10627 O O   . GLY P  1 97  ? 57.297  84.776  69.151  1.00 35.11  ? 238  GLY K O   1 
ATOM   10628 N N   . ASP P  1 98  ? 56.110  84.162  70.964  1.00 43.32  ? 239  ASP K N   1 
ATOM   10629 C CA  . ASP P  1 98  ? 57.263  83.752  71.745  1.00 43.32  ? 239  ASP K CA  1 
ATOM   10630 C C   . ASP P  1 98  ? 56.778  82.794  72.825  1.00 43.32  ? 239  ASP K C   1 
ATOM   10631 O O   . ASP P  1 98  ? 55.582  82.578  72.957  1.00 43.32  ? 239  ASP K O   1 
ATOM   10632 C CB  . ASP P  1 98  ? 57.931  84.978  72.365  1.00 43.32  ? 239  ASP K CB  1 
ATOM   10633 C CG  . ASP P  1 98  ? 59.433  84.832  72.475  1.00 43.32  ? 239  ASP K CG  1 
ATOM   10634 O OD1 . ASP P  1 98  ? 59.911  83.683  72.616  1.00 43.32  ? 239  ASP K OD1 1 
ATOM   10635 O OD2 . ASP P  1 98  ? 60.135  85.867  72.428  1.00 43.32  ? 239  ASP K OD2 1 
ATOM   10636 N N   . LYS P  1 99  ? 57.701  82.231  73.593  1.00 48.20  ? 240  LYS K N   1 
ATOM   10637 C CA  . LYS P  1 99  ? 57.357  81.273  74.641  1.00 48.20  ? 240  LYS K CA  1 
ATOM   10638 C C   . LYS P  1 99  ? 56.047  81.523  75.358  1.00 48.20  ? 240  LYS K C   1 
ATOM   10639 O O   . LYS P  1 99  ? 55.976  82.363  76.241  1.00 48.20  ? 240  LYS K O   1 
ATOM   10640 C CB  . LYS P  1 99  ? 58.466  81.196  75.684  1.00 48.20  ? 240  LYS K CB  1 
ATOM   10641 C CG  . LYS P  1 99  ? 59.834  80.915  75.100  1.00 48.20  ? 240  LYS K CG  1 
ATOM   10642 C CD  . LYS P  1 99  ? 60.839  80.531  76.184  1.00 48.20  ? 240  LYS K CD  1 
ATOM   10643 C CE  . LYS P  1 99  ? 62.274  80.908  75.782  1.00 48.20  ? 240  LYS K CE  1 
ATOM   10644 N NZ  . LYS P  1 99  ? 63.260  80.660  76.893  1.00 48.20  ? 240  LYS K NZ  1 
ATOM   10645 N N   . GLY P  1 100 ? 55.019  80.773  74.964  1.00 30.21  ? 241  GLY K N   1 
ATOM   10646 C CA  . GLY P  1 100 ? 53.705  80.866  75.580  1.00 30.21  ? 241  GLY K CA  1 
ATOM   10647 C C   . GLY P  1 100 ? 52.927  82.154  75.399  1.00 30.21  ? 241  GLY K C   1 
ATOM   10648 O O   . GLY P  1 100 ? 51.989  82.419  76.153  1.00 30.21  ? 241  GLY K O   1 
ATOM   10649 N N   . ILE P  1 101 ? 53.304  82.951  74.400  1.00 30.55  ? 242  ILE K N   1 
ATOM   10650 C CA  . ILE P  1 101 ? 52.638  84.218  74.142  1.00 30.55  ? 242  ILE K CA  1 
ATOM   10651 C C   . ILE P  1 101 ? 52.648  84.557  72.664  1.00 30.55  ? 242  ILE K C   1 
ATOM   10652 O O   . ILE P  1 101 ? 53.551  84.153  71.937  1.00 30.55  ? 242  ILE K O   1 
ATOM   10653 C CB  . ILE P  1 101 ? 53.314  85.395  74.934  1.00 30.55  ? 242  ILE K CB  1 
ATOM   10654 C CG1 . ILE P  1 101 ? 54.657  85.774  74.317  1.00 30.55  ? 242  ILE K CG1 1 
ATOM   10655 C CG2 . ILE P  1 101 ? 53.537  84.990  76.384  1.00 30.55  ? 242  ILE K CG2 1 
ATOM   10656 C CD1 . ILE P  1 101 ? 54.564  86.823  73.263  1.00 30.55  ? 242  ILE K CD1 1 
ATOM   10657 N N   . ILE P  1 102 ? 51.622  85.282  72.227  1.00 41.31  ? 243  ILE K N   1 
ATOM   10658 C CA  . ILE P  1 102 ? 51.537  85.742  70.854  1.00 41.31  ? 243  ILE K CA  1 
ATOM   10659 C C   . ILE P  1 102 ? 51.731  87.251  70.938  1.00 41.31  ? 243  ILE K C   1 
ATOM   10660 O O   . ILE P  1 102 ? 51.611  87.854  72.007  1.00 41.31  ? 243  ILE K O   1 
ATOM   10661 C CB  . ILE P  1 102 ? 50.180  85.454  70.219  1.00 41.31  ? 243  ILE K CB  1 
ATOM   10662 C CG1 . ILE P  1 102 ? 49.065  85.797  71.204  1.00 41.31  ? 243  ILE K CG1 1 
ATOM   10663 C CG2 . ILE P  1 102 ? 50.116  84.007  69.784  1.00 41.31  ? 243  ILE K CG2 1 
ATOM   10664 C CD1 . ILE P  1 102 ? 48.340  87.077  70.878  1.00 41.31  ? 243  ILE K CD1 1 
ATOM   10665 N N   . TYR P  1 103 ? 52.022  87.863  69.807  1.00 46.42  ? 244  TYR K N   1 
ATOM   10666 C CA  . TYR P  1 103 ? 52.268  89.287  69.785  1.00 46.42  ? 244  TYR K CA  1 
ATOM   10667 C C   . TYR P  1 103 ? 51.145  90.081  69.170  1.00 46.42  ? 244  TYR K C   1 
ATOM   10668 O O   . TYR P  1 103 ? 50.559  89.689  68.164  1.00 46.42  ? 244  TYR K O   1 
ATOM   10669 C CB  . TYR P  1 103 ? 53.551  89.573  68.995  1.00 46.42  ? 244  TYR K CB  1 
ATOM   10670 C CG  . TYR P  1 103 ? 54.823  89.491  69.811  1.00 46.42  ? 244  TYR K CG  1 
ATOM   10671 C CD1 . TYR P  1 103 ? 55.759  88.486  69.586  1.00 46.42  ? 244  TYR K CD1 1 
ATOM   10672 C CD2 . TYR P  1 103 ? 55.075  90.411  70.821  1.00 46.42  ? 244  TYR K CD2 1 
ATOM   10673 C CE1 . TYR P  1 103 ? 56.910  88.399  70.350  1.00 46.42  ? 244  TYR K CE1 1 
ATOM   10674 C CE2 . TYR P  1 103 ? 56.221  90.336  71.589  1.00 46.42  ? 244  TYR K CE2 1 
ATOM   10675 C CZ  . TYR P  1 103 ? 57.136  89.329  71.353  1.00 46.42  ? 244  TYR K CZ  1 
ATOM   10676 O OH  . TYR P  1 103 ? 58.281  89.272  72.127  1.00 46.42  ? 244  TYR K OH  1 
ATOM   10677 N N   . GLY P  1 104 ? 50.846  91.215  69.777  1.00 33.78  ? 245  GLY K N   1 
ATOM   10678 C CA  . GLY P  1 104 ? 49.828  92.062  69.204  1.00 33.78  ? 245  GLY K CA  1 
ATOM   10679 C C   . GLY P  1 104 ? 50.567  92.719  68.058  1.00 33.78  ? 245  GLY K C   1 
ATOM   10680 O O   . GLY P  1 104 ? 51.777  92.514  67.901  1.00 33.78  ? 245  GLY K O   1 
ATOM   10681 N N   . THR P  1 105 ? 49.868  93.495  67.243  1.00 42.41  ? 246  THR K N   1 
ATOM   10682 C CA  . THR P  1 105 ? 50.534  94.156  66.138  1.00 42.41  ? 246  THR K CA  1 
ATOM   10683 C C   . THR P  1 105 ? 51.359  95.327  66.645  1.00 42.41  ? 246  THR K C   1 
ATOM   10684 O O   . THR P  1 105 ? 52.130  95.926  65.900  1.00 42.41  ? 246  THR K O   1 
ATOM   10685 C CB  . THR P  1 105 ? 49.534  94.665  65.116  1.00 42.41  ? 246  THR K CB  1 
ATOM   10686 O OG1 . THR P  1 105 ? 50.091  94.477  63.817  1.00 42.41  ? 246  THR K OG1 1 
ATOM   10687 C CG2 . THR P  1 105 ? 49.228  96.161  65.323  1.00 42.41  ? 246  THR K CG2 1 
ATOM   10688 N N   . ASP P  1 106 ? 51.188  95.650  67.921  1.00 45.76  ? 247  ASP K N   1 
ATOM   10689 C CA  . ASP P  1 106 ? 51.901  96.752  68.541  1.00 45.76  ? 247  ASP K CA  1 
ATOM   10690 C C   . ASP P  1 106 ? 53.190  96.275  69.212  1.00 45.76  ? 247  ASP K C   1 
ATOM   10691 O O   . ASP P  1 106 ? 53.958  97.077  69.735  1.00 45.76  ? 247  ASP K O   1 
ATOM   10692 C CB  . ASP P  1 106 ? 50.991  97.435  69.568  1.00 45.76  ? 247  ASP K CB  1 
ATOM   10693 C CG  . ASP P  1 106 ? 50.269  96.442  70.461  1.00 45.76  ? 247  ASP K CG  1 
ATOM   10694 O OD1 . ASP P  1 106 ? 50.431  95.221  70.227  1.00 45.76  ? 247  ASP K OD1 1 
ATOM   10695 O OD2 . ASP P  1 106 ? 49.541  96.870  71.394  1.00 45.76  ? 247  ASP K OD2 1 
ATOM   10696 N N   . GLY P  1 107 ? 53.437  94.969  69.188  1.00 36.10  ? 248  GLY K N   1 
ATOM   10697 C CA  . GLY P  1 107 ? 54.635  94.441  69.823  1.00 36.10  ? 248  GLY K CA  1 
ATOM   10698 C C   . GLY P  1 107 ? 54.389  94.042  71.269  1.00 36.10  ? 248  GLY K C   1 
ATOM   10699 O O   . GLY P  1 107 ? 55.305  93.651  71.992  1.00 36.10  ? 248  GLY K O   1 
ATOM   10700 N N   . GLN P  1 108 ? 53.136  94.142  71.696  1.00 44.94  ? 254  GLN K N   1 
ATOM   10701 C CA  . GLN P  1 108 ? 52.757  93.790  73.053  1.00 44.94  ? 254  GLN K CA  1 
ATOM   10702 C C   . GLN P  1 108 ? 52.545  92.295  73.158  1.00 44.94  ? 254  GLN K C   1 
ATOM   10703 O O   . GLN P  1 108 ? 52.253  91.625  72.166  1.00 44.94  ? 254  GLN K O   1 
ATOM   10704 C CB  . GLN P  1 108 ? 51.479  94.511  73.431  1.00 44.94  ? 254  GLN K CB  1 
ATOM   10705 C CG  . GLN P  1 108 ? 51.687  95.962  73.739  1.00 44.94  ? 254  GLN K CG  1 
ATOM   10706 C CD  . GLN P  1 108 ? 52.670  96.161  74.879  1.00 44.94  ? 254  GLN K CD  1 
ATOM   10707 O OE1 . GLN P  1 108 ? 52.809  95.304  75.756  1.00 44.94  ? 254  GLN K OE1 1 
ATOM   10708 N NE2 . GLN P  1 108 ? 53.362  97.295  74.869  1.00 44.94  ? 254  GLN K NE2 1 
ATOM   10709 N N   . GLU P  1 109 ? 52.659  91.778  74.375  1.00 55.84  ? 255  GLU K N   1 
ATOM   10710 C CA  . GLU P  1 109 ? 52.533  90.344  74.601  1.00 55.84  ? 255  GLU K CA  1 
ATOM   10711 C C   . GLU P  1 109 ? 51.205  89.873  75.157  1.00 55.84  ? 255  GLU K C   1 
ATOM   10712 O O   . GLU P  1 109 ? 50.649  90.493  76.053  1.00 55.84  ? 255  GLU K O   1 
ATOM   10713 C CB  . GLU P  1 109 ? 53.658  89.883  75.526  1.00 55.84  ? 255  GLU K CB  1 
ATOM   10714 C CG  . GLU P  1 109 ? 55.025  90.386  75.087  1.00 55.84  ? 255  GLU K CG  1 
ATOM   10715 C CD  . GLU P  1 109 ? 56.161  89.674  75.774  1.00 55.84  ? 255  GLU K CD  1 
ATOM   10716 O OE1 . GLU P  1 109 ? 55.890  88.971  76.778  1.00 55.84  ? 255  GLU K OE1 1 
ATOM   10717 O OE2 . GLU P  1 109 ? 57.315  89.826  75.299  1.00 55.84  ? 255  GLU K OE2 1 
ATOM   10718 N N   . ALA P  1 110 ? 50.711  88.756  74.634  1.00 46.68  ? 256  ALA K N   1 
ATOM   10719 C CA  . ALA P  1 110 ? 49.445  88.192  75.091  1.00 46.68  ? 256  ALA K CA  1 
ATOM   10720 C C   . ALA P  1 110 ? 49.612  86.717  75.437  1.00 46.68  ? 256  ALA K C   1 
ATOM   10721 O O   . ALA P  1 110 ? 49.630  85.868  74.547  1.00 46.68  ? 256  ALA K O   1 
ATOM   10722 C CB  . ALA P  1 110 ? 48.377  88.347  74.005  1.00 46.68  ? 256  ALA K CB  1 
ATOM   10723 N N   . PRO P  1 111 ? 49.739  86.385  76.733  1.00 32.82  ? 257  PRO K N   1 
ATOM   10724 C CA  . PRO P  1 111 ? 49.899  84.973  77.088  1.00 32.82  ? 257  PRO K CA  1 
ATOM   10725 C C   . PRO P  1 111 ? 48.752  84.161  76.509  1.00 32.82  ? 257  PRO K C   1 
ATOM   10726 O O   . PRO P  1 111 ? 47.592  84.472  76.736  1.00 32.82  ? 257  PRO K O   1 
ATOM   10727 C CB  . PRO P  1 111 ? 49.894  84.977  78.618  1.00 32.82  ? 257  PRO K CB  1 
ATOM   10728 C CG  . PRO P  1 111 ? 50.337  86.349  78.989  1.00 32.82  ? 257  PRO K CG  1 
ATOM   10729 C CD  . PRO P  1 111 ? 49.757  87.251  77.926  1.00 32.82  ? 257  PRO K CD  1 
ATOM   10730 N N   . ILE P  1 112 ? 49.095  83.133  75.742  1.00 27.69  ? 258  ILE K N   1 
ATOM   10731 C CA  . ILE P  1 112 ? 48.108  82.273  75.114  1.00 27.69  ? 258  ILE K CA  1 
ATOM   10732 C C   . ILE P  1 112 ? 47.105  81.817  76.147  1.00 27.69  ? 258  ILE K C   1 
ATOM   10733 O O   . ILE P  1 112 ? 45.918  81.701  75.866  1.00 27.69  ? 258  ILE K O   1 
ATOM   10734 C CB  . ILE P  1 112 ? 48.768  81.053  74.515  1.00 27.69  ? 258  ILE K CB  1 
ATOM   10735 C CG1 . ILE P  1 112 ? 49.896  81.497  73.584  1.00 27.69  ? 258  ILE K CG1 1 
ATOM   10736 C CG2 . ILE P  1 112 ? 47.713  80.195  73.836  1.00 27.69  ? 258  ILE K CG2 1 
ATOM   10737 C CD1 . ILE P  1 112 ? 50.431  80.387  72.733  1.00 27.69  ? 258  ILE K CD1 1 
ATOM   10738 N N   . TYR P  1 113 ? 47.597  81.560  77.347  1.00 46.70  ? 259  TYR K N   1 
ATOM   10739 C CA  . TYR P  1 113 ? 46.742  81.140  78.434  1.00 46.70  ? 259  TYR K CA  1 
ATOM   10740 C C   . TYR P  1 113 ? 45.701  82.218  78.691  1.00 46.70  ? 259  TYR K C   1 
ATOM   10741 O O   . TYR P  1 113 ? 44.519  81.930  78.836  1.00 46.70  ? 259  TYR K O   1 
ATOM   10742 C CB  . TYR P  1 113 ? 47.570  80.948  79.695  1.00 46.70  ? 259  TYR K CB  1 
ATOM   10743 C CG  . TYR P  1 113 ? 46.736  80.592  80.901  1.00 46.70  ? 259  TYR K CG  1 
ATOM   10744 C CD1 . TYR P  1 113 ? 46.116  79.332  80.999  1.00 46.70  ? 259  TYR K CD1 1 
ATOM   10745 C CD2 . TYR P  1 113 ? 46.572  81.500  81.961  1.00 46.70  ? 259  TYR K CD2 1 
ATOM   10746 C CE1 . TYR P  1 113 ? 45.358  78.975  82.126  1.00 46.70  ? 259  TYR K CE1 1 
ATOM   10747 C CE2 . TYR P  1 113 ? 45.813  81.157  83.098  1.00 46.70  ? 259  TYR K CE2 1 
ATOM   10748 C CZ  . TYR P  1 113 ? 45.213  79.890  83.173  1.00 46.70  ? 259  TYR K CZ  1 
ATOM   10749 O OH  . TYR P  1 113 ? 44.501  79.534  84.303  1.00 46.70  ? 259  TYR K OH  1 
ATOM   10750 N N   . GLU P  1 114 ? 46.157  83.466  78.763  1.00 59.64  ? 260  GLU K N   1 
ATOM   10751 C CA  . GLU P  1 114 ? 45.278  84.607  79.001  1.00 59.64  ? 260  GLU K CA  1 
ATOM   10752 C C   . GLU P  1 114 ? 44.107  84.612  78.044  1.00 59.64  ? 260  GLU K C   1 
ATOM   10753 O O   . GLU P  1 114 ? 42.984  84.947  78.418  1.00 59.64  ? 260  GLU K O   1 
ATOM   10754 C CB  . GLU P  1 114 ? 46.043  85.908  78.807  1.00 59.64  ? 260  GLU K CB  1 
ATOM   10755 C CG  . GLU P  1 114 ? 47.021  86.202  79.891  1.00 59.64  ? 260  GLU K CG  1 
ATOM   10756 C CD  . GLU P  1 114 ? 46.328  86.472  81.198  1.00 59.64  ? 260  GLU K CD  1 
ATOM   10757 O OE1 . GLU P  1 114 ? 45.384  85.714  81.528  1.00 59.64  ? 260  GLU K OE1 1 
ATOM   10758 O OE2 . GLU P  1 114 ? 46.727  87.440  81.892  1.00 59.64  ? 260  GLU K OE2 1 
ATOM   10759 N N   . LEU P  1 115 ? 44.396  84.259  76.794  1.00 35.73  ? 261  LEU K N   1 
ATOM   10760 C CA  . LEU P  1 115 ? 43.404  84.226  75.732  1.00 35.73  ? 261  LEU K CA  1 
ATOM   10761 C C   . LEU P  1 115 ? 42.399  83.115  75.940  1.00 35.73  ? 261  LEU K C   1 
ATOM   10762 O O   . LEU P  1 115 ? 41.234  83.370  76.203  1.00 35.73  ? 261  LEU K O   1 
ATOM   10763 C CB  . LEU P  1 115 ? 44.103  84.052  74.393  1.00 35.73  ? 261  LEU K CB  1 
ATOM   10764 C CG  . LEU P  1 115 ? 45.243  85.052  74.185  1.00 35.73  ? 261  LEU K CG  1 
ATOM   10765 C CD1 . LEU P  1 115 ? 45.790  84.907  72.779  1.00 35.73  ? 261  LEU K CD1 1 
ATOM   10766 C CD2 . LEU P  1 115 ? 44.742  86.490  74.417  1.00 35.73  ? 261  LEU K CD2 1 
ATOM   10767 N N   . THR P  1 116 ? 42.854  81.876  75.827  1.00 45.37  ? 262  THR K N   1 
ATOM   10768 C CA  . THR P  1 116 ? 41.970  80.733  76.009  1.00 45.37  ? 262  THR K CA  1 
ATOM   10769 C C   . THR P  1 116 ? 41.162  80.810  77.299  1.00 45.37  ? 262  THR K C   1 
ATOM   10770 O O   . THR P  1 116 ? 39.977  80.508  77.303  1.00 45.37  ? 262  THR K O   1 
ATOM   10771 C CB  . THR P  1 116 ? 42.751  79.418  76.035  1.00 45.37  ? 262  THR K CB  1 
ATOM   10772 O OG1 . THR P  1 116 ? 43.911  79.567  76.859  1.00 45.37  ? 262  THR K OG1 1 
ATOM   10773 C CG2 . THR P  1 116 ? 43.181  79.041  74.650  1.00 45.37  ? 262  THR K CG2 1 
ATOM   10774 N N   . SER P  1 117 ? 41.786  81.227  78.392  1.00 40.46  ? 263  SER K N   1 
ATOM   10775 C CA  . SER P  1 117 ? 41.074  81.279  79.662  1.00 40.46  ? 263  SER K CA  1 
ATOM   10776 C C   . SER P  1 117 ? 39.870  82.203  79.673  1.00 40.46  ? 263  SER K C   1 
ATOM   10777 O O   . SER P  1 117 ? 39.042  82.155  80.593  1.00 40.46  ? 263  SER K O   1 
ATOM   10778 C CB  . SER P  1 117 ? 42.024  81.662  80.795  1.00 40.46  ? 263  SER K CB  1 
ATOM   10779 O OG  . SER P  1 117 ? 42.397  83.020  80.709  1.00 40.46  ? 263  SER K OG  1 
ATOM   10780 N N   . GLN P  1 118 ? 39.762  83.042  78.652  1.00 47.86  ? 264  GLN K N   1 
ATOM   10781 C CA  . GLN P  1 118 ? 38.640  83.976  78.556  1.00 47.86  ? 264  GLN K CA  1 
ATOM   10782 C C   . GLN P  1 118 ? 37.313  83.247  78.368  1.00 47.86  ? 264  GLN K C   1 
ATOM   10783 O O   . GLN P  1 118 ? 36.255  83.788  78.672  1.00 47.86  ? 264  GLN K O   1 
ATOM   10784 C CB  . GLN P  1 118 ? 38.831  84.926  77.369  1.00 47.86  ? 264  GLN K CB  1 
ATOM   10785 C CG  . GLN P  1 118 ? 39.880  85.962  77.593  1.00 47.86  ? 264  GLN K CG  1 
ATOM   10786 C CD  . GLN P  1 118 ? 39.823  86.480  78.987  1.00 47.86  ? 264  GLN K CD  1 
ATOM   10787 O OE1 . GLN P  1 118 ? 40.837  86.519  79.692  1.00 47.86  ? 264  GLN K OE1 1 
ATOM   10788 N NE2 . GLN P  1 118 ? 38.626  86.878  79.416  1.00 47.86  ? 264  GLN K NE2 1 
ATOM   10789 N N   . PHE P  1 119 ? 37.373  82.012  77.885  1.00 27.27  ? 265  PHE K N   1 
ATOM   10790 C CA  . PHE P  1 119 ? 36.160  81.262  77.600  1.00 27.27  ? 265  PHE K CA  1 
ATOM   10791 C C   . PHE P  1 119 ? 35.901  80.019  78.440  1.00 27.27  ? 265  PHE K C   1 
ATOM   10792 O O   . PHE P  1 119 ? 35.301  79.028  77.966  1.00 27.27  ? 265  PHE K O   1 
ATOM   10793 C CB  . PHE P  1 119 ? 36.144  80.913  76.116  1.00 27.27  ? 265  PHE K CB  1 
ATOM   10794 C CG  . PHE P  1 119 ? 36.348  82.103  75.230  1.00 27.27  ? 265  PHE K CG  1 
ATOM   10795 C CD1 . PHE P  1 119 ? 37.607  82.672  75.081  1.00 27.27  ? 265  PHE K CD1 1 
ATOM   10796 C CD2 . PHE P  1 119 ? 35.280  82.668  74.561  1.00 27.27  ? 265  PHE K CD2 1 
ATOM   10797 C CE1 . PHE P  1 119 ? 37.790  83.781  74.280  1.00 27.27  ? 265  PHE K CE1 1 
ATOM   10798 C CE2 . PHE P  1 119 ? 35.457  83.778  73.758  1.00 27.27  ? 265  PHE K CE2 1 
ATOM   10799 C CZ  . PHE P  1 119 ? 36.706  84.335  73.614  1.00 27.27  ? 265  PHE K CZ  1 
ATOM   10800 N N   . THR P  1 120 ? 36.330  80.077  79.698  1.00 39.69  ? 266  THR K N   1 
ATOM   10801 C CA  . THR P  1 120 ? 36.116  78.960  80.590  1.00 39.69  ? 266  THR K CA  1 
ATOM   10802 C C   . THR P  1 120 ? 34.593  78.782  80.775  1.00 39.69  ? 266  THR K C   1 
ATOM   10803 O O   . THR P  1 120 ? 33.790  79.275  79.974  1.00 39.69  ? 266  THR K O   1 
ATOM   10804 C CB  . THR P  1 120 ? 36.822  79.227  81.931  1.00 39.69  ? 266  THR K CB  1 
ATOM   10805 O OG1 . THR P  1 120 ? 36.205  80.334  82.589  1.00 39.69  ? 266  THR K OG1 1 
ATOM   10806 C CG2 . THR P  1 120 ? 38.260  79.593  81.701  1.00 39.69  ? 266  THR K CG2 1 
ATOM   10807 N N   . GLY P  1 121 ? 34.185  78.062  81.813  1.00 62.34  ? 267  GLY K N   1 
ATOM   10808 C CA  . GLY P  1 121 ? 32.763  77.874  82.047  1.00 62.34  ? 267  GLY K CA  1 
ATOM   10809 C C   . GLY P  1 121 ? 32.202  79.046  82.818  1.00 62.34  ? 267  GLY K C   1 
ATOM   10810 O O   . GLY P  1 121 ? 31.152  79.581  82.474  1.00 62.34  ? 267  GLY K O   1 
ATOM   10811 N N   . LEU P  1 122 ? 32.903  79.441  83.874  1.00 39.57  ? 268  LEU K N   1 
ATOM   10812 C CA  . LEU P  1 122 ? 32.477  80.568  84.681  1.00 39.57  ? 268  LEU K CA  1 
ATOM   10813 C C   . LEU P  1 122 ? 32.484  81.809  83.807  1.00 39.57  ? 268  LEU K C   1 
ATOM   10814 O O   . LEU P  1 122 ? 31.520  82.570  83.788  1.00 39.57  ? 268  LEU K O   1 
ATOM   10815 C CB  . LEU P  1 122 ? 33.414  80.764  85.867  1.00 39.57  ? 268  LEU K CB  1 
ATOM   10816 C CG  . LEU P  1 122 ? 33.570  79.547  86.790  1.00 39.57  ? 268  LEU K CG  1 
ATOM   10817 C CD1 . LEU P  1 122 ? 34.027  79.996  88.161  1.00 39.57  ? 268  LEU K CD1 1 
ATOM   10818 C CD2 . LEU P  1 122 ? 32.257  78.821  86.929  1.00 39.57  ? 268  LEU K CD2 1 
ATOM   10819 N N   . LYS P  1 123 ? 33.562  82.002  83.058  1.00 48.12  ? 269  LYS K N   1 
ATOM   10820 C CA  . LYS P  1 123 ? 33.674  83.162  82.182  1.00 48.12  ? 269  LYS K CA  1 
ATOM   10821 C C   . LYS P  1 123 ? 32.750  83.120  80.964  1.00 48.12  ? 269  LYS K C   1 
ATOM   10822 O O   . LYS P  1 123 ? 32.676  84.082  80.219  1.00 48.12  ? 269  LYS K O   1 
ATOM   10823 C CB  . LYS P  1 123 ? 35.117  83.324  81.701  1.00 48.12  ? 269  LYS K CB  1 
ATOM   10824 C CG  . LYS P  1 123 ? 36.068  83.860  82.752  1.00 48.12  ? 269  LYS K CG  1 
ATOM   10825 C CD  . LYS P  1 123 ? 36.906  84.995  82.169  1.00 48.12  ? 269  LYS K CD  1 
ATOM   10826 C CE  . LYS P  1 123 ? 37.569  85.868  83.250  1.00 48.12  ? 269  LYS K CE  1 
ATOM   10827 N NZ  . LYS P  1 123 ? 38.315  87.021  82.650  1.00 48.12  ? 269  LYS K NZ  1 
ATOM   10828 N N   . CYS P  1 124 ? 32.040  82.028  80.733  1.00 26.86  ? 270  CYS K N   1 
ATOM   10829 C CA  . CYS P  1 124 ? 31.180  82.009  79.564  1.00 26.86  ? 270  CYS K CA  1 
ATOM   10830 C C   . CYS P  1 124 ? 30.225  80.829  79.557  1.00 26.86  ? 270  CYS K C   1 
ATOM   10831 O O   . CYS P  1 124 ? 30.318  79.939  78.691  1.00 26.86  ? 270  CYS K O   1 
ATOM   10832 C CB  . CYS P  1 124 ? 32.026  81.985  78.292  1.00 26.86  ? 270  CYS K CB  1 
ATOM   10833 S SG  . CYS P  1 124 ? 31.081  81.999  76.730  1.00 26.86  ? 270  CYS K SG  1 
ATOM   10834 N N   . PRO P  1 125 ? 29.287  80.799  80.526  1.00 28.21  ? 271  PRO K N   1 
ATOM   10835 C CA  . PRO P  1 125 ? 28.291  79.728  80.653  1.00 28.21  ? 271  PRO K CA  1 
ATOM   10836 C C   . PRO P  1 125 ? 27.622  79.345  79.345  1.00 28.21  ? 271  PRO K C   1 
ATOM   10837 O O   . PRO P  1 125 ? 27.426  78.167  79.084  1.00 28.21  ? 271  PRO K O   1 
ATOM   10838 C CB  . PRO P  1 125 ? 27.298  80.281  81.663  1.00 28.21  ? 271  PRO K CB  1 
ATOM   10839 C CG  . PRO P  1 125 ? 28.113  81.194  82.517  1.00 28.21  ? 271  PRO K CG  1 
ATOM   10840 C CD  . PRO P  1 125 ? 29.157  81.801  81.602  1.00 28.21  ? 271  PRO K CD  1 
ATOM   10841 N N   . SER P  1 126 ? 27.284  80.315  78.503  1.00 23.60  ? 272  SER K N   1 
ATOM   10842 C CA  . SER P  1 126 ? 26.613  79.961  77.249  1.00 23.60  ? 272  SER K CA  1 
ATOM   10843 C C   . SER P  1 126 ? 27.387  78.933  76.461  1.00 23.60  ? 272  SER K C   1 
ATOM   10844 O O   . SER P  1 126 ? 26.835  78.366  75.519  1.00 23.60  ? 272  SER K O   1 
ATOM   10845 C CB  . SER P  1 126 ? 26.376  81.171  76.337  1.00 23.60  ? 272  SER K CB  1 
ATOM   10846 O OG  . SER P  1 126 ? 26.673  82.389  76.988  1.00 23.60  ? 272  SER K OG  1 
ATOM   10847 N N   . LEU P  1 127 ? 28.657  78.697  76.829  1.00 53.07  ? 273  LEU K N   1 
ATOM   10848 C CA  . LEU P  1 127 ? 29.522  77.724  76.126  1.00 53.07  ? 273  LEU K CA  1 
ATOM   10849 C C   . LEU P  1 127 ? 29.915  76.485  76.939  1.00 53.07  ? 273  LEU K C   1 
ATOM   10850 O O   . LEU P  1 127 ? 30.597  75.576  76.437  1.00 53.07  ? 273  LEU K O   1 
ATOM   10851 C CB  . LEU P  1 127 ? 30.787  78.419  75.624  1.00 53.07  ? 273  LEU K CB  1 
ATOM   10852 C CG  . LEU P  1 127 ? 30.649  79.064  74.242  1.00 53.07  ? 273  LEU K CG  1 
ATOM   10853 C CD1 . LEU P  1 127