data_1QFG
# 
_entry.id   1QFG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QFG         
RCSB  RCSB000826   
WWPDB D_1000000826 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2fcp 'FERRIC HYDROXAMATE UPTAKE RECEPTOR (FHUA) FROM E.COLI'                                        unspecified 
PDB 1qff 
;E. COLI FERRIC HYDROXAMATE UPTAKE RECEPTOR (FHUA) 
IN COMPLEX WITH BOUND FERRICHROME-IRON
;
unspecified 
PDB 1fcp 'FERRIC HYDROXAMATE UPTAKE RECEPTOR (FHUA) FROM E.COLI IN COMPLEX WITH BOUND FERRICHROME-IRON' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QFG 
_pdbx_database_status.recvd_initial_deposition_date   1999-04-10 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ferguson, A.D.' 1 
'Welte, W.'      2 
'Hofmann, E.'    3 
'Lindner, B.'    4 
'Holst, O.'      5 
'Coulton, J.W.'  6 
'Diederichs, K.' 7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'A conserved structural motif for lipopolysaccharide recognition by procaryotic and eucaryotic proteins.' 
'Structure Fold.Des.' 8   585  592  2000 FODEFH UK 0969-2126 1263 ? 10873859 '10.1016/S0969-2126(00)00143-X' 
1       'Siderophore-mediated iron transport: crystal structure of FhuA with bound lipopolysaccharide.' Science               282 
2215 2220 1998 SCIEAS US 0036-8075 0038 ? 9856937  10.1126/science.282.5397.2215   
2       
;An internal affinity-tag for purification and crystallization of the siderophore receptor FhuA, integral outer membrane protein from Escherichia coli K-12.
;
'Protein Sci.'        7   1636 1638 1998 PRCIEI US 0961-8368 0795 ? 9684898  10.1002/pro.5560070719          
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ferguson, A.D.' 1  ? 
primary 'Welte, W.'      2  ? 
primary 'Hofmann, E.'    3  ? 
primary 'Lindner, B.'    4  ? 
primary 'Holst, O.'      5  ? 
primary 'Coulton, J.W.'  6  ? 
primary 'Diederichs, K.' 7  ? 
1       'Ferguson, A.D.' 8  ? 
1       'Hofmann, E.'    9  ? 
1       'Coulton, J.W.'  10 ? 
1       'Diederichs, K.' 11 ? 
1       'Welte, W.'      12 ? 
2       'Ferguson, A.D.' 13 ? 
2       'Breed, J.'      14 ? 
2       'Diederichs, K.' 15 ? 
2       'Welte, W.'      16 ? 
2       'Coulton, J.W.'  17 ? 
# 
_cell.entry_id           1QFG 
_cell.length_a           171.550 
_cell.length_b           171.550 
_cell.length_c           87.650 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1QFG 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'PROTEIN (FERRIC HYDROXAMATE UPTAKE RECEPTOR)' 80051.109 1   ? YES ? 'COMPLEXED WITH LIPOPOLYSACCHARIDE' 
2  branched    man 
;alpha-D-glucopyranose-(1-3)-[alpha-D-galactopyranose-(1-6)]alpha-D-glucopyranose-(1-3)-L-glycero-alpha-D-manno-heptopyranose-(1-3)-L-glycero-alpha-D-manno-heptopyranose-(1-5)-[3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid-(2-4)]3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid-(2-6)-2-amino-2,3-dideoxy-alpha-D-glucoyranose-(1-6)-2-amino-2-deoxy-alpha-D-glucopyranose
;
1635.438  1   ? ?   ? ?                                   
3  non-polymer syn 'NICKEL (II) ION' 58.693    1   ? ?   ? ?                                   
4  non-polymer syn 'PHOSPHATE ION' 94.971    2   ? ?   ? ?                                   
5  non-polymer syn '3-HYDROXY-TETRADECANOIC ACID' 244.370   4   ? ?   ? ?                                   
6  non-polymer syn 'LAURIC ACID' 200.318   1   ? ?   ? ?                                   
7  non-polymer syn 'MYRISTIC ACID' 228.371   1   ? ?   ? ?                                   
8  non-polymer syn DECYLAMINE-N,N-DIMETHYL-N-OXIDE 201.349   3   ? ?   ? ?                                   
9  non-polymer syn DIPHOSPHATE 173.943   2   ? ?   ? ?                                   
10 non-polymer syn GLYCEROL 92.094    8   ? ?   ? ?                                   
11 water       nat water 18.015    244 ? ?   ? ?                                   
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        FHUA 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AVEPKEDTITVTAAPAPQESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALSYTPGVSVGT
RGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAVIDPYMLERAEIMRGPVSVLYGKSSPGGLLNMVSKRPTTEP
LKEVQFKAGTDSLFQTGFDFSDSLDDDGVYSYRLTGLARSANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPE
TGYYGWLPKEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKTSQNSVYGYGVCSD
PANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFATGDIDHTLLTGVDFMRMRNDINAWFGYDDSVPLL
NLYNPSSHHHHHHGSSVNTDFDFNAKDPANSGPYRILNKQKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTD
KRDDKQFTWRGGVNYLFDNGVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAVYNLTKTNNL
MADPEGSFFSVEGGEIRARGVEIEAKAALSASVNVVGSYTYTDAEYTTDTTYKGNTPAQVPKHMASLWADYTFFDGPLSG
LTLGTGGRYTGSSYGDPANSFKVGSYTVVDALVRYDLARVGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVAT
ATFRF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AVEPKEDTITVTAAPAPQESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALSYTPGVSVGT
RGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAVIDPYMLERAEIMRGPVSVLYGKSSPGGLLNMVSKRPTTEP
LKEVQFKAGTDSLFQTGFDFSDSLDDDGVYSYRLTGLARSANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPE
TGYYGWLPKEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKTSQNSVYGYGVCSD
PANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFATGDIDHTLLTGVDFMRMRNDINAWFGYDDSVPLL
NLYNPSSHHHHHHGSSVNTDFDFNAKDPANSGPYRILNKQKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTD
KRDDKQFTWRGGVNYLFDNGVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAVYNLTKTNNL
MADPEGSFFSVEGGEIRARGVEIEAKAALSASVNVVGSYTYTDAEYTTDTTYKGNTPAQVPKHMASLWADYTFFDGPLSG
LTLGTGGRYTGSSYGDPANSFKVGSYTVVDALVRYDLARVGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVAT
ATFRF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   VAL n 
1 3   GLU n 
1 4   PRO n 
1 5   LYS n 
1 6   GLU n 
1 7   ASP n 
1 8   THR n 
1 9   ILE n 
1 10  THR n 
1 11  VAL n 
1 12  THR n 
1 13  ALA n 
1 14  ALA n 
1 15  PRO n 
1 16  ALA n 
1 17  PRO n 
1 18  GLN n 
1 19  GLU n 
1 20  SER n 
1 21  ALA n 
1 22  TRP n 
1 23  GLY n 
1 24  PRO n 
1 25  ALA n 
1 26  ALA n 
1 27  THR n 
1 28  ILE n 
1 29  ALA n 
1 30  ALA n 
1 31  ARG n 
1 32  GLN n 
1 33  SER n 
1 34  ALA n 
1 35  THR n 
1 36  GLY n 
1 37  THR n 
1 38  LYS n 
1 39  THR n 
1 40  ASP n 
1 41  THR n 
1 42  PRO n 
1 43  ILE n 
1 44  GLN n 
1 45  LYS n 
1 46  VAL n 
1 47  PRO n 
1 48  GLN n 
1 49  SER n 
1 50  ILE n 
1 51  SER n 
1 52  VAL n 
1 53  VAL n 
1 54  THR n 
1 55  ALA n 
1 56  GLU n 
1 57  GLU n 
1 58  MET n 
1 59  ALA n 
1 60  LEU n 
1 61  HIS n 
1 62  GLN n 
1 63  PRO n 
1 64  LYS n 
1 65  SER n 
1 66  VAL n 
1 67  LYS n 
1 68  GLU n 
1 69  ALA n 
1 70  LEU n 
1 71  SER n 
1 72  TYR n 
1 73  THR n 
1 74  PRO n 
1 75  GLY n 
1 76  VAL n 
1 77  SER n 
1 78  VAL n 
1 79  GLY n 
1 80  THR n 
1 81  ARG n 
1 82  GLY n 
1 83  ALA n 
1 84  SER n 
1 85  ASN n 
1 86  THR n 
1 87  TYR n 
1 88  ASP n 
1 89  HIS n 
1 90  LEU n 
1 91  ILE n 
1 92  ILE n 
1 93  ARG n 
1 94  GLY n 
1 95  PHE n 
1 96  ALA n 
1 97  ALA n 
1 98  GLU n 
1 99  GLY n 
1 100 GLN n 
1 101 SER n 
1 102 GLN n 
1 103 ASN n 
1 104 ASN n 
1 105 TYR n 
1 106 LEU n 
1 107 ASN n 
1 108 GLY n 
1 109 LEU n 
1 110 LYS n 
1 111 LEU n 
1 112 GLN n 
1 113 GLY n 
1 114 ASN n 
1 115 PHE n 
1 116 TYR n 
1 117 ASN n 
1 118 ASP n 
1 119 ALA n 
1 120 VAL n 
1 121 ILE n 
1 122 ASP n 
1 123 PRO n 
1 124 TYR n 
1 125 MET n 
1 126 LEU n 
1 127 GLU n 
1 128 ARG n 
1 129 ALA n 
1 130 GLU n 
1 131 ILE n 
1 132 MET n 
1 133 ARG n 
1 134 GLY n 
1 135 PRO n 
1 136 VAL n 
1 137 SER n 
1 138 VAL n 
1 139 LEU n 
1 140 TYR n 
1 141 GLY n 
1 142 LYS n 
1 143 SER n 
1 144 SER n 
1 145 PRO n 
1 146 GLY n 
1 147 GLY n 
1 148 LEU n 
1 149 LEU n 
1 150 ASN n 
1 151 MET n 
1 152 VAL n 
1 153 SER n 
1 154 LYS n 
1 155 ARG n 
1 156 PRO n 
1 157 THR n 
1 158 THR n 
1 159 GLU n 
1 160 PRO n 
1 161 LEU n 
1 162 LYS n 
1 163 GLU n 
1 164 VAL n 
1 165 GLN n 
1 166 PHE n 
1 167 LYS n 
1 168 ALA n 
1 169 GLY n 
1 170 THR n 
1 171 ASP n 
1 172 SER n 
1 173 LEU n 
1 174 PHE n 
1 175 GLN n 
1 176 THR n 
1 177 GLY n 
1 178 PHE n 
1 179 ASP n 
1 180 PHE n 
1 181 SER n 
1 182 ASP n 
1 183 SER n 
1 184 LEU n 
1 185 ASP n 
1 186 ASP n 
1 187 ASP n 
1 188 GLY n 
1 189 VAL n 
1 190 TYR n 
1 191 SER n 
1 192 TYR n 
1 193 ARG n 
1 194 LEU n 
1 195 THR n 
1 196 GLY n 
1 197 LEU n 
1 198 ALA n 
1 199 ARG n 
1 200 SER n 
1 201 ALA n 
1 202 ASN n 
1 203 ALA n 
1 204 GLN n 
1 205 GLN n 
1 206 LYS n 
1 207 GLY n 
1 208 SER n 
1 209 GLU n 
1 210 GLU n 
1 211 GLN n 
1 212 ARG n 
1 213 TYR n 
1 214 ALA n 
1 215 ILE n 
1 216 ALA n 
1 217 PRO n 
1 218 ALA n 
1 219 PHE n 
1 220 THR n 
1 221 TRP n 
1 222 ARG n 
1 223 PRO n 
1 224 ASP n 
1 225 ASP n 
1 226 LYS n 
1 227 THR n 
1 228 ASN n 
1 229 PHE n 
1 230 THR n 
1 231 PHE n 
1 232 LEU n 
1 233 SER n 
1 234 TYR n 
1 235 PHE n 
1 236 GLN n 
1 237 ASN n 
1 238 GLU n 
1 239 PRO n 
1 240 GLU n 
1 241 THR n 
1 242 GLY n 
1 243 TYR n 
1 244 TYR n 
1 245 GLY n 
1 246 TRP n 
1 247 LEU n 
1 248 PRO n 
1 249 LYS n 
1 250 GLU n 
1 251 GLY n 
1 252 THR n 
1 253 VAL n 
1 254 GLU n 
1 255 PRO n 
1 256 LEU n 
1 257 PRO n 
1 258 ASN n 
1 259 GLY n 
1 260 LYS n 
1 261 ARG n 
1 262 LEU n 
1 263 PRO n 
1 264 THR n 
1 265 ASP n 
1 266 PHE n 
1 267 ASN n 
1 268 GLU n 
1 269 GLY n 
1 270 ALA n 
1 271 LYS n 
1 272 ASN n 
1 273 ASN n 
1 274 THR n 
1 275 TYR n 
1 276 SER n 
1 277 ARG n 
1 278 ASN n 
1 279 GLU n 
1 280 LYS n 
1 281 MET n 
1 282 VAL n 
1 283 GLY n 
1 284 TYR n 
1 285 SER n 
1 286 PHE n 
1 287 ASP n 
1 288 HIS n 
1 289 GLU n 
1 290 PHE n 
1 291 ASN n 
1 292 ASP n 
1 293 THR n 
1 294 PHE n 
1 295 THR n 
1 296 VAL n 
1 297 ARG n 
1 298 GLN n 
1 299 ASN n 
1 300 LEU n 
1 301 ARG n 
1 302 PHE n 
1 303 ALA n 
1 304 GLU n 
1 305 ASN n 
1 306 LYS n 
1 307 THR n 
1 308 SER n 
1 309 GLN n 
1 310 ASN n 
1 311 SER n 
1 312 VAL n 
1 313 TYR n 
1 314 GLY n 
1 315 TYR n 
1 316 GLY n 
1 317 VAL n 
1 318 CYS n 
1 319 SER n 
1 320 ASP n 
1 321 PRO n 
1 322 ALA n 
1 323 ASN n 
1 324 ALA n 
1 325 TYR n 
1 326 SER n 
1 327 LYS n 
1 328 GLN n 
1 329 CYS n 
1 330 ALA n 
1 331 ALA n 
1 332 LEU n 
1 333 ALA n 
1 334 PRO n 
1 335 ALA n 
1 336 ASP n 
1 337 LYS n 
1 338 GLY n 
1 339 HIS n 
1 340 TYR n 
1 341 LEU n 
1 342 ALA n 
1 343 ARG n 
1 344 LYS n 
1 345 TYR n 
1 346 VAL n 
1 347 VAL n 
1 348 ASP n 
1 349 ASP n 
1 350 GLU n 
1 351 LYS n 
1 352 LEU n 
1 353 GLN n 
1 354 ASN n 
1 355 PHE n 
1 356 SER n 
1 357 VAL n 
1 358 ASP n 
1 359 THR n 
1 360 GLN n 
1 361 LEU n 
1 362 GLN n 
1 363 SER n 
1 364 LYS n 
1 365 PHE n 
1 366 ALA n 
1 367 THR n 
1 368 GLY n 
1 369 ASP n 
1 370 ILE n 
1 371 ASP n 
1 372 HIS n 
1 373 THR n 
1 374 LEU n 
1 375 LEU n 
1 376 THR n 
1 377 GLY n 
1 378 VAL n 
1 379 ASP n 
1 380 PHE n 
1 381 MET n 
1 382 ARG n 
1 383 MET n 
1 384 ARG n 
1 385 ASN n 
1 386 ASP n 
1 387 ILE n 
1 388 ASN n 
1 389 ALA n 
1 390 TRP n 
1 391 PHE n 
1 392 GLY n 
1 393 TYR n 
1 394 ASP n 
1 395 ASP n 
1 396 SER n 
1 397 VAL n 
1 398 PRO n 
1 399 LEU n 
1 400 LEU n 
1 401 ASN n 
1 402 LEU n 
1 403 TYR n 
1 404 ASN n 
1 405 PRO n 
1 406 SER n 
1 407 SER n 
1 408 HIS n 
1 409 HIS n 
1 410 HIS n 
1 411 HIS n 
1 412 HIS n 
1 413 HIS n 
1 414 GLY n 
1 415 SER n 
1 416 SER n 
1 417 VAL n 
1 418 ASN n 
1 419 THR n 
1 420 ASP n 
1 421 PHE n 
1 422 ASP n 
1 423 PHE n 
1 424 ASN n 
1 425 ALA n 
1 426 LYS n 
1 427 ASP n 
1 428 PRO n 
1 429 ALA n 
1 430 ASN n 
1 431 SER n 
1 432 GLY n 
1 433 PRO n 
1 434 TYR n 
1 435 ARG n 
1 436 ILE n 
1 437 LEU n 
1 438 ASN n 
1 439 LYS n 
1 440 GLN n 
1 441 LYS n 
1 442 GLN n 
1 443 THR n 
1 444 GLY n 
1 445 VAL n 
1 446 TYR n 
1 447 VAL n 
1 448 GLN n 
1 449 ASP n 
1 450 GLN n 
1 451 ALA n 
1 452 GLN n 
1 453 TRP n 
1 454 ASP n 
1 455 LYS n 
1 456 VAL n 
1 457 LEU n 
1 458 VAL n 
1 459 THR n 
1 460 LEU n 
1 461 GLY n 
1 462 GLY n 
1 463 ARG n 
1 464 TYR n 
1 465 ASP n 
1 466 TRP n 
1 467 ALA n 
1 468 ASP n 
1 469 GLN n 
1 470 GLU n 
1 471 SER n 
1 472 LEU n 
1 473 ASN n 
1 474 ARG n 
1 475 VAL n 
1 476 ALA n 
1 477 GLY n 
1 478 THR n 
1 479 THR n 
1 480 ASP n 
1 481 LYS n 
1 482 ARG n 
1 483 ASP n 
1 484 ASP n 
1 485 LYS n 
1 486 GLN n 
1 487 PHE n 
1 488 THR n 
1 489 TRP n 
1 490 ARG n 
1 491 GLY n 
1 492 GLY n 
1 493 VAL n 
1 494 ASN n 
1 495 TYR n 
1 496 LEU n 
1 497 PHE n 
1 498 ASP n 
1 499 ASN n 
1 500 GLY n 
1 501 VAL n 
1 502 THR n 
1 503 PRO n 
1 504 TYR n 
1 505 PHE n 
1 506 SER n 
1 507 TYR n 
1 508 SER n 
1 509 GLU n 
1 510 SER n 
1 511 PHE n 
1 512 GLU n 
1 513 PRO n 
1 514 SER n 
1 515 SER n 
1 516 GLN n 
1 517 VAL n 
1 518 GLY n 
1 519 LYS n 
1 520 ASP n 
1 521 GLY n 
1 522 ASN n 
1 523 ILE n 
1 524 PHE n 
1 525 ALA n 
1 526 PRO n 
1 527 SER n 
1 528 LYS n 
1 529 GLY n 
1 530 LYS n 
1 531 GLN n 
1 532 TYR n 
1 533 GLU n 
1 534 VAL n 
1 535 GLY n 
1 536 VAL n 
1 537 LYS n 
1 538 TYR n 
1 539 VAL n 
1 540 PRO n 
1 541 GLU n 
1 542 ASP n 
1 543 ARG n 
1 544 PRO n 
1 545 ILE n 
1 546 VAL n 
1 547 VAL n 
1 548 THR n 
1 549 GLY n 
1 550 ALA n 
1 551 VAL n 
1 552 TYR n 
1 553 ASN n 
1 554 LEU n 
1 555 THR n 
1 556 LYS n 
1 557 THR n 
1 558 ASN n 
1 559 ASN n 
1 560 LEU n 
1 561 MET n 
1 562 ALA n 
1 563 ASP n 
1 564 PRO n 
1 565 GLU n 
1 566 GLY n 
1 567 SER n 
1 568 PHE n 
1 569 PHE n 
1 570 SER n 
1 571 VAL n 
1 572 GLU n 
1 573 GLY n 
1 574 GLY n 
1 575 GLU n 
1 576 ILE n 
1 577 ARG n 
1 578 ALA n 
1 579 ARG n 
1 580 GLY n 
1 581 VAL n 
1 582 GLU n 
1 583 ILE n 
1 584 GLU n 
1 585 ALA n 
1 586 LYS n 
1 587 ALA n 
1 588 ALA n 
1 589 LEU n 
1 590 SER n 
1 591 ALA n 
1 592 SER n 
1 593 VAL n 
1 594 ASN n 
1 595 VAL n 
1 596 VAL n 
1 597 GLY n 
1 598 SER n 
1 599 TYR n 
1 600 THR n 
1 601 TYR n 
1 602 THR n 
1 603 ASP n 
1 604 ALA n 
1 605 GLU n 
1 606 TYR n 
1 607 THR n 
1 608 THR n 
1 609 ASP n 
1 610 THR n 
1 611 THR n 
1 612 TYR n 
1 613 LYS n 
1 614 GLY n 
1 615 ASN n 
1 616 THR n 
1 617 PRO n 
1 618 ALA n 
1 619 GLN n 
1 620 VAL n 
1 621 PRO n 
1 622 LYS n 
1 623 HIS n 
1 624 MET n 
1 625 ALA n 
1 626 SER n 
1 627 LEU n 
1 628 TRP n 
1 629 ALA n 
1 630 ASP n 
1 631 TYR n 
1 632 THR n 
1 633 PHE n 
1 634 PHE n 
1 635 ASP n 
1 636 GLY n 
1 637 PRO n 
1 638 LEU n 
1 639 SER n 
1 640 GLY n 
1 641 LEU n 
1 642 THR n 
1 643 LEU n 
1 644 GLY n 
1 645 THR n 
1 646 GLY n 
1 647 GLY n 
1 648 ARG n 
1 649 TYR n 
1 650 THR n 
1 651 GLY n 
1 652 SER n 
1 653 SER n 
1 654 TYR n 
1 655 GLY n 
1 656 ASP n 
1 657 PRO n 
1 658 ALA n 
1 659 ASN n 
1 660 SER n 
1 661 PHE n 
1 662 LYS n 
1 663 VAL n 
1 664 GLY n 
1 665 SER n 
1 666 TYR n 
1 667 THR n 
1 668 VAL n 
1 669 VAL n 
1 670 ASP n 
1 671 ALA n 
1 672 LEU n 
1 673 VAL n 
1 674 ARG n 
1 675 TYR n 
1 676 ASP n 
1 677 LEU n 
1 678 ALA n 
1 679 ARG n 
1 680 VAL n 
1 681 GLY n 
1 682 MET n 
1 683 ALA n 
1 684 GLY n 
1 685 SER n 
1 686 ASN n 
1 687 VAL n 
1 688 ALA n 
1 689 LEU n 
1 690 HIS n 
1 691 VAL n 
1 692 ASN n 
1 693 ASN n 
1 694 LEU n 
1 695 PHE n 
1 696 ASP n 
1 697 ARG n 
1 698 GLU n 
1 699 TYR n 
1 700 VAL n 
1 701 ALA n 
1 702 SER n 
1 703 CYS n 
1 704 PHE n 
1 705 ASN n 
1 706 THR n 
1 707 TYR n 
1 708 GLY n 
1 709 CYS n 
1 710 PHE n 
1 711 TRP n 
1 712 GLY n 
1 713 ALA n 
1 714 GLU n 
1 715 ARG n 
1 716 GLN n 
1 717 VAL n 
1 718 VAL n 
1 719 ALA n 
1 720 THR n 
1 721 ALA n 
1 722 THR n 
1 723 PHE n 
1 724 ARG n 
1 725 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    K-12 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              'RA CHEMOTYPE' 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 BACTERIAL 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               AW740 
_entity_src_gen.pdbx_host_org_variant              'RA CHEMOTYPE' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    'OUTER MEMBRANE' 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PHX405 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_code                    FHUA_ECOLI 
_struct_ref.db_name                    UNP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P06971 
_struct_ref.pdbx_align_begin           34 
_struct_ref.pdbx_seq_one_letter_code   
;AVEPKEDTITVTAAPAPQESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALSYTPGVSVGT
RGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAVIDPYMLERAEIMRGPVSVLYGKSSPGGLLNMVSKRPTTEP
LKEVQFKAGTDSLFQTGFDFSDSLDDDGVYSYRLTGLARSANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPE
TGYYGWLPKEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKTSQNSVYGYGVCSD
PANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFATGDIDHTLLTGVDFMRMRNDINAWFGYDDSVPLL
NLYNPVNTDFDFNAKDPANSGPYRILNKQKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTDKRDDKQFTWRG
GVNYLFDNGVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAVYNLTKTNNLMADPEGSFFSV
EGGEIRARGVEIEAKAALSASVNVVGSYTYTDAEYTTDTTYKGNTPAQVPKHMASLWADYTFFDGPLSGLTLGTGGRYTG
SSYGDPANSFKVGSYTVVDALVRYDLARVGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVATATFRF
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1QFG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 725 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P06971 
_struct_ref_seq.db_align_beg                  34 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  747 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       725 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1QFG SER A 406 ? UNP P06971 ? ? 'INTRACHAIN HIS TAG' 406 1  
1 1QFG SER A 407 ? UNP P06971 ? ? 'INTRACHAIN HIS TAG' 407 2  
1 1QFG HIS A 408 ? UNP P06971 ? ? 'INTRACHAIN HIS TAG' 408 3  
1 1QFG HIS A 409 ? UNP P06971 ? ? 'INTRACHAIN HIS TAG' 409 4  
1 1QFG HIS A 410 ? UNP P06971 ? ? 'INTRACHAIN HIS TAG' 410 5  
1 1QFG HIS A 411 ? UNP P06971 ? ? 'INTRACHAIN HIS TAG' 411 6  
1 1QFG HIS A 412 ? UNP P06971 ? ? 'INTRACHAIN HIS TAG' 412 7  
1 1QFG HIS A 413 ? UNP P06971 ? ? 'INTRACHAIN HIS TAG' 413 8  
1 1QFG GLY A 414 ? UNP P06971 ? ? 'INTRACHAIN HIS TAG' 414 9  
1 1QFG SER A 415 ? UNP P06971 ? ? 'INTRACHAIN HIS TAG' 415 10 
1 1QFG SER A 416 ? UNP P06971 ? ? 'INTRACHAIN HIS TAG' 416 11 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                           ?                               'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking'           y ARGININE                                          ?                               
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                        ?                               
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                   ?                               'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking'           y CYSTEINE                                          ?                               
'C3 H7 N O2 S'   121.158 
DAO non-polymer                   . 'LAURIC ACID'                                     ?                               'C12 H24 O2' 
200.318 
DDQ non-polymer                   . DECYLAMINE-N,N-DIMETHYL-N-OXIDE                   ?                               
'C12 H27 N O'    201.349 
DPO non-polymer                   . DIPHOSPHATE                                       ?                               'O7 P2 -4' 
173.943 
FTT non-polymer                   . '3-HYDROXY-TETRADECANOIC ACID'                    '3-HYDROXY-MYRISTIC ACID'       'C14 H28 O3' 
244.370 
GCN 'D-saccharide, alpha linking' . 2-amino-2,3-dideoxy-alpha-D-glucoyranose          ?                               
'C6 H13 N O4'    163.172 
GLA 'D-saccharide, alpha linking' . alpha-D-galactopyranose                           ?                               'C6 H12 O6' 
180.156 
GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose                             ?                               'C6 H12 O6' 
180.156 
GLN 'L-peptide linking'           y GLUTAMINE                                         ?                               
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                   ?                               'C5 H9 N O4' 
147.129 
GLY 'peptide linking'             y GLYCINE                                           ?                               'C2 H5 N O2' 
75.067  
GMH 'D-saccharide, alpha linking' . L-glycero-alpha-D-manno-heptopyranose             ?                               'C7 H14 O7' 
210.182 
GOL non-polymer                   . GLYCEROL                                          'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 
92.094  
HIS 'L-peptide linking'           y HISTIDINE                                         ?                               
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                             ?                               'H2 O' 
18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                        ?                               
'C6 H13 N O2'    131.173 
KDO 'D-saccharide, alpha linking' . '3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid' ?                               'C8 H14 O8' 
238.192 
LEU 'L-peptide linking'           y LEUCINE                                           ?                               
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                            ?                               
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                                        ?                               
'C5 H11 N O2 S'  149.211 
MYR non-polymer                   . 'MYRISTIC ACID'                                   ?                               'C14 H28 O2' 
228.371 
NI  non-polymer                   . 'NICKEL (II) ION'                                 ?                               'Ni 2' 
58.693  
PA1 'D-saccharide, alpha linking' . 2-amino-2-deoxy-alpha-D-glucopyranose             ?                               
'C6 H13 N O5'    179.171 
PHE 'L-peptide linking'           y PHENYLALANINE                                     ?                               
'C9 H11 N O2'    165.189 
PO4 non-polymer                   . 'PHOSPHATE ION'                                   ?                               'O4 P -3' 
94.971  
PRO 'L-peptide linking'           y PROLINE                                           ?                               'C5 H9 N O2' 
115.130 
SER 'L-peptide linking'           y SERINE                                            ?                               'C3 H7 N O3' 
105.093 
THR 'L-peptide linking'           y THREONINE                                         ?                               'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                        ?                               
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                          ?                               
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                            ?                               
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QFG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.65 
_exptl_crystal.density_percent_sol   73.54 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.4 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;100MM SODIUM CACODYLATE (PH 6.4), 12.5% PEG 2000 MONOMETHYLETHER, 20% GLYCEROL, 
1% CIS-INOSITOL, 3% PEG 200, VAPOR DIFFUSION, HANGING DROP, temperature 290K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1998-08-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.051 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I711' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I711 
_diffrn_source.pdbx_wavelength             1.051 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QFG 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             42.300 
_reflns.d_resolution_high            2.450 
_reflns.number_obs                   53749 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            0.078 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.0000 
_reflns.B_iso_Wilson_estimate        43.12 
_reflns.pdbx_redundancy              6.400 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.d_res_high             2.45 
_reflns_shell.d_res_low              2.50 
_reflns_shell.percent_possible_all   92.2 
_reflns_shell.Rmerge_I_obs           0.334 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        3.10 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.entry_id                                 1QFG 
_refine.ls_number_reflns_obs                     50668 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             42.3 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    99.5 
_refine.ls_R_factor_obs                          0.221 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.221 
_refine.ls_R_factor_R_free                       0.271 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.600 
_refine.ls_number_reflns_R_free                  2309 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               65.40 
_refine.aniso_B[1][1]                            -13.78000 
_refine.aniso_B[2][2]                            -13.78000 
_refine.aniso_B[3][3]                            27.55000 
_refine.aniso_B[1][2]                            2.99000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.30 
_refine.solvent_model_param_bsol                 53.33 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'MOD. ENGH&HUBER PROTEIN_REP.PARAM (CNS)' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1QFG 
_refine_analyze.Luzzati_coordinate_error_obs    0.34 
_refine_analyze.Luzzati_sigma_a_obs             0.62 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.42 
_refine_analyze.Luzzati_sigma_a_free            0.70 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5524 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         309 
_refine_hist.number_atoms_solvent             244 
_refine_hist.number_atoms_total               6077 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        42.3 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.026 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             2.70  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      28.30 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.72  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             5.44  2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            6.60  3.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             7.88  3.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            9.26  4.000 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.66 
_refine_ls_shell.number_reflns_R_work             7897 
_refine_ls_shell.R_factor_R_work                  0.412 
_refine_ls_shell.percent_reflns_obs               99.20 
_refine_ls_shell.R_factor_R_free                  0.417 
_refine_ls_shell.R_factor_R_free_error            0.020 
_refine_ls_shell.percent_reflns_R_free            5.40 
_refine_ls_shell.number_reflns_R_free             454 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM  PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM    ?           'X-RAY DIFFRACTION' 
3 ION.PARAM          ?           'X-RAY DIFFRACTION' 
4 CARBOHYDRATE.PARAM ?           'X-RAY DIFFRACTION' 
5 FHUA.PARAM         ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1QFG 
_struct.title                     'E. COLI FERRIC HYDROXAMATE RECEPTOR (FHUA)' 
_struct.pdbx_descriptor           'FERRIC HYDROXAMATE UPTAKE RECEPTOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QFG 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
_struct_keywords.text            
;TONB-DEPENDENT RECEPTOR, INTEGRAL OUTER MEMBRANE PROTEIN, FERRICHROME-IRON RECEPTOR, ACTIVE TRANSPORT, IRON TRANSPORT PROTEIN, LIPOPOLYSACCHARIDE, METAL TRANSPORT
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 4  ? 
F N N 5  ? 
G N N 5  ? 
H N N 5  ? 
I N N 6  ? 
J N N 5  ? 
K N N 7  ? 
L N N 8  ? 
M N N 8  ? 
N N N 8  ? 
O N N 9  ? 
P N N 9  ? 
Q N N 10 ? 
R N N 10 ? 
S N N 10 ? 
T N N 10 ? 
U N N 10 ? 
V N N 10 ? 
W N N 10 ? 
X N N 10 ? 
Y N N 11 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 23  ? ALA A 30  ? GLY A 23  ALA A 30  1 ? 8 
HELX_P HELX_P2  2  GLN A 44  ? VAL A 46  ? GLN A 44  VAL A 46  5 ? 3 
HELX_P HELX_P3  3  ALA A 55  ? GLN A 62  ? ALA A 55  GLN A 62  1 ? 8 
HELX_P HELX_P4  4  SER A 65  ? LEU A 70  ? SER A 65  LEU A 70  1 ? 6 
HELX_P HELX_P5  5  ALA A 97  ? SER A 101 ? ALA A 97  SER A 101 5 ? 5 
HELX_P HELX_P6  6  ASP A 122 ? TYR A 124 ? ASP A 122 TYR A 124 5 ? 3 
HELX_P HELX_P7  7  VAL A 136 ? GLY A 141 ? VAL A 136 GLY A 141 1 ? 6 
HELX_P HELX_P8  8  ASP A 320 ? ALA A 324 ? ASP A 320 ALA A 324 5 ? 5 
HELX_P HELX_P9  9  SER A 326 ? ALA A 331 ? SER A 326 ALA A 331 1 ? 6 
HELX_P HELX_P10 10 SER A 407 ? GLY A 414 ? SER A 407 GLY A 414 1 ? 8 
HELX_P HELX_P11 11 LEU A 677 ? GLY A 681 ? LEU A 677 GLY A 681 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 318 SG ? ? ? 1_555 A CYS 329 SG ? ? A CYS 318  A CYS 329  1_555 ? ? ? ? ? ? ? 2.087 ? ? 
disulf2  disulf ?    ? A CYS 703 SG ? ? ? 1_555 A CYS 709 SG ? ? A CYS 703  A CYS 709  1_555 ? ? ? ? ? ? ? 2.004 ? ? 
covale1  covale one  ? F FTT .   C1 ? ? ? 1_555 B PA1 .   N2 ? ? A FTT 1009 B PA1 1    1_555 ? ? ? ? ? ? ? 1.367 ? ? 
covale2  covale none ? G FTT .   O1 ? ? ? 1_555 B PA1 .   C3 ? ? A FTT 1010 B PA1 1    1_555 ? ? ? ? ? ? ? 1.467 ? ? 
covale3  covale one  ? H FTT .   O3 ? ? ? 1_555 I DAO .   C1 ? ? A FTT 1011 A DAO 1012 1_555 ? ? ? ? ? ? ? 1.404 ? ? 
covale4  covale one  ? H FTT .   C1 ? ? ? 1_555 B GCN .   N2 ? ? A FTT 1011 B GCN 2    1_555 ? ? ? ? ? ? ? 1.337 ? ? 
covale5  covale one  ? J FTT .   O3 ? ? ? 1_555 K MYR .   C1 ? ? A FTT 1013 A MYR 1014 1_555 ? ? ? ? ? ? ? 1.381 ? ? 
covale6  covale none ? J FTT .   O1 ? ? ? 1_555 B GCN .   C3 ? ? A FTT 1013 B GCN 2    1_555 ? ? ? ? ? ? ? 1.434 ? ? 
covale7  covale one  ? O DPO .   P1 ? ? ? 1_555 B PA1 .   O1 ? ? A DPO 2000 B PA1 1    1_555 ? ? ? ? ? ? ? 1.555 ? ? 
covale8  covale one  ? B PA1 .   O6 ? ? ? 1_555 B GCN .   C1 ? ? B PA1 1    B GCN 2    1_555 ? ? ? ? ? ? ? 1.368 ? ? 
covale9  covale one  ? B GCN .   O6 ? ? ? 1_555 B KDO .   C2 ? ? B GCN 2    B KDO 3    1_555 ? ? ? ? ? ? ? 1.408 ? ? 
covale10 covale one  ? B KDO .   O5 ? ? ? 1_555 B GMH .   C1 ? ? B KDO 3    B GMH 4    1_555 ? ? ? ? ? ? ? 1.398 ? ? 
covale11 covale one  ? B KDO .   O4 ? ? ? 1_555 B KDO .   C2 ? ? B KDO 3    B KDO 9    1_555 ? ? ? ? ? ? ? 1.397 ? ? 
covale12 covale one  ? B GMH .   O3 ? ? ? 1_555 B GMH .   C1 ? ? B GMH 4    B GMH 5    1_555 ? ? ? ? ? ? ? 1.448 ? ? 
covale13 covale one  ? B GMH .   O3 ? ? ? 1_555 B GLC .   C1 ? ? B GMH 5    B GLC 6    1_555 ? ? ? ? ? ? ? 1.412 ? ? 
covale14 covale one  ? B GLC .   O3 ? ? ? 1_555 B GLC .   C1 ? ? B GLC 6    B GLC 7    1_555 ? ? ? ? ? ? ? 1.406 ? ? 
covale15 covale one  ? B GLC .   O6 ? ? ? 1_555 B GLA .   C1 ? ? B GLC 6    B GLA 8    1_555 ? ? ? ? ? ? ? 1.397 ? ? 
metalc1  metalc ?    ? C NI  .   NI ? ? ? 1_555 E PO4 .   O3 ? ? A NI  1030 A PO4 2005 1_555 ? ? ? ? ? ? ? 2.145 ? ? 
metalc2  metalc ?    ? C NI  .   NI ? ? ? 1_555 E PO4 .   O4 ? ? A NI  1030 A PO4 2005 1_555 ? ? ? ? ? ? ? 2.659 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2  ? 
B ? 5  ? 
C ? 2  ? 
D ? 23 ? 
E ? 2  ? 
F ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? parallel      
B 4  5  ? anti-parallel 
C 1  2  ? anti-parallel 
D 1  2  ? anti-parallel 
D 2  3  ? anti-parallel 
D 3  4  ? anti-parallel 
D 4  5  ? anti-parallel 
D 5  6  ? anti-parallel 
D 6  7  ? anti-parallel 
D 7  8  ? anti-parallel 
D 8  9  ? anti-parallel 
D 9  10 ? anti-parallel 
D 10 11 ? anti-parallel 
D 11 12 ? anti-parallel 
D 12 13 ? anti-parallel 
D 13 14 ? anti-parallel 
D 14 15 ? anti-parallel 
D 15 16 ? anti-parallel 
D 16 17 ? anti-parallel 
D 17 18 ? anti-parallel 
D 18 19 ? anti-parallel 
D 19 20 ? anti-parallel 
D 20 21 ? anti-parallel 
D 21 22 ? anti-parallel 
D 22 23 ? anti-parallel 
E 1  2  ? anti-parallel 
F 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  GLN A 32  ? SER A 33  ? GLN A 32  SER A 33  
A 2  THR A 41  ? PRO A 42  ? THR A 41  PRO A 42  
B 1  ILE A 50  ? THR A 54  ? ILE A 50  THR A 54  
B 2  LEU A 126 ? ARG A 133 ? LEU A 126 ARG A 133 
B 3  GLY A 147 ? SER A 153 ? GLY A 147 SER A 153 
B 4  ASN A 104 ? LEU A 106 ? ASN A 104 LEU A 106 
B 5  LEU A 109 ? LYS A 110 ? LEU A 109 LYS A 110 
C 1  VAL A 76  ? SER A 77  ? VAL A 76  SER A 77  
C 2  ILE A 91  ? ILE A 92  ? ILE A 91  ILE A 92  
D 1  LEU A 161 ? GLY A 169 ? LEU A 161 GLY A 169 
D 2  PHE A 174 ? SER A 183 ? PHE A 174 SER A 183 
D 3  TYR A 190 ? ASN A 202 ? TYR A 190 ASN A 202 
D 4  GLU A 209 ? TRP A 221 ? GLU A 209 TRP A 221 
D 5  THR A 227 ? GLU A 238 ? THR A 227 GLU A 238 
D 6  THR A 274 ? GLU A 289 ? THR A 274 GLU A 289 
D 7  PHE A 294 ? VAL A 317 ? PHE A 294 VAL A 317 
D 8  TYR A 340 ? THR A 367 ? TYR A 340 THR A 367 
D 9  ILE A 370 ? ASN A 401 ? ILE A 370 ASN A 401 
D 10 SER A 431 ? TRP A 453 ? SER A 431 TRP A 453 
D 11 VAL A 456 ? ASN A 473 ? VAL A 456 ASN A 473 
D 12 THR A 478 ? TYR A 495 ? THR A 478 TYR A 495 
D 13 THR A 502 ? GLU A 512 ? THR A 502 GLU A 512 
D 14 SER A 527 ? TYR A 538 ? SER A 527 TYR A 538 
D 15 ILE A 545 ? ALA A 562 ? ILE A 545 ALA A 562 
D 16 SER A 570 ? SER A 590 ? SER A 570 SER A 590 
D 17 VAL A 593 ? THR A 608 ? VAL A 593 THR A 608 
D 18 HIS A 623 ? PHE A 633 ? HIS A 623 PHE A 633 
D 19 LEU A 641 ? THR A 650 ? LEU A 641 THR A 650 
D 20 TYR A 666 ? TYR A 675 ? TYR A 666 TYR A 675 
D 21 ASN A 686 ? ASN A 692 ? ASN A 686 ASN A 692 
D 22 GLN A 716 ? PHE A 725 ? GLN A 716 PHE A 725 
D 23 LEU A 161 ? GLY A 169 ? LEU A 161 GLY A 169 
E 1  SER A 653 ? TYR A 654 ? SER A 653 TYR A 654 
E 2  LYS A 662 ? VAL A 663 ? LYS A 662 VAL A 663 
F 1  VAL A 700 ? ASN A 705 ? VAL A 700 ASN A 705 
F 2  GLY A 708 ? TRP A 711 ? GLY A 708 TRP A 711 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O SER A 33  ? O SER A 33  N THR A 41  ? N THR A 41  
B 1  2  N VAL A 53  ? N VAL A 53  O ALA A 129 ? O ALA A 129 
B 2  3  N MET A 132 ? N MET A 132 O LEU A 148 ? O LEU A 148 
B 3  4  O LEU A 149 ? O LEU A 149 N TYR A 105 ? N TYR A 105 
B 4  5  N LEU A 106 ? N LEU A 106 O LEU A 109 ? O LEU A 109 
C 1  2  N SER A 77  ? N SER A 77  O ILE A 91  ? O ILE A 91  
D 1  2  O LYS A 167 ? O LYS A 167 N GLN A 175 ? N GLN A 175 
D 2  3  O ASP A 182 ? O ASP A 182 N TYR A 192 ? N TYR A 192 
D 3  4  O ALA A 201 ? O ALA A 201 N GLU A 210 ? N GLU A 210 
D 4  5  N TRP A 221 ? N TRP A 221 O PHE A 229 ? O PHE A 229 
D 5  6  O GLU A 238 ? O GLU A 238 N ARG A 277 ? N ARG A 277 
D 6  7  O HIS A 288 ? O HIS A 288 N VAL A 296 ? N VAL A 296 
D 7  8  O GLY A 316 ? O GLY A 316 N ALA A 342 ? N ALA A 342 
D 8  9  N THR A 367 ? N THR A 367 O ILE A 370 ? O ILE A 370 
D 9  10 O PHE A 391 ? O PHE A 391 N GLY A 432 ? N GLY A 432 
D 10 11 N TRP A 453 ? N TRP A 453 O VAL A 456 ? O VAL A 456 
D 11 12 N ASN A 473 ? N ASN A 473 O THR A 478 ? O THR A 478 
D 12 13 N TYR A 495 ? N TYR A 495 O PRO A 503 ? O PRO A 503 
D 13 14 N GLU A 512 ? N GLU A 512 O SER A 527 ? O SER A 527 
D 14 15 N TYR A 538 ? N TYR A 538 O VAL A 547 ? O VAL A 547 
D 15 16 N MET A 561 ? N MET A 561 O VAL A 571 ? O VAL A 571 
D 16 17 N LEU A 589 ? N LEU A 589 O VAL A 593 ? O VAL A 593 
D 17 18 N THR A 600 ? N THR A 600 O MET A 624 ? O MET A 624 
D 18 19 N PHE A 633 ? N PHE A 633 O LEU A 641 ? O LEU A 641 
D 19 20 N THR A 650 ? N THR A 650 O TYR A 666 ? O TYR A 666 
D 20 21 N TYR A 675 ? N TYR A 675 O VAL A 687 ? O VAL A 687 
D 21 22 O ASN A 692 ? O ASN A 692 N GLN A 716 ? N GLN A 716 
D 22 23 N PHE A 725 ? N PHE A 725 O LYS A 162 ? O LYS A 162 
E 1  2  O SER A 653 ? O SER A 653 N VAL A 663 ? N VAL A 663 
F 1  2  N PHE A 704 ? N PHE A 704 O GLY A 708 ? O GLY A 708 
# 
_database_PDB_matrix.entry_id          1QFG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QFG 
_atom_sites.fract_transf_matrix[1][1]   0.005829 
_atom_sites.fract_transf_matrix[1][2]   0.003365 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006731 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011409 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NI 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLU A 1  19  ? 73.501  111.693 29.978 1.00 101.89 ? 19   GLU A N   1 
ATOM   2    C  CA  . GLU A 1  19  ? 73.543  111.444 28.492 1.00 104.42 ? 19   GLU A CA  1 
ATOM   3    C  C   . GLU A 1  19  ? 73.224  109.964 28.140 1.00 101.73 ? 19   GLU A C   1 
ATOM   4    O  O   . GLU A 1  19  ? 72.150  109.677 27.557 1.00 99.12  ? 19   GLU A O   1 
ATOM   5    C  CB  . GLU A 1  19  ? 74.914  111.853 27.942 1.00 106.87 ? 19   GLU A CB  1 
ATOM   6    C  CG  . GLU A 1  19  ? 74.946  111.972 26.428 1.00 112.56 ? 19   GLU A CG  1 
ATOM   7    C  CD  . GLU A 1  19  ? 74.376  113.271 25.839 1.00 117.82 ? 19   GLU A CD  1 
ATOM   8    O  OE1 . GLU A 1  19  ? 75.008  114.350 25.990 1.00 124.81 ? 19   GLU A OE1 1 
ATOM   9    O  OE2 . GLU A 1  19  ? 73.301  113.202 25.199 1.00 117.87 ? 19   GLU A OE2 1 
ATOM   10   N  N   . SER A 1  20  ? 74.140  109.041 28.484 1.00 98.31  ? 20   SER A N   1 
ATOM   11   C  CA  . SER A 1  20  ? 73.927  107.584 28.285 1.00 89.40  ? 20   SER A CA  1 
ATOM   12   C  C   . SER A 1  20  ? 73.258  107.063 29.569 1.00 83.90  ? 20   SER A C   1 
ATOM   13   O  O   . SER A 1  20  ? 73.419  107.658 30.648 1.00 79.22  ? 20   SER A O   1 
ATOM   14   C  CB  . SER A 1  20  ? 75.242  106.876 28.021 1.00 81.53  ? 20   SER A CB  1 
ATOM   15   O  OG  . SER A 1  20  ? 76.286  107.515 28.728 1.00 95.15  ? 20   SER A OG  1 
ATOM   16   N  N   . ALA A 1  21  ? 72.510  105.970 29.469 1.00 79.69  ? 21   ALA A N   1 
ATOM   17   C  CA  . ALA A 1  21  ? 71.731  105.464 30.637 1.00 81.32  ? 21   ALA A CA  1 
ATOM   18   C  C   . ALA A 1  21  ? 72.307  105.394 32.062 1.00 74.21  ? 21   ALA A C   1 
ATOM   19   O  O   . ALA A 1  21  ? 71.642  105.796 33.019 1.00 71.08  ? 21   ALA A O   1 
ATOM   20   C  CB  . ALA A 1  21  ? 71.111  104.080 30.294 1.00 86.76  ? 21   ALA A CB  1 
ATOM   21   N  N   . TRP A 1  22  ? 73.518  104.845 32.169 1.00 70.98  ? 22   TRP A N   1 
ATOM   22   C  CA  . TRP A 1  22  ? 74.243  104.634 33.404 1.00 68.96  ? 22   TRP A CA  1 
ATOM   23   C  C   . TRP A 1  22  ? 74.933  105.861 33.904 1.00 72.29  ? 22   TRP A C   1 
ATOM   24   O  O   . TRP A 1  22  ? 75.782  105.797 34.801 1.00 74.39  ? 22   TRP A O   1 
ATOM   25   C  CB  . TRP A 1  22  ? 75.272  103.550 33.160 1.00 66.63  ? 22   TRP A CB  1 
ATOM   26   C  CG  . TRP A 1  22  ? 76.232  103.855 32.082 1.00 62.91  ? 22   TRP A CG  1 
ATOM   27   C  CD1 . TRP A 1  22  ? 77.477  104.416 32.214 1.00 57.57  ? 22   TRP A CD1 1 
ATOM   28   C  CD2 . TRP A 1  22  ? 76.029  103.645 30.678 1.00 55.87  ? 22   TRP A CD2 1 
ATOM   29   N  NE1 . TRP A 1  22  ? 78.055  104.572 30.959 1.00 55.91  ? 22   TRP A NE1 1 
ATOM   30   C  CE2 . TRP A 1  22  ? 77.179  104.099 30.013 1.00 56.06  ? 22   TRP A CE2 1 
ATOM   31   C  CE3 . TRP A 1  22  ? 74.991  103.120 29.916 1.00 56.40  ? 22   TRP A CE3 1 
ATOM   32   C  CZ2 . TRP A 1  22  ? 77.286  104.038 28.623 1.00 56.40  ? 22   TRP A CZ2 1 
ATOM   33   C  CZ3 . TRP A 1  22  ? 75.116  103.063 28.511 1.00 54.39  ? 22   TRP A CZ3 1 
ATOM   34   C  CH2 . TRP A 1  22  ? 76.224  103.506 27.901 1.00 54.91  ? 22   TRP A CH2 1 
ATOM   35   N  N   . GLY A 1  23  ? 74.555  106.983 33.325 1.00 73.63  ? 23   GLY A N   1 
ATOM   36   C  CA  . GLY A 1  23  ? 75.205  108.210 33.678 1.00 75.60  ? 23   GLY A CA  1 
ATOM   37   C  C   . GLY A 1  23  ? 74.724  108.749 34.969 1.00 79.30  ? 23   GLY A C   1 
ATOM   38   O  O   . GLY A 1  23  ? 74.892  108.135 35.983 1.00 79.50  ? 23   GLY A O   1 
ATOM   39   N  N   . PRO A 1  24  ? 74.212  109.972 34.948 1.00 87.42  ? 24   PRO A N   1 
ATOM   40   C  CA  . PRO A 1  24  ? 73.677  110.654 36.119 1.00 81.06  ? 24   PRO A CA  1 
ATOM   41   C  C   . PRO A 1  24  ? 72.254  110.171 36.415 1.00 83.99  ? 24   PRO A C   1 
ATOM   42   O  O   . PRO A 1  24  ? 71.833  110.221 37.589 1.00 81.37  ? 24   PRO A O   1 
ATOM   43   C  CB  . PRO A 1  24  ? 73.759  112.113 35.705 1.00 88.55  ? 24   PRO A CB  1 
ATOM   44   C  CG  . PRO A 1  24  ? 75.051  112.127 34.895 1.00 83.70  ? 24   PRO A CG  1 
ATOM   45   C  CD  . PRO A 1  24  ? 74.784  110.952 33.999 1.00 86.16  ? 24   PRO A CD  1 
ATOM   46   N  N   . ALA A 1  25  ? 71.520  109.721 35.375 1.00 76.40  ? 25   ALA A N   1 
ATOM   47   C  CA  . ALA A 1  25  ? 70.161  109.158 35.566 1.00 79.69  ? 25   ALA A CA  1 
ATOM   48   C  C   . ALA A 1  25  ? 70.315  108.001 36.579 1.00 86.57  ? 25   ALA A C   1 
ATOM   49   O  O   . ALA A 1  25  ? 69.442  107.775 37.458 1.00 87.08  ? 25   ALA A O   1 
ATOM   50   C  CB  . ALA A 1  25  ? 69.585  108.604 34.247 1.00 78.15  ? 25   ALA A CB  1 
ATOM   51   N  N   . ALA A 1  26  ? 71.425  107.266 36.416 1.00 77.96  ? 26   ALA A N   1 
ATOM   52   C  CA  . ALA A 1  26  ? 71.790  106.175 37.309 1.00 76.44  ? 26   ALA A CA  1 
ATOM   53   C  C   . ALA A 1  26  ? 72.301  106.705 38.685 1.00 75.40  ? 26   ALA A C   1 
ATOM   54   O  O   . ALA A 1  26  ? 71.783  106.315 39.732 1.00 71.31  ? 26   ALA A O   1 
ATOM   55   C  CB  . ALA A 1  26  ? 72.854  105.352 36.655 1.00 77.30  ? 26   ALA A CB  1 
ATOM   56   N  N   . THR A 1  27  ? 73.301  107.600 38.665 1.00 78.67  ? 27   THR A N   1 
ATOM   57   C  CA  . THR A 1  27  ? 73.888  108.198 39.888 1.00 80.72  ? 27   THR A CA  1 
ATOM   58   C  C   . THR A 1  27  ? 72.755  108.661 40.815 1.00 80.71  ? 27   THR A C   1 
ATOM   59   O  O   . THR A 1  27  ? 72.673  108.222 41.983 1.00 80.92  ? 27   THR A O   1 
ATOM   60   C  CB  . THR A 1  27  ? 74.852  109.490 39.617 1.00 82.60  ? 27   THR A CB  1 
ATOM   61   O  OG1 . THR A 1  27  ? 75.941  109.163 38.730 1.00 85.29  ? 27   THR A OG1 1 
ATOM   62   C  CG2 . THR A 1  27  ? 75.462  110.036 40.963 1.00 74.77  ? 27   THR A CG2 1 
ATOM   63   N  N   . ILE A 1  28  ? 71.867  109.504 40.276 1.00 77.22  ? 28   ILE A N   1 
ATOM   64   C  CA  . ILE A 1  28  ? 70.774  110.069 41.063 1.00 76.58  ? 28   ILE A CA  1 
ATOM   65   C  C   . ILE A 1  28  ? 69.676  109.110 41.487 1.00 71.43  ? 28   ILE A C   1 
ATOM   66   O  O   . ILE A 1  28  ? 69.145  109.214 42.590 1.00 74.81  ? 28   ILE A O   1 
ATOM   67   C  CB  . ILE A 1  28  ? 70.173  111.334 40.361 1.00 77.52  ? 28   ILE A CB  1 
ATOM   68   C  CG1 . ILE A 1  28  ? 69.662  110.960 38.984 1.00 82.92  ? 28   ILE A CG1 1 
ATOM   69   C  CG2 . ILE A 1  28  ? 71.259  112.451 40.275 1.00 75.98  ? 28   ILE A CG2 1 
ATOM   70   C  CD1 . ILE A 1  28  ? 69.718  112.121 37.965 1.00 94.77  ? 28   ILE A CD1 1 
ATOM   71   N  N   . ALA A 1  29  ? 69.316  108.180 40.629 1.00 67.78  ? 29   ALA A N   1 
ATOM   72   C  CA  . ALA A 1  29  ? 68.305  107.223 41.010 1.00 64.04  ? 29   ALA A CA  1 
ATOM   73   C  C   . ALA A 1  29  ? 68.822  106.465 42.263 1.00 66.98  ? 29   ALA A C   1 
ATOM   74   O  O   . ALA A 1  29  ? 68.074  105.980 43.123 1.00 70.12  ? 29   ALA A O   1 
ATOM   75   C  CB  . ALA A 1  29  ? 68.086  106.252 39.851 1.00 64.34  ? 29   ALA A CB  1 
ATOM   76   N  N   . ALA A 1  30  ? 70.129  106.381 42.349 1.00 60.65  ? 30   ALA A N   1 
ATOM   77   C  CA  . ALA A 1  30  ? 70.762  105.674 43.420 1.00 65.10  ? 30   ALA A CA  1 
ATOM   78   C  C   . ALA A 1  30  ? 71.013  106.491 44.675 1.00 68.77  ? 30   ALA A C   1 
ATOM   79   O  O   . ALA A 1  30  ? 71.821  106.091 45.527 1.00 69.70  ? 30   ALA A O   1 
ATOM   80   C  CB  . ALA A 1  30  ? 72.091  105.121 42.893 1.00 68.88  ? 30   ALA A CB  1 
ATOM   81   N  N   . ARG A 1  31  ? 70.355  107.634 44.787 1.00 71.27  ? 31   ARG A N   1 
ATOM   82   C  CA  . ARG A 1  31  ? 70.590  108.515 45.924 1.00 74.97  ? 31   ARG A CA  1 
ATOM   83   C  C   . ARG A 1  31  ? 69.652  108.079 46.995 1.00 75.64  ? 31   ARG A C   1 
ATOM   84   O  O   . ARG A 1  31  ? 69.885  108.278 48.210 1.00 69.42  ? 31   ARG A O   1 
ATOM   85   C  CB  . ARG A 1  31  ? 70.281  109.971 45.539 1.00 83.65  ? 31   ARG A CB  1 
ATOM   86   C  CG  . ARG A 1  31  ? 71.042  110.482 44.324 1.00 88.06  ? 31   ARG A CG  1 
ATOM   87   C  CD  . ARG A 1  31  ? 71.044  112.006 44.218 1.00 94.42  ? 31   ARG A CD  1 
ATOM   88   N  NE  . ARG A 1  31  ? 72.393  112.523 44.420 1.00 101.09 ? 31   ARG A NE  1 
ATOM   89   C  CZ  . ARG A 1  31  ? 72.922  113.529 43.737 1.00 100.70 ? 31   ARG A CZ  1 
ATOM   90   N  NH1 . ARG A 1  31  ? 72.224  114.153 42.787 1.00 98.78  ? 31   ARG A NH1 1 
ATOM   91   N  NH2 . ARG A 1  31  ? 74.163  113.894 44.000 1.00 102.16 ? 31   ARG A NH2 1 
ATOM   92   N  N   . GLN A 1  32  ? 68.592  107.482 46.455 1.00 67.94  ? 32   GLN A N   1 
ATOM   93   C  CA  . GLN A 1  32  ? 67.436  106.948 47.135 1.00 65.49  ? 32   GLN A CA  1 
ATOM   94   C  C   . GLN A 1  32  ? 67.592  105.460 47.496 1.00 69.29  ? 32   GLN A C   1 
ATOM   95   O  O   . GLN A 1  32  ? 68.097  104.665 46.711 1.00 65.41  ? 32   GLN A O   1 
ATOM   96   C  CB  . GLN A 1  32  ? 66.263  107.119 46.150 1.00 75.42  ? 32   GLN A CB  1 
ATOM   97   C  CG  . GLN A 1  32  ? 65.130  108.171 46.510 1.00 76.29  ? 32   GLN A CG  1 
ATOM   98   C  CD  . GLN A 1  32  ? 65.590  109.310 47.404 1.00 77.01  ? 32   GLN A CD  1 
ATOM   99   O  OE1 . GLN A 1  32  ? 66.232  110.246 46.932 1.00 76.85  ? 32   GLN A OE1 1 
ATOM   100  N  NE2 . GLN A 1  32  ? 65.275  109.227 48.715 1.00 79.89  ? 32   GLN A NE2 1 
ATOM   101  N  N   . SER A 1  33  ? 67.152  105.088 48.685 1.00 65.52  ? 33   SER A N   1 
ATOM   102  C  CA  . SER A 1  33  ? 67.190  103.730 49.110 1.00 54.68  ? 33   SER A CA  1 
ATOM   103  C  C   . SER A 1  33  ? 66.244  103.410 50.181 1.00 55.39  ? 33   SER A C   1 
ATOM   104  O  O   . SER A 1  33  ? 65.632  104.240 50.691 1.00 57.17  ? 33   SER A O   1 
ATOM   105  C  CB  . SER A 1  33  ? 68.510  103.340 49.640 1.00 65.06  ? 33   SER A CB  1 
ATOM   106  O  OG  . SER A 1  33  ? 68.414  101.916 49.906 1.00 71.36  ? 33   SER A OG  1 
ATOM   107  N  N   . ALA A 1  34  ? 66.183  102.171 50.598 1.00 55.66  ? 34   ALA A N   1 
ATOM   108  C  CA  . ALA A 1  34  ? 65.258  101.807 51.651 1.00 54.85  ? 34   ALA A CA  1 
ATOM   109  C  C   . ALA A 1  34  ? 65.763  100.630 52.517 1.00 55.52  ? 34   ALA A C   1 
ATOM   110  O  O   . ALA A 1  34  ? 65.278  100.362 53.630 1.00 54.87  ? 34   ALA A O   1 
ATOM   111  C  CB  . ALA A 1  34  ? 63.973  101.435 51.031 1.00 52.88  ? 34   ALA A CB  1 
ATOM   112  N  N   . THR A 1  35  ? 66.757  99.951  51.988 1.00 54.43  ? 35   THR A N   1 
ATOM   113  C  CA  . THR A 1  35  ? 67.250  98.822  52.651 1.00 53.78  ? 35   THR A CA  1 
ATOM   114  C  C   . THR A 1  35  ? 67.757  99.192  54.049 1.00 54.79  ? 35   THR A C   1 
ATOM   115  O  O   . THR A 1  35  ? 67.690  98.338  54.943 1.00 54.05  ? 35   THR A O   1 
ATOM   116  C  CB  . THR A 1  35  ? 68.384  98.256  51.844 1.00 53.77  ? 35   THR A CB  1 
ATOM   117  O  OG1 . THR A 1  35  ? 67.903  97.540  50.686 1.00 54.84  ? 35   THR A OG1 1 
ATOM   118  C  CG2 . THR A 1  35  ? 69.183  97.381  52.693 1.00 53.33  ? 35   THR A CG2 1 
ATOM   119  N  N   . GLY A 1  36  ? 68.255  100.427 54.231 1.00 53.87  ? 36   GLY A N   1 
ATOM   120  C  CA  . GLY A 1  36  ? 68.862  100.818 55.481 1.00 53.87  ? 36   GLY A CA  1 
ATOM   121  C  C   . GLY A 1  36  ? 67.978  101.347 56.584 1.00 56.28  ? 36   GLY A C   1 
ATOM   122  O  O   . GLY A 1  36  ? 68.417  101.444 57.724 1.00 53.31  ? 36   GLY A O   1 
ATOM   123  N  N   . THR A 1  37  ? 66.717  101.635 56.263 1.00 57.62  ? 37   THR A N   1 
ATOM   124  C  CA  . THR A 1  37  ? 65.783  102.212 57.241 1.00 58.33  ? 37   THR A CA  1 
ATOM   125  C  C   . THR A 1  37  ? 64.381  101.709 57.108 1.00 58.15  ? 37   THR A C   1 
ATOM   126  O  O   . THR A 1  37  ? 63.487  102.106 57.848 1.00 63.28  ? 37   THR A O   1 
ATOM   127  C  CB  . THR A 1  37  ? 65.612  103.632 56.985 1.00 59.26  ? 37   THR A CB  1 
ATOM   128  O  OG1 . THR A 1  37  ? 64.738  103.735 55.851 1.00 59.24  ? 37   THR A OG1 1 
ATOM   129  C  CG2 . THR A 1  37  ? 66.985  104.289 56.645 1.00 59.45  ? 37   THR A CG2 1 
ATOM   130  N  N   . LYS A 1  38  ? 64.180  100.886 56.111 1.00 59.77  ? 38   LYS A N   1 
ATOM   131  C  CA  . LYS A 1  38  ? 62.870  100.365 55.836 1.00 68.77  ? 38   LYS A CA  1 
ATOM   132  C  C   . LYS A 1  38  ? 61.881  101.457 55.535 1.00 68.48  ? 38   LYS A C   1 
ATOM   133  O  O   . LYS A 1  38  ? 60.674  101.220 55.561 1.00 80.43  ? 38   LYS A O   1 
ATOM   134  C  CB  . LYS A 1  38  ? 62.328  99.477  56.952 1.00 68.22  ? 38   LYS A CB  1 
ATOM   135  C  CG  . LYS A 1  38  ? 63.003  98.112  57.032 1.00 55.47  ? 38   LYS A CG  1 
ATOM   136  C  CD  . LYS A 1  38  ? 61.995  96.881  57.272 1.00 53.62  ? 38   LYS A CD  1 
ATOM   137  C  CE  . LYS A 1  38  ? 62.795  95.614  57.600 1.00 52.10  ? 38   LYS A CE  1 
ATOM   138  N  NZ  . LYS A 1  38  ? 62.103  94.399  58.008 1.00 53.46  ? 38   LYS A NZ  1 
ATOM   139  N  N   . THR A 1  39  ? 62.376  102.656 55.262 1.00 57.88  ? 39   THR A N   1 
ATOM   140  C  CA  . THR A 1  39  ? 61.498  103.742 54.856 1.00 58.01  ? 39   THR A CA  1 
ATOM   141  C  C   . THR A 1  39  ? 62.271  104.235 53.702 1.00 68.18  ? 39   THR A C   1 
ATOM   142  O  O   . THR A 1  39  ? 63.497  104.105 53.669 1.00 74.07  ? 39   THR A O   1 
ATOM   143  C  CB  . THR A 1  39  ? 61.425  104.965 55.785 1.00 57.90  ? 39   THR A CB  1 
ATOM   144  O  OG1 . THR A 1  39  ? 62.717  105.598 55.884 1.00 61.92  ? 39   THR A OG1 1 
ATOM   145  C  CG2 . THR A 1  39  ? 60.857  104.598 57.092 1.00 48.85  ? 39   THR A CG2 1 
ATOM   146  N  N   . ASP A 1  40  ? 61.564  104.806 52.754 1.00 67.60  ? 40   ASP A N   1 
ATOM   147  C  CA  . ASP A 1  40  ? 62.220  105.360 51.637 1.00 61.68  ? 40   ASP A CA  1 
ATOM   148  C  C   . ASP A 1  40  ? 62.928  106.655 52.068 1.00 60.97  ? 40   ASP A C   1 
ATOM   149  O  O   . ASP A 1  40  ? 62.286  107.668 52.229 1.00 61.88  ? 40   ASP A O   1 
ATOM   150  C  CB  . ASP A 1  40  ? 61.200  105.614 50.586 1.00 68.22  ? 40   ASP A CB  1 
ATOM   151  C  CG  . ASP A 1  40  ? 61.821  105.662 49.285 1.00 77.00  ? 40   ASP A CG  1 
ATOM   152  O  OD1 . ASP A 1  40  ? 62.532  106.655 49.023 1.00 78.28  ? 40   ASP A OD1 1 
ATOM   153  O  OD2 . ASP A 1  40  ? 61.645  104.673 48.555 1.00 88.31  ? 40   ASP A OD2 1 
ATOM   154  N  N   . THR A 1  41  ? 64.258  106.589 52.186 1.00 55.18  ? 41   THR A N   1 
ATOM   155  C  CA  . THR A 1  41  ? 65.164  107.620 52.674 1.00 54.92  ? 41   THR A CA  1 
ATOM   156  C  C   . THR A 1  41  ? 66.320  107.752 51.738 1.00 59.24  ? 41   THR A C   1 
ATOM   157  O  O   . THR A 1  41  ? 66.728  106.808 51.214 1.00 59.36  ? 41   THR A O   1 
ATOM   158  C  CB  . THR A 1  41  ? 65.770  107.181 54.059 1.00 54.59  ? 41   THR A CB  1 
ATOM   159  O  OG1 . THR A 1  41  ? 64.749  107.202 55.068 1.00 55.41  ? 41   THR A OG1 1 
ATOM   160  C  CG2 . THR A 1  41  ? 66.943  107.985 54.437 1.00 52.67  ? 41   THR A CG2 1 
ATOM   161  N  N   . PRO A 1  42  ? 66.872  108.943 51.546 1.00 63.85  ? 42   PRO A N   1 
ATOM   162  C  CA  . PRO A 1  42  ? 67.998  109.157 50.663 1.00 60.21  ? 42   PRO A CA  1 
ATOM   163  C  C   . PRO A 1  42  ? 69.241  108.846 51.412 1.00 64.30  ? 42   PRO A C   1 
ATOM   164  O  O   . PRO A 1  42  ? 69.253  108.985 52.636 1.00 75.06  ? 42   PRO A O   1 
ATOM   165  C  CB  . PRO A 1  42  ? 67.867  110.632 50.318 1.00 68.27  ? 42   PRO A CB  1 
ATOM   166  C  CG  . PRO A 1  42  ? 67.319  111.192 51.520 1.00 68.36  ? 42   PRO A CG  1 
ATOM   167  C  CD  . PRO A 1  42  ? 66.228  110.226 51.851 1.00 72.12  ? 42   PRO A CD  1 
ATOM   168  N  N   . ILE A 1  43  ? 70.321  108.536 50.708 1.00 56.20  ? 43   ILE A N   1 
ATOM   169  C  CA  . ILE A 1  43  ? 71.458  108.067 51.429 1.00 60.26  ? 43   ILE A CA  1 
ATOM   170  C  C   . ILE A 1  43  ? 72.230  108.906 52.346 1.00 69.95  ? 43   ILE A C   1 
ATOM   171  O  O   . ILE A 1  43  ? 72.959  108.375 53.196 1.00 66.52  ? 43   ILE A O   1 
ATOM   172  C  CB  . ILE A 1  43  ? 72.407  107.366 50.528 1.00 59.20  ? 43   ILE A CB  1 
ATOM   173  C  CG1 . ILE A 1  43  ? 72.928  108.292 49.464 1.00 59.27  ? 43   ILE A CG1 1 
ATOM   174  C  CG2 . ILE A 1  43  ? 71.658  106.218 49.844 1.00 59.20  ? 43   ILE A CG2 1 
ATOM   175  C  CD1 . ILE A 1  43  ? 73.652  107.492 48.363 1.00 78.15  ? 43   ILE A CD1 1 
ATOM   176  N  N   . GLN A 1  44  ? 72.108  110.213 52.198 1.00 70.93  ? 44   GLN A N   1 
ATOM   177  C  CA  . GLN A 1  44  ? 72.850  111.044 53.106 1.00 72.27  ? 44   GLN A CA  1 
ATOM   178  C  C   . GLN A 1  44  ? 72.034  111.097 54.423 1.00 74.56  ? 44   GLN A C   1 
ATOM   179  O  O   . GLN A 1  44  ? 72.554  111.422 55.482 1.00 71.57  ? 44   GLN A O   1 
ATOM   180  C  CB  . GLN A 1  44  ? 73.120  112.412 52.498 1.00 70.83  ? 44   GLN A CB  1 
ATOM   181  C  CG  . GLN A 1  44  ? 71.903  113.284 52.343 1.00 82.53  ? 44   GLN A CG  1 
ATOM   182  C  CD  . GLN A 1  44  ? 70.993  112.856 51.232 1.00 79.36  ? 44   GLN A CD  1 
ATOM   183  O  OE1 . GLN A 1  44  ? 71.429  112.465 50.142 1.00 81.43  ? 44   GLN A OE1 1 
ATOM   184  N  NE2 . GLN A 1  44  ? 69.703  112.946 51.493 1.00 89.14  ? 44   GLN A NE2 1 
ATOM   185  N  N   . LYS A 1  45  ? 70.774  110.695 54.367 1.00 68.51  ? 45   LYS A N   1 
ATOM   186  C  CA  . LYS A 1  45  ? 69.977  110.656 55.560 1.00 62.82  ? 45   LYS A CA  1 
ATOM   187  C  C   . LYS A 1  45  ? 70.051  109.283 56.204 1.00 66.79  ? 45   LYS A C   1 
ATOM   188  O  O   . LYS A 1  45  ? 69.230  108.934 57.124 1.00 62.14  ? 45   LYS A O   1 
ATOM   189  C  CB  . LYS A 1  45  ? 68.531  110.986 55.223 1.00 69.31  ? 45   LYS A CB  1 
ATOM   190  C  CG  . LYS A 1  45  ? 68.361  112.413 54.703 1.00 72.81  ? 45   LYS A CG  1 
ATOM   191  C  CD  . LYS A 1  45  ? 66.949  112.898 54.989 1.00 72.15  ? 45   LYS A CD  1 
ATOM   192  C  CE  . LYS A 1  45  ? 66.677  114.349 54.552 1.00 65.37  ? 45   LYS A CE  1 
ATOM   193  N  NZ  . LYS A 1  45  ? 65.165  114.421 54.650 1.00 75.66  ? 45   LYS A NZ  1 
ATOM   194  N  N   . VAL A 1  46  ? 70.996  108.479 55.696 1.00 65.77  ? 46   VAL A N   1 
ATOM   195  C  CA  . VAL A 1  46  ? 71.174  107.145 56.245 1.00 54.65  ? 46   VAL A CA  1 
ATOM   196  C  C   . VAL A 1  46  ? 72.535  107.031 56.919 1.00 67.40  ? 46   VAL A C   1 
ATOM   197  O  O   . VAL A 1  46  ? 73.606  107.178 56.313 1.00 59.88  ? 46   VAL A O   1 
ATOM   198  C  CB  . VAL A 1  46  ? 70.817  106.019 55.199 1.00 55.77  ? 46   VAL A CB  1 
ATOM   199  C  CG1 . VAL A 1  46  ? 71.286  104.585 55.658 1.00 53.65  ? 46   VAL A CG1 1 
ATOM   200  C  CG2 . VAL A 1  46  ? 69.325  105.960 55.091 1.00 53.67  ? 46   VAL A CG2 1 
ATOM   201  N  N   . PRO A 1  47  ? 72.459  106.879 58.237 1.00 53.09  ? 47   PRO A N   1 
ATOM   202  C  CA  . PRO A 1  47  ? 73.298  106.733 59.420 1.00 64.74  ? 47   PRO A CA  1 
ATOM   203  C  C   . PRO A 1  47  ? 74.169  105.543 59.413 1.00 71.54  ? 47   PRO A C   1 
ATOM   204  O  O   . PRO A 1  47  ? 74.845  105.256 60.415 1.00 66.20  ? 47   PRO A O   1 
ATOM   205  C  CB  . PRO A 1  47  ? 72.274  106.638 60.552 1.00 63.93  ? 47   PRO A CB  1 
ATOM   206  C  CG  . PRO A 1  47  ? 71.154  105.910 59.885 1.00 67.71  ? 47   PRO A CG  1 
ATOM   207  C  CD  . PRO A 1  47  ? 71.037  106.663 58.586 1.00 52.88  ? 47   PRO A CD  1 
ATOM   208  N  N   . GLN A 1  48  ? 74.148  104.829 58.301 1.00 68.53  ? 48   GLN A N   1 
ATOM   209  C  CA  . GLN A 1  48  ? 74.934  103.607 58.187 1.00 66.00  ? 48   GLN A CA  1 
ATOM   210  C  C   . GLN A 1  48  ? 75.474  103.499 56.781 1.00 69.97  ? 48   GLN A C   1 
ATOM   211  O  O   . GLN A 1  48  ? 74.923  104.117 55.846 1.00 62.13  ? 48   GLN A O   1 
ATOM   212  C  CB  . GLN A 1  48  ? 74.039  102.433 58.452 1.00 60.87  ? 48   GLN A CB  1 
ATOM   213  C  CG  . GLN A 1  48  ? 74.725  101.228 58.969 1.00 65.52  ? 48   GLN A CG  1 
ATOM   214  C  CD  . GLN A 1  48  ? 73.826  100.524 59.979 1.00 63.71  ? 48   GLN A CD  1 
ATOM   215  O  OE1 . GLN A 1  48  ? 72.655  100.909 60.198 1.00 62.47  ? 48   GLN A OE1 1 
ATOM   216  N  NE2 . GLN A 1  48  ? 74.356  99.500  60.599 1.00 65.98  ? 48   GLN A NE2 1 
ATOM   217  N  N   . SER A 1  49  ? 76.540  102.719 56.630 1.00 70.94  ? 49   SER A N   1 
ATOM   218  C  CA  . SER A 1  49  ? 77.163  102.525 55.338 1.00 53.68  ? 49   SER A CA  1 
ATOM   219  C  C   . SER A 1  49  ? 76.241  101.720 54.380 1.00 55.48  ? 49   SER A C   1 
ATOM   220  O  O   . SER A 1  49  ? 75.790  100.632 54.728 1.00 57.21  ? 49   SER A O   1 
ATOM   221  C  CB  . SER A 1  49  ? 78.482  101.825 55.545 1.00 51.58  ? 49   SER A CB  1 
ATOM   222  O  OG  . SER A 1  49  ? 79.496  102.766 55.483 1.00 52.99  ? 49   SER A OG  1 
ATOM   223  N  N   . ILE A 1  50  ? 75.950  102.245 53.186 1.00 55.33  ? 50   ILE A N   1 
ATOM   224  C  CA  . ILE A 1  50  ? 75.083  101.536 52.237 1.00 56.28  ? 50   ILE A CA  1 
ATOM   225  C  C   . ILE A 1  50  ? 75.412  101.855 50.791 1.00 55.61  ? 50   ILE A C   1 
ATOM   226  O  O   . ILE A 1  50  ? 75.587  102.998 50.478 1.00 54.85  ? 50   ILE A O   1 
ATOM   227  C  CB  . ILE A 1  50  ? 73.609  101.896 52.417 1.00 56.97  ? 50   ILE A CB  1 
ATOM   228  C  CG1 . ILE A 1  50  ? 72.794  101.231 51.319 1.00 57.64  ? 50   ILE A CG1 1 
ATOM   229  C  CG2 . ILE A 1  50  ? 73.408  103.414 52.331 1.00 57.01  ? 50   ILE A CG2 1 
ATOM   230  C  CD1 . ILE A 1  50  ? 71.384  101.091 51.708 1.00 55.67  ? 50   ILE A CD1 1 
ATOM   231  N  N   . SER A 1  51  ? 75.469  100.836 49.936 1.00 55.55  ? 51   SER A N   1 
ATOM   232  C  CA  . SER A 1  51  ? 75.774  101.008 48.519 1.00 54.24  ? 51   SER A CA  1 
ATOM   233  C  C   . SER A 1  51  ? 74.645  100.556 47.636 1.00 54.37  ? 51   SER A C   1 
ATOM   234  O  O   . SER A 1  51  ? 73.899  99.690  47.999 1.00 53.06  ? 51   SER A O   1 
ATOM   235  C  CB  . SER A 1  51  ? 76.987  100.231 48.107 1.00 54.88  ? 51   SER A CB  1 
ATOM   236  O  OG  . SER A 1  51  ? 78.168  100.703 48.702 1.00 55.76  ? 51   SER A OG  1 
ATOM   237  N  N   . VAL A 1  52  ? 74.556  101.154 46.450 1.00 53.87  ? 52   VAL A N   1 
ATOM   238  C  CA  . VAL A 1  52  ? 73.476  100.885 45.516 1.00 52.04  ? 52   VAL A CA  1 
ATOM   239  C  C   . VAL A 1  52  ? 73.956  100.712 44.075 1.00 53.63  ? 52   VAL A C   1 
ATOM   240  O  O   . VAL A 1  52  ? 74.815  101.469 43.557 1.00 54.34  ? 52   VAL A O   1 
ATOM   241  C  CB  . VAL A 1  52  ? 72.538  102.043 45.575 1.00 50.59  ? 52   VAL A CB  1 
ATOM   242  C  CG1 . VAL A 1  52  ? 71.355  101.780 44.713 1.00 48.79  ? 52   VAL A CG1 1 
ATOM   243  C  CG2 . VAL A 1  52  ? 72.117  102.300 47.041 1.00 50.78  ? 52   VAL A CG2 1 
ATOM   244  N  N   . VAL A 1  53  ? 73.427  99.711  43.416 1.00 51.47  ? 53   VAL A N   1 
ATOM   245  C  CA  . VAL A 1  53  ? 73.852  99.446  42.071 1.00 52.47  ? 53   VAL A CA  1 
ATOM   246  C  C   . VAL A 1  53  ? 72.610  99.263  41.367 1.00 53.53  ? 53   VAL A C   1 
ATOM   247  O  O   . VAL A 1  53  ? 71.774  98.478  41.768 1.00 55.45  ? 53   VAL A O   1 
ATOM   248  C  CB  . VAL A 1  53  ? 74.695  98.183  42.005 1.00 53.05  ? 53   VAL A CB  1 
ATOM   249  C  CG1 . VAL A 1  53  ? 75.341  97.982  40.560 1.00 48.91  ? 53   VAL A CG1 1 
ATOM   250  C  CG2 . VAL A 1  53  ? 75.822  98.305  43.079 1.00 50.15  ? 53   VAL A CG2 1 
ATOM   251  N  N   . THR A 1  54  ? 72.488  100.020 40.310 1.00 53.31  ? 54   THR A N   1 
ATOM   252  C  CA  . THR A 1  54  ? 71.278  100.106 39.490 1.00 53.56  ? 54   THR A CA  1 
ATOM   253  C  C   . THR A 1  54  ? 71.309  99.237  38.280 1.00 53.52  ? 54   THR A C   1 
ATOM   254  O  O   . THR A 1  54  ? 72.365  98.793  37.816 1.00 53.44  ? 54   THR A O   1 
ATOM   255  C  CB  . THR A 1  54  ? 71.081  101.554 39.024 1.00 53.92  ? 54   THR A CB  1 
ATOM   256  O  OG1 . THR A 1  54  ? 72.195  101.971 38.195 1.00 55.91  ? 54   THR A OG1 1 
ATOM   257  C  CG2 . THR A 1  54  ? 71.115  102.434 40.241 1.00 53.60  ? 54   THR A CG2 1 
ATOM   258  N  N   . ALA A 1  55  ? 70.123  99.018  37.781 1.00 54.60  ? 55   ALA A N   1 
ATOM   259  C  CA  . ALA A 1  55  ? 69.906  98.173  36.647 1.00 55.13  ? 55   ALA A CA  1 
ATOM   260  C  C   . ALA A 1  55  ? 70.669  98.650  35.426 1.00 55.21  ? 55   ALA A C   1 
ATOM   261  O  O   . ALA A 1  55  ? 71.235  97.823  34.706 1.00 54.40  ? 55   ALA A O   1 
ATOM   262  C  CB  . ALA A 1  55  ? 68.379  98.044  36.370 1.00 53.28  ? 55   ALA A CB  1 
ATOM   263  N  N   . GLU A 1  56  ? 70.713  99.972  35.233 1.00 55.77  ? 56   GLU A N   1 
ATOM   264  C  CA  . GLU A 1  56  ? 71.422  100.587 34.091 1.00 55.95  ? 56   GLU A CA  1 
ATOM   265  C  C   . GLU A 1  56  ? 72.891  100.243 34.246 1.00 55.77  ? 56   GLU A C   1 
ATOM   266  O  O   . GLU A 1  56  ? 73.584  99.850  33.266 1.00 69.06  ? 56   GLU A O   1 
ATOM   267  C  CB  . GLU A 1  56  ? 71.194  102.100 34.053 1.00 63.31  ? 56   GLU A CB  1 
ATOM   268  C  CG  . GLU A 1  56  ? 69.741  102.464 33.842 1.00 60.35  ? 56   GLU A CG  1 
ATOM   269  C  CD  . GLU A 1  56  ? 68.883  102.166 35.117 1.00 87.56  ? 56   GLU A CD  1 
ATOM   270  O  OE1 . GLU A 1  56  ? 69.284  102.592 36.248 1.00 72.37  ? 56   GLU A OE1 1 
ATOM   271  O  OE2 . GLU A 1  56  ? 67.801  101.509 34.994 1.00 97.35  ? 56   GLU A OE2 1 
ATOM   272  N  N   . GLU A 1  57  ? 73.371  100.322 35.474 1.00 53.87  ? 57   GLU A N   1 
ATOM   273  C  CA  . GLU A 1  57  ? 74.732  99.876  35.664 1.00 54.27  ? 57   GLU A CA  1 
ATOM   274  C  C   . GLU A 1  57  ? 74.948  98.381  35.352 1.00 54.07  ? 57   GLU A C   1 
ATOM   275  O  O   . GLU A 1  57  ? 75.908  98.055  34.707 1.00 56.95  ? 57   GLU A O   1 
ATOM   276  C  CB  . GLU A 1  57  ? 75.199  100.222 37.064 1.00 56.25  ? 57   GLU A CB  1 
ATOM   277  C  CG  . GLU A 1  57  ? 74.652  101.625 37.467 1.00 56.94  ? 57   GLU A CG  1 
ATOM   278  C  CD  . GLU A 1  57  ? 75.209  102.072 38.767 1.00 58.70  ? 57   GLU A CD  1 
ATOM   279  O  OE1 . GLU A 1  57  ? 76.459  102.029 38.872 1.00 58.14  ? 57   GLU A OE1 1 
ATOM   280  O  OE2 . GLU A 1  57  ? 74.402  102.434 39.664 1.00 59.21  ? 57   GLU A OE2 1 
ATOM   281  N  N   . MET A 1  58  ? 74.091  97.462  35.771 1.00 51.31  ? 58   MET A N   1 
ATOM   282  C  CA  . MET A 1  58  ? 74.351  96.091  35.444 1.00 51.37  ? 58   MET A CA  1 
ATOM   283  C  C   . MET A 1  58  ? 74.160  95.837  33.932 1.00 51.88  ? 58   MET A C   1 
ATOM   284  O  O   . MET A 1  58  ? 74.677  94.897  33.367 1.00 53.02  ? 58   MET A O   1 
ATOM   285  C  CB  . MET A 1  58  ? 73.425  95.168  36.281 1.00 51.41  ? 58   MET A CB  1 
ATOM   286  C  CG  . MET A 1  58  ? 73.611  95.357  37.844 1.00 51.34  ? 58   MET A CG  1 
ATOM   287  S  SD  . MET A 1  58  ? 72.515  94.330  38.894 1.00 57.00  ? 58   MET A SD  1 
ATOM   288  C  CE  . MET A 1  58  ? 71.071  95.212  39.007 1.00 46.34  ? 58   MET A CE  1 
ATOM   289  N  N   . ALA A 1  59  ? 73.352  96.670  33.306 1.00 53.18  ? 59   ALA A N   1 
ATOM   290  C  CA  . ALA A 1  59  ? 73.058  96.572  31.905 1.00 53.16  ? 59   ALA A CA  1 
ATOM   291  C  C   . ALA A 1  59  ? 74.381  96.978  31.222 1.00 53.15  ? 59   ALA A C   1 
ATOM   292  O  O   . ALA A 1  59  ? 74.760  96.366  30.216 1.00 52.13  ? 59   ALA A O   1 
ATOM   293  C  CB  . ALA A 1  59  ? 71.926  97.470  31.578 1.00 50.89  ? 59   ALA A CB  1 
ATOM   294  N  N   . LEU A 1  60  ? 75.122  97.932  31.803 1.00 52.26  ? 60   LEU A N   1 
ATOM   295  C  CA  . LEU A 1  60  ? 76.456  98.276  31.208 1.00 53.00  ? 60   LEU A CA  1 
ATOM   296  C  C   . LEU A 1  60  ? 77.543  97.215  31.386 1.00 53.23  ? 60   LEU A C   1 
ATOM   297  O  O   . LEU A 1  60  ? 78.161  96.746  30.410 1.00 53.08  ? 60   LEU A O   1 
ATOM   298  C  CB  . LEU A 1  60  ? 77.060  99.564  31.810 1.00 50.34  ? 60   LEU A CB  1 
ATOM   299  C  CG  . LEU A 1  60  ? 78.420  100.029 31.239 1.00 51.88  ? 60   LEU A CG  1 
ATOM   300  C  CD1 . LEU A 1  60  ? 78.400  100.230 29.666 1.00 50.05  ? 60   LEU A CD1 1 
ATOM   301  C  CD2 . LEU A 1  60  ? 78.798  101.308 31.981 1.00 50.52  ? 60   LEU A CD2 1 
ATOM   302  N  N   . HIS A 1  61  ? 77.775  96.891  32.673 1.00 53.13  ? 61   HIS A N   1 
ATOM   303  C  CA  . HIS A 1  61  ? 78.795  95.979  33.116 1.00 51.57  ? 61   HIS A CA  1 
ATOM   304  C  C   . HIS A 1  61  ? 78.570  94.517  32.882 1.00 52.84  ? 61   HIS A C   1 
ATOM   305  O  O   . HIS A 1  61  ? 79.578  93.756  32.839 1.00 55.87  ? 61   HIS A O   1 
ATOM   306  C  CB  . HIS A 1  61  ? 79.074  96.242  34.569 1.00 50.91  ? 61   HIS A CB  1 
ATOM   307  C  CG  . HIS A 1  61  ? 79.917  97.469  34.828 1.00 50.36  ? 61   HIS A CG  1 
ATOM   308  N  ND1 . HIS A 1  61  ? 79.405  98.603  35.404 1.00 51.87  ? 61   HIS A ND1 1 
ATOM   309  C  CD2 . HIS A 1  61  ? 81.260  97.645  34.801 1.00 51.13  ? 61   HIS A CD2 1 
ATOM   310  C  CE1 . HIS A 1  61  ? 80.387  99.433  35.747 1.00 50.21  ? 61   HIS A CE1 1 
ATOM   311  N  NE2 . HIS A 1  61  ? 81.521  98.861  35.403 1.00 52.10  ? 61   HIS A NE2 1 
ATOM   312  N  N   . GLN A 1  62  ? 77.304  94.091  32.786 1.00 51.51  ? 62   GLN A N   1 
ATOM   313  C  CA  . GLN A 1  62  ? 76.966  92.696  32.468 1.00 52.38  ? 62   GLN A CA  1 
ATOM   314  C  C   . GLN A 1  62  ? 77.556  91.654  33.368 1.00 53.60  ? 62   GLN A C   1 
ATOM   315  O  O   . GLN A 1  62  ? 78.127  90.633  32.860 1.00 56.66  ? 62   GLN A O   1 
ATOM   316  C  CB  . GLN A 1  62  ? 77.441  92.291  31.071 1.00 52.56  ? 62   GLN A CB  1 
ATOM   317  C  CG  . GLN A 1  62  ? 76.626  92.810  29.881 1.00 54.24  ? 62   GLN A CG  1 
ATOM   318  C  CD  . GLN A 1  62  ? 75.130  92.551  29.944 1.00 55.03  ? 62   GLN A CD  1 
ATOM   319  O  OE1 . GLN A 1  62  ? 74.666  91.446  29.714 1.00 57.43  ? 62   GLN A OE1 1 
ATOM   320  N  NE2 . GLN A 1  62  ? 74.365  93.593  30.236 1.00 54.59  ? 62   GLN A NE2 1 
ATOM   321  N  N   . PRO A 1  63  ? 77.385  91.820  34.698 1.00 51.53  ? 63   PRO A N   1 
ATOM   322  C  CA  . PRO A 1  63  ? 77.934  90.884  35.664 1.00 48.72  ? 63   PRO A CA  1 
ATOM   323  C  C   . PRO A 1  63  ? 77.400  89.521  35.568 1.00 49.11  ? 63   PRO A C   1 
ATOM   324  O  O   . PRO A 1  63  ? 76.253  89.328  35.299 1.00 50.09  ? 63   PRO A O   1 
ATOM   325  C  CB  . PRO A 1  63  ? 77.659  91.525  37.007 1.00 48.98  ? 63   PRO A CB  1 
ATOM   326  C  CG  . PRO A 1  63  ? 76.592  92.473  36.807 1.00 47.58  ? 63   PRO A CG  1 
ATOM   327  C  CD  . PRO A 1  63  ? 76.442  92.762  35.312 1.00 49.47  ? 63   PRO A CD  1 
ATOM   328  N  N   . LYS A 1  64  ? 78.268  88.525  35.740 1.00 49.84  ? 64   LYS A N   1 
ATOM   329  C  CA  . LYS A 1  64  ? 77.779  87.160  35.680 1.00 48.35  ? 64   LYS A CA  1 
ATOM   330  C  C   . LYS A 1  64  ? 76.799  87.035  36.822 1.00 46.91  ? 64   LYS A C   1 
ATOM   331  O  O   . LYS A 1  64  ? 75.751  86.481  36.620 1.00 46.68  ? 64   LYS A O   1 
ATOM   332  C  CB  . LYS A 1  64  ? 78.910  86.120  35.843 1.00 50.11  ? 64   LYS A CB  1 
ATOM   333  C  CG  . LYS A 1  64  ? 78.487  84.722  35.367 1.00 50.97  ? 64   LYS A CG  1 
ATOM   334  C  CD  . LYS A 1  64  ? 79.423  83.666  35.804 1.00 55.86  ? 64   LYS A CD  1 
ATOM   335  C  CE  . LYS A 1  64  ? 80.779  83.772  35.039 1.00 57.24  ? 64   LYS A CE  1 
ATOM   336  N  NZ  . LYS A 1  64  ? 81.792  82.672  35.302 1.00 56.54  ? 64   LYS A NZ  1 
ATOM   337  N  N   . SER A 1  65  ? 77.134  87.537  38.013 1.00 44.06  ? 65   SER A N   1 
ATOM   338  C  CA  . SER A 1  65  ? 76.183  87.422  39.114 1.00 44.45  ? 65   SER A CA  1 
ATOM   339  C  C   . SER A 1  65  ? 75.983  88.696  39.951 1.00 42.90  ? 65   SER A C   1 
ATOM   340  O  O   . SER A 1  65  ? 76.496  89.719  39.565 1.00 42.65  ? 65   SER A O   1 
ATOM   341  C  CB  . SER A 1  65  ? 76.531  86.185  39.965 1.00 41.59  ? 65   SER A CB  1 
ATOM   342  O  OG  . SER A 1  65  ? 77.547  86.454  40.873 1.00 45.09  ? 65   SER A OG  1 
ATOM   343  N  N   . VAL A 1  66  ? 75.145  88.664  41.008 1.00 44.71  ? 66   VAL A N   1 
ATOM   344  C  CA  . VAL A 1  66  ? 74.969  89.852  41.879 1.00 44.33  ? 66   VAL A CA  1 
ATOM   345  C  C   . VAL A 1  66  ? 76.336  90.188  42.423 1.00 43.99  ? 66   VAL A C   1 
ATOM   346  O  O   . VAL A 1  66  ? 76.627  91.345  42.756 1.00 44.76  ? 66   VAL A O   1 
ATOM   347  C  CB  . VAL A 1  66  ? 74.123  89.634  43.133 1.00 41.70  ? 66   VAL A CB  1 
ATOM   348  C  CG1 . VAL A 1  66  ? 73.110  90.685  43.329 1.00 41.86  ? 66   VAL A CG1 1 
ATOM   349  C  CG2 . VAL A 1  66  ? 73.536  88.447  43.076 1.00 45.80  ? 66   VAL A CG2 1 
ATOM   350  N  N   . LYS A 1  67  ? 77.181  89.185  42.522 1.00 45.36  ? 67   LYS A N   1 
ATOM   351  C  CA  . LYS A 1  67  ? 78.517  89.406  43.092 1.00 47.18  ? 67   LYS A CA  1 
ATOM   352  C  C   . LYS A 1  67  ? 79.312  90.504  42.383 1.00 50.01  ? 67   LYS A C   1 
ATOM   353  O  O   . LYS A 1  67  ? 79.680  91.542  42.985 1.00 52.60  ? 67   LYS A O   1 
ATOM   354  C  CB  . LYS A 1  67  ? 79.331  88.110  43.086 1.00 47.05  ? 67   LYS A CB  1 
ATOM   355  C  CG  . LYS A 1  67  ? 78.896  87.066  44.103 1.00 45.48  ? 67   LYS A CG  1 
ATOM   356  C  CD  . LYS A 1  67  ? 79.841  85.935  44.140 1.00 42.89  ? 67   LYS A CD  1 
ATOM   357  C  CE  . LYS A 1  67  ? 79.907  85.142  42.871 1.00 40.68  ? 67   LYS A CE  1 
ATOM   358  N  NZ  . LYS A 1  67  ? 78.818  84.157  42.584 1.00 40.49  ? 67   LYS A NZ  1 
ATOM   359  N  N   . GLU A 1  68  ? 79.539  90.313  41.084 1.00 49.71  ? 68   GLU A N   1 
ATOM   360  C  CA  . GLU A 1  68  ? 80.311  91.253  40.271 1.00 49.22  ? 68   GLU A CA  1 
ATOM   361  C  C   . GLU A 1  68  ? 79.661  92.589  40.245 1.00 49.21  ? 68   GLU A C   1 
ATOM   362  O  O   . GLU A 1  68  ? 80.304  93.621  40.139 1.00 52.41  ? 68   GLU A O   1 
ATOM   363  C  CB  . GLU A 1  68  ? 80.491  90.700  38.856 1.00 49.48  ? 68   GLU A CB  1 
ATOM   364  C  CG  . GLU A 1  68  ? 81.283  89.368  38.836 1.00 46.85  ? 68   GLU A CG  1 
ATOM   365  C  CD  . GLU A 1  68  ? 80.464  88.129  39.311 1.00 67.76  ? 68   GLU A CD  1 
ATOM   366  O  OE1 . GLU A 1  68  ? 79.392  88.249  39.965 1.00 71.41  ? 68   GLU A OE1 1 
ATOM   367  O  OE2 . GLU A 1  68  ? 80.920  87.003  39.048 1.00 67.87  ? 68   GLU A OE2 1 
ATOM   368  N  N   . ALA A 1  69  ? 78.364  92.569  40.394 1.00 48.83  ? 69   ALA A N   1 
ATOM   369  C  CA  . ALA A 1  69  ? 77.583  93.786  40.428 1.00 47.30  ? 69   ALA A CA  1 
ATOM   370  C  C   . ALA A 1  69  ? 78.027  94.691  41.544 1.00 49.53  ? 69   ALA A C   1 
ATOM   371  O  O   . ALA A 1  69  ? 77.925  95.894  41.400 1.00 51.25  ? 69   ALA A O   1 
ATOM   372  C  CB  . ALA A 1  69  ? 76.115  93.430  40.556 1.00 46.38  ? 69   ALA A CB  1 
ATOM   373  N  N   . LEU A 1  70  ? 78.548  94.141  42.651 1.00 51.07  ? 70   LEU A N   1 
ATOM   374  C  CA  . LEU A 1  70  ? 78.986  94.988  43.759 1.00 50.32  ? 70   LEU A CA  1 
ATOM   375  C  C   . LEU A 1  70  ? 80.496  95.216  43.714 1.00 52.65  ? 70   LEU A C   1 
ATOM   376  O  O   . LEU A 1  70  ? 81.093  95.794  44.647 1.00 52.66  ? 70   LEU A O   1 
ATOM   377  C  CB  . LEU A 1  70  ? 78.580  94.331  45.105 1.00 50.18  ? 70   LEU A CB  1 
ATOM   378  C  CG  . LEU A 1  70  ? 77.091  94.056  44.987 1.00 52.29  ? 70   LEU A CG  1 
ATOM   379  C  CD1 . LEU A 1  70  ? 76.721  92.807  45.661 1.00 52.51  ? 70   LEU A CD1 1 
ATOM   380  C  CD2 . LEU A 1  70  ? 76.355  95.175  45.537 1.00 49.56  ? 70   LEU A CD2 1 
ATOM   381  N  N   . SER A 1  71  ? 81.134  94.754  42.641 1.00 53.21  ? 71   SER A N   1 
ATOM   382  C  CA  . SER A 1  71  ? 82.596  94.897  42.517 1.00 53.48  ? 71   SER A CA  1 
ATOM   383  C  C   . SER A 1  71  ? 83.255  96.251  42.734 1.00 54.71  ? 71   SER A C   1 
ATOM   384  O  O   . SER A 1  71  ? 84.446  96.273  42.963 1.00 56.09  ? 71   SER A O   1 
ATOM   385  C  CB  . SER A 1  71  ? 83.055  94.434  41.155 1.00 52.93  ? 71   SER A CB  1 
ATOM   386  O  OG  . SER A 1  71  ? 83.168  93.046  41.100 1.00 57.11  ? 71   SER A OG  1 
ATOM   387  N  N   . TYR A 1  72  ? 82.550  97.366  42.620 1.00 53.07  ? 72   TYR A N   1 
ATOM   388  C  CA  . TYR A 1  72  ? 83.234  98.621  42.806 1.00 55.20  ? 72   TYR A CA  1 
ATOM   389  C  C   . TYR A 1  72  ? 82.828  99.285  44.068 1.00 56.93  ? 72   TYR A C   1 
ATOM   390  O  O   . TYR A 1  72  ? 82.898  100.499 44.198 1.00 57.49  ? 72   TYR A O   1 
ATOM   391  C  CB  . TYR A 1  72  ? 82.950  99.542  41.649 1.00 54.59  ? 72   TYR A CB  1 
ATOM   392  C  CG  . TYR A 1  72  ? 83.583  98.998  40.412 1.00 55.87  ? 72   TYR A CG  1 
ATOM   393  C  CD1 . TYR A 1  72  ? 82.900  98.114  39.560 1.00 54.69  ? 72   TYR A CD1 1 
ATOM   394  C  CD2 . TYR A 1  72  ? 84.940  99.267  40.142 1.00 54.79  ? 72   TYR A CD2 1 
ATOM   395  C  CE1 . TYR A 1  72  ? 83.584  97.516  38.478 1.00 54.15  ? 72   TYR A CE1 1 
ATOM   396  C  CE2 . TYR A 1  72  ? 85.602  98.672  39.081 1.00 52.95  ? 72   TYR A CE2 1 
ATOM   397  C  CZ  . TYR A 1  72  ? 84.944  97.814  38.279 1.00 51.71  ? 72   TYR A CZ  1 
ATOM   398  O  OH  . TYR A 1  72  ? 85.687  97.176  37.381 1.00 49.65  ? 72   TYR A OH  1 
ATOM   399  N  N   . THR A 1  73  ? 82.473  98.465  45.028 1.00 63.40  ? 73   THR A N   1 
ATOM   400  C  CA  . THR A 1  73  ? 81.928  98.960  46.265 1.00 67.97  ? 73   THR A CA  1 
ATOM   401  C  C   . THR A 1  73  ? 82.777  98.678  47.451 1.00 56.17  ? 73   THR A C   1 
ATOM   402  O  O   . THR A 1  73  ? 83.366  97.642  47.541 1.00 56.67  ? 73   THR A O   1 
ATOM   403  C  CB  . THR A 1  73  ? 80.635  98.279  46.410 1.00 73.12  ? 73   THR A CB  1 
ATOM   404  O  OG1 . THR A 1  73  ? 79.885  98.543  45.224 1.00 67.68  ? 73   THR A OG1 1 
ATOM   405  C  CG2 . THR A 1  73  ? 79.913  98.747  47.610 1.00 85.86  ? 73   THR A CG2 1 
ATOM   406  N  N   . PRO A 1  74  ? 82.850  99.579  48.412 1.00 73.38  ? 74   PRO A N   1 
ATOM   407  C  CA  . PRO A 1  74  ? 83.730  99.175  49.524 1.00 57.14  ? 74   PRO A CA  1 
ATOM   408  C  C   . PRO A 1  74  ? 83.255  98.158  50.554 1.00 55.70  ? 74   PRO A C   1 
ATOM   409  O  O   . PRO A 1  74  ? 82.078  98.006  50.809 1.00 56.13  ? 74   PRO A O   1 
ATOM   410  C  CB  . PRO A 1  74  ? 84.044  100.506 50.217 1.00 56.86  ? 74   PRO A CB  1 
ATOM   411  C  CG  . PRO A 1  74  ? 82.676  101.244 50.080 1.00 56.70  ? 74   PRO A CG  1 
ATOM   412  C  CD  . PRO A 1  74  ? 82.390  100.966 48.572 1.00 77.56  ? 74   PRO A CD  1 
ATOM   413  N  N   . GLY A 1  75  ? 84.241  97.528  51.169 1.00 55.82  ? 75   GLY A N   1 
ATOM   414  C  CA  . GLY A 1  75  ? 84.041  96.613  52.264 1.00 56.89  ? 75   GLY A CA  1 
ATOM   415  C  C   . GLY A 1  75  ? 83.520  95.219  52.017 1.00 57.66  ? 75   GLY A C   1 
ATOM   416  O  O   . GLY A 1  75  ? 83.049  94.581  52.980 1.00 58.75  ? 75   GLY A O   1 
ATOM   417  N  N   . VAL A 1  76  ? 83.656  94.728  50.790 1.00 55.01  ? 76   VAL A N   1 
ATOM   418  C  CA  . VAL A 1  76  ? 83.138  93.468  50.436 1.00 54.59  ? 76   VAL A CA  1 
ATOM   419  C  C   . VAL A 1  76  ? 84.037  92.675  49.486 1.00 57.26  ? 76   VAL A C   1 
ATOM   420  O  O   . VAL A 1  76  ? 84.466  93.210  48.424 1.00 56.74  ? 76   VAL A O   1 
ATOM   421  C  CB  . VAL A 1  76  ? 81.727  93.713  49.775 1.00 56.29  ? 76   VAL A CB  1 
ATOM   422  C  CG1 . VAL A 1  76  ? 81.877  94.220  48.345 1.00 54.20  ? 76   VAL A CG1 1 
ATOM   423  C  CG2 . VAL A 1  76  ? 80.913  92.444  49.787 1.00 54.76  ? 76   VAL A CG2 1 
ATOM   424  N  N   . SER A 1  77  ? 84.357  91.412  49.828 1.00 57.86  ? 77   SER A N   1 
ATOM   425  C  CA  . SER A 1  77  ? 85.142  90.574  48.890 1.00 57.96  ? 77   SER A CA  1 
ATOM   426  C  C   . SER A 1  77  ? 84.039  89.838  48.110 1.00 59.00  ? 77   SER A C   1 
ATOM   427  O  O   . SER A 1  77  ? 83.214  89.183  48.701 1.00 59.79  ? 77   SER A O   1 
ATOM   428  C  CB  . SER A 1  77  ? 85.995  89.493  49.572 1.00 64.04  ? 77   SER A CB  1 
ATOM   429  O  OG  . SER A 1  77  ? 86.843  89.941  50.627 1.00 65.22  ? 77   SER A OG  1 
ATOM   430  N  N   . VAL A 1  78  ? 83.999  89.963  46.790 1.00 58.67  ? 78   VAL A N   1 
ATOM   431  C  CA  . VAL A 1  78  ? 82.972  89.274  46.005 1.00 54.02  ? 78   VAL A CA  1 
ATOM   432  C  C   . VAL A 1  78  ? 83.551  88.078  45.281 1.00 53.45  ? 78   VAL A C   1 
ATOM   433  O  O   . VAL A 1  78  ? 82.838  87.201  44.906 1.00 52.07  ? 78   VAL A O   1 
ATOM   434  C  CB  . VAL A 1  78  ? 82.327  90.238  45.001 1.00 56.18  ? 78   VAL A CB  1 
ATOM   435  C  CG1 . VAL A 1  78  ? 81.644  91.297  45.751 1.00 54.67  ? 78   VAL A CG1 1 
ATOM   436  C  CG2 . VAL A 1  78  ? 83.377  90.890  44.003 1.00 52.87  ? 78   VAL A CG2 1 
ATOM   437  N  N   . GLY A 1  79  ? 84.877  87.998  45.185 1.00 52.94  ? 79   GLY A N   1 
ATOM   438  C  CA  . GLY A 1  79  ? 85.487  86.889  44.479 1.00 51.30  ? 79   GLY A CA  1 
ATOM   439  C  C   . GLY A 1  79  ? 86.140  85.766  45.245 1.00 51.45  ? 79   GLY A C   1 
ATOM   440  O  O   . GLY A 1  79  ? 86.786  84.948  44.648 1.00 51.99  ? 79   GLY A O   1 
ATOM   441  N  N   . THR A 1  80  ? 85.928  85.699  46.553 1.00 50.47  ? 80   THR A N   1 
ATOM   442  C  CA  . THR A 1  80  ? 86.515  84.705  47.371 1.00 46.73  ? 80   THR A CA  1 
ATOM   443  C  C   . THR A 1  80  ? 86.620  83.382  46.779 1.00 45.43  ? 80   THR A C   1 
ATOM   444  O  O   . THR A 1  80  ? 87.664  82.801  46.824 1.00 48.02  ? 80   THR A O   1 
ATOM   445  C  CB  . THR A 1  80  ? 85.786  84.661  48.688 1.00 49.98  ? 80   THR A CB  1 
ATOM   446  O  OG1 . THR A 1  80  ? 86.045  85.902  49.378 1.00 53.06  ? 80   THR A OG1 1 
ATOM   447  C  CG2 . THR A 1  80  ? 86.320  83.573  49.585 1.00 49.45  ? 80   THR A CG2 1 
ATOM   448  N  N   . ARG A 1  81  ? 85.576  82.877  46.172 1.00 45.32  ? 81   ARG A N   1 
ATOM   449  C  CA  . ARG A 1  81  ? 85.558  81.483  45.604 1.00 43.34  ? 81   ARG A CA  1 
ATOM   450  C  C   . ARG A 1  81  ? 86.027  81.319  44.144 1.00 43.49  ? 81   ARG A C   1 
ATOM   451  O  O   . ARG A 1  81  ? 85.874  80.277  43.478 1.00 42.69  ? 81   ARG A O   1 
ATOM   452  C  CB  . ARG A 1  81  ? 84.136  80.912  45.738 1.00 39.15  ? 81   ARG A CB  1 
ATOM   453  C  CG  . ARG A 1  81  ? 84.085  79.503  45.633 1.00 37.31  ? 81   ARG A CG  1 
ATOM   454  C  CD  . ARG A 1  81  ? 84.185  78.869  46.937 1.00 41.95  ? 81   ARG A CD  1 
ATOM   455  N  NE  . ARG A 1  81  ? 84.229  77.430  46.720 1.00 44.82  ? 81   ARG A NE  1 
ATOM   456  C  CZ  . ARG A 1  81  ? 83.703  76.580  47.587 1.00 47.19  ? 81   ARG A CZ  1 
ATOM   457  N  NH1 . ARG A 1  81  ? 83.103  77.051  48.720 1.00 47.43  ? 81   ARG A NH1 1 
ATOM   458  N  NH2 . ARG A 1  81  ? 83.734  75.283  47.328 1.00 46.16  ? 81   ARG A NH2 1 
ATOM   459  N  N   . GLY A 1  82  ? 86.547  82.405  43.640 1.00 43.47  ? 82   GLY A N   1 
ATOM   460  C  CA  . GLY A 1  82  ? 87.076  82.368  42.315 1.00 47.72  ? 82   GLY A CA  1 
ATOM   461  C  C   . GLY A 1  82  ? 86.109  81.995  41.237 1.00 49.28  ? 82   GLY A C   1 
ATOM   462  O  O   . GLY A 1  82  ? 85.005  82.451  41.191 1.00 52.53  ? 82   GLY A O   1 
ATOM   463  N  N   . ALA A 1  83  ? 86.535  81.129  40.368 1.00 50.47  ? 83   ALA A N   1 
ATOM   464  C  CA  . ALA A 1  83  ? 85.749  80.737  39.220 1.00 51.37  ? 83   ALA A CA  1 
ATOM   465  C  C   . ALA A 1  83  ? 84.415  80.091  39.560 1.00 53.53  ? 83   ALA A C   1 
ATOM   466  O  O   . ALA A 1  83  ? 83.514  80.044  38.718 1.00 55.44  ? 83   ALA A O   1 
ATOM   467  C  CB  . ALA A 1  83  ? 86.611  79.807  38.308 1.00 50.78  ? 83   ALA A CB  1 
ATOM   468  N  N   . SER A 1  84  ? 84.229  79.590  40.767 1.00 52.53  ? 84   SER A N   1 
ATOM   469  C  CA  . SER A 1  84  ? 82.897  79.022  40.996 1.00 49.89  ? 84   SER A CA  1 
ATOM   470  C  C   . SER A 1  84  ? 81.834  80.069  40.910 1.00 46.47  ? 84   SER A C   1 
ATOM   471  O  O   . SER A 1  84  ? 82.071  81.190  41.185 1.00 48.13  ? 84   SER A O   1 
ATOM   472  C  CB  . SER A 1  84  ? 82.794  78.434  42.378 1.00 50.68  ? 84   SER A CB  1 
ATOM   473  O  OG  . SER A 1  84  ? 81.758  77.493  42.456 1.00 52.53  ? 84   SER A OG  1 
ATOM   474  N  N   . ASN A 1  85  ? 80.649  79.701  40.490 1.00 47.46  ? 85   ASN A N   1 
ATOM   475  C  CA  . ASN A 1  85  ? 79.486  80.611  40.480 1.00 47.18  ? 85   ASN A CA  1 
ATOM   476  C  C   . ASN A 1  85  ? 78.307  80.008  41.262 1.00 45.93  ? 85   ASN A C   1 
ATOM   477  O  O   . ASN A 1  85  ? 77.305  80.614  41.382 1.00 48.59  ? 85   ASN A O   1 
ATOM   478  C  CB  . ASN A 1  85  ? 79.031  80.982  39.047 1.00 48.24  ? 85   ASN A CB  1 
ATOM   479  C  CG  . ASN A 1  85  ? 78.203  82.292  38.990 1.00 50.03  ? 85   ASN A CG  1 
ATOM   480  O  OD1 . ASN A 1  85  ? 78.577  83.340  39.568 1.00 51.76  ? 85   ASN A OD1 1 
ATOM   481  N  ND2 . ASN A 1  85  ? 77.083  82.232  38.299 1.00 50.21  ? 85   ASN A ND2 1 
ATOM   482  N  N   . THR A 1  86  ? 78.427  78.833  41.831 1.00 44.43  ? 86   THR A N   1 
ATOM   483  C  CA  . THR A 1  86  ? 77.297  78.290  42.586 1.00 45.04  ? 86   THR A CA  1 
ATOM   484  C  C   . THR A 1  86  ? 76.532  79.184  43.630 1.00 40.64  ? 86   THR A C   1 
ATOM   485  O  O   . THR A 1  86  ? 75.367  79.093  43.779 1.00 43.26  ? 86   THR A O   1 
ATOM   486  C  CB  . THR A 1  86  ? 77.796  76.962  43.279 1.00 46.97  ? 86   THR A CB  1 
ATOM   487  O  OG1 . THR A 1  86  ? 78.470  76.182  42.279 1.00 45.06  ? 86   THR A OG1 1 
ATOM   488  C  CG2 . THR A 1  86  ? 76.629  76.168  43.944 1.00 41.35  ? 86   THR A CG2 1 
ATOM   489  N  N   . TYR A 1  87  ? 77.191  80.059  44.303 1.00 36.08  ? 87   TYR A N   1 
ATOM   490  C  CA  . TYR A 1  87  ? 76.570  80.850  45.323 1.00 35.29  ? 87   TYR A CA  1 
ATOM   491  C  C   . TYR A 1  87  ? 77.005  82.292  45.289 1.00 36.54  ? 87   TYR A C   1 
ATOM   492  O  O   . TYR A 1  87  ? 78.058  82.620  44.791 1.00 39.96  ? 87   TYR A O   1 
ATOM   493  C  CB  . TYR A 1  87  ? 76.951  80.261  46.698 1.00 31.60  ? 87   TYR A CB  1 
ATOM   494  C  CG  . TYR A 1  87  ? 76.430  78.916  46.847 1.00 28.63  ? 87   TYR A CG  1 
ATOM   495  C  CD1 . TYR A 1  87  ? 75.115  78.708  47.037 1.00 31.58  ? 87   TYR A CD1 1 
ATOM   496  C  CD2 . TYR A 1  87  ? 77.234  77.841  46.840 1.00 33.84  ? 87   TYR A CD2 1 
ATOM   497  C  CE1 . TYR A 1  87  ? 74.582  77.392  47.206 1.00 31.12  ? 87   TYR A CE1 1 
ATOM   498  C  CE2 . TYR A 1  87  ? 76.756  76.541  47.033 1.00 30.50  ? 87   TYR A CE2 1 
ATOM   499  C  CZ  . TYR A 1  87  ? 75.417  76.331  47.190 1.00 34.61  ? 87   TYR A CZ  1 
ATOM   500  O  OH  . TYR A 1  87  ? 74.856  75.046  47.171 1.00 38.50  ? 87   TYR A OH  1 
ATOM   501  N  N   . ASP A 1  88  ? 76.183  83.177  45.815 1.00 36.45  ? 88   ASP A N   1 
ATOM   502  C  CA  . ASP A 1  88  ? 76.557  84.509  45.852 1.00 36.39  ? 88   ASP A CA  1 
ATOM   503  C  C   . ASP A 1  88  ? 76.916  84.723  47.336 1.00 41.07  ? 88   ASP A C   1 
ATOM   504  O  O   . ASP A 1  88  ? 76.168  85.273  48.119 1.00 42.97  ? 88   ASP A O   1 
ATOM   505  C  CB  . ASP A 1  88  ? 75.418  85.298  45.392 1.00 35.97  ? 88   ASP A CB  1 
ATOM   506  C  CG  . ASP A 1  88  ? 75.182  85.173  43.842 1.00 45.03  ? 88   ASP A CG  1 
ATOM   507  O  OD1 . ASP A 1  88  ? 76.179  85.070  43.090 1.00 42.85  ? 88   ASP A OD1 1 
ATOM   508  O  OD2 . ASP A 1  88  ? 74.009  85.250  43.378 1.00 42.80  ? 88   ASP A OD2 1 
ATOM   509  N  N   . HIS A 1  89  ? 78.102  84.264  47.696 1.00 41.18  ? 89   HIS A N   1 
ATOM   510  C  CA  . HIS A 1  89  ? 78.669  84.421  48.999 1.00 45.38  ? 89   HIS A CA  1 
ATOM   511  C  C   . HIS A 1  89  ? 79.524  85.682  49.100 1.00 47.40  ? 89   HIS A C   1 
ATOM   512  O  O   . HIS A 1  89  ? 80.383  85.964  48.301 1.00 49.12  ? 89   HIS A O   1 
ATOM   513  C  CB  . HIS A 1  89  ? 79.544  83.239  49.263 1.00 47.92  ? 89   HIS A CB  1 
ATOM   514  C  CG  . HIS A 1  89  ? 80.172  83.265  50.600 1.00 54.79  ? 89   HIS A CG  1 
ATOM   515  N  ND1 . HIS A 1  89  ? 79.414  83.368  51.761 1.00 79.56  ? 89   HIS A ND1 1 
ATOM   516  C  CD2 . HIS A 1  89  ? 81.474  83.191  50.995 1.00 57.00  ? 89   HIS A CD2 1 
ATOM   517  C  CE1 . HIS A 1  89  ? 80.221  83.345  52.804 1.00 57.45  ? 89   HIS A CE1 1 
ATOM   518  N  NE2 . HIS A 1  89  ? 81.479  83.235  52.369 1.00 58.46  ? 89   HIS A NE2 1 
ATOM   519  N  N   . LEU A 1  90  ? 79.298  86.451  50.114 1.00 47.14  ? 90   LEU A N   1 
ATOM   520  C  CA  . LEU A 1  90  ? 80.025  87.626  50.263 1.00 44.60  ? 90   LEU A CA  1 
ATOM   521  C  C   . LEU A 1  90  ? 80.580  87.770  51.689 1.00 49.03  ? 90   LEU A C   1 
ATOM   522  O  O   . LEU A 1  90  ? 79.860  87.616  52.722 1.00 47.05  ? 90   LEU A O   1 
ATOM   523  C  CB  . LEU A 1  90  ? 79.123  88.752  50.011 1.00 40.88  ? 90   LEU A CB  1 
ATOM   524  C  CG  . LEU A 1  90  ? 78.373  88.766  48.680 1.00 46.40  ? 90   LEU A CG  1 
ATOM   525  C  CD1 . LEU A 1  90  ? 77.402  89.970  48.617 1.00 43.65  ? 90   LEU A CD1 1 
ATOM   526  C  CD2 . LEU A 1  90  ? 79.341  88.932  47.516 1.00 44.93  ? 90   LEU A CD2 1 
ATOM   527  N  N   . ILE A 1  91  ? 81.888  88.065  51.748 1.00 51.26  ? 91   ILE A N   1 
ATOM   528  C  CA  . ILE A 1  91  ? 82.484  88.411  53.025 1.00 51.45  ? 91   ILE A CA  1 
ATOM   529  C  C   . ILE A 1  91  ? 82.430  89.958  53.100 1.00 52.76  ? 91   ILE A C   1 
ATOM   530  O  O   . ILE A 1  91  ? 82.943  90.641  52.230 1.00 53.83  ? 91   ILE A O   1 
ATOM   531  C  CB  . ILE A 1  91  ? 83.891  87.968  53.145 1.00 49.26  ? 91   ILE A CB  1 
ATOM   532  C  CG1 . ILE A 1  91  ? 83.953  86.438  53.044 1.00 48.49  ? 91   ILE A CG1 1 
ATOM   533  C  CG2 . ILE A 1  91  ? 84.384  88.428  54.483 1.00 48.41  ? 91   ILE A CG2 1 
ATOM   534  C  CD1 . ILE A 1  91  ? 85.348  85.940  53.079 1.00 50.18  ? 91   ILE A CD1 1 
ATOM   535  N  N   . ILE A 1  92  ? 81.745  90.474  54.122 1.00 53.83  ? 92   ILE A N   1 
ATOM   536  C  CA  . ILE A 1  92  ? 81.545  91.891  54.318 1.00 54.00  ? 92   ILE A CA  1 
ATOM   537  C  C   . ILE A 1  92  ? 82.190  92.363  55.595 1.00 54.26  ? 92   ILE A C   1 
ATOM   538  O  O   . ILE A 1  92  ? 81.973  91.787  56.628 1.00 54.90  ? 92   ILE A O   1 
ATOM   539  C  CB  . ILE A 1  92  ? 80.063  92.190  54.461 1.00 53.97  ? 92   ILE A CB  1 
ATOM   540  C  CG1 . ILE A 1  92  ? 79.288  91.501  53.340 1.00 52.29  ? 92   ILE A CG1 1 
ATOM   541  C  CG2 . ILE A 1  92  ? 79.797  93.698  54.447 1.00 52.64  ? 92   ILE A CG2 1 
ATOM   542  C  CD1 . ILE A 1  92  ? 77.798  91.798  53.407 1.00 46.59  ? 92   ILE A CD1 1 
ATOM   543  N  N   . ARG A 1  93  ? 82.979  93.422  55.511 1.00 55.52  ? 93   ARG A N   1 
ATOM   544  C  CA  . ARG A 1  93  ? 83.654  93.983  56.663 1.00 55.26  ? 93   ARG A CA  1 
ATOM   545  C  C   . ARG A 1  93  ? 84.329  92.889  57.466 1.00 54.93  ? 93   ARG A C   1 
ATOM   546  O  O   . ARG A 1  93  ? 84.306  92.884  58.715 1.00 55.64  ? 93   ARG A O   1 
ATOM   547  C  CB  . ARG A 1  93  ? 82.641  94.764  57.491 1.00 53.92  ? 93   ARG A CB  1 
ATOM   548  C  CG  . ARG A 1  93  ? 83.002  96.190  57.573 1.00 55.37  ? 93   ARG A CG  1 
ATOM   549  C  CD  . ARG A 1  93  ? 82.080  97.148  56.934 1.00 55.18  ? 93   ARG A CD  1 
ATOM   550  N  NE  . ARG A 1  93  ? 81.422  97.907  57.965 1.00 55.97  ? 93   ARG A NE  1 
ATOM   551  C  CZ  . ARG A 1  93  ? 81.190  99.214  57.929 1.00 56.78  ? 93   ARG A CZ  1 
ATOM   552  N  NH1 . ARG A 1  93  ? 81.561  99.957  56.913 1.00 60.38  ? 93   ARG A NH1 1 
ATOM   553  N  NH2 . ARG A 1  93  ? 80.546  99.778  58.916 1.00 70.97  ? 93   ARG A NH2 1 
ATOM   554  N  N   . GLY A 1  94  ? 84.968  91.980  56.745 1.00 53.51  ? 94   GLY A N   1 
ATOM   555  C  CA  . GLY A 1  94  ? 85.580  90.822  57.404 1.00 53.91  ? 94   GLY A CA  1 
ATOM   556  C  C   . GLY A 1  94  ? 84.712  89.614  57.855 1.00 54.41  ? 94   GLY A C   1 
ATOM   557  O  O   . GLY A 1  94  ? 85.246  88.562  58.109 1.00 56.30  ? 94   GLY A O   1 
ATOM   558  N  N   . PHE A 1  95  ? 83.398  89.730  57.991 1.00 53.81  ? 95   PHE A N   1 
ATOM   559  C  CA  . PHE A 1  95  ? 82.612  88.581  58.408 1.00 53.67  ? 95   PHE A CA  1 
ATOM   560  C  C   . PHE A 1  95  ? 81.669  87.980  57.402 1.00 54.60  ? 95   PHE A C   1 
ATOM   561  O  O   . PHE A 1  95  ? 81.308  88.571  56.387 1.00 54.53  ? 95   PHE A O   1 
ATOM   562  C  CB  . PHE A 1  95  ? 81.756  88.895  59.610 1.00 54.40  ? 95   PHE A CB  1 
ATOM   563  C  CG  . PHE A 1  95  ? 82.489  89.499  60.739 1.00 67.29  ? 95   PHE A CG  1 
ATOM   564  C  CD1 . PHE A 1  95  ? 82.872  90.821  60.689 1.00 68.39  ? 95   PHE A CD1 1 
ATOM   565  C  CD2 . PHE A 1  95  ? 82.924  88.710  61.789 1.00 65.43  ? 95   PHE A CD2 1 
ATOM   566  C  CE1 . PHE A 1  95  ? 83.642  91.358  61.665 1.00 62.18  ? 95   PHE A CE1 1 
ATOM   567  C  CE2 . PHE A 1  95  ? 83.696  89.234  62.769 1.00 68.73  ? 95   PHE A CE2 1 
ATOM   568  C  CZ  . PHE A 1  95  ? 84.082  90.569  62.697 1.00 68.60  ? 95   PHE A CZ  1 
ATOM   569  N  N   . ALA A 1  96  ? 81.256  86.772  57.719 1.00 55.08  ? 96   ALA A N   1 
ATOM   570  C  CA  . ALA A 1  96  ? 80.328  86.043  56.904 1.00 55.71  ? 96   ALA A CA  1 
ATOM   571  C  C   . ALA A 1  96  ? 79.353  85.476  57.916 1.00 56.24  ? 96   ALA A C   1 
ATOM   572  O  O   . ALA A 1  96  ? 79.618  85.485  59.117 1.00 58.00  ? 96   ALA A O   1 
ATOM   573  C  CB  . ALA A 1  96  ? 81.038  84.961  56.208 1.00 55.61  ? 96   ALA A CB  1 
ATOM   574  N  N   . ALA A 1  97  ? 78.207  85.016  57.443 1.00 57.03  ? 97   ALA A N   1 
ATOM   575  C  CA  . ALA A 1  97  ? 77.197  84.408  58.328 1.00 64.21  ? 97   ALA A CA  1 
ATOM   576  C  C   . ALA A 1  97  ? 77.525  83.094  59.004 1.00 67.70  ? 97   ALA A C   1 
ATOM   577  O  O   . ALA A 1  97  ? 78.464  82.352  58.641 1.00 60.36  ? 97   ALA A O   1 
ATOM   578  C  CB  . ALA A 1  97  ? 75.907  84.198  57.607 1.00 55.65  ? 97   ALA A CB  1 
ATOM   579  N  N   . GLU A 1  98  ? 76.698  82.843  60.010 1.00 68.06  ? 98   GLU A N   1 
ATOM   580  C  CA  . GLU A 1  98  ? 76.727  81.621  60.774 1.00 74.95  ? 98   GLU A CA  1 
ATOM   581  C  C   . GLU A 1  98  ? 76.785  80.498  59.735 1.00 70.13  ? 98   GLU A C   1 
ATOM   582  O  O   . GLU A 1  98  ? 75.828  80.306  58.957 1.00 71.31  ? 98   GLU A O   1 
ATOM   583  C  CB  . GLU A 1  98  ? 75.415  81.530  61.582 1.00 83.51  ? 98   GLU A CB  1 
ATOM   584  C  CG  . GLU A 1  98  ? 75.424  80.583  62.807 1.00 85.88  ? 98   GLU A CG  1 
ATOM   585  C  CD  . GLU A 1  98  ? 75.128  79.122  62.461 1.00 90.48  ? 98   GLU A CD  1 
ATOM   586  O  OE1 . GLU A 1  98  ? 74.064  78.943  61.776 1.00 94.28  ? 98   GLU A OE1 1 
ATOM   587  O  OE2 . GLU A 1  98  ? 75.934  78.192  62.885 1.00 75.89  ? 98   GLU A OE2 1 
ATOM   588  N  N   . GLY A 1  99  ? 77.901  79.782  59.725 1.00 59.73  ? 99   GLY A N   1 
ATOM   589  C  CA  . GLY A 1  99  ? 78.045  78.682  58.811 1.00 59.58  ? 99   GLY A CA  1 
ATOM   590  C  C   . GLY A 1  99  ? 78.638  78.978  57.451 1.00 63.60  ? 99   GLY A C   1 
ATOM   591  O  O   . GLY A 1  99  ? 79.031  78.081  56.769 1.00 71.28  ? 99   GLY A O   1 
ATOM   592  N  N   . GLN A 1  100 ? 78.730  80.217  57.020 1.00 68.51  ? 100  GLN A N   1 
ATOM   593  C  CA  . GLN A 1  100 ? 79.256  80.497  55.675 1.00 71.93  ? 100  GLN A CA  1 
ATOM   594  C  C   . GLN A 1  100 ? 78.068  80.484  54.713 1.00 69.61  ? 100  GLN A C   1 
ATOM   595  O  O   . GLN A 1  100 ? 78.193  80.434  53.492 1.00 56.58  ? 100  GLN A O   1 
ATOM   596  C  CB  . GLN A 1  100 ? 80.306  79.462  55.228 1.00 92.64  ? 100  GLN A CB  1 
ATOM   597  C  CG  . GLN A 1  100 ? 81.598  79.372  56.084 1.00 111.34 ? 100  GLN A CG  1 
ATOM   598  C  CD  . GLN A 1  100 ? 82.354  80.675  56.200 1.00 120.39 ? 100  GLN A CD  1 
ATOM   599  O  OE1 . GLN A 1  100 ? 82.307  81.513  55.308 1.00 139.36 ? 100  GLN A OE1 1 
ATOM   600  N  NE2 . GLN A 1  100 ? 83.078  80.840  57.300 1.00 129.80 ? 100  GLN A NE2 1 
ATOM   601  N  N   . SER A 1  101 ? 76.897  80.470  55.320 1.00 56.15  ? 101  SER A N   1 
ATOM   602  C  CA  . SER A 1  101 ? 75.637  80.571  54.666 1.00 53.80  ? 101  SER A CA  1 
ATOM   603  C  C   . SER A 1  101 ? 75.492  82.010  54.066 1.00 51.45  ? 101  SER A C   1 
ATOM   604  O  O   . SER A 1  101 ? 76.026  82.956  54.579 1.00 73.44  ? 101  SER A O   1 
ATOM   605  C  CB  . SER A 1  101 ? 74.553  80.404  55.726 1.00 55.11  ? 101  SER A CB  1 
ATOM   606  O  OG  . SER A 1  101 ? 73.799  79.234  55.497 1.00 62.89  ? 101  SER A OG  1 
ATOM   607  N  N   . GLN A 1  102 ? 74.773  82.153  52.979 1.00 47.61  ? 102  GLN A N   1 
ATOM   608  C  CA  . GLN A 1  102 ? 74.531  83.450  52.429 1.00 46.36  ? 102  GLN A CA  1 
ATOM   609  C  C   . GLN A 1  102 ? 73.704  84.271  53.414 1.00 45.30  ? 102  GLN A C   1 
ATOM   610  O  O   . GLN A 1  102 ? 72.907  83.749  54.114 1.00 48.31  ? 102  GLN A O   1 
ATOM   611  C  CB  . GLN A 1  102 ? 73.686  83.385  51.129 1.00 43.14  ? 102  GLN A CB  1 
ATOM   612  C  CG  . GLN A 1  102 ? 74.290  82.633  50.102 1.00 41.81  ? 102  GLN A CG  1 
ATOM   613  C  CD  . GLN A 1  102 ? 73.493  82.510  48.789 1.00 42.81  ? 102  GLN A CD  1 
ATOM   614  O  OE1 . GLN A 1  102 ? 74.071  82.211  47.805 1.00 44.09  ? 102  GLN A OE1 1 
ATOM   615  N  NE2 . GLN A 1  102 ? 72.187  82.739  48.792 1.00 46.85  ? 102  GLN A NE2 1 
ATOM   616  N  N   . ASN A 1  103 ? 73.859  85.582  53.401 1.00 44.68  ? 103  ASN A N   1 
ATOM   617  C  CA  . ASN A 1  103 ? 73.008  86.419  54.199 1.00 40.71  ? 103  ASN A CA  1 
ATOM   618  C  C   . ASN A 1  103 ? 72.424  87.328  53.152 1.00 36.16  ? 103  ASN A C   1 
ATOM   619  O  O   . ASN A 1  103 ? 72.720  88.467  53.106 1.00 36.19  ? 103  ASN A O   1 
ATOM   620  C  CB  . ASN A 1  103 ? 73.807  87.224  55.236 1.00 41.46  ? 103  ASN A CB  1 
ATOM   621  C  CG  . ASN A 1  103 ? 72.939  87.958  56.097 1.00 40.11  ? 103  ASN A CG  1 
ATOM   622  O  OD1 . ASN A 1  103 ? 71.789  87.530  56.316 1.00 45.03  ? 103  ASN A OD1 1 
ATOM   623  N  ND2 . ASN A 1  103 ? 73.402  89.075  56.600 1.00 44.63  ? 103  ASN A ND2 1 
ATOM   624  N  N   . ASN A 1  104 ? 71.604  86.776  52.285 1.00 39.76  ? 104  ASN A N   1 
ATOM   625  C  CA  . ASN A 1  104 ? 71.009  87.488  51.122 1.00 39.15  ? 104  ASN A CA  1 
ATOM   626  C  C   . ASN A 1  104 ? 69.495  87.759  51.172 1.00 38.81  ? 104  ASN A C   1 
ATOM   627  O  O   . ASN A 1  104 ? 68.727  86.832  51.431 1.00 42.11  ? 104  ASN A O   1 
ATOM   628  C  CB  . ASN A 1  104 ? 71.298  86.702  49.855 1.00 37.96  ? 104  ASN A CB  1 
ATOM   629  C  CG  . ASN A 1  104 ? 72.751  86.654  49.537 1.00 41.09  ? 104  ASN A CG  1 
ATOM   630  O  OD1 . ASN A 1  104 ? 73.538  86.982  50.340 1.00 41.20  ? 104  ASN A OD1 1 
ATOM   631  N  ND2 . ASN A 1  104 ? 73.108  86.215  48.354 1.00 39.55  ? 104  ASN A ND2 1 
ATOM   632  N  N   . TYR A 1  105 ? 69.073  89.014  50.963 1.00 38.11  ? 105  TYR A N   1 
ATOM   633  C  CA  . TYR A 1  105 ? 67.639  89.381  50.924 1.00 41.34  ? 105  TYR A CA  1 
ATOM   634  C  C   . TYR A 1  105 ? 67.098  89.639  49.445 1.00 43.91  ? 105  TYR A C   1 
ATOM   635  O  O   . TYR A 1  105 ? 67.868  89.906  48.474 1.00 46.84  ? 105  TYR A O   1 
ATOM   636  C  CB  . TYR A 1  105 ? 67.418  90.614  51.828 1.00 41.86  ? 105  TYR A CB  1 
ATOM   637  C  CG  . TYR A 1  105 ? 67.527  90.268  53.299 1.00 40.85  ? 105  TYR A CG  1 
ATOM   638  C  CD1 . TYR A 1  105 ? 68.697  89.788  53.836 1.00 41.61  ? 105  TYR A CD1 1 
ATOM   639  C  CD2 . TYR A 1  105 ? 66.406  90.329  54.159 1.00 45.95  ? 105  TYR A CD2 1 
ATOM   640  C  CE1 . TYR A 1  105 ? 68.752  89.392  55.141 1.00 43.67  ? 105  TYR A CE1 1 
ATOM   641  C  CE2 . TYR A 1  105 ? 66.462  89.915  55.509 1.00 40.74  ? 105  TYR A CE2 1 
ATOM   642  C  CZ  . TYR A 1  105 ? 67.620  89.462  55.985 1.00 43.30  ? 105  TYR A CZ  1 
ATOM   643  O  OH  . TYR A 1  105 ? 67.737  89.081  57.310 1.00 44.54  ? 105  TYR A OH  1 
ATOM   644  N  N   . LEU A 1  106 ? 65.806  89.488  49.235 1.00 43.80  ? 106  LEU A N   1 
ATOM   645  C  CA  . LEU A 1  106 ? 65.233  89.794  47.947 1.00 41.56  ? 106  LEU A CA  1 
ATOM   646  C  C   . LEU A 1  106 ? 63.902  90.439  48.347 1.00 44.71  ? 106  LEU A C   1 
ATOM   647  O  O   . LEU A 1  106 ? 63.024  89.794  48.953 1.00 45.78  ? 106  LEU A O   1 
ATOM   648  C  CB  . LEU A 1  106 ? 64.992  88.550  47.182 1.00 38.46  ? 106  LEU A CB  1 
ATOM   649  C  CG  . LEU A 1  106 ? 64.284  88.823  45.855 1.00 38.13  ? 106  LEU A CG  1 
ATOM   650  C  CD1 . LEU A 1  106 ? 65.136  89.399  44.809 1.00 32.90  ? 106  LEU A CD1 1 
ATOM   651  C  CD2 . LEU A 1  106 ? 63.639  87.507  45.467 1.00 36.70  ? 106  LEU A CD2 1 
ATOM   652  N  N   . ASN A 1  107 ? 63.773  91.727  48.051 1.00 44.15  ? 107  ASN A N   1 
ATOM   653  C  CA  . ASN A 1  107 ? 62.560  92.487  48.329 1.00 45.65  ? 107  ASN A CA  1 
ATOM   654  C  C   . ASN A 1  107 ? 62.305  92.730  49.814 1.00 48.29  ? 107  ASN A C   1 
ATOM   655  O  O   . ASN A 1  107 ? 61.192  92.839  50.250 1.00 49.40  ? 107  ASN A O   1 
ATOM   656  C  CB  . ASN A 1  107 ? 61.365  91.849  47.630 1.00 43.56  ? 107  ASN A CB  1 
ATOM   657  C  CG  . ASN A 1  107 ? 61.579  91.714  46.059 1.00 45.03  ? 107  ASN A CG  1 
ATOM   658  O  OD1 . ASN A 1  107 ? 62.066  92.633  45.432 1.00 45.47  ? 107  ASN A OD1 1 
ATOM   659  N  ND2 . ASN A 1  107 ? 61.218  90.586  45.487 1.00 40.08  ? 107  ASN A ND2 1 
ATOM   660  N  N   . GLY A 1  108 ? 63.373  92.790  50.600 1.00 49.78  ? 108  GLY A N   1 
ATOM   661  C  CA  . GLY A 1  108 ? 63.250  93.107  52.003 1.00 48.64  ? 108  GLY A CA  1 
ATOM   662  C  C   . GLY A 1  108 ? 63.024  91.896  52.804 1.00 51.44  ? 108  GLY A C   1 
ATOM   663  O  O   . GLY A 1  108 ? 62.927  92.009  54.023 1.00 53.67  ? 108  GLY A O   1 
ATOM   664  N  N   . LEU A 1  109 ? 62.944  90.742  52.142 1.00 49.95  ? 109  LEU A N   1 
ATOM   665  C  CA  . LEU A 1  109 ? 62.674  89.533  52.877 1.00 50.22  ? 109  LEU A CA  1 
ATOM   666  C  C   . LEU A 1  109 ? 63.802  88.600  52.735 1.00 50.84  ? 109  LEU A C   1 
ATOM   667  O  O   . LEU A 1  109 ? 64.303  88.503  51.652 1.00 53.65  ? 109  LEU A O   1 
ATOM   668  C  CB  . LEU A 1  109 ? 61.422  88.896  52.351 1.00 48.69  ? 109  LEU A CB  1 
ATOM   669  C  CG  . LEU A 1  109 ? 60.126  89.728  52.504 1.00 46.90  ? 109  LEU A CG  1 
ATOM   670  C  CD1 . LEU A 1  109 ? 59.047  88.969  51.825 1.00 44.48  ? 109  LEU A CD1 1 
ATOM   671  C  CD2 . LEU A 1  109 ? 59.755  89.958  54.000 1.00 46.84  ? 109  LEU A CD2 1 
ATOM   672  N  N   . LYS A 1  110 ? 64.203  87.908  53.794 1.00 48.59  ? 110  LYS A N   1 
ATOM   673  C  CA  . LYS A 1  110 ? 65.322  87.021  53.646 1.00 45.75  ? 110  LYS A CA  1 
ATOM   674  C  C   . LYS A 1  110 ? 65.178  85.784  52.829 1.00 46.54  ? 110  LYS A C   1 
ATOM   675  O  O   . LYS A 1  110 ? 64.201  85.025  52.970 1.00 47.83  ? 110  LYS A O   1 
ATOM   676  C  CB  . LYS A 1  110 ? 65.857  86.574  54.977 1.00 42.93  ? 110  LYS A CB  1 
ATOM   677  C  CG  . LYS A 1  110 ? 67.182  85.961  54.760 1.00 44.06  ? 110  LYS A CG  1 
ATOM   678  C  CD  . LYS A 1  110 ? 67.923  85.750  56.004 1.00 43.37  ? 110  LYS A CD  1 
ATOM   679  C  CE  . LYS A 1  110 ? 69.114  84.970  55.723 1.00 42.25  ? 110  LYS A CE  1 
ATOM   680  N  NZ  . LYS A 1  110 ? 69.863  84.824  56.988 1.00 44.77  ? 110  LYS A NZ  1 
ATOM   681  N  N   . LEU A 1  111 ? 66.153  85.510  51.954 1.00 46.50  ? 111  LEU A N   1 
ATOM   682  C  CA  . LEU A 1  111 ? 66.020  84.249  51.222 1.00 44.43  ? 111  LEU A CA  1 
ATOM   683  C  C   . LEU A 1  111 ? 66.761  83.312  52.164 1.00 45.07  ? 111  LEU A C   1 
ATOM   684  O  O   . LEU A 1  111 ? 67.954  83.091  51.955 1.00 45.00  ? 111  LEU A O   1 
ATOM   685  C  CB  . LEU A 1  111 ? 66.750  84.251  49.905 1.00 41.42  ? 111  LEU A CB  1 
ATOM   686  C  CG  . LEU A 1  111 ? 66.227  84.905  48.630 1.00 40.46  ? 111  LEU A CG  1 
ATOM   687  C  CD1 . LEU A 1  111 ? 67.464  85.252  47.910 1.00 36.70  ? 111  LEU A CD1 1 
ATOM   688  C  CD2 . LEU A 1  111 ? 65.303  84.043  47.816 1.00 35.22  ? 111  LEU A CD2 1 
ATOM   689  N  N   . GLN A 1  112 ? 66.069  82.791  53.205 1.00 43.78  ? 112  GLN A N   1 
ATOM   690  C  CA  . GLN A 1  112 ? 66.703  81.885  54.146 1.00 45.57  ? 112  GLN A CA  1 
ATOM   691  C  C   . GLN A 1  112 ? 67.075  80.513  53.606 1.00 45.05  ? 112  GLN A C   1 
ATOM   692  O  O   . GLN A 1  112 ? 66.208  79.763  53.287 1.00 43.69  ? 112  GLN A O   1 
ATOM   693  C  CB  . GLN A 1  112 ? 65.849  81.615  55.373 1.00 46.37  ? 112  GLN A CB  1 
ATOM   694  C  CG  . GLN A 1  112 ? 66.284  82.350  56.504 1.00 49.11  ? 112  GLN A CG  1 
ATOM   695  C  CD  . GLN A 1  112 ? 67.576  81.833  57.060 1.00 53.26  ? 112  GLN A CD  1 
ATOM   696  O  OE1 . GLN A 1  112 ? 68.230  82.523  57.863 1.00 53.24  ? 112  GLN A OE1 1 
ATOM   697  N  NE2 . GLN A 1  112 ? 67.981  80.624  56.624 1.00 53.09  ? 112  GLN A NE2 1 
ATOM   698  N  N   . GLY A 1  113 ? 68.368  80.185  53.559 1.00 45.02  ? 113  GLY A N   1 
ATOM   699  C  CA  . GLY A 1  113 ? 68.768  78.872  53.107 1.00 45.28  ? 113  GLY A CA  1 
ATOM   700  C  C   . GLY A 1  113 ? 69.324  78.086  54.273 1.00 46.93  ? 113  GLY A C   1 
ATOM   701  O  O   . GLY A 1  113 ? 69.335  78.488  55.444 1.00 47.07  ? 113  GLY A O   1 
ATOM   702  N  N   . ASN A 1  114 ? 69.840  76.937  53.925 1.00 48.51  ? 114  ASN A N   1 
ATOM   703  C  CA  . ASN A 1  114 ? 70.394  76.036  54.907 1.00 48.25  ? 114  ASN A CA  1 
ATOM   704  C  C   . ASN A 1  114 ? 71.293  75.004  54.305 1.00 47.10  ? 114  ASN A C   1 
ATOM   705  O  O   . ASN A 1  114 ? 70.910  74.412  53.300 1.00 43.76  ? 114  ASN A O   1 
ATOM   706  C  CB  . ASN A 1  114 ? 69.284  75.306  55.624 1.00 49.66  ? 114  ASN A CB  1 
ATOM   707  C  CG  . ASN A 1  114 ? 69.795  74.411  56.719 1.00 49.88  ? 114  ASN A CG  1 
ATOM   708  O  OD1 . ASN A 1  114 ? 69.706  73.195  56.620 1.00 51.28  ? 114  ASN A OD1 1 
ATOM   709  N  ND2 . ASN A 1  114 ? 70.316  75.002  57.774 1.00 46.82  ? 114  ASN A ND2 1 
ATOM   710  N  N   . PHE A 1  115 ? 72.475  74.806  54.913 1.00 46.41  ? 115  PHE A N   1 
ATOM   711  C  CA  . PHE A 1  115 ? 73.400  73.770  54.436 1.00 47.89  ? 115  PHE A CA  1 
ATOM   712  C  C   . PHE A 1  115 ? 73.642  73.985  52.917 1.00 48.75  ? 115  PHE A C   1 
ATOM   713  O  O   . PHE A 1  115 ? 73.778  75.133  52.543 1.00 51.79  ? 115  PHE A O   1 
ATOM   714  C  CB  . PHE A 1  115 ? 72.742  72.449  54.740 1.00 47.91  ? 115  PHE A CB  1 
ATOM   715  C  CG  . PHE A 1  115 ? 73.664  71.362  54.849 1.00 47.38  ? 115  PHE A CG  1 
ATOM   716  C  CD1 . PHE A 1  115 ? 74.658  71.411  55.798 1.00 46.31  ? 115  PHE A CD1 1 
ATOM   717  C  CD2 . PHE A 1  115 ? 73.546  70.240  53.992 1.00 47.75  ? 115  PHE A CD2 1 
ATOM   718  C  CE1 . PHE A 1  115 ? 75.555  70.317  55.913 1.00 46.83  ? 115  PHE A CE1 1 
ATOM   719  C  CE2 . PHE A 1  115 ? 74.410  69.143  54.075 1.00 45.31  ? 115  PHE A CE2 1 
ATOM   720  C  CZ  . PHE A 1  115 ? 75.404  69.174  55.020 1.00 48.65  ? 115  PHE A CZ  1 
ATOM   721  N  N   . TYR A 1  116 ? 73.725  73.003  52.024 1.00 48.50  ? 116  TYR A N   1 
ATOM   722  C  CA  . TYR A 1  116 ? 73.890  73.430  50.611 1.00 49.14  ? 116  TYR A CA  1 
ATOM   723  C  C   . TYR A 1  116 ? 72.677  74.100  49.942 1.00 51.17  ? 116  TYR A C   1 
ATOM   724  O  O   . TYR A 1  116 ? 72.760  74.504  48.804 1.00 52.29  ? 116  TYR A O   1 
ATOM   725  C  CB  . TYR A 1  116 ? 74.292  72.295  49.749 1.00 48.26  ? 116  TYR A CB  1 
ATOM   726  C  CG  . TYR A 1  116 ? 75.665  71.731  50.102 1.00 52.49  ? 116  TYR A CG  1 
ATOM   727  C  CD1 . TYR A 1  116 ? 76.866  72.364  49.623 1.00 50.90  ? 116  TYR A CD1 1 
ATOM   728  C  CD2 . TYR A 1  116 ? 75.798  70.510  50.824 1.00 53.01  ? 116  TYR A CD2 1 
ATOM   729  C  CE1 . TYR A 1  116 ? 78.120  71.790  49.836 1.00 53.80  ? 116  TYR A CE1 1 
ATOM   730  C  CE2 . TYR A 1  116 ? 77.086  69.910  51.032 1.00 54.97  ? 116  TYR A CE2 1 
ATOM   731  C  CZ  . TYR A 1  116 ? 78.219  70.552  50.522 1.00 56.59  ? 116  TYR A CZ  1 
ATOM   732  O  OH  . TYR A 1  116 ? 79.430  69.939  50.542 1.00 69.20  ? 116  TYR A OH  1 
ATOM   733  N  N   . ASN A 1  117 ? 71.565  74.308  50.659 1.00 51.39  ? 117  ASN A N   1 
ATOM   734  C  CA  . ASN A 1  117 ? 70.363  74.857  50.021 1.00 50.69  ? 117  ASN A CA  1 
ATOM   735  C  C   . ASN A 1  117 ? 70.338  76.339  50.202 1.00 51.54  ? 117  ASN A C   1 
ATOM   736  O  O   . ASN A 1  117 ? 69.879  76.891  51.233 1.00 49.87  ? 117  ASN A O   1 
ATOM   737  C  CB  . ASN A 1  117 ? 69.114  74.211  50.610 1.00 49.87  ? 117  ASN A CB  1 
ATOM   738  C  CG  . ASN A 1  117 ? 68.042  73.856  49.553 1.00 52.16  ? 117  ASN A CG  1 
ATOM   739  O  OD1 . ASN A 1  117 ? 68.156  74.194  48.363 1.00 51.08  ? 117  ASN A OD1 1 
ATOM   740  N  ND2 . ASN A 1  117 ? 66.976  73.168  50.002 1.00 52.88  ? 117  ASN A ND2 1 
ATOM   741  N  N   . ASP A 1  118 ? 70.846  76.996  49.166 1.00 51.23  ? 118  ASP A N   1 
ATOM   742  C  CA  . ASP A 1  118 ? 70.979  78.435  49.169 1.00 50.33  ? 118  ASP A CA  1 
ATOM   743  C  C   . ASP A 1  118 ? 70.589  78.819  47.768 1.00 49.34  ? 118  ASP A C   1 
ATOM   744  O  O   . ASP A 1  118 ? 70.897  78.119  46.785 1.00 50.66  ? 118  ASP A O   1 
ATOM   745  C  CB  . ASP A 1  118 ? 72.413  78.821  49.614 1.00 52.45  ? 118  ASP A CB  1 
ATOM   746  C  CG  . ASP A 1  118 ? 72.424  79.602  50.961 1.00 53.71  ? 118  ASP A CG  1 
ATOM   747  O  OD1 . ASP A 1  118 ? 71.341  80.050  51.370 1.00 55.78  ? 118  ASP A OD1 1 
ATOM   748  O  OD2 . ASP A 1  118 ? 73.465  79.796  51.609 1.00 52.35  ? 118  ASP A OD2 1 
ATOM   749  N  N   . ALA A 1  119 ? 69.870  79.931  47.666 1.00 46.64  ? 119  ALA A N   1 
ATOM   750  C  CA  . ALA A 1  119 ? 69.284  80.281  46.396 1.00 44.13  ? 119  ALA A CA  1 
ATOM   751  C  C   . ALA A 1  119 ? 69.904  81.487  45.821 1.00 43.62  ? 119  ALA A C   1 
ATOM   752  O  O   . ALA A 1  119 ? 70.388  82.340  46.545 1.00 45.59  ? 119  ALA A O   1 
ATOM   753  C  CB  . ALA A 1  119 ? 67.736  80.507  46.601 1.00 42.61  ? 119  ALA A CB  1 
ATOM   754  N  N   . VAL A 1  120 ? 69.885  81.608  44.511 1.00 40.77  ? 120  VAL A N   1 
ATOM   755  C  CA  . VAL A 1  120 ? 70.463  82.821  43.960 1.00 38.39  ? 120  VAL A CA  1 
ATOM   756  C  C   . VAL A 1  120 ? 69.490  83.358  42.985 1.00 40.50  ? 120  VAL A C   1 
ATOM   757  O  O   . VAL A 1  120 ? 68.530  82.679  42.550 1.00 41.10  ? 120  VAL A O   1 
ATOM   758  C  CB  . VAL A 1  120 ? 71.980  82.571  43.418 1.00 35.91  ? 120  VAL A CB  1 
ATOM   759  C  CG1 . VAL A 1  120 ? 72.879  82.053  44.662 1.00 37.17  ? 120  VAL A CG1 1 
ATOM   760  C  CG2 . VAL A 1  120 ? 72.075  81.467  42.371 1.00 28.47  ? 120  VAL A CG2 1 
ATOM   761  N  N   . ILE A 1  121 ? 69.677  84.605  42.666 1.00 39.53  ? 121  ILE A N   1 
ATOM   762  C  CA  . ILE A 1  121 ? 68.777  85.211  41.718 1.00 39.70  ? 121  ILE A CA  1 
ATOM   763  C  C   . ILE A 1  121 ? 69.607  85.730  40.602 1.00 39.59  ? 121  ILE A C   1 
ATOM   764  O  O   . ILE A 1  121 ? 70.561  86.437  40.858 1.00 38.10  ? 121  ILE A O   1 
ATOM   765  C  CB  . ILE A 1  121 ? 68.035  86.460  42.338 1.00 40.98  ? 121  ILE A CB  1 
ATOM   766  C  CG1 . ILE A 1  121 ? 67.204  86.047  43.549 1.00 41.23  ? 121  ILE A CG1 1 
ATOM   767  C  CG2 . ILE A 1  121 ? 67.089  87.030  41.327 1.00 39.06  ? 121  ILE A CG2 1 
ATOM   768  C  CD1 . ILE A 1  121 ? 66.062  85.150  43.147 1.00 39.44  ? 121  ILE A CD1 1 
ATOM   769  N  N   . ASP A 1  122 ? 69.243  85.482  39.342 1.00 41.80  ? 122  ASP A N   1 
ATOM   770  C  CA  . ASP A 1  122 ? 70.078  86.002  38.225 1.00 37.37  ? 122  ASP A CA  1 
ATOM   771  C  C   . ASP A 1  122 ? 70.089  87.496  38.130 1.00 38.41  ? 122  ASP A C   1 
ATOM   772  O  O   . ASP A 1  122 ? 69.088  88.071  38.211 1.00 41.61  ? 122  ASP A O   1 
ATOM   773  C  CB  . ASP A 1  122 ? 69.563  85.497  36.895 1.00 39.76  ? 122  ASP A CB  1 
ATOM   774  C  CG  . ASP A 1  122 ? 70.619  85.613  35.823 1.00 42.72  ? 122  ASP A CG  1 
ATOM   775  O  OD1 . ASP A 1  122 ? 70.960  86.814  35.388 1.00 42.07  ? 122  ASP A OD1 1 
ATOM   776  O  OD2 . ASP A 1  122 ? 71.161  84.471  35.518 1.00 46.03  ? 122  ASP A OD2 1 
ATOM   777  N  N   . PRO A 1  123 ? 71.228  88.163  37.951 1.00 39.66  ? 123  PRO A N   1 
ATOM   778  C  CA  . PRO A 1  123 ? 71.053  89.640  37.856 1.00 41.10  ? 123  PRO A CA  1 
ATOM   779  C  C   . PRO A 1  123 ? 70.189  90.156  36.682 1.00 46.17  ? 123  PRO A C   1 
ATOM   780  O  O   . PRO A 1  123 ? 69.778  91.300  36.687 1.00 48.18  ? 123  PRO A O   1 
ATOM   781  C  CB  . PRO A 1  123 ? 72.481  90.196  37.748 1.00 37.38  ? 123  PRO A CB  1 
ATOM   782  C  CG  . PRO A 1  123 ? 73.315  88.983  37.360 1.00 38.20  ? 123  PRO A CG  1 
ATOM   783  C  CD  . PRO A 1  123 ? 72.662  87.746  37.928 1.00 39.11  ? 123  PRO A CD  1 
ATOM   784  N  N   . TYR A 1  124 ? 69.893  89.365  35.661 1.00 48.40  ? 124  TYR A N   1 
ATOM   785  C  CA  . TYR A 1  124 ? 69.037  89.906  34.613 1.00 50.00  ? 124  TYR A CA  1 
ATOM   786  C  C   . TYR A 1  124 ? 67.640  90.144  35.158 1.00 52.34  ? 124  TYR A C   1 
ATOM   787  O  O   . TYR A 1  124 ? 66.859  90.841  34.570 1.00 54.11  ? 124  TYR A O   1 
ATOM   788  C  CB  . TYR A 1  124 ? 68.862  88.890  33.518 1.00 52.28  ? 124  TYR A CB  1 
ATOM   789  C  CG  . TYR A 1  124 ? 68.217  89.394  32.282 1.00 52.47  ? 124  TYR A CG  1 
ATOM   790  C  CD1 . TYR A 1  124 ? 68.629  90.610  31.723 1.00 52.78  ? 124  TYR A CD1 1 
ATOM   791  C  CD2 . TYR A 1  124 ? 67.187  88.659  31.644 1.00 52.80  ? 124  TYR A CD2 1 
ATOM   792  C  CE1 . TYR A 1  124 ? 68.047  91.081  30.605 1.00 52.56  ? 124  TYR A CE1 1 
ATOM   793  C  CE2 . TYR A 1  124 ? 66.590  89.154  30.460 1.00 50.90  ? 124  TYR A CE2 1 
ATOM   794  C  CZ  . TYR A 1  124 ? 67.042  90.361  29.985 1.00 50.68  ? 124  TYR A CZ  1 
ATOM   795  O  OH  . TYR A 1  124 ? 66.512  90.903  28.874 1.00 51.79  ? 124  TYR A OH  1 
ATOM   796  N  N   . MET A 1  125 ? 67.287  89.528  36.264 1.00 53.62  ? 125  MET A N   1 
ATOM   797  C  CA  . MET A 1  125 ? 65.973  89.690  36.801 1.00 50.21  ? 125  MET A CA  1 
ATOM   798  C  C   . MET A 1  125 ? 65.919  90.727  37.875 1.00 48.82  ? 125  MET A C   1 
ATOM   799  O  O   . MET A 1  125 ? 64.915  90.881  38.527 1.00 48.29  ? 125  MET A O   1 
ATOM   800  C  CB  . MET A 1  125 ? 65.559  88.376  37.340 1.00 52.55  ? 125  MET A CB  1 
ATOM   801  C  CG  . MET A 1  125 ? 66.357  87.303  36.753 1.00 56.11  ? 125  MET A CG  1 
ATOM   802  S  SD  . MET A 1  125 ? 65.749  86.581  35.262 1.00 57.42  ? 125  MET A SD  1 
ATOM   803  C  CE  . MET A 1  125 ? 64.350  86.493  36.016 1.00 56.67  ? 125  MET A CE  1 
ATOM   804  N  N   . LEU A 1  126 ? 66.984  91.482  38.059 1.00 48.17  ? 126  LEU A N   1 
ATOM   805  C  CA  . LEU A 1  126 ? 67.018  92.505  39.110 1.00 46.74  ? 126  LEU A CA  1 
ATOM   806  C  C   . LEU A 1  126 ? 66.821  93.945  38.640 1.00 50.00  ? 126  LEU A C   1 
ATOM   807  O  O   . LEU A 1  126 ? 67.118  94.303  37.527 1.00 54.85  ? 126  LEU A O   1 
ATOM   808  C  CB  . LEU A 1  126 ? 68.354  92.422  39.862 1.00 42.16  ? 126  LEU A CB  1 
ATOM   809  C  CG  . LEU A 1  126 ? 68.563  91.069  40.487 1.00 40.72  ? 126  LEU A CG  1 
ATOM   810  C  CD1 . LEU A 1  126 ? 69.495  91.086  41.668 1.00 43.70  ? 126  LEU A CD1 1 
ATOM   811  C  CD2 . LEU A 1  126 ? 67.244  90.645  41.007 1.00 35.88  ? 126  LEU A CD2 1 
ATOM   812  N  N   . GLU A 1  127 ? 66.337  94.805  39.493 1.00 51.75  ? 127  GLU A N   1 
ATOM   813  C  CA  . GLU A 1  127 ? 66.199  96.191  39.121 1.00 52.36  ? 127  GLU A CA  1 
ATOM   814  C  C   . GLU A 1  127 ? 67.341  96.922  39.792 1.00 54.36  ? 127  GLU A C   1 
ATOM   815  O  O   . GLU A 1  127 ? 67.820  97.915  39.304 1.00 54.54  ? 127  GLU A O   1 
ATOM   816  C  CB  . GLU A 1  127 ? 64.895  96.767  39.658 1.00 54.85  ? 127  GLU A CB  1 
ATOM   817  C  CG  . GLU A 1  127 ? 64.195  97.770  38.756 1.00 74.43  ? 127  GLU A CG  1 
ATOM   818  C  CD  . GLU A 1  127 ? 62.677  97.651  39.009 1.00 89.80  ? 127  GLU A CD  1 
ATOM   819  O  OE1 . GLU A 1  127 ? 62.328  97.535  40.243 1.00 74.16  ? 127  GLU A OE1 1 
ATOM   820  O  OE2 . GLU A 1  127 ? 61.860  97.665  38.013 1.00 62.13  ? 127  GLU A OE2 1 
ATOM   821  N  N   . ARG A 1  128 ? 67.768  96.391  40.930 1.00 54.70  ? 128  ARG A N   1 
ATOM   822  C  CA  . ARG A 1  128 ? 68.826  96.972  41.682 1.00 52.01  ? 128  ARG A CA  1 
ATOM   823  C  C   . ARG A 1  128 ? 69.277  96.036  42.792 1.00 50.57  ? 128  ARG A C   1 
ATOM   824  O  O   . ARG A 1  128 ? 68.637  95.038  43.087 1.00 49.06  ? 128  ARG A O   1 
ATOM   825  C  CB  . ARG A 1  128 ? 68.325  98.335  42.153 1.00 52.67  ? 128  ARG A CB  1 
ATOM   826  C  CG  . ARG A 1  128 ? 68.154  98.685  43.622 1.00 54.86  ? 128  ARG A CG  1 
ATOM   827  C  CD  . ARG A 1  128 ? 67.292  99.939  43.636 1.00 55.98  ? 128  ARG A CD  1 
ATOM   828  N  NE  . ARG A 1  128 ? 67.620  100.914 44.663 1.00 56.48  ? 128  ARG A NE  1 
ATOM   829  C  CZ  . ARG A 1  128 ? 67.748  102.210 44.442 1.00 55.20  ? 128  ARG A CZ  1 
ATOM   830  N  NH1 . ARG A 1  128 ? 67.591  102.697 43.216 1.00 52.26  ? 128  ARG A NH1 1 
ATOM   831  N  NH2 . ARG A 1  128 ? 67.992  103.013 45.466 1.00 54.50  ? 128  ARG A NH2 1 
ATOM   832  N  N   . ALA A 1  129 ? 70.441  96.358  43.346 1.00 51.33  ? 129  ALA A N   1 
ATOM   833  C  CA  . ALA A 1  129 ? 71.026  95.612  44.427 1.00 53.50  ? 129  ALA A CA  1 
ATOM   834  C  C   . ALA A 1  129 ? 71.513  96.610  45.404 1.00 53.93  ? 129  ALA A C   1 
ATOM   835  O  O   . ALA A 1  129 ? 72.018  97.594  44.979 1.00 55.36  ? 129  ALA A O   1 
ATOM   836  C  CB  . ALA A 1  129 ? 72.202  94.846  43.920 1.00 54.17  ? 129  ALA A CB  1 
ATOM   837  N  N   . GLU A 1  130 ? 71.381  96.352  46.694 1.00 56.00  ? 130  GLU A N   1 
ATOM   838  C  CA  . GLU A 1  130 ? 71.938  97.230  47.747 1.00 56.41  ? 130  GLU A CA  1 
ATOM   839  C  C   . GLU A 1  130 ? 72.680  96.388  48.820 1.00 57.06  ? 130  GLU A C   1 
ATOM   840  O  O   . GLU A 1  130 ? 72.223  95.295  49.199 1.00 58.80  ? 130  GLU A O   1 
ATOM   841  C  CB  . GLU A 1  130 ? 70.811  98.038  48.388 1.00 57.32  ? 130  GLU A CB  1 
ATOM   842  C  CG  . GLU A 1  130 ? 69.857  98.685  47.349 1.00 65.76  ? 130  GLU A CG  1 
ATOM   843  C  CD  . GLU A 1  130 ? 68.823  99.640  47.954 1.00 63.02  ? 130  GLU A CD  1 
ATOM   844  O  OE1 . GLU A 1  130 ? 68.629  99.621  49.181 1.00 83.95  ? 130  GLU A OE1 1 
ATOM   845  O  OE2 . GLU A 1  130 ? 68.165  100.408 47.218 1.00 68.69  ? 130  GLU A OE2 1 
ATOM   846  N  N   . ILE A 1  131 ? 73.851  96.855  49.279 1.00 56.92  ? 131  ILE A N   1 
ATOM   847  C  CA  . ILE A 1  131 ? 74.617  96.154  50.317 1.00 53.19  ? 131  ILE A CA  1 
ATOM   848  C  C   . ILE A 1  131 ? 74.635  97.065  51.480 1.00 54.43  ? 131  ILE A C   1 
ATOM   849  O  O   . ILE A 1  131 ? 75.003  98.205  51.312 1.00 55.67  ? 131  ILE A O   1 
ATOM   850  C  CB  . ILE A 1  131 ? 76.082  95.826  49.939 1.00 51.95  ? 131  ILE A CB  1 
ATOM   851  C  CG1 . ILE A 1  131 ? 76.121  94.808  48.805 1.00 83.49  ? 131  ILE A CG1 1 
ATOM   852  C  CG2 . ILE A 1  131 ? 76.796  95.057  51.054 1.00 45.69  ? 131  ILE A CG2 1 
ATOM   853  C  CD1 . ILE A 1  131 ? 77.492  94.174  48.561 1.00 77.26  ? 131  ILE A CD1 1 
ATOM   854  N  N   . MET A 1  132 ? 74.201  96.566  52.640 1.00 54.66  ? 132  MET A N   1 
ATOM   855  C  CA  . MET A 1  132 ? 74.183  97.317  53.895 1.00 55.49  ? 132  MET A CA  1 
ATOM   856  C  C   . MET A 1  132 ? 75.230  96.778  54.828 1.00 56.21  ? 132  MET A C   1 
ATOM   857  O  O   . MET A 1  132 ? 75.102  95.663  55.263 1.00 57.09  ? 132  MET A O   1 
ATOM   858  C  CB  . MET A 1  132 ? 72.823  97.194  54.535 1.00 59.96  ? 132  MET A CB  1 
ATOM   859  C  CG  . MET A 1  132 ? 72.779  97.593  55.914 1.00 84.68  ? 132  MET A CG  1 
ATOM   860  S  SD  . MET A 1  132 ? 71.571  98.818  56.020 1.00 99.44  ? 132  MET A SD  1 
ATOM   861  C  CE  . MET A 1  132 ? 72.227  99.960  54.687 1.00 72.94  ? 132  MET A CE  1 
ATOM   862  N  N   . ARG A 1  133 ? 76.281  97.554  55.114 1.00 57.79  ? 133  ARG A N   1 
ATOM   863  C  CA  . ARG A 1  133 ? 77.397  97.125  55.987 1.00 57.26  ? 133  ARG A CA  1 
ATOM   864  C  C   . ARG A 1  133 ? 77.212  97.368  57.484 1.00 57.31  ? 133  ARG A C   1 
ATOM   865  O  O   . ARG A 1  133 ? 76.535  98.311  57.940 1.00 71.14  ? 133  ARG A O   1 
ATOM   866  C  CB  . ARG A 1  133 ? 78.669  97.809  55.599 1.00 56.69  ? 133  ARG A CB  1 
ATOM   867  C  CG  . ARG A 1  133 ? 79.202  97.403  54.282 1.00 66.19  ? 133  ARG A CG  1 
ATOM   868  C  CD  . ARG A 1  133 ? 80.122  98.420  53.702 1.00 59.89  ? 133  ARG A CD  1 
ATOM   869  N  NE  . ARG A 1  133 ? 79.607  98.651  52.387 1.00 69.79  ? 133  ARG A NE  1 
ATOM   870  C  CZ  . ARG A 1  133 ? 79.603  99.823  51.796 1.00 58.05  ? 133  ARG A CZ  1 
ATOM   871  N  NH1 . ARG A 1  133 ? 80.120  100.859 52.420 1.00 56.50  ? 133  ARG A NH1 1 
ATOM   872  N  NH2 . ARG A 1  133 ? 79.018  99.945  50.618 1.00 56.76  ? 133  ARG A NH2 1 
ATOM   873  N  N   . GLY A 1  134 ? 77.813  96.475  58.233 1.00 56.61  ? 134  GLY A N   1 
ATOM   874  C  CA  . GLY A 1  134 ? 77.705  96.526  59.660 1.00 54.82  ? 134  GLY A CA  1 
ATOM   875  C  C   . GLY A 1  134 ? 76.420  95.851  60.001 1.00 65.64  ? 134  GLY A C   1 
ATOM   876  O  O   . GLY A 1  134 ? 75.756  95.287  59.144 1.00 68.58  ? 134  GLY A O   1 
ATOM   877  N  N   . PRO A 1  135 ? 76.047  95.917  61.270 1.00 70.04  ? 135  PRO A N   1 
ATOM   878  C  CA  . PRO A 1  135 ? 74.842  95.319  61.814 1.00 54.48  ? 135  PRO A CA  1 
ATOM   879  C  C   . PRO A 1  135 ? 73.553  95.927  61.392 1.00 54.17  ? 135  PRO A C   1 
ATOM   880  O  O   . PRO A 1  135 ? 73.470  97.126  61.230 1.00 52.90  ? 135  PRO A O   1 
ATOM   881  C  CB  . PRO A 1  135 ? 75.068  95.423  63.319 1.00 54.42  ? 135  PRO A CB  1 
ATOM   882  C  CG  . PRO A 1  135 ? 76.623  95.469  63.414 1.00 53.42  ? 135  PRO A CG  1 
ATOM   883  C  CD  . PRO A 1  135 ? 76.912  96.426  62.352 1.00 72.47  ? 135  PRO A CD  1 
ATOM   884  N  N   . VAL A 1  136 ? 72.536  95.079  61.249 1.00 53.72  ? 136  VAL A N   1 
ATOM   885  C  CA  . VAL A 1  136 ? 71.235  95.531  60.852 1.00 51.85  ? 136  VAL A CA  1 
ATOM   886  C  C   . VAL A 1  136 ? 70.164  94.688  61.452 1.00 52.14  ? 136  VAL A C   1 
ATOM   887  O  O   . VAL A 1  136 ? 69.043  94.619  60.940 1.00 52.61  ? 136  VAL A O   1 
ATOM   888  C  CB  . VAL A 1  136 ? 71.085  95.599  59.268 1.00 54.39  ? 136  VAL A CB  1 
ATOM   889  C  CG1 . VAL A 1  136 ? 71.661  97.001  58.767 1.00 55.17  ? 136  VAL A CG1 1 
ATOM   890  C  CG2 . VAL A 1  136 ? 71.866  94.491  58.540 1.00 48.98  ? 136  VAL A CG2 1 
ATOM   891  N  N   . SER A 1  137 ? 70.463  94.046  62.561 1.00 51.79  ? 137  SER A N   1 
ATOM   892  C  CA  . SER A 1  137 ? 69.413  93.263  63.150 1.00 53.67  ? 137  SER A CA  1 
ATOM   893  C  C   . SER A 1  137 ? 68.391  94.259  63.588 1.00 53.99  ? 137  SER A C   1 
ATOM   894  O  O   . SER A 1  137 ? 67.226  93.993  63.624 1.00 54.95  ? 137  SER A O   1 
ATOM   895  C  CB  . SER A 1  137 ? 69.847  92.463  64.352 1.00 55.08  ? 137  SER A CB  1 
ATOM   896  O  OG  . SER A 1  137 ? 70.828  91.498  64.040 1.00 57.04  ? 137  SER A OG  1 
ATOM   897  N  N   . VAL A 1  138 ? 68.798  95.444  63.908 1.00 55.95  ? 138  VAL A N   1 
ATOM   898  C  CA  . VAL A 1  138 ? 67.764  96.368  64.310 1.00 57.56  ? 138  VAL A CA  1 
ATOM   899  C  C   . VAL A 1  138 ? 66.587  96.406  63.329 1.00 57.52  ? 138  VAL A C   1 
ATOM   900  O  O   . VAL A 1  138 ? 65.504  96.821  63.706 1.00 63.46  ? 138  VAL A O   1 
ATOM   901  C  CB  . VAL A 1  138 ? 68.305  97.774  64.448 1.00 58.57  ? 138  VAL A CB  1 
ATOM   902  C  CG1 . VAL A 1  138 ? 68.219  98.458  63.102 1.00 57.40  ? 138  VAL A CG1 1 
ATOM   903  C  CG2 . VAL A 1  138 ? 67.524  98.533  65.582 1.00 59.19  ? 138  VAL A CG2 1 
ATOM   904  N  N   . LEU A 1  139 ? 66.769  95.993  62.071 1.00 58.45  ? 139  LEU A N   1 
ATOM   905  C  CA  . LEU A 1  139 ? 65.616  96.033  61.157 1.00 56.60  ? 139  LEU A CA  1 
ATOM   906  C  C   . LEU A 1  139 ? 65.178  94.693  60.566 1.00 56.21  ? 139  LEU A C   1 
ATOM   907  O  O   . LEU A 1  139 ? 64.013  94.544  60.181 1.00 55.49  ? 139  LEU A O   1 
ATOM   908  C  CB  . LEU A 1  139 ? 65.843  97.072  60.055 1.00 56.31  ? 139  LEU A CB  1 
ATOM   909  C  CG  . LEU A 1  139 ? 65.574  98.592  60.363 1.00 56.09  ? 139  LEU A CG  1 
ATOM   910  C  CD1 . LEU A 1  139 ? 66.368  99.463  59.387 1.00 55.29  ? 139  LEU A CD1 1 
ATOM   911  C  CD2 . LEU A 1  139 ? 64.087  98.982  60.270 1.00 50.61  ? 139  LEU A CD2 1 
ATOM   912  N  N   . TYR A 1  140 ? 66.065  93.689  60.613 1.00 55.85  ? 140  TYR A N   1 
ATOM   913  C  CA  . TYR A 1  140 ? 65.847  92.368  60.013 1.00 52.86  ? 140  TYR A CA  1 
ATOM   914  C  C   . TYR A 1  140 ? 66.033  91.128  60.880 1.00 52.82  ? 140  TYR A C   1 
ATOM   915  O  O   . TYR A 1  140 ? 65.854  90.000  60.381 1.00 55.15  ? 140  TYR A O   1 
ATOM   916  C  CB  . TYR A 1  140 ? 66.788  92.196  58.792 1.00 52.81  ? 140  TYR A CB  1 
ATOM   917  C  CG  . TYR A 1  140 ? 66.774  93.328  57.767 1.00 51.86  ? 140  TYR A CG  1 
ATOM   918  C  CD1 . TYR A 1  140 ? 67.559  94.441  57.935 1.00 51.86  ? 140  TYR A CD1 1 
ATOM   919  C  CD2 . TYR A 1  140 ? 65.920  93.296  56.704 1.00 51.84  ? 140  TYR A CD2 1 
ATOM   920  C  CE1 . TYR A 1  140 ? 67.492  95.477  57.091 1.00 53.10  ? 140  TYR A CE1 1 
ATOM   921  C  CE2 . TYR A 1  140 ? 65.825  94.327  55.848 1.00 53.43  ? 140  TYR A CE2 1 
ATOM   922  C  CZ  . TYR A 1  140 ? 66.613  95.432  56.027 1.00 55.60  ? 140  TYR A CZ  1 
ATOM   923  O  OH  . TYR A 1  140 ? 66.515  96.497  55.135 1.00 54.86  ? 140  TYR A OH  1 
ATOM   924  N  N   . GLY A 1  141 ? 66.426  91.247  62.141 1.00 51.00  ? 141  GLY A N   1 
ATOM   925  C  CA  . GLY A 1  141 ? 66.559  90.032  62.934 1.00 47.40  ? 141  GLY A CA  1 
ATOM   926  C  C   . GLY A 1  141 ? 67.917  89.400  62.869 1.00 46.91  ? 141  GLY A C   1 
ATOM   927  O  O   . GLY A 1  141 ? 68.896  90.026  62.546 1.00 45.15  ? 141  GLY A O   1 
ATOM   928  N  N   . LYS A 1  142 ? 67.994  88.132  63.228 1.00 47.03  ? 142  LYS A N   1 
ATOM   929  C  CA  . LYS A 1  142 ? 69.275  87.468  63.183 1.00 48.98  ? 142  LYS A CA  1 
ATOM   930  C  C   . LYS A 1  142 ? 69.911  87.770  61.848 1.00 50.96  ? 142  LYS A C   1 
ATOM   931  O  O   . LYS A 1  142 ? 69.300  87.589  60.753 1.00 49.74  ? 142  LYS A O   1 
ATOM   932  C  CB  . LYS A 1  142 ? 69.120  85.967  63.321 1.00 48.76  ? 142  LYS A CB  1 
ATOM   933  C  CG  . LYS A 1  142 ? 68.147  85.321  62.402 1.00 45.79  ? 142  LYS A CG  1 
ATOM   934  C  CD  . LYS A 1  142 ? 68.365  83.883  62.475 1.00 42.46  ? 142  LYS A CD  1 
ATOM   935  C  CE  . LYS A 1  142 ? 67.231  83.131  61.862 1.00 47.26  ? 142  LYS A CE  1 
ATOM   936  N  NZ  . LYS A 1  142 ? 67.815  81.898  61.082 1.00 54.59  ? 142  LYS A NZ  1 
ATOM   937  N  N   . SER A 1  143 ? 71.146  88.219  61.962 1.00 51.70  ? 143  SER A N   1 
ATOM   938  C  CA  . SER A 1  143 ? 71.908  88.633  60.822 1.00 55.18  ? 143  SER A CA  1 
ATOM   939  C  C   . SER A 1  143 ? 73.348  88.680  61.248 1.00 55.95  ? 143  SER A C   1 
ATOM   940  O  O   . SER A 1  143 ? 73.665  88.884  62.403 1.00 57.18  ? 143  SER A O   1 
ATOM   941  C  CB  . SER A 1  143 ? 71.461  90.029  60.337 1.00 55.38  ? 143  SER A CB  1 
ATOM   942  O  OG  . SER A 1  143 ? 72.288  90.376  59.229 1.00 74.94  ? 143  SER A OG  1 
ATOM   943  N  N   . SER A 1  144 ? 74.215  88.500  60.271 1.00 56.99  ? 144  SER A N   1 
ATOM   944  C  CA  . SER A 1  144 ? 75.652  88.471  60.481 1.00 54.49  ? 144  SER A CA  1 
ATOM   945  C  C   . SER A 1  144 ? 76.189  89.841  60.722 1.00 52.23  ? 144  SER A C   1 
ATOM   946  O  O   . SER A 1  144 ? 75.703  90.809  60.122 1.00 74.94  ? 144  SER A O   1 
ATOM   947  C  CB  . SER A 1  144 ? 76.334  87.877  59.235 1.00 81.36  ? 144  SER A CB  1 
ATOM   948  O  OG  . SER A 1  144 ? 77.330  88.743  58.696 1.00 58.43  ? 144  SER A OG  1 
ATOM   949  N  N   . PRO A 1  145 ? 77.174  89.983  61.645 1.00 50.75  ? 145  PRO A N   1 
ATOM   950  C  CA  . PRO A 1  145 ? 77.681  91.355  61.824 1.00 49.44  ? 145  PRO A CA  1 
ATOM   951  C  C   . PRO A 1  145 ? 78.371  91.540  60.466 1.00 52.53  ? 145  PRO A C   1 
ATOM   952  O  O   . PRO A 1  145 ? 78.681  90.578  59.798 1.00 55.37  ? 145  PRO A O   1 
ATOM   953  C  CB  . PRO A 1  145 ? 78.637  91.166  62.899 1.00 45.53  ? 145  PRO A CB  1 
ATOM   954  C  CG  . PRO A 1  145 ? 79.184  89.829  62.628 1.00 43.61  ? 145  PRO A CG  1 
ATOM   955  C  CD  . PRO A 1  145 ? 78.094  89.005  62.240 1.00 46.44  ? 145  PRO A CD  1 
ATOM   956  N  N   . GLY A 1  146 ? 78.651  92.681  59.946 1.00 53.54  ? 146  GLY A N   1 
ATOM   957  C  CA  . GLY A 1  146 ? 79.244  92.473  58.639 1.00 53.67  ? 146  GLY A CA  1 
ATOM   958  C  C   . GLY A 1  146 ? 78.326  93.094  57.644 1.00 53.62  ? 146  GLY A C   1 
ATOM   959  O  O   . GLY A 1  146 ? 78.709  94.034  56.948 1.00 54.53  ? 146  GLY A O   1 
ATOM   960  N  N   . GLY A 1  147 ? 77.102  92.623  57.625 1.00 52.91  ? 147  GLY A N   1 
ATOM   961  C  CA  . GLY A 1  147 ? 76.146  93.208  56.724 1.00 54.19  ? 147  GLY A CA  1 
ATOM   962  C  C   . GLY A 1  147 ? 75.146  92.275  56.094 1.00 54.35  ? 147  GLY A C   1 
ATOM   963  O  O   . GLY A 1  147 ? 74.994  91.111  56.467 1.00 55.02  ? 147  GLY A O   1 
ATOM   964  N  N   . LEU A 1  148 ? 74.456  92.794  55.103 1.00 54.01  ? 148  LEU A N   1 
ATOM   965  C  CA  . LEU A 1  148 ? 73.420  92.030  54.444 1.00 52.08  ? 148  LEU A CA  1 
ATOM   966  C  C   . LEU A 1  148 ? 73.285  92.526  53.012 1.00 50.66  ? 148  LEU A C   1 
ATOM   967  O  O   . LEU A 1  148 ? 73.618  93.671  52.714 1.00 48.82  ? 148  LEU A O   1 
ATOM   968  C  CB  . LEU A 1  148 ? 72.198  92.295  55.249 1.00 52.59  ? 148  LEU A CB  1 
ATOM   969  C  CG  . LEU A 1  148 ? 70.782  92.337  54.757 1.00 55.77  ? 148  LEU A CG  1 
ATOM   970  C  CD1 . LEU A 1  148 ? 69.976  92.749  55.951 1.00 50.79  ? 148  LEU A CD1 1 
ATOM   971  C  CD2 . LEU A 1  148 ? 70.599  93.340  53.554 1.00 53.49  ? 148  LEU A CD2 1 
ATOM   972  N  N   . LEU A 1  149 ? 72.800  91.666  52.122 1.00 48.79  ? 149  LEU A N   1 
ATOM   973  C  CA  . LEU A 1  149 ? 72.647  92.059  50.705 1.00 43.62  ? 149  LEU A CA  1 
ATOM   974  C  C   . LEU A 1  149 ? 71.213  92.056  50.421 1.00 42.27  ? 149  LEU A C   1 
ATOM   975  O  O   . LEU A 1  149 ? 70.572  91.084  50.731 1.00 41.07  ? 149  LEU A O   1 
ATOM   976  C  CB  . LEU A 1  149 ? 73.281  91.056  49.742 1.00 41.26  ? 149  LEU A CB  1 
ATOM   977  C  CG  . LEU A 1  149 ? 72.704  91.104  48.257 1.00 37.67  ? 149  LEU A CG  1 
ATOM   978  C  CD1 . LEU A 1  149 ? 73.260  92.224  47.480 1.00 38.81  ? 149  LEU A CD1 1 
ATOM   979  C  CD2 . LEU A 1  149 ? 73.009  89.960  47.531 1.00 33.79  ? 149  LEU A CD2 1 
ATOM   980  N  N   . ASN A 1  150 ? 70.685  93.148  49.876 1.00 43.14  ? 150  ASN A N   1 
ATOM   981  C  CA  . ASN A 1  150 ? 69.273  93.170  49.444 1.00 44.02  ? 150  ASN A CA  1 
ATOM   982  C  C   . ASN A 1  150 ? 69.089  93.408  47.926 1.00 42.99  ? 150  ASN A C   1 
ATOM   983  O  O   . ASN A 1  150 ? 69.469  94.442  47.371 1.00 44.06  ? 150  ASN A O   1 
ATOM   984  C  CB  . ASN A 1  150 ? 68.472  94.216  50.157 1.00 41.34  ? 150  ASN A CB  1 
ATOM   985  C  CG  . ASN A 1  150 ? 66.943  94.094  49.870 1.00 44.29  ? 150  ASN A CG  1 
ATOM   986  O  OD1 . ASN A 1  150 ? 66.363  92.971  49.813 1.00 45.29  ? 150  ASN A OD1 1 
ATOM   987  N  ND2 . ASN A 1  150 ? 66.279  95.259  49.751 1.00 43.36  ? 150  ASN A ND2 1 
ATOM   988  N  N   . MET A 1  151 ? 68.472  92.456  47.268 1.00 42.88  ? 151  MET A N   1 
ATOM   989  C  CA  . MET A 1  151 ? 68.270  92.559  45.821 1.00 42.99  ? 151  MET A CA  1 
ATOM   990  C  C   . MET A 1  151 ? 66.812  92.942  45.584 1.00 44.56  ? 151  MET A C   1 
ATOM   991  O  O   . MET A 1  151 ? 65.954  92.586  46.380 1.00 49.81  ? 151  MET A O   1 
ATOM   992  C  CB  . MET A 1  151 ? 68.558  91.208  45.140 1.00 42.63  ? 151  MET A CB  1 
ATOM   993  C  CG  . MET A 1  151 ? 69.921  90.671  45.216 1.00 40.37  ? 151  MET A CG  1 
ATOM   994  S  SD  . MET A 1  151 ? 69.996  88.912  44.910 1.00 47.17  ? 151  MET A SD  1 
ATOM   995  C  CE  . MET A 1  151 ? 69.347  88.255  46.239 1.00 46.01  ? 151  MET A CE  1 
ATOM   996  N  N   . VAL A 1  152 ? 66.511  93.669  44.512 1.00 43.32  ? 152  VAL A N   1 
ATOM   997  C  CA  . VAL A 1  152 ? 65.153  94.076  44.270 1.00 41.05  ? 152  VAL A CA  1 
ATOM   998  C  C   . VAL A 1  152 ? 64.710  93.525  42.917 1.00 43.07  ? 152  VAL A C   1 
ATOM   999  O  O   . VAL A 1  152 ? 65.385  93.700  41.963 1.00 42.73  ? 152  VAL A O   1 
ATOM   1000 C  CB  . VAL A 1  152 ? 65.087  95.681  44.274 1.00 42.42  ? 152  VAL A CB  1 
ATOM   1001 C  CG1 . VAL A 1  152 ? 63.693  96.197  43.921 1.00 37.09  ? 152  VAL A CG1 1 
ATOM   1002 C  CG2 . VAL A 1  152 ? 65.562  96.252  45.697 1.00 41.90  ? 152  VAL A CG2 1 
ATOM   1003 N  N   . SER A 1  153 ? 63.560  92.885  42.871 1.00 44.82  ? 153  SER A N   1 
ATOM   1004 C  CA  . SER A 1  153 ? 62.980  92.336  41.683 1.00 48.40  ? 153  SER A CA  1 
ATOM   1005 C  C   . SER A 1  153 ? 62.614  93.364  40.645 1.00 49.40  ? 153  SER A C   1 
ATOM   1006 O  O   . SER A 1  153 ? 62.137  94.438  40.988 1.00 52.51  ? 153  SER A O   1 
ATOM   1007 C  CB  . SER A 1  153 ? 61.673  91.627  42.016 1.00 47.47  ? 153  SER A CB  1 
ATOM   1008 O  OG  . SER A 1  153 ? 61.876  90.464  42.739 1.00 47.83  ? 153  SER A OG  1 
ATOM   1009 N  N   . LYS A 1  154 ? 62.777  93.032  39.377 1.00 49.18  ? 154  LYS A N   1 
ATOM   1010 C  CA  . LYS A 1  154 ? 62.300  93.933  38.310 1.00 47.24  ? 154  LYS A CA  1 
ATOM   1011 C  C   . LYS A 1  154 ? 60.777  93.948  38.509 1.00 47.54  ? 154  LYS A C   1 
ATOM   1012 O  O   . LYS A 1  154 ? 60.198  92.920  38.804 1.00 47.38  ? 154  LYS A O   1 
ATOM   1013 C  CB  . LYS A 1  154 ? 62.656  93.384  36.911 1.00 43.70  ? 154  LYS A CB  1 
ATOM   1014 C  CG  . LYS A 1  154 ? 64.071  93.731  36.411 1.00 46.89  ? 154  LYS A CG  1 
ATOM   1015 C  CD  . LYS A 1  154 ? 64.372  93.310  34.974 1.00 46.34  ? 154  LYS A CD  1 
ATOM   1016 C  CE  . LYS A 1  154 ? 65.698  93.909  34.491 1.00 45.08  ? 154  LYS A CE  1 
ATOM   1017 N  NZ  . LYS A 1  154 ? 66.238  93.159  33.191 1.00 46.89  ? 154  LYS A NZ  1 
ATOM   1018 N  N   . ARG A 1  155 ? 60.133  95.112  38.419 1.00 49.87  ? 155  ARG A N   1 
ATOM   1019 C  CA  . ARG A 1  155 ? 58.671  95.171  38.585 1.00 50.55  ? 155  ARG A CA  1 
ATOM   1020 C  C   . ARG A 1  155 ? 58.116  95.681  37.237 1.00 50.25  ? 155  ARG A C   1 
ATOM   1021 O  O   . ARG A 1  155 ? 58.876  96.117  36.379 1.00 50.15  ? 155  ARG A O   1 
ATOM   1022 C  CB  . ARG A 1  155 ? 58.202  96.127  39.723 1.00 51.17  ? 155  ARG A CB  1 
ATOM   1023 C  CG  . ARG A 1  155 ? 58.961  96.317  41.077 1.00 51.20  ? 155  ARG A CG  1 
ATOM   1024 C  CD  . ARG A 1  155 ? 59.407  95.003  41.678 1.00 56.91  ? 155  ARG A CD  1 
ATOM   1025 N  NE  . ARG A 1  155 ? 59.916  94.975  43.057 1.00 56.04  ? 155  ARG A NE  1 
ATOM   1026 C  CZ  . ARG A 1  155 ? 59.261  95.479  44.092 1.00 69.64  ? 155  ARG A CZ  1 
ATOM   1027 N  NH1 . ARG A 1  155 ? 58.076  96.105  43.901 1.00 54.65  ? 155  ARG A NH1 1 
ATOM   1028 N  NH2 . ARG A 1  155 ? 59.740  95.253  45.323 1.00 64.74  ? 155  ARG A NH2 1 
ATOM   1029 N  N   . PRO A 1  156 ? 56.794  95.574  37.020 1.00 50.46  ? 156  PRO A N   1 
ATOM   1030 C  CA  . PRO A 1  156 ? 56.190  96.053  35.748 1.00 50.70  ? 156  PRO A CA  1 
ATOM   1031 C  C   . PRO A 1  156 ? 56.457  97.518  35.539 1.00 51.19  ? 156  PRO A C   1 
ATOM   1032 O  O   . PRO A 1  156 ? 56.506  98.276  36.501 1.00 68.15  ? 156  PRO A O   1 
ATOM   1033 C  CB  . PRO A 1  156 ? 54.738  95.764  35.936 1.00 49.65  ? 156  PRO A CB  1 
ATOM   1034 C  CG  . PRO A 1  156 ? 54.827  94.400  36.671 1.00 49.52  ? 156  PRO A CG  1 
ATOM   1035 C  CD  . PRO A 1  156 ? 55.813  94.789  37.788 1.00 47.98  ? 156  PRO A CD  1 
ATOM   1036 N  N   . THR A 1  157 ? 56.684  97.894  34.279 1.00 72.92  ? 157  THR A N   1 
ATOM   1037 C  CA  . THR A 1  157 ? 57.031  99.285  33.884 1.00 69.23  ? 157  THR A CA  1 
ATOM   1038 C  C   . THR A 1  157 ? 55.836  100.178 33.525 1.00 76.19  ? 157  THR A C   1 
ATOM   1039 O  O   . THR A 1  157 ? 54.730  99.690  33.162 1.00 69.58  ? 157  THR A O   1 
ATOM   1040 C  CB  . THR A 1  157 ? 57.971  99.326  32.626 1.00 54.11  ? 157  THR A CB  1 
ATOM   1041 O  OG1 . THR A 1  157 ? 57.426  98.472  31.610 1.00 73.91  ? 157  THR A OG1 1 
ATOM   1042 C  CG2 . THR A 1  157 ? 59.443  98.837  32.929 1.00 52.97  ? 157  THR A CG2 1 
ATOM   1043 N  N   . THR A 1  158 ? 56.058  101.491 33.606 1.00 76.43  ? 158  THR A N   1 
ATOM   1044 C  CA  . THR A 1  158 ? 55.003  102.441 33.218 1.00 84.74  ? 158  THR A CA  1 
ATOM   1045 C  C   . THR A 1  158 ? 54.839  102.341 31.661 1.00 85.86  ? 158  THR A C   1 
ATOM   1046 O  O   . THR A 1  158 ? 53.826  101.831 31.150 1.00 84.92  ? 158  THR A O   1 
ATOM   1047 C  CB  . THR A 1  158 ? 55.328  103.901 33.777 1.00 86.03  ? 158  THR A CB  1 
ATOM   1048 O  OG1 . THR A 1  158 ? 56.759  104.129 33.863 1.00 73.72  ? 158  THR A OG1 1 
ATOM   1049 C  CG2 . THR A 1  158 ? 54.667  104.055 35.245 1.00 82.53  ? 158  THR A CG2 1 
ATOM   1050 N  N   . GLU A 1  159 ? 55.888  102.727 30.943 1.00 83.01  ? 159  GLU A N   1 
ATOM   1051 C  CA  . GLU A 1  159 ? 55.988  102.640 29.483 1.00 84.79  ? 159  GLU A CA  1 
ATOM   1052 C  C   . GLU A 1  159 ? 56.254  101.187 29.049 1.00 78.84  ? 159  GLU A C   1 
ATOM   1053 O  O   . GLU A 1  159 ? 56.737  100.373 29.820 1.00 78.95  ? 159  GLU A O   1 
ATOM   1054 C  CB  . GLU A 1  159 ? 57.160  103.479 29.039 1.00 89.81  ? 159  GLU A CB  1 
ATOM   1055 C  CG  . GLU A 1  159 ? 58.484  102.839 29.482 1.00 108.11 ? 159  GLU A CG  1 
ATOM   1056 C  CD  . GLU A 1  159 ? 58.660  102.703 31.019 1.00 115.10 ? 159  GLU A CD  1 
ATOM   1057 O  OE1 . GLU A 1  159 ? 57.825  103.266 31.779 1.00 121.43 ? 159  GLU A OE1 1 
ATOM   1058 O  OE2 . GLU A 1  159 ? 59.653  102.050 31.460 1.00 105.20 ? 159  GLU A OE2 1 
ATOM   1059 N  N   . PRO A 1  160 ? 56.017  100.861 27.776 1.00 75.87  ? 160  PRO A N   1 
ATOM   1060 C  CA  . PRO A 1  160 ? 56.241  99.488  27.323 1.00 66.90  ? 160  PRO A CA  1 
ATOM   1061 C  C   . PRO A 1  160 ? 57.672  99.117  27.168 1.00 66.81  ? 160  PRO A C   1 
ATOM   1062 O  O   . PRO A 1  160 ? 58.534  99.960  26.991 1.00 63.67  ? 160  PRO A O   1 
ATOM   1063 C  CB  . PRO A 1  160 ? 55.538  99.430  25.977 1.00 73.07  ? 160  PRO A CB  1 
ATOM   1064 C  CG  . PRO A 1  160 ? 54.741  100.711 25.905 1.00 71.01  ? 160  PRO A CG  1 
ATOM   1065 C  CD  . PRO A 1  160 ? 55.582  101.688 26.650 1.00 70.33  ? 160  PRO A CD  1 
ATOM   1066 N  N   . LEU A 1  161 ? 57.914  97.818  27.239 1.00 68.60  ? 161  LEU A N   1 
ATOM   1067 C  CA  . LEU A 1  161 ? 59.245  97.278  27.093 1.00 59.05  ? 161  LEU A CA  1 
ATOM   1068 C  C   . LEU A 1  161 ? 59.165  95.945  26.420 1.00 59.05  ? 161  LEU A C   1 
ATOM   1069 O  O   . LEU A 1  161 ? 58.469  95.047  26.894 1.00 63.27  ? 161  LEU A O   1 
ATOM   1070 C  CB  . LEU A 1  161 ? 59.868  97.084  28.437 1.00 59.95  ? 161  LEU A CB  1 
ATOM   1071 C  CG  . LEU A 1  161 ? 61.166  96.322  28.402 1.00 56.19  ? 161  LEU A CG  1 
ATOM   1072 C  CD1 . LEU A 1  161 ? 62.229  97.250  27.875 1.00 53.96  ? 161  LEU A CD1 1 
ATOM   1073 C  CD2 . LEU A 1  161 ? 61.493  95.876  29.827 1.00 55.25  ? 161  LEU A CD2 1 
ATOM   1074 N  N   . LYS A 1  162 ? 59.872  95.813  25.307 1.00 65.35  ? 162  LYS A N   1 
ATOM   1075 C  CA  . LYS A 1  162 ? 59.926  94.548  24.549 1.00 64.61  ? 162  LYS A CA  1 
ATOM   1076 C  C   . LYS A 1  162 ? 61.422  94.296  24.230 1.00 67.00  ? 162  LYS A C   1 
ATOM   1077 O  O   . LYS A 1  162 ? 61.960  94.828  23.242 1.00 65.83  ? 162  LYS A O   1 
ATOM   1078 C  CB  . LYS A 1  162 ? 59.103  94.660  23.251 1.00 66.84  ? 162  LYS A CB  1 
ATOM   1079 C  CG  . LYS A 1  162 ? 57.638  94.259  23.340 1.00 62.62  ? 162  LYS A CG  1 
ATOM   1080 C  CD  . LYS A 1  162 ? 56.736  95.182  22.510 1.00 77.53  ? 162  LYS A CD  1 
ATOM   1081 C  CE  . LYS A 1  162 ? 55.225  94.842  22.714 1.00 84.80  ? 162  LYS A CE  1 
ATOM   1082 N  NZ  . LYS A 1  162 ? 54.273  95.988  22.399 1.00 80.04  ? 162  LYS A NZ  1 
ATOM   1083 N  N   . GLU A 1  163 ? 62.098  93.513  25.081 1.00 63.22  ? 163  GLU A N   1 
ATOM   1084 C  CA  . GLU A 1  163 ? 63.524  93.219  24.904 1.00 58.81  ? 163  GLU A CA  1 
ATOM   1085 C  C   . GLU A 1  163 ? 63.868  91.765  24.681 1.00 59.18  ? 163  GLU A C   1 
ATOM   1086 O  O   . GLU A 1  163 ? 63.266  90.869  25.240 1.00 57.27  ? 163  GLU A O   1 
ATOM   1087 C  CB  . GLU A 1  163 ? 64.267  93.716  26.095 1.00 58.54  ? 163  GLU A CB  1 
ATOM   1088 C  CG  . GLU A 1  163 ? 65.698  93.892  25.985 1.00 57.48  ? 163  GLU A CG  1 
ATOM   1089 C  CD  . GLU A 1  163 ? 66.285  94.266  27.371 1.00 59.23  ? 163  GLU A CD  1 
ATOM   1090 O  OE1 . GLU A 1  163 ? 66.424  93.370  28.228 1.00 58.74  ? 163  GLU A OE1 1 
ATOM   1091 O  OE2 . GLU A 1  163 ? 66.594  95.447  27.619 1.00 62.34  ? 163  GLU A OE2 1 
ATOM   1092 N  N   . VAL A 1  164 ? 64.817  91.561  23.782 1.00 59.56  ? 164  VAL A N   1 
ATOM   1093 C  CA  . VAL A 1  164 ? 65.346  90.225  23.481 1.00 59.02  ? 164  VAL A CA  1 
ATOM   1094 C  C   . VAL A 1  164 ? 66.855  90.400  23.509 1.00 58.26  ? 164  VAL A C   1 
ATOM   1095 O  O   . VAL A 1  164 ? 67.362  91.436  23.053 1.00 59.24  ? 164  VAL A O   1 
ATOM   1096 C  CB  . VAL A 1  164 ? 64.888  89.705  22.156 1.00 78.65  ? 164  VAL A CB  1 
ATOM   1097 C  CG1 . VAL A 1  164 ? 65.638  88.449  21.861 1.00 69.28  ? 164  VAL A CG1 1 
ATOM   1098 C  CG2 . VAL A 1  164 ? 63.419  89.352  22.234 1.00 57.00  ? 164  VAL A CG2 1 
ATOM   1099 N  N   . GLN A 1  165 ? 67.563  89.437  24.093 1.00 57.76  ? 165  GLN A N   1 
ATOM   1100 C  CA  . GLN A 1  165 ? 69.026  89.572  24.287 1.00 58.30  ? 165  GLN A CA  1 
ATOM   1101 C  C   . GLN A 1  165 ? 69.722  88.292  23.953 1.00 58.89  ? 165  GLN A C   1 
ATOM   1102 O  O   . GLN A 1  165 ? 69.226  87.201  24.291 1.00 66.16  ? 165  GLN A O   1 
ATOM   1103 C  CB  . GLN A 1  165 ? 69.339  89.941  25.737 1.00 57.01  ? 165  GLN A CB  1 
ATOM   1104 C  CG  . GLN A 1  165 ? 70.716  90.445  25.989 1.00 57.53  ? 165  GLN A CG  1 
ATOM   1105 C  CD  . GLN A 1  165 ? 70.914  90.866  27.457 1.00 58.90  ? 165  GLN A CD  1 
ATOM   1106 O  OE1 . GLN A 1  165 ? 70.907  90.017  28.399 1.00 53.90  ? 165  GLN A OE1 1 
ATOM   1107 N  NE2 . GLN A 1  165 ? 71.078  92.207  27.663 1.00 57.84  ? 165  GLN A NE2 1 
ATOM   1108 N  N   . PHE A 1  166 ? 70.881  88.405  23.302 1.00 58.79  ? 166  PHE A N   1 
ATOM   1109 C  CA  . PHE A 1  166 ? 71.599  87.205  22.889 1.00 57.53  ? 166  PHE A CA  1 
ATOM   1110 C  C   . PHE A 1  166 ? 72.957  87.459  23.270 1.00 57.62  ? 166  PHE A C   1 
ATOM   1111 O  O   . PHE A 1  166 ? 73.379  88.622  23.228 1.00 57.41  ? 166  PHE A O   1 
ATOM   1112 C  CB  . PHE A 1  166 ? 71.558  87.032  21.397 1.00 58.66  ? 166  PHE A CB  1 
ATOM   1113 C  CG  . PHE A 1  166 ? 70.174  86.890  20.854 1.00 58.33  ? 166  PHE A CG  1 
ATOM   1114 C  CD1 . PHE A 1  166 ? 69.474  85.684  20.996 1.00 58.46  ? 166  PHE A CD1 1 
ATOM   1115 C  CD2 . PHE A 1  166 ? 69.570  87.955  20.181 1.00 57.68  ? 166  PHE A CD2 1 
ATOM   1116 C  CE1 . PHE A 1  166 ? 68.161  85.513  20.460 1.00 58.72  ? 166  PHE A CE1 1 
ATOM   1117 C  CE2 . PHE A 1  166 ? 68.298  87.803  19.645 1.00 58.57  ? 166  PHE A CE2 1 
ATOM   1118 C  CZ  . PHE A 1  166 ? 67.584  86.573  19.783 1.00 57.99  ? 166  PHE A CZ  1 
ATOM   1119 N  N   . LYS A 1  167 ? 73.622  86.361  23.620 1.00 57.49  ? 167  LYS A N   1 
ATOM   1120 C  CA  . LYS A 1  167 ? 74.988  86.367  24.102 1.00 57.74  ? 167  LYS A CA  1 
ATOM   1121 C  C   . LYS A 1  167 ? 75.700  85.167  23.579 1.00 56.86  ? 167  LYS A C   1 
ATOM   1122 O  O   . LYS A 1  167 ? 75.165  84.044  23.569 1.00 56.56  ? 167  LYS A O   1 
ATOM   1123 C  CB  . LYS A 1  167 ? 75.019  86.220  25.633 1.00 58.70  ? 167  LYS A CB  1 
ATOM   1124 C  CG  . LYS A 1  167 ? 74.910  87.507  26.501 1.00 58.88  ? 167  LYS A CG  1 
ATOM   1125 C  CD  . LYS A 1  167 ? 74.819  87.073  28.010 1.00 58.77  ? 167  LYS A CD  1 
ATOM   1126 C  CE  . LYS A 1  167 ? 74.501  88.211  28.976 1.00 54.97  ? 167  LYS A CE  1 
ATOM   1127 N  NZ  . LYS A 1  167 ? 75.417  89.319  28.703 1.00 56.25  ? 167  LYS A NZ  1 
ATOM   1128 N  N   . ALA A 1  168 ? 76.927  85.401  23.160 1.00 56.12  ? 168  ALA A N   1 
ATOM   1129 C  CA  . ALA A 1  168 ? 77.798  84.300  22.712 1.00 66.06  ? 168  ALA A CA  1 
ATOM   1130 C  C   . ALA A 1  168 ? 79.122  84.661  23.310 1.00 67.91  ? 168  ALA A C   1 
ATOM   1131 O  O   . ALA A 1  168 ? 79.566  85.855  23.199 1.00 63.79  ? 168  ALA A O   1 
ATOM   1132 C  CB  . ALA A 1  168 ? 77.949  84.233  21.197 1.00 58.65  ? 168  ALA A CB  1 
ATOM   1133 N  N   . GLY A 1  169 ? 79.728  83.669  23.972 1.00 55.91  ? 169  GLY A N   1 
ATOM   1134 C  CA  . GLY A 1  169 ? 81.036  83.900  24.595 1.00 59.23  ? 169  GLY A CA  1 
ATOM   1135 C  C   . GLY A 1  169 ? 82.005  82.720  24.577 1.00 64.44  ? 169  GLY A C   1 
ATOM   1136 O  O   . GLY A 1  169 ? 81.717  81.651  23.977 1.00 63.12  ? 169  GLY A O   1 
ATOM   1137 N  N   . THR A 1  170 ? 83.150  82.935  25.239 1.00 61.69  ? 170  THR A N   1 
ATOM   1138 C  CA  . THR A 1  170 ? 84.224  81.945  25.433 1.00 62.94  ? 170  THR A CA  1 
ATOM   1139 C  C   . THR A 1  170 ? 83.704  80.856  26.329 1.00 67.13  ? 170  THR A C   1 
ATOM   1140 O  O   . THR A 1  170 ? 82.765  81.075  27.092 1.00 77.74  ? 170  THR A O   1 
ATOM   1141 C  CB  . THR A 1  170 ? 85.341  82.477  26.247 1.00 63.61  ? 170  THR A CB  1 
ATOM   1142 O  OG1 . THR A 1  170 ? 85.334  83.916  26.215 1.00 78.62  ? 170  THR A OG1 1 
ATOM   1143 C  CG2 . THR A 1  170 ? 86.628  81.969  25.718 1.00 79.57  ? 170  THR A CG2 1 
ATOM   1144 N  N   . ASP A 1  171 ? 84.336  79.696  26.281 1.00 69.43  ? 171  ASP A N   1 
ATOM   1145 C  CA  . ASP A 1  171 ? 83.957  78.550  27.126 1.00 60.50  ? 171  ASP A CA  1 
ATOM   1146 C  C   . ASP A 1  171 ? 82.621  78.049  26.770 1.00 68.00  ? 171  ASP A C   1 
ATOM   1147 O  O   . ASP A 1  171 ? 81.990  77.249  27.531 1.00 67.64  ? 171  ASP A O   1 
ATOM   1148 C  CB  . ASP A 1  171 ? 83.963  78.891  28.630 1.00 74.50  ? 171  ASP A CB  1 
ATOM   1149 C  CG  . ASP A 1  171 ? 85.398  79.106  29.204 1.00 86.47  ? 171  ASP A CG  1 
ATOM   1150 O  OD1 . ASP A 1  171 ? 86.206  78.141  29.105 1.00 81.69  ? 171  ASP A OD1 1 
ATOM   1151 O  OD2 . ASP A 1  171 ? 85.709  80.228  29.741 1.00 88.61  ? 171  ASP A OD2 1 
ATOM   1152 N  N   . SER A 1  172 ? 82.151  78.525  25.617 1.00 69.67  ? 172  SER A N   1 
ATOM   1153 C  CA  . SER A 1  172 ? 80.846  78.059  25.112 1.00 71.31  ? 172  SER A CA  1 
ATOM   1154 C  C   . SER A 1  172 ? 79.595  78.629  25.730 1.00 64.21  ? 172  SER A C   1 
ATOM   1155 O  O   . SER A 1  172 ? 78.566  77.955  25.862 1.00 64.20  ? 172  SER A O   1 
ATOM   1156 C  CB  . SER A 1  172 ? 80.744  76.532  25.189 1.00 71.55  ? 172  SER A CB  1 
ATOM   1157 O  OG  . SER A 1  172 ? 81.352  75.928  24.059 1.00 69.06  ? 172  SER A OG  1 
ATOM   1158 N  N   . LEU A 1  173 ? 79.696  79.880  26.112 1.00 63.75  ? 173  LEU A N   1 
ATOM   1159 C  CA  . LEU A 1  173 ? 78.560  80.579  26.645 1.00 59.62  ? 173  LEU A CA  1 
ATOM   1160 C  C   . LEU A 1  173 ? 77.581  80.936  25.504 1.00 62.90  ? 173  LEU A C   1 
ATOM   1161 O  O   . LEU A 1  173 ? 77.947  81.512  24.454 1.00 70.02  ? 173  LEU A O   1 
ATOM   1162 C  CB  . LEU A 1  173 ? 79.065  81.859  27.300 1.00 59.50  ? 173  LEU A CB  1 
ATOM   1163 C  CG  . LEU A 1  173 ? 78.109  82.884  27.922 1.00 67.16  ? 173  LEU A CG  1 
ATOM   1164 C  CD1 . LEU A 1  173 ? 77.097  82.205  28.826 1.00 57.06  ? 173  LEU A CD1 1 
ATOM   1165 C  CD2 . LEU A 1  173 ? 78.939  83.879  28.705 1.00 56.27  ? 173  LEU A CD2 1 
ATOM   1166 N  N   . PHE A 1  174 ? 76.337  80.570  25.709 1.00 69.95  ? 174  PHE A N   1 
ATOM   1167 C  CA  . PHE A 1  174 ? 75.266  80.915  24.801 1.00 72.41  ? 174  PHE A CA  1 
ATOM   1168 C  C   . PHE A 1  174 ? 74.150  81.286  25.748 1.00 71.97  ? 174  PHE A C   1 
ATOM   1169 O  O   . PHE A 1  174 ? 73.755  80.468  26.607 1.00 66.35  ? 174  PHE A O   1 
ATOM   1170 C  CB  . PHE A 1  174 ? 74.839  79.715  23.944 1.00 68.56  ? 174  PHE A CB  1 
ATOM   1171 C  CG  . PHE A 1  174 ? 75.780  79.433  22.849 1.00 73.33  ? 174  PHE A CG  1 
ATOM   1172 C  CD1 . PHE A 1  174 ? 75.965  80.363  21.840 1.00 70.97  ? 174  PHE A CD1 1 
ATOM   1173 C  CD2 . PHE A 1  174 ? 76.584  78.294  22.882 1.00 81.57  ? 174  PHE A CD2 1 
ATOM   1174 C  CE1 . PHE A 1  174 ? 76.929  80.177  20.904 1.00 77.73  ? 174  PHE A CE1 1 
ATOM   1175 C  CE2 . PHE A 1  174 ? 77.553  78.100  21.952 1.00 73.26  ? 174  PHE A CE2 1 
ATOM   1176 C  CZ  . PHE A 1  174 ? 77.731  79.042  20.961 1.00 79.58  ? 174  PHE A CZ  1 
ATOM   1177 N  N   . GLN A 1  175 ? 73.686  82.525  25.672 1.00 70.69  ? 175  GLN A N   1 
ATOM   1178 C  CA  . GLN A 1  175 ? 72.556  82.859  26.515 1.00 57.59  ? 175  GLN A CA  1 
ATOM   1179 C  C   . GLN A 1  175 ? 71.551  83.506  25.680 1.00 57.59  ? 175  GLN A C   1 
ATOM   1180 O  O   . GLN A 1  175 ? 71.887  84.372  24.835 1.00 58.50  ? 175  GLN A O   1 
ATOM   1181 C  CB  . GLN A 1  175 ? 72.886  83.851  27.641 1.00 56.61  ? 175  GLN A CB  1 
ATOM   1182 C  CG  . GLN A 1  175 ? 71.748  84.049  28.670 1.00 54.17  ? 175  GLN A CG  1 
ATOM   1183 C  CD  . GLN A 1  175 ? 72.275  84.935  29.786 1.00 55.88  ? 175  GLN A CD  1 
ATOM   1184 O  OE1 . GLN A 1  175 ? 73.321  84.628  30.344 1.00 56.49  ? 175  GLN A OE1 1 
ATOM   1185 N  NE2 . GLN A 1  175 ? 71.621  86.075  30.065 1.00 52.19  ? 175  GLN A NE2 1 
ATOM   1186 N  N   . THR A 1  176 ? 70.314  83.130  25.949 1.00 57.27  ? 176  THR A N   1 
ATOM   1187 C  CA  . THR A 1  176 ? 69.202  83.774  25.278 1.00 58.21  ? 176  THR A CA  1 
ATOM   1188 C  C   . THR A 1  176 ? 68.160  84.259  26.323 1.00 56.85  ? 176  THR A C   1 
ATOM   1189 O  O   . THR A 1  176 ? 67.706  83.481  27.182 1.00 56.35  ? 176  THR A O   1 
ATOM   1190 C  CB  . THR A 1  176 ? 68.539  82.816  24.228 1.00 57.92  ? 176  THR A CB  1 
ATOM   1191 O  OG1 . THR A 1  176 ? 67.794  83.609  23.332 1.00 59.86  ? 176  THR A OG1 1 
ATOM   1192 C  CG2 . THR A 1  176 ? 67.525  81.884  24.861 1.00 59.15  ? 176  THR A CG2 1 
ATOM   1193 N  N   . GLY A 1  177 ? 67.792  85.535  26.275 1.00 57.09  ? 177  GLY A N   1 
ATOM   1194 C  CA  . GLY A 1  177 ? 66.760  86.021  27.208 1.00 57.36  ? 177  GLY A CA  1 
ATOM   1195 C  C   . GLY A 1  177 ? 65.813  87.156  26.790 1.00 57.11  ? 177  GLY A C   1 
ATOM   1196 O  O   . GLY A 1  177 ? 66.082  87.888  25.846 1.00 76.79  ? 177  GLY A O   1 
ATOM   1197 N  N   . PHE A 1  178 ? 64.693  87.300  27.492 1.00 55.51  ? 178  PHE A N   1 
ATOM   1198 C  CA  . PHE A 1  178 ? 63.728  88.398  27.245 1.00 53.78  ? 178  PHE A CA  1 
ATOM   1199 C  C   . PHE A 1  178 ? 63.193  89.088  28.501 1.00 55.57  ? 178  PHE A C   1 
ATOM   1200 O  O   . PHE A 1  178 ? 63.153  88.567  29.662 1.00 53.59  ? 178  PHE A O   1 
ATOM   1201 C  CB  . PHE A 1  178 ? 62.511  87.938  26.499 1.00 51.41  ? 178  PHE A CB  1 
ATOM   1202 C  CG  . PHE A 1  178 ? 61.739  86.885  27.222 1.00 50.90  ? 178  PHE A CG  1 
ATOM   1203 C  CD1 . PHE A 1  178 ? 62.192  85.585  27.267 1.00 50.84  ? 178  PHE A CD1 1 
ATOM   1204 C  CD2 . PHE A 1  178 ? 60.578  87.193  27.929 1.00 51.94  ? 178  PHE A CD2 1 
ATOM   1205 C  CE1 . PHE A 1  178 ? 61.501  84.592  28.010 1.00 50.35  ? 178  PHE A CE1 1 
ATOM   1206 C  CE2 . PHE A 1  178 ? 59.885  86.225  28.670 1.00 50.48  ? 178  PHE A CE2 1 
ATOM   1207 C  CZ  . PHE A 1  178 ? 60.351  84.914  28.710 1.00 50.67  ? 178  PHE A CZ  1 
ATOM   1208 N  N   . ASP A 1  179 ? 62.723  90.281  28.211 1.00 56.95  ? 179  ASP A N   1 
ATOM   1209 C  CA  . ASP A 1  179 ? 62.164  91.161  29.208 1.00 57.57  ? 179  ASP A CA  1 
ATOM   1210 C  C   . ASP A 1  179 ? 61.005  91.972  28.567 1.00 57.86  ? 179  ASP A C   1 
ATOM   1211 O  O   . ASP A 1  179 ? 61.213  92.944  27.876 1.00 67.68  ? 179  ASP A O   1 
ATOM   1212 C  CB  . ASP A 1  179 ? 63.290  92.083  29.704 1.00 56.39  ? 179  ASP A CB  1 
ATOM   1213 C  CG  . ASP A 1  179 ? 63.010  92.700  31.067 1.00 56.25  ? 179  ASP A CG  1 
ATOM   1214 O  OD1 . ASP A 1  179 ? 61.900  92.469  31.622 1.00 55.71  ? 179  ASP A OD1 1 
ATOM   1215 O  OD2 . ASP A 1  179 ? 63.924  93.422  31.559 1.00 55.81  ? 179  ASP A OD2 1 
ATOM   1216 N  N   . PHE A 1  180 ? 59.786  91.546  28.793 1.00 61.95  ? 180  PHE A N   1 
ATOM   1217 C  CA  . PHE A 1  180 ? 58.622  92.279  28.284 1.00 63.23  ? 180  PHE A CA  1 
ATOM   1218 C  C   . PHE A 1  180 ? 57.715  92.793  29.416 1.00 59.58  ? 180  PHE A C   1 
ATOM   1219 O  O   . PHE A 1  180 ? 57.335  92.072  30.346 1.00 58.90  ? 180  PHE A O   1 
ATOM   1220 C  CB  . PHE A 1  180 ? 57.754  91.376  27.430 1.00 64.11  ? 180  PHE A CB  1 
ATOM   1221 C  CG  . PHE A 1  180 ? 58.446  90.841  26.271 1.00 72.94  ? 180  PHE A CG  1 
ATOM   1222 C  CD1 . PHE A 1  180 ? 58.950  91.691  25.307 1.00 84.33  ? 180  PHE A CD1 1 
ATOM   1223 C  CD2 . PHE A 1  180 ? 58.643  89.479  26.145 1.00 80.54  ? 180  PHE A CD2 1 
ATOM   1224 C  CE1 . PHE A 1  180 ? 59.646  91.204  24.234 1.00 76.24  ? 180  PHE A CE1 1 
ATOM   1225 C  CE2 . PHE A 1  180 ? 59.341  88.965  25.073 1.00 73.15  ? 180  PHE A CE2 1 
ATOM   1226 C  CZ  . PHE A 1  180 ? 59.845  89.847  24.114 1.00 69.11  ? 180  PHE A CZ  1 
ATOM   1227 N  N   . SER A 1  181 ? 57.314  94.033  29.300 1.00 61.28  ? 181  SER A N   1 
ATOM   1228 C  CA  . SER A 1  181 ? 56.414  94.597  30.288 1.00 57.81  ? 181  SER A CA  1 
ATOM   1229 C  C   . SER A 1  181 ? 55.354  95.515  29.598 1.00 65.88  ? 181  SER A C   1 
ATOM   1230 O  O   . SER A 1  181 ? 55.658  96.331  28.700 1.00 61.02  ? 181  SER A O   1 
ATOM   1231 C  CB  . SER A 1  181 ? 57.230  95.423  31.286 1.00 51.86  ? 181  SER A CB  1 
ATOM   1232 O  OG  . SER A 1  181 ? 56.479  95.681  32.456 1.00 53.46  ? 181  SER A OG  1 
ATOM   1233 N  N   . ASP A 1  182 ? 54.116  95.398  30.037 1.00 64.81  ? 182  ASP A N   1 
ATOM   1234 C  CA  . ASP A 1  182 ? 53.117  96.268  29.526 1.00 62.18  ? 182  ASP A CA  1 
ATOM   1235 C  C   . ASP A 1  182 ? 51.913  96.427  30.441 1.00 65.81  ? 182  ASP A C   1 
ATOM   1236 O  O   . ASP A 1  182 ? 51.692  95.626  31.394 1.00 56.29  ? 182  ASP A O   1 
ATOM   1237 C  CB  . ASP A 1  182 ? 52.661  95.726  28.191 1.00 67.30  ? 182  ASP A CB  1 
ATOM   1238 C  CG  . ASP A 1  182 ? 52.318  96.842  27.196 1.00 70.13  ? 182  ASP A CG  1 
ATOM   1239 O  OD1 . ASP A 1  182 ? 52.459  98.076  27.543 1.00 64.08  ? 182  ASP A OD1 1 
ATOM   1240 O  OD2 . ASP A 1  182 ? 51.932  96.458  26.066 1.00 70.21  ? 182  ASP A OD2 1 
ATOM   1241 N  N   . SER A 1  183 ? 51.102  97.433  30.095 1.00 64.79  ? 183  SER A N   1 
ATOM   1242 C  CA  . SER A 1  183 ? 49.852  97.675  30.809 1.00 58.29  ? 183  SER A CA  1 
ATOM   1243 C  C   . SER A 1  183 ? 48.776  96.950  30.092 1.00 57.80  ? 183  SER A C   1 
ATOM   1244 O  O   . SER A 1  183 ? 48.836  96.785  28.896 1.00 70.07  ? 183  SER A O   1 
ATOM   1245 C  CB  . SER A 1  183 ? 49.491  99.130  30.820 1.00 48.43  ? 183  SER A CB  1 
ATOM   1246 O  OG  . SER A 1  183 ? 50.596  99.884  31.282 1.00 67.05  ? 183  SER A OG  1 
ATOM   1247 N  N   . LEU A 1  184 ? 47.798  96.508  30.854 1.00 67.21  ? 184  LEU A N   1 
ATOM   1248 C  CA  . LEU A 1  184 ? 46.647  95.828  30.329 1.00 59.76  ? 184  LEU A CA  1 
ATOM   1249 C  C   . LEU A 1  184 ? 45.463  96.764  30.202 1.00 71.89  ? 184  LEU A C   1 
ATOM   1250 O  O   . LEU A 1  184 ? 44.387  96.339  29.832 1.00 80.99  ? 184  LEU A O   1 
ATOM   1251 C  CB  . LEU A 1  184 ? 46.247  94.685  31.254 1.00 65.44  ? 184  LEU A CB  1 
ATOM   1252 C  CG  . LEU A 1  184 ? 47.170  93.470  31.070 1.00 76.08  ? 184  LEU A CG  1 
ATOM   1253 C  CD1 . LEU A 1  184 ? 46.373  92.242  30.605 1.00 72.77  ? 184  LEU A CD1 1 
ATOM   1254 C  CD2 . LEU A 1  184 ? 48.212  93.786  30.002 1.00 73.18  ? 184  LEU A CD2 1 
ATOM   1255 N  N   . ASP A 1  185 ? 45.658  98.042  30.482 1.00 66.38  ? 185  ASP A N   1 
ATOM   1256 C  CA  . ASP A 1  185 ? 44.564  98.990  30.452 1.00 45.32  ? 185  ASP A CA  1 
ATOM   1257 C  C   . ASP A 1  185 ? 45.220  100.335 30.195 1.00 60.36  ? 185  ASP A C   1 
ATOM   1258 O  O   . ASP A 1  185 ? 46.415  100.472 30.438 1.00 58.51  ? 185  ASP A O   1 
ATOM   1259 C  CB  . ASP A 1  185 ? 43.828  98.936  31.801 1.00 59.74  ? 185  ASP A CB  1 
ATOM   1260 C  CG  . ASP A 1  185 ? 44.577  99.645  32.922 1.00 55.60  ? 185  ASP A CG  1 
ATOM   1261 O  OD1 . ASP A 1  185 ? 45.632  99.192  33.391 1.00 60.34  ? 185  ASP A OD1 1 
ATOM   1262 O  OD2 . ASP A 1  185 ? 44.090  100.695 33.324 1.00 68.29  ? 185  ASP A OD2 1 
ATOM   1263 N  N   . ASP A 1  186 ? 44.494  101.357 29.742 1.00 68.79  ? 186  ASP A N   1 
ATOM   1264 C  CA  . ASP A 1  186 ? 45.243  102.561 29.447 1.00 65.52  ? 186  ASP A CA  1 
ATOM   1265 C  C   . ASP A 1  186 ? 45.596  103.460 30.539 1.00 57.64  ? 186  ASP A C   1 
ATOM   1266 O  O   . ASP A 1  186 ? 46.379  104.371 30.371 1.00 57.33  ? 186  ASP A O   1 
ATOM   1267 C  CB  . ASP A 1  186 ? 44.614  103.305 28.304 1.00 71.43  ? 186  ASP A CB  1 
ATOM   1268 C  CG  . ASP A 1  186 ? 44.592  102.460 27.075 1.00 83.05  ? 186  ASP A CG  1 
ATOM   1269 O  OD1 . ASP A 1  186 ? 45.610  101.722 26.861 1.00 89.44  ? 186  ASP A OD1 1 
ATOM   1270 O  OD2 . ASP A 1  186 ? 43.570  102.505 26.355 1.00 82.54  ? 186  ASP A OD2 1 
ATOM   1271 N  N   . ASP A 1  187 ? 45.070  103.137 31.693 1.00 63.94  ? 187  ASP A N   1 
ATOM   1272 C  CA  . ASP A 1  187 ? 45.317  103.912 32.863 1.00 64.52  ? 187  ASP A CA  1 
ATOM   1273 C  C   . ASP A 1  187 ? 46.355  103.291 33.703 1.00 63.45  ? 187  ASP A C   1 
ATOM   1274 O  O   . ASP A 1  187 ? 46.896  103.919 34.606 1.00 65.39  ? 187  ASP A O   1 
ATOM   1275 C  CB  . ASP A 1  187 ? 44.013  104.095 33.609 1.00 66.90  ? 187  ASP A CB  1 
ATOM   1276 C  CG  . ASP A 1  187 ? 43.264  105.293 33.091 1.00 61.71  ? 187  ASP A CG  1 
ATOM   1277 O  OD1 . ASP A 1  187 ? 43.711  106.425 33.410 1.00 71.74  ? 187  ASP A OD1 1 
ATOM   1278 O  OD2 . ASP A 1  187 ? 42.284  105.100 32.336 1.00 58.73  ? 187  ASP A OD2 1 
ATOM   1279 N  N   . GLY A 1  188 ? 46.627  102.029 33.396 1.00 71.82  ? 188  GLY A N   1 
ATOM   1280 C  CA  . GLY A 1  188 ? 47.669  101.295 34.099 1.00 68.17  ? 188  GLY A CA  1 
ATOM   1281 C  C   . GLY A 1  188 ? 47.334  100.825 35.482 1.00 64.07  ? 188  GLY A C   1 
ATOM   1282 O  O   . GLY A 1  188 ? 48.156  100.862 36.339 1.00 69.30  ? 188  GLY A O   1 
ATOM   1283 N  N   . VAL A 1  189 ? 46.116  100.399 35.709 1.00 60.75  ? 189  VAL A N   1 
ATOM   1284 C  CA  . VAL A 1  189 ? 45.782  99.942  37.003 1.00 62.80  ? 189  VAL A CA  1 
ATOM   1285 C  C   . VAL A 1  189 ? 46.291  98.509  36.928 1.00 65.18  ? 189  VAL A C   1 
ATOM   1286 O  O   . VAL A 1  189 ? 46.571  97.890  37.938 1.00 62.91  ? 189  VAL A O   1 
ATOM   1287 C  CB  . VAL A 1  189 ? 44.181  100.119 37.266 1.00 78.01  ? 189  VAL A CB  1 
ATOM   1288 C  CG1 . VAL A 1  189 ? 43.321  99.466  36.160 1.00 51.19  ? 189  VAL A CG1 1 
ATOM   1289 C  CG2 . VAL A 1  189 ? 43.792  99.557  38.705 1.00 53.26  ? 189  VAL A CG2 1 
ATOM   1290 N  N   . TYR A 1  190 ? 46.446  98.008  35.713 1.00 58.68  ? 190  TYR A N   1 
ATOM   1291 C  CA  . TYR A 1  190 ? 46.942  96.670  35.528 1.00 60.11  ? 190  TYR A CA  1 
ATOM   1292 C  C   . TYR A 1  190 ? 48.153  96.508  34.621 1.00 64.54  ? 190  TYR A C   1 
ATOM   1293 O  O   . TYR A 1  190 ? 48.091  96.831  33.416 1.00 64.16  ? 190  TYR A O   1 
ATOM   1294 C  CB  . TYR A 1  190 ? 45.874  95.802  34.959 1.00 61.86  ? 190  TYR A CB  1 
ATOM   1295 C  CG  . TYR A 1  190 ? 44.634  95.739  35.760 1.00 68.65  ? 190  TYR A CG  1 
ATOM   1296 C  CD1 . TYR A 1  190 ? 44.622  95.231  37.056 1.00 68.81  ? 190  TYR A CD1 1 
ATOM   1297 C  CD2 . TYR A 1  190 ? 43.426  96.130  35.190 1.00 79.49  ? 190  TYR A CD2 1 
ATOM   1298 C  CE1 . TYR A 1  190 ? 43.404  95.102  37.770 1.00 75.86  ? 190  TYR A CE1 1 
ATOM   1299 C  CE2 . TYR A 1  190 ? 42.224  96.018  35.880 1.00 75.47  ? 190  TYR A CE2 1 
ATOM   1300 C  CZ  . TYR A 1  190 ? 42.213  95.509  37.156 1.00 73.94  ? 190  TYR A CZ  1 
ATOM   1301 O  OH  . TYR A 1  190 ? 41.007  95.447  37.779 1.00 64.74  ? 190  TYR A OH  1 
ATOM   1302 N  N   . SER A 1  191 ? 49.257  96.017  35.185 1.00 53.44  ? 191  SER A N   1 
ATOM   1303 C  CA  . SER A 1  191 ? 50.441  95.782  34.354 1.00 66.43  ? 191  SER A CA  1 
ATOM   1304 C  C   . SER A 1  191 ? 51.193  94.512  34.727 1.00 65.17  ? 191  SER A C   1 
ATOM   1305 O  O   . SER A 1  191 ? 51.051  93.949  35.826 1.00 64.71  ? 191  SER A O   1 
ATOM   1306 C  CB  . SER A 1  191 ? 51.403  97.019  34.289 1.00 51.78  ? 191  SER A CB  1 
ATOM   1307 O  OG  . SER A 1  191 ? 51.793  97.568  35.561 1.00 55.46  ? 191  SER A OG  1 
ATOM   1308 N  N   . TYR A 1  192 ? 51.968  94.027  33.779 1.00 63.95  ? 192  TYR A N   1 
ATOM   1309 C  CA  . TYR A 1  192 ? 52.721  92.828  34.034 1.00 56.41  ? 192  TYR A CA  1 
ATOM   1310 C  C   . TYR A 1  192 ? 54.166  92.944  33.582 1.00 56.56  ? 192  TYR A C   1 
ATOM   1311 O  O   . TYR A 1  192 ? 54.582  93.930  32.923 1.00 56.07  ? 192  TYR A O   1 
ATOM   1312 C  CB  . TYR A 1  192 ? 52.084  91.674  33.285 1.00 59.94  ? 192  TYR A CB  1 
ATOM   1313 C  CG  . TYR A 1  192 ? 52.302  91.766  31.785 1.00 67.55  ? 192  TYR A CG  1 
ATOM   1314 C  CD1 . TYR A 1  192 ? 53.554  91.604  31.240 1.00 63.25  ? 192  TYR A CD1 1 
ATOM   1315 C  CD2 . TYR A 1  192 ? 51.263  92.097  30.927 1.00 72.04  ? 192  TYR A CD2 1 
ATOM   1316 C  CE1 . TYR A 1  192 ? 53.769  91.781  29.901 1.00 73.32  ? 192  TYR A CE1 1 
ATOM   1317 C  CE2 . TYR A 1  192 ? 51.461  92.270  29.564 1.00 71.27  ? 192  TYR A CE2 1 
ATOM   1318 C  CZ  . TYR A 1  192 ? 52.718  92.118  29.052 1.00 77.69  ? 192  TYR A CZ  1 
ATOM   1319 O  OH  . TYR A 1  192 ? 52.957  92.336  27.704 1.00 75.31  ? 192  TYR A OH  1 
ATOM   1320 N  N   . ARG A 1  193 ? 54.961  91.939  33.958 1.00 55.14  ? 193  ARG A N   1 
ATOM   1321 C  CA  . ARG A 1  193 ? 56.338  91.850  33.447 1.00 52.33  ? 193  ARG A CA  1 
ATOM   1322 C  C   . ARG A 1  193 ? 56.672  90.401  33.490 1.00 53.01  ? 193  ARG A C   1 
ATOM   1323 O  O   . ARG A 1  193 ? 56.160  89.619  34.352 1.00 53.06  ? 193  ARG A O   1 
ATOM   1324 C  CB  . ARG A 1  193 ? 57.360  92.687  34.202 1.00 50.13  ? 193  ARG A CB  1 
ATOM   1325 C  CG  . ARG A 1  193 ? 58.739  92.881  33.417 1.00 48.82  ? 193  ARG A CG  1 
ATOM   1326 C  CD  . ARG A 1  193 ? 59.646  93.971  34.092 1.00 45.30  ? 193  ARG A CD  1 
ATOM   1327 N  NE  . ARG A 1  193 ? 60.937  94.235  33.469 1.00 45.76  ? 193  ARG A NE  1 
ATOM   1328 C  CZ  . ARG A 1  193 ? 61.664  95.290  33.798 1.00 44.90  ? 193  ARG A CZ  1 
ATOM   1329 N  NH1 . ARG A 1  193 ? 61.169  96.086  34.719 1.00 46.42  ? 193  ARG A NH1 1 
ATOM   1330 N  NH2 . ARG A 1  193 ? 62.831  95.580  33.227 1.00 43.76  ? 193  ARG A NH2 1 
ATOM   1331 N  N   . LEU A 1  194 ? 57.405  89.999  32.467 1.00 52.63  ? 194  LEU A N   1 
ATOM   1332 C  CA  . LEU A 1  194 ? 57.823  88.616  32.367 1.00 52.95  ? 194  LEU A CA  1 
ATOM   1333 C  C   . LEU A 1  194 ? 59.258  88.697  31.877 1.00 53.32  ? 194  LEU A C   1 
ATOM   1334 O  O   . LEU A 1  194 ? 59.547  89.255  30.777 1.00 54.85  ? 194  LEU A O   1 
ATOM   1335 C  CB  . LEU A 1  194 ? 56.915  87.840  31.406 1.00 51.47  ? 194  LEU A CB  1 
ATOM   1336 C  CG  . LEU A 1  194 ? 57.039  86.288  31.443 1.00 55.15  ? 194  LEU A CG  1 
ATOM   1337 C  CD1 . LEU A 1  194 ? 56.437  85.677  32.766 1.00 53.09  ? 194  LEU A CD1 1 
ATOM   1338 C  CD2 . LEU A 1  194 ? 56.352  85.679  30.252 1.00 50.95  ? 194  LEU A CD2 1 
ATOM   1339 N  N   . THR A 1  195 ? 60.179  88.257  32.738 1.00 52.10  ? 195  THR A N   1 
ATOM   1340 C  CA  . THR A 1  195 ? 61.610  88.264  32.362 1.00 51.80  ? 195  THR A CA  1 
ATOM   1341 C  C   . THR A 1  195 ? 62.038  86.792  32.366 1.00 52.99  ? 195  THR A C   1 
ATOM   1342 O  O   . THR A 1  195 ? 61.596  86.034  33.248 1.00 53.39  ? 195  THR A O   1 
ATOM   1343 C  CB  . THR A 1  195 ? 62.403  89.118  33.332 1.00 50.61  ? 195  THR A CB  1 
ATOM   1344 O  OG1 . THR A 1  195 ? 61.680  90.344  33.514 1.00 53.22  ? 195  THR A OG1 1 
ATOM   1345 C  CG2 . THR A 1  195 ? 63.805  89.420  32.852 1.00 46.18  ? 195  THR A CG2 1 
ATOM   1346 N  N   . GLY A 1  196 ? 62.781  86.364  31.328 1.00 53.38  ? 196  GLY A N   1 
ATOM   1347 C  CA  . GLY A 1  196 ? 63.230  84.973  31.279 1.00 52.41  ? 196  GLY A CA  1 
ATOM   1348 C  C   . GLY A 1  196 ? 64.611  84.760  30.711 1.00 52.02  ? 196  GLY A C   1 
ATOM   1349 O  O   . GLY A 1  196 ? 65.190  85.627  30.018 1.00 52.76  ? 196  GLY A O   1 
ATOM   1350 N  N   . LEU A 1  197 ? 65.222  83.632  31.033 1.00 52.39  ? 197  LEU A N   1 
ATOM   1351 C  CA  . LEU A 1  197 ? 66.541  83.421  30.457 1.00 51.25  ? 197  LEU A CA  1 
ATOM   1352 C  C   . LEU A 1  197 ? 66.923  82.017  30.378 1.00 51.55  ? 197  LEU A C   1 
ATOM   1353 O  O   . LEU A 1  197 ? 66.501  81.210  31.220 1.00 50.33  ? 197  LEU A O   1 
ATOM   1354 C  CB  . LEU A 1  197 ? 67.624  84.163  31.194 1.00 50.15  ? 197  LEU A CB  1 
ATOM   1355 C  CG  . LEU A 1  197 ? 68.199  83.705  32.531 1.00 50.85  ? 197  LEU A CG  1 
ATOM   1356 C  CD1 . LEU A 1  197 ? 69.400  82.752  32.347 1.00 50.12  ? 197  LEU A CD1 1 
ATOM   1357 C  CD2 . LEU A 1  197 ? 68.813  84.957  33.179 1.00 50.46  ? 197  LEU A CD2 1 
ATOM   1358 N  N   . ALA A 1  198 ? 67.668  81.717  29.301 1.00 51.31  ? 198  ALA A N   1 
ATOM   1359 C  CA  . ALA A 1  198 ? 68.250  80.372  29.105 1.00 50.72  ? 198  ALA A CA  1 
ATOM   1360 C  C   . ALA A 1  198 ? 69.761  80.565  28.878 1.00 50.49  ? 198  ALA A C   1 
ATOM   1361 O  O   . ALA A 1  198 ? 70.208  81.444  28.164 1.00 53.47  ? 198  ALA A O   1 
ATOM   1362 C  CB  . ALA A 1  198 ? 67.576  79.635  28.011 1.00 50.81  ? 198  ALA A CB  1 
ATOM   1363 N  N   . ARG A 1  199 ? 70.555  79.819  29.623 1.00 51.84  ? 199  ARG A N   1 
ATOM   1364 C  CA  . ARG A 1  199 ? 72.031  79.964  29.637 1.00 50.12  ? 199  ARG A CA  1 
ATOM   1365 C  C   . ARG A 1  199 ? 72.710  78.621  29.763 1.00 50.77  ? 199  ARG A C   1 
ATOM   1366 O  O   . ARG A 1  199 ? 72.131  77.634  30.239 1.00 50.86  ? 199  ARG A O   1 
ATOM   1367 C  CB  . ARG A 1  199 ? 72.411  80.753  30.849 1.00 51.37  ? 199  ARG A CB  1 
ATOM   1368 C  CG  . ARG A 1  199 ? 73.763  81.176  30.946 1.00 67.56  ? 199  ARG A CG  1 
ATOM   1369 C  CD  . ARG A 1  199 ? 74.012  81.229  32.394 1.00 72.78  ? 199  ARG A CD  1 
ATOM   1370 N  NE  . ARG A 1  199 ? 75.425  80.984  32.659 1.00 91.09  ? 199  ARG A NE  1 
ATOM   1371 C  CZ  . ARG A 1  199 ? 76.365  81.907  32.457 1.00 93.10  ? 199  ARG A CZ  1 
ATOM   1372 N  NH1 . ARG A 1  199 ? 75.958  83.114  31.985 1.00 77.38  ? 199  ARG A NH1 1 
ATOM   1373 N  NH2 . ARG A 1  199 ? 77.673  81.639  32.744 1.00 54.93  ? 199  ARG A NH2 1 
ATOM   1374 N  N   . SER A 1  200 ? 73.933  78.569  29.258 1.00 79.92  ? 200  SER A N   1 
ATOM   1375 C  CA  . SER A 1  200 ? 74.744  77.368  29.337 1.00 68.95  ? 200  SER A CA  1 
ATOM   1376 C  C   . SER A 1  200 ? 76.133  77.756  28.958 1.00 58.80  ? 200  SER A C   1 
ATOM   1377 O  O   . SER A 1  200 ? 76.342  78.647  28.158 1.00 59.58  ? 200  SER A O   1 
ATOM   1378 C  CB  . SER A 1  200 ? 74.266  76.270  28.391 1.00 68.76  ? 200  SER A CB  1 
ATOM   1379 O  OG  . SER A 1  200 ? 74.673  76.541  27.079 1.00 68.69  ? 200  SER A OG  1 
ATOM   1380 N  N   . ALA A 1  201 ? 77.094  77.116  29.592 1.00 58.36  ? 201  ALA A N   1 
ATOM   1381 C  CA  . ALA A 1  201 ? 78.477  77.334  29.276 1.00 57.47  ? 201  ALA A CA  1 
ATOM   1382 C  C   . ALA A 1  201 ? 79.165  76.157  29.925 1.00 57.72  ? 201  ALA A C   1 
ATOM   1383 O  O   . ALA A 1  201 ? 78.505  75.319  30.588 1.00 58.52  ? 201  ALA A O   1 
ATOM   1384 C  CB  . ALA A 1  201 ? 78.982  78.642  29.853 1.00 55.45  ? 201  ALA A CB  1 
ATOM   1385 N  N   . ASN A 1  202 ? 80.468  76.048  29.669 1.00 57.03  ? 202  ASN A N   1 
ATOM   1386 C  CA  . ASN A 1  202 ? 81.237  75.026  30.317 1.00 56.36  ? 202  ASN A CA  1 
ATOM   1387 C  C   . ASN A 1  202 ? 81.981  75.811  31.375 1.00 56.01  ? 202  ASN A C   1 
ATOM   1388 O  O   . ASN A 1  202 ? 82.330  76.959  31.150 1.00 56.14  ? 202  ASN A O   1 
ATOM   1389 C  CB  . ASN A 1  202 ? 82.244  74.413  29.382 1.00 55.73  ? 202  ASN A CB  1 
ATOM   1390 C  CG  . ASN A 1  202 ? 81.613  73.743  28.172 1.00 76.44  ? 202  ASN A CG  1 
ATOM   1391 O  OD1 . ASN A 1  202 ? 81.958  74.097  27.075 1.00 81.62  ? 202  ASN A OD1 1 
ATOM   1392 N  ND2 . ASN A 1  202 ? 80.717  72.770  28.363 1.00 66.17  ? 202  ASN A ND2 1 
ATOM   1393 N  N   . ALA A 1  203 ? 82.183  75.203  32.532 1.00 54.81  ? 203  ALA A N   1 
ATOM   1394 C  CA  . ALA A 1  203 ? 82.924  75.824  33.597 1.00 55.46  ? 203  ALA A CA  1 
ATOM   1395 C  C   . ALA A 1  203 ? 84.372  75.996  33.223 1.00 56.08  ? 203  ALA A C   1 
ATOM   1396 O  O   . ALA A 1  203 ? 84.856  75.312  32.344 1.00 58.64  ? 203  ALA A O   1 
ATOM   1397 C  CB  . ALA A 1  203 ? 82.846  74.938  34.831 1.00 55.20  ? 203  ALA A CB  1 
ATOM   1398 N  N   . GLN A 1  204 ? 85.071  76.912  33.880 1.00 57.39  ? 204  GLN A N   1 
ATOM   1399 C  CA  . GLN A 1  204 ? 86.526  77.077  33.685 1.00 68.87  ? 204  GLN A CA  1 
ATOM   1400 C  C   . GLN A 1  204 ? 87.269  75.715  33.855 1.00 68.32  ? 204  GLN A C   1 
ATOM   1401 O  O   . GLN A 1  204 ? 88.189  75.413  33.118 1.00 75.97  ? 204  GLN A O   1 
ATOM   1402 C  CB  . GLN A 1  204 ? 87.057  78.076  34.713 1.00 59.28  ? 204  GLN A CB  1 
ATOM   1403 C  CG  . GLN A 1  204 ? 88.451  77.995  34.945 1.00 50.76  ? 204  GLN A CG  1 
ATOM   1404 C  CD  . GLN A 1  204 ? 88.985  79.225  35.609 1.00 54.63  ? 204  GLN A CD  1 
ATOM   1405 O  OE1 . GLN A 1  204 ? 88.560  80.343  35.309 1.00 54.45  ? 204  GLN A OE1 1 
ATOM   1406 N  NE2 . GLN A 1  204 ? 89.952  79.041  36.522 1.00 68.04  ? 204  GLN A NE2 1 
ATOM   1407 N  N   . GLN A 1  205 ? 86.817  74.893  34.797 1.00 71.08  ? 205  GLN A N   1 
ATOM   1408 C  CA  . GLN A 1  205 ? 87.380  73.566  35.124 1.00 69.62  ? 205  GLN A CA  1 
ATOM   1409 C  C   . GLN A 1  205 ? 86.917  72.529  34.146 1.00 67.93  ? 205  GLN A C   1 
ATOM   1410 O  O   . GLN A 1  205 ? 85.731  72.402  33.936 1.00 66.53  ? 205  GLN A O   1 
ATOM   1411 C  CB  . GLN A 1  205 ? 86.918  73.142  36.533 1.00 41.03  ? 205  GLN A CB  1 
ATOM   1412 C  CG  . GLN A 1  205 ? 86.306  74.374  37.203 1.00 70.61  ? 205  GLN A CG  1 
ATOM   1413 C  CD  . GLN A 1  205 ? 87.364  75.106  37.807 1.00 58.95  ? 205  GLN A CD  1 
ATOM   1414 O  OE1 . GLN A 1  205 ? 87.268  76.300  38.121 1.00 63.20  ? 205  GLN A OE1 1 
ATOM   1415 N  NE2 . GLN A 1  205 ? 88.462  74.378  38.011 1.00 64.89  ? 205  GLN A NE2 1 
ATOM   1416 N  N   . LYS A 1  206 ? 87.851  71.742  33.603 1.00 69.13  ? 206  LYS A N   1 
ATOM   1417 C  CA  . LYS A 1  206 ? 87.518  70.732  32.609 1.00 64.17  ? 206  LYS A CA  1 
ATOM   1418 C  C   . LYS A 1  206 ? 86.502  69.707  33.072 1.00 61.68  ? 206  LYS A C   1 
ATOM   1419 O  O   . LYS A 1  206 ? 86.572  69.143  34.172 1.00 62.13  ? 206  LYS A O   1 
ATOM   1420 C  CB  . LYS A 1  206 ? 88.813  70.052  32.107 1.00 77.13  ? 206  LYS A CB  1 
ATOM   1421 C  CG  . LYS A 1  206 ? 89.163  70.340  30.611 1.00 78.99  ? 206  LYS A CG  1 
ATOM   1422 C  CD  . LYS A 1  206 ? 89.387  69.006  29.829 1.00 84.72  ? 206  LYS A CD  1 
ATOM   1423 C  CE  . LYS A 1  206 ? 88.332  68.698  28.730 1.00 87.60  ? 206  LYS A CE  1 
ATOM   1424 N  NZ  . LYS A 1  206 ? 88.538  69.344  27.357 1.00 84.56  ? 206  LYS A NZ  1 
ATOM   1425 N  N   . GLY A 1  207 ? 85.547  69.446  32.208 1.00 51.84  ? 207  GLY A N   1 
ATOM   1426 C  CA  . GLY A 1  207 ? 84.534  68.495  32.571 1.00 51.91  ? 207  GLY A CA  1 
ATOM   1427 C  C   . GLY A 1  207 ? 83.337  69.136  33.279 1.00 55.26  ? 207  GLY A C   1 
ATOM   1428 O  O   . GLY A 1  207 ? 82.269  68.505  33.365 1.00 57.29  ? 207  GLY A O   1 
ATOM   1429 N  N   . SER A 1  208 ? 83.455  70.356  33.822 1.00 60.54  ? 208  SER A N   1 
ATOM   1430 C  CA  . SER A 1  208 ? 82.269  70.927  34.439 1.00 63.00  ? 208  SER A CA  1 
ATOM   1431 C  C   . SER A 1  208 ? 81.489  71.879  33.534 1.00 63.79  ? 208  SER A C   1 
ATOM   1432 O  O   . SER A 1  208 ? 82.047  72.648  32.734 1.00 61.47  ? 208  SER A O   1 
ATOM   1433 C  CB  . SER A 1  208 ? 82.604  71.583  35.798 1.00 65.49  ? 208  SER A CB  1 
ATOM   1434 O  OG  . SER A 1  208 ? 82.518  70.595  36.850 1.00 75.57  ? 208  SER A OG  1 
ATOM   1435 N  N   . GLU A 1  209 ? 80.169  71.789  33.620 1.00 65.63  ? 209  GLU A N   1 
ATOM   1436 C  CA  . GLU A 1  209 ? 79.330  72.699  32.825 1.00 73.12  ? 209  GLU A CA  1 
ATOM   1437 C  C   . GLU A 1  209 ? 78.361  73.382  33.782 1.00 63.28  ? 209  GLU A C   1 
ATOM   1438 O  O   . GLU A 1  209 ? 78.204  72.976  34.946 1.00 55.28  ? 209  GLU A O   1 
ATOM   1439 C  CB  . GLU A 1  209 ? 78.423  72.009  31.783 1.00 70.23  ? 209  GLU A CB  1 
ATOM   1440 C  CG  . GLU A 1  209 ? 78.855  70.747  31.112 1.00 81.11  ? 209  GLU A CG  1 
ATOM   1441 C  CD  . GLU A 1  209 ? 77.677  69.751  31.034 1.00 89.89  ? 209  GLU A CD  1 
ATOM   1442 O  OE1 . GLU A 1  209 ? 77.237  69.289  32.125 1.00 94.70  ? 209  GLU A OE1 1 
ATOM   1443 O  OE2 . GLU A 1  209 ? 77.194  69.449  29.903 1.00 87.74  ? 209  GLU A OE2 1 
ATOM   1444 N  N   . GLU A 1  210 ? 77.657  74.360  33.221 1.00 54.63  ? 210  GLU A N   1 
ATOM   1445 C  CA  . GLU A 1  210 ? 76.641  75.159  33.920 1.00 54.97  ? 210  GLU A CA  1 
ATOM   1446 C  C   . GLU A 1  210 ? 75.446  75.314  33.029 1.00 53.87  ? 210  GLU A C   1 
ATOM   1447 O  O   . GLU A 1  210 ? 75.572  75.578  31.839 1.00 55.42  ? 210  GLU A O   1 
ATOM   1448 C  CB  . GLU A 1  210 ? 77.179  76.572  34.189 1.00 52.99  ? 210  GLU A CB  1 
ATOM   1449 C  CG  . GLU A 1  210 ? 78.165  76.732  35.317 1.00 51.63  ? 210  GLU A CG  1 
ATOM   1450 C  CD  . GLU A 1  210 ? 79.100  77.898  35.079 1.00 53.89  ? 210  GLU A CD  1 
ATOM   1451 O  OE1 . GLU A 1  210 ? 78.663  78.853  34.379 1.00 94.02  ? 210  GLU A OE1 1 
ATOM   1452 O  OE2 . GLU A 1  210 ? 80.259  77.869  35.599 1.00 51.85  ? 210  GLU A OE2 1 
ATOM   1453 N  N   . GLN A 1  211 ? 74.280  75.167  33.580 1.00 53.46  ? 211  GLN A N   1 
ATOM   1454 C  CA  . GLN A 1  211 ? 73.080  75.440  32.779 1.00 54.15  ? 211  GLN A CA  1 
ATOM   1455 C  C   . GLN A 1  211 ? 72.037  76.213  33.611 1.00 53.45  ? 211  GLN A C   1 
ATOM   1456 O  O   . GLN A 1  211 ? 71.856  75.906  34.814 1.00 55.16  ? 211  GLN A O   1 
ATOM   1457 C  CB  . GLN A 1  211 ? 72.412  74.141  32.351 1.00 55.98  ? 211  GLN A CB  1 
ATOM   1458 C  CG  . GLN A 1  211 ? 73.088  73.317  31.275 1.00 69.53  ? 211  GLN A CG  1 
ATOM   1459 C  CD  . GLN A 1  211 ? 72.588  71.908  31.362 1.00 74.75  ? 211  GLN A CD  1 
ATOM   1460 O  OE1 . GLN A 1  211 ? 71.365  71.646  31.254 1.00 77.39  ? 211  GLN A OE1 1 
ATOM   1461 N  NE2 . GLN A 1  211 ? 73.510  70.986  31.605 1.00 61.36  ? 211  GLN A NE2 1 
ATOM   1462 N  N   . ARG A 1  212 ? 71.327  77.168  33.029 1.00 50.14  ? 212  ARG A N   1 
ATOM   1463 C  CA  . ARG A 1  212 ? 70.291  77.829  33.843 1.00 49.81  ? 212  ARG A CA  1 
ATOM   1464 C  C   . ARG A 1  212 ? 69.048  78.184  33.093 1.00 50.99  ? 212  ARG A C   1 
ATOM   1465 O  O   . ARG A 1  212 ? 69.107  78.739  31.978 1.00 50.65  ? 212  ARG A O   1 
ATOM   1466 C  CB  . ARG A 1  212 ? 70.832  79.122  34.493 1.00 47.86  ? 212  ARG A CB  1 
ATOM   1467 C  CG  . ARG A 1  212 ? 69.896  79.922  35.353 1.00 43.73  ? 212  ARG A CG  1 
ATOM   1468 C  CD  . ARG A 1  212 ? 70.552  81.184  35.880 1.00 43.52  ? 212  ARG A CD  1 
ATOM   1469 N  NE  . ARG A 1  212 ? 71.344  80.751  37.011 1.00 48.13  ? 212  ARG A NE  1 
ATOM   1470 C  CZ  . ARG A 1  212 ? 71.980  81.541  37.844 1.00 46.44  ? 212  ARG A CZ  1 
ATOM   1471 N  NH1 . ARG A 1  212 ? 71.959  82.862  37.709 1.00 40.78  ? 212  ARG A NH1 1 
ATOM   1472 N  NH2 . ARG A 1  212 ? 72.601  80.968  38.825 1.00 46.00  ? 212  ARG A NH2 1 
ATOM   1473 N  N   . TYR A 1  213 ? 67.910  77.852  33.691 1.00 50.45  ? 213  TYR A N   1 
ATOM   1474 C  CA  . TYR A 1  213 ? 66.636  78.283  33.091 1.00 50.28  ? 213  TYR A CA  1 
ATOM   1475 C  C   . TYR A 1  213 ? 65.910  79.120  34.199 1.00 49.91  ? 213  TYR A C   1 
ATOM   1476 O  O   . TYR A 1  213 ? 65.679  78.656  35.373 1.00 48.08  ? 213  TYR A O   1 
ATOM   1477 C  CB  . TYR A 1  213 ? 65.756  77.097  32.592 1.00 46.25  ? 213  TYR A CB  1 
ATOM   1478 C  CG  . TYR A 1  213 ? 66.472  76.282  31.574 1.00 77.50  ? 213  TYR A CG  1 
ATOM   1479 C  CD1 . TYR A 1  213 ? 66.693  76.785  30.303 1.00 70.87  ? 213  TYR A CD1 1 
ATOM   1480 C  CD2 . TYR A 1  213 ? 67.160  75.118  31.958 1.00 82.10  ? 213  TYR A CD2 1 
ATOM   1481 C  CE1 . TYR A 1  213 ? 67.602  76.190  29.450 1.00 83.59  ? 213  TYR A CE1 1 
ATOM   1482 C  CE2 . TYR A 1  213 ? 68.074  74.513  31.123 1.00 77.38  ? 213  TYR A CE2 1 
ATOM   1483 C  CZ  . TYR A 1  213 ? 68.320  75.064  29.863 1.00 87.82  ? 213  TYR A CZ  1 
ATOM   1484 O  OH  . TYR A 1  213 ? 69.389  74.604  29.092 1.00 90.07  ? 213  TYR A OH  1 
ATOM   1485 N  N   . ALA A 1  214 ? 65.486  80.302  33.785 1.00 49.88  ? 214  ALA A N   1 
ATOM   1486 C  CA  . ALA A 1  214 ? 64.810  81.195  34.694 1.00 51.00  ? 214  ALA A CA  1 
ATOM   1487 C  C   . ALA A 1  214 ? 63.778  82.102  34.092 1.00 51.34  ? 214  ALA A C   1 
ATOM   1488 O  O   . ALA A 1  214 ? 64.046  82.843  33.164 1.00 54.08  ? 214  ALA A O   1 
ATOM   1489 C  CB  . ALA A 1  214 ? 65.848  82.030  35.457 1.00 50.53  ? 214  ALA A CB  1 
ATOM   1490 N  N   . ILE A 1  215 ? 62.590  82.043  34.682 1.00 52.35  ? 215  ILE A N   1 
ATOM   1491 C  CA  . ILE A 1  215 ? 61.418  82.877  34.346 1.00 51.25  ? 215  ILE A CA  1 
ATOM   1492 C  C   . ILE A 1  215 ? 60.861  83.558  35.624 1.00 50.33  ? 215  ILE A C   1 
ATOM   1493 O  O   . ILE A 1  215 ? 60.622  82.894  36.637 1.00 49.81  ? 215  ILE A O   1 
ATOM   1494 C  CB  . ILE A 1  215 ? 60.321  81.958  33.743 1.00 54.45  ? 215  ILE A CB  1 
ATOM   1495 C  CG1 . ILE A 1  215 ? 59.291  82.771  33.014 1.00 52.28  ? 215  ILE A CG1 1 
ATOM   1496 C  CG2 . ILE A 1  215 ? 59.761  81.025  34.823 1.00 53.48  ? 215  ILE A CG2 1 
ATOM   1497 C  CD1 . ILE A 1  215 ? 59.935  83.625  32.089 1.00 55.00  ? 215  ILE A CD1 1 
ATOM   1498 N  N   . ALA A 1  216 ? 60.757  84.892  35.603 1.00 50.23  ? 216  ALA A N   1 
ATOM   1499 C  CA  . ALA A 1  216 ? 60.144  85.711  36.699 1.00 45.50  ? 216  ALA A CA  1 
ATOM   1500 C  C   . ALA A 1  216 ? 58.869  86.420  36.272 1.00 44.98  ? 216  ALA A C   1 
ATOM   1501 O  O   . ALA A 1  216 ? 58.934  87.464  35.606 1.00 47.58  ? 216  ALA A O   1 
ATOM   1502 C  CB  . ALA A 1  216 ? 61.086  86.791  37.161 1.00 44.08  ? 216  ALA A CB  1 
ATOM   1503 N  N   . PRO A 1  217 ? 57.712  85.853  36.544 1.00 41.83  ? 217  PRO A N   1 
ATOM   1504 C  CA  . PRO A 1  217 ? 56.436  86.514  36.197 1.00 40.93  ? 217  PRO A CA  1 
ATOM   1505 C  C   . PRO A 1  217 ? 56.072  87.507  37.339 1.00 42.69  ? 217  PRO A C   1 
ATOM   1506 O  O   . PRO A 1  217 ? 56.133  87.127  38.500 1.00 43.09  ? 217  PRO A O   1 
ATOM   1507 C  CB  . PRO A 1  217 ? 55.398  85.380  36.134 1.00 39.86  ? 217  PRO A CB  1 
ATOM   1508 C  CG  . PRO A 1  217 ? 56.074  84.114  36.233 1.00 38.67  ? 217  PRO A CG  1 
ATOM   1509 C  CD  . PRO A 1  217 ? 57.613  84.395  36.492 1.00 43.39  ? 217  PRO A CD  1 
ATOM   1510 N  N   . ALA A 1  218 ? 55.713  88.754  37.001 1.00 43.87  ? 218  ALA A N   1 
ATOM   1511 C  CA  . ALA A 1  218 ? 55.321  89.849  37.944 1.00 45.67  ? 218  ALA A CA  1 
ATOM   1512 C  C   . ALA A 1  218 ? 54.068  90.522  37.427 1.00 49.56  ? 218  ALA A C   1 
ATOM   1513 O  O   . ALA A 1  218 ? 53.868  90.655  36.214 1.00 52.45  ? 218  ALA A O   1 
ATOM   1514 C  CB  . ALA A 1  218 ? 56.398  90.914  38.057 1.00 42.45  ? 218  ALA A CB  1 
ATOM   1515 N  N   . PHE A 1  219 ? 53.246  90.985  38.340 1.00 51.47  ? 219  PHE A N   1 
ATOM   1516 C  CA  . PHE A 1  219 ? 51.967  91.594  38.007 1.00 52.76  ? 219  PHE A CA  1 
ATOM   1517 C  C   . PHE A 1  219 ? 51.696  92.686  39.006 1.00 53.11  ? 219  PHE A C   1 
ATOM   1518 O  O   . PHE A 1  219 ? 51.790  92.422  40.215 1.00 53.80  ? 219  PHE A O   1 
ATOM   1519 C  CB  . PHE A 1  219 ? 50.905  90.555  38.140 1.00 54.13  ? 219  PHE A CB  1 
ATOM   1520 C  CG  . PHE A 1  219 ? 49.608  90.994  37.645 1.00 57.14  ? 219  PHE A CG  1 
ATOM   1521 C  CD1 . PHE A 1  219 ? 49.370  91.067  36.264 1.00 56.80  ? 219  PHE A CD1 1 
ATOM   1522 C  CD2 . PHE A 1  219 ? 48.650  91.491  38.533 1.00 56.05  ? 219  PHE A CD2 1 
ATOM   1523 C  CE1 . PHE A 1  219 ? 48.186  91.657  35.767 1.00 56.60  ? 219  PHE A CE1 1 
ATOM   1524 C  CE2 . PHE A 1  219 ? 47.478  92.081  38.034 1.00 57.65  ? 219  PHE A CE2 1 
ATOM   1525 C  CZ  . PHE A 1  219 ? 47.254  92.166  36.632 1.00 55.38  ? 219  PHE A CZ  1 
ATOM   1526 N  N   . THR A 1  220 ? 51.488  93.915  38.516 1.00 52.74  ? 220  THR A N   1 
ATOM   1527 C  CA  . THR A 1  220 ? 51.160  95.053  39.397 1.00 54.11  ? 220  THR A CA  1 
ATOM   1528 C  C   . THR A 1  220 ? 49.705  95.552  39.271 1.00 55.29  ? 220  THR A C   1 
ATOM   1529 O  O   . THR A 1  220 ? 49.157  95.691  38.183 1.00 55.07  ? 220  THR A O   1 
ATOM   1530 C  CB  . THR A 1  220 ? 51.940  96.343  39.154 1.00 54.01  ? 220  THR A CB  1 
ATOM   1531 O  OG1 . THR A 1  220 ? 53.299  96.192  39.529 1.00 54.34  ? 220  THR A OG1 1 
ATOM   1532 C  CG2 . THR A 1  220 ? 51.332  97.450  39.973 1.00 51.51  ? 220  THR A CG2 1 
ATOM   1533 N  N   . TRP A 1  221 ? 49.119  95.851  40.414 1.00 56.41  ? 221  TRP A N   1 
ATOM   1534 C  CA  . TRP A 1  221 ? 47.760  96.357  40.495 1.00 55.41  ? 221  TRP A CA  1 
ATOM   1535 C  C   . TRP A 1  221 ? 47.758  97.687  41.245 1.00 55.99  ? 221  TRP A C   1 
ATOM   1536 O  O   . TRP A 1  221 ? 47.931  97.676  42.477 1.00 66.68  ? 221  TRP A O   1 
ATOM   1537 C  CB  . TRP A 1  221 ? 46.951  95.396  41.289 1.00 57.20  ? 221  TRP A CB  1 
ATOM   1538 C  CG  . TRP A 1  221 ? 45.561  95.807  41.400 1.00 78.09  ? 221  TRP A CG  1 
ATOM   1539 C  CD1 . TRP A 1  221 ? 44.769  96.274  40.399 1.00 70.29  ? 221  TRP A CD1 1 
ATOM   1540 C  CD2 . TRP A 1  221 ? 44.712  95.615  42.529 1.00 75.16  ? 221  TRP A CD2 1 
ATOM   1541 N  NE1 . TRP A 1  221 ? 43.476  96.369  40.825 1.00 67.39  ? 221  TRP A NE1 1 
ATOM   1542 C  CE2 . TRP A 1  221 ? 43.411  95.975  42.119 1.00 72.47  ? 221  TRP A CE2 1 
ATOM   1543 C  CE3 . TRP A 1  221 ? 44.924  95.168  43.831 1.00 76.54  ? 221  TRP A CE3 1 
ATOM   1544 C  CZ2 . TRP A 1  221 ? 42.323  95.896  42.984 1.00 71.24  ? 221  TRP A CZ2 1 
ATOM   1545 C  CZ3 . TRP A 1  221 ? 43.837  95.093  44.686 1.00 69.80  ? 221  TRP A CZ3 1 
ATOM   1546 C  CH2 . TRP A 1  221 ? 42.550  95.455  44.252 1.00 73.91  ? 221  TRP A CH2 1 
ATOM   1547 N  N   . ARG A 1  222 ? 47.663  98.815  40.534 1.00 54.86  ? 222  ARG A N   1 
ATOM   1548 C  CA  . ARG A 1  222 ? 47.560  100.139 41.172 1.00 54.98  ? 222  ARG A CA  1 
ATOM   1549 C  C   . ARG A 1  222 ? 46.079  100.573 40.938 1.00 56.74  ? 222  ARG A C   1 
ATOM   1550 O  O   . ARG A 1  222 ? 45.810  101.193 39.916 1.00 59.23  ? 222  ARG A O   1 
ATOM   1551 C  CB  . ARG A 1  222 ? 48.415  101.183 40.476 1.00 54.88  ? 222  ARG A CB  1 
ATOM   1552 C  CG  . ARG A 1  222 ? 49.885  100.951 40.464 1.00 63.83  ? 222  ARG A CG  1 
ATOM   1553 C  CD  . ARG A 1  222 ? 50.733  102.194 40.842 1.00 67.72  ? 222  ARG A CD  1 
ATOM   1554 N  NE  . ARG A 1  222 ? 52.140  101.920 40.576 1.00 68.59  ? 222  ARG A NE  1 
ATOM   1555 C  CZ  . ARG A 1  222 ? 52.567  101.522 39.369 1.00 84.01  ? 222  ARG A CZ  1 
ATOM   1556 N  NH1 . ARG A 1  222 ? 51.689  101.390 38.370 1.00 93.47  ? 222  ARG A NH1 1 
ATOM   1557 N  NH2 . ARG A 1  222 ? 53.841  101.193 39.136 1.00 74.93  ? 222  ARG A NH2 1 
ATOM   1558 N  N   . PRO A 1  223 ? 45.116  100.255 41.864 1.00 56.44  ? 223  PRO A N   1 
ATOM   1559 C  CA  . PRO A 1  223 ? 43.698  100.621 41.704 1.00 56.65  ? 223  PRO A CA  1 
ATOM   1560 C  C   . PRO A 1  223 ? 43.494  102.110 41.677 1.00 64.06  ? 223  PRO A C   1 
ATOM   1561 O  O   . PRO A 1  223 ? 42.456  102.573 41.232 1.00 59.98  ? 223  PRO A O   1 
ATOM   1562 C  CB  . PRO A 1  223 ? 42.990  100.030 42.945 1.00 56.85  ? 223  PRO A CB  1 
ATOM   1563 C  CG  . PRO A 1  223 ? 44.050  99.383  43.757 1.00 56.94  ? 223  PRO A CG  1 
ATOM   1564 C  CD  . PRO A 1  223 ? 45.387  99.878  43.270 1.00 56.04  ? 223  PRO A CD  1 
ATOM   1565 N  N   . ASP A 1  224 ? 44.509  102.814 42.171 1.00 65.83  ? 224  ASP A N   1 
ATOM   1566 C  CA  . ASP A 1  224 ? 44.560  104.252 42.291 1.00 69.54  ? 224  ASP A CA  1 
ATOM   1567 C  C   . ASP A 1  224 ? 45.984  104.604 42.676 1.00 71.22  ? 224  ASP A C   1 
ATOM   1568 O  O   . ASP A 1  224 ? 46.812  103.729 42.789 1.00 77.14  ? 224  ASP A O   1 
ATOM   1569 C  CB  . ASP A 1  224 ? 43.704  104.678 43.449 1.00 71.96  ? 224  ASP A CB  1 
ATOM   1570 C  CG  . ASP A 1  224 ? 44.199  104.103 44.766 1.00 69.83  ? 224  ASP A CG  1 
ATOM   1571 O  OD1 . ASP A 1  224 ? 45.405  104.186 45.091 1.00 79.96  ? 224  ASP A OD1 1 
ATOM   1572 O  OD2 . ASP A 1  224 ? 43.362  103.568 45.498 1.00 79.67  ? 224  ASP A OD2 1 
ATOM   1573 N  N   . ASP A 1  225 ? 46.242  105.871 42.992 1.00 70.51  ? 225  ASP A N   1 
ATOM   1574 C  CA  . ASP A 1  225 ? 47.585  106.289 43.364 1.00 64.96  ? 225  ASP A CA  1 
ATOM   1575 C  C   . ASP A 1  225 ? 48.023  106.308 44.821 1.00 65.63  ? 225  ASP A C   1 
ATOM   1576 O  O   . ASP A 1  225 ? 49.008  106.966 45.150 1.00 65.74  ? 225  ASP A O   1 
ATOM   1577 C  CB  . ASP A 1  225 ? 47.924  107.663 42.770 1.00 67.93  ? 225  ASP A CB  1 
ATOM   1578 C  CG  . ASP A 1  225 ? 47.109  108.835 43.398 1.00 85.18  ? 225  ASP A CG  1 
ATOM   1579 O  OD1 . ASP A 1  225 ? 46.547  108.740 44.538 1.00 82.19  ? 225  ASP A OD1 1 
ATOM   1580 O  OD2 . ASP A 1  225 ? 47.057  109.897 42.724 1.00 90.45  ? 225  ASP A OD2 1 
ATOM   1581 N  N   . LYS A 1  226 ? 47.328  105.646 45.718 1.00 64.17  ? 226  LYS A N   1 
ATOM   1582 C  CA  . LYS A 1  226 ? 47.834  105.621 47.089 1.00 67.59  ? 226  LYS A CA  1 
ATOM   1583 C  C   . LYS A 1  226 ? 47.943  104.090 47.391 1.00 71.45  ? 226  LYS A C   1 
ATOM   1584 O  O   . LYS A 1  226 ? 48.205  103.664 48.525 1.00 70.69  ? 226  LYS A O   1 
ATOM   1585 C  CB  . LYS A 1  226 ? 46.858  106.369 48.057 1.00 76.90  ? 226  LYS A CB  1 
ATOM   1586 C  CG  . LYS A 1  226 ? 46.843  107.947 47.944 1.00 79.81  ? 226  LYS A CG  1 
ATOM   1587 C  CD  . LYS A 1  226 ? 45.612  108.631 48.627 1.00 80.45  ? 226  LYS A CD  1 
ATOM   1588 C  CE  . LYS A 1  226 ? 44.658  109.398 47.643 1.00 85.48  ? 226  LYS A CE  1 
ATOM   1589 N  NZ  . LYS A 1  226 ? 43.796  108.616 46.624 1.00 72.64  ? 226  LYS A NZ  1 
ATOM   1590 N  N   . THR A 1  227 ? 47.772  103.291 46.335 1.00 63.45  ? 227  THR A N   1 
ATOM   1591 C  CA  . THR A 1  227 ? 47.773  101.866 46.448 1.00 64.50  ? 227  THR A CA  1 
ATOM   1592 C  C   . THR A 1  227 ? 48.574  101.087 45.391 1.00 67.89  ? 227  THR A C   1 
ATOM   1593 O  O   . THR A 1  227 ? 48.521  101.390 44.191 1.00 61.81  ? 227  THR A O   1 
ATOM   1594 C  CB  . THR A 1  227 ? 46.304  101.369 46.504 1.00 66.74  ? 227  THR A CB  1 
ATOM   1595 O  OG1 . THR A 1  227 ? 45.686  101.872 47.700 1.00 76.01  ? 227  THR A OG1 1 
ATOM   1596 C  CG2 . THR A 1  227 ? 46.237  99.846  46.581 1.00 58.58  ? 227  THR A CG2 1 
ATOM   1597 N  N   . ASN A 1  228 ? 49.343  100.097 45.864 1.00 60.17  ? 228  ASN A N   1 
ATOM   1598 C  CA  . ASN A 1  228 ? 50.122  99.256  44.978 1.00 59.75  ? 228  ASN A CA  1 
ATOM   1599 C  C   . ASN A 1  228 ? 50.316  97.808  45.450 1.00 57.55  ? 228  ASN A C   1 
ATOM   1600 O  O   . ASN A 1  228 ? 50.919  97.542  46.511 1.00 57.41  ? 228  ASN A O   1 
ATOM   1601 C  CB  . ASN A 1  228 ? 51.500  99.842  44.741 1.00 57.61  ? 228  ASN A CB  1 
ATOM   1602 C  CG  . ASN A 1  228 ? 52.340  98.973  43.783 1.00 67.36  ? 228  ASN A CG  1 
ATOM   1603 O  OD1 . ASN A 1  228 ? 52.323  97.765  43.875 1.00 87.47  ? 228  ASN A OD1 1 
ATOM   1604 N  ND2 . ASN A 1  228 ? 53.068  99.588  42.886 1.00 62.01  ? 228  ASN A ND2 1 
ATOM   1605 N  N   . PHE A 1  229 ? 49.817  96.861  44.669 1.00 56.28  ? 229  PHE A N   1 
ATOM   1606 C  CA  . PHE A 1  229 ? 50.040  95.455  45.017 1.00 55.75  ? 229  PHE A CA  1 
ATOM   1607 C  C   . PHE A 1  229 ? 50.783  94.816  43.861 1.00 56.01  ? 229  PHE A C   1 
ATOM   1608 O  O   . PHE A 1  229 ? 50.189  94.623  42.771 1.00 68.08  ? 229  PHE A O   1 
ATOM   1609 C  CB  . PHE A 1  229 ? 48.740  94.686  45.198 1.00 55.08  ? 229  PHE A CB  1 
ATOM   1610 C  CG  . PHE A 1  229 ? 48.915  93.202  45.414 1.00 53.14  ? 229  PHE A CG  1 
ATOM   1611 C  CD1 . PHE A 1  229 ? 49.024  92.693  46.676 1.00 52.15  ? 229  PHE A CD1 1 
ATOM   1612 C  CD2 . PHE A 1  229 ? 48.894  92.331  44.356 1.00 51.26  ? 229  PHE A CD2 1 
ATOM   1613 C  CE1 . PHE A 1  229 ? 49.093  91.334  46.885 1.00 52.32  ? 229  PHE A CE1 1 
ATOM   1614 C  CE2 . PHE A 1  229 ? 48.967  90.945  44.544 1.00 50.61  ? 229  PHE A CE2 1 
ATOM   1615 C  CZ  . PHE A 1  229 ? 49.070  90.444  45.806 1.00 50.94  ? 229  PHE A CZ  1 
ATOM   1616 N  N   . THR A 1  230 ? 52.071  94.511  44.066 1.00 53.96  ? 230  THR A N   1 
ATOM   1617 C  CA  . THR A 1  230 ? 52.802  93.851  43.020 1.00 52.26  ? 230  THR A CA  1 
ATOM   1618 C  C   . THR A 1  230 ? 53.106  92.410  43.363 1.00 51.77  ? 230  THR A C   1 
ATOM   1619 O  O   . THR A 1  230 ? 53.765  92.159  44.315 1.00 50.82  ? 230  THR A O   1 
ATOM   1620 C  CB  . THR A 1  230 ? 54.101  94.562  42.708 1.00 52.25  ? 230  THR A CB  1 
ATOM   1621 O  OG1 . THR A 1  230 ? 53.807  95.929  42.340 1.00 49.56  ? 230  THR A OG1 1 
ATOM   1622 C  CG2 . THR A 1  230 ? 54.839  93.813  41.546 1.00 49.03  ? 230  THR A CG2 1 
ATOM   1623 N  N   . PHE A 1  231 ? 52.618  91.485  42.548 1.00 51.41  ? 231  PHE A N   1 
ATOM   1624 C  CA  . PHE A 1  231 ? 52.882  90.067  42.717 1.00 52.37  ? 231  PHE A CA  1 
ATOM   1625 C  C   . PHE A 1  231 ? 54.236  89.751  42.075 1.00 52.43  ? 231  PHE A C   1 
ATOM   1626 O  O   . PHE A 1  231 ? 54.486  89.995  40.892 1.00 51.81  ? 231  PHE A O   1 
ATOM   1627 C  CB  . PHE A 1  231 ? 51.835  89.254  42.013 1.00 52.24  ? 231  PHE A CB  1 
ATOM   1628 C  CG  . PHE A 1  231 ? 52.234  87.833  41.726 1.00 50.93  ? 231  PHE A CG  1 
ATOM   1629 C  CD1 . PHE A 1  231 ? 52.136  86.857  42.688 1.00 50.45  ? 231  PHE A CD1 1 
ATOM   1630 C  CD2 . PHE A 1  231 ? 52.493  87.428  40.408 1.00 51.90  ? 231  PHE A CD2 1 
ATOM   1631 C  CE1 . PHE A 1  231 ? 52.254  85.473  42.350 1.00 50.20  ? 231  PHE A CE1 1 
ATOM   1632 C  CE2 . PHE A 1  231 ? 52.612  86.070  40.067 1.00 49.11  ? 231  PHE A CE2 1 
ATOM   1633 C  CZ  . PHE A 1  231 ? 52.480  85.092  41.058 1.00 50.21  ? 231  PHE A CZ  1 
ATOM   1634 N  N   . LEU A 1  232 ? 55.100  89.194  42.896 1.00 51.64  ? 232  LEU A N   1 
ATOM   1635 C  CA  . LEU A 1  232 ? 56.438  88.854  42.451 1.00 49.92  ? 232  LEU A CA  1 
ATOM   1636 C  C   . LEU A 1  232 ? 56.712  87.329  42.448 1.00 49.05  ? 232  LEU A C   1 
ATOM   1637 O  O   . LEU A 1  232 ? 56.592  86.679  43.485 1.00 48.89  ? 232  LEU A O   1 
ATOM   1638 C  CB  . LEU A 1  232 ? 57.426  89.579  43.369 1.00 45.49  ? 232  LEU A CB  1 
ATOM   1639 C  CG  . LEU A 1  232 ? 57.302  91.068  43.397 1.00 42.92  ? 232  LEU A CG  1 
ATOM   1640 C  CD1 . LEU A 1  232 ? 58.050  91.624  44.554 1.00 40.90  ? 232  LEU A CD1 1 
ATOM   1641 C  CD2 . LEU A 1  232 ? 57.862  91.622  42.050 1.00 41.43  ? 232  LEU A CD2 1 
ATOM   1642 N  N   . SER A 1  233 ? 57.069  86.762  41.307 1.00 48.11  ? 233  SER A N   1 
ATOM   1643 C  CA  . SER A 1  233 ? 57.378  85.348  41.333 1.00 50.25  ? 233  SER A CA  1 
ATOM   1644 C  C   . SER A 1  233 ? 58.706  85.051  40.636 1.00 50.03  ? 233  SER A C   1 
ATOM   1645 O  O   . SER A 1  233 ? 59.150  85.820  39.805 1.00 48.52  ? 233  SER A O   1 
ATOM   1646 C  CB  . SER A 1  233 ? 56.260  84.507  40.706 1.00 52.97  ? 233  SER A CB  1 
ATOM   1647 O  OG  . SER A 1  233 ? 56.117  84.756  39.287 1.00 54.93  ? 233  SER A OG  1 
ATOM   1648 N  N   . TYR A 1  234 ? 59.358  83.946  41.031 1.00 49.26  ? 234  TYR A N   1 
ATOM   1649 C  CA  . TYR A 1  234 ? 60.618  83.532  40.400 1.00 48.68  ? 234  TYR A CA  1 
ATOM   1650 C  C   . TYR A 1  234 ? 60.745  82.013  40.337 1.00 49.71  ? 234  TYR A C   1 
ATOM   1651 O  O   . TYR A 1  234 ? 60.505  81.303  41.308 1.00 51.09  ? 234  TYR A O   1 
ATOM   1652 C  CB  . TYR A 1  234 ? 61.754  84.126  41.149 1.00 48.53  ? 234  TYR A CB  1 
ATOM   1653 C  CG  . TYR A 1  234 ? 63.065  84.003  40.495 1.00 48.23  ? 234  TYR A CG  1 
ATOM   1654 C  CD1 . TYR A 1  234 ? 63.435  84.848  39.486 1.00 47.36  ? 234  TYR A CD1 1 
ATOM   1655 C  CD2 . TYR A 1  234 ? 64.001  83.053  40.956 1.00 48.37  ? 234  TYR A CD2 1 
ATOM   1656 C  CE1 . TYR A 1  234 ? 64.752  84.776  38.940 1.00 48.12  ? 234  TYR A CE1 1 
ATOM   1657 C  CE2 . TYR A 1  234 ? 65.312  82.983  40.419 1.00 47.36  ? 234  TYR A CE2 1 
ATOM   1658 C  CZ  . TYR A 1  234 ? 65.692  83.851  39.431 1.00 46.33  ? 234  TYR A CZ  1 
ATOM   1659 O  OH  . TYR A 1  234 ? 67.023  83.890  39.057 1.00 43.35  ? 234  TYR A OH  1 
ATOM   1660 N  N   . PHE A 1  235 ? 61.045  81.490  39.158 1.00 50.24  ? 235  PHE A N   1 
ATOM   1661 C  CA  . PHE A 1  235 ? 61.190  80.027  39.014 1.00 50.62  ? 235  PHE A CA  1 
ATOM   1662 C  C   . PHE A 1  235 ? 62.485  79.774  38.308 1.00 49.86  ? 235  PHE A C   1 
ATOM   1663 O  O   . PHE A 1  235 ? 62.720  80.339  37.252 1.00 48.88  ? 235  PHE A O   1 
ATOM   1664 C  CB  . PHE A 1  235 ? 60.048  79.467  38.188 1.00 50.51  ? 235  PHE A CB  1 
ATOM   1665 C  CG  . PHE A 1  235 ? 58.734  79.788  38.752 1.00 51.60  ? 235  PHE A CG  1 
ATOM   1666 C  CD1 . PHE A 1  235 ? 58.158  78.968  39.719 1.00 52.16  ? 235  PHE A CD1 1 
ATOM   1667 C  CD2 . PHE A 1  235 ? 58.101  80.960  38.409 1.00 48.73  ? 235  PHE A CD2 1 
ATOM   1668 C  CE1 . PHE A 1  235 ? 56.930  79.329  40.337 1.00 51.53  ? 235  PHE A CE1 1 
ATOM   1669 C  CE2 . PHE A 1  235 ? 56.939  81.309  38.996 1.00 51.14  ? 235  PHE A CE2 1 
ATOM   1670 C  CZ  . PHE A 1  235 ? 56.334  80.480  39.985 1.00 50.21  ? 235  PHE A CZ  1 
ATOM   1671 N  N   . GLN A 1  236 ? 63.355  78.959  38.904 1.00 50.03  ? 236  GLN A N   1 
ATOM   1672 C  CA  . GLN A 1  236 ? 64.647  78.676  38.271 1.00 48.24  ? 236  GLN A CA  1 
ATOM   1673 C  C   . GLN A 1  236 ? 64.998  77.203  38.423 1.00 49.29  ? 236  GLN A C   1 
ATOM   1674 O  O   . GLN A 1  236 ? 64.772  76.598  39.452 1.00 48.50  ? 236  GLN A O   1 
ATOM   1675 C  CB  . GLN A 1  236 ? 65.710  79.568  38.887 1.00 44.82  ? 236  GLN A CB  1 
ATOM   1676 C  CG  . GLN A 1  236 ? 67.125  79.414  38.445 1.00 42.14  ? 236  GLN A CG  1 
ATOM   1677 C  CD  . GLN A 1  236 ? 67.997  80.468  39.110 1.00 44.41  ? 236  GLN A CD  1 
ATOM   1678 O  OE1 . GLN A 1  236 ? 68.018  81.612  38.665 1.00 47.14  ? 236  GLN A OE1 1 
ATOM   1679 N  NE2 . GLN A 1  236 ? 68.680  80.115  40.214 1.00 40.41  ? 236  GLN A NE2 1 
ATOM   1680 N  N   . ASN A 1  237 ? 65.429  76.638  37.305 1.00 51.56  ? 237  ASN A N   1 
ATOM   1681 C  CA  . ASN A 1  237 ? 65.927  75.283  37.219 1.00 52.47  ? 237  ASN A CA  1 
ATOM   1682 C  C   . ASN A 1  237 ? 67.423  75.282  36.694 1.00 52.99  ? 237  ASN A C   1 
ATOM   1683 O  O   . ASN A 1  237 ? 67.805  75.956  35.719 1.00 54.52  ? 237  ASN A O   1 
ATOM   1684 C  CB  . ASN A 1  237 ? 65.049  74.439  36.332 1.00 51.24  ? 237  ASN A CB  1 
ATOM   1685 C  CG  . ASN A 1  237 ? 65.570  73.000  36.230 1.00 75.16  ? 237  ASN A CG  1 
ATOM   1686 O  OD1 . ASN A 1  237 ? 65.732  72.325  37.244 1.00 64.19  ? 237  ASN A OD1 1 
ATOM   1687 N  ND2 . ASN A 1  237 ? 65.849  72.536  35.009 1.00 71.20  ? 237  ASN A ND2 1 
ATOM   1688 N  N   . GLU A 1  238 ? 68.268  74.576  37.423 1.00 53.27  ? 238  GLU A N   1 
ATOM   1689 C  CA  . GLU A 1  238 ? 69.678  74.488  37.114 1.00 53.56  ? 238  GLU A CA  1 
ATOM   1690 C  C   . GLU A 1  238 ? 70.088  73.042  37.344 1.00 55.06  ? 238  GLU A C   1 
ATOM   1691 O  O   . GLU A 1  238 ? 70.299  72.614  38.492 1.00 57.28  ? 238  GLU A O   1 
ATOM   1692 C  CB  . GLU A 1  238 ? 70.499  75.372  38.038 1.00 52.25  ? 238  GLU A CB  1 
ATOM   1693 C  CG  . GLU A 1  238 ? 70.284  76.889  38.019 1.00 49.65  ? 238  GLU A CG  1 
ATOM   1694 C  CD  . GLU A 1  238 ? 71.031  77.573  39.196 1.00 49.95  ? 238  GLU A CD  1 
ATOM   1695 O  OE1 . GLU A 1  238 ? 70.583  77.553  40.351 1.00 50.52  ? 238  GLU A OE1 1 
ATOM   1696 O  OE2 . GLU A 1  238 ? 72.081  78.127  38.981 1.00 49.41  ? 238  GLU A OE2 1 
ATOM   1697 N  N   . PRO A 1  239 ? 70.146  72.259  36.248 1.00 56.31  ? 239  PRO A N   1 
ATOM   1698 C  CA  . PRO A 1  239 ? 70.495  70.837  36.052 1.00 55.95  ? 239  PRO A CA  1 
ATOM   1699 C  C   . PRO A 1  239 ? 71.947  70.728  36.492 1.00 56.21  ? 239  PRO A C   1 
ATOM   1700 O  O   . PRO A 1  239 ? 72.273  69.924  37.342 1.00 56.80  ? 239  PRO A O   1 
ATOM   1701 C  CB  . PRO A 1  239 ? 70.348  70.662  34.537 1.00 56.15  ? 239  PRO A CB  1 
ATOM   1702 C  CG  . PRO A 1  239 ? 69.328  71.729  34.149 1.00 53.92  ? 239  PRO A CG  1 
ATOM   1703 C  CD  . PRO A 1  239 ? 69.857  72.893  34.939 1.00 55.83  ? 239  PRO A CD  1 
ATOM   1704 N  N   . GLU A 1  240 ? 72.781  71.601  35.922 1.00 55.34  ? 240  GLU A N   1 
ATOM   1705 C  CA  . GLU A 1  240 ? 74.173  71.710  36.295 1.00 53.87  ? 240  GLU A CA  1 
ATOM   1706 C  C   . GLU A 1  240 ? 74.611  73.137  36.756 1.00 52.68  ? 240  GLU A C   1 
ATOM   1707 O  O   . GLU A 1  240 ? 74.525  74.124  36.052 1.00 53.03  ? 240  GLU A O   1 
ATOM   1708 C  CB  . GLU A 1  240 ? 75.100  71.194  35.148 1.00 55.07  ? 240  GLU A CB  1 
ATOM   1709 C  CG  . GLU A 1  240 ? 75.085  69.641  34.877 1.00 54.28  ? 240  GLU A CG  1 
ATOM   1710 C  CD  . GLU A 1  240 ? 75.334  68.725  36.141 1.00 55.40  ? 240  GLU A CD  1 
ATOM   1711 O  OE1 . GLU A 1  240 ? 75.988  69.223  37.100 1.00 58.50  ? 240  GLU A OE1 1 
ATOM   1712 O  OE2 . GLU A 1  240 ? 74.921  67.491  36.161 1.00 52.80  ? 240  GLU A OE2 1 
ATOM   1713 N  N   . THR A 1  241 ? 75.152  73.197  37.958 1.00 52.88  ? 241  THR A N   1 
ATOM   1714 C  CA  . THR A 1  241 ? 75.639  74.409  38.636 1.00 50.94  ? 241  THR A CA  1 
ATOM   1715 C  C   . THR A 1  241 ? 77.136  74.711  38.474 1.00 49.46  ? 241  THR A C   1 
ATOM   1716 O  O   . THR A 1  241 ? 77.605  75.851  38.694 1.00 48.01  ? 241  THR A O   1 
ATOM   1717 C  CB  . THR A 1  241 ? 75.371  74.247  40.103 1.00 53.29  ? 241  THR A CB  1 
ATOM   1718 O  OG1 . THR A 1  241 ? 73.993  74.555  40.349 1.00 53.46  ? 241  THR A OG1 1 
ATOM   1719 C  CG2 . THR A 1  241 ? 76.246  75.182  40.875 1.00 55.58  ? 241  THR A CG2 1 
ATOM   1720 N  N   . GLY A 1  242 ? 77.886  73.655  38.136 1.00 49.39  ? 242  GLY A N   1 
ATOM   1721 C  CA  . GLY A 1  242 ? 79.338  73.742  37.913 1.00 48.79  ? 242  GLY A CA  1 
ATOM   1722 C  C   . GLY A 1  242 ? 80.314  73.389  39.022 1.00 47.91  ? 242  GLY A C   1 
ATOM   1723 O  O   . GLY A 1  242 ? 80.026  72.781  39.995 1.00 47.09  ? 242  GLY A O   1 
ATOM   1724 N  N   . TYR A 1  243 ? 81.515  73.817  38.843 1.00 48.64  ? 243  TYR A N   1 
ATOM   1725 C  CA  . TYR A 1  243 ? 82.541  73.560  39.806 1.00 49.03  ? 243  TYR A CA  1 
ATOM   1726 C  C   . TYR A 1  243 ? 82.331  74.160  41.218 1.00 49.00  ? 243  TYR A C   1 
ATOM   1727 O  O   . TYR A 1  243 ? 82.017  75.311  41.403 1.00 48.55  ? 243  TYR A O   1 
ATOM   1728 C  CB  . TYR A 1  243 ? 83.839  74.099  39.217 1.00 45.97  ? 243  TYR A CB  1 
ATOM   1729 C  CG  . TYR A 1  243 ? 85.003  73.766  40.091 1.00 49.32  ? 243  TYR A CG  1 
ATOM   1730 C  CD1 . TYR A 1  243 ? 85.458  72.470  40.197 1.00 47.86  ? 243  TYR A CD1 1 
ATOM   1731 C  CD2 . TYR A 1  243 ? 85.624  74.753  40.855 1.00 50.20  ? 243  TYR A CD2 1 
ATOM   1732 C  CE1 . TYR A 1  243 ? 86.481  72.160  41.014 1.00 48.73  ? 243  TYR A CE1 1 
ATOM   1733 C  CE2 . TYR A 1  243 ? 86.653  74.440  41.725 1.00 50.23  ? 243  TYR A CE2 1 
ATOM   1734 C  CZ  . TYR A 1  243 ? 87.093  73.135  41.797 1.00 47.77  ? 243  TYR A CZ  1 
ATOM   1735 O  OH  . TYR A 1  243 ? 88.196  72.847  42.603 1.00 44.41  ? 243  TYR A OH  1 
ATOM   1736 N  N   . TYR A 1  244 ? 82.605  73.394  42.239 1.00 50.85  ? 244  TYR A N   1 
ATOM   1737 C  CA  . TYR A 1  244 ? 82.533  73.925  43.615 1.00 50.25  ? 244  TYR A CA  1 
ATOM   1738 C  C   . TYR A 1  244 ? 83.597  73.138  44.477 1.00 50.71  ? 244  TYR A C   1 
ATOM   1739 O  O   . TYR A 1  244 ? 83.379  72.877  45.666 1.00 51.20  ? 244  TYR A O   1 
ATOM   1740 C  CB  . TYR A 1  244 ? 81.110  73.697  44.118 1.00 48.28  ? 244  TYR A CB  1 
ATOM   1741 C  CG  . TYR A 1  244 ? 80.783  74.494  45.335 1.00 45.43  ? 244  TYR A CG  1 
ATOM   1742 C  CD1 . TYR A 1  244 ? 80.882  75.885  45.311 1.00 45.00  ? 244  TYR A CD1 1 
ATOM   1743 C  CD2 . TYR A 1  244 ? 80.452  73.866  46.516 1.00 43.18  ? 244  TYR A CD2 1 
ATOM   1744 C  CE1 . TYR A 1  244 ? 80.679  76.635  46.422 1.00 45.63  ? 244  TYR A CE1 1 
ATOM   1745 C  CE2 . TYR A 1  244 ? 80.259  74.588  47.635 1.00 44.56  ? 244  TYR A CE2 1 
ATOM   1746 C  CZ  . TYR A 1  244 ? 80.371  75.987  47.609 1.00 45.42  ? 244  TYR A CZ  1 
ATOM   1747 O  OH  . TYR A 1  244 ? 80.158  76.715  48.753 1.00 44.29  ? 244  TYR A OH  1 
ATOM   1748 N  N   . GLY A 1  245 ? 84.743  72.831  43.845 1.00 50.33  ? 245  GLY A N   1 
ATOM   1749 C  CA  . GLY A 1  245 ? 85.748  71.983  44.419 1.00 48.24  ? 245  GLY A CA  1 
ATOM   1750 C  C   . GLY A 1  245 ? 86.774  72.666  45.244 1.00 48.34  ? 245  GLY A C   1 
ATOM   1751 O  O   . GLY A 1  245 ? 86.770  73.908  45.319 1.00 47.32  ? 245  GLY A O   1 
ATOM   1752 N  N   . TRP A 1  246 ? 87.705  71.857  45.799 1.00 48.80  ? 246  TRP A N   1 
ATOM   1753 C  CA  . TRP A 1  246 ? 88.749  72.372  46.706 1.00 48.55  ? 246  TRP A CA  1 
ATOM   1754 C  C   . TRP A 1  246 ? 90.122  72.041  46.253 1.00 48.01  ? 246  TRP A C   1 
ATOM   1755 O  O   . TRP A 1  246 ? 90.377  70.915  45.929 1.00 49.71  ? 246  TRP A O   1 
ATOM   1756 C  CB  . TRP A 1  246 ? 88.606  71.798  48.136 1.00 48.37  ? 246  TRP A CB  1 
ATOM   1757 C  CG  . TRP A 1  246 ? 87.430  72.292  48.975 1.00 51.57  ? 246  TRP A CG  1 
ATOM   1758 C  CD1 . TRP A 1  246 ? 86.550  73.241  48.634 1.00 49.30  ? 246  TRP A CD1 1 
ATOM   1759 C  CD2 . TRP A 1  246 ? 87.058  71.848  50.319 1.00 52.70  ? 246  TRP A CD2 1 
ATOM   1760 N  NE1 . TRP A 1  246 ? 85.665  73.429  49.656 1.00 52.09  ? 246  TRP A NE1 1 
ATOM   1761 C  CE2 . TRP A 1  246 ? 85.940  72.601  50.688 1.00 50.83  ? 246  TRP A CE2 1 
ATOM   1762 C  CE3 . TRP A 1  246 ? 87.570  70.902  51.212 1.00 53.32  ? 246  TRP A CE3 1 
ATOM   1763 C  CZ2 . TRP A 1  246 ? 85.295  72.424  51.905 1.00 51.10  ? 246  TRP A CZ2 1 
ATOM   1764 C  CZ3 . TRP A 1  246 ? 86.913  70.729  52.440 1.00 53.78  ? 246  TRP A CZ3 1 
ATOM   1765 C  CH2 . TRP A 1  246 ? 85.783  71.505  52.766 1.00 52.01  ? 246  TRP A CH2 1 
ATOM   1766 N  N   . LEU A 1  247 ? 91.036  73.000  46.224 1.00 49.04  ? 247  LEU A N   1 
ATOM   1767 C  CA  . LEU A 1  247 ? 92.414  72.665  45.808 1.00 48.00  ? 247  LEU A CA  1 
ATOM   1768 C  C   . LEU A 1  247 ? 93.429  72.950  46.903 1.00 49.44  ? 247  LEU A C   1 
ATOM   1769 O  O   . LEU A 1  247 ? 93.259  73.900  47.673 1.00 49.27  ? 247  LEU A O   1 
ATOM   1770 C  CB  . LEU A 1  247 ? 92.800  73.437  44.561 1.00 42.66  ? 247  LEU A CB  1 
ATOM   1771 C  CG  . LEU A 1  247 ? 92.074  72.900  43.329 1.00 42.13  ? 247  LEU A CG  1 
ATOM   1772 C  CD1 . LEU A 1  247 ? 92.793  73.546  42.081 1.00 40.11  ? 247  LEU A CD1 1 
ATOM   1773 C  CD2 . LEU A 1  247 ? 92.061  71.404  43.294 1.00 34.07  ? 247  LEU A CD2 1 
ATOM   1774 N  N   . PRO A 1  248 ? 94.522  72.155  46.959 1.00 52.03  ? 248  PRO A N   1 
ATOM   1775 C  CA  . PRO A 1  248 ? 95.585  72.288  47.951 1.00 52.55  ? 248  PRO A CA  1 
ATOM   1776 C  C   . PRO A 1  248 ? 96.368  73.554  47.691 1.00 54.19  ? 248  PRO A C   1 
ATOM   1777 O  O   . PRO A 1  248 ? 96.413  74.058  46.552 1.00 53.51  ? 248  PRO A O   1 
ATOM   1778 C  CB  . PRO A 1  248 ? 96.398  71.037  47.702 1.00 52.75  ? 248  PRO A CB  1 
ATOM   1779 C  CG  . PRO A 1  248 ? 96.365  70.966  46.277 1.00 54.00  ? 248  PRO A CG  1 
ATOM   1780 C  CD  . PRO A 1  248 ? 94.910  71.119  45.984 1.00 53.20  ? 248  PRO A CD  1 
ATOM   1781 N  N   . LYS A 1  249 ? 96.949  74.112  48.743 1.00 54.68  ? 249  LYS A N   1 
ATOM   1782 C  CA  . LYS A 1  249 ? 97.735  75.301  48.495 1.00 55.64  ? 249  LYS A CA  1 
ATOM   1783 C  C   . LYS A 1  249 ? 98.940  74.826  47.709 1.00 55.79  ? 249  LYS A C   1 
ATOM   1784 O  O   . LYS A 1  249 ? 99.666  75.641  47.116 1.00 59.48  ? 249  LYS A O   1 
ATOM   1785 C  CB  . LYS A 1  249 ? 98.175  76.004  49.791 1.00 55.90  ? 249  LYS A CB  1 
ATOM   1786 C  CG  . LYS A 1  249 ? 99.276  75.371  50.482 1.00 54.34  ? 249  LYS A CG  1 
ATOM   1787 C  CD  . LYS A 1  249 ? 99.199  75.706  51.957 1.00 61.63  ? 249  LYS A CD  1 
ATOM   1788 C  CE  . LYS A 1  249 ? 100.519 75.395  52.722 1.00 58.24  ? 249  LYS A CE  1 
ATOM   1789 N  NZ  . LYS A 1  249 ? 101.368 74.216  52.274 1.00 67.90  ? 249  LYS A NZ  1 
ATOM   1790 N  N   . GLU A 1  250 ? 99.151  73.505  47.712 1.00 69.38  ? 250  GLU A N   1 
ATOM   1791 C  CA  . GLU A 1  250 ? 100.286 72.868  47.016 1.00 64.60  ? 250  GLU A CA  1 
ATOM   1792 C  C   . GLU A 1  250 ? 99.892  72.556  45.586 1.00 66.40  ? 250  GLU A C   1 
ATOM   1793 O  O   . GLU A 1  250 ? 99.262  71.524  45.323 1.00 59.61  ? 250  GLU A O   1 
ATOM   1794 C  CB  . GLU A 1  250 ? 100.711 71.555  47.720 1.00 71.23  ? 250  GLU A CB  1 
ATOM   1795 C  CG  . GLU A 1  250 ? 101.453 71.697  49.059 1.00 70.00  ? 250  GLU A CG  1 
ATOM   1796 C  CD  . GLU A 1  250 ? 100.516 71.925  50.225 1.00 74.17  ? 250  GLU A CD  1 
ATOM   1797 O  OE1 . GLU A 1  250 ? 99.354  72.245  49.943 1.00 81.25  ? 250  GLU A OE1 1 
ATOM   1798 O  OE2 . GLU A 1  250 ? 100.915 71.812  51.412 1.00 82.21  ? 250  GLU A OE2 1 
ATOM   1799 N  N   . GLY A 1  251 ? 100.264 73.453  44.676 1.00 59.60  ? 251  GLY A N   1 
ATOM   1800 C  CA  . GLY A 1  251 ? 99.935  73.293  43.266 1.00 60.03  ? 251  GLY A CA  1 
ATOM   1801 C  C   . GLY A 1  251 ? 99.126  74.483  42.784 1.00 60.10  ? 251  GLY A C   1 
ATOM   1802 O  O   . GLY A 1  251 ? 98.671  74.542  41.657 1.00 60.49  ? 251  GLY A O   1 
ATOM   1803 N  N   . THR A 1  252 ? 98.919  75.408  43.702 1.00 58.43  ? 252  THR A N   1 
ATOM   1804 C  CA  . THR A 1  252 ? 98.158  76.578  43.452 1.00 57.93  ? 252  THR A CA  1 
ATOM   1805 C  C   . THR A 1  252 ? 98.958  77.756  44.015 1.00 58.71  ? 252  THR A C   1 
ATOM   1806 O  O   . THR A 1  252 ? 99.705  78.413  43.299 1.00 95.71  ? 252  THR A O   1 
ATOM   1807 C  CB  . THR A 1  252 ? 96.710  76.427  44.127 1.00 59.11  ? 252  THR A CB  1 
ATOM   1808 O  OG1 . THR A 1  252 ? 96.833  76.274  45.553 1.00 59.32  ? 252  THR A OG1 1 
ATOM   1809 C  CG2 . THR A 1  252 ? 95.960  75.189  43.549 1.00 55.07  ? 252  THR A CG2 1 
ATOM   1810 N  N   . VAL A 1  253 ? 98.816  78.031  45.299 1.00 57.22  ? 253  VAL A N   1 
ATOM   1811 C  CA  . VAL A 1  253 ? 99.577  79.131  45.921 1.00 57.64  ? 253  VAL A CA  1 
ATOM   1812 C  C   . VAL A 1  253 ? 101.078 78.896  45.913 1.00 58.51  ? 253  VAL A C   1 
ATOM   1813 O  O   . VAL A 1  253 ? 101.864 79.822  45.760 1.00 57.67  ? 253  VAL A O   1 
ATOM   1814 C  CB  . VAL A 1  253 ? 99.211  79.323  47.441 1.00 58.64  ? 253  VAL A CB  1 
ATOM   1815 C  CG1 . VAL A 1  253 ? 100.155 80.323  48.072 1.00 58.78  ? 253  VAL A CG1 1 
ATOM   1816 C  CG2 . VAL A 1  253 ? 97.754  79.810  47.619 1.00 58.20  ? 253  VAL A CG2 1 
ATOM   1817 N  N   . GLU A 1  254 ? 101.433 77.630  46.104 1.00 71.26  ? 254  GLU A N   1 
ATOM   1818 C  CA  . GLU A 1  254 ? 102.783 77.160  46.225 1.00 69.46  ? 254  GLU A CA  1 
ATOM   1819 C  C   . GLU A 1  254 ? 103.115 76.155  45.187 1.00 69.40  ? 254  GLU A C   1 
ATOM   1820 O  O   . GLU A 1  254 ? 102.261 75.559  44.563 1.00 72.34  ? 254  GLU A O   1 
ATOM   1821 C  CB  . GLU A 1  254 ? 102.976 76.534  47.616 1.00 49.81  ? 254  GLU A CB  1 
ATOM   1822 C  CG  . GLU A 1  254 ? 103.066 77.629  48.710 1.00 51.71  ? 254  GLU A CG  1 
ATOM   1823 C  CD  . GLU A 1  254 ? 102.986 77.038  50.144 1.00 69.58  ? 254  GLU A CD  1 
ATOM   1824 O  OE1 . GLU A 1  254 ? 102.936 75.787  50.280 1.00 55.69  ? 254  GLU A OE1 1 
ATOM   1825 O  OE2 . GLU A 1  254 ? 102.966 77.824  51.134 1.00 68.25  ? 254  GLU A OE2 1 
ATOM   1826 N  N   . PRO A 1  255 ? 104.397 75.941  44.978 1.00 66.43  ? 255  PRO A N   1 
ATOM   1827 C  CA  . PRO A 1  255 ? 104.677 74.941  43.949 1.00 58.83  ? 255  PRO A CA  1 
ATOM   1828 C  C   . PRO A 1  255 ? 104.569 73.544  44.503 1.00 65.41  ? 255  PRO A C   1 
ATOM   1829 O  O   . PRO A 1  255 ? 104.534 73.304  45.736 1.00 67.87  ? 255  PRO A O   1 
ATOM   1830 C  CB  . PRO A 1  255 ? 106.092 75.244  43.543 1.00 60.40  ? 255  PRO A CB  1 
ATOM   1831 C  CG  . PRO A 1  255 ? 106.293 76.733  43.935 1.00 58.07  ? 255  PRO A CG  1 
ATOM   1832 C  CD  . PRO A 1  255 ? 105.477 76.939  45.145 1.00 63.15  ? 255  PRO A CD  1 
ATOM   1833 N  N   . LEU A 1  256 ? 104.496 72.610  43.571 1.00 62.40  ? 256  LEU A N   1 
ATOM   1834 C  CA  . LEU A 1  256 ? 104.440 71.211  43.915 1.00 63.99  ? 256  LEU A CA  1 
ATOM   1835 C  C   . LEU A 1  256 ? 105.898 70.852  44.146 1.00 74.30  ? 256  LEU A C   1 
ATOM   1836 O  O   . LEU A 1  256 ? 106.808 71.586  43.712 1.00 63.22  ? 256  LEU A O   1 
ATOM   1837 C  CB  . LEU A 1  256 ? 103.898 70.410  42.748 1.00 68.33  ? 256  LEU A CB  1 
ATOM   1838 C  CG  . LEU A 1  256 ? 102.393 70.371  42.822 1.00 62.93  ? 256  LEU A CG  1 
ATOM   1839 C  CD1 . LEU A 1  256 ? 101.833 69.390  41.879 1.00 61.41  ? 256  LEU A CD1 1 
ATOM   1840 C  CD2 . LEU A 1  256 ? 102.065 69.895  44.256 1.00 68.38  ? 256  LEU A CD2 1 
ATOM   1841 N  N   . PRO A 1  257 ? 106.163 69.747  44.862 1.00 74.65  ? 257  PRO A N   1 
ATOM   1842 C  CA  . PRO A 1  257 ? 107.582 69.509  45.009 1.00 75.29  ? 257  PRO A CA  1 
ATOM   1843 C  C   . PRO A 1  257 ? 108.351 69.639  43.659 1.00 78.75  ? 257  PRO A C   1 
ATOM   1844 O  O   . PRO A 1  257 ? 109.468 70.171  43.647 1.00 80.29  ? 257  PRO A O   1 
ATOM   1845 C  CB  . PRO A 1  257 ? 107.583 68.136  45.650 1.00 71.44  ? 257  PRO A CB  1 
ATOM   1846 C  CG  . PRO A 1  257 ? 106.500 68.284  46.617 1.00 74.27  ? 257  PRO A CG  1 
ATOM   1847 C  CD  . PRO A 1  257 ? 105.413 68.793  45.688 1.00 75.79  ? 257  PRO A CD  1 
ATOM   1848 N  N   . ASN A 1  258 ? 107.758 69.215  42.532 1.00 78.81  ? 258  ASN A N   1 
ATOM   1849 C  CA  . ASN A 1  258 ? 108.427 69.355  41.200 1.00 77.07  ? 258  ASN A CA  1 
ATOM   1850 C  C   . ASN A 1  258 ? 108.607 70.799  40.675 1.00 75.29  ? 258  ASN A C   1 
ATOM   1851 O  O   . ASN A 1  258 ? 108.960 70.987  39.517 1.00 79.15  ? 258  ASN A O   1 
ATOM   1852 C  CB  . ASN A 1  258 ? 107.689 68.601  40.083 1.00 59.53  ? 258  ASN A CB  1 
ATOM   1853 C  CG  . ASN A 1  258 ? 106.370 69.259  39.735 1.00 69.84  ? 258  ASN A CG  1 
ATOM   1854 O  OD1 . ASN A 1  258 ? 106.155 70.445  40.102 1.00 61.91  ? 258  ASN A OD1 1 
ATOM   1855 N  ND2 . ASN A 1  258 ? 105.469 68.520  39.039 1.00 67.13  ? 258  ASN A ND2 1 
ATOM   1856 N  N   . GLY A 1  259 ? 108.355 71.815  41.484 1.00 76.39  ? 259  GLY A N   1 
ATOM   1857 C  CA  . GLY A 1  259 ? 108.533 73.177  40.994 1.00 71.24  ? 259  GLY A CA  1 
ATOM   1858 C  C   . GLY A 1  259 ? 107.338 73.742  40.218 1.00 81.68  ? 259  GLY A C   1 
ATOM   1859 O  O   . GLY A 1  259 ? 107.204 74.978  40.047 1.00 77.71  ? 259  GLY A O   1 
ATOM   1860 N  N   . LYS A 1  260 ? 106.454 72.857  39.751 1.00 75.50  ? 260  LYS A N   1 
ATOM   1861 C  CA  . LYS A 1  260 ? 105.272 73.296  39.006 1.00 80.60  ? 260  LYS A CA  1 
ATOM   1862 C  C   . LYS A 1  260 ? 103.933 73.494  39.787 1.00 77.72  ? 260  LYS A C   1 
ATOM   1863 O  O   . LYS A 1  260 ? 103.859 73.342  41.023 1.00 75.46  ? 260  LYS A O   1 
ATOM   1864 C  CB  . LYS A 1  260 ? 105.026 72.326  37.869 1.00 73.44  ? 260  LYS A CB  1 
ATOM   1865 C  CG  . LYS A 1  260 ? 106.229 72.048  37.050 1.00 66.03  ? 260  LYS A CG  1 
ATOM   1866 C  CD  . LYS A 1  260 ? 106.046 70.666  36.548 1.00 70.91  ? 260  LYS A CD  1 
ATOM   1867 C  CE  . LYS A 1  260 ? 107.021 70.318  35.521 1.00 68.95  ? 260  LYS A CE  1 
ATOM   1868 N  NZ  . LYS A 1  260 ? 106.247 69.419  34.631 1.00 81.60  ? 260  LYS A NZ  1 
ATOM   1869 N  N   . ARG A 1  261 ? 102.893 73.832  39.014 1.00 77.33  ? 261  ARG A N   1 
ATOM   1870 C  CA  . ARG A 1  261 ? 101.547 74.084  39.515 1.00 63.14  ? 261  ARG A CA  1 
ATOM   1871 C  C   . ARG A 1  261 ? 100.402 73.460  38.785 1.00 62.11  ? 261  ARG A C   1 
ATOM   1872 O  O   . ARG A 1  261 ? 100.525 73.071  37.648 1.00 57.17  ? 261  ARG A O   1 
ATOM   1873 C  CB  . ARG A 1  261 ? 101.315 75.541  39.546 1.00 50.29  ? 261  ARG A CB  1 
ATOM   1874 C  CG  . ARG A 1  261 ? 102.096 76.140  40.655 1.00 52.60  ? 261  ARG A CG  1 
ATOM   1875 C  CD  . ARG A 1  261 ? 101.849 77.549  40.702 1.00 48.45  ? 261  ARG A CD  1 
ATOM   1876 N  NE  . ARG A 1  261 ? 102.317 78.208  41.922 1.00 53.05  ? 261  ARG A NE  1 
ATOM   1877 C  CZ  . ARG A 1  261 ? 103.484 78.832  42.001 1.00 78.06  ? 261  ARG A CZ  1 
ATOM   1878 N  NH1 . ARG A 1  261 ? 104.301 78.810  40.954 1.00 70.36  ? 261  ARG A NH1 1 
ATOM   1879 N  NH2 . ARG A 1  261 ? 103.742 79.654  43.011 1.00 47.17  ? 261  ARG A NH2 1 
ATOM   1880 N  N   . LEU A 1  262 ? 99.289  73.319  39.482 1.00 69.47  ? 262  LEU A N   1 
ATOM   1881 C  CA  . LEU A 1  262 ? 98.099  72.791  38.870 1.00 57.18  ? 262  LEU A CA  1 
ATOM   1882 C  C   . LEU A 1  262 ? 97.600  73.907  37.977 1.00 56.51  ? 262  LEU A C   1 
ATOM   1883 O  O   . LEU A 1  262 ? 97.599  75.095  38.327 1.00 55.75  ? 262  LEU A O   1 
ATOM   1884 C  CB  . LEU A 1  262 ? 97.074  72.496  39.922 1.00 58.08  ? 262  LEU A CB  1 
ATOM   1885 C  CG  . LEU A 1  262 ? 97.256  71.237  40.726 1.00 58.63  ? 262  LEU A CG  1 
ATOM   1886 C  CD1 . LEU A 1  262 ? 96.280  71.310  41.866 1.00 58.10  ? 262  LEU A CD1 1 
ATOM   1887 C  CD2 . LEU A 1  262 ? 97.036  70.021  39.880 1.00 57.74  ? 262  LEU A CD2 1 
ATOM   1888 N  N   . PRO A 1  263 ? 97.198  73.561  36.771 1.00 56.01  ? 263  PRO A N   1 
ATOM   1889 C  CA  . PRO A 1  263 ? 96.726  74.689  35.969 1.00 56.59  ? 263  PRO A CA  1 
ATOM   1890 C  C   . PRO A 1  263 ? 95.282  75.223  36.371 1.00 56.79  ? 263  PRO A C   1 
ATOM   1891 O  O   . PRO A 1  263 ? 94.430  74.451  36.822 1.00 64.24  ? 263  PRO A O   1 
ATOM   1892 C  CB  . PRO A 1  263 ? 96.781  74.104  34.553 1.00 55.00  ? 263  PRO A CB  1 
ATOM   1893 C  CG  . PRO A 1  263 ? 96.536  72.637  34.728 1.00 53.56  ? 263  PRO A CG  1 
ATOM   1894 C  CD  . PRO A 1  263 ? 97.305  72.322  35.982 1.00 55.98  ? 263  PRO A CD  1 
ATOM   1895 N  N   . THR A 1  264 ? 95.027  76.523  36.220 1.00 55.83  ? 264  THR A N   1 
ATOM   1896 C  CA  . THR A 1  264 ? 93.698  77.101  36.480 1.00 52.36  ? 264  THR A CA  1 
ATOM   1897 C  C   . THR A 1  264 ? 92.402  76.327  36.063 1.00 53.91  ? 264  THR A C   1 
ATOM   1898 O  O   . THR A 1  264 ? 91.291  76.600  36.595 1.00 52.93  ? 264  THR A O   1 
ATOM   1899 C  CB  . THR A 1  264 ? 93.590  78.450  35.802 1.00 53.02  ? 264  THR A CB  1 
ATOM   1900 O  OG1 . THR A 1  264 ? 93.622  78.276  34.365 1.00 76.62  ? 264  THR A OG1 1 
ATOM   1901 C  CG2 . THR A 1  264 ? 94.688  79.387  36.278 1.00 51.76  ? 264  THR A CG2 1 
ATOM   1902 N  N   . ASP A 1  265 ? 92.510  75.366  35.134 1.00 55.31  ? 265  ASP A N   1 
ATOM   1903 C  CA  . ASP A 1  265 ? 91.308  74.632  34.659 1.00 53.38  ? 265  ASP A CA  1 
ATOM   1904 C  C   . ASP A 1  265 ? 91.284  73.232  35.149 1.00 52.67  ? 265  ASP A C   1 
ATOM   1905 O  O   . ASP A 1  265 ? 90.503  72.360  34.766 1.00 54.92  ? 265  ASP A O   1 
ATOM   1906 C  CB  . ASP A 1  265 ? 91.264  74.666  33.119 1.00 52.44  ? 265  ASP A CB  1 
ATOM   1907 C  CG  . ASP A 1  265 ? 92.246  73.678  32.463 1.00 69.36  ? 265  ASP A CG  1 
ATOM   1908 O  OD1 . ASP A 1  265 ? 93.435  73.606  32.877 1.00 68.15  ? 265  ASP A OD1 1 
ATOM   1909 O  OD2 . ASP A 1  265 ? 91.812  72.971  31.521 1.00 69.26  ? 265  ASP A OD2 1 
ATOM   1910 N  N   . PHE A 1  266 ? 92.193  72.972  36.022 1.00 52.90  ? 266  PHE A N   1 
ATOM   1911 C  CA  . PHE A 1  266 ? 92.263  71.625  36.589 1.00 52.80  ? 266  PHE A CA  1 
ATOM   1912 C  C   . PHE A 1  266 ? 91.016  71.366  37.434 1.00 52.40  ? 266  PHE A C   1 
ATOM   1913 O  O   . PHE A 1  266 ? 90.548  72.267  38.135 1.00 53.52  ? 266  PHE A O   1 
ATOM   1914 C  CB  . PHE A 1  266 ? 93.518  71.528  37.488 1.00 51.65  ? 266  PHE A CB  1 
ATOM   1915 C  CG  . PHE A 1  266 ? 93.619  70.256  38.299 1.00 51.76  ? 266  PHE A CG  1 
ATOM   1916 C  CD1 . PHE A 1  266 ? 93.690  69.033  37.667 1.00 49.79  ? 266  PHE A CD1 1 
ATOM   1917 C  CD2 . PHE A 1  266 ? 93.604  70.306  39.704 1.00 50.34  ? 266  PHE A CD2 1 
ATOM   1918 C  CE1 . PHE A 1  266 ? 93.830  67.905  38.393 1.00 50.13  ? 266  PHE A CE1 1 
ATOM   1919 C  CE2 . PHE A 1  266 ? 93.745  69.206  40.410 1.00 49.61  ? 266  PHE A CE2 1 
ATOM   1920 C  CZ  . PHE A 1  266 ? 93.820  67.995  39.774 1.00 51.04  ? 266  PHE A CZ  1 
ATOM   1921 N  N   . ASN A 1  267 ? 90.584  70.129  37.442 1.00 52.84  ? 267  ASN A N   1 
ATOM   1922 C  CA  . ASN A 1  267 ? 89.463  69.725  38.166 1.00 54.44  ? 267  ASN A CA  1 
ATOM   1923 C  C   . ASN A 1  267 ? 89.707  68.408  38.957 1.00 56.58  ? 267  ASN A C   1 
ATOM   1924 O  O   . ASN A 1  267 ? 89.891  67.353  38.367 1.00 57.04  ? 267  ASN A O   1 
ATOM   1925 C  CB  . ASN A 1  267 ? 88.379  69.592  37.120 1.00 55.53  ? 267  ASN A CB  1 
ATOM   1926 C  CG  . ASN A 1  267 ? 87.042  69.116  37.678 1.00 58.45  ? 267  ASN A CG  1 
ATOM   1927 O  OD1 . ASN A 1  267 ? 86.889  68.880  38.901 1.00 59.96  ? 267  ASN A OD1 1 
ATOM   1928 N  ND2 . ASN A 1  267 ? 86.048  68.938  36.755 1.00 66.05  ? 267  ASN A ND2 1 
ATOM   1929 N  N   . GLU A 1  268 ? 89.729  68.465  40.291 1.00 56.46  ? 268  GLU A N   1 
ATOM   1930 C  CA  . GLU A 1  268 ? 89.883  67.240  41.062 1.00 55.47  ? 268  GLU A CA  1 
ATOM   1931 C  C   . GLU A 1  268 ? 88.670  66.379  41.148 1.00 57.33  ? 268  GLU A C   1 
ATOM   1932 O  O   . GLU A 1  268 ? 88.767  65.310  41.754 1.00 66.19  ? 268  GLU A O   1 
ATOM   1933 C  CB  . GLU A 1  268 ? 90.234  67.436  42.550 1.00 64.77  ? 268  GLU A CB  1 
ATOM   1934 C  CG  . GLU A 1  268 ? 90.172  68.808  43.161 1.00 74.53  ? 268  GLU A CG  1 
ATOM   1935 C  CD  . GLU A 1  268 ? 88.791  69.435  43.263 1.00 57.26  ? 268  GLU A CD  1 
ATOM   1936 O  OE1 . GLU A 1  268 ? 88.045  69.206  44.233 1.00 59.24  ? 268  GLU A OE1 1 
ATOM   1937 O  OE2 . GLU A 1  268 ? 88.492  70.210  42.354 1.00 66.32  ? 268  GLU A OE2 1 
ATOM   1938 N  N   . GLY A 1  269 ? 87.522  66.797  40.611 1.00 57.99  ? 269  GLY A N   1 
ATOM   1939 C  CA  . GLY A 1  269 ? 86.322  65.979  40.798 1.00 55.52  ? 269  GLY A CA  1 
ATOM   1940 C  C   . GLY A 1  269 ? 86.159  64.767  39.922 1.00 56.11  ? 269  GLY A C   1 
ATOM   1941 O  O   . GLY A 1  269 ? 86.950  64.612  39.031 1.00 55.76  ? 269  GLY A O   1 
ATOM   1942 N  N   . ALA A 1  270 ? 85.147  63.922  40.146 1.00 56.80  ? 270  ALA A N   1 
ATOM   1943 C  CA  . ALA A 1  270 ? 84.924  62.781  39.293 1.00 56.25  ? 270  ALA A CA  1 
ATOM   1944 C  C   . ALA A 1  270 ? 84.696  63.259  37.865 1.00 58.31  ? 270  ALA A C   1 
ATOM   1945 O  O   . ALA A 1  270 ? 85.100  64.321  37.475 1.00 60.15  ? 270  ALA A O   1 
ATOM   1946 C  CB  . ALA A 1  270 ? 83.761  62.073  39.727 1.00 58.82  ? 270  ALA A CB  1 
ATOM   1947 N  N   . LYS A 1  271 ? 84.076  62.482  37.020 1.00 63.34  ? 271  LYS A N   1 
ATOM   1948 C  CA  . LYS A 1  271 ? 83.886  63.072  35.714 1.00 67.51  ? 271  LYS A CA  1 
ATOM   1949 C  C   . LYS A 1  271 ? 82.378  63.064  35.619 1.00 67.31  ? 271  LYS A C   1 
ATOM   1950 O  O   . LYS A 1  271 ? 81.772  63.695  34.763 1.00 66.58  ? 271  LYS A O   1 
ATOM   1951 C  CB  . LYS A 1  271 ? 84.569  62.249  34.601 1.00 69.27  ? 271  LYS A CB  1 
ATOM   1952 C  CG  . LYS A 1  271 ? 83.672  61.319  33.769 1.00 70.03  ? 271  LYS A CG  1 
ATOM   1953 C  CD  . LYS A 1  271 ? 84.348  60.935  32.409 1.00 85.78  ? 271  LYS A CD  1 
ATOM   1954 C  CE  . LYS A 1  271 ? 83.938  61.832  31.190 1.00 87.60  ? 271  LYS A CE  1 
ATOM   1955 N  NZ  . LYS A 1  271 ? 82.783  61.269  30.381 1.00 90.28  ? 271  LYS A NZ  1 
ATOM   1956 N  N   . ASN A 1  272 ? 81.803  62.360  36.585 1.00 58.19  ? 272  ASN A N   1 
ATOM   1957 C  CA  . ASN A 1  272 ? 80.376  62.167  36.722 1.00 57.46  ? 272  ASN A CA  1 
ATOM   1958 C  C   . ASN A 1  272 ? 79.851  62.932  38.015 1.00 57.70  ? 272  ASN A C   1 
ATOM   1959 O  O   . ASN A 1  272 ? 78.785  62.614  38.644 1.00 56.33  ? 272  ASN A O   1 
ATOM   1960 C  CB  . ASN A 1  272 ? 80.136  60.646  36.739 1.00 57.11  ? 272  ASN A CB  1 
ATOM   1961 C  CG  . ASN A 1  272 ? 80.779  60.002  37.909 1.00 57.43  ? 272  ASN A CG  1 
ATOM   1962 O  OD1 . ASN A 1  272 ? 81.927  60.291  38.186 1.00 59.34  ? 272  ASN A OD1 1 
ATOM   1963 N  ND2 . ASN A 1  272 ? 80.059  59.164  38.625 1.00 56.97  ? 272  ASN A ND2 1 
ATOM   1964 N  N   . ASN A 1  273 ? 80.659  63.924  38.405 1.00 57.46  ? 273  ASN A N   1 
ATOM   1965 C  CA  . ASN A 1  273 ? 80.343  64.841  39.516 1.00 58.16  ? 273  ASN A CA  1 
ATOM   1966 C  C   . ASN A 1  273 ? 79.116  65.596  38.969 1.00 57.79  ? 273  ASN A C   1 
ATOM   1967 O  O   . ASN A 1  273 ? 79.079  66.027  37.788 1.00 57.06  ? 273  ASN A O   1 
ATOM   1968 C  CB  . ASN A 1  273 ? 81.513  65.824  39.765 1.00 56.66  ? 273  ASN A CB  1 
ATOM   1969 C  CG  . ASN A 1  273 ? 82.278  65.537  41.073 1.00 57.83  ? 273  ASN A CG  1 
ATOM   1970 O  OD1 . ASN A 1  273 ? 82.247  64.426  41.647 1.00 59.66  ? 273  ASN A OD1 1 
ATOM   1971 N  ND2 . ASN A 1  273 ? 82.968  66.545  41.541 1.00 53.67  ? 273  ASN A ND2 1 
ATOM   1972 N  N   . THR A 1  274 ? 78.102  65.728  39.796 1.00 56.24  ? 274  THR A N   1 
ATOM   1973 C  CA  . THR A 1  274 ? 76.932  66.406  39.327 1.00 54.40  ? 274  THR A CA  1 
ATOM   1974 C  C   . THR A 1  274 ? 76.403  67.295  40.462 1.00 53.86  ? 274  THR A C   1 
ATOM   1975 O  O   . THR A 1  274 ? 76.402  66.862  41.636 1.00 50.99  ? 274  THR A O   1 
ATOM   1976 C  CB  . THR A 1  274 ? 75.869  65.385  38.915 1.00 55.21  ? 274  THR A CB  1 
ATOM   1977 O  OG1 . THR A 1  274 ? 74.725  66.107  38.430 1.00 57.66  ? 274  THR A OG1 1 
ATOM   1978 C  CG2 . THR A 1  274 ? 75.441  64.528  40.088 1.00 51.41  ? 274  THR A CG2 1 
ATOM   1979 N  N   . TYR A 1  275 ? 75.929  68.507  40.106 1.00 52.08  ? 275  TYR A N   1 
ATOM   1980 C  CA  . TYR A 1  275 ? 75.439  69.487  41.093 1.00 51.52  ? 275  TYR A CA  1 
ATOM   1981 C  C   . TYR A 1  275 ? 74.238  70.267  40.492 1.00 52.14  ? 275  TYR A C   1 
ATOM   1982 O  O   . TYR A 1  275 ? 74.342  70.917  39.407 1.00 51.97  ? 275  TYR A O   1 
ATOM   1983 C  CB  . TYR A 1  275 ? 76.602  70.445  41.447 1.00 51.44  ? 275  TYR A CB  1 
ATOM   1984 C  CG  . TYR A 1  275 ? 76.568  71.071  42.835 1.00 50.89  ? 275  TYR A CG  1 
ATOM   1985 C  CD1 . TYR A 1  275 ? 75.413  71.678  43.348 1.00 48.89  ? 275  TYR A CD1 1 
ATOM   1986 C  CD2 . TYR A 1  275 ? 77.672  71.097  43.603 1.00 47.44  ? 275  TYR A CD2 1 
ATOM   1987 C  CE1 . TYR A 1  275 ? 75.413  72.246  44.568 1.00 46.28  ? 275  TYR A CE1 1 
ATOM   1988 C  CE2 . TYR A 1  275 ? 77.641  71.716  44.832 1.00 47.31  ? 275  TYR A CE2 1 
ATOM   1989 C  CZ  . TYR A 1  275 ? 76.560  72.266  45.305 1.00 45.86  ? 275  TYR A CZ  1 
ATOM   1990 O  OH  . TYR A 1  275 ? 76.630  72.880  46.525 1.00 45.98  ? 275  TYR A OH  1 
ATOM   1991 N  N   . SER A 1  276 ? 73.103  70.196  41.177 1.00 49.48  ? 276  SER A N   1 
ATOM   1992 C  CA  . SER A 1  276 ? 71.896  70.868  40.673 1.00 50.94  ? 276  SER A CA  1 
ATOM   1993 C  C   . SER A 1  276 ? 71.013  71.606  41.731 1.00 50.77  ? 276  SER A C   1 
ATOM   1994 O  O   . SER A 1  276 ? 70.946  71.223  42.934 1.00 48.70  ? 276  SER A O   1 
ATOM   1995 C  CB  . SER A 1  276 ? 71.030  69.866  39.935 1.00 51.25  ? 276  SER A CB  1 
ATOM   1996 O  OG  . SER A 1  276 ? 70.386  68.984  40.855 1.00 53.77  ? 276  SER A OG  1 
ATOM   1997 N  N   . ARG A 1  277 ? 70.320  72.663  41.258 1.00 50.15  ? 277  ARG A N   1 
ATOM   1998 C  CA  . ARG A 1  277 ? 69.482  73.471  42.148 1.00 47.40  ? 277  ARG A CA  1 
ATOM   1999 C  C   . ARG A 1  277 ? 68.197  73.788  41.500 1.00 47.98  ? 277  ARG A C   1 
ATOM   2000 O  O   . ARG A 1  277 ? 68.151  74.023  40.277 1.00 45.88  ? 277  ARG A O   1 
ATOM   2001 C  CB  . ARG A 1  277 ? 70.179  74.801  42.524 1.00 45.04  ? 277  ARG A CB  1 
ATOM   2002 C  CG  . ARG A 1  277 ? 69.365  75.800  43.382 1.00 41.10  ? 277  ARG A CG  1 
ATOM   2003 C  CD  . ARG A 1  277 ? 70.264  76.734  43.976 1.00 42.18  ? 277  ARG A CD  1 
ATOM   2004 N  NE  . ARG A 1  277 ? 71.100  77.355  42.968 1.00 36.56  ? 277  ARG A NE  1 
ATOM   2005 C  CZ  . ARG A 1  277 ? 72.255  77.960  43.230 1.00 40.46  ? 277  ARG A CZ  1 
ATOM   2006 N  NH1 . ARG A 1  277 ? 72.754  78.058  44.548 1.00 33.93  ? 277  ARG A NH1 1 
ATOM   2007 N  NH2 . ARG A 1  277 ? 72.958  78.395  42.173 1.00 34.47  ? 277  ARG A NH2 1 
ATOM   2008 N  N   . ASN A 1  278 ? 67.165  73.818  42.340 1.00 47.33  ? 278  ASN A N   1 
ATOM   2009 C  CA  . ASN A 1  278 ? 65.829  74.160  41.877 1.00 50.14  ? 278  ASN A CA  1 
ATOM   2010 C  C   . ASN A 1  278 ? 65.195  75.201  42.784 1.00 50.31  ? 278  ASN A C   1 
ATOM   2011 O  O   . ASN A 1  278 ? 65.137  74.993  44.014 1.00 50.60  ? 278  ASN A O   1 
ATOM   2012 C  CB  . ASN A 1  278 ? 64.914  72.938  41.861 1.00 52.26  ? 278  ASN A CB  1 
ATOM   2013 C  CG  . ASN A 1  278 ? 63.715  73.173  41.004 1.00 54.94  ? 278  ASN A CG  1 
ATOM   2014 O  OD1 . ASN A 1  278 ? 62.622  73.451  41.523 1.00 58.43  ? 278  ASN A OD1 1 
ATOM   2015 N  ND2 . ASN A 1  278 ? 63.901  73.123  39.660 1.00 53.39  ? 278  ASN A ND2 1 
ATOM   2016 N  N   . GLU A 1  279 ? 64.685  76.283  42.180 1.00 49.04  ? 279  GLU A N   1 
ATOM   2017 C  CA  . GLU A 1  279 ? 64.077  77.377  42.928 1.00 49.16  ? 279  GLU A CA  1 
ATOM   2018 C  C   . GLU A 1  279 ? 62.717  77.803  42.412 1.00 48.64  ? 279  GLU A C   1 
ATOM   2019 O  O   . GLU A 1  279 ? 62.609  78.044  41.236 1.00 50.35  ? 279  GLU A O   1 
ATOM   2020 C  CB  . GLU A 1  279 ? 64.978  78.614  42.861 1.00 48.52  ? 279  GLU A CB  1 
ATOM   2021 C  CG  . GLU A 1  279 ? 66.273  78.612  43.680 1.00 50.22  ? 279  GLU A CG  1 
ATOM   2022 C  CD  . GLU A 1  279 ? 67.372  79.614  43.212 1.00 49.35  ? 279  GLU A CD  1 
ATOM   2023 O  OE1 . GLU A 1  279 ? 67.060  80.697  42.728 1.00 50.27  ? 279  GLU A OE1 1 
ATOM   2024 O  OE2 . GLU A 1  279 ? 68.601  79.365  43.363 1.00 51.11  ? 279  GLU A OE2 1 
ATOM   2025 N  N   . LYS A 1  280 ? 61.700  77.859  43.273 1.00 47.90  ? 280  LYS A N   1 
ATOM   2026 C  CA  . LYS A 1  280 ? 60.364  78.423  42.926 1.00 50.05  ? 280  LYS A CA  1 
ATOM   2027 C  C   . LYS A 1  280 ? 59.874  79.270  44.139 1.00 51.50  ? 280  LYS A C   1 
ATOM   2028 O  O   . LYS A 1  280 ? 59.970  78.816  45.320 1.00 51.38  ? 280  LYS A O   1 
ATOM   2029 C  CB  . LYS A 1  280 ? 59.290  77.378  42.672 1.00 47.34  ? 280  LYS A CB  1 
ATOM   2030 C  CG  . LYS A 1  280 ? 59.809  76.032  42.266 1.00 49.67  ? 280  LYS A CG  1 
ATOM   2031 C  CD  . LYS A 1  280 ? 58.668  75.164  41.902 1.00 49.23  ? 280  LYS A CD  1 
ATOM   2032 C  CE  . LYS A 1  280 ? 59.024  74.100  40.924 1.00 50.00  ? 280  LYS A CE  1 
ATOM   2033 N  NZ  . LYS A 1  280 ? 59.041  72.764  41.555 1.00 51.28  ? 280  LYS A NZ  1 
ATOM   2034 N  N   . MET A 1  281 ? 59.373  80.474  43.812 1.00 50.86  ? 281  MET A N   1 
ATOM   2035 C  CA  . MET A 1  281 ? 58.856  81.470  44.737 1.00 52.02  ? 281  MET A CA  1 
ATOM   2036 C  C   . MET A 1  281 ? 57.626  82.266  44.262 1.00 53.27  ? 281  MET A C   1 
ATOM   2037 O  O   . MET A 1  281 ? 57.496  82.602  43.072 1.00 57.31  ? 281  MET A O   1 
ATOM   2038 C  CB  . MET A 1  281 ? 59.918  82.511  45.023 1.00 53.16  ? 281  MET A CB  1 
ATOM   2039 C  CG  . MET A 1  281 ? 61.288  82.213  44.535 1.00 54.27  ? 281  MET A CG  1 
ATOM   2040 S  SD  . MET A 1  281 ? 62.473  83.469  45.189 1.00 54.94  ? 281  MET A SD  1 
ATOM   2041 C  CE  . MET A 1  281 ? 63.889  82.409  45.131 1.00 49.98  ? 281  MET A CE  1 
ATOM   2042 N  N   . VAL A 1  282 ? 56.762  82.652  45.197 1.00 52.54  ? 282  VAL A N   1 
ATOM   2043 C  CA  . VAL A 1  282 ? 55.577  83.435  44.887 1.00 51.19  ? 282  VAL A CA  1 
ATOM   2044 C  C   . VAL A 1  282 ? 55.441  84.303  46.118 1.00 53.01  ? 282  VAL A C   1 
ATOM   2045 O  O   . VAL A 1  282 ? 55.647  83.851  47.262 1.00 53.42  ? 282  VAL A O   1 
ATOM   2046 C  CB  . VAL A 1  282 ? 54.314  82.570  44.746 1.00 51.13  ? 282  VAL A CB  1 
ATOM   2047 C  CG1 . VAL A 1  282 ? 54.365  81.720  43.455 1.00 51.66  ? 282  VAL A CG1 1 
ATOM   2048 C  CG2 . VAL A 1  282 ? 54.168  81.618  45.921 1.00 47.58  ? 282  VAL A CG2 1 
ATOM   2049 N  N   . GLY A 1  283 ? 55.120  85.569  45.864 1.00 53.43  ? 283  GLY A N   1 
ATOM   2050 C  CA  . GLY A 1  283 ? 54.977  86.580  46.888 1.00 50.51  ? 283  GLY A CA  1 
ATOM   2051 C  C   . GLY A 1  283 ? 54.407  87.876  46.304 1.00 49.71  ? 283  GLY A C   1 
ATOM   2052 O  O   . GLY A 1  283 ? 53.761  87.902  45.230 1.00 48.33  ? 283  GLY A O   1 
ATOM   2053 N  N   . TYR A 1  284 ? 54.658  88.956  47.047 1.00 48.50  ? 284  TYR A N   1 
ATOM   2054 C  CA  . TYR A 1  284 ? 54.221  90.276  46.691 1.00 49.09  ? 284  TYR A CA  1 
ATOM   2055 C  C   . TYR A 1  284 ? 54.735  91.340  47.555 1.00 50.76  ? 284  TYR A C   1 
ATOM   2056 O  O   . TYR A 1  284 ? 55.142  91.130  48.713 1.00 52.66  ? 284  TYR A O   1 
ATOM   2057 C  CB  . TYR A 1  284 ? 52.700  90.401  46.730 1.00 51.27  ? 284  TYR A CB  1 
ATOM   2058 C  CG  . TYR A 1  284 ? 52.052  90.080  48.084 1.00 52.47  ? 284  TYR A CG  1 
ATOM   2059 C  CD1 . TYR A 1  284 ? 51.981  91.046  49.078 1.00 51.88  ? 284  TYR A CD1 1 
ATOM   2060 C  CD2 . TYR A 1  284 ? 51.514  88.825  48.348 1.00 53.21  ? 284  TYR A CD2 1 
ATOM   2061 C  CE1 . TYR A 1  284 ? 51.420  90.815  50.248 1.00 51.86  ? 284  TYR A CE1 1 
ATOM   2062 C  CE2 . TYR A 1  284 ? 50.934  88.565  49.557 1.00 54.49  ? 284  TYR A CE2 1 
ATOM   2063 C  CZ  . TYR A 1  284 ? 50.887  89.587  50.520 1.00 55.70  ? 284  TYR A CZ  1 
ATOM   2064 O  OH  . TYR A 1  284 ? 50.285  89.405  51.776 1.00 58.15  ? 284  TYR A OH  1 
ATOM   2065 N  N   . SER A 1  285 ? 54.687  92.532  46.981 1.00 52.43  ? 285  SER A N   1 
ATOM   2066 C  CA  . SER A 1  285 ? 55.039  93.739  47.669 1.00 52.52  ? 285  SER A CA  1 
ATOM   2067 C  C   . SER A 1  285 ? 53.728  94.532  47.637 1.00 54.53  ? 285  SER A C   1 
ATOM   2068 O  O   . SER A 1  285 ? 52.990  94.588  46.614 1.00 55.22  ? 285  SER A O   1 
ATOM   2069 C  CB  . SER A 1  285 ? 56.076  94.505  46.951 1.00 53.08  ? 285  SER A CB  1 
ATOM   2070 O  OG  . SER A 1  285 ? 56.277  95.718  47.637 1.00 100.65 ? 285  SER A OG  1 
ATOM   2071 N  N   . PHE A 1  286 ? 53.416  95.082  48.807 1.00 55.05  ? 286  PHE A N   1 
ATOM   2072 C  CA  . PHE A 1  286 ? 52.237  95.852  48.996 1.00 58.54  ? 286  PHE A CA  1 
ATOM   2073 C  C   . PHE A 1  286 ? 52.468  97.130  49.737 1.00 61.74  ? 286  PHE A C   1 
ATOM   2074 O  O   . PHE A 1  286 ? 53.178  97.189  50.749 1.00 59.51  ? 286  PHE A O   1 
ATOM   2075 C  CB  . PHE A 1  286 ? 51.209  95.069  49.742 1.00 62.62  ? 286  PHE A CB  1 
ATOM   2076 C  CG  . PHE A 1  286 ? 49.925  95.804  49.906 1.00 69.66  ? 286  PHE A CG  1 
ATOM   2077 C  CD1 . PHE A 1  286 ? 49.163  96.154  48.779 1.00 67.28  ? 286  PHE A CD1 1 
ATOM   2078 C  CD2 . PHE A 1  286 ? 49.471  96.152  51.181 1.00 59.70  ? 286  PHE A CD2 1 
ATOM   2079 C  CE1 . PHE A 1  286 ? 47.960  96.840  48.924 1.00 61.42  ? 286  PHE A CE1 1 
ATOM   2080 C  CE2 . PHE A 1  286 ? 48.271  96.838  51.347 1.00 59.19  ? 286  PHE A CE2 1 
ATOM   2081 C  CZ  . PHE A 1  286 ? 47.509  97.184  50.215 1.00 62.61  ? 286  PHE A CZ  1 
ATOM   2082 N  N   . ASP A 1  287 ? 51.909  98.188  49.176 1.00 63.29  ? 287  ASP A N   1 
ATOM   2083 C  CA  . ASP A 1  287 ? 51.966  99.456  49.860 1.00 67.50  ? 287  ASP A CA  1 
ATOM   2084 C  C   . ASP A 1  287 ? 50.621  100.205 49.708 1.00 65.08  ? 287  ASP A C   1 
ATOM   2085 O  O   . ASP A 1  287 ? 49.920  100.110 48.684 1.00 60.34  ? 287  ASP A O   1 
ATOM   2086 C  CB  . ASP A 1  287 ? 53.168  100.303 49.406 1.00 73.13  ? 287  ASP A CB  1 
ATOM   2087 C  CG  . ASP A 1  287 ? 53.268  100.422 47.910 1.00 89.46  ? 287  ASP A CG  1 
ATOM   2088 O  OD1 . ASP A 1  287 ? 53.794  99.472  47.244 1.00 92.04  ? 287  ASP A OD1 1 
ATOM   2089 O  OD2 . ASP A 1  287 ? 52.796  101.478 47.412 1.00 92.60  ? 287  ASP A OD2 1 
ATOM   2090 N  N   . HIS A 1  288 ? 50.212  100.832 50.804 1.00 66.65  ? 288  HIS A N   1 
ATOM   2091 C  CA  . HIS A 1  288 ? 49.001  101.673 50.818 1.00 71.67  ? 288  HIS A CA  1 
ATOM   2092 C  C   . HIS A 1  288 ? 49.162  102.922 51.732 1.00 72.49  ? 288  HIS A C   1 
ATOM   2093 O  O   . HIS A 1  288 ? 49.450  102.819 52.951 1.00 68.05  ? 288  HIS A O   1 
ATOM   2094 C  CB  . HIS A 1  288 ? 47.774  100.873 51.229 1.00 74.59  ? 288  HIS A CB  1 
ATOM   2095 C  CG  . HIS A 1  288 ? 46.531  101.691 51.280 1.00 82.62  ? 288  HIS A CG  1 
ATOM   2096 N  ND1 . HIS A 1  288 ? 45.284  101.140 51.476 1.00 87.30  ? 288  HIS A ND1 1 
ATOM   2097 C  CD2 . HIS A 1  288 ? 46.339  103.027 51.186 1.00 92.14  ? 288  HIS A CD2 1 
ATOM   2098 C  CE1 . HIS A 1  288 ? 44.383  102.103 51.504 1.00 86.54  ? 288  HIS A CE1 1 
ATOM   2099 N  NE2 . HIS A 1  288 ? 44.998  103.260 51.333 1.00 87.55  ? 288  HIS A NE2 1 
ATOM   2100 N  N   . GLU A 1  289 ? 49.072  104.101 51.107 1.00 75.68  ? 289  GLU A N   1 
ATOM   2101 C  CA  . GLU A 1  289 ? 49.108  105.357 51.837 1.00 74.47  ? 289  GLU A CA  1 
ATOM   2102 C  C   . GLU A 1  289 ? 47.615  105.703 52.098 1.00 81.78  ? 289  GLU A C   1 
ATOM   2103 O  O   . GLU A 1  289 ? 46.829  105.946 51.161 1.00 85.49  ? 289  GLU A O   1 
ATOM   2104 C  CB  . GLU A 1  289 ? 49.738  106.421 50.996 1.00 75.52  ? 289  GLU A CB  1 
ATOM   2105 C  CG  . GLU A 1  289 ? 49.758  107.764 51.643 1.00 76.58  ? 289  GLU A CG  1 
ATOM   2106 C  CD  . GLU A 1  289 ? 50.238  108.868 50.682 1.00 81.96  ? 289  GLU A CD  1 
ATOM   2107 O  OE1 . GLU A 1  289 ? 51.104  108.582 49.821 1.00 87.09  ? 289  GLU A OE1 1 
ATOM   2108 O  OE2 . GLU A 1  289 ? 49.767  110.026 50.790 1.00 85.83  ? 289  GLU A OE2 1 
ATOM   2109 N  N   . PHE A 1  290 ? 47.229  105.631 53.372 1.00 77.54  ? 290  PHE A N   1 
ATOM   2110 C  CA  . PHE A 1  290 ? 45.889  105.917 53.871 1.00 78.44  ? 290  PHE A CA  1 
ATOM   2111 C  C   . PHE A 1  290 ? 45.480  107.379 53.869 1.00 75.99  ? 290  PHE A C   1 
ATOM   2112 O  O   . PHE A 1  290 ? 44.380  107.681 53.454 1.00 72.84  ? 290  PHE A O   1 
ATOM   2113 C  CB  . PHE A 1  290 ? 45.750  105.446 55.311 1.00 82.03  ? 290  PHE A CB  1 
ATOM   2114 C  CG  . PHE A 1  290 ? 45.552  104.001 55.430 1.00 84.40  ? 290  PHE A CG  1 
ATOM   2115 C  CD1 . PHE A 1  290 ? 44.454  103.402 54.851 1.00 88.77  ? 290  PHE A CD1 1 
ATOM   2116 C  CD2 . PHE A 1  290 ? 46.462  103.221 56.108 1.00 82.83  ? 290  PHE A CD2 1 
ATOM   2117 C  CE1 . PHE A 1  290 ? 44.261  102.019 54.941 1.00 94.78  ? 290  PHE A CE1 1 
ATOM   2118 C  CE2 . PHE A 1  290 ? 46.282  101.845 56.207 1.00 84.97  ? 290  PHE A CE2 1 
ATOM   2119 C  CZ  . PHE A 1  290 ? 45.176  101.242 55.625 1.00 88.93  ? 290  PHE A CZ  1 
ATOM   2120 N  N   . ASN A 1  291 ? 46.344  108.263 54.372 1.00 68.17  ? 291  ASN A N   1 
ATOM   2121 C  CA  . ASN A 1  291 ? 46.056  109.702 54.463 1.00 75.94  ? 291  ASN A CA  1 
ATOM   2122 C  C   . ASN A 1  291 ? 47.431  110.277 54.623 1.00 72.26  ? 291  ASN A C   1 
ATOM   2123 O  O   . ASN A 1  291 ? 48.381  109.557 54.439 1.00 84.56  ? 291  ASN A O   1 
ATOM   2124 C  CB  . ASN A 1  291 ? 45.264  110.036 55.723 1.00 74.93  ? 291  ASN A CB  1 
ATOM   2125 C  CG  . ASN A 1  291 ? 46.011  109.613 56.979 1.00 81.66  ? 291  ASN A CG  1 
ATOM   2126 O  OD1 . ASN A 1  291 ? 47.184  110.007 57.214 1.00 71.19  ? 291  ASN A OD1 1 
ATOM   2127 N  ND2 . ASN A 1  291 ? 45.358  108.783 57.789 1.00 78.31  ? 291  ASN A ND2 1 
ATOM   2128 N  N   . ASP A 1  292 ? 47.548  111.527 55.049 1.00 74.02  ? 292  ASP A N   1 
ATOM   2129 C  CA  . ASP A 1  292 ? 48.864  112.195 55.172 1.00 73.23  ? 292  ASP A CA  1 
ATOM   2130 C  C   . ASP A 1  292 ? 49.825  111.766 56.289 1.00 73.60  ? 292  ASP A C   1 
ATOM   2131 O  O   . ASP A 1  292 ? 50.979  112.247 56.364 1.00 68.32  ? 292  ASP A O   1 
ATOM   2132 C  CB  . ASP A 1  292 ? 48.639  113.698 55.337 1.00 84.16  ? 292  ASP A CB  1 
ATOM   2133 C  CG  . ASP A 1  292 ? 47.656  114.251 54.332 1.00 90.54  ? 292  ASP A CG  1 
ATOM   2134 O  OD1 . ASP A 1  292 ? 48.152  114.849 53.342 1.00 93.68  ? 292  ASP A OD1 1 
ATOM   2135 O  OD2 . ASP A 1  292 ? 46.419  114.066 54.538 1.00 91.94  ? 292  ASP A OD2 1 
ATOM   2136 N  N   . THR A 1  293 ? 49.373  110.869 57.153 1.00 67.00  ? 293  THR A N   1 
ATOM   2137 C  CA  . THR A 1  293 ? 50.208  110.497 58.270 1.00 75.81  ? 293  THR A CA  1 
ATOM   2138 C  C   . THR A 1  293 ? 50.437  108.976 58.361 1.00 76.02  ? 293  THR A C   1 
ATOM   2139 O  O   . THR A 1  293 ? 51.374  108.493 59.007 1.00 79.90  ? 293  THR A O   1 
ATOM   2140 C  CB  . THR A 1  293 ? 49.536  111.074 59.599 1.00 79.56  ? 293  THR A CB  1 
ATOM   2141 O  OG1 . THR A 1  293 ? 50.530  111.180 60.627 1.00 75.97  ? 293  THR A OG1 1 
ATOM   2142 C  CG2 . THR A 1  293 ? 48.349  110.181 60.081 1.00 59.56  ? 293  THR A CG2 1 
ATOM   2143 N  N   . PHE A 1  294 ? 49.583  108.234 57.671 1.00 79.04  ? 294  PHE A N   1 
ATOM   2144 C  CA  . PHE A 1  294 ? 49.622  106.784 57.710 1.00 82.70  ? 294  PHE A CA  1 
ATOM   2145 C  C   . PHE A 1  294 ? 49.753  105.997 56.429 1.00 83.65  ? 294  PHE A C   1 
ATOM   2146 O  O   . PHE A 1  294 ? 48.815  105.970 55.634 1.00 88.74  ? 294  PHE A O   1 
ATOM   2147 C  CB  . PHE A 1  294 ? 48.375  106.260 58.411 1.00 82.75  ? 294  PHE A CB  1 
ATOM   2148 C  CG  . PHE A 1  294 ? 48.434  106.390 59.861 1.00 88.45  ? 294  PHE A CG  1 
ATOM   2149 C  CD1 . PHE A 1  294 ? 49.673  106.394 60.507 1.00 91.99  ? 294  PHE A CD1 1 
ATOM   2150 C  CD2 . PHE A 1  294 ? 47.277  106.422 60.610 1.00 90.07  ? 294  PHE A CD2 1 
ATOM   2151 C  CE1 . PHE A 1  294 ? 49.755  106.415 61.892 1.00 91.96  ? 294  PHE A CE1 1 
ATOM   2152 C  CE2 . PHE A 1  294 ? 47.351  106.446 61.996 1.00 93.21  ? 294  PHE A CE2 1 
ATOM   2153 C  CZ  . PHE A 1  294 ? 48.591  106.439 62.637 1.00 92.87  ? 294  PHE A CZ  1 
ATOM   2154 N  N   . THR A 1  295 ? 50.897  105.332 56.258 1.00 78.93  ? 295  THR A N   1 
ATOM   2155 C  CA  . THR A 1  295 ? 51.108  104.459 55.125 1.00 68.03  ? 295  THR A CA  1 
ATOM   2156 C  C   . THR A 1  295 ? 51.358  103.061 55.666 1.00 66.68  ? 295  THR A C   1 
ATOM   2157 O  O   . THR A 1  295 ? 52.011  102.888 56.708 1.00 70.69  ? 295  THR A O   1 
ATOM   2158 C  CB  . THR A 1  295 ? 52.351  104.807 54.329 1.00 70.96  ? 295  THR A CB  1 
ATOM   2159 O  OG1 . THR A 1  295 ? 52.285  106.156 53.842 1.00 71.79  ? 295  THR A OG1 1 
ATOM   2160 C  CG2 . THR A 1  295 ? 52.451  103.827 53.135 1.00 69.65  ? 295  THR A CG2 1 
ATOM   2161 N  N   . VAL A 1  296 ? 50.800  102.049 55.025 1.00 59.58  ? 296  VAL A N   1 
ATOM   2162 C  CA  . VAL A 1  296 ? 51.150  100.703 55.455 1.00 59.50  ? 296  VAL A CA  1 
ATOM   2163 C  C   . VAL A 1  296 ? 51.828  99.872  54.350 1.00 72.89  ? 296  VAL A C   1 
ATOM   2164 O  O   . VAL A 1  296 ? 51.386  99.876  53.166 1.00 67.22  ? 296  VAL A O   1 
ATOM   2165 C  CB  . VAL A 1  296 ? 49.972  99.844  55.868 1.00 54.25  ? 296  VAL A CB  1 
ATOM   2166 C  CG1 . VAL A 1  296 ? 48.992  99.719  54.791 1.00 52.69  ? 296  VAL A CG1 1 
ATOM   2167 C  CG2 . VAL A 1  296 ? 50.472  98.452  56.141 1.00 54.82  ? 296  VAL A CG2 1 
ATOM   2168 N  N   . ARG A 1  297 ? 52.913  99.185  54.674 1.00 62.71  ? 297  ARG A N   1 
ATOM   2169 C  CA  . ARG A 1  297 ? 53.373  98.269  53.642 1.00 67.21  ? 297  ARG A CA  1 
ATOM   2170 C  C   . ARG A 1  297 ? 53.652  96.935  54.212 1.00 65.02  ? 297  ARG A C   1 
ATOM   2171 O  O   . ARG A 1  297 ? 54.173  96.842  55.328 1.00 68.18  ? 297  ARG A O   1 
ATOM   2172 C  CB  . ARG A 1  297 ? 54.585  98.751  52.826 1.00 60.01  ? 297  ARG A CB  1 
ATOM   2173 C  CG  . ARG A 1  297 ? 55.830  99.070  53.547 1.00 72.06  ? 297  ARG A CG  1 
ATOM   2174 C  CD  . ARG A 1  297 ? 56.814  99.842  52.634 1.00 69.96  ? 297  ARG A CD  1 
ATOM   2175 N  NE  . ARG A 1  297 ? 56.824  101.289 52.862 1.00 84.79  ? 297  ARG A NE  1 
ATOM   2176 C  CZ  . ARG A 1  297 ? 57.252  101.925 53.973 1.00 85.53  ? 297  ARG A CZ  1 
ATOM   2177 N  NH1 . ARG A 1  297 ? 57.735  101.285 55.069 1.00 67.63  ? 297  ARG A NH1 1 
ATOM   2178 N  NH2 . ARG A 1  297 ? 57.231  103.254 53.964 1.00 74.44  ? 297  ARG A NH2 1 
ATOM   2179 N  N   . GLN A 1  298 ? 53.265  95.906  53.446 1.00 67.68  ? 298  GLN A N   1 
ATOM   2180 C  CA  . GLN A 1  298 ? 53.524  94.505  53.780 1.00 57.38  ? 298  GLN A CA  1 
ATOM   2181 C  C   . GLN A 1  298 ? 54.296  93.841  52.652 1.00 57.63  ? 298  GLN A C   1 
ATOM   2182 O  O   . GLN A 1  298 ? 53.927  93.962  51.523 1.00 57.94  ? 298  GLN A O   1 
ATOM   2183 C  CB  . GLN A 1  298 ? 52.237  93.723  53.949 1.00 57.96  ? 298  GLN A CB  1 
ATOM   2184 C  CG  . GLN A 1  298 ? 52.399  92.417  54.700 1.00 57.99  ? 298  GLN A CG  1 
ATOM   2185 C  CD  . GLN A 1  298 ? 51.090  91.620  54.786 1.00 68.64  ? 298  GLN A CD  1 
ATOM   2186 O  OE1 . GLN A 1  298 ? 50.540  91.155  53.768 1.00 59.45  ? 298  GLN A OE1 1 
ATOM   2187 N  NE2 . GLN A 1  298 ? 50.592  91.457  55.998 1.00 58.20  ? 298  GLN A NE2 1 
ATOM   2188 N  N   . ASN A 1  299 ? 55.367  93.126  52.975 1.00 58.25  ? 299  ASN A N   1 
ATOM   2189 C  CA  . ASN A 1  299 ? 56.190  92.361  52.010 1.00 57.04  ? 299  ASN A CA  1 
ATOM   2190 C  C   . ASN A 1  299 ? 56.081  90.927  52.353 1.00 56.05  ? 299  ASN A C   1 
ATOM   2191 O  O   . ASN A 1  299 ? 56.368  90.576  53.464 1.00 58.79  ? 299  ASN A O   1 
ATOM   2192 C  CB  . ASN A 1  299 ? 57.626  92.748  52.143 1.00 54.87  ? 299  ASN A CB  1 
ATOM   2193 C  CG  . ASN A 1  299 ? 57.881  94.012  51.471 1.00 55.67  ? 299  ASN A CG  1 
ATOM   2194 O  OD1 . ASN A 1  299 ? 57.296  94.228  50.419 1.00 74.45  ? 299  ASN A OD1 1 
ATOM   2195 N  ND2 . ASN A 1  299 ? 58.736  94.872  52.029 1.00 54.06  ? 299  ASN A ND2 1 
ATOM   2196 N  N   . LEU A 1  300 ? 55.662  90.089  51.430 1.00 55.38  ? 300  LEU A N   1 
ATOM   2197 C  CA  . LEU A 1  300 ? 55.553  88.655  51.737 1.00 54.31  ? 300  LEU A CA  1 
ATOM   2198 C  C   . LEU A 1  300 ? 56.044  87.644  50.690 1.00 53.40  ? 300  LEU A C   1 
ATOM   2199 O  O   . LEU A 1  300 ? 55.944  87.833  49.488 1.00 52.67  ? 300  LEU A O   1 
ATOM   2200 C  CB  . LEU A 1  300 ? 54.108  88.324  52.085 1.00 55.31  ? 300  LEU A CB  1 
ATOM   2201 C  CG  . LEU A 1  300 ? 53.638  86.845  52.138 1.00 56.09  ? 300  LEU A CG  1 
ATOM   2202 C  CD1 . LEU A 1  300 ? 52.508  86.777  53.138 1.00 54.76  ? 300  LEU A CD1 1 
ATOM   2203 C  CD2 . LEU A 1  300 ? 53.181  86.307  50.761 1.00 51.88  ? 300  LEU A CD2 1 
ATOM   2204 N  N   . ARG A 1  301 ? 56.558  86.530  51.149 1.00 51.73  ? 301  ARG A N   1 
ATOM   2205 C  CA  . ARG A 1  301 ? 56.997  85.547  50.158 1.00 50.11  ? 301  ARG A CA  1 
ATOM   2206 C  C   . ARG A 1  301 ? 56.994  84.122  50.625 1.00 49.65  ? 301  ARG A C   1 
ATOM   2207 O  O   . ARG A 1  301 ? 57.209  83.832  51.826 1.00 48.50  ? 301  ARG A O   1 
ATOM   2208 C  CB  . ARG A 1  301 ? 58.447  85.870  49.652 1.00 46.90  ? 301  ARG A CB  1 
ATOM   2209 C  CG  . ARG A 1  301 ? 58.978  84.869  48.694 1.00 41.95  ? 301  ARG A CG  1 
ATOM   2210 C  CD  . ARG A 1  301 ? 60.112  85.350  47.901 1.00 42.14  ? 301  ARG A CD  1 
ATOM   2211 N  NE  . ARG A 1  301 ? 61.357  85.295  48.675 1.00 42.71  ? 301  ARG A NE  1 
ATOM   2212 C  CZ  . ARG A 1  301 ? 62.055  86.369  49.082 1.00 45.20  ? 301  ARG A CZ  1 
ATOM   2213 N  NH1 . ARG A 1  301 ? 61.678  87.605  48.765 1.00 43.37  ? 301  ARG A NH1 1 
ATOM   2214 N  NH2 . ARG A 1  301 ? 63.035  86.237  49.982 1.00 48.22  ? 301  ARG A NH2 1 
ATOM   2215 N  N   . PHE A 1  302 ? 56.682  83.239  49.687 1.00 48.98  ? 302  PHE A N   1 
ATOM   2216 C  CA  . PHE A 1  302 ? 56.862  81.808  49.980 1.00 49.92  ? 302  PHE A CA  1 
ATOM   2217 C  C   . PHE A 1  302 ? 57.861  81.095  48.990 1.00 49.29  ? 302  PHE A C   1 
ATOM   2218 O  O   . PHE A 1  302 ? 57.829  81.300  47.748 1.00 49.01  ? 302  PHE A O   1 
ATOM   2219 C  CB  . PHE A 1  302 ? 55.560  81.047  49.941 1.00 48.46  ? 302  PHE A CB  1 
ATOM   2220 C  CG  . PHE A 1  302 ? 55.737  79.586  50.207 1.00 47.35  ? 302  PHE A CG  1 
ATOM   2221 C  CD1 . PHE A 1  302 ? 55.975  79.115  51.507 1.00 48.25  ? 302  PHE A CD1 1 
ATOM   2222 C  CD2 . PHE A 1  302 ? 55.732  78.663  49.165 1.00 46.98  ? 302  PHE A CD2 1 
ATOM   2223 C  CE1 . PHE A 1  302 ? 56.214  77.721  51.756 1.00 46.11  ? 302  PHE A CE1 1 
ATOM   2224 C  CE2 . PHE A 1  302 ? 55.971  77.263  49.371 1.00 46.25  ? 302  PHE A CE2 1 
ATOM   2225 C  CZ  . PHE A 1  302 ? 56.207  76.792  50.663 1.00 46.76  ? 302  PHE A CZ  1 
ATOM   2226 N  N   . ALA A 1  303 ? 58.758  80.269  49.492 1.00 48.98  ? 303  ALA A N   1 
ATOM   2227 C  CA  . ALA A 1  303 ? 59.621  79.561  48.527 1.00 46.76  ? 303  ALA A CA  1 
ATOM   2228 C  C   . ALA A 1  303 ? 59.817  78.116  48.879 1.00 47.13  ? 303  ALA A C   1 
ATOM   2229 O  O   . ALA A 1  303 ? 59.786  77.732  50.079 1.00 48.84  ? 303  ALA A O   1 
ATOM   2230 C  CB  . ALA A 1  303 ? 61.027  80.208  48.402 1.00 42.76  ? 303  ALA A CB  1 
ATOM   2231 N  N   . GLU A 1  304 ? 60.002  77.344  47.816 1.00 45.93  ? 304  GLU A N   1 
ATOM   2232 C  CA  . GLU A 1  304 ? 60.328  75.962  47.904 1.00 49.15  ? 304  GLU A CA  1 
ATOM   2233 C  C   . GLU A 1  304 ? 61.539  75.753  47.025 1.00 49.97  ? 304  GLU A C   1 
ATOM   2234 O  O   . GLU A 1  304 ? 61.472  75.949  45.797 1.00 52.05  ? 304  GLU A O   1 
ATOM   2235 C  CB  . GLU A 1  304 ? 59.200  75.052  47.436 1.00 50.00  ? 304  GLU A CB  1 
ATOM   2236 C  CG  . GLU A 1  304 ? 59.735  73.568  47.377 1.00 52.38  ? 304  GLU A CG  1 
ATOM   2237 C  CD  . GLU A 1  304 ? 58.662  72.500  47.537 1.00 53.69  ? 304  GLU A CD  1 
ATOM   2238 O  OE1 . GLU A 1  304 ? 58.255  72.267  48.683 1.00 55.46  ? 304  GLU A OE1 1 
ATOM   2239 O  OE2 . GLU A 1  304 ? 58.217  71.884  46.548 1.00 51.60  ? 304  GLU A OE2 1 
ATOM   2240 N  N   . ASN A 1  305 ? 62.670  75.422  47.646 1.00 50.22  ? 305  ASN A N   1 
ATOM   2241 C  CA  . ASN A 1  305 ? 63.915  75.228  46.865 1.00 50.02  ? 305  ASN A CA  1 
ATOM   2242 C  C   . ASN A 1  305 ? 64.611  73.945  47.173 1.00 48.50  ? 305  ASN A C   1 
ATOM   2243 O  O   . ASN A 1  305 ? 64.588  73.454  48.286 1.00 48.55  ? 305  ASN A O   1 
ATOM   2244 C  CB  . ASN A 1  305 ? 64.949  76.367  47.020 1.00 51.16  ? 305  ASN A CB  1 
ATOM   2245 C  CG  . ASN A 1  305 ? 64.343  77.727  46.982 1.00 53.61  ? 305  ASN A CG  1 
ATOM   2246 O  OD1 . ASN A 1  305 ? 63.690  78.145  46.007 1.00 57.13  ? 305  ASN A OD1 1 
ATOM   2247 N  ND2 . ASN A 1  305 ? 64.548  78.444  48.051 1.00 53.90  ? 305  ASN A ND2 1 
ATOM   2248 N  N   . LYS A 1  306 ? 65.265  73.443  46.140 1.00 48.86  ? 306  LYS A N   1 
ATOM   2249 C  CA  . LYS A 1  306 ? 65.962  72.179  46.185 1.00 48.45  ? 306  LYS A CA  1 
ATOM   2250 C  C   . LYS A 1  306 ? 67.329  72.189  45.603 1.00 47.85  ? 306  LYS A C   1 
ATOM   2251 O  O   . LYS A 1  306 ? 67.647  72.933  44.697 1.00 48.55  ? 306  LYS A O   1 
ATOM   2252 C  CB  . LYS A 1  306 ? 65.192  71.131  45.370 1.00 48.70  ? 306  LYS A CB  1 
ATOM   2253 C  CG  . LYS A 1  306 ? 63.816  70.703  45.877 1.00 45.90  ? 306  LYS A CG  1 
ATOM   2254 C  CD  . LYS A 1  306 ? 63.058  70.177  44.688 1.00 47.15  ? 306  LYS A CD  1 
ATOM   2255 C  CE  . LYS A 1  306 ? 61.628  69.833  45.103 1.00 51.84  ? 306  LYS A CE  1 
ATOM   2256 N  NZ  . LYS A 1  306 ? 60.677  69.588  43.977 1.00 52.79  ? 306  LYS A NZ  1 
ATOM   2257 N  N   . THR A 1  307 ? 68.107  71.258  46.119 1.00 49.10  ? 307  THR A N   1 
ATOM   2258 C  CA  . THR A 1  307 ? 69.424  70.983  45.621 1.00 49.25  ? 307  THR A CA  1 
ATOM   2259 C  C   . THR A 1  307 ? 69.900  69.488  45.783 1.00 51.22  ? 307  THR A C   1 
ATOM   2260 O  O   . THR A 1  307 ? 69.511  68.789  46.744 1.00 49.94  ? 307  THR A O   1 
ATOM   2261 C  CB  . THR A 1  307 ? 70.506  71.994  46.162 1.00 48.90  ? 307  THR A CB  1 
ATOM   2262 O  OG1 . THR A 1  307 ? 71.681  71.729  45.394 1.00 49.66  ? 307  THR A OG1 1 
ATOM   2263 C  CG2 . THR A 1  307 ? 70.839  71.897  47.712 1.00 45.51  ? 307  THR A CG2 1 
ATOM   2264 N  N   . SER A 1  308 ? 70.695  69.016  44.789 1.00 51.91  ? 308  SER A N   1 
ATOM   2265 C  CA  . SER A 1  308 ? 71.311  67.687  44.785 1.00 52.00  ? 308  SER A CA  1 
ATOM   2266 C  C   . SER A 1  308 ? 72.680  67.815  44.274 1.00 51.66  ? 308  SER A C   1 
ATOM   2267 O  O   . SER A 1  308 ? 72.987  68.725  43.569 1.00 53.73  ? 308  SER A O   1 
ATOM   2268 C  CB  . SER A 1  308 ? 70.731  66.705  43.809 1.00 50.48  ? 308  SER A CB  1 
ATOM   2269 O  OG  . SER A 1  308 ? 69.379  66.548  43.970 1.00 56.88  ? 308  SER A OG  1 
ATOM   2270 N  N   . GLN A 1  309 ? 73.500  66.830  44.604 1.00 52.30  ? 309  GLN A N   1 
ATOM   2271 C  CA  . GLN A 1  309 ? 74.880  66.726  44.119 1.00 50.52  ? 309  GLN A CA  1 
ATOM   2272 C  C   . GLN A 1  309 ? 75.485  65.379  44.434 1.00 50.29  ? 309  GLN A C   1 
ATOM   2273 O  O   . GLN A 1  309 ? 75.100  64.698  45.393 1.00 52.41  ? 309  GLN A O   1 
ATOM   2274 C  CB  . GLN A 1  309 ? 75.820  67.848  44.650 1.00 50.84  ? 309  GLN A CB  1 
ATOM   2275 C  CG  . GLN A 1  309 ? 76.270  67.743  46.130 1.00 48.82  ? 309  GLN A CG  1 
ATOM   2276 C  CD  . GLN A 1  309 ? 77.078  68.917  46.558 1.00 52.42  ? 309  GLN A CD  1 
ATOM   2277 O  OE1 . GLN A 1  309 ? 78.289  68.969  46.332 1.00 55.31  ? 309  GLN A OE1 1 
ATOM   2278 N  NE2 . GLN A 1  309 ? 76.415  69.897  47.171 1.00 74.43  ? 309  GLN A NE2 1 
ATOM   2279 N  N   . ASN A 1  310 ? 76.431  65.015  43.550 1.00 52.96  ? 310  ASN A N   1 
ATOM   2280 C  CA  . ASN A 1  310 ? 77.299  63.830  43.614 1.00 50.77  ? 310  ASN A CA  1 
ATOM   2281 C  C   . ASN A 1  310 ? 78.619  64.527  43.444 1.00 50.03  ? 310  ASN A C   1 
ATOM   2282 O  O   . ASN A 1  310 ? 78.945  64.963  42.345 1.00 49.21  ? 310  ASN A O   1 
ATOM   2283 C  CB  . ASN A 1  310 ? 77.071  62.925  42.406 1.00 49.33  ? 310  ASN A CB  1 
ATOM   2284 C  CG  . ASN A 1  310 ? 75.840  62.032  42.554 1.00 49.67  ? 310  ASN A CG  1 
ATOM   2285 O  OD1 . ASN A 1  310 ? 75.356  61.557  41.535 1.00 50.40  ? 310  ASN A OD1 1 
ATOM   2286 N  ND2 . ASN A 1  310 ? 75.330  61.786  43.810 1.00 44.83  ? 310  ASN A ND2 1 
ATOM   2287 N  N   . SER A 1  311 ? 79.388  64.659  44.498 1.00 52.06  ? 311  SER A N   1 
ATOM   2288 C  CA  . SER A 1  311 ? 80.634  65.377  44.257 1.00 55.44  ? 311  SER A CA  1 
ATOM   2289 C  C   . SER A 1  311 ? 81.895  64.849  44.924 1.00 57.28  ? 311  SER A C   1 
ATOM   2290 O  O   . SER A 1  311 ? 81.966  64.661  46.191 1.00 58.42  ? 311  SER A O   1 
ATOM   2291 C  CB  . SER A 1  311 ? 80.536  66.842  44.689 1.00 55.77  ? 311  SER A CB  1 
ATOM   2292 O  OG  . SER A 1  311 ? 79.462  67.529  44.129 1.00 57.70  ? 311  SER A OG  1 
ATOM   2293 N  N   . VAL A 1  312 ? 82.905  64.673  44.082 1.00 56.39  ? 312  VAL A N   1 
ATOM   2294 C  CA  . VAL A 1  312 ? 84.153  64.244  44.611 1.00 56.65  ? 312  VAL A CA  1 
ATOM   2295 C  C   . VAL A 1  312 ? 84.941  65.522  44.751 1.00 57.25  ? 312  VAL A C   1 
ATOM   2296 O  O   . VAL A 1  312 ? 85.031  66.330  43.800 1.00 56.89  ? 312  VAL A O   1 
ATOM   2297 C  CB  . VAL A 1  312 ? 84.873  63.202  43.713 1.00 57.07  ? 312  VAL A CB  1 
ATOM   2298 C  CG1 . VAL A 1  312 ? 86.323  63.646  43.386 1.00 56.82  ? 312  VAL A CG1 1 
ATOM   2299 C  CG2 . VAL A 1  312 ? 84.919  61.937  44.447 1.00 55.51  ? 312  VAL A CG2 1 
ATOM   2300 N  N   . TYR A 1  313 ? 85.487  65.725  45.957 1.00 55.37  ? 313  TYR A N   1 
ATOM   2301 C  CA  . TYR A 1  313 ? 86.218  66.933  46.152 1.00 54.37  ? 313  TYR A CA  1 
ATOM   2302 C  C   . TYR A 1  313 ? 87.621  66.768  46.778 1.00 54.23  ? 313  TYR A C   1 
ATOM   2303 O  O   . TYR A 1  313 ? 87.870  65.830  47.480 1.00 55.27  ? 313  TYR A O   1 
ATOM   2304 C  CB  . TYR A 1  313 ? 85.323  67.878  46.945 1.00 51.62  ? 313  TYR A CB  1 
ATOM   2305 C  CG  . TYR A 1  313 ? 85.070  67.417  48.403 1.00 48.85  ? 313  TYR A CG  1 
ATOM   2306 C  CD1 . TYR A 1  313 ? 84.135  66.478  48.733 1.00 46.44  ? 313  TYR A CD1 1 
ATOM   2307 C  CD2 . TYR A 1  313 ? 85.781  68.000  49.432 1.00 48.22  ? 313  TYR A CD2 1 
ATOM   2308 C  CE1 . TYR A 1  313 ? 83.901  66.144  50.068 1.00 46.85  ? 313  TYR A CE1 1 
ATOM   2309 C  CE2 . TYR A 1  313 ? 85.568  67.666  50.737 1.00 50.12  ? 313  TYR A CE2 1 
ATOM   2310 C  CZ  . TYR A 1  313 ? 84.635  66.744  51.064 1.00 48.53  ? 313  TYR A CZ  1 
ATOM   2311 O  OH  . TYR A 1  313 ? 84.546  66.487  52.427 1.00 52.26  ? 313  TYR A OH  1 
ATOM   2312 N  N   . GLY A 1  314 ? 88.508  67.715  46.517 1.00 54.46  ? 314  GLY A N   1 
ATOM   2313 C  CA  . GLY A 1  314 ? 89.849  67.657  47.020 1.00 54.99  ? 314  GLY A CA  1 
ATOM   2314 C  C   . GLY A 1  314 ? 89.873  67.859  48.507 1.00 57.09  ? 314  GLY A C   1 
ATOM   2315 O  O   . GLY A 1  314 ? 88.951  68.476  49.040 1.00 57.85  ? 314  GLY A O   1 
ATOM   2316 N  N   . TYR A 1  315 ? 90.909  67.307  49.158 1.00 57.43  ? 315  TYR A N   1 
ATOM   2317 C  CA  . TYR A 1  315 ? 91.134  67.424  50.592 1.00 57.16  ? 315  TYR A CA  1 
ATOM   2318 C  C   . TYR A 1  315 ? 92.617  67.512  50.914 1.00 57.61  ? 315  TYR A C   1 
ATOM   2319 O  O   . TYR A 1  315 ? 93.092  66.941  51.841 1.00 57.16  ? 315  TYR A O   1 
ATOM   2320 C  CB  . TYR A 1  315 ? 90.526  66.268  51.359 1.00 57.92  ? 315  TYR A CB  1 
ATOM   2321 C  CG  . TYR A 1  315 ? 90.064  66.674  52.743 1.00 65.76  ? 315  TYR A CG  1 
ATOM   2322 C  CD1 . TYR A 1  315 ? 88.958  67.490  52.893 1.00 55.41  ? 315  TYR A CD1 1 
ATOM   2323 C  CD2 . TYR A 1  315 ? 90.758  66.258  53.907 1.00 61.66  ? 315  TYR A CD2 1 
ATOM   2324 C  CE1 . TYR A 1  315 ? 88.534  67.902  54.141 1.00 62.86  ? 315  TYR A CE1 1 
ATOM   2325 C  CE2 . TYR A 1  315 ? 90.345  66.669  55.150 1.00 65.01  ? 315  TYR A CE2 1 
ATOM   2326 C  CZ  . TYR A 1  315 ? 89.229  67.495  55.252 1.00 65.33  ? 315  TYR A CZ  1 
ATOM   2327 O  OH  . TYR A 1  315 ? 88.830  67.936  56.463 1.00 69.54  ? 315  TYR A OH  1 
ATOM   2328 N  N   . GLY A 1  316 ? 93.350  68.246  50.097 1.00 58.28  ? 316  GLY A N   1 
ATOM   2329 C  CA  . GLY A 1  316 ? 94.754  68.468  50.343 1.00 57.25  ? 316  GLY A CA  1 
ATOM   2330 C  C   . GLY A 1  316 ? 95.682  67.371  49.934 1.00 58.63  ? 316  GLY A C   1 
ATOM   2331 O  O   . GLY A 1  316 ? 95.255  66.241  49.568 1.00 59.06  ? 316  GLY A O   1 
ATOM   2332 N  N   . VAL A 1  317 ? 96.973  67.721  49.965 1.00 58.38  ? 317  VAL A N   1 
ATOM   2333 C  CA  . VAL A 1  317 ? 97.975  66.731  49.669 1.00 56.93  ? 317  VAL A CA  1 
ATOM   2334 C  C   . VAL A 1  317 ? 98.139  65.827  50.888 1.00 57.59  ? 317  VAL A C   1 
ATOM   2335 O  O   . VAL A 1  317 ? 97.741  66.162  52.037 1.00 58.13  ? 317  VAL A O   1 
ATOM   2336 C  CB  . VAL A 1  317 ? 99.275  67.353  49.207 1.00 55.86  ? 317  VAL A CB  1 
ATOM   2337 C  CG1 . VAL A 1  317 ? 99.116  67.766  47.801 1.00 55.46  ? 317  VAL A CG1 1 
ATOM   2338 C  CG2 . VAL A 1  317 ? 99.634  68.555  49.989 1.00 56.03  ? 317  VAL A CG2 1 
ATOM   2339 N  N   . CYS A 1  318 ? 98.619  64.624  50.600 1.00 58.01  ? 318  CYS A N   1 
ATOM   2340 C  CA  . CYS A 1  318 ? 98.859  63.586  51.585 1.00 56.42  ? 318  CYS A CA  1 
ATOM   2341 C  C   . CYS A 1  318 ? 99.757  63.984  52.709 1.00 56.84  ? 318  CYS A C   1 
ATOM   2342 O  O   . CYS A 1  318 ? 99.693  63.434  53.795 1.00 71.89  ? 318  CYS A O   1 
ATOM   2343 C  CB  . CYS A 1  318 ? 99.418  62.414  50.865 1.00 57.26  ? 318  CYS A CB  1 
ATOM   2344 S  SG  . CYS A 1  318 ? 98.050  61.429  50.185 1.00 77.59  ? 318  CYS A SG  1 
ATOM   2345 N  N   . SER A 1  319 ? 100.571 64.989  52.446 1.00 56.38  ? 319  SER A N   1 
ATOM   2346 C  CA  . SER A 1  319 ? 101.502 65.509  53.415 1.00 55.20  ? 319  SER A CA  1 
ATOM   2347 C  C   . SER A 1  319 ? 100.860 66.524  54.371 1.00 55.38  ? 319  SER A C   1 
ATOM   2348 O  O   . SER A 1  319 ? 101.538 67.071  55.240 1.00 54.80  ? 319  SER A O   1 
ATOM   2349 C  CB  . SER A 1  319 ? 102.677 66.136  52.631 1.00 53.85  ? 319  SER A CB  1 
ATOM   2350 O  OG  . SER A 1  319 ? 102.555 67.520  52.329 1.00 58.54  ? 319  SER A OG  1 
ATOM   2351 N  N   . ASP A 1  320 ? 99.556  66.789  54.181 1.00 71.46  ? 320  ASP A N   1 
ATOM   2352 C  CA  . ASP A 1  320 ? 98.792  67.806  54.941 1.00 61.67  ? 320  ASP A CA  1 
ATOM   2353 C  C   . ASP A 1  320 ? 98.256  67.196  56.182 1.00 66.07  ? 320  ASP A C   1 
ATOM   2354 O  O   . ASP A 1  320 ? 97.643  66.128  56.138 1.00 64.52  ? 320  ASP A O   1 
ATOM   2355 C  CB  . ASP A 1  320 ? 97.570  68.313  54.121 1.00 71.28  ? 320  ASP A CB  1 
ATOM   2356 C  CG  . ASP A 1  320 ? 96.801  69.528  54.792 1.00 60.04  ? 320  ASP A CG  1 
ATOM   2357 O  OD1 . ASP A 1  320 ? 96.429  69.542  55.998 1.00 60.08  ? 320  ASP A OD1 1 
ATOM   2358 O  OD2 . ASP A 1  320 ? 96.562  70.511  54.068 1.00 59.84  ? 320  ASP A OD2 1 
ATOM   2359 N  N   . PRO A 1  321 ? 98.431  67.887  57.304 1.00 63.86  ? 321  PRO A N   1 
ATOM   2360 C  CA  . PRO A 1  321 ? 97.995  67.517  58.659 1.00 58.26  ? 321  PRO A CA  1 
ATOM   2361 C  C   . PRO A 1  321 ? 96.631  66.849  58.642 1.00 57.89  ? 321  PRO A C   1 
ATOM   2362 O  O   . PRO A 1  321 ? 96.345  65.889  59.370 1.00 61.99  ? 321  PRO A O   1 
ATOM   2363 C  CB  . PRO A 1  321 ? 97.952  68.863  59.384 1.00 61.47  ? 321  PRO A CB  1 
ATOM   2364 C  CG  . PRO A 1  321 ? 99.031  69.598  58.794 1.00 55.22  ? 321  PRO A CG  1 
ATOM   2365 C  CD  . PRO A 1  321 ? 98.947  69.257  57.284 1.00 64.30  ? 321  PRO A CD  1 
ATOM   2366 N  N   . ALA A 1  322 ? 95.786  67.373  57.774 1.00 58.55  ? 322  ALA A N   1 
ATOM   2367 C  CA  . ALA A 1  322 ? 94.420  66.898  57.604 1.00 57.37  ? 322  ALA A CA  1 
ATOM   2368 C  C   . ALA A 1  322 ? 94.268  65.464  57.091 1.00 56.78  ? 322  ALA A C   1 
ATOM   2369 O  O   . ALA A 1  322 ? 93.197  64.897  57.091 1.00 55.69  ? 322  ALA A O   1 
ATOM   2370 C  CB  . ALA A 1  322 ? 93.712  67.859  56.718 1.00 56.50  ? 322  ALA A CB  1 
ATOM   2371 N  N   . ASN A 1  323 ? 95.371  64.889  56.649 1.00 57.37  ? 323  ASN A N   1 
ATOM   2372 C  CA  . ASN A 1  323 ? 95.388  63.509  56.191 1.00 72.55  ? 323  ASN A CA  1 
ATOM   2373 C  C   . ASN A 1  323 ? 96.324  62.595  57.053 1.00 70.13  ? 323  ASN A C   1 
ATOM   2374 O  O   . ASN A 1  323 ? 96.747  61.498  56.661 1.00 64.89  ? 323  ASN A O   1 
ATOM   2375 C  CB  . ASN A 1  323 ? 95.731  63.523  54.710 1.00 62.15  ? 323  ASN A CB  1 
ATOM   2376 C  CG  . ASN A 1  323 ? 94.742  64.334  53.935 1.00 59.82  ? 323  ASN A CG  1 
ATOM   2377 O  OD1 . ASN A 1  323 ? 93.530  64.134  54.119 1.00 60.37  ? 323  ASN A OD1 1 
ATOM   2378 N  ND2 . ASN A 1  323 ? 95.227  65.268  53.072 1.00 58.35  ? 323  ASN A ND2 1 
ATOM   2379 N  N   . ALA A 1  324 ? 96.613  63.085  58.250 1.00 62.96  ? 324  ALA A N   1 
ATOM   2380 C  CA  . ALA A 1  324 ? 97.402  62.366  59.226 1.00 68.26  ? 324  ALA A CA  1 
ATOM   2381 C  C   . ALA A 1  324 ? 97.011  60.873  59.217 1.00 65.83  ? 324  ALA A C   1 
ATOM   2382 O  O   . ALA A 1  324 ? 97.863  60.005  58.978 1.00 74.99  ? 324  ALA A O   1 
ATOM   2383 C  CB  . ALA A 1  324 ? 97.139  62.995  60.648 1.00 64.94  ? 324  ALA A CB  1 
ATOM   2384 N  N   . TYR A 1  325 ? 95.719  60.622  59.462 1.00 63.21  ? 325  TYR A N   1 
ATOM   2385 C  CA  . TYR A 1  325 ? 95.064  59.310  59.524 1.00 59.79  ? 325  TYR A CA  1 
ATOM   2386 C  C   . TYR A 1  325 ? 94.568  58.654  58.221 1.00 58.54  ? 325  TYR A C   1 
ATOM   2387 O  O   . TYR A 1  325 ? 93.840  57.640  58.242 1.00 62.03  ? 325  TYR A O   1 
ATOM   2388 C  CB  . TYR A 1  325 ? 93.869  59.416  60.409 1.00 59.36  ? 325  TYR A CB  1 
ATOM   2389 C  CG  . TYR A 1  325 ? 94.115  60.137  61.694 1.00 81.53  ? 325  TYR A CG  1 
ATOM   2390 C  CD1 . TYR A 1  325 ? 94.895  59.584  62.687 1.00 88.97  ? 325  TYR A CD1 1 
ATOM   2391 C  CD2 . TYR A 1  325 ? 93.538  61.358  61.930 1.00 87.75  ? 325  TYR A CD2 1 
ATOM   2392 C  CE1 . TYR A 1  325 ? 95.095  60.229  63.884 1.00 92.51  ? 325  TYR A CE1 1 
ATOM   2393 C  CE2 . TYR A 1  325 ? 93.728  62.016  63.118 1.00 93.01  ? 325  TYR A CE2 1 
ATOM   2394 C  CZ  . TYR A 1  325 ? 94.511  61.454  64.100 1.00 95.29  ? 325  TYR A CZ  1 
ATOM   2395 O  OH  . TYR A 1  325 ? 94.728  62.151  65.280 1.00 96.55  ? 325  TYR A OH  1 
ATOM   2396 N  N   . SER A 1  326 ? 94.906  59.226  57.093 1.00 53.21  ? 326  SER A N   1 
ATOM   2397 C  CA  . SER A 1  326 ? 94.469  58.623  55.843 1.00 68.13  ? 326  SER A CA  1 
ATOM   2398 C  C   . SER A 1  326 ? 95.366  57.432  55.493 1.00 70.58  ? 326  SER A C   1 
ATOM   2399 O  O   . SER A 1  326 ? 96.614  57.552  55.304 1.00 64.73  ? 326  SER A O   1 
ATOM   2400 C  CB  . SER A 1  326 ? 94.499  59.672  54.727 1.00 54.68  ? 326  SER A CB  1 
ATOM   2401 O  OG  . SER A 1  326 ? 94.937  59.133  53.489 1.00 69.94  ? 326  SER A OG  1 
ATOM   2402 N  N   . LYS A 1  327 ? 94.759  56.263  55.401 1.00 68.12  ? 327  LYS A N   1 
ATOM   2403 C  CA  . LYS A 1  327 ? 95.586  55.115  55.065 1.00 70.58  ? 327  LYS A CA  1 
ATOM   2404 C  C   . LYS A 1  327 ? 96.226  55.215  53.668 1.00 72.69  ? 327  LYS A C   1 
ATOM   2405 O  O   . LYS A 1  327 ? 97.440  55.076  53.553 1.00 77.88  ? 327  LYS A O   1 
ATOM   2406 C  CB  . LYS A 1  327 ? 94.793  53.829  55.239 1.00 68.70  ? 327  LYS A CB  1 
ATOM   2407 C  CG  . LYS A 1  327 ? 94.329  53.613  56.683 1.00 68.34  ? 327  LYS A CG  1 
ATOM   2408 C  CD  . LYS A 1  327 ? 93.225  52.667  56.573 1.00 67.00  ? 327  LYS A CD  1 
ATOM   2409 C  CE  . LYS A 1  327 ? 92.637  52.329  57.870 1.00 78.30  ? 327  LYS A CE  1 
ATOM   2410 N  NZ  . LYS A 1  327 ? 91.594  51.275  57.510 1.00 85.07  ? 327  LYS A NZ  1 
ATOM   2411 N  N   . GLN A 1  328 ? 95.463  55.467  52.610 1.00 73.73  ? 328  GLN A N   1 
ATOM   2412 C  CA  . GLN A 1  328 ? 96.114  55.597  51.300 1.00 76.03  ? 328  GLN A CA  1 
ATOM   2413 C  C   . GLN A 1  328 ? 97.246  56.648  51.378 1.00 71.36  ? 328  GLN A C   1 
ATOM   2414 O  O   . GLN A 1  328 ? 98.209  56.622  50.588 1.00 76.70  ? 328  GLN A O   1 
ATOM   2415 C  CB  . GLN A 1  328 ? 95.123  56.001  50.200 1.00 73.97  ? 328  GLN A CB  1 
ATOM   2416 C  CG  . GLN A 1  328 ? 93.973  55.053  49.938 1.00 80.13  ? 328  GLN A CG  1 
ATOM   2417 C  CD  . GLN A 1  328 ? 92.757  55.786  49.349 1.00 86.43  ? 328  GLN A CD  1 
ATOM   2418 O  OE1 . GLN A 1  328 ? 91.784  55.152  48.876 1.00 83.43  ? 328  GLN A OE1 1 
ATOM   2419 N  NE2 . GLN A 1  328 ? 92.803  57.136  49.393 1.00 80.64  ? 328  GLN A NE2 1 
ATOM   2420 N  N   . CYS A 1  329 ? 97.168  57.566  52.318 1.00 66.92  ? 329  CYS A N   1 
ATOM   2421 C  CA  . CYS A 1  329 ? 98.260  58.533  52.398 1.00 75.77  ? 329  CYS A CA  1 
ATOM   2422 C  C   . CYS A 1  329 ? 99.513  58.014  53.167 1.00 75.42  ? 329  CYS A C   1 
ATOM   2423 O  O   . CYS A 1  329 ? 100.654 58.225  52.746 1.00 69.48  ? 329  CYS A O   1 
ATOM   2424 C  CB  . CYS A 1  329 ? 97.768  59.857  52.998 1.00 75.04  ? 329  CYS A CB  1 
ATOM   2425 S  SG  . CYS A 1  329 ? 96.917  61.086  51.904 1.00 83.40  ? 329  CYS A SG  1 
ATOM   2426 N  N   . ALA A 1  330 ? 99.305  57.337  54.293 1.00 82.49  ? 330  ALA A N   1 
ATOM   2427 C  CA  . ALA A 1  330 ? 100.433 56.796  55.057 1.00 83.06  ? 330  ALA A CA  1 
ATOM   2428 C  C   . ALA A 1  330 ? 101.201 55.809  54.166 1.00 85.34  ? 330  ALA A C   1 
ATOM   2429 O  O   . ALA A 1  330 ? 102.450 55.759  54.192 1.00 84.58  ? 330  ALA A O   1 
ATOM   2430 C  CB  . ALA A 1  330 ? 99.937  56.093  56.287 1.00 75.11  ? 330  ALA A CB  1 
ATOM   2431 N  N   . ALA A 1  331 ? 100.452 55.038  53.380 1.00 78.76  ? 331  ALA A N   1 
ATOM   2432 C  CA  . ALA A 1  331 ? 101.029 54.074  52.455 1.00 74.46  ? 331  ALA A CA  1 
ATOM   2433 C  C   . ALA A 1  331 ? 101.915 54.627  51.299 1.00 76.37  ? 331  ALA A C   1 
ATOM   2434 O  O   . ALA A 1  331 ? 102.011 53.965  50.258 1.00 80.43  ? 331  ALA A O   1 
ATOM   2435 C  CB  . ALA A 1  331 ? 99.930  53.246  51.869 1.00 59.89  ? 331  ALA A CB  1 
ATOM   2436 N  N   . LEU A 1  332 ? 102.581 55.778  51.459 1.00 71.76  ? 332  LEU A N   1 
ATOM   2437 C  CA  . LEU A 1  332 ? 103.425 56.330  50.378 1.00 76.15  ? 332  LEU A CA  1 
ATOM   2438 C  C   . LEU A 1  332 ? 104.734 56.802  50.943 1.00 76.26  ? 332  LEU A C   1 
ATOM   2439 O  O   . LEU A 1  332 ? 104.835 57.096  52.129 1.00 84.08  ? 332  LEU A O   1 
ATOM   2440 C  CB  . LEU A 1  332 ? 102.800 57.585  49.714 1.00 78.22  ? 332  LEU A CB  1 
ATOM   2441 C  CG  . LEU A 1  332 ? 101.400 57.820  49.074 1.00 83.28  ? 332  LEU A CG  1 
ATOM   2442 C  CD1 . LEU A 1  332 ? 101.179 59.315  49.162 1.00 80.07  ? 332  LEU A CD1 1 
ATOM   2443 C  CD2 . LEU A 1  332 ? 101.229 57.344  47.579 1.00 63.47  ? 332  LEU A CD2 1 
ATOM   2444 N  N   . ALA A 1  333 ? 105.721 56.945  50.072 1.00 78.41  ? 333  ALA A N   1 
ATOM   2445 C  CA  . ALA A 1  333 ? 107.051 57.433  50.457 1.00 76.53  ? 333  ALA A CA  1 
ATOM   2446 C  C   . ALA A 1  333 ? 107.004 58.876  50.982 1.00 79.90  ? 333  ALA A C   1 
ATOM   2447 O  O   . ALA A 1  333 ? 106.733 59.835  50.231 1.00 74.26  ? 333  ALA A O   1 
ATOM   2448 C  CB  . ALA A 1  333 ? 108.012 57.355  49.256 1.00 70.87  ? 333  ALA A CB  1 
ATOM   2449 N  N   . PRO A 1  334 ? 107.281 59.048  52.287 1.00 81.63  ? 334  PRO A N   1 
ATOM   2450 C  CA  . PRO A 1  334 ? 107.293 60.338  52.984 1.00 81.23  ? 334  PRO A CA  1 
ATOM   2451 C  C   . PRO A 1  334 ? 107.470 61.557  52.082 1.00 81.75  ? 334  PRO A C   1 
ATOM   2452 O  O   . PRO A 1  334 ? 106.746 62.568  52.230 1.00 79.28  ? 334  PRO A O   1 
ATOM   2453 C  CB  . PRO A 1  334 ? 108.453 60.168  53.982 1.00 74.70  ? 334  PRO A CB  1 
ATOM   2454 C  CG  . PRO A 1  334 ? 108.257 58.772  54.458 1.00 78.57  ? 334  PRO A CG  1 
ATOM   2455 C  CD  . PRO A 1  334 ? 107.771 57.981  53.188 1.00 82.10  ? 334  PRO A CD  1 
ATOM   2456 N  N   . ALA A 1  335 ? 108.447 61.455  51.169 1.00 84.82  ? 335  ALA A N   1 
ATOM   2457 C  CA  . ALA A 1  335 ? 108.801 62.535  50.228 1.00 85.49  ? 335  ALA A CA  1 
ATOM   2458 C  C   . ALA A 1  335 ? 107.805 62.706  49.052 1.00 85.56  ? 335  ALA A C   1 
ATOM   2459 O  O   . ALA A 1  335 ? 107.941 63.656  48.259 1.00 85.69  ? 335  ALA A O   1 
ATOM   2460 C  CB  . ALA A 1  335 ? 110.260 62.335  49.709 1.00 66.91  ? 335  ALA A CB  1 
ATOM   2461 N  N   . ASP A 1  336 ? 106.825 61.789  48.968 1.00 78.01  ? 336  ASP A N   1 
ATOM   2462 C  CA  . ASP A 1  336 ? 105.738 61.815  47.967 1.00 81.25  ? 336  ASP A CA  1 
ATOM   2463 C  C   . ASP A 1  336 ? 104.458 62.392  48.496 1.00 76.93  ? 336  ASP A C   1 
ATOM   2464 O  O   . ASP A 1  336 ? 103.632 62.867  47.736 1.00 77.88  ? 336  ASP A O   1 
ATOM   2465 C  CB  . ASP A 1  336 ? 105.321 60.425  47.545 1.00 81.84  ? 336  ASP A CB  1 
ATOM   2466 C  CG  . ASP A 1  336 ? 106.364 59.757  46.762 1.00 86.06  ? 336  ASP A CG  1 
ATOM   2467 O  OD1 . ASP A 1  336 ? 107.381 60.486  46.532 1.00 60.54  ? 336  ASP A OD1 1 
ATOM   2468 O  OD2 . ASP A 1  336 ? 106.135 58.547  46.398 1.00 81.69  ? 336  ASP A OD2 1 
ATOM   2469 N  N   . LYS A 1  337 ? 104.279 62.254  49.798 1.00 68.36  ? 337  LYS A N   1 
ATOM   2470 C  CA  . LYS A 1  337 ? 103.077 62.690  50.443 1.00 71.04  ? 337  LYS A CA  1 
ATOM   2471 C  C   . LYS A 1  337 ? 102.575 64.048  49.940 1.00 64.94  ? 337  LYS A C   1 
ATOM   2472 O  O   . LYS A 1  337 ? 101.385 64.220  49.725 1.00 63.33  ? 337  LYS A O   1 
ATOM   2473 C  CB  . LYS A 1  337 ? 103.277 62.684  51.966 1.00 64.52  ? 337  LYS A CB  1 
ATOM   2474 C  CG  . LYS A 1  337 ? 103.376 61.263  52.591 1.00 70.33  ? 337  LYS A CG  1 
ATOM   2475 C  CD  . LYS A 1  337 ? 103.141 61.338  54.156 1.00 73.47  ? 337  LYS A CD  1 
ATOM   2476 C  CE  . LYS A 1  337 ? 103.953 60.328  54.979 1.00 71.46  ? 337  LYS A CE  1 
ATOM   2477 N  NZ  . LYS A 1  337 ? 103.975 58.914  54.482 1.00 71.98  ? 337  LYS A NZ  1 
ATOM   2478 N  N   . GLY A 1  338 ? 103.503 64.963  49.692 1.00 67.30  ? 338  GLY A N   1 
ATOM   2479 C  CA  . GLY A 1  338 ? 103.198 66.317  49.259 1.00 56.81  ? 338  GLY A CA  1 
ATOM   2480 C  C   . GLY A 1  338 ? 103.020 66.594  47.759 1.00 58.01  ? 338  GLY A C   1 
ATOM   2481 O  O   . GLY A 1  338 ? 103.102 67.767  47.373 1.00 58.39  ? 338  GLY A O   1 
ATOM   2482 N  N   . HIS A 1  339 ? 102.774 65.563  46.935 1.00 56.08  ? 339  HIS A N   1 
ATOM   2483 C  CA  . HIS A 1  339 ? 102.505 65.790  45.540 1.00 56.02  ? 339  HIS A CA  1 
ATOM   2484 C  C   . HIS A 1  339 ? 101.403 64.844  45.106 1.00 56.58  ? 339  HIS A C   1 
ATOM   2485 O  O   . HIS A 1  339 ? 101.172 64.600  43.891 1.00 58.26  ? 339  HIS A O   1 
ATOM   2486 C  CB  . HIS A 1  339 ? 103.787 65.709  44.673 1.00 56.96  ? 339  HIS A CB  1 
ATOM   2487 C  CG  . HIS A 1  339 ? 104.201 64.317  44.278 1.00 68.86  ? 339  HIS A CG  1 
ATOM   2488 N  ND1 . HIS A 1  339 ? 105.441 63.788  44.602 1.00 59.05  ? 339  HIS A ND1 1 
ATOM   2489 C  CD2 . HIS A 1  339 ? 103.574 63.372  43.534 1.00 68.63  ? 339  HIS A CD2 1 
ATOM   2490 C  CE1 . HIS A 1  339 ? 105.547 62.583  44.071 1.00 68.32  ? 339  HIS A CE1 1 
ATOM   2491 N  NE2 . HIS A 1  339 ? 104.431 62.305  43.418 1.00 68.27  ? 339  HIS A NE2 1 
ATOM   2492 N  N   . TYR A 1  340 ? 100.717 64.296  46.114 1.00 56.00  ? 340  TYR A N   1 
ATOM   2493 C  CA  . TYR A 1  340 ? 99.529  63.437  45.905 1.00 65.03  ? 340  TYR A CA  1 
ATOM   2494 C  C   . TYR A 1  340 ? 98.299  64.106  46.590 1.00 69.67  ? 340  TYR A C   1 
ATOM   2495 O  O   . TYR A 1  340 ? 98.449  64.872  47.575 1.00 66.87  ? 340  TYR A O   1 
ATOM   2496 C  CB  . TYR A 1  340 ? 99.722  62.070  46.492 1.00 72.24  ? 340  TYR A CB  1 
ATOM   2497 C  CG  . TYR A 1  340 ? 100.382 61.120  45.552 1.00 77.93  ? 340  TYR A CG  1 
ATOM   2498 C  CD1 . TYR A 1  340 ? 101.800 61.038  45.462 1.00 76.77  ? 340  TYR A CD1 1 
ATOM   2499 C  CD2 . TYR A 1  340 ? 99.599  60.232  44.802 1.00 73.91  ? 340  TYR A CD2 1 
ATOM   2500 C  CE1 . TYR A 1  340 ? 102.399 60.069  44.654 1.00 65.85  ? 340  TYR A CE1 1 
ATOM   2501 C  CE2 . TYR A 1  340 ? 100.164 59.277  44.007 1.00 67.69  ? 340  TYR A CE2 1 
ATOM   2502 C  CZ  . TYR A 1  340 ? 101.557 59.180  43.923 1.00 71.63  ? 340  TYR A CZ  1 
ATOM   2503 O  OH  . TYR A 1  340 ? 102.073 58.187  43.118 1.00 68.20  ? 340  TYR A OH  1 
ATOM   2504 N  N   . LEU A 1  341 ? 97.087  63.816  46.103 1.00 66.06  ? 341  LEU A N   1 
ATOM   2505 C  CA  . LEU A 1  341 ? 95.917  64.504  46.644 1.00 61.62  ? 341  LEU A CA  1 
ATOM   2506 C  C   . LEU A 1  341 ? 94.849  63.604  47.214 1.00 63.63  ? 341  LEU A C   1 
ATOM   2507 O  O   . LEU A 1  341 ? 94.387  62.692  46.521 1.00 61.06  ? 341  LEU A O   1 
ATOM   2508 C  CB  . LEU A 1  341 ? 95.330  65.376  45.547 1.00 68.44  ? 341  LEU A CB  1 
ATOM   2509 C  CG  . LEU A 1  341 ? 94.064  66.133  45.880 1.00 67.09  ? 341  LEU A CG  1 
ATOM   2510 C  CD1 . LEU A 1  341 ? 94.371  67.085  46.974 1.00 60.74  ? 341  LEU A CD1 1 
ATOM   2511 C  CD2 . LEU A 1  341 ? 93.551  66.840  44.653 1.00 55.99  ? 341  LEU A CD2 1 
ATOM   2512 N  N   . ALA A 1  342 ? 94.485  63.853  48.488 1.00 55.54  ? 342  ALA A N   1 
ATOM   2513 C  CA  . ALA A 1  342 ? 93.466  63.090  49.209 1.00 54.55  ? 342  ALA A CA  1 
ATOM   2514 C  C   . ALA A 1  342 ? 92.168  63.713  48.665 1.00 55.42  ? 342  ALA A C   1 
ATOM   2515 O  O   . ALA A 1  342 ? 92.081  64.930  48.438 1.00 55.51  ? 342  ALA A O   1 
ATOM   2516 C  CB  . ALA A 1  342 ? 93.604  63.318  50.739 1.00 54.63  ? 342  ALA A CB  1 
ATOM   2517 N  N   . ARG A 1  343 ? 91.173  62.878  48.422 1.00 54.72  ? 343  ARG A N   1 
ATOM   2518 C  CA  . ARG A 1  343 ? 89.902  63.339  47.883 1.00 52.80  ? 343  ARG A CA  1 
ATOM   2519 C  C   . ARG A 1  343 ? 88.829  62.699  48.705 1.00 53.93  ? 343  ARG A C   1 
ATOM   2520 O  O   . ARG A 1  343 ? 89.043  61.591  49.187 1.00 53.71  ? 343  ARG A O   1 
ATOM   2521 C  CB  . ARG A 1  343 ? 89.679  62.825  46.477 1.00 50.75  ? 343  ARG A CB  1 
ATOM   2522 C  CG  . ARG A 1  343 ? 90.195  63.684  45.414 1.00 51.10  ? 343  ARG A CG  1 
ATOM   2523 C  CD  . ARG A 1  343 ? 90.634  62.752  44.383 1.00 70.21  ? 343  ARG A CD  1 
ATOM   2524 N  NE  . ARG A 1  343 ? 89.835  62.761  43.188 1.00 75.62  ? 343  ARG A NE  1 
ATOM   2525 C  CZ  . ARG A 1  343 ? 89.848  61.761  42.337 1.00 75.15  ? 343  ARG A CZ  1 
ATOM   2526 N  NH1 . ARG A 1  343 ? 90.604  60.710  42.589 1.00 68.85  ? 343  ARG A NH1 1 
ATOM   2527 N  NH2 . ARG A 1  343 ? 89.140  61.830  41.231 1.00 76.72  ? 343  ARG A NH2 1 
ATOM   2528 N  N   . LYS A 1  344 ? 87.672  63.380  48.847 1.00 55.07  ? 344  LYS A N   1 
ATOM   2529 C  CA  . LYS A 1  344 ? 86.492  62.784  49.538 1.00 54.78  ? 344  LYS A CA  1 
ATOM   2530 C  C   . LYS A 1  344 ? 85.249  62.894  48.685 1.00 55.00  ? 344  LYS A C   1 
ATOM   2531 O  O   . LYS A 1  344 ? 85.302  63.079  47.442 1.00 56.20  ? 344  LYS A O   1 
ATOM   2532 C  CB  . LYS A 1  344 ? 86.288  63.450  50.890 1.00 53.03  ? 344  LYS A CB  1 
ATOM   2533 C  CG  . LYS A 1  344 ? 87.579  63.385  51.697 1.00 50.92  ? 344  LYS A CG  1 
ATOM   2534 C  CD  . LYS A 1  344 ? 87.184  63.563  53.084 1.00 52.03  ? 344  LYS A CD  1 
ATOM   2535 C  CE  . LYS A 1  344 ? 88.328  63.332  53.925 1.00 52.57  ? 344  LYS A CE  1 
ATOM   2536 N  NZ  . LYS A 1  344 ? 88.083  64.105  55.081 1.00 53.55  ? 344  LYS A NZ  1 
ATOM   2537 N  N   . TYR A 1  345 ? 84.105  62.770  49.300 1.00 55.13  ? 345  TYR A N   1 
ATOM   2538 C  CA  . TYR A 1  345 ? 82.991  62.984  48.431 1.00 56.22  ? 345  TYR A CA  1 
ATOM   2539 C  C   . TYR A 1  345 ? 81.670  63.207  49.178 1.00 57.75  ? 345  TYR A C   1 
ATOM   2540 O  O   . TYR A 1  345 ? 81.587  63.008  50.401 1.00 58.16  ? 345  TYR A O   1 
ATOM   2541 C  CB  . TYR A 1  345 ? 82.908  61.809  47.455 1.00 55.34  ? 345  TYR A CB  1 
ATOM   2542 C  CG  . TYR A 1  345 ? 82.257  60.549  48.040 1.00 67.81  ? 345  TYR A CG  1 
ATOM   2543 C  CD1 . TYR A 1  345 ? 80.887  60.523  48.328 1.00 71.75  ? 345  TYR A CD1 1 
ATOM   2544 C  CD2 . TYR A 1  345 ? 83.008  59.377  48.303 1.00 71.44  ? 345  TYR A CD2 1 
ATOM   2545 C  CE1 . TYR A 1  345 ? 80.258  59.378  48.860 1.00 50.01  ? 345  TYR A CE1 1 
ATOM   2546 C  CE2 . TYR A 1  345 ? 82.393  58.222  48.828 1.00 48.57  ? 345  TYR A CE2 1 
ATOM   2547 C  CZ  . TYR A 1  345 ? 81.004  58.233  49.104 1.00 70.66  ? 345  TYR A CZ  1 
ATOM   2548 O  OH  . TYR A 1  345 ? 80.319  57.127  49.571 1.00 79.74  ? 345  TYR A OH  1 
ATOM   2549 N  N   . VAL A 1  346 ? 80.647  63.674  48.450 1.00 57.31  ? 346  VAL A N   1 
ATOM   2550 C  CA  . VAL A 1  346 ? 79.346  63.788  49.070 1.00 57.05  ? 346  VAL A CA  1 
ATOM   2551 C  C   . VAL A 1  346 ? 78.252  63.580  48.057 1.00 57.88  ? 346  VAL A C   1 
ATOM   2552 O  O   . VAL A 1  346 ? 78.418  63.811  46.812 1.00 59.92  ? 346  VAL A O   1 
ATOM   2553 C  CB  . VAL A 1  346 ? 79.138  65.131  49.824 1.00 57.07  ? 346  VAL A CB  1 
ATOM   2554 C  CG1 . VAL A 1  346 ? 79.173  66.236  48.856 1.00 57.74  ? 346  VAL A CG1 1 
ATOM   2555 C  CG2 . VAL A 1  346 ? 77.804  65.134  50.567 1.00 57.35  ? 346  VAL A CG2 1 
ATOM   2556 N  N   . VAL A 1  347 ? 77.161  63.050  48.584 1.00 56.76  ? 347  VAL A N   1 
ATOM   2557 C  CA  . VAL A 1  347 ? 75.952  62.845  47.798 1.00 56.17  ? 347  VAL A CA  1 
ATOM   2558 C  C   . VAL A 1  347 ? 74.948  63.571  48.644 1.00 56.16  ? 347  VAL A C   1 
ATOM   2559 O  O   . VAL A 1  347 ? 74.857  63.338  49.865 1.00 54.94  ? 347  VAL A O   1 
ATOM   2560 C  CB  . VAL A 1  347 ? 75.503  61.361  47.672 1.00 55.39  ? 347  VAL A CB  1 
ATOM   2561 C  CG1 . VAL A 1  347 ? 74.083  61.311  47.092 1.00 51.92  ? 347  VAL A CG1 1 
ATOM   2562 C  CG2 . VAL A 1  347 ? 76.471  60.599  46.742 1.00 54.92  ? 347  VAL A CG2 1 
ATOM   2563 N  N   . ASP A 1  348 ? 74.184  64.457  48.015 1.00 55.59  ? 348  ASP A N   1 
ATOM   2564 C  CA  . ASP A 1  348 ? 73.239  65.229  48.826 1.00 56.15  ? 348  ASP A CA  1 
ATOM   2565 C  C   . ASP A 1  348 ? 71.916  65.363  48.118 1.00 56.35  ? 348  ASP A C   1 
ATOM   2566 O  O   . ASP A 1  348 ? 71.838  65.310  46.906 1.00 56.74  ? 348  ASP A O   1 
ATOM   2567 C  CB  . ASP A 1  348 ? 73.878  66.613  49.078 1.00 57.66  ? 348  ASP A CB  1 
ATOM   2568 C  CG  . ASP A 1  348 ? 72.979  67.596  49.810 1.00 57.00  ? 348  ASP A CG  1 
ATOM   2569 O  OD1 . ASP A 1  348 ? 72.462  67.176  50.855 1.00 58.49  ? 348  ASP A OD1 1 
ATOM   2570 O  OD2 . ASP A 1  348 ? 72.837  68.774  49.345 1.00 53.02  ? 348  ASP A OD2 1 
ATOM   2571 N  N   . ASP A 1  349 ? 70.868  65.477  48.904 1.00 55.63  ? 349  ASP A N   1 
ATOM   2572 C  CA  . ASP A 1  349 ? 69.523  65.705  48.400 1.00 54.72  ? 349  ASP A CA  1 
ATOM   2573 C  C   . ASP A 1  349 ? 68.845  66.511  49.494 1.00 53.22  ? 349  ASP A C   1 
ATOM   2574 O  O   . ASP A 1  349 ? 68.805  66.093  50.654 1.00 77.15  ? 349  ASP A O   1 
ATOM   2575 C  CB  . ASP A 1  349 ? 68.754  64.413  48.170 1.00 54.25  ? 349  ASP A CB  1 
ATOM   2576 C  CG  . ASP A 1  349 ? 67.361  64.660  47.588 1.00 82.55  ? 349  ASP A CG  1 
ATOM   2577 O  OD1 . ASP A 1  349 ? 66.400  64.862  48.397 1.00 74.77  ? 349  ASP A OD1 1 
ATOM   2578 O  OD2 . ASP A 1  349 ? 67.248  64.656  46.325 1.00 57.08  ? 349  ASP A OD2 1 
ATOM   2579 N  N   . GLU A 1  350 ? 68.304  67.648  49.120 1.00 51.09  ? 350  GLU A N   1 
ATOM   2580 C  CA  . GLU A 1  350 ? 67.695  68.539  50.079 1.00 50.25  ? 350  GLU A CA  1 
ATOM   2581 C  C   . GLU A 1  350 ? 66.492  69.253  49.552 1.00 50.60  ? 350  GLU A C   1 
ATOM   2582 O  O   . GLU A 1  350 ? 66.368  69.562  48.344 1.00 51.45  ? 350  GLU A O   1 
ATOM   2583 C  CB  . GLU A 1  350 ? 68.684  69.638  50.441 1.00 51.68  ? 350  GLU A CB  1 
ATOM   2584 C  CG  . GLU A 1  350 ? 70.000  69.188  50.932 1.00 52.72  ? 350  GLU A CG  1 
ATOM   2585 C  CD  . GLU A 1  350 ? 70.898  70.326  51.413 1.00 54.37  ? 350  GLU A CD  1 
ATOM   2586 O  OE1 . GLU A 1  350 ? 70.470  71.151  52.257 1.00 66.06  ? 350  GLU A OE1 1 
ATOM   2587 O  OE2 . GLU A 1  350 ? 72.060  70.360  50.973 1.00 79.37  ? 350  GLU A OE2 1 
ATOM   2588 N  N   . LYS A 1  351 ? 65.605  69.583  50.445 1.00 49.19  ? 351  LYS A N   1 
ATOM   2589 C  CA  . LYS A 1  351 ? 64.473  70.339  49.995 1.00 50.36  ? 351  LYS A CA  1 
ATOM   2590 C  C   . LYS A 1  351 ? 63.948  71.198  51.125 1.00 51.10  ? 351  LYS A C   1 
ATOM   2591 O  O   . LYS A 1  351 ? 63.751  70.649  52.235 1.00 53.31  ? 351  LYS A O   1 
ATOM   2592 C  CB  . LYS A 1  351 ? 63.421  69.407  49.499 1.00 51.08  ? 351  LYS A CB  1 
ATOM   2593 C  CG  . LYS A 1  351 ? 62.114  70.079  49.326 1.00 52.38  ? 351  LYS A CG  1 
ATOM   2594 C  CD  . LYS A 1  351 ? 61.097  69.118  48.744 1.00 54.42  ? 351  LYS A CD  1 
ATOM   2595 C  CE  . LYS A 1  351 ? 60.463  68.156  49.809 1.00 54.19  ? 351  LYS A CE  1 
ATOM   2596 N  NZ  . LYS A 1  351 ? 59.126  67.717  49.280 1.00 54.83  ? 351  LYS A NZ  1 
ATOM   2597 N  N   . LEU A 1  352 ? 63.781  72.518  50.856 1.00 49.59  ? 352  LEU A N   1 
ATOM   2598 C  CA  . LEU A 1  352 ? 63.275  73.480  51.824 1.00 48.28  ? 352  LEU A CA  1 
ATOM   2599 C  C   . LEU A 1  352 ? 62.114  74.388  51.465 1.00 49.23  ? 352  LEU A C   1 
ATOM   2600 O  O   . LEU A 1  352 ? 61.849  74.671  50.300 1.00 48.99  ? 352  LEU A O   1 
ATOM   2601 C  CB  . LEU A 1  352 ? 64.419  74.338  52.358 1.00 48.32  ? 352  LEU A CB  1 
ATOM   2602 C  CG  . LEU A 1  352 ? 65.002  75.764  52.069 1.00 46.41  ? 352  LEU A CG  1 
ATOM   2603 C  CD1 . LEU A 1  352 ? 64.068  76.986  52.417 1.00 44.45  ? 352  LEU A CD1 1 
ATOM   2604 C  CD2 . LEU A 1  352 ? 66.279  75.901  52.880 1.00 35.81  ? 352  LEU A CD2 1 
ATOM   2605 N  N   . GLN A 1  353 ? 61.380  74.806  52.505 1.00 50.58  ? 353  GLN A N   1 
ATOM   2606 C  CA  . GLN A 1  353 ? 60.306  75.762  52.322 1.00 51.37  ? 353  GLN A CA  1 
ATOM   2607 C  C   . GLN A 1  353 ? 60.631  76.871  53.240 1.00 52.23  ? 353  GLN A C   1 
ATOM   2608 O  O   . GLN A 1  353 ? 61.147  76.646  54.322 1.00 52.32  ? 353  GLN A O   1 
ATOM   2609 C  CB  . GLN A 1  353 ? 58.969  75.235  52.701 1.00 52.65  ? 353  GLN A CB  1 
ATOM   2610 C  CG  . GLN A 1  353 ? 58.938  73.820  53.199 1.00 54.17  ? 353  GLN A CG  1 
ATOM   2611 C  CD  . GLN A 1  353 ? 59.006  72.830  52.129 1.00 51.38  ? 353  GLN A CD  1 
ATOM   2612 O  OE1 . GLN A 1  353 ? 59.336  71.701  52.370 1.00 48.51  ? 353  GLN A OE1 1 
ATOM   2613 N  NE2 . GLN A 1  353 ? 58.734  73.260  50.903 1.00 83.61  ? 353  GLN A NE2 1 
ATOM   2614 N  N   . ASN A 1  354 ? 60.347  78.092  52.785 1.00 53.70  ? 354  ASN A N   1 
ATOM   2615 C  CA  . ASN A 1  354 ? 60.653  79.326  53.524 1.00 53.19  ? 354  ASN A CA  1 
ATOM   2616 C  C   . ASN A 1  354 ? 59.510  80.279  53.294 1.00 53.54  ? 354  ASN A C   1 
ATOM   2617 O  O   . ASN A 1  354 ? 59.147  80.599  52.131 1.00 54.99  ? 354  ASN A O   1 
ATOM   2618 C  CB  . ASN A 1  354 ? 61.912  79.885  52.912 1.00 53.98  ? 354  ASN A CB  1 
ATOM   2619 C  CG  . ASN A 1  354 ? 62.460  81.115  53.597 1.00 54.79  ? 354  ASN A CG  1 
ATOM   2620 O  OD1 . ASN A 1  354 ? 63.436  81.691  53.060 1.00 54.10  ? 354  ASN A OD1 1 
ATOM   2621 N  ND2 . ASN A 1  354 ? 61.910  81.507  54.780 1.00 53.28  ? 354  ASN A ND2 1 
ATOM   2622 N  N   . PHE A 1  355 ? 58.900  80.694  54.394 1.00 52.84  ? 355  PHE A N   1 
ATOM   2623 C  CA  . PHE A 1  355 ? 57.819  81.654  54.313 1.00 51.84  ? 355  PHE A CA  1 
ATOM   2624 C  C   . PHE A 1  355 ? 58.188  82.923  55.076 1.00 52.56  ? 355  PHE A C   1 
ATOM   2625 O  O   . PHE A 1  355 ? 58.831  82.883  56.142 1.00 53.28  ? 355  PHE A O   1 
ATOM   2626 C  CB  . PHE A 1  355 ? 56.582  81.018  54.872 1.00 53.23  ? 355  PHE A CB  1 
ATOM   2627 C  CG  . PHE A 1  355 ? 55.435  81.965  55.032 1.00 53.87  ? 355  PHE A CG  1 
ATOM   2628 C  CD1 . PHE A 1  355 ? 54.680  82.364  53.937 1.00 51.97  ? 355  PHE A CD1 1 
ATOM   2629 C  CD2 . PHE A 1  355 ? 55.217  82.596  56.255 1.00 53.98  ? 355  PHE A CD2 1 
ATOM   2630 C  CE1 . PHE A 1  355 ? 53.753  83.391  54.045 1.00 49.88  ? 355  PHE A CE1 1 
ATOM   2631 C  CE2 . PHE A 1  355 ? 54.272  83.637  56.346 1.00 53.55  ? 355  PHE A CE2 1 
ATOM   2632 C  CZ  . PHE A 1  355 ? 53.557  84.026  55.230 1.00 49.89  ? 355  PHE A CZ  1 
ATOM   2633 N  N   . SER A 1  356 ? 57.802  84.074  54.522 1.00 53.54  ? 356  SER A N   1 
ATOM   2634 C  CA  . SER A 1  356 ? 58.117  85.369  55.142 1.00 54.15  ? 356  SER A CA  1 
ATOM   2635 C  C   . SER A 1  356 ? 57.067  86.395  54.905 1.00 54.71  ? 356  SER A C   1 
ATOM   2636 O  O   . SER A 1  356 ? 56.470  86.423  53.829 1.00 57.02  ? 356  SER A O   1 
ATOM   2637 C  CB  . SER A 1  356 ? 59.419  85.941  54.586 1.00 54.86  ? 356  SER A CB  1 
ATOM   2638 O  OG  . SER A 1  356 ? 60.454  84.964  54.535 1.00 58.86  ? 356  SER A OG  1 
ATOM   2639 N  N   . VAL A 1  357 ? 56.840  87.236  55.915 1.00 54.78  ? 357  VAL A N   1 
ATOM   2640 C  CA  . VAL A 1  357 ? 55.908  88.368  55.840 1.00 54.96  ? 357  VAL A CA  1 
ATOM   2641 C  C   . VAL A 1  357 ? 56.505  89.396  56.771 1.00 55.66  ? 357  VAL A C   1 
ATOM   2642 O  O   . VAL A 1  357 ? 56.945  89.051  57.852 1.00 55.35  ? 357  VAL A O   1 
ATOM   2643 C  CB  . VAL A 1  357 ? 54.494  88.133  56.459 1.00 56.40  ? 357  VAL A CB  1 
ATOM   2644 C  CG1 . VAL A 1  357 ? 53.410  88.733  55.582 1.00 55.96  ? 357  VAL A CG1 1 
ATOM   2645 C  CG2 . VAL A 1  357 ? 54.250  86.724  56.741 1.00 55.88  ? 357  VAL A CG2 1 
ATOM   2646 N  N   . ASP A 1  358 ? 56.538  90.648  56.345 1.00 56.18  ? 358  ASP A N   1 
ATOM   2647 C  CA  . ASP A 1  358 ? 57.021  91.750  57.179 1.00 56.65  ? 358  ASP A CA  1 
ATOM   2648 C  C   . ASP A 1  358 ? 55.897  92.754  56.968 1.00 58.50  ? 358  ASP A C   1 
ATOM   2649 O  O   . ASP A 1  358 ? 55.457  93.002  55.826 1.00 57.67  ? 358  ASP A O   1 
ATOM   2650 C  CB  . ASP A 1  358 ? 58.312  92.360  56.657 1.00 66.34  ? 358  ASP A CB  1 
ATOM   2651 C  CG  . ASP A 1  358 ? 58.837  93.454  57.536 1.00 58.54  ? 358  ASP A CG  1 
ATOM   2652 O  OD1 . ASP A 1  358 ? 58.403  93.642  58.684 1.00 74.16  ? 358  ASP A OD1 1 
ATOM   2653 O  OD2 . ASP A 1  358 ? 59.719  94.143  57.081 1.00 50.50  ? 358  ASP A OD2 1 
ATOM   2654 N  N   . THR A 1  359 ? 55.373  93.269  58.074 1.00 62.60  ? 359  THR A N   1 
ATOM   2655 C  CA  . THR A 1  359 ? 54.315  94.205  57.963 1.00 59.01  ? 359  THR A CA  1 
ATOM   2656 C  C   . THR A 1  359 ? 54.742  95.390  58.741 1.00 62.70  ? 359  THR A C   1 
ATOM   2657 O  O   . THR A 1  359 ? 55.293  95.251  59.821 1.00 59.59  ? 359  THR A O   1 
ATOM   2658 C  CB  . THR A 1  359 ? 53.103  93.646  58.501 1.00 62.02  ? 359  THR A CB  1 
ATOM   2659 O  OG1 . THR A 1  359 ? 53.010  92.285  58.081 1.00 71.95  ? 359  THR A OG1 1 
ATOM   2660 C  CG2 . THR A 1  359 ? 51.927  94.396  57.932 1.00 56.23  ? 359  THR A CG2 1 
ATOM   2661 N  N   . GLN A 1  360 ? 54.537  96.552  58.160 1.00 54.84  ? 360  GLN A N   1 
ATOM   2662 C  CA  . GLN A 1  360 ? 54.950  97.765  58.792 1.00 61.91  ? 360  GLN A CA  1 
ATOM   2663 C  C   . GLN A 1  360 ? 53.983  98.908  58.539 1.00 63.12  ? 360  GLN A C   1 
ATOM   2664 O  O   . GLN A 1  360 ? 53.276  98.949  57.525 1.00 64.39  ? 360  GLN A O   1 
ATOM   2665 C  CB  . GLN A 1  360 ? 56.355  98.116  58.322 1.00 59.96  ? 360  GLN A CB  1 
ATOM   2666 C  CG  . GLN A 1  360 ? 56.642  97.675  56.918 1.00 64.57  ? 360  GLN A CG  1 
ATOM   2667 C  CD  . GLN A 1  360 ? 58.134  97.844  56.490 1.00 62.83  ? 360  GLN A CD  1 
ATOM   2668 O  OE1 . GLN A 1  360 ? 58.551  98.877  55.920 1.00 60.98  ? 360  GLN A OE1 1 
ATOM   2669 N  NE2 . GLN A 1  360 ? 58.924  96.815  56.763 1.00 52.72  ? 360  GLN A NE2 1 
ATOM   2670 N  N   . LEU A 1  361 ? 53.930  99.800  59.524 1.00 67.34  ? 361  LEU A N   1 
ATOM   2671 C  CA  . LEU A 1  361 ? 53.075  100.982 59.540 1.00 60.52  ? 361  LEU A CA  1 
ATOM   2672 C  C   . LEU A 1  361 ? 54.025  102.114 59.705 1.00 58.68  ? 361  LEU A C   1 
ATOM   2673 O  O   . LEU A 1  361 ? 54.835  102.080 60.638 1.00 59.91  ? 361  LEU A O   1 
ATOM   2674 C  CB  . LEU A 1  361 ? 52.169  100.965 60.747 1.00 59.23  ? 361  LEU A CB  1 
ATOM   2675 C  CG  . LEU A 1  361 ? 51.456  102.301 60.792 1.00 71.10  ? 361  LEU A CG  1 
ATOM   2676 C  CD1 . LEU A 1  361 ? 50.046  102.136 60.225 1.00 60.23  ? 361  LEU A CD1 1 
ATOM   2677 C  CD2 . LEU A 1  361 ? 51.455  102.804 62.203 1.00 73.17  ? 361  LEU A CD2 1 
ATOM   2678 N  N   . GLN A 1  362 ? 53.964  103.086 58.791 1.00 61.88  ? 362  GLN A N   1 
ATOM   2679 C  CA  . GLN A 1  362 ? 54.850  104.276 58.815 1.00 72.10  ? 362  GLN A CA  1 
ATOM   2680 C  C   . GLN A 1  362 ? 53.941  105.463 59.173 1.00 77.51  ? 362  GLN A C   1 
ATOM   2681 O  O   . GLN A 1  362 ? 52.880  105.676 58.533 1.00 79.36  ? 362  GLN A O   1 
ATOM   2682 C  CB  . GLN A 1  362 ? 55.519  104.482 57.427 1.00 56.13  ? 362  GLN A CB  1 
ATOM   2683 C  CG  . GLN A 1  362 ? 56.327  105.739 57.183 1.00 56.07  ? 362  GLN A CG  1 
ATOM   2684 C  CD  . GLN A 1  362 ? 56.670  105.915 55.689 1.00 71.87  ? 362  GLN A CD  1 
ATOM   2685 O  OE1 . GLN A 1  362 ? 57.631  105.309 55.165 1.00 79.10  ? 362  GLN A OE1 1 
ATOM   2686 N  NE2 . GLN A 1  362 ? 55.874  106.732 54.988 1.00 62.51  ? 362  GLN A NE2 1 
ATOM   2687 N  N   . SER A 1  363 ? 54.328  106.215 60.207 1.00 80.32  ? 363  SER A N   1 
ATOM   2688 C  CA  . SER A 1  363 ? 53.514  107.346 60.658 1.00 72.15  ? 363  SER A CA  1 
ATOM   2689 C  C   . SER A 1  363 ? 54.411  108.538 60.603 1.00 73.45  ? 363  SER A C   1 
ATOM   2690 O  O   . SER A 1  363 ? 55.442  108.549 61.278 1.00 81.10  ? 363  SER A O   1 
ATOM   2691 C  CB  . SER A 1  363 ? 53.045  107.115 62.099 1.00 71.01  ? 363  SER A CB  1 
ATOM   2692 O  OG  . SER A 1  363 ? 52.473  105.812 62.317 1.00 64.70  ? 363  SER A OG  1 
ATOM   2693 N  N   . LYS A 1  364 ? 54.063  109.505 59.753 1.00 71.96  ? 364  LYS A N   1 
ATOM   2694 C  CA  . LYS A 1  364 ? 54.828  110.746 59.637 1.00 69.08  ? 364  LYS A CA  1 
ATOM   2695 C  C   . LYS A 1  364 ? 54.009  111.723 60.506 1.00 81.20  ? 364  LYS A C   1 
ATOM   2696 O  O   . LYS A 1  364 ? 52.757  111.658 60.526 1.00 75.64  ? 364  LYS A O   1 
ATOM   2697 C  CB  . LYS A 1  364 ? 54.823  111.306 58.202 1.00 71.96  ? 364  LYS A CB  1 
ATOM   2698 C  CG  . LYS A 1  364 ? 55.456  110.504 57.051 1.00 74.37  ? 364  LYS A CG  1 
ATOM   2699 C  CD  . LYS A 1  364 ? 56.884  110.951 56.823 1.00 75.24  ? 364  LYS A CD  1 
ATOM   2700 C  CE  . LYS A 1  364 ? 57.309  110.732 55.371 1.00 84.53  ? 364  LYS A CE  1 
ATOM   2701 N  NZ  . LYS A 1  364 ? 58.350  111.766 54.929 1.00 90.16  ? 364  LYS A NZ  1 
ATOM   2702 N  N   . PHE A 1  365 ? 54.694  112.593 61.251 1.00 85.77  ? 365  PHE A N   1 
ATOM   2703 C  CA  . PHE A 1  365 ? 54.019  113.619 62.054 1.00 88.38  ? 365  PHE A CA  1 
ATOM   2704 C  C   . PHE A 1  365 ? 55.025  114.501 62.717 1.00 92.27  ? 365  PHE A C   1 
ATOM   2705 O  O   . PHE A 1  365 ? 56.210  114.170 62.817 1.00 93.94  ? 365  PHE A O   1 
ATOM   2706 C  CB  . PHE A 1  365 ? 53.081  113.047 63.129 1.00 87.27  ? 365  PHE A CB  1 
ATOM   2707 C  CG  . PHE A 1  365 ? 53.754  112.133 64.125 1.00 90.20  ? 365  PHE A CG  1 
ATOM   2708 C  CD1 . PHE A 1  365 ? 54.726  112.616 65.010 1.00 89.55  ? 365  PHE A CD1 1 
ATOM   2709 C  CD2 . PHE A 1  365 ? 53.442  110.755 64.145 1.00 92.55  ? 365  PHE A CD2 1 
ATOM   2710 C  CE1 . PHE A 1  365 ? 55.391  111.733 65.899 1.00 91.40  ? 365  PHE A CE1 1 
ATOM   2711 C  CE2 . PHE A 1  365 ? 54.094  109.874 65.020 1.00 89.04  ? 365  PHE A CE2 1 
ATOM   2712 C  CZ  . PHE A 1  365 ? 55.077  110.368 65.899 1.00 82.73  ? 365  PHE A CZ  1 
ATOM   2713 N  N   . ALA A 1  366 ? 54.544  115.650 63.170 1.00 100.16 ? 366  ALA A N   1 
ATOM   2714 C  CA  . ALA A 1  366 ? 55.422  116.588 63.861 1.00 95.91  ? 366  ALA A CA  1 
ATOM   2715 C  C   . ALA A 1  366 ? 55.168  116.748 65.377 1.00 92.15  ? 366  ALA A C   1 
ATOM   2716 O  O   . ALA A 1  366 ? 54.121  116.357 66.005 1.00 76.76  ? 366  ALA A O   1 
ATOM   2717 C  CB  . ALA A 1  366 ? 55.408  117.957 63.167 1.00 91.01  ? 366  ALA A CB  1 
ATOM   2718 N  N   . THR A 1  367 ? 56.207  117.324 65.936 1.00 88.43  ? 367  THR A N   1 
ATOM   2719 C  CA  . THR A 1  367 ? 56.325  117.581 67.338 1.00 89.64  ? 367  THR A CA  1 
ATOM   2720 C  C   . THR A 1  367 ? 56.955  118.969 67.307 1.00 96.54  ? 367  THR A C   1 
ATOM   2721 O  O   . THR A 1  367 ? 58.189  119.141 67.382 1.00 97.59  ? 367  THR A O   1 
ATOM   2722 C  CB  . THR A 1  367 ? 57.239  116.487 67.924 1.00 85.33  ? 367  THR A CB  1 
ATOM   2723 O  OG1 . THR A 1  367 ? 56.521  115.809 68.945 1.00 83.94  ? 367  THR A OG1 1 
ATOM   2724 C  CG2 . THR A 1  367 ? 58.585  117.022 68.433 1.00 74.66  ? 367  THR A CG2 1 
ATOM   2725 N  N   . GLY A 1  368 ? 56.089  119.964 67.136 1.00 94.27  ? 368  GLY A N   1 
ATOM   2726 C  CA  . GLY A 1  368 ? 56.570  121.318 67.058 1.00 98.29  ? 368  GLY A CA  1 
ATOM   2727 C  C   . GLY A 1  368 ? 57.461  121.491 65.853 1.00 97.90  ? 368  GLY A C   1 
ATOM   2728 O  O   . GLY A 1  368 ? 56.972  121.473 64.724 1.00 101.95 ? 368  GLY A O   1 
ATOM   2729 N  N   . ASP A 1  369 ? 58.760  121.671 66.078 1.00 99.91  ? 369  ASP A N   1 
ATOM   2730 C  CA  . ASP A 1  369 ? 59.667  121.852 64.962 1.00 105.24 ? 369  ASP A CA  1 
ATOM   2731 C  C   . ASP A 1  369 ? 60.474  120.620 64.641 1.00 105.21 ? 369  ASP A C   1 
ATOM   2732 O  O   . ASP A 1  369 ? 61.498  120.660 63.933 1.00 105.88 ? 369  ASP A O   1 
ATOM   2733 C  CB  . ASP A 1  369 ? 60.585  123.036 65.209 1.00 108.19 ? 369  ASP A CB  1 
ATOM   2734 C  CG  . ASP A 1  369 ? 60.216  124.197 64.331 1.00 110.17 ? 369  ASP A CG  1 
ATOM   2735 O  OD1 . ASP A 1  369 ? 61.131  124.854 63.776 1.00 111.32 ? 369  ASP A OD1 1 
ATOM   2736 O  OD2 . ASP A 1  369 ? 58.989  124.423 64.191 1.00 102.47 ? 369  ASP A OD2 1 
ATOM   2737 N  N   . ILE A 1  370 ? 59.965  119.520 65.163 1.00 105.32 ? 370  ILE A N   1 
ATOM   2738 C  CA  . ILE A 1  370 ? 60.569  118.230 64.995 1.00 106.34 ? 370  ILE A CA  1 
ATOM   2739 C  C   . ILE A 1  370 ? 59.645  117.310 64.212 1.00 104.06 ? 370  ILE A C   1 
ATOM   2740 O  O   . ILE A 1  370 ? 58.507  117.029 64.624 1.00 105.85 ? 370  ILE A O   1 
ATOM   2741 C  CB  . ILE A 1  370 ? 60.925  117.645 66.372 1.00 102.95 ? 370  ILE A CB  1 
ATOM   2742 C  CG1 . ILE A 1  370 ? 62.252  118.261 66.852 1.00 108.78 ? 370  ILE A CG1 1 
ATOM   2743 C  CG2 . ILE A 1  370 ? 61.042  116.189 66.278 1.00 103.74 ? 370  ILE A CG2 1 
ATOM   2744 C  CD1 . ILE A 1  370 ? 62.932  117.550 68.020 1.00 102.88 ? 370  ILE A CD1 1 
ATOM   2745 N  N   . ASP A 1  371 ? 60.129  116.877 63.051 1.00 101.17 ? 371  ASP A N   1 
ATOM   2746 C  CA  . ASP A 1  371 ? 59.360  115.962 62.215 1.00 99.45  ? 371  ASP A CA  1 
ATOM   2747 C  C   . ASP A 1  371 ? 59.784  114.536 62.394 1.00 96.30  ? 371  ASP A C   1 
ATOM   2748 O  O   . ASP A 1  371 ? 60.970  114.225 62.533 1.00 93.09  ? 371  ASP A O   1 
ATOM   2749 C  CB  . ASP A 1  371 ? 59.479  116.327 60.766 1.00 97.87  ? 371  ASP A CB  1 
ATOM   2750 C  CG  . ASP A 1  371 ? 58.567  117.449 60.412 1.00 103.29 ? 371  ASP A CG  1 
ATOM   2751 O  OD1 . ASP A 1  371 ? 57.342  117.352 60.712 1.00 102.08 ? 371  ASP A OD1 1 
ATOM   2752 O  OD2 . ASP A 1  371 ? 59.082  118.428 59.843 1.00 102.94 ? 371  ASP A OD2 1 
ATOM   2753 N  N   . HIS A 1  372 ? 58.798  113.657 62.402 1.00 99.22  ? 372  HIS A N   1 
ATOM   2754 C  CA  . HIS A 1  372 ? 59.096  112.253 62.602 1.00 99.38  ? 372  HIS A CA  1 
ATOM   2755 C  C   . HIS A 1  372 ? 58.580  111.302 61.560 1.00 93.95  ? 372  HIS A C   1 
ATOM   2756 O  O   . HIS A 1  372 ? 57.484  111.470 60.984 1.00 97.06  ? 372  HIS A O   1 
ATOM   2757 C  CB  . HIS A 1  372 ? 58.533  111.743 63.928 1.00 98.71  ? 372  HIS A CB  1 
ATOM   2758 C  CG  . HIS A 1  372 ? 58.768  112.656 65.080 1.00 103.18 ? 372  HIS A CG  1 
ATOM   2759 N  ND1 . HIS A 1  372 ? 58.001  112.613 66.215 1.00 106.64 ? 372  HIS A ND1 1 
ATOM   2760 C  CD2 . HIS A 1  372 ? 59.640  113.676 65.237 1.00 102.72 ? 372  HIS A CD2 1 
ATOM   2761 C  CE1 . HIS A 1  372 ? 58.379  113.583 67.030 1.00 104.11 ? 372  HIS A CE1 1 
ATOM   2762 N  NE2 . HIS A 1  372 ? 59.367  114.241 66.458 1.00 101.82 ? 372  HIS A NE2 1 
ATOM   2763 N  N   . THR A 1  373 ? 59.400  110.293 61.339 1.00 81.50  ? 373  THR A N   1 
ATOM   2764 C  CA  . THR A 1  373 ? 58.989  109.228 60.503 1.00 75.33  ? 373  THR A CA  1 
ATOM   2765 C  C   . THR A 1  373 ? 59.165  108.071 61.507 1.00 69.85  ? 373  THR A C   1 
ATOM   2766 O  O   . THR A 1  373 ? 60.266  107.731 61.998 1.00 62.98  ? 373  THR A O   1 
ATOM   2767 C  CB  . THR A 1  373 ? 59.817  109.178 59.244 1.00 77.11  ? 373  THR A CB  1 
ATOM   2768 O  OG1 . THR A 1  373 ? 59.696  110.437 58.551 1.00 78.93  ? 373  THR A OG1 1 
ATOM   2769 C  CG2 . THR A 1  373 ? 59.284  108.070 58.342 1.00 79.76  ? 373  THR A CG2 1 
ATOM   2770 N  N   . LEU A 1  374 ? 58.023  107.527 61.872 1.00 67.45  ? 374  LEU A N   1 
ATOM   2771 C  CA  . LEU A 1  374 ? 57.972  106.500 62.882 1.00 71.11  ? 374  LEU A CA  1 
ATOM   2772 C  C   . LEU A 1  374 ? 57.615  105.158 62.356 1.00 73.33  ? 374  LEU A C   1 
ATOM   2773 O  O   . LEU A 1  374 ? 56.442  104.909 61.966 1.00 65.22  ? 374  LEU A O   1 
ATOM   2774 C  CB  . LEU A 1  374 ? 56.934  106.854 63.943 1.00 72.36  ? 374  LEU A CB  1 
ATOM   2775 C  CG  . LEU A 1  374 ? 56.666  105.760 64.968 1.00 61.15  ? 374  LEU A CG  1 
ATOM   2776 C  CD1 . LEU A 1  374 ? 57.799  105.725 65.902 1.00 63.49  ? 374  LEU A CD1 1 
ATOM   2777 C  CD2 . LEU A 1  374 ? 55.366  106.048 65.676 1.00 62.27  ? 374  LEU A CD2 1 
ATOM   2778 N  N   . LEU A 1  375 ? 58.596  104.263 62.414 1.00 70.49  ? 375  LEU A N   1 
ATOM   2779 C  CA  . LEU A 1  375 ? 58.329  102.948 61.903 1.00 65.24  ? 375  LEU A CA  1 
ATOM   2780 C  C   . LEU A 1  375 ? 58.021  101.968 62.986 1.00 63.22  ? 375  LEU A C   1 
ATOM   2781 O  O   . LEU A 1  375 ? 58.703  101.858 64.020 1.00 68.93  ? 375  LEU A O   1 
ATOM   2782 C  CB  . LEU A 1  375 ? 59.496  102.467 61.044 1.00 66.67  ? 375  LEU A CB  1 
ATOM   2783 C  CG  . LEU A 1  375 ? 59.380  101.142 60.282 1.00 54.52  ? 375  LEU A CG  1 
ATOM   2784 C  CD1 . LEU A 1  375 ? 58.242  101.148 59.193 1.00 67.57  ? 375  LEU A CD1 1 
ATOM   2785 C  CD2 . LEU A 1  375 ? 60.735  100.969 59.635 1.00 54.58  ? 375  LEU A CD2 1 
ATOM   2786 N  N   . THR A 1  376 ? 56.957  101.242 62.772 1.00 58.28  ? 376  THR A N   1 
ATOM   2787 C  CA  . THR A 1  376 ? 56.650  100.250 63.756 1.00 69.41  ? 376  THR A CA  1 
ATOM   2788 C  C   . THR A 1  376 ? 56.228  99.070  62.900 1.00 71.65  ? 376  THR A C   1 
ATOM   2789 O  O   . THR A 1  376 ? 55.362  99.250  62.018 1.00 73.37  ? 376  THR A O   1 
ATOM   2790 C  CB  . THR A 1  376 ? 55.465  100.709 64.677 1.00 72.42  ? 376  THR A CB  1 
ATOM   2791 O  OG1 . THR A 1  376 ? 54.247  100.795 63.904 1.00 70.29  ? 376  THR A OG1 1 
ATOM   2792 C  CG2 . THR A 1  376 ? 55.785  102.082 65.290 1.00 77.26  ? 376  THR A CG2 1 
ATOM   2793 N  N   . GLY A 1  377 ? 56.828  97.887  63.151 1.00 68.11  ? 377  GLY A N   1 
ATOM   2794 C  CA  . GLY A 1  377 ? 56.463  96.689  62.408 1.00 61.61  ? 377  GLY A CA  1 
ATOM   2795 C  C   . GLY A 1  377 ? 56.721  95.326  63.020 1.00 64.46  ? 377  GLY A C   1 
ATOM   2796 O  O   . GLY A 1  377 ? 57.470  95.225  64.003 1.00 67.71  ? 377  GLY A O   1 
ATOM   2797 N  N   . VAL A 1  378 ? 56.096  94.296  62.430 1.00 56.28  ? 378  VAL A N   1 
ATOM   2798 C  CA  . VAL A 1  378 ? 56.285  92.923  62.857 1.00 68.54  ? 378  VAL A CA  1 
ATOM   2799 C  C   . VAL A 1  378 ? 56.757  92.096  61.643 1.00 58.70  ? 378  VAL A C   1 
ATOM   2800 O  O   . VAL A 1  378 ? 56.199  92.164  60.566 1.00 59.36  ? 378  VAL A O   1 
ATOM   2801 C  CB  . VAL A 1  378 ? 54.994  92.335  63.546 1.00 68.87  ? 378  VAL A CB  1 
ATOM   2802 C  CG1 . VAL A 1  378 ? 54.527  93.305  64.630 1.00 65.64  ? 378  VAL A CG1 1 
ATOM   2803 C  CG2 . VAL A 1  378 ? 53.885  92.113  62.572 1.00 64.23  ? 378  VAL A CG2 1 
ATOM   2804 N  N   . ASP A 1  379 ? 57.820  91.328  61.864 1.00 58.51  ? 379  ASP A N   1 
ATOM   2805 C  CA  . ASP A 1  379 ? 58.505  90.511  60.869 1.00 56.46  ? 379  ASP A CA  1 
ATOM   2806 C  C   . ASP A 1  379 ? 58.465  89.067  61.309 1.00 57.41  ? 379  ASP A C   1 
ATOM   2807 O  O   . ASP A 1  379 ? 58.760  88.755  62.491 1.00 58.18  ? 379  ASP A O   1 
ATOM   2808 C  CB  . ASP A 1  379 ? 59.966  91.027  60.781 1.00 73.71  ? 379  ASP A CB  1 
ATOM   2809 C  CG  . ASP A 1  379 ? 60.811  90.320  59.734 1.00 72.63  ? 379  ASP A CG  1 
ATOM   2810 O  OD1 . ASP A 1  379 ? 60.202  89.787  58.791 1.00 68.62  ? 379  ASP A OD1 1 
ATOM   2811 O  OD2 . ASP A 1  379 ? 62.079  90.319  59.839 1.00 65.34  ? 379  ASP A OD2 1 
ATOM   2812 N  N   . PHE A 1  380 ? 58.104  88.185  60.375 1.00 55.40  ? 380  PHE A N   1 
ATOM   2813 C  CA  . PHE A 1  380 ? 58.083  86.795  60.675 1.00 54.05  ? 380  PHE A CA  1 
ATOM   2814 C  C   . PHE A 1  380 ? 58.619  85.881  59.579 1.00 55.49  ? 380  PHE A C   1 
ATOM   2815 O  O   . PHE A 1  380 ? 58.394  86.141  58.412 1.00 57.93  ? 380  PHE A O   1 
ATOM   2816 C  CB  . PHE A 1  380 ? 56.635  86.401  60.955 1.00 52.58  ? 380  PHE A CB  1 
ATOM   2817 C  CG  . PHE A 1  380 ? 56.428  84.895  61.145 1.00 49.56  ? 380  PHE A CG  1 
ATOM   2818 C  CD1 . PHE A 1  380 ? 56.849  84.256  62.319 1.00 46.60  ? 380  PHE A CD1 1 
ATOM   2819 C  CD2 . PHE A 1  380 ? 55.942  84.126  60.119 1.00 45.66  ? 380  PHE A CD2 1 
ATOM   2820 C  CE1 . PHE A 1  380 ? 56.786  82.883  62.434 1.00 44.79  ? 380  PHE A CE1 1 
ATOM   2821 C  CE2 . PHE A 1  380 ? 55.891  82.699  60.232 1.00 45.87  ? 380  PHE A CE2 1 
ATOM   2822 C  CZ  . PHE A 1  380 ? 56.301  82.100  61.360 1.00 47.59  ? 380  PHE A CZ  1 
ATOM   2823 N  N   . MET A 1  381 ? 59.304  84.797  59.944 1.00 55.54  ? 381  MET A N   1 
ATOM   2824 C  CA  . MET A 1  381 ? 59.675  83.766  58.951 1.00 55.84  ? 381  MET A CA  1 
ATOM   2825 C  C   . MET A 1  381 ? 59.803  82.422  59.605 1.00 55.16  ? 381  MET A C   1 
ATOM   2826 O  O   . MET A 1  381 ? 60.031  82.374  60.773 1.00 56.21  ? 381  MET A O   1 
ATOM   2827 C  CB  . MET A 1  381 ? 61.017  84.039  58.212 1.00 56.44  ? 381  MET A CB  1 
ATOM   2828 C  CG  . MET A 1  381 ? 62.365  84.007  58.970 1.00 55.82  ? 381  MET A CG  1 
ATOM   2829 S  SD  . MET A 1  381 ? 63.305  82.404  59.370 1.00 60.48  ? 381  MET A SD  1 
ATOM   2830 C  CE  . MET A 1  381 ? 62.513  81.402  58.356 1.00 60.20  ? 381  MET A CE  1 
ATOM   2831 N  N   . ARG A 1  382 ? 59.647  81.363  58.823 1.00 53.47  ? 382  ARG A N   1 
ATOM   2832 C  CA  . ARG A 1  382 ? 59.914  79.998  59.236 1.00 52.71  ? 382  ARG A CA  1 
ATOM   2833 C  C   . ARG A 1  382 ? 60.619  79.335  58.015 1.00 53.14  ? 382  ARG A C   1 
ATOM   2834 O  O   . ARG A 1  382 ? 60.274  79.593  56.834 1.00 53.83  ? 382  ARG A O   1 
ATOM   2835 C  CB  . ARG A 1  382 ? 58.668  79.174  59.562 1.00 52.88  ? 382  ARG A CB  1 
ATOM   2836 C  CG  . ARG A 1  382 ? 57.666  78.951  58.409 1.00 55.08  ? 382  ARG A CG  1 
ATOM   2837 C  CD  . ARG A 1  382 ? 56.657  77.851  58.745 1.00 53.15  ? 382  ARG A CD  1 
ATOM   2838 N  NE  . ARG A 1  382 ? 57.226  76.576  58.398 1.00 52.88  ? 382  ARG A NE  1 
ATOM   2839 C  CZ  . ARG A 1  382 ? 56.978  75.932  57.254 1.00 52.91  ? 382  ARG A CZ  1 
ATOM   2840 N  NH1 . ARG A 1  382 ? 56.129  76.492  56.393 1.00 47.36  ? 382  ARG A NH1 1 
ATOM   2841 N  NH2 . ARG A 1  382 ? 57.605  74.735  56.972 1.00 52.53  ? 382  ARG A NH2 1 
ATOM   2842 N  N   . MET A 1  383 ? 61.621  78.517  58.300 1.00 50.77  ? 383  MET A N   1 
ATOM   2843 C  CA  . MET A 1  383 ? 62.316  77.819  57.289 1.00 51.29  ? 383  MET A CA  1 
ATOM   2844 C  C   . MET A 1  383 ? 62.456  76.370  57.699 1.00 52.81  ? 383  MET A C   1 
ATOM   2845 O  O   . MET A 1  383 ? 62.693  76.036  58.873 1.00 53.39  ? 383  MET A O   1 
ATOM   2846 C  CB  . MET A 1  383 ? 63.673  78.401  57.148 1.00 52.03  ? 383  MET A CB  1 
ATOM   2847 C  CG  . MET A 1  383 ? 64.468  77.849  55.967 1.00 50.49  ? 383  MET A CG  1 
ATOM   2848 S  SD  . MET A 1  383 ? 65.550  76.357  56.413 1.00 56.16  ? 383  MET A SD  1 
ATOM   2849 C  CE  . MET A 1  383 ? 66.504  76.954  57.992 1.00 47.92  ? 383  MET A CE  1 
ATOM   2850 N  N   . ARG A 1  384 ? 62.316  75.511  56.709 1.00 51.01  ? 384  ARG A N   1 
ATOM   2851 C  CA  . ARG A 1  384 ? 62.476  74.127  56.942 1.00 52.04  ? 384  ARG A CA  1 
ATOM   2852 C  C   . ARG A 1  384 ? 63.333  73.568  55.852 1.00 55.92  ? 384  ARG A C   1 
ATOM   2853 O  O   . ARG A 1  384 ? 63.070  73.823  54.639 1.00 55.51  ? 384  ARG A O   1 
ATOM   2854 C  CB  . ARG A 1  384 ? 61.186  73.442  56.832 1.00 52.43  ? 384  ARG A CB  1 
ATOM   2855 C  CG  . ARG A 1  384 ? 61.197  71.946  57.170 1.00 49.88  ? 384  ARG A CG  1 
ATOM   2856 C  CD  . ARG A 1  384 ? 59.760  71.660  57.838 1.00 54.19  ? 384  ARG A CD  1 
ATOM   2857 N  NE  . ARG A 1  384 ? 59.345  70.337  57.480 1.00 54.81  ? 384  ARG A NE  1 
ATOM   2858 C  CZ  . ARG A 1  384 ? 58.493  69.629  58.148 1.00 53.94  ? 384  ARG A CZ  1 
ATOM   2859 N  NH1 . ARG A 1  384 ? 57.930  70.130  59.224 1.00 57.03  ? 384  ARG A NH1 1 
ATOM   2860 N  NH2 . ARG A 1  384 ? 58.313  68.387  57.767 1.00 56.72  ? 384  ARG A NH2 1 
ATOM   2861 N  N   . ASN A 1  385 ? 64.342  72.774  56.271 1.00 56.39  ? 385  ASN A N   1 
ATOM   2862 C  CA  . ASN A 1  385 ? 65.195  72.144  55.299 1.00 55.43  ? 385  ASN A CA  1 
ATOM   2863 C  C   . ASN A 1  385 ? 65.414  70.700  55.684 1.00 56.00  ? 385  ASN A C   1 
ATOM   2864 O  O   . ASN A 1  385 ? 65.822  70.373  56.758 1.00 53.29  ? 385  ASN A O   1 
ATOM   2865 C  CB  . ASN A 1  385 ? 66.517  72.903  55.143 1.00 54.12  ? 385  ASN A CB  1 
ATOM   2866 C  CG  . ASN A 1  385 ? 67.304  72.421  53.978 1.00 52.57  ? 385  ASN A CG  1 
ATOM   2867 O  OD1 . ASN A 1  385 ? 66.748  72.115  52.936 1.00 52.69  ? 385  ASN A OD1 1 
ATOM   2868 N  ND2 . ASN A 1  385 ? 68.600  72.336  54.143 1.00 52.88  ? 385  ASN A ND2 1 
ATOM   2869 N  N   . ASP A 1  386 ? 65.133  69.834  54.724 1.00 58.04  ? 386  ASP A N   1 
ATOM   2870 C  CA  . ASP A 1  386 ? 65.247  68.422  54.934 1.00 58.49  ? 386  ASP A CA  1 
ATOM   2871 C  C   . ASP A 1  386 ? 66.474  67.830  54.160 1.00 58.17  ? 386  ASP A C   1 
ATOM   2872 O  O   . ASP A 1  386 ? 66.542  67.727  52.938 1.00 57.78  ? 386  ASP A O   1 
ATOM   2873 C  CB  . ASP A 1  386 ? 63.901  67.818  54.542 1.00 58.83  ? 386  ASP A CB  1 
ATOM   2874 C  CG  . ASP A 1  386 ? 63.656  66.446  55.151 1.00 59.32  ? 386  ASP A CG  1 
ATOM   2875 O  OD1 . ASP A 1  386 ? 64.528  65.591  54.980 1.00 64.80  ? 386  ASP A OD1 1 
ATOM   2876 O  OD2 . ASP A 1  386 ? 62.587  66.211  55.778 1.00 65.19  ? 386  ASP A OD2 1 
ATOM   2877 N  N   . ILE A 1  387 ? 67.458  67.413  54.927 1.00 57.33  ? 387  ILE A N   1 
ATOM   2878 C  CA  . ILE A 1  387 ? 68.663  66.921  54.328 1.00 56.44  ? 387  ILE A CA  1 
ATOM   2879 C  C   . ILE A 1  387 ? 68.811  65.444  54.478 1.00 56.30  ? 387  ILE A C   1 
ATOM   2880 O  O   . ILE A 1  387 ? 68.526  64.890  55.529 1.00 71.57  ? 387  ILE A O   1 
ATOM   2881 C  CB  . ILE A 1  387 ? 69.958  67.667  54.941 1.00 55.14  ? 387  ILE A CB  1 
ATOM   2882 C  CG1 . ILE A 1  387 ? 69.856  69.167  54.700 1.00 52.29  ? 387  ILE A CG1 1 
ATOM   2883 C  CG2 . ILE A 1  387 ? 71.233  67.131  54.322 1.00 54.11  ? 387  ILE A CG2 1 
ATOM   2884 C  CD1 . ILE A 1  387 ? 70.178  69.955  55.860 1.00 49.37  ? 387  ILE A CD1 1 
ATOM   2885 N  N   . ASN A 1  388 ? 69.260  64.854  53.380 1.00 55.47  ? 388  ASN A N   1 
ATOM   2886 C  CA  . ASN A 1  388 ? 69.564  63.449  53.244 1.00 55.12  ? 388  ASN A CA  1 
ATOM   2887 C  C   . ASN A 1  388 ? 70.853  63.269  52.348 1.00 53.55  ? 388  ASN A C   1 
ATOM   2888 O  O   . ASN A 1  388 ? 70.806  63.180  51.120 1.00 52.69  ? 388  ASN A O   1 
ATOM   2889 C  CB  . ASN A 1  388 ? 68.389  62.695  52.631 1.00 68.26  ? 388  ASN A CB  1 
ATOM   2890 C  CG  . ASN A 1  388 ? 68.703  61.198  52.371 1.00 63.53  ? 388  ASN A CG  1 
ATOM   2891 O  OD1 . ASN A 1  388 ? 68.111  60.603  51.503 1.00 60.33  ? 388  ASN A OD1 1 
ATOM   2892 N  ND2 . ASN A 1  388 ? 69.638  60.600  53.140 1.00 82.87  ? 388  ASN A ND2 1 
ATOM   2893 N  N   . ALA A 1  389 ? 71.988  63.200  53.018 1.00 51.74  ? 389  ALA A N   1 
ATOM   2894 C  CA  . ALA A 1  389 ? 73.257  63.062  52.357 1.00 51.88  ? 389  ALA A CA  1 
ATOM   2895 C  C   . ALA A 1  389 ? 74.055  61.865  52.886 1.00 51.84  ? 389  ALA A C   1 
ATOM   2896 O  O   . ALA A 1  389 ? 73.623  61.114  53.733 1.00 69.19  ? 389  ALA A O   1 
ATOM   2897 C  CB  . ALA A 1  389 ? 74.078  64.324  52.523 1.00 48.70  ? 389  ALA A CB  1 
ATOM   2898 N  N   . TRP A 1  390 ? 75.267  61.779  52.360 1.00 77.63  ? 390  TRP A N   1 
ATOM   2899 C  CA  . TRP A 1  390 ? 76.227  60.733  52.616 1.00 68.68  ? 390  TRP A CA  1 
ATOM   2900 C  C   . TRP A 1  390 ? 77.619  61.313  52.384 1.00 62.99  ? 390  TRP A C   1 
ATOM   2901 O  O   . TRP A 1  390 ? 77.865  61.912  51.353 1.00 59.67  ? 390  TRP A O   1 
ATOM   2902 C  CB  . TRP A 1  390 ? 75.983  59.631  51.593 1.00 74.31  ? 390  TRP A CB  1 
ATOM   2903 C  CG  . TRP A 1  390 ? 76.643  58.343  51.921 1.00 79.80  ? 390  TRP A CG  1 
ATOM   2904 C  CD1 . TRP A 1  390 ? 77.951  57.964  51.665 1.00 73.40  ? 390  TRP A CD1 1 
ATOM   2905 C  CD2 . TRP A 1  390 ? 76.031  57.253  52.559 1.00 78.61  ? 390  TRP A CD2 1 
ATOM   2906 N  NE1 . TRP A 1  390 ? 78.159  56.707  52.100 1.00 75.38  ? 390  TRP A NE1 1 
ATOM   2907 C  CE2 . TRP A 1  390 ? 77.001  56.234  52.654 1.00 84.44  ? 390  TRP A CE2 1 
ATOM   2908 C  CE3 . TRP A 1  390 ? 74.748  57.031  53.051 1.00 75.50  ? 390  TRP A CE3 1 
ATOM   2909 C  CZ2 . TRP A 1  390 ? 76.718  54.988  53.234 1.00 76.68  ? 390  TRP A CZ2 1 
ATOM   2910 C  CZ3 . TRP A 1  390 ? 74.464  55.813  53.612 1.00 73.66  ? 390  TRP A CZ3 1 
ATOM   2911 C  CH2 . TRP A 1  390 ? 75.444  54.796  53.700 1.00 69.33  ? 390  TRP A CH2 1 
ATOM   2912 N  N   . PHE A 1  391 ? 78.529  61.127  53.324 1.00 64.07  ? 391  PHE A N   1 
ATOM   2913 C  CA  . PHE A 1  391 ? 79.886  61.630  53.152 1.00 68.90  ? 391  PHE A CA  1 
ATOM   2914 C  C   . PHE A 1  391 ? 81.052  60.629  53.219 1.00 67.39  ? 391  PHE A C   1 
ATOM   2915 O  O   . PHE A 1  391 ? 81.192  59.878  54.184 1.00 63.81  ? 391  PHE A O   1 
ATOM   2916 C  CB  . PHE A 1  391 ? 80.188  62.737  54.161 1.00 53.46  ? 391  PHE A CB  1 
ATOM   2917 C  CG  . PHE A 1  391 ? 79.311  63.953  54.018 1.00 56.02  ? 391  PHE A CG  1 
ATOM   2918 C  CD1 . PHE A 1  391 ? 77.970  63.925  54.417 1.00 53.61  ? 391  PHE A CD1 1 
ATOM   2919 C  CD2 . PHE A 1  391 ? 79.852  65.189  53.537 1.00 56.33  ? 391  PHE A CD2 1 
ATOM   2920 C  CE1 . PHE A 1  391 ? 77.174  65.130  54.351 1.00 54.41  ? 391  PHE A CE1 1 
ATOM   2921 C  CE2 . PHE A 1  391 ? 79.067  66.365  53.483 1.00 55.80  ? 391  PHE A CE2 1 
ATOM   2922 C  CZ  . PHE A 1  391 ? 77.724  66.322  53.888 1.00 54.81  ? 391  PHE A CZ  1 
ATOM   2923 N  N   . GLY A 1  392 ? 81.888  60.666  52.173 1.00 66.62  ? 392  GLY A N   1 
ATOM   2924 C  CA  . GLY A 1  392 ? 83.088  59.872  52.135 1.00 59.74  ? 392  GLY A CA  1 
ATOM   2925 C  C   . GLY A 1  392 ? 84.014  60.444  53.201 1.00 65.56  ? 392  GLY A C   1 
ATOM   2926 O  O   . GLY A 1  392 ? 84.109  61.655  53.333 1.00 56.63  ? 392  GLY A O   1 
ATOM   2927 N  N   . TYR A 1  393 ? 84.686  59.583  53.978 1.00 67.73  ? 393  TYR A N   1 
ATOM   2928 C  CA  . TYR A 1  393 ? 85.629  60.059  54.982 1.00 62.85  ? 393  TYR A CA  1 
ATOM   2929 C  C   . TYR A 1  393 ? 87.020  59.795  54.468 1.00 65.26  ? 393  TYR A C   1 
ATOM   2930 O  O   . TYR A 1  393 ? 87.233  59.656  53.256 1.00 59.50  ? 393  TYR A O   1 
ATOM   2931 C  CB  . TYR A 1  393 ? 85.492  59.331  56.305 1.00 55.93  ? 393  TYR A CB  1 
ATOM   2932 C  CG  . TYR A 1  393 ? 84.108  59.330  56.812 1.00 55.93  ? 393  TYR A CG  1 
ATOM   2933 C  CD1 . TYR A 1  393 ? 83.347  60.508  56.864 1.00 66.41  ? 393  TYR A CD1 1 
ATOM   2934 C  CD2 . TYR A 1  393 ? 83.536  58.157  57.208 1.00 53.36  ? 393  TYR A CD2 1 
ATOM   2935 C  CE1 . TYR A 1  393 ? 82.016  60.492  57.307 1.00 58.20  ? 393  TYR A CE1 1 
ATOM   2936 C  CE2 . TYR A 1  393 ? 82.215  58.111  57.659 1.00 72.90  ? 393  TYR A CE2 1 
ATOM   2937 C  CZ  . TYR A 1  393 ? 81.467  59.274  57.706 1.00 68.84  ? 393  TYR A CZ  1 
ATOM   2938 O  OH  . TYR A 1  393 ? 80.185  59.143  58.144 1.00 66.94  ? 393  TYR A OH  1 
ATOM   2939 N  N   . ASP A 1  394 ? 87.962  59.683  55.401 1.00 67.61  ? 394  ASP A N   1 
ATOM   2940 C  CA  . ASP A 1  394 ? 89.314  59.472  54.990 1.00 64.51  ? 394  ASP A CA  1 
ATOM   2941 C  C   . ASP A 1  394 ? 89.655  58.516  53.910 1.00 65.46  ? 394  ASP A C   1 
ATOM   2942 O  O   . ASP A 1  394 ? 90.444  58.904  53.034 1.00 77.30  ? 394  ASP A O   1 
ATOM   2943 C  CB  . ASP A 1  394 ? 90.246  59.306  56.173 1.00 64.05  ? 394  ASP A CB  1 
ATOM   2944 C  CG  . ASP A 1  394 ? 90.914  60.635  56.516 1.00 78.94  ? 394  ASP A CG  1 
ATOM   2945 O  OD1 . ASP A 1  394 ? 90.858  61.556  55.651 1.00 86.91  ? 394  ASP A OD1 1 
ATOM   2946 O  OD2 . ASP A 1  394 ? 91.484  60.796  57.609 1.00 82.58  ? 394  ASP A OD2 1 
ATOM   2947 N  N   . ASP A 1  395 ? 89.155  57.308  53.815 1.00 64.16  ? 395  ASP A N   1 
ATOM   2948 C  CA  . ASP A 1  395 ? 89.728  56.703  52.574 1.00 79.53  ? 395  ASP A CA  1 
ATOM   2949 C  C   . ASP A 1  395 ? 88.698  56.286  51.589 1.00 78.31  ? 395  ASP A C   1 
ATOM   2950 O  O   . ASP A 1  395 ? 88.732  55.164  51.055 1.00 76.79  ? 395  ASP A O   1 
ATOM   2951 C  CB  . ASP A 1  395 ? 90.679  55.502  52.800 1.00 79.61  ? 395  ASP A CB  1 
ATOM   2952 C  CG  . ASP A 1  395 ? 91.972  55.882  53.472 1.00 77.57  ? 395  ASP A CG  1 
ATOM   2953 O  OD1 . ASP A 1  395 ? 91.980  55.886  54.721 1.00 68.32  ? 395  ASP A OD1 1 
ATOM   2954 O  OD2 . ASP A 1  395 ? 92.956  56.173  52.752 1.00 76.14  ? 395  ASP A OD2 1 
ATOM   2955 N  N   . SER A 1  396 ? 87.798  57.218  51.333 1.00 74.04  ? 396  SER A N   1 
ATOM   2956 C  CA  . SER A 1  396 ? 86.711  56.974  50.453 1.00 53.36  ? 396  SER A CA  1 
ATOM   2957 C  C   . SER A 1  396 ? 86.995  57.167  48.941 1.00 54.23  ? 396  SER A C   1 
ATOM   2958 O  O   . SER A 1  396 ? 86.218  56.735  48.112 1.00 55.06  ? 396  SER A O   1 
ATOM   2959 C  CB  . SER A 1  396 ? 85.579  57.821  50.952 1.00 52.67  ? 396  SER A CB  1 
ATOM   2960 O  OG  . SER A 1  396 ? 86.092  59.132  51.133 1.00 55.17  ? 396  SER A OG  1 
ATOM   2961 N  N   . VAL A 1  397 ? 88.105  57.756  48.538 1.00 54.58  ? 397  VAL A N   1 
ATOM   2962 C  CA  . VAL A 1  397 ? 88.245  57.910  47.086 1.00 56.34  ? 397  VAL A CA  1 
ATOM   2963 C  C   . VAL A 1  397 ? 89.700  57.931  46.648 1.00 56.92  ? 397  VAL A C   1 
ATOM   2964 O  O   . VAL A 1  397 ? 90.598  58.375  47.375 1.00 58.43  ? 397  VAL A O   1 
ATOM   2965 C  CB  . VAL A 1  397 ? 87.332  59.206  46.523 1.00 57.91  ? 397  VAL A CB  1 
ATOM   2966 C  CG1 . VAL A 1  397 ? 87.125  60.267  47.611 1.00 58.58  ? 397  VAL A CG1 1 
ATOM   2967 C  CG2 . VAL A 1  397 ? 87.926  59.845  45.241 1.00 57.34  ? 397  VAL A CG2 1 
ATOM   2968 N  N   . PRO A 1  398 ? 89.963  57.396  45.460 1.00 57.64  ? 398  PRO A N   1 
ATOM   2969 C  CA  . PRO A 1  398 ? 91.318  57.321  44.890 1.00 57.23  ? 398  PRO A CA  1 
ATOM   2970 C  C   . PRO A 1  398 ? 92.149  58.538  45.142 1.00 57.47  ? 398  PRO A C   1 
ATOM   2971 O  O   . PRO A 1  398 ? 91.656  59.511  45.636 1.00 78.29  ? 398  PRO A O   1 
ATOM   2972 C  CB  . PRO A 1  398 ? 91.054  57.025  43.422 1.00 65.65  ? 398  PRO A CB  1 
ATOM   2973 C  CG  . PRO A 1  398 ? 89.945  55.968  43.560 1.00 58.38  ? 398  PRO A CG  1 
ATOM   2974 C  CD  . PRO A 1  398 ? 88.996  56.633  44.639 1.00 58.26  ? 398  PRO A CD  1 
ATOM   2975 N  N   . LEU A 1  399 ? 93.443  58.483  44.910 1.00 70.72  ? 399  LEU A N   1 
ATOM   2976 C  CA  . LEU A 1  399 ? 94.228  59.682  45.161 1.00 73.52  ? 399  LEU A CA  1 
ATOM   2977 C  C   . LEU A 1  399 ? 94.598  60.261  43.810 1.00 71.27  ? 399  LEU A C   1 
ATOM   2978 O  O   . LEU A 1  399 ? 94.176  59.737  42.787 1.00 76.93  ? 399  LEU A O   1 
ATOM   2979 C  CB  . LEU A 1  399 ? 95.483  59.354  45.977 1.00 67.11  ? 399  LEU A CB  1 
ATOM   2980 C  CG  . LEU A 1  399 ? 95.294  58.841  47.423 1.00 73.48  ? 399  LEU A CG  1 
ATOM   2981 C  CD1 . LEU A 1  399 ? 95.844  57.420  47.442 1.00 75.60  ? 399  LEU A CD1 1 
ATOM   2982 C  CD2 . LEU A 1  399 ? 96.058  59.682  48.475 1.00 58.90  ? 399  LEU A CD2 1 
ATOM   2983 N  N   . LEU A 1  400 ? 95.320  61.368  43.776 1.00 73.06  ? 400  LEU A N   1 
ATOM   2984 C  CA  . LEU A 1  400 ? 95.744  61.865  42.473 1.00 71.88  ? 400  LEU A CA  1 
ATOM   2985 C  C   . LEU A 1  400 ? 97.169  62.402  42.499 1.00 70.21  ? 400  LEU A C   1 
ATOM   2986 O  O   . LEU A 1  400 ? 97.626  63.091  43.416 1.00 69.25  ? 400  LEU A O   1 
ATOM   2987 C  CB  . LEU A 1  400 ? 94.816  62.952  41.896 1.00 76.53  ? 400  LEU A CB  1 
ATOM   2988 C  CG  . LEU A 1  400 ? 93.325  62.864  41.522 1.00 70.52  ? 400  LEU A CG  1 
ATOM   2989 C  CD1 . LEU A 1  400 ? 93.033  64.163  40.798 1.00 71.26  ? 400  LEU A CD1 1 
ATOM   2990 C  CD2 . LEU A 1  400 ? 92.969  61.727  40.634 1.00 59.96  ? 400  LEU A CD2 1 
ATOM   2991 N  N   . ASN A 1  401 ? 97.892  62.048  41.463 1.00 73.47  ? 401  ASN A N   1 
ATOM   2992 C  CA  . ASN A 1  401 ? 99.224  62.534  41.384 1.00 73.13  ? 401  ASN A CA  1 
ATOM   2993 C  C   . ASN A 1  401 ? 99.036  63.820  40.665 1.00 60.10  ? 401  ASN A C   1 
ATOM   2994 O  O   . ASN A 1  401 ? 98.368  63.878  39.642 1.00 60.53  ? 401  ASN A O   1 
ATOM   2995 C  CB  . ASN A 1  401 ? 100.099 61.590  40.583 1.00 72.47  ? 401  ASN A CB  1 
ATOM   2996 C  CG  . ASN A 1  401 ? 101.554 61.799  40.878 1.00 80.32  ? 401  ASN A CG  1 
ATOM   2997 O  OD1 . ASN A 1  401 ? 102.127 62.836  40.543 1.00 81.71  ? 401  ASN A OD1 1 
ATOM   2998 N  ND2 . ASN A 1  401 ? 102.169 60.819  41.534 1.00 90.02  ? 401  ASN A ND2 1 
ATOM   2999 N  N   . LEU A 1  402 ? 99.589  64.856  41.253 1.00 64.51  ? 402  LEU A N   1 
ATOM   3000 C  CA  . LEU A 1  402 ? 99.518  66.194  40.691 1.00 64.75  ? 402  LEU A CA  1 
ATOM   3001 C  C   . LEU A 1  402 ? 100.709 66.473  39.801 1.00 67.11  ? 402  LEU A C   1 
ATOM   3002 O  O   . LEU A 1  402 ? 100.875 67.613  39.321 1.00 66.27  ? 402  LEU A O   1 
ATOM   3003 C  CB  . LEU A 1  402 ? 99.420  67.246  41.822 1.00 62.82  ? 402  LEU A CB  1 
ATOM   3004 C  CG  . LEU A 1  402 ? 98.036  67.369  42.510 1.00 68.28  ? 402  LEU A CG  1 
ATOM   3005 C  CD1 . LEU A 1  402 ? 96.983  66.323  41.984 1.00 57.61  ? 402  LEU A CD1 1 
ATOM   3006 C  CD2 . LEU A 1  402 ? 98.241  67.194  43.994 1.00 65.65  ? 402  LEU A CD2 1 
ATOM   3007 N  N   . TYR A 1  403 ? 101.558 65.450  39.621 1.00 68.84  ? 403  TYR A N   1 
ATOM   3008 C  CA  . TYR A 1  403 ? 102.714 65.535  38.730 1.00 72.40  ? 403  TYR A CA  1 
ATOM   3009 C  C   . TYR A 1  403 ? 102.279 65.511  37.244 1.00 70.72  ? 403  TYR A C   1 
ATOM   3010 O  O   . TYR A 1  403 ? 102.714 66.416  36.535 1.00 68.79  ? 403  TYR A O   1 
ATOM   3011 C  CB  . TYR A 1  403 ? 103.788 64.429  39.000 1.00 79.54  ? 403  TYR A CB  1 
ATOM   3012 C  CG  . TYR A 1  403 ? 104.866 64.875  39.991 1.00 81.69  ? 403  TYR A CG  1 
ATOM   3013 C  CD1 . TYR A 1  403 ? 104.783 66.141  40.603 1.00 84.27  ? 403  TYR A CD1 1 
ATOM   3014 C  CD2 . TYR A 1  403 ? 105.877 64.000  40.424 1.00 74.36  ? 403  TYR A CD2 1 
ATOM   3015 C  CE1 . TYR A 1  403 ? 105.661 66.523  41.624 1.00 78.16  ? 403  TYR A CE1 1 
ATOM   3016 C  CE2 . TYR A 1  403 ? 106.772 64.369  41.464 1.00 62.41  ? 403  TYR A CE2 1 
ATOM   3017 C  CZ  . TYR A 1  403 ? 106.645 65.636  42.057 1.00 77.82  ? 403  TYR A CZ  1 
ATOM   3018 O  OH  . TYR A 1  403 ? 107.446 66.028  43.113 1.00 72.39  ? 403  TYR A OH  1 
ATOM   3019 N  N   . ASN A 1  404 ? 101.478 64.542  36.754 1.00 61.90  ? 404  ASN A N   1 
ATOM   3020 C  CA  . ASN A 1  404 ? 101.105 64.643  35.334 1.00 72.93  ? 404  ASN A CA  1 
ATOM   3021 C  C   . ASN A 1  404 ? 100.392 66.023  35.166 1.00 81.54  ? 404  ASN A C   1 
ATOM   3022 O  O   . ASN A 1  404 ? 100.849 66.900  34.400 1.00 80.16  ? 404  ASN A O   1 
ATOM   3023 C  CB  . ASN A 1  404 ? 100.229 63.465  34.832 1.00 66.65  ? 404  ASN A CB  1 
ATOM   3024 C  CG  . ASN A 1  404 ? 100.717 62.922  33.449 1.00 87.39  ? 404  ASN A CG  1 
ATOM   3025 O  OD1 . ASN A 1  404 ? 99.937  62.488  32.584 1.00 82.75  ? 404  ASN A OD1 1 
ATOM   3026 N  ND2 . ASN A 1  404 ? 102.039 62.961  33.248 1.00 95.47  ? 404  ASN A ND2 1 
ATOM   3027 N  N   . PRO A 1  405 ? 99.286  66.252  35.912 1.00 85.79  ? 405  PRO A N   1 
ATOM   3028 C  CA  . PRO A 1  405 ? 98.514  67.503  35.886 1.00 81.26  ? 405  PRO A CA  1 
ATOM   3029 C  C   . PRO A 1  405 ? 99.373  68.741  35.771 1.00 81.91  ? 405  PRO A C   1 
ATOM   3030 O  O   . PRO A 1  405 ? 99.071  69.663  34.998 1.00 88.23  ? 405  PRO A O   1 
ATOM   3031 C  CB  . PRO A 1  405 ? 97.799  67.475  37.219 1.00 81.22  ? 405  PRO A CB  1 
ATOM   3032 C  CG  . PRO A 1  405 ? 97.382  66.019  37.287 1.00 90.67  ? 405  PRO A CG  1 
ATOM   3033 C  CD  . PRO A 1  405 ? 98.587  65.237  36.734 1.00 89.35  ? 405  PRO A CD  1 
ATOM   3034 N  N   . SER A 1  406 ? 100.435 68.745  36.565 1.00 76.72  ? 406  SER A N   1 
ATOM   3035 C  CA  . SER A 1  406 ? 101.383 69.835  36.640 1.00 73.00  ? 406  SER A CA  1 
ATOM   3036 C  C   . SER A 1  406 ? 102.185 70.142  35.348 1.00 73.91  ? 406  SER A C   1 
ATOM   3037 O  O   . SER A 1  406 ? 102.846 71.208  35.213 1.00 64.15  ? 406  SER A O   1 
ATOM   3038 C  CB  . SER A 1  406 ? 102.371 69.530  37.767 1.00 71.23  ? 406  SER A CB  1 
ATOM   3039 O  OG  . SER A 1  406 ? 103.178 70.676  38.022 1.00 82.59  ? 406  SER A OG  1 
ATOM   3040 N  N   . SER A 1  407 ? 102.170 69.227  34.391 1.00 65.56  ? 407  SER A N   1 
ATOM   3041 C  CA  . SER A 1  407 ? 102.953 69.500  33.208 1.00 72.63  ? 407  SER A CA  1 
ATOM   3042 C  C   . SER A 1  407 ? 102.655 70.825  32.487 1.00 75.85  ? 407  SER A C   1 
ATOM   3043 O  O   . SER A 1  407 ? 101.550 71.390  32.586 1.00 88.87  ? 407  SER A O   1 
ATOM   3044 C  CB  . SER A 1  407 ? 102.754 68.397  32.214 1.00 72.51  ? 407  SER A CB  1 
ATOM   3045 O  OG  . SER A 1  407 ? 101.559 68.644  31.534 1.00 77.14  ? 407  SER A OG  1 
ATOM   3046 N  N   . HIS A 1  408 ? 103.664 71.326  31.776 1.00 78.38  ? 408  HIS A N   1 
ATOM   3047 C  CA  . HIS A 1  408 ? 103.499 72.495  30.908 1.00 74.15  ? 408  HIS A CA  1 
ATOM   3048 C  C   . HIS A 1  408 ? 102.573 71.940  29.767 1.00 78.85  ? 408  HIS A C   1 
ATOM   3049 O  O   . HIS A 1  408 ? 101.849 72.699  29.109 1.00 76.49  ? 408  HIS A O   1 
ATOM   3050 C  CB  . HIS A 1  408 ? 104.838 72.943  30.271 1.00 62.96  ? 408  HIS A CB  1 
ATOM   3051 C  CG  . HIS A 1  408 ? 104.685 73.500  28.887 1.00 70.68  ? 408  HIS A CG  1 
ATOM   3052 N  ND1 . HIS A 1  408 ? 104.390 72.701  27.790 1.00 68.54  ? 408  HIS A ND1 1 
ATOM   3053 C  CD2 . HIS A 1  408 ? 104.624 74.779  28.431 1.00 74.99  ? 408  HIS A CD2 1 
ATOM   3054 C  CE1 . HIS A 1  408 ? 104.139 73.458  26.739 1.00 61.22  ? 408  HIS A CE1 1 
ATOM   3055 N  NE2 . HIS A 1  408 ? 104.274 74.730  27.094 1.00 74.27  ? 408  HIS A NE2 1 
ATOM   3056 N  N   . HIS A 1  409 ? 102.599 70.632  29.505 1.00 72.18  ? 409  HIS A N   1 
ATOM   3057 C  CA  . HIS A 1  409 ? 101.720 70.147  28.464 1.00 72.13  ? 409  HIS A CA  1 
ATOM   3058 C  C   . HIS A 1  409 ? 100.322 70.639  28.736 1.00 71.69  ? 409  HIS A C   1 
ATOM   3059 O  O   . HIS A 1  409 ? 99.650  71.214  27.871 1.00 72.63  ? 409  HIS A O   1 
ATOM   3060 C  CB  . HIS A 1  409 ? 101.634 68.617  28.445 1.00 77.49  ? 409  HIS A CB  1 
ATOM   3061 C  CG  . HIS A 1  409 ? 100.487 68.083  27.623 1.00 70.78  ? 409  HIS A CG  1 
ATOM   3062 N  ND1 . HIS A 1  409 ? 100.446 68.182  26.254 1.00 79.77  ? 409  HIS A ND1 1 
ATOM   3063 C  CD2 . HIS A 1  409 ? 99.333  67.478  27.998 1.00 81.71  ? 409  HIS A CD2 1 
ATOM   3064 C  CE1 . HIS A 1  409 ? 99.308  67.656  25.809 1.00 85.34  ? 409  HIS A CE1 1 
ATOM   3065 N  NE2 . HIS A 1  409 ? 98.619  67.224  26.846 1.00 89.26  ? 409  HIS A NE2 1 
ATOM   3066 N  N   . HIS A 1  410 ? 99.867  70.350  29.948 1.00 75.97  ? 410  HIS A N   1 
ATOM   3067 C  CA  . HIS A 1  410 ? 98.513  70.687  30.337 1.00 80.19  ? 410  HIS A CA  1 
ATOM   3068 C  C   . HIS A 1  410 ? 98.249  72.190  30.459 1.00 71.21  ? 410  HIS A C   1 
ATOM   3069 O  O   . HIS A 1  410 ? 97.250  72.682  29.949 1.00 70.44  ? 410  HIS A O   1 
ATOM   3070 C  CB  . HIS A 1  410 ? 98.158  69.865  31.586 1.00 82.64  ? 410  HIS A CB  1 
ATOM   3071 C  CG  . HIS A 1  410 ? 98.052  68.377  31.320 1.00 51.76  ? 410  HIS A CG  1 
ATOM   3072 N  ND1 . HIS A 1  410 ? 97.018  67.826  30.626 1.00 53.21  ? 410  HIS A ND1 1 
ATOM   3073 C  CD2 . HIS A 1  410 ? 98.784  67.330  31.783 1.00 54.49  ? 410  HIS A CD2 1 
ATOM   3074 C  CE1 . HIS A 1  410 ? 97.091  66.492  30.686 1.00 54.77  ? 410  HIS A CE1 1 
ATOM   3075 N  NE2 . HIS A 1  410 ? 98.150  66.168  31.387 1.00 53.00  ? 410  HIS A NE2 1 
ATOM   3076 N  N   . HIS A 1  411 ? 99.140  72.936  31.092 1.00 69.75  ? 411  HIS A N   1 
ATOM   3077 C  CA  . HIS A 1  411 ? 98.918  74.392  31.135 1.00 77.61  ? 411  HIS A CA  1 
ATOM   3078 C  C   . HIS A 1  411 ? 98.779  74.879  29.711 1.00 72.33  ? 411  HIS A C   1 
ATOM   3079 O  O   . HIS A 1  411 ? 98.212  75.938  29.415 1.00 85.25  ? 411  HIS A O   1 
ATOM   3080 C  CB  . HIS A 1  411 ? 100.086 75.166  31.754 1.00 68.51  ? 411  HIS A CB  1 
ATOM   3081 C  CG  . HIS A 1  411 ? 100.280 74.895  33.207 1.00 72.51  ? 411  HIS A CG  1 
ATOM   3082 N  ND1 . HIS A 1  411 ? 100.311 75.903  34.158 1.00 70.39  ? 411  HIS A ND1 1 
ATOM   3083 C  CD2 . HIS A 1  411 ? 100.532 73.742  33.876 1.00 67.45  ? 411  HIS A CD2 1 
ATOM   3084 C  CE1 . HIS A 1  411 ? 100.583 75.385  35.340 1.00 60.44  ? 411  HIS A CE1 1 
ATOM   3085 N  NE2 . HIS A 1  411 ? 100.723 74.070  35.202 1.00 70.00  ? 411  HIS A NE2 1 
ATOM   3086 N  N   . HIS A 1  412 ? 99.301  74.095  28.812 1.00 80.57  ? 412  HIS A N   1 
ATOM   3087 C  CA  . HIS A 1  412 ? 99.241  74.506  27.449 1.00 80.25  ? 412  HIS A CA  1 
ATOM   3088 C  C   . HIS A 1  412 ? 98.181  73.733  26.612 1.00 75.09  ? 412  HIS A C   1 
ATOM   3089 O  O   . HIS A 1  412 ? 97.440  74.350  25.882 1.00 75.28  ? 412  HIS A O   1 
ATOM   3090 C  CB  . HIS A 1  412 ? 100.666 74.502  26.869 1.00 77.57  ? 412  HIS A CB  1 
ATOM   3091 C  CG  . HIS A 1  412 ? 100.716 74.898  25.434 1.00 92.52  ? 412  HIS A CG  1 
ATOM   3092 N  ND1 . HIS A 1  412 ? 100.521 76.193  25.011 1.00 99.02  ? 412  HIS A ND1 1 
ATOM   3093 C  CD2 . HIS A 1  412 ? 100.850 74.146  24.315 1.00 95.39  ? 412  HIS A CD2 1 
ATOM   3094 C  CE1 . HIS A 1  412 ? 100.530 76.228  23.686 1.00 97.78  ? 412  HIS A CE1 1 
ATOM   3095 N  NE2 . HIS A 1  412 ? 100.726 75.000  23.240 1.00 87.93  ? 412  HIS A NE2 1 
ATOM   3096 N  N   . HIS A 1  413 ? 98.010  72.435  26.699 1.00 72.64  ? 413  HIS A N   1 
ATOM   3097 C  CA  . HIS A 1  413 ? 96.934  71.960  25.850 1.00 74.72  ? 413  HIS A CA  1 
ATOM   3098 C  C   . HIS A 1  413 ? 95.653  71.579  26.613 1.00 79.85  ? 413  HIS A C   1 
ATOM   3099 O  O   . HIS A 1  413 ? 94.755  70.858  26.085 1.00 79.10  ? 413  HIS A O   1 
ATOM   3100 C  CB  . HIS A 1  413 ? 97.483  70.867  24.926 1.00 89.11  ? 413  HIS A CB  1 
ATOM   3101 C  CG  . HIS A 1  413 ? 98.442  71.396  23.885 1.00 90.67  ? 413  HIS A CG  1 
ATOM   3102 N  ND1 . HIS A 1  413 ? 99.502  70.666  23.369 1.00 93.76  ? 413  HIS A ND1 1 
ATOM   3103 C  CD2 . HIS A 1  413 ? 98.492  72.592  23.246 1.00 86.15  ? 413  HIS A CD2 1 
ATOM   3104 C  CE1 . HIS A 1  413 ? 100.148 71.386  22.480 1.00 95.07  ? 413  HIS A CE1 1 
ATOM   3105 N  NE2 . HIS A 1  413 ? 99.554  72.564  22.384 1.00 79.31  ? 413  HIS A NE2 1 
ATOM   3106 N  N   . GLY A 1  414 ? 95.587  72.105  27.856 1.00 78.10  ? 414  GLY A N   1 
ATOM   3107 C  CA  . GLY A 1  414 ? 94.459  71.918  28.765 1.00 76.39  ? 414  GLY A CA  1 
ATOM   3108 C  C   . GLY A 1  414 ? 94.496  70.760  29.753 1.00 81.18  ? 414  GLY A C   1 
ATOM   3109 O  O   . GLY A 1  414 ? 95.264  69.810  29.549 1.00 84.84  ? 414  GLY A O   1 
ATOM   3110 N  N   . SER A 1  415 ? 93.677  70.815  30.823 1.00 77.69  ? 415  SER A N   1 
ATOM   3111 C  CA  . SER A 1  415 ? 93.662  69.718  31.798 1.00 66.69  ? 415  SER A CA  1 
ATOM   3112 C  C   . SER A 1  415 ? 92.961  68.549  31.199 1.00 66.12  ? 415  SER A C   1 
ATOM   3113 O  O   . SER A 1  415 ? 92.401  68.605  30.121 1.00 74.35  ? 415  SER A O   1 
ATOM   3114 C  CB  . SER A 1  415 ? 92.961  70.083  33.109 1.00 67.12  ? 415  SER A CB  1 
ATOM   3115 O  OG  . SER A 1  415 ? 93.796  70.813  33.984 1.00 71.10  ? 415  SER A OG  1 
ATOM   3116 N  N   . SER A 1  416 ? 92.970  67.465  31.919 1.00 66.97  ? 416  SER A N   1 
ATOM   3117 C  CA  . SER A 1  416 ? 92.332  66.287  31.422 1.00 69.45  ? 416  SER A CA  1 
ATOM   3118 C  C   . SER A 1  416 ? 91.348  65.855  32.485 1.00 71.07  ? 416  SER A C   1 
ATOM   3119 O  O   . SER A 1  416 ? 91.664  65.829  33.687 1.00 74.37  ? 416  SER A O   1 
ATOM   3120 C  CB  . SER A 1  416 ? 93.396  65.201  31.187 1.00 77.55  ? 416  SER A CB  1 
ATOM   3121 O  OG  . SER A 1  416 ? 94.401  65.661  30.269 1.00 85.34  ? 416  SER A OG  1 
ATOM   3122 N  N   . VAL A 1  417 ? 90.156  65.509  32.030 1.00 72.14  ? 417  VAL A N   1 
ATOM   3123 C  CA  . VAL A 1  417 ? 89.077  65.068  32.889 1.00 73.83  ? 417  VAL A CA  1 
ATOM   3124 C  C   . VAL A 1  417 ? 89.627  63.869  33.672 1.00 75.46  ? 417  VAL A C   1 
ATOM   3125 O  O   . VAL A 1  417 ? 90.574  63.251  33.217 1.00 83.49  ? 417  VAL A O   1 
ATOM   3126 C  CB  . VAL A 1  417 ? 87.931  64.661  31.993 1.00 70.45  ? 417  VAL A CB  1 
ATOM   3127 C  CG1 . VAL A 1  417 ? 88.506  63.695  30.903 1.00 82.31  ? 417  VAL A CG1 1 
ATOM   3128 C  CG2 . VAL A 1  417 ? 86.820  63.997  32.790 1.00 75.75  ? 417  VAL A CG2 1 
ATOM   3129 N  N   . ASN A 1  418 ? 89.075  63.570  34.847 1.00 72.40  ? 418  ASN A N   1 
ATOM   3130 C  CA  . ASN A 1  418 ? 89.506  62.425  35.634 1.00 64.48  ? 418  ASN A CA  1 
ATOM   3131 C  C   . ASN A 1  418 ? 88.588  61.305  35.263 1.00 68.02  ? 418  ASN A C   1 
ATOM   3132 O  O   . ASN A 1  418 ? 88.107  61.305  34.127 1.00 72.87  ? 418  ASN A O   1 
ATOM   3133 C  CB  . ASN A 1  418 ? 89.513  62.735  37.136 1.00 64.25  ? 418  ASN A CB  1 
ATOM   3134 C  CG  . ASN A 1  418 ? 90.648  63.768  37.512 1.00 71.32  ? 418  ASN A CG  1 
ATOM   3135 O  OD1 . ASN A 1  418 ? 91.850  63.528  37.272 1.00 80.71  ? 418  ASN A OD1 1 
ATOM   3136 N  ND2 . ASN A 1  418 ? 90.258  64.910  38.086 1.00 67.34  ? 418  ASN A ND2 1 
ATOM   3137 N  N   . THR A 1  419 ? 88.294  60.368  36.157 1.00 67.83  ? 419  THR A N   1 
ATOM   3138 C  CA  . THR A 1  419 ? 87.479  59.236  35.726 1.00 69.87  ? 419  THR A CA  1 
ATOM   3139 C  C   . THR A 1  419 ? 86.244  59.191  36.558 1.00 65.23  ? 419  THR A C   1 
ATOM   3140 O  O   . THR A 1  419 ? 86.226  59.932  37.506 1.00 71.18  ? 419  THR A O   1 
ATOM   3141 C  CB  . THR A 1  419 ? 88.322  57.913  35.861 1.00 75.02  ? 419  THR A CB  1 
ATOM   3142 O  OG1 . THR A 1  419 ? 88.354  57.471  37.226 1.00 77.32  ? 419  THR A OG1 1 
ATOM   3143 C  CG2 . THR A 1  419 ? 89.793  58.201  35.452 1.00 77.38  ? 419  THR A CG2 1 
ATOM   3144 N  N   . ASP A 1  420 ? 85.254  58.320  36.260 1.00 47.15  ? 420  ASP A N   1 
ATOM   3145 C  CA  . ASP A 1  420 ? 84.021  58.248  37.025 1.00 56.61  ? 420  ASP A CA  1 
ATOM   3146 C  C   . ASP A 1  420 ? 84.265  57.976  38.553 1.00 59.91  ? 420  ASP A C   1 
ATOM   3147 O  O   . ASP A 1  420 ? 85.309  58.281  39.061 1.00 68.30  ? 420  ASP A O   1 
ATOM   3148 C  CB  . ASP A 1  420 ? 82.990  57.252  36.389 1.00 50.05  ? 420  ASP A CB  1 
ATOM   3149 C  CG  . ASP A 1  420 ? 82.275  57.803  35.087 1.00 80.72  ? 420  ASP A CG  1 
ATOM   3150 O  OD1 . ASP A 1  420 ? 82.552  58.924  34.611 1.00 81.45  ? 420  ASP A OD1 1 
ATOM   3151 O  OD2 . ASP A 1  420 ? 81.399  57.097  34.513 1.00 82.28  ? 420  ASP A OD2 1 
ATOM   3152 N  N   . PHE A 1  421 ? 83.276  57.488  39.290 1.00 59.75  ? 421  PHE A N   1 
ATOM   3153 C  CA  . PHE A 1  421 ? 83.433  57.211  40.715 1.00 69.21  ? 421  PHE A CA  1 
ATOM   3154 C  C   . PHE A 1  421 ? 82.110  56.654  41.091 1.00 73.41  ? 421  PHE A C   1 
ATOM   3155 O  O   . PHE A 1  421 ? 81.102  57.244  40.750 1.00 71.03  ? 421  PHE A O   1 
ATOM   3156 C  CB  . PHE A 1  421 ? 83.611  58.460  41.541 1.00 46.94  ? 421  PHE A CB  1 
ATOM   3157 C  CG  . PHE A 1  421 ? 83.616  58.184  43.006 1.00 70.02  ? 421  PHE A CG  1 
ATOM   3158 C  CD1 . PHE A 1  421 ? 84.739  57.650  43.623 1.00 69.37  ? 421  PHE A CD1 1 
ATOM   3159 C  CD2 . PHE A 1  421 ? 82.509  58.441  43.777 1.00 65.83  ? 421  PHE A CD2 1 
ATOM   3160 C  CE1 . PHE A 1  421 ? 84.757  57.381  44.999 1.00 53.05  ? 421  PHE A CE1 1 
ATOM   3161 C  CE2 . PHE A 1  421 ? 82.525  58.175  45.161 1.00 68.48  ? 421  PHE A CE2 1 
ATOM   3162 C  CZ  . PHE A 1  421 ? 83.646  57.651  45.761 1.00 55.30  ? 421  PHE A CZ  1 
ATOM   3163 N  N   . ASP A 1  422 ? 82.078  55.516  41.768 1.00 78.19  ? 422  ASP A N   1 
ATOM   3164 C  CA  . ASP A 1  422 ? 80.770  54.982  42.133 1.00 79.06  ? 422  ASP A CA  1 
ATOM   3165 C  C   . ASP A 1  422 ? 80.282  55.745  43.342 1.00 74.33  ? 422  ASP A C   1 
ATOM   3166 O  O   . ASP A 1  422 ? 80.867  55.698  44.414 1.00 69.22  ? 422  ASP A O   1 
ATOM   3167 C  CB  . ASP A 1  422 ? 80.807  53.483  42.433 1.00 78.61  ? 422  ASP A CB  1 
ATOM   3168 C  CG  . ASP A 1  422 ? 79.424  52.868  42.490 1.00 87.33  ? 422  ASP A CG  1 
ATOM   3169 O  OD1 . ASP A 1  422 ? 78.445  53.642  42.352 1.00 96.07  ? 422  ASP A OD1 1 
ATOM   3170 O  OD2 . ASP A 1  422 ? 79.320  51.620  42.670 1.00 88.42  ? 422  ASP A OD2 1 
ATOM   3171 N  N   . PHE A 1  423 ? 79.200  56.465  43.120 1.00 73.71  ? 423  PHE A N   1 
ATOM   3172 C  CA  . PHE A 1  423 ? 78.635  57.259  44.147 1.00 71.66  ? 423  PHE A CA  1 
ATOM   3173 C  C   . PHE A 1  423 ? 77.672  56.418  44.868 1.00 74.29  ? 423  PHE A C   1 
ATOM   3174 O  O   . PHE A 1  423 ? 77.192  56.840  45.912 1.00 67.04  ? 423  PHE A O   1 
ATOM   3175 C  CB  . PHE A 1  423 ? 77.942  58.510  43.573 1.00 73.57  ? 423  PHE A CB  1 
ATOM   3176 C  CG  . PHE A 1  423 ? 78.894  59.665  43.291 1.00 51.40  ? 423  PHE A CG  1 
ATOM   3177 C  CD1 . PHE A 1  423 ? 79.446  60.403  44.334 1.00 48.62  ? 423  PHE A CD1 1 
ATOM   3178 C  CD2 . PHE A 1  423 ? 79.295  59.943  41.990 1.00 51.87  ? 423  PHE A CD2 1 
ATOM   3179 C  CE1 . PHE A 1  423 ? 80.371  61.391  44.136 1.00 48.61  ? 423  PHE A CE1 1 
ATOM   3180 C  CE2 . PHE A 1  423 ? 80.241  60.939  41.738 1.00 52.13  ? 423  PHE A CE2 1 
ATOM   3181 C  CZ  . PHE A 1  423 ? 80.792  61.682  42.853 1.00 53.30  ? 423  PHE A CZ  1 
ATOM   3182 N  N   . ASN A 1  424 ? 77.396  55.219  44.356 1.00 78.48  ? 424  ASN A N   1 
ATOM   3183 C  CA  . ASN A 1  424 ? 76.415  54.370  45.044 1.00 87.08  ? 424  ASN A CA  1 
ATOM   3184 C  C   . ASN A 1  424 ? 77.000  53.347  45.937 1.00 86.12  ? 424  ASN A C   1 
ATOM   3185 O  O   . ASN A 1  424 ? 76.420  52.961  46.948 1.00 92.21  ? 424  ASN A O   1 
ATOM   3186 C  CB  . ASN A 1  424 ? 75.472  53.698  44.075 1.00 91.72  ? 424  ASN A CB  1 
ATOM   3187 C  CG  . ASN A 1  424 ? 74.596  54.690  43.387 1.00 105.97 ? 424  ASN A CG  1 
ATOM   3188 O  OD1 . ASN A 1  424 ? 73.698  55.283  44.004 1.00 108.64 ? 424  ASN A OD1 1 
ATOM   3189 N  ND2 . ASN A 1  424 ? 74.875  54.929  42.101 1.00 109.43 ? 424  ASN A ND2 1 
ATOM   3190 N  N   . ALA A 1  425 ? 78.175  52.898  45.596 1.00 87.96  ? 425  ALA A N   1 
ATOM   3191 C  CA  . ALA A 1  425 ? 78.764  51.908  46.461 1.00 92.02  ? 425  ALA A CA  1 
ATOM   3192 C  C   . ALA A 1  425 ? 79.028  52.647  47.743 1.00 89.22  ? 425  ALA A C   1 
ATOM   3193 O  O   . ALA A 1  425 ? 80.057  53.301  47.840 1.00 94.04  ? 425  ALA A O   1 
ATOM   3194 C  CB  . ALA A 1  425 ? 80.038  51.460  45.869 1.00 96.90  ? 425  ALA A CB  1 
ATOM   3195 N  N   . LYS A 1  426 ? 78.149  52.612  48.728 1.00 78.12  ? 426  LYS A N   1 
ATOM   3196 C  CA  . LYS A 1  426 ? 78.546  53.399  49.858 1.00 75.28  ? 426  LYS A CA  1 
ATOM   3197 C  C   . LYS A 1  426 ? 79.094  52.543  50.942 1.00 83.21  ? 426  LYS A C   1 
ATOM   3198 O  O   . LYS A 1  426 ? 78.357  52.050  51.789 1.00 83.14  ? 426  LYS A O   1 
ATOM   3199 C  CB  . LYS A 1  426 ? 77.419  54.232  50.383 1.00 75.53  ? 426  LYS A CB  1 
ATOM   3200 C  CG  . LYS A 1  426 ? 76.143  54.118  49.656 1.00 77.35  ? 426  LYS A CG  1 
ATOM   3201 C  CD  . LYS A 1  426 ? 75.800  55.377  48.910 1.00 87.70  ? 426  LYS A CD  1 
ATOM   3202 C  CE  . LYS A 1  426 ? 74.329  55.707  49.111 1.00 92.29  ? 426  LYS A CE  1 
ATOM   3203 N  NZ  . LYS A 1  426 ? 74.056  55.949  50.578 1.00 93.06  ? 426  LYS A NZ  1 
ATOM   3204 N  N   . ASP A 1  427 ? 80.412  52.389  50.924 1.00 81.84  ? 427  ASP A N   1 
ATOM   3205 C  CA  . ASP A 1  427 ? 81.115  51.568  51.901 1.00 85.33  ? 427  ASP A CA  1 
ATOM   3206 C  C   . ASP A 1  427 ? 81.048  52.194  53.293 1.00 78.91  ? 427  ASP A C   1 
ATOM   3207 O  O   . ASP A 1  427 ? 81.601  53.244  53.523 1.00 82.96  ? 427  ASP A O   1 
ATOM   3208 C  CB  . ASP A 1  427 ? 82.584  51.361  51.446 1.00 90.60  ? 427  ASP A CB  1 
ATOM   3209 C  CG  . ASP A 1  427 ? 83.329  50.279  52.246 1.00 90.10  ? 427  ASP A CG  1 
ATOM   3210 O  OD1 . ASP A 1  427 ? 82.696  49.506  53.027 1.00 85.08  ? 427  ASP A OD1 1 
ATOM   3211 O  OD2 . ASP A 1  427 ? 84.570  50.213  52.078 1.00 88.89  ? 427  ASP A OD2 1 
ATOM   3212 N  N   . PRO A 1  428 ? 80.390  51.512  54.240 1.00 79.25  ? 428  PRO A N   1 
ATOM   3213 C  CA  . PRO A 1  428 ? 80.159  51.862  55.651 1.00 76.59  ? 428  PRO A CA  1 
ATOM   3214 C  C   . PRO A 1  428 ? 81.469  51.960  56.363 1.00 79.09  ? 428  PRO A C   1 
ATOM   3215 O  O   . PRO A 1  428 ? 81.576  52.416  57.510 1.00 81.77  ? 428  PRO A O   1 
ATOM   3216 C  CB  . PRO A 1  428 ? 79.376  50.678  56.164 1.00 77.09  ? 428  PRO A CB  1 
ATOM   3217 C  CG  . PRO A 1  428 ? 78.876  49.975  54.873 1.00 81.88  ? 428  PRO A CG  1 
ATOM   3218 C  CD  . PRO A 1  428 ? 80.009  50.113  53.988 1.00 70.99  ? 428  PRO A CD  1 
ATOM   3219 N  N   . ALA A 1  429 ? 82.458  51.472  55.639 1.00 78.35  ? 429  ALA A N   1 
ATOM   3220 C  CA  . ALA A 1  429 ? 83.834  51.405  56.048 1.00 75.53  ? 429  ALA A CA  1 
ATOM   3221 C  C   . ALA A 1  429 ? 84.445  52.769  56.193 1.00 76.18  ? 429  ALA A C   1 
ATOM   3222 O  O   . ALA A 1  429 ? 84.859  53.177  57.279 1.00 87.21  ? 429  ALA A O   1 
ATOM   3223 C  CB  . ALA A 1  429 ? 84.601  50.616  55.010 1.00 68.82  ? 429  ALA A CB  1 
ATOM   3224 N  N   . ASN A 1  430 ? 84.452  53.473  55.070 1.00 75.14  ? 430  ASN A N   1 
ATOM   3225 C  CA  . ASN A 1  430 ? 85.054  54.799  54.902 1.00 71.56  ? 430  ASN A CA  1 
ATOM   3226 C  C   . ASN A 1  430 ? 84.012  55.913  54.624 1.00 77.21  ? 430  ASN A C   1 
ATOM   3227 O  O   . ASN A 1  430 ? 84.376  57.030  54.178 1.00 72.37  ? 430  ASN A O   1 
ATOM   3228 C  CB  . ASN A 1  430 ? 85.908  54.685  53.669 1.00 75.56  ? 430  ASN A CB  1 
ATOM   3229 C  CG  . ASN A 1  430 ? 85.057  54.289  52.435 1.00 66.79  ? 430  ASN A CG  1 
ATOM   3230 O  OD1 . ASN A 1  430 ? 85.460  53.500  51.582 1.00 75.60  ? 430  ASN A OD1 1 
ATOM   3231 N  ND2 . ASN A 1  430 ? 83.888  54.879  52.339 1.00 70.89  ? 430  ASN A ND2 1 
ATOM   3232 N  N   . SER A 1  431 ? 82.733  55.636  54.888 1.00 78.28  ? 431  SER A N   1 
ATOM   3233 C  CA  . SER A 1  431 ? 81.693  56.582  54.506 1.00 61.46  ? 431  SER A CA  1 
ATOM   3234 C  C   . SER A 1  431 ? 80.436  56.515  55.342 1.00 57.85  ? 431  SER A C   1 
ATOM   3235 O  O   . SER A 1  431 ? 80.112  55.497  55.934 1.00 59.72  ? 431  SER A O   1 
ATOM   3236 C  CB  . SER A 1  431 ? 81.414  56.288  53.033 1.00 59.27  ? 431  SER A CB  1 
ATOM   3237 O  OG  . SER A 1  431 ? 80.056  56.256  52.778 1.00 70.62  ? 431  SER A OG  1 
ATOM   3238 N  N   . GLY A 1  432 ? 79.689  57.585  55.390 1.00 59.63  ? 432  GLY A N   1 
ATOM   3239 C  CA  . GLY A 1  432 ? 78.519  57.497  56.227 1.00 62.29  ? 432  GLY A CA  1 
ATOM   3240 C  C   . GLY A 1  432 ? 77.333  58.273  55.745 1.00 66.05  ? 432  GLY A C   1 
ATOM   3241 O  O   . GLY A 1  432 ? 77.386  58.959  54.770 1.00 66.64  ? 432  GLY A O   1 
ATOM   3242 N  N   . PRO A 1  433 ? 76.217  58.146  56.422 1.00 71.50  ? 433  PRO A N   1 
ATOM   3243 C  CA  . PRO A 1  433 ? 74.979  58.854  56.069 1.00 69.41  ? 433  PRO A CA  1 
ATOM   3244 C  C   . PRO A 1  433 ? 74.890  60.035  56.982 1.00 68.61  ? 433  PRO A C   1 
ATOM   3245 O  O   . PRO A 1  433 ? 75.377  59.955  58.128 1.00 70.53  ? 433  PRO A O   1 
ATOM   3246 C  CB  . PRO A 1  433 ? 73.869  57.880  56.429 1.00 59.97  ? 433  PRO A CB  1 
ATOM   3247 C  CG  . PRO A 1  433 ? 74.657  56.518  56.625 1.00 70.13  ? 433  PRO A CG  1 
ATOM   3248 C  CD  . PRO A 1  433 ? 75.930  56.973  57.252 1.00 73.76  ? 433  PRO A CD  1 
ATOM   3249 N  N   . TYR A 1  434 ? 74.257  61.104  56.472 1.00 68.08  ? 434  TYR A N   1 
ATOM   3250 C  CA  . TYR A 1  434 ? 74.000  62.361  57.190 1.00 65.09  ? 434  TYR A CA  1 
ATOM   3251 C  C   . TYR A 1  434 ? 72.544  62.663  56.858 1.00 70.22  ? 434  TYR A C   1 
ATOM   3252 O  O   . TYR A 1  434 ? 72.238  62.913  55.658 1.00 60.46  ? 434  TYR A O   1 
ATOM   3253 C  CB  . TYR A 1  434 ? 74.844  63.471  56.589 1.00 68.78  ? 434  TYR A CB  1 
ATOM   3254 C  CG  . TYR A 1  434 ? 74.791  64.764  57.332 1.00 65.14  ? 434  TYR A CG  1 
ATOM   3255 C  CD1 . TYR A 1  434 ? 75.166  64.807  58.633 1.00 60.30  ? 434  TYR A CD1 1 
ATOM   3256 C  CD2 . TYR A 1  434 ? 74.373  65.928  56.743 1.00 62.00  ? 434  TYR A CD2 1 
ATOM   3257 C  CE1 . TYR A 1  434 ? 75.140  65.944  59.352 1.00 54.40  ? 434  TYR A CE1 1 
ATOM   3258 C  CE2 . TYR A 1  434 ? 74.349  67.093  57.477 1.00 64.25  ? 434  TYR A CE2 1 
ATOM   3259 C  CZ  . TYR A 1  434 ? 74.746  67.078  58.802 1.00 58.46  ? 434  TYR A CZ  1 
ATOM   3260 O  OH  . TYR A 1  434 ? 74.807  68.192  59.632 1.00 62.64  ? 434  TYR A OH  1 
ATOM   3261 N  N   . ARG A 1  435 ? 71.650  62.607  57.856 1.00 63.99  ? 435  ARG A N   1 
ATOM   3262 C  CA  . ARG A 1  435 ? 70.204  62.904  57.596 1.00 66.24  ? 435  ARG A CA  1 
ATOM   3263 C  C   . ARG A 1  435 ? 69.672  63.860  58.657 1.00 69.27  ? 435  ARG A C   1 
ATOM   3264 O  O   . ARG A 1  435 ? 69.521  63.542  59.834 1.00 63.00  ? 435  ARG A O   1 
ATOM   3265 C  CB  . ARG A 1  435 ? 69.353  61.631  57.504 1.00 57.55  ? 435  ARG A CB  1 
ATOM   3266 C  CG  . ARG A 1  435 ? 69.852  60.661  56.356 1.00 71.20  ? 435  ARG A CG  1 
ATOM   3267 C  CD  . ARG A 1  435 ? 68.839  59.599  55.829 1.00 78.67  ? 435  ARG A CD  1 
ATOM   3268 N  NE  . ARG A 1  435 ? 68.378  58.624  56.837 1.00 87.02  ? 435  ARG A NE  1 
ATOM   3269 C  CZ  . ARG A 1  435 ? 67.350  58.809  57.678 1.00 89.99  ? 435  ARG A CZ  1 
ATOM   3270 N  NH1 . ARG A 1  435 ? 66.635  59.938  57.637 1.00 96.02  ? 435  ARG A NH1 1 
ATOM   3271 N  NH2 . ARG A 1  435 ? 67.063  57.893  58.603 1.00 84.98  ? 435  ARG A NH2 1 
ATOM   3272 N  N   . ILE A 1  436 ? 69.391  65.070  58.220 1.00 70.16  ? 436  ILE A N   1 
ATOM   3273 C  CA  . ILE A 1  436 ? 69.020  66.073  59.173 1.00 71.89  ? 436  ILE A CA  1 
ATOM   3274 C  C   . ILE A 1  436 ? 67.852  66.797  58.632 1.00 67.44  ? 436  ILE A C   1 
ATOM   3275 O  O   . ILE A 1  436 ? 67.680  66.874  57.437 1.00 67.37  ? 436  ILE A O   1 
ATOM   3276 C  CB  . ILE A 1  436 ? 70.239  67.068  59.406 1.00 53.05  ? 436  ILE A CB  1 
ATOM   3277 C  CG1 . ILE A 1  436 ? 71.546  66.245  59.638 1.00 53.79  ? 436  ILE A CG1 1 
ATOM   3278 C  CG2 . ILE A 1  436 ? 69.949  68.029  60.534 1.00 49.19  ? 436  ILE A CG2 1 
ATOM   3279 C  CD1 . ILE A 1  436 ? 71.978  65.958  61.100 1.00 52.34  ? 436  ILE A CD1 1 
ATOM   3280 N  N   . LEU A 1  437 ? 67.041  67.298  59.548 1.00 69.32  ? 437  LEU A N   1 
ATOM   3281 C  CA  . LEU A 1  437 ? 65.875  68.048  59.222 1.00 55.73  ? 437  LEU A CA  1 
ATOM   3282 C  C   . LEU A 1  437 ? 65.982  69.231  60.116 1.00 55.75  ? 437  LEU A C   1 
ATOM   3283 O  O   . LEU A 1  437 ? 65.780  69.097  61.308 1.00 55.19  ? 437  LEU A O   1 
ATOM   3284 C  CB  . LEU A 1  437 ? 64.580  67.294  59.594 1.00 56.39  ? 437  LEU A CB  1 
ATOM   3285 C  CG  . LEU A 1  437 ? 63.338  68.222  59.447 1.00 56.40  ? 437  LEU A CG  1 
ATOM   3286 C  CD1 . LEU A 1  437 ? 62.893  68.227  57.976 1.00 51.19  ? 437  LEU A CD1 1 
ATOM   3287 C  CD2 . LEU A 1  437 ? 62.216  67.831  60.457 1.00 54.81  ? 437  LEU A CD2 1 
ATOM   3288 N  N   . ASN A 1  438 ? 66.288  70.391  59.531 1.00 55.42  ? 438  ASN A N   1 
ATOM   3289 C  CA  . ASN A 1  438 ? 66.416  71.652  60.291 1.00 55.29  ? 438  ASN A CA  1 
ATOM   3290 C  C   . ASN A 1  438 ? 65.235  72.539  60.143 1.00 54.51  ? 438  ASN A C   1 
ATOM   3291 O  O   . ASN A 1  438 ? 64.666  72.570  59.046 1.00 54.83  ? 438  ASN A O   1 
ATOM   3292 C  CB  . ASN A 1  438 ? 67.628  72.436  59.845 1.00 54.84  ? 438  ASN A CB  1 
ATOM   3293 C  CG  . ASN A 1  438 ? 68.906  71.719  60.140 1.00 74.20  ? 438  ASN A CG  1 
ATOM   3294 O  OD1 . ASN A 1  438 ? 69.139  71.314  61.294 1.00 55.41  ? 438  ASN A OD1 1 
ATOM   3295 N  ND2 . ASN A 1  438 ? 69.749  71.539  59.108 1.00 53.75  ? 438  ASN A ND2 1 
ATOM   3296 N  N   . LYS A 1  439 ? 64.910  73.270  61.219 1.00 52.92  ? 439  LYS A N   1 
ATOM   3297 C  CA  . LYS A 1  439 ? 63.759  74.183  61.275 1.00 52.32  ? 439  LYS A CA  1 
ATOM   3298 C  C   . LYS A 1  439 ? 64.235  75.379  61.939 1.00 53.21  ? 439  LYS A C   1 
ATOM   3299 O  O   . LYS A 1  439 ? 65.020  75.254  62.865 1.00 55.65  ? 439  LYS A O   1 
ATOM   3300 C  CB  . LYS A 1  439 ? 62.639  73.693  62.193 1.00 50.83  ? 439  LYS A CB  1 
ATOM   3301 C  CG  . LYS A 1  439 ? 61.870  72.493  61.688 1.00 49.61  ? 439  LYS A CG  1 
ATOM   3302 C  CD  . LYS A 1  439 ? 60.805  71.988  62.593 1.00 49.36  ? 439  LYS A CD  1 
ATOM   3303 C  CE  . LYS A 1  439 ? 59.974  70.930  61.751 1.00 87.55  ? 439  LYS A CE  1 
ATOM   3304 N  NZ  . LYS A 1  439 ? 58.663  70.408  62.279 1.00 73.04  ? 439  LYS A NZ  1 
ATOM   3305 N  N   . GLN A 1  440 ? 63.737  76.533  61.495 1.00 52.87  ? 440  GLN A N   1 
ATOM   3306 C  CA  . GLN A 1  440 ? 64.037  77.847  62.097 1.00 52.26  ? 440  GLN A CA  1 
ATOM   3307 C  C   . GLN A 1  440 ? 62.736  78.651  62.070 1.00 51.48  ? 440  GLN A C   1 
ATOM   3308 O  O   . GLN A 1  440 ? 61.924  78.396  61.211 1.00 49.93  ? 440  GLN A O   1 
ATOM   3309 C  CB  . GLN A 1  440 ? 65.108  78.636  61.305 1.00 52.50  ? 440  GLN A CB  1 
ATOM   3310 C  CG  . GLN A 1  440 ? 66.473  78.018  61.243 1.00 52.87  ? 440  GLN A CG  1 
ATOM   3311 C  CD  . GLN A 1  440 ? 67.434  78.811  60.388 1.00 55.19  ? 440  GLN A CD  1 
ATOM   3312 O  OE1 . GLN A 1  440 ? 67.133  79.902  59.885 1.00 56.29  ? 440  GLN A OE1 1 
ATOM   3313 N  NE2 . GLN A 1  440 ? 68.608  78.268  60.213 1.00 57.93  ? 440  GLN A NE2 1 
ATOM   3314 N  N   . LYS A 1  441 ? 62.560  79.588  63.019 1.00 52.00  ? 441  LYS A N   1 
ATOM   3315 C  CA  . LYS A 1  441 ? 61.400  80.473  63.157 1.00 52.92  ? 441  LYS A CA  1 
ATOM   3316 C  C   . LYS A 1  441 ? 61.969  81.719  63.811 1.00 54.30  ? 441  LYS A C   1 
ATOM   3317 O  O   . LYS A 1  441 ? 62.950  81.647  64.569 1.00 55.28  ? 441  LYS A O   1 
ATOM   3318 C  CB  . LYS A 1  441 ? 60.343  79.862  64.083 1.00 55.57  ? 441  LYS A CB  1 
ATOM   3319 C  CG  . LYS A 1  441 ? 58.881  79.796  63.591 1.00 67.83  ? 441  LYS A CG  1 
ATOM   3320 C  CD  . LYS A 1  441 ? 58.072  78.748  64.423 1.00 74.09  ? 441  LYS A CD  1 
ATOM   3321 C  CE  . LYS A 1  441 ? 56.558  78.653  63.978 1.00 88.35  ? 441  LYS A CE  1 
ATOM   3322 N  NZ  . LYS A 1  441 ? 55.679  77.613  64.630 1.00 86.34  ? 441  LYS A NZ  1 
ATOM   3323 N  N   . GLN A 1  442 ? 61.400  82.878  63.489 1.00 55.26  ? 442  GLN A N   1 
ATOM   3324 C  CA  . GLN A 1  442 ? 61.861  84.141  64.068 1.00 56.33  ? 442  GLN A CA  1 
ATOM   3325 C  C   . GLN A 1  442 ? 60.697  85.059  63.903 1.00 57.75  ? 442  GLN A C   1 
ATOM   3326 O  O   . GLN A 1  442 ? 60.098  85.133  62.830 1.00 66.05  ? 442  GLN A O   1 
ATOM   3327 C  CB  . GLN A 1  442 ? 63.024  84.747  63.294 1.00 57.71  ? 442  GLN A CB  1 
ATOM   3328 C  CG  . GLN A 1  442 ? 63.796  85.836  64.044 1.00 58.01  ? 442  GLN A CG  1 
ATOM   3329 C  CD  . GLN A 1  442 ? 64.881  86.457  63.206 1.00 55.71  ? 442  GLN A CD  1 
ATOM   3330 O  OE1 . GLN A 1  442 ? 65.971  86.727  63.659 1.00 56.40  ? 442  GLN A OE1 1 
ATOM   3331 N  NE2 . GLN A 1  442 ? 64.570  86.686  61.981 1.00 57.51  ? 442  GLN A NE2 1 
ATOM   3332 N  N   . THR A 1  443 ? 60.358  85.727  64.989 1.00 58.67  ? 443  THR A N   1 
ATOM   3333 C  CA  . THR A 1  443 ? 59.270  86.668  64.984 1.00 58.64  ? 443  THR A CA  1 
ATOM   3334 C  C   . THR A 1  443 ? 59.942  87.789  65.641 1.00 58.56  ? 443  THR A C   1 
ATOM   3335 O  O   . THR A 1  443 ? 60.573  87.581  66.641 1.00 58.64  ? 443  THR A O   1 
ATOM   3336 C  CB  . THR A 1  443 ? 58.088  86.212  65.860 1.00 58.90  ? 443  THR A CB  1 
ATOM   3337 O  OG1 . THR A 1  443 ? 57.557  84.963  65.370 1.00 65.25  ? 443  THR A OG1 1 
ATOM   3338 C  CG2 . THR A 1  443 ? 56.977  87.247  65.809 1.00 57.47  ? 443  THR A CG2 1 
ATOM   3339 N  N   . GLY A 1  444 ? 59.871  88.962  65.040 1.00 58.66  ? 444  GLY A N   1 
ATOM   3340 C  CA  . GLY A 1  444 ? 60.498  90.124  65.641 1.00 57.39  ? 444  GLY A CA  1 
ATOM   3341 C  C   . GLY A 1  444 ? 59.552  91.300  65.548 1.00 64.08  ? 444  GLY A C   1 
ATOM   3342 O  O   . GLY A 1  444 ? 58.664  91.320  64.663 1.00 61.72  ? 444  GLY A O   1 
ATOM   3343 N  N   . VAL A 1  445 ? 59.685  92.226  66.501 1.00 61.81  ? 445  VAL A N   1 
ATOM   3344 C  CA  . VAL A 1  445 ? 58.903  93.460  66.535 1.00 61.56  ? 445  VAL A CA  1 
ATOM   3345 C  C   . VAL A 1  445 ? 59.926  94.552  66.693 1.00 65.69  ? 445  VAL A C   1 
ATOM   3346 O  O   . VAL A 1  445 ? 60.847  94.450  67.526 1.00 64.53  ? 445  VAL A O   1 
ATOM   3347 C  CB  . VAL A 1  445 ? 57.887  93.510  67.703 1.00 65.97  ? 445  VAL A CB  1 
ATOM   3348 C  CG1 . VAL A 1  445 ? 56.696  92.526  67.444 1.00 65.91  ? 445  VAL A CG1 1 
ATOM   3349 C  CG2 . VAL A 1  445 ? 58.563  93.159  68.946 1.00 68.80  ? 445  VAL A CG2 1 
ATOM   3350 N  N   . TYR A 1  446 ? 59.807  95.590  65.873 1.00 55.17  ? 446  TYR A N   1 
ATOM   3351 C  CA  . TYR A 1  446 ? 60.813  96.662  65.927 1.00 53.81  ? 446  TYR A CA  1 
ATOM   3352 C  C   . TYR A 1  446 ? 60.132  98.051  65.798 1.00 53.93  ? 446  TYR A C   1 
ATOM   3353 O  O   . TYR A 1  446 ? 58.978  98.202  65.327 1.00 66.83  ? 446  TYR A O   1 
ATOM   3354 C  CB  . TYR A 1  446 ? 61.826  96.445  64.783 1.00 56.20  ? 446  TYR A CB  1 
ATOM   3355 C  CG  . TYR A 1  446 ? 61.179  96.316  63.371 1.00 55.42  ? 446  TYR A CG  1 
ATOM   3356 C  CD1 . TYR A 1  446 ? 60.574  95.135  62.962 1.00 54.77  ? 446  TYR A CD1 1 
ATOM   3357 C  CD2 . TYR A 1  446 ? 61.141  97.380  62.497 1.00 54.74  ? 446  TYR A CD2 1 
ATOM   3358 C  CE1 . TYR A 1  446 ? 59.974  95.000  61.754 1.00 54.35  ? 446  TYR A CE1 1 
ATOM   3359 C  CE2 . TYR A 1  446 ? 60.498  97.249  61.235 1.00 56.22  ? 446  TYR A CE2 1 
ATOM   3360 C  CZ  . TYR A 1  446 ? 59.933  96.055  60.880 1.00 54.85  ? 446  TYR A CZ  1 
ATOM   3361 O  OH  . TYR A 1  446 ? 59.324  95.894  59.662 1.00 53.97  ? 446  TYR A OH  1 
ATOM   3362 N  N   . VAL A 1  447 ? 60.843  99.076  66.213 1.00 52.86  ? 447  VAL A N   1 
ATOM   3363 C  CA  . VAL A 1  447 ? 60.289  100.387 66.180 1.00 52.30  ? 447  VAL A CA  1 
ATOM   3364 C  C   . VAL A 1  447 ? 61.420  101.272 65.892 1.00 60.27  ? 447  VAL A C   1 
ATOM   3365 O  O   . VAL A 1  447 ? 62.511  101.053 66.414 1.00 63.61  ? 447  VAL A O   1 
ATOM   3366 C  CB  . VAL A 1  447 ? 59.847  100.823 67.585 1.00 75.61  ? 447  VAL A CB  1 
ATOM   3367 C  CG1 . VAL A 1  447 ? 59.678  102.377 67.636 1.00 53.06  ? 447  VAL A CG1 1 
ATOM   3368 C  CG2 . VAL A 1  447 ? 58.598  100.068 67.991 1.00 50.47  ? 447  VAL A CG2 1 
ATOM   3369 N  N   . GLN A 1  448 ? 61.179  102.290 65.085 1.00 62.39  ? 448  GLN A N   1 
ATOM   3370 C  CA  . GLN A 1  448 ? 62.236  103.262 64.834 1.00 69.45  ? 448  GLN A CA  1 
ATOM   3371 C  C   . GLN A 1  448 ? 61.660  104.557 64.357 1.00 71.26  ? 448  GLN A C   1 
ATOM   3372 O  O   . GLN A 1  448 ? 60.547  104.607 63.773 1.00 72.18  ? 448  GLN A O   1 
ATOM   3373 C  CB  . GLN A 1  448 ? 63.295  102.739 63.864 1.00 69.68  ? 448  GLN A CB  1 
ATOM   3374 C  CG  . GLN A 1  448 ? 63.959  103.736 62.988 1.00 61.40  ? 448  GLN A CG  1 
ATOM   3375 C  CD  . GLN A 1  448 ? 63.894  103.268 61.555 1.00 69.24  ? 448  GLN A CD  1 
ATOM   3376 O  OE1 . GLN A 1  448 ? 64.898  103.167 60.837 1.00 68.28  ? 448  GLN A OE1 1 
ATOM   3377 N  NE2 . GLN A 1  448 ? 62.695  102.955 61.133 1.00 76.88  ? 448  GLN A NE2 1 
ATOM   3378 N  N   . ASP A 1  449 ? 62.428  105.604 64.676 1.00 68.41  ? 449  ASP A N   1 
ATOM   3379 C  CA  . ASP A 1  449 ? 62.070  106.948 64.344 1.00 61.92  ? 449  ASP A CA  1 
ATOM   3380 C  C   . ASP A 1  449 ? 63.195  107.648 63.704 1.00 62.56  ? 449  ASP A C   1 
ATOM   3381 O  O   . ASP A 1  449 ? 64.369  107.546 64.115 1.00 59.83  ? 449  ASP A O   1 
ATOM   3382 C  CB  . ASP A 1  449 ? 61.674  107.773 65.583 1.00 67.86  ? 449  ASP A CB  1 
ATOM   3383 C  CG  . ASP A 1  449 ? 60.959  109.091 65.208 1.00 70.91  ? 449  ASP A CG  1 
ATOM   3384 O  OD1 . ASP A 1  449 ? 59.745  108.992 64.829 1.00 70.37  ? 449  ASP A OD1 1 
ATOM   3385 O  OD2 . ASP A 1  449 ? 61.604  110.201 65.269 1.00 74.78  ? 449  ASP A OD2 1 
ATOM   3386 N  N   . GLN A 1  450 ? 62.819  108.335 62.649 1.00 64.57  ? 450  GLN A N   1 
ATOM   3387 C  CA  . GLN A 1  450 ? 63.750  109.191 61.954 1.00 74.77  ? 450  GLN A CA  1 
ATOM   3388 C  C   . GLN A 1  450 ? 63.050  110.510 62.303 1.00 77.80  ? 450  GLN A C   1 
ATOM   3389 O  O   . GLN A 1  450 ? 61.837  110.726 61.986 1.00 69.32  ? 450  GLN A O   1 
ATOM   3390 C  CB  . GLN A 1  450 ? 63.737  108.905 60.454 1.00 79.82  ? 450  GLN A CB  1 
ATOM   3391 C  CG  . GLN A 1  450 ? 64.351  107.560 60.084 1.00 74.18  ? 450  GLN A CG  1 
ATOM   3392 C  CD  . GLN A 1  450 ? 63.959  107.189 58.699 1.00 68.54  ? 450  GLN A CD  1 
ATOM   3393 O  OE1 . GLN A 1  450 ? 62.799  106.789 58.474 1.00 56.49  ? 450  GLN A OE1 1 
ATOM   3394 N  NE2 . GLN A 1  450 ? 64.905  107.327 57.742 1.00 52.36  ? 450  GLN A NE2 1 
ATOM   3395 N  N   . ALA A 1  451 ? 63.800  111.311 63.057 1.00 78.38  ? 451  ALA A N   1 
ATOM   3396 C  CA  . ALA A 1  451 ? 63.360  112.596 63.562 1.00 81.27  ? 451  ALA A CA  1 
ATOM   3397 C  C   . ALA A 1  451 ? 64.304  113.634 63.006 1.00 81.50  ? 451  ALA A C   1 
ATOM   3398 O  O   . ALA A 1  451 ? 65.539  113.539 63.135 1.00 80.05  ? 451  ALA A O   1 
ATOM   3399 C  CB  . ALA A 1  451 ? 63.391  112.594 65.085 1.00 74.86  ? 451  ALA A CB  1 
ATOM   3400 N  N   . GLN A 1  452 ? 63.714  114.615 62.347 1.00 84.77  ? 452  GLN A N   1 
ATOM   3401 C  CA  . GLN A 1  452 ? 64.496  115.676 61.752 1.00 94.48  ? 452  GLN A CA  1 
ATOM   3402 C  C   . GLN A 1  452 ? 64.025  116.998 62.327 1.00 99.95  ? 452  GLN A C   1 
ATOM   3403 O  O   . GLN A 1  452 ? 62.826  117.341 62.359 1.00 95.79  ? 452  GLN A O   1 
ATOM   3404 C  CB  . GLN A 1  452 ? 64.315  115.682 60.254 1.00 97.22  ? 452  GLN A CB  1 
ATOM   3405 C  CG  . GLN A 1  452 ? 65.461  116.234 59.473 1.00 100.49 ? 452  GLN A CG  1 
ATOM   3406 C  CD  . GLN A 1  452 ? 65.106  116.238 58.000 1.00 106.84 ? 452  GLN A CD  1 
ATOM   3407 O  OE1 . GLN A 1  452 ? 64.505  115.268 57.474 1.00 104.84 ? 452  GLN A OE1 1 
ATOM   3408 N  NE2 . GLN A 1  452 ? 65.464  117.320 57.317 1.00 105.07 ? 452  GLN A NE2 1 
ATOM   3409 N  N   . TRP A 1  453 ? 65.018  117.733 62.788 1.00 105.13 ? 453  TRP A N   1 
ATOM   3410 C  CA  . TRP A 1  453 ? 64.811  119.008 63.399 1.00 106.98 ? 453  TRP A CA  1 
ATOM   3411 C  C   . TRP A 1  453 ? 65.860  119.869 62.728 1.00 104.00 ? 453  TRP A C   1 
ATOM   3412 O  O   . TRP A 1  453 ? 67.005  119.962 63.129 1.00 99.18  ? 453  TRP A O   1 
ATOM   3413 C  CB  . TRP A 1  453 ? 64.968  118.844 64.918 1.00 113.60 ? 453  TRP A CB  1 
ATOM   3414 C  CG  . TRP A 1  453 ? 64.905  120.086 65.707 1.00 121.74 ? 453  TRP A CG  1 
ATOM   3415 C  CD1 . TRP A 1  453 ? 64.045  121.141 65.551 1.00 123.63 ? 453  TRP A CD1 1 
ATOM   3416 C  CD2 . TRP A 1  453 ? 65.815  120.451 66.737 1.00 125.32 ? 453  TRP A CD2 1 
ATOM   3417 N  NE1 . TRP A 1  453 ? 64.383  122.154 66.419 1.00 122.79 ? 453  TRP A NE1 1 
ATOM   3418 C  CE2 . TRP A 1  453 ? 65.459  121.753 67.151 1.00 124.19 ? 453  TRP A CE2 1 
ATOM   3419 C  CE3 . TRP A 1  453 ? 66.893  119.801 67.346 1.00 127.38 ? 453  TRP A CE3 1 
ATOM   3420 C  CZ2 . TRP A 1  453 ? 66.166  122.412 68.147 1.00 130.01 ? 453  TRP A CZ2 1 
ATOM   3421 C  CZ3 . TRP A 1  453 ? 67.590  120.459 68.334 1.00 131.16 ? 453  TRP A CZ3 1 
ATOM   3422 C  CH2 . TRP A 1  453 ? 67.225  121.755 68.727 1.00 133.09 ? 453  TRP A CH2 1 
ATOM   3423 N  N   . ASP A 1  454 ? 65.412  120.437 61.623 1.00 106.47 ? 454  ASP A N   1 
ATOM   3424 C  CA  . ASP A 1  454 ? 66.188  121.312 60.782 1.00 109.91 ? 454  ASP A CA  1 
ATOM   3425 C  C   . ASP A 1  454 ? 67.350  120.628 60.144 1.00 103.67 ? 454  ASP A C   1 
ATOM   3426 O  O   . ASP A 1  454 ? 67.119  119.774 59.316 1.00 111.07 ? 454  ASP A O   1 
ATOM   3427 C  CB  . ASP A 1  454 ? 66.556  122.583 61.545 1.00 117.33 ? 454  ASP A CB  1 
ATOM   3428 C  CG  . ASP A 1  454 ? 65.294  123.367 61.961 1.00 126.92 ? 454  ASP A CG  1 
ATOM   3429 O  OD1 . ASP A 1  454 ? 64.319  123.371 61.157 1.00 130.36 ? 454  ASP A OD1 1 
ATOM   3430 O  OD2 . ASP A 1  454 ? 65.259  123.960 63.074 1.00 133.53 ? 454  ASP A OD2 1 
ATOM   3431 N  N   . LYS A 1  455 ? 68.584  120.947 60.479 1.00 99.81  ? 455  LYS A N   1 
ATOM   3432 C  CA  . LYS A 1  455 ? 69.666  120.254 59.773 1.00 100.43 ? 455  LYS A CA  1 
ATOM   3433 C  C   . LYS A 1  455 ? 70.178  118.949 60.448 1.00 95.57  ? 455  LYS A C   1 
ATOM   3434 O  O   . LYS A 1  455 ? 71.189  118.317 60.061 1.00 87.79  ? 455  LYS A O   1 
ATOM   3435 C  CB  . LYS A 1  455 ? 70.791  121.254 59.452 1.00 103.70 ? 455  LYS A CB  1 
ATOM   3436 C  CG  . LYS A 1  455 ? 70.474  122.173 58.238 1.00 111.85 ? 455  LYS A CG  1 
ATOM   3437 C  CD  . LYS A 1  455 ? 69.134  122.969 58.393 1.00 125.51 ? 455  LYS A CD  1 
ATOM   3438 C  CE  . LYS A 1  455 ? 67.884  122.299 57.734 1.00 127.39 ? 455  LYS A CE  1 
ATOM   3439 N  NZ  . LYS A 1  455 ? 67.697  122.536 56.252 1.00 128.69 ? 455  LYS A NZ  1 
ATOM   3440 N  N   . VAL A 1  456 ? 69.392  118.521 61.421 1.00 92.90  ? 456  VAL A N   1 
ATOM   3441 C  CA  . VAL A 1  456 ? 69.679  117.335 62.166 1.00 85.76  ? 456  VAL A CA  1 
ATOM   3442 C  C   . VAL A 1  456 ? 68.658  116.245 61.896 1.00 89.14  ? 456  VAL A C   1 
ATOM   3443 O  O   . VAL A 1  456 ? 67.419  116.453 61.875 1.00 84.57  ? 456  VAL A O   1 
ATOM   3444 C  CB  . VAL A 1  456 ? 69.722  117.660 63.662 1.00 86.34  ? 456  VAL A CB  1 
ATOM   3445 C  CG1 . VAL A 1  456 ? 69.612  116.401 64.510 1.00 84.02  ? 456  VAL A CG1 1 
ATOM   3446 C  CG2 . VAL A 1  456 ? 71.013  118.359 63.950 1.00 87.59  ? 456  VAL A CG2 1 
ATOM   3447 N  N   . LEU A 1  457 ? 69.211  115.072 61.644 1.00 84.99  ? 457  LEU A N   1 
ATOM   3448 C  CA  . LEU A 1  457 ? 68.399  113.926 61.427 1.00 80.53  ? 457  LEU A CA  1 
ATOM   3449 C  C   . LEU A 1  457 ? 68.898  112.952 62.472 1.00 75.61  ? 457  LEU A C   1 
ATOM   3450 O  O   . LEU A 1  457 ? 70.097  112.713 62.643 1.00 76.08  ? 457  LEU A O   1 
ATOM   3451 C  CB  . LEU A 1  457 ? 68.587  113.432 60.000 1.00 84.21  ? 457  LEU A CB  1 
ATOM   3452 C  CG  . LEU A 1  457 ? 68.058  112.038 59.598 1.00 86.18  ? 457  LEU A CG  1 
ATOM   3453 C  CD1 . LEU A 1  457 ? 67.039  111.485 60.605 1.00 79.49  ? 457  LEU A CD1 1 
ATOM   3454 C  CD2 . LEU A 1  457 ? 67.499  112.131 58.152 1.00 76.51  ? 457  LEU A CD2 1 
ATOM   3455 N  N   . VAL A 1  458 ? 67.966  112.391 63.197 1.00 70.61  ? 458  VAL A N   1 
ATOM   3456 C  CA  . VAL A 1  458 ? 68.373  111.479 64.218 1.00 74.42  ? 458  VAL A CA  1 
ATOM   3457 C  C   . VAL A 1  458 ? 67.651  110.167 63.990 1.00 77.54  ? 458  VAL A C   1 
ATOM   3458 O  O   . VAL A 1  458 ? 66.400  110.091 63.921 1.00 78.30  ? 458  VAL A O   1 
ATOM   3459 C  CB  . VAL A 1  458 ? 67.992  112.004 65.613 1.00 76.04  ? 458  VAL A CB  1 
ATOM   3460 C  CG1 . VAL A 1  458 ? 66.541  111.594 65.942 1.00 82.97  ? 458  VAL A CG1 1 
ATOM   3461 C  CG2 . VAL A 1  458 ? 68.923  111.473 66.654 1.00 72.87  ? 458  VAL A CG2 1 
ATOM   3462 N  N   . THR A 1  459 ? 68.425  109.104 63.875 1.00 74.13  ? 459  THR A N   1 
ATOM   3463 C  CA  . THR A 1  459 ? 67.743  107.864 63.698 1.00 70.65  ? 459  THR A CA  1 
ATOM   3464 C  C   . THR A 1  459 ? 67.866  107.034 64.959 1.00 70.03  ? 459  THR A C   1 
ATOM   3465 O  O   . THR A 1  459 ? 68.940  106.944 65.570 1.00 67.89  ? 459  THR A O   1 
ATOM   3466 C  CB  . THR A 1  459 ? 68.302  107.096 62.498 1.00 65.50  ? 459  THR A CB  1 
ATOM   3467 O  OG1 . THR A 1  459 ? 68.483  107.968 61.359 1.00 66.23  ? 459  THR A OG1 1 
ATOM   3468 C  CG2 . THR A 1  459 ? 67.337  106.033 62.175 1.00 57.57  ? 459  THR A CG2 1 
ATOM   3469 N  N   . LEU A 1  460 ? 66.777  106.452 65.403 1.00 56.76  ? 460  LEU A N   1 
ATOM   3470 C  CA  . LEU A 1  460 ? 66.950  105.607 66.557 1.00 69.26  ? 460  LEU A CA  1 
ATOM   3471 C  C   . LEU A 1  460 ? 65.787  104.683 66.671 1.00 67.08  ? 460  LEU A C   1 
ATOM   3472 O  O   . LEU A 1  460 ? 64.662  105.089 66.405 1.00 67.52  ? 460  LEU A O   1 
ATOM   3473 C  CB  . LEU A 1  460 ? 67.110  106.427 67.851 1.00 75.54  ? 460  LEU A CB  1 
ATOM   3474 C  CG  . LEU A 1  460 ? 66.634  105.710 69.141 1.00 79.91  ? 460  LEU A CG  1 
ATOM   3475 C  CD1 . LEU A 1  460 ? 67.798  105.072 69.920 1.00 70.89  ? 460  LEU A CD1 1 
ATOM   3476 C  CD2 . LEU A 1  460 ? 65.875  106.708 69.992 1.00 67.87  ? 460  LEU A CD2 1 
ATOM   3477 N  N   . GLY A 1  461 ? 66.077  103.433 67.021 1.00 59.26  ? 461  GLY A N   1 
ATOM   3478 C  CA  . GLY A 1  461 ? 65.029  102.429 67.194 1.00 58.29  ? 461  GLY A CA  1 
ATOM   3479 C  C   . GLY A 1  461 ? 65.600  101.138 67.802 1.00 52.32  ? 461  GLY A C   1 
ATOM   3480 O  O   . GLY A 1  461 ? 66.795  101.035 68.187 1.00 64.29  ? 461  GLY A O   1 
ATOM   3481 N  N   . GLY A 1  462 ? 64.773  100.113 67.875 1.00 51.09  ? 462  GLY A N   1 
ATOM   3482 C  CA  . GLY A 1  462 ? 65.266  98.872  68.435 1.00 67.64  ? 462  GLY A CA  1 
ATOM   3483 C  C   . GLY A 1  462 ? 64.386  97.771  67.907 1.00 68.96  ? 462  GLY A C   1 
ATOM   3484 O  O   . GLY A 1  462 ? 63.341  98.060  67.301 1.00 62.67  ? 462  GLY A O   1 
ATOM   3485 N  N   . ARG A 1  463 ? 64.801  96.518  68.106 1.00 66.04  ? 463  ARG A N   1 
ATOM   3486 C  CA  . ARG A 1  463 ? 64.004  95.395  67.626 1.00 68.87  ? 463  ARG A CA  1 
ATOM   3487 C  C   . ARG A 1  463 ? 64.214  94.325  68.645 1.00 67.99  ? 463  ARG A C   1 
ATOM   3488 O  O   . ARG A 1  463 ? 65.266  94.317  69.302 1.00 66.67  ? 463  ARG A O   1 
ATOM   3489 C  CB  . ARG A 1  463 ? 64.486  94.884  66.240 1.00 66.43  ? 463  ARG A CB  1 
ATOM   3490 C  CG  . ARG A 1  463 ? 63.716  93.640  65.765 1.00 52.48  ? 463  ARG A CG  1 
ATOM   3491 C  CD  . ARG A 1  463 ? 63.775  93.420  64.263 1.00 70.70  ? 463  ARG A CD  1 
ATOM   3492 N  NE  . ARG A 1  463 ? 63.681  91.999  63.952 1.00 63.87  ? 463  ARG A NE  1 
ATOM   3493 C  CZ  . ARG A 1  463 ? 63.182  91.504  62.827 1.00 64.99  ? 463  ARG A CZ  1 
ATOM   3494 N  NH1 . ARG A 1  463 ? 62.730  92.315  61.863 1.00 54.73  ? 463  ARG A NH1 1 
ATOM   3495 N  NH2 . ARG A 1  463 ? 63.046  90.181  62.708 1.00 57.68  ? 463  ARG A NH2 1 
ATOM   3496 N  N   . TYR A 1  464 ? 63.235  93.426  68.749 1.00 63.80  ? 464  TYR A N   1 
ATOM   3497 C  CA  . TYR A 1  464 ? 63.289  92.337  69.705 1.00 66.46  ? 464  TYR A CA  1 
ATOM   3498 C  C   . TYR A 1  464 ? 62.918  91.126  68.908 1.00 65.41  ? 464  TYR A C   1 
ATOM   3499 O  O   . TYR A 1  464 ? 61.878  91.116  68.248 1.00 61.68  ? 464  TYR A O   1 
ATOM   3500 C  CB  . TYR A 1  464 ? 62.231  92.519  70.855 1.00 76.93  ? 464  TYR A CB  1 
ATOM   3501 C  CG  . TYR A 1  464 ? 62.278  91.480  72.036 1.00 73.73  ? 464  TYR A CG  1 
ATOM   3502 C  CD1 . TYR A 1  464 ? 63.184  91.621  73.113 1.00 80.14  ? 464  TYR A CD1 1 
ATOM   3503 C  CD2 . TYR A 1  464 ? 61.493  90.307  72.000 1.00 83.76  ? 464  TYR A CD2 1 
ATOM   3504 C  CE1 . TYR A 1  464 ? 63.314  90.590  74.119 1.00 76.04  ? 464  TYR A CE1 1 
ATOM   3505 C  CE2 . TYR A 1  464 ? 61.619  89.279  72.986 1.00 81.50  ? 464  TYR A CE2 1 
ATOM   3506 C  CZ  . TYR A 1  464 ? 62.535  89.423  74.040 1.00 80.97  ? 464  TYR A CZ  1 
ATOM   3507 O  OH  . TYR A 1  464 ? 62.703  88.377  74.952 1.00 75.96  ? 464  TYR A OH  1 
ATOM   3508 N  N   . ASP A 1  465 ? 63.714  90.072  69.050 1.00 64.23  ? 465  ASP A N   1 
ATOM   3509 C  CA  . ASP A 1  465 ? 63.468  88.845  68.323 1.00 63.07  ? 465  ASP A CA  1 
ATOM   3510 C  C   . ASP A 1  465 ? 63.251  87.534  69.112 1.00 63.90  ? 465  ASP A C   1 
ATOM   3511 O  O   . ASP A 1  465 ? 63.869  87.287  70.143 1.00 68.25  ? 465  ASP A O   1 
ATOM   3512 C  CB  . ASP A 1  465 ? 64.614  88.657  67.287 1.00 47.90  ? 465  ASP A CB  1 
ATOM   3513 C  CG  . ASP A 1  465 ? 64.458  89.578  66.028 1.00 64.66  ? 465  ASP A CG  1 
ATOM   3514 O  OD1 . ASP A 1  465 ? 63.625  89.239  65.142 1.00 59.80  ? 465  ASP A OD1 1 
ATOM   3515 O  OD2 . ASP A 1  465 ? 65.151  90.633  65.927 1.00 60.78  ? 465  ASP A OD2 1 
ATOM   3516 N  N   . TRP A 1  466 ? 62.358  86.709  68.587 1.00 61.55  ? 466  TRP A N   1 
ATOM   3517 C  CA  . TRP A 1  466 ? 62.069  85.402  69.095 1.00 60.90  ? 466  TRP A CA  1 
ATOM   3518 C  C   . TRP A 1  466 ? 62.601  84.480  68.012 1.00 66.90  ? 466  TRP A C   1 
ATOM   3519 O  O   . TRP A 1  466 ? 61.933  84.209  67.001 1.00 66.63  ? 466  TRP A O   1 
ATOM   3520 C  CB  . TRP A 1  466 ? 60.579  85.172  69.218 1.00 66.94  ? 466  TRP A CB  1 
ATOM   3521 C  CG  . TRP A 1  466 ? 60.023  85.675  70.452 1.00 81.14  ? 466  TRP A CG  1 
ATOM   3522 C  CD1 . TRP A 1  466 ? 59.997  85.049  71.671 1.00 81.90  ? 466  TRP A CD1 1 
ATOM   3523 C  CD2 . TRP A 1  466 ? 59.528  86.996  70.655 1.00 86.29  ? 466  TRP A CD2 1 
ATOM   3524 N  NE1 . TRP A 1  466 ? 59.523  85.925  72.620 1.00 86.22  ? 466  TRP A NE1 1 
ATOM   3525 C  CE2 . TRP A 1  466 ? 59.223  87.124  72.020 1.00 84.04  ? 466  TRP A CE2 1 
ATOM   3526 C  CE3 . TRP A 1  466 ? 59.308  88.087  69.806 1.00 86.17  ? 466  TRP A CE3 1 
ATOM   3527 C  CZ2 . TRP A 1  466 ? 58.723  88.288  72.560 1.00 85.18  ? 466  TRP A CZ2 1 
ATOM   3528 C  CZ3 . TRP A 1  466 ? 58.814  89.241  70.337 1.00 92.26  ? 466  TRP A CZ3 1 
ATOM   3529 C  CH2 . TRP A 1  466 ? 58.519  89.336  71.707 1.00 90.98  ? 466  TRP A CH2 1 
ATOM   3530 N  N   . ALA A 1  467 ? 63.789  83.959  68.252 1.00 69.20  ? 467  ALA A N   1 
ATOM   3531 C  CA  . ALA A 1  467 ? 64.428  83.108  67.285 1.00 70.16  ? 467  ALA A CA  1 
ATOM   3532 C  C   . ALA A 1  467 ? 64.521  81.680  67.726 1.00 58.62  ? 467  ALA A C   1 
ATOM   3533 O  O   . ALA A 1  467 ? 65.459  81.283  68.404 1.00 63.72  ? 467  ALA A O   1 
ATOM   3534 C  CB  . ALA A 1  467 ? 65.787  83.646  67.006 1.00 66.10  ? 467  ALA A CB  1 
ATOM   3535 N  N   . ASP A 1  468 ? 63.581  80.876  67.287 1.00 52.84  ? 468  ASP A N   1 
ATOM   3536 C  CA  . ASP A 1  468 ? 63.656  79.521  67.702 1.00 53.87  ? 468  ASP A CA  1 
ATOM   3537 C  C   . ASP A 1  468 ? 63.991  78.491  66.629 1.00 53.48  ? 468  ASP A C   1 
ATOM   3538 O  O   . ASP A 1  468 ? 63.473  78.504  65.523 1.00 78.58  ? 468  ASP A O   1 
ATOM   3539 C  CB  . ASP A 1  468 ? 62.361  79.066  68.360 1.00 67.70  ? 468  ASP A CB  1 
ATOM   3540 C  CG  . ASP A 1  468 ? 61.620  80.134  69.071 1.00 53.94  ? 468  ASP A CG  1 
ATOM   3541 O  OD1 . ASP A 1  468 ? 62.219  81.015  69.783 1.00 77.32  ? 468  ASP A OD1 1 
ATOM   3542 O  OD2 . ASP A 1  468 ? 60.366  80.059  68.913 1.00 71.72  ? 468  ASP A OD2 1 
ATOM   3543 N  N   . GLN A 1  469 ? 64.832  77.558  67.016 1.00 53.17  ? 469  GLN A N   1 
ATOM   3544 C  CA  . GLN A 1  469 ? 65.264  76.459  66.153 1.00 53.60  ? 469  GLN A CA  1 
ATOM   3545 C  C   . GLN A 1  469 ? 65.108  75.099  66.763 1.00 53.94  ? 469  GLN A C   1 
ATOM   3546 O  O   . GLN A 1  469 ? 65.105  74.937  67.986 1.00 85.52  ? 469  GLN A O   1 
ATOM   3547 C  CB  . GLN A 1  469 ? 66.749  76.564  65.771 1.00 55.24  ? 469  GLN A CB  1 
ATOM   3548 C  CG  . GLN A 1  469 ? 67.742  76.766  66.896 1.00 53.81  ? 469  GLN A CG  1 
ATOM   3549 C  CD  . GLN A 1  469 ? 69.114  76.822  66.374 1.00 53.24  ? 469  GLN A CD  1 
ATOM   3550 O  OE1 . GLN A 1  469 ? 69.483  75.980  65.625 1.00 57.50  ? 469  GLN A OE1 1 
ATOM   3551 N  NE2 . GLN A 1  469 ? 69.882  77.779  66.779 1.00 52.45  ? 469  GLN A NE2 1 
ATOM   3552 N  N   . GLU A 1  470 ? 65.048  74.129  65.878 1.00 52.56  ? 470  GLU A N   1 
ATOM   3553 C  CA  . GLU A 1  470 ? 64.940  72.775  66.267 1.00 53.59  ? 470  GLU A CA  1 
ATOM   3554 C  C   . GLU A 1  470 ? 65.599  71.941  65.189 1.00 75.00  ? 470  GLU A C   1 
ATOM   3555 O  O   . GLU A 1  470 ? 65.333  72.119  63.998 1.00 57.67  ? 470  GLU A O   1 
ATOM   3556 C  CB  . GLU A 1  470 ? 63.467  72.442  66.365 1.00 80.45  ? 470  GLU A CB  1 
ATOM   3557 C  CG  . GLU A 1  470 ? 63.106  71.039  66.805 1.00 84.38  ? 470  GLU A CG  1 
ATOM   3558 C  CD  . GLU A 1  470 ? 61.606  70.905  66.976 1.00 89.10  ? 470  GLU A CD  1 
ATOM   3559 O  OE1 . GLU A 1  470 ? 61.041  71.752  67.740 1.00 84.46  ? 470  GLU A OE1 1 
ATOM   3560 O  OE2 . GLU A 1  470 ? 61.008  69.982  66.341 1.00 80.89  ? 470  GLU A OE2 1 
ATOM   3561 N  N   . SER A 1  471 ? 66.439  71.007  65.614 1.00 79.29  ? 471  SER A N   1 
ATOM   3562 C  CA  . SER A 1  471 ? 67.104  70.118  64.675 1.00 55.59  ? 471  SER A CA  1 
ATOM   3563 C  C   . SER A 1  471 ? 66.894  68.560  64.897 1.00 56.58  ? 471  SER A C   1 
ATOM   3564 O  O   . SER A 1  471 ? 67.263  68.015  65.930 1.00 58.26  ? 471  SER A O   1 
ATOM   3565 C  CB  . SER A 1  471 ? 68.596  70.447  64.686 1.00 53.18  ? 471  SER A CB  1 
ATOM   3566 O  OG  . SER A 1  471 ? 69.250  69.690  63.676 1.00 51.66  ? 471  SER A OG  1 
ATOM   3567 N  N   . LEU A 1  472 ? 66.346  67.846  63.931 1.00 53.62  ? 472  LEU A N   1 
ATOM   3568 C  CA  . LEU A 1  472 ? 66.203  66.440  64.107 1.00 52.93  ? 472  LEU A CA  1 
ATOM   3569 C  C   . LEU A 1  472 ? 67.285  65.672  63.299 1.00 55.25  ? 472  LEU A C   1 
ATOM   3570 O  O   . LEU A 1  472 ? 67.464  65.883  62.093 1.00 73.61  ? 472  LEU A O   1 
ATOM   3571 C  CB  . LEU A 1  472 ? 64.795  65.935  63.709 1.00 51.71  ? 472  LEU A CB  1 
ATOM   3572 C  CG  . LEU A 1  472 ? 64.739  64.429  63.208 1.00 53.83  ? 472  LEU A CG  1 
ATOM   3573 C  CD1 . LEU A 1  472 ? 64.972  63.425  64.373 1.00 51.68  ? 472  LEU A CD1 1 
ATOM   3574 C  CD2 . LEU A 1  472 ? 63.438  64.087  62.420 1.00 50.09  ? 472  LEU A CD2 1 
ATOM   3575 N  N   . ASN A 1  473 ? 67.976  64.748  63.968 1.00 73.87  ? 473  ASN A N   1 
ATOM   3576 C  CA  . ASN A 1  473 ? 68.972  63.916  63.311 1.00 58.50  ? 473  ASN A CA  1 
ATOM   3577 C  C   . ASN A 1  473 ? 68.319  62.520  63.062 1.00 70.12  ? 473  ASN A C   1 
ATOM   3578 O  O   . ASN A 1  473 ? 68.157  61.674  63.923 1.00 59.57  ? 473  ASN A O   1 
ATOM   3579 C  CB  . ASN A 1  473 ? 70.231  63.846  64.169 1.00 54.45  ? 473  ASN A CB  1 
ATOM   3580 C  CG  . ASN A 1  473 ? 71.317  63.030  63.506 1.00 64.39  ? 473  ASN A CG  1 
ATOM   3581 O  OD1 . ASN A 1  473 ? 71.025  62.127  62.740 1.00 67.24  ? 473  ASN A OD1 1 
ATOM   3582 N  ND2 . ASN A 1  473 ? 72.580  63.330  63.809 1.00 55.43  ? 473  ASN A ND2 1 
ATOM   3583 N  N   . ARG A 1  474 ? 67.902  62.303  61.835 1.00 69.51  ? 474  ARG A N   1 
ATOM   3584 C  CA  . ARG A 1  474 ? 67.223  61.089  61.529 1.00 59.63  ? 474  ARG A CA  1 
ATOM   3585 C  C   . ARG A 1  474 ? 68.114  59.872  61.698 1.00 74.84  ? 474  ARG A C   1 
ATOM   3586 O  O   . ARG A 1  474 ? 67.607  58.814  62.047 1.00 87.20  ? 474  ARG A O   1 
ATOM   3587 C  CB  . ARG A 1  474 ? 66.643  61.171  60.123 1.00 65.38  ? 474  ARG A CB  1 
ATOM   3588 C  CG  . ARG A 1  474 ? 65.626  62.291  59.871 1.00 64.43  ? 474  ARG A CG  1 
ATOM   3589 C  CD  . ARG A 1  474 ? 65.436  62.398  58.311 1.00 60.58  ? 474  ARG A CD  1 
ATOM   3590 N  NE  . ARG A 1  474 ? 64.262  63.150  57.802 1.00 72.39  ? 474  ARG A NE  1 
ATOM   3591 C  CZ  . ARG A 1  474 ? 63.050  63.312  58.378 1.00 65.34  ? 474  ARG A CZ  1 
ATOM   3592 N  NH1 . ARG A 1  474 ? 62.714  62.820  59.549 1.00 65.79  ? 474  ARG A NH1 1 
ATOM   3593 N  NH2 . ARG A 1  474 ? 62.122  63.957  57.728 1.00 68.87  ? 474  ARG A NH2 1 
ATOM   3594 N  N   . VAL A 1  475 ? 69.429  59.997  61.446 1.00 76.13  ? 475  VAL A N   1 
ATOM   3595 C  CA  . VAL A 1  475 ? 70.393  58.880  61.617 1.00 65.12  ? 475  VAL A CA  1 
ATOM   3596 C  C   . VAL A 1  475 ? 70.612  58.570  63.145 1.00 64.05  ? 475  VAL A C   1 
ATOM   3597 O  O   . VAL A 1  475 ? 70.620  57.439  63.551 1.00 59.36  ? 475  VAL A O   1 
ATOM   3598 C  CB  . VAL A 1  475 ? 71.775  59.184  60.932 1.00 66.75  ? 475  VAL A CB  1 
ATOM   3599 C  CG1 . VAL A 1  475 ? 72.768  58.127  61.267 1.00 60.38  ? 475  VAL A CG1 1 
ATOM   3600 C  CG2 . VAL A 1  475 ? 71.661  59.193  59.452 1.00 65.11  ? 475  VAL A CG2 1 
ATOM   3601 N  N   . ALA A 1  476 ? 70.749  59.555  64.005 1.00 60.25  ? 476  ALA A N   1 
ATOM   3602 C  CA  . ALA A 1  476 ? 70.936  59.258  65.431 1.00 62.63  ? 476  ALA A CA  1 
ATOM   3603 C  C   . ALA A 1  476 ? 69.607  59.272  66.107 1.00 69.72  ? 476  ALA A C   1 
ATOM   3604 O  O   . ALA A 1  476 ? 69.514  59.070  67.328 1.00 71.19  ? 476  ALA A O   1 
ATOM   3605 C  CB  . ALA A 1  476 ? 71.777  60.339  66.086 1.00 45.99  ? 476  ALA A CB  1 
ATOM   3606 N  N   . GLY A 1  477 ? 68.575  59.570  65.329 1.00 66.33  ? 477  GLY A N   1 
ATOM   3607 C  CA  . GLY A 1  477 ? 67.280  59.692  65.937 1.00 58.30  ? 477  GLY A CA  1 
ATOM   3608 C  C   . GLY A 1  477 ? 67.331  60.746  67.043 1.00 55.34  ? 477  GLY A C   1 
ATOM   3609 O  O   . GLY A 1  477 ? 66.575  60.651  67.950 1.00 57.74  ? 477  GLY A O   1 
ATOM   3610 N  N   . THR A 1  478 ? 68.171  61.768  67.015 1.00 55.33  ? 478  THR A N   1 
ATOM   3611 C  CA  . THR A 1  478 ? 68.090  62.707  68.148 1.00 59.69  ? 478  THR A CA  1 
ATOM   3612 C  C   . THR A 1  478 ? 67.549  64.125  67.819 1.00 86.43  ? 478  THR A C   1 
ATOM   3613 O  O   . THR A 1  478 ? 67.427  64.479  66.617 1.00 68.19  ? 478  THR A O   1 
ATOM   3614 C  CB  . THR A 1  478 ? 69.419  62.853  68.778 1.00 72.79  ? 478  THR A CB  1 
ATOM   3615 O  OG1 . THR A 1  478 ? 70.261  63.619  67.907 1.00 70.69  ? 478  THR A OG1 1 
ATOM   3616 C  CG2 . THR A 1  478 ? 69.997  61.479  69.027 1.00 57.10  ? 478  THR A CG2 1 
ATOM   3617 N  N   . THR A 1  479 ? 67.234  64.925  68.857 1.00 58.92  ? 479  THR A N   1 
ATOM   3618 C  CA  . THR A 1  479 ? 66.694  66.251  68.620 1.00 53.57  ? 479  THR A CA  1 
ATOM   3619 C  C   . THR A 1  479 ? 67.214  67.405  69.437 1.00 67.12  ? 479  THR A C   1 
ATOM   3620 O  O   . THR A 1  479 ? 67.041  67.440  70.648 1.00 86.20  ? 479  THR A O   1 
ATOM   3621 C  CB  . THR A 1  479 ? 65.155  66.272  68.742 1.00 57.65  ? 479  THR A CB  1 
ATOM   3622 O  OG1 . THR A 1  479 ? 64.580  65.446  67.712 1.00 66.36  ? 479  THR A OG1 1 
ATOM   3623 C  CG2 . THR A 1  479 ? 64.601  67.732  68.565 1.00 57.24  ? 479  THR A CG2 1 
ATOM   3624 N  N   . ASP A 1  480 ? 67.802  68.393  68.758 1.00 69.40  ? 480  ASP A N   1 
ATOM   3625 C  CA  . ASP A 1  480 ? 68.345  69.578  69.406 1.00 66.56  ? 480  ASP A CA  1 
ATOM   3626 C  C   . ASP A 1  480 ? 67.477  70.817  69.201 1.00 66.53  ? 480  ASP A C   1 
ATOM   3627 O  O   . ASP A 1  480 ? 67.038  71.123  68.072 1.00 64.17  ? 480  ASP A O   1 
ATOM   3628 C  CB  . ASP A 1  480 ? 69.745  69.848  68.894 1.00 61.86  ? 480  ASP A CB  1 
ATOM   3629 C  CG  . ASP A 1  480 ? 70.742  68.878  69.417 1.00 68.63  ? 480  ASP A CG  1 
ATOM   3630 O  OD1 . ASP A 1  480 ? 71.043  68.921  70.660 1.00 70.17  ? 480  ASP A OD1 1 
ATOM   3631 O  OD2 . ASP A 1  480 ? 71.227  68.072  68.580 1.00 67.13  ? 480  ASP A OD2 1 
ATOM   3632 N  N   . LYS A 1  481 ? 67.238  71.532  70.300 1.00 58.72  ? 481  LYS A N   1 
ATOM   3633 C  CA  . LYS A 1  481 ? 66.408  72.712  70.257 1.00 57.53  ? 481  LYS A CA  1 
ATOM   3634 C  C   . LYS A 1  481 ? 66.954  73.835  71.105 1.00 59.85  ? 481  LYS A C   1 
ATOM   3635 O  O   . LYS A 1  481 ? 67.749  73.610  72.010 1.00 68.27  ? 481  LYS A O   1 
ATOM   3636 C  CB  . LYS A 1  481 ? 65.006  72.403  70.741 1.00 66.35  ? 481  LYS A CB  1 
ATOM   3637 C  CG  . LYS A 1  481 ? 64.379  71.134  70.181 1.00 82.83  ? 481  LYS A CG  1 
ATOM   3638 C  CD  . LYS A 1  481 ? 62.860  71.106  70.385 1.00 88.10  ? 481  LYS A CD  1 
ATOM   3639 C  CE  . LYS A 1  481 ? 62.465  70.405  71.671 1.00 102.61 ? 481  LYS A CE  1 
ATOM   3640 N  NZ  . LYS A 1  481 ? 61.013  70.658  71.978 1.00 107.67 ? 481  LYS A NZ  1 
ATOM   3641 N  N   . ARG A 1  482 ? 66.571  75.063  70.736 1.00 50.52  ? 482  ARG A N   1 
ATOM   3642 C  CA  . ARG A 1  482 ? 66.925  76.280  71.440 1.00 47.32  ? 482  ARG A CA  1 
ATOM   3643 C  C   . ARG A 1  482 ? 66.044  77.325  70.847 1.00 69.72  ? 482  ARG A C   1 
ATOM   3644 O  O   . ARG A 1  482 ? 65.744  77.267  69.640 1.00 63.44  ? 482  ARG A O   1 
ATOM   3645 C  CB  . ARG A 1  482 ? 68.349  76.683  71.228 1.00 45.56  ? 482  ARG A CB  1 
ATOM   3646 C  CG  . ARG A 1  482 ? 68.597  78.011  71.803 1.00 43.67  ? 482  ARG A CG  1 
ATOM   3647 C  CD  . ARG A 1  482 ? 70.043  78.163  72.278 1.00 41.65  ? 482  ARG A CD  1 
ATOM   3648 N  NE  . ARG A 1  482 ? 70.065  79.445  72.974 1.00 67.69  ? 482  ARG A NE  1 
ATOM   3649 C  CZ  . ARG A 1  482 ? 70.995  79.808  73.851 1.00 81.58  ? 482  ARG A CZ  1 
ATOM   3650 N  NH1 . ARG A 1  482 ? 71.989  78.967  74.133 1.00 76.16  ? 482  ARG A NH1 1 
ATOM   3651 N  NH2 . ARG A 1  482 ? 70.922  80.994  74.458 1.00 76.69  ? 482  ARG A NH2 1 
ATOM   3652 N  N   . ASP A 1  483 ? 65.615  78.242  71.718 1.00 66.54  ? 483  ASP A N   1 
ATOM   3653 C  CA  . ASP A 1  483 ? 64.734  79.368  71.392 1.00 65.31  ? 483  ASP A CA  1 
ATOM   3654 C  C   . ASP A 1  483 ? 65.521  80.533  71.912 1.00 61.05  ? 483  ASP A C   1 
ATOM   3655 O  O   . ASP A 1  483 ? 65.889  80.491  73.026 1.00 66.37  ? 483  ASP A O   1 
ATOM   3656 C  CB  . ASP A 1  483 ? 63.413  79.369  72.221 1.00 68.66  ? 483  ASP A CB  1 
ATOM   3657 C  CG  . ASP A 1  483 ? 62.454  78.210  71.897 1.00 70.48  ? 483  ASP A CG  1 
ATOM   3658 O  OD1 . ASP A 1  483 ? 62.672  77.406  70.952 1.00 67.87  ? 483  ASP A OD1 1 
ATOM   3659 O  OD2 . ASP A 1  483 ? 61.437  78.121  72.621 1.00 82.48  ? 483  ASP A OD2 1 
ATOM   3660 N  N   . ASP A 1  484 ? 65.794  81.582  71.152 1.00 70.55  ? 484  ASP A N   1 
ATOM   3661 C  CA  . ASP A 1  484 ? 66.558  82.666  71.746 1.00 68.37  ? 484  ASP A CA  1 
ATOM   3662 C  C   . ASP A 1  484 ? 65.588  83.763  71.796 1.00 69.23  ? 484  ASP A C   1 
ATOM   3663 O  O   . ASP A 1  484 ? 64.530  83.677  71.117 1.00 69.22  ? 484  ASP A O   1 
ATOM   3664 C  CB  . ASP A 1  484 ? 67.780  83.083  70.912 1.00 68.55  ? 484  ASP A CB  1 
ATOM   3665 C  CG  . ASP A 1  484 ? 68.782  81.957  70.738 1.00 68.24  ? 484  ASP A CG  1 
ATOM   3666 O  OD1 . ASP A 1  484 ? 69.571  81.681  71.669 1.00 70.04  ? 484  ASP A OD1 1 
ATOM   3667 O  OD2 . ASP A 1  484 ? 68.770  81.332  69.651 1.00 82.09  ? 484  ASP A OD2 1 
ATOM   3668 N  N   . LYS A 1  485 ? 65.952  84.756  72.613 1.00 62.82  ? 485  LYS A N   1 
ATOM   3669 C  CA  . LYS A 1  485 ? 65.159  85.931  72.836 1.00 63.36  ? 485  LYS A CA  1 
ATOM   3670 C  C   . LYS A 1  485 ? 66.206  86.998  72.806 1.00 63.48  ? 485  LYS A C   1 
ATOM   3671 O  O   . LYS A 1  485 ? 67.180  86.933  73.532 1.00 66.62  ? 485  LYS A O   1 
ATOM   3672 C  CB  . LYS A 1  485 ? 64.404  85.809  74.192 1.00 74.86  ? 485  LYS A CB  1 
ATOM   3673 C  CG  . LYS A 1  485 ? 62.916  85.271  74.045 1.00 75.49  ? 485  LYS A CG  1 
ATOM   3674 C  CD  . LYS A 1  485 ? 62.249  84.745  75.360 1.00 87.83  ? 485  LYS A CD  1 
ATOM   3675 C  CE  . LYS A 1  485 ? 61.857  83.225  75.278 1.00 91.60  ? 485  LYS A CE  1 
ATOM   3676 N  NZ  . LYS A 1  485 ? 61.462  82.680  73.905 1.00 87.09  ? 485  LYS A NZ  1 
ATOM   3677 N  N   . GLN A 1  486 ? 66.050  87.955  71.889 1.00 70.79  ? 486  GLN A N   1 
ATOM   3678 C  CA  . GLN A 1  486 ? 67.054  89.019  71.703 1.00 63.58  ? 486  GLN A CA  1 
ATOM   3679 C  C   . GLN A 1  486 ? 66.514  90.401  71.364 1.00 60.29  ? 486  GLN A C   1 
ATOM   3680 O  O   . GLN A 1  486 ? 65.472  90.560  70.706 1.00 68.53  ? 486  GLN A O   1 
ATOM   3681 C  CB  . GLN A 1  486 ? 68.080  88.648  70.587 1.00 67.94  ? 486  GLN A CB  1 
ATOM   3682 C  CG  . GLN A 1  486 ? 69.024  87.527  70.887 1.00 55.63  ? 486  GLN A CG  1 
ATOM   3683 C  CD  . GLN A 1  486 ? 69.910  87.779  72.124 1.00 64.19  ? 486  GLN A CD  1 
ATOM   3684 O  OE1 . GLN A 1  486 ? 70.468  88.863  72.284 1.00 75.88  ? 486  GLN A OE1 1 
ATOM   3685 N  NE2 . GLN A 1  486 ? 70.083  86.755  72.961 1.00 52.22  ? 486  GLN A NE2 1 
ATOM   3686 N  N   . PHE A 1  487 ? 67.309  91.390  71.780 1.00 65.10  ? 487  PHE A N   1 
ATOM   3687 C  CA  . PHE A 1  487 ? 67.049  92.787  71.599 1.00 56.38  ? 487  PHE A CA  1 
ATOM   3688 C  C   . PHE A 1  487 ? 68.310  93.294  70.971 1.00 55.73  ? 487  PHE A C   1 
ATOM   3689 O  O   . PHE A 1  487 ? 69.375  92.808  71.237 1.00 57.61  ? 487  PHE A O   1 
ATOM   3690 C  CB  . PHE A 1  487 ? 66.814  93.502  72.971 1.00 57.18  ? 487  PHE A CB  1 
ATOM   3691 C  CG  . PHE A 1  487 ? 66.417  94.955  72.825 1.00 56.85  ? 487  PHE A CG  1 
ATOM   3692 C  CD1 . PHE A 1  487 ? 65.176  95.296  72.346 1.00 55.71  ? 487  PHE A CD1 1 
ATOM   3693 C  CD2 . PHE A 1  487 ? 67.366  95.970  72.959 1.00 57.93  ? 487  PHE A CD2 1 
ATOM   3694 C  CE1 . PHE A 1  487 ? 64.897  96.623  71.978 1.00 57.59  ? 487  PHE A CE1 1 
ATOM   3695 C  CE2 . PHE A 1  487 ? 67.084  97.333  72.588 1.00 57.30  ? 487  PHE A CE2 1 
ATOM   3696 C  CZ  . PHE A 1  487 ? 65.852  97.650  72.092 1.00 57.27  ? 487  PHE A CZ  1 
ATOM   3697 N  N   . THR A 1  488 ? 68.179  94.317  70.168 1.00 55.03  ? 488  THR A N   1 
ATOM   3698 C  CA  . THR A 1  488 ? 69.277  94.918  69.450 1.00 54.31  ? 488  THR A CA  1 
ATOM   3699 C  C   . THR A 1  488 ? 68.595  96.267  69.191 1.00 55.46  ? 488  THR A C   1 
ATOM   3700 O  O   . THR A 1  488 ? 67.293  96.352  69.097 1.00 55.39  ? 488  THR A O   1 
ATOM   3701 C  CB  . THR A 1  488 ? 69.527  94.205  67.953 1.00 56.01  ? 488  THR A CB  1 
ATOM   3702 O  OG1 . THR A 1  488 ? 68.373  94.373  67.099 1.00 69.61  ? 488  THR A OG1 1 
ATOM   3703 C  CG2 . THR A 1  488 ? 69.689  92.711  68.028 1.00 52.15  ? 488  THR A CG2 1 
ATOM   3704 N  N   . TRP A 1  489 ? 69.435  97.297  69.060 1.00 54.61  ? 489  TRP A N   1 
ATOM   3705 C  CA  . TRP A 1  489 ? 68.967  98.641  68.771 1.00 54.60  ? 489  TRP A CA  1 
ATOM   3706 C  C   . TRP A 1  489 ? 70.107  99.361  68.077 1.00 55.10  ? 489  TRP A C   1 
ATOM   3707 O  O   . TRP A 1  489 ? 71.213  98.886  67.980 1.00 54.73  ? 489  TRP A O   1 
ATOM   3708 C  CB  . TRP A 1  489 ? 68.537  99.424  70.035 1.00 71.89  ? 489  TRP A CB  1 
ATOM   3709 C  CG  . TRP A 1  489 ? 69.688  99.721  70.969 1.00 61.41  ? 489  TRP A CG  1 
ATOM   3710 C  CD1 . TRP A 1  489 ? 70.311  98.827  71.763 1.00 62.24  ? 489  TRP A CD1 1 
ATOM   3711 C  CD2 . TRP A 1  489 ? 70.445  100.947 71.074 1.00 67.41  ? 489  TRP A CD2 1 
ATOM   3712 N  NE1 . TRP A 1  489 ? 71.419  99.393  72.351 1.00 65.44  ? 489  TRP A NE1 1 
ATOM   3713 C  CE2 . TRP A 1  489 ? 71.525  100.697 71.947 1.00 68.52  ? 489  TRP A CE2 1 
ATOM   3714 C  CE3 . TRP A 1  489 ? 70.327  102.229 70.500 1.00 78.37  ? 489  TRP A CE3 1 
ATOM   3715 C  CZ2 . TRP A 1  489 ? 72.489  101.680 72.276 1.00 70.49  ? 489  TRP A CZ2 1 
ATOM   3716 C  CZ3 . TRP A 1  489 ? 71.301  103.216 70.820 1.00 71.54  ? 489  TRP A CZ3 1 
ATOM   3717 C  CH2 . TRP A 1  489 ? 72.359  102.923 71.701 1.00 65.05  ? 489  TRP A CH2 1 
ATOM   3718 N  N   . ARG A 1  490 ? 69.795  100.526 67.572 1.00 56.30  ? 490  ARG A N   1 
ATOM   3719 C  CA  . ARG A 1  490 ? 70.740  101.271 66.843 1.00 56.53  ? 490  ARG A CA  1 
ATOM   3720 C  C   . ARG A 1  490 ? 70.192  102.658 66.936 1.00 71.91  ? 490  ARG A C   1 
ATOM   3721 O  O   . ARG A 1  490 ? 68.940  102.848 67.032 1.00 59.83  ? 490  ARG A O   1 
ATOM   3722 C  CB  . ARG A 1  490 ? 70.683  100.861 65.395 1.00 56.74  ? 490  ARG A CB  1 
ATOM   3723 C  CG  . ARG A 1  490 ? 71.285  101.929 64.458 1.00 66.27  ? 490  ARG A CG  1 
ATOM   3724 C  CD  . ARG A 1  490 ? 71.044  101.635 62.946 1.00 55.80  ? 490  ARG A CD  1 
ATOM   3725 N  NE  . ARG A 1  490 ? 69.664  101.877 62.471 1.00 56.70  ? 490  ARG A NE  1 
ATOM   3726 C  CZ  . ARG A 1  490 ? 69.301  101.874 61.162 1.00 54.99  ? 490  ARG A CZ  1 
ATOM   3727 N  NH1 . ARG A 1  490 ? 70.228  101.641 60.230 1.00 48.94  ? 490  ARG A NH1 1 
ATOM   3728 N  NH2 . ARG A 1  490 ? 68.022  102.084 60.792 1.00 49.50  ? 490  ARG A NH2 1 
ATOM   3729 N  N   . GLY A 1  491 ? 71.141  103.593 66.870 1.00 64.14  ? 491  GLY A N   1 
ATOM   3730 C  CA  . GLY A 1  491 ? 70.854  105.004 66.897 1.00 65.32  ? 491  GLY A CA  1 
ATOM   3731 C  C   . GLY A 1  491 ? 72.032  105.759 66.251 1.00 68.41  ? 491  GLY A C   1 
ATOM   3732 O  O   . GLY A 1  491 ? 73.208  105.315 66.295 1.00 59.13  ? 491  GLY A O   1 
ATOM   3733 N  N   . GLY A 1  492 ? 71.709  106.914 65.655 1.00 63.31  ? 492  GLY A N   1 
ATOM   3734 C  CA  . GLY A 1  492 ? 72.714  107.738 64.991 1.00 63.35  ? 492  GLY A CA  1 
ATOM   3735 C  C   . GLY A 1  492 ? 72.184  109.084 64.485 1.00 60.56  ? 492  GLY A C   1 
ATOM   3736 O  O   . GLY A 1  492 ? 70.971  109.336 64.390 1.00 60.15  ? 492  GLY A O   1 
ATOM   3737 N  N   . VAL A 1  493 ? 73.126  109.924 64.091 1.00 58.05  ? 493  VAL A N   1 
ATOM   3738 C  CA  . VAL A 1  493 ? 72.816  111.247 63.615 1.00 68.95  ? 493  VAL A CA  1 
ATOM   3739 C  C   . VAL A 1  493 ? 73.565  111.515 62.341 1.00 75.48  ? 493  VAL A C   1 
ATOM   3740 O  O   . VAL A 1  493 ? 74.742  111.140 62.186 1.00 67.73  ? 493  VAL A O   1 
ATOM   3741 C  CB  . VAL A 1  493 ? 73.332  112.412 64.578 1.00 81.52  ? 493  VAL A CB  1 
ATOM   3742 C  CG1 . VAL A 1  493 ? 72.425  113.622 64.463 1.00 70.53  ? 493  VAL A CG1 1 
ATOM   3743 C  CG2 . VAL A 1  493 ? 73.471  111.968 66.041 1.00 71.89  ? 493  VAL A CG2 1 
ATOM   3744 N  N   . ASN A 1  494 ? 72.868  112.222 61.464 1.00 80.73  ? 494  ASN A N   1 
ATOM   3745 C  CA  . ASN A 1  494 ? 73.412  112.700 60.193 1.00 90.86  ? 494  ASN A CA  1 
ATOM   3746 C  C   . ASN A 1  494 ? 73.119  114.163 60.203 1.00 94.13  ? 494  ASN A C   1 
ATOM   3747 O  O   . ASN A 1  494 ? 71.934  114.534 60.332 1.00 94.89  ? 494  ASN A O   1 
ATOM   3748 C  CB  . ASN A 1  494 ? 72.645  112.204 58.984 1.00 88.95  ? 494  ASN A CB  1 
ATOM   3749 C  CG  . ASN A 1  494 ? 72.940  110.823 58.675 1.00 81.86  ? 494  ASN A CG  1 
ATOM   3750 O  OD1 . ASN A 1  494 ? 72.185  109.926 59.059 1.00 74.89  ? 494  ASN A OD1 1 
ATOM   3751 N  ND2 . ASN A 1  494 ? 74.070  110.608 57.995 1.00 54.93  ? 494  ASN A ND2 1 
ATOM   3752 N  N   . TYR A 1  495 ? 74.157  114.977 60.014 1.00 95.10  ? 495  TYR A N   1 
ATOM   3753 C  CA  . TYR A 1  495 ? 73.989  116.425 59.988 1.00 94.93  ? 495  TYR A CA  1 
ATOM   3754 C  C   . TYR A 1  495 ? 73.972  116.876 58.549 1.00 94.12  ? 495  TYR A C   1 
ATOM   3755 O  O   . TYR A 1  495 ? 74.966  116.702 57.817 1.00 91.80  ? 495  TYR A O   1 
ATOM   3756 C  CB  . TYR A 1  495 ? 75.133  117.120 60.700 1.00 100.83 ? 495  TYR A CB  1 
ATOM   3757 C  CG  . TYR A 1  495 ? 74.798  118.544 61.010 1.00 105.21 ? 495  TYR A CG  1 
ATOM   3758 C  CD1 . TYR A 1  495 ? 74.144  118.884 62.201 1.00 109.60 ? 495  TYR A CD1 1 
ATOM   3759 C  CD2 . TYR A 1  495 ? 75.106  119.558 60.104 1.00 107.17 ? 495  TYR A CD2 1 
ATOM   3760 C  CE1 . TYR A 1  495 ? 73.812  120.209 62.482 1.00 108.77 ? 495  TYR A CE1 1 
ATOM   3761 C  CE2 . TYR A 1  495 ? 74.778  120.883 60.368 1.00 109.07 ? 495  TYR A CE2 1 
ATOM   3762 C  CZ  . TYR A 1  495 ? 74.140  121.209 61.558 1.00 111.44 ? 495  TYR A CZ  1 
ATOM   3763 O  OH  . TYR A 1  495 ? 73.893  122.541 61.833 1.00 110.85 ? 495  TYR A OH  1 
ATOM   3764 N  N   . LEU A 1  496 ? 72.877  117.504 58.149 1.00 85.00  ? 496  LEU A N   1 
ATOM   3765 C  CA  . LEU A 1  496 ? 72.778  117.879 56.763 1.00 91.84  ? 496  LEU A CA  1 
ATOM   3766 C  C   . LEU A 1  496 ? 73.120  119.349 56.343 1.00 94.80  ? 496  LEU A C   1 
ATOM   3767 O  O   . LEU A 1  496 ? 72.367  120.275 56.606 1.00 93.37  ? 496  LEU A O   1 
ATOM   3768 C  CB  . LEU A 1  496 ? 71.386  117.395 56.323 1.00 89.24  ? 496  LEU A CB  1 
ATOM   3769 C  CG  . LEU A 1  496 ? 71.053  117.010 54.862 1.00 98.72  ? 496  LEU A CG  1 
ATOM   3770 C  CD1 . LEU A 1  496 ? 72.307  116.478 54.112 1.00 86.96  ? 496  LEU A CD1 1 
ATOM   3771 C  CD2 . LEU A 1  496 ? 69.882  116.004 54.864 1.00 85.16  ? 496  LEU A CD2 1 
ATOM   3772 N  N   . PHE A 1  497 ? 74.286  119.535 55.709 1.00 100.34 ? 497  PHE A N   1 
ATOM   3773 C  CA  . PHE A 1  497 ? 74.793  120.849 55.215 1.00 102.60 ? 497  PHE A CA  1 
ATOM   3774 C  C   . PHE A 1  497 ? 74.363  121.020 53.766 1.00 105.49 ? 497  PHE A C   1 
ATOM   3775 O  O   . PHE A 1  497 ? 74.819  120.259 52.916 1.00 111.32 ? 497  PHE A O   1 
ATOM   3776 C  CB  . PHE A 1  497 ? 76.309  120.884 55.030 1.00 105.61 ? 497  PHE A CB  1 
ATOM   3777 C  CG  . PHE A 1  497 ? 77.127  121.166 56.242 1.00 107.12 ? 497  PHE A CG  1 
ATOM   3778 C  CD1 . PHE A 1  497 ? 76.631  121.005 57.528 1.00 103.01 ? 497  PHE A CD1 1 
ATOM   3779 C  CD2 . PHE A 1  497 ? 78.502  121.430 56.053 1.00 110.85 ? 497  PHE A CD2 1 
ATOM   3780 C  CE1 . PHE A 1  497 ? 77.482  121.139 58.621 1.00 105.85 ? 497  PHE A CE1 1 
ATOM   3781 C  CE2 . PHE A 1  497 ? 79.363  121.567 57.124 1.00 114.13 ? 497  PHE A CE2 1 
ATOM   3782 C  CZ  . PHE A 1  497 ? 78.857  121.396 58.419 1.00 112.70 ? 497  PHE A CZ  1 
ATOM   3783 N  N   . ASP A 1  498 ? 73.600  122.050 53.455 1.00 105.60 ? 498  ASP A N   1 
ATOM   3784 C  CA  . ASP A 1  498 ? 73.148  122.300 52.089 1.00 105.59 ? 498  ASP A CA  1 
ATOM   3785 C  C   . ASP A 1  498 ? 74.200  122.392 50.979 1.00 104.63 ? 498  ASP A C   1 
ATOM   3786 O  O   . ASP A 1  498 ? 73.843  122.398 49.798 1.00 103.47 ? 498  ASP A O   1 
ATOM   3787 C  CB  . ASP A 1  498 ? 72.332  123.569 52.088 1.00 114.65 ? 498  ASP A CB  1 
ATOM   3788 C  CG  . ASP A 1  498 ? 72.835  124.542 53.111 1.00 121.68 ? 498  ASP A CG  1 
ATOM   3789 O  OD1 . ASP A 1  498 ? 74.079  124.535 53.333 1.00 121.24 ? 498  ASP A OD1 1 
ATOM   3790 O  OD2 . ASP A 1  498 ? 72.003  125.290 53.688 1.00 125.71 ? 498  ASP A OD2 1 
ATOM   3791 N  N   . ASN A 1  499 ? 75.479  122.499 51.315 1.00 103.24 ? 499  ASN A N   1 
ATOM   3792 C  CA  . ASN A 1  499 ? 76.477  122.537 50.242 1.00 103.96 ? 499  ASN A CA  1 
ATOM   3793 C  C   . ASN A 1  499 ? 76.581  121.107 49.734 1.00 109.22 ? 499  ASN A C   1 
ATOM   3794 O  O   . ASN A 1  499 ? 77.147  120.861 48.662 1.00 110.62 ? 499  ASN A O   1 
ATOM   3795 C  CB  . ASN A 1  499 ? 77.840  122.988 50.765 1.00 99.43  ? 499  ASN A CB  1 
ATOM   3796 C  CG  . ASN A 1  499 ? 78.296  122.189 51.969 1.00 96.26  ? 499  ASN A CG  1 
ATOM   3797 O  OD1 . ASN A 1  499 ? 77.472  121.693 52.728 1.00 96.79  ? 499  ASN A OD1 1 
ATOM   3798 N  ND2 . ASN A 1  499 ? 79.612  122.082 52.165 1.00 92.40  ? 499  ASN A ND2 1 
ATOM   3799 N  N   . GLY A 1  500 ? 76.015  120.184 50.530 1.00 110.78 ? 500  GLY A N   1 
ATOM   3800 C  CA  . GLY A 1  500 ? 76.009  118.754 50.240 1.00 106.97 ? 500  GLY A CA  1 
ATOM   3801 C  C   . GLY A 1  500 ? 77.057  118.021 51.068 1.00 107.44 ? 500  GLY A C   1 
ATOM   3802 O  O   . GLY A 1  500 ? 78.017  117.457 50.535 1.00 107.49 ? 500  GLY A O   1 
ATOM   3803 N  N   . VAL A 1  501 ? 76.907  118.037 52.382 1.00 98.43  ? 501  VAL A N   1 
ATOM   3804 C  CA  . VAL A 1  501 ? 77.892  117.371 53.211 1.00 89.87  ? 501  VAL A CA  1 
ATOM   3805 C  C   . VAL A 1  501 ? 77.151  116.804 54.373 1.00 93.78  ? 501  VAL A C   1 
ATOM   3806 O  O   . VAL A 1  501 ? 76.538  117.533 55.210 1.00 81.15  ? 501  VAL A O   1 
ATOM   3807 C  CB  . VAL A 1  501 ? 78.963  118.321 53.745 1.00 89.25  ? 501  VAL A CB  1 
ATOM   3808 C  CG1 . VAL A 1  501 ? 79.433  117.844 55.109 1.00 94.10  ? 501  VAL A CG1 1 
ATOM   3809 C  CG2 . VAL A 1  501 ? 80.145  118.378 52.807 1.00 77.56  ? 501  VAL A CG2 1 
ATOM   3810 N  N   . THR A 1  502 ? 77.196  115.487 54.440 1.00 88.24  ? 502  THR A N   1 
ATOM   3811 C  CA  . THR A 1  502 ? 76.486  114.889 55.509 1.00 83.01  ? 502  THR A CA  1 
ATOM   3812 C  C   . THR A 1  502 ? 77.416  114.059 56.321 1.00 85.31  ? 502  THR A C   1 
ATOM   3813 O  O   . THR A 1  502 ? 77.931  113.052 55.889 1.00 84.46  ? 502  THR A O   1 
ATOM   3814 C  CB  . THR A 1  502 ? 75.336  114.162 54.949 1.00 83.49  ? 502  THR A CB  1 
ATOM   3815 O  OG1 . THR A 1  502 ? 75.145  114.600 53.585 1.00 80.19  ? 502  THR A OG1 1 
ATOM   3816 C  CG2 . THR A 1  502 ? 74.095  114.473 55.778 1.00 73.16  ? 502  THR A CG2 1 
ATOM   3817 N  N   . PRO A 1  503 ? 77.733  114.569 57.502 1.00 87.85  ? 503  PRO A N   1 
ATOM   3818 C  CA  . PRO A 1  503 ? 78.621  113.914 58.439 1.00 83.84  ? 503  PRO A CA  1 
ATOM   3819 C  C   . PRO A 1  503 ? 77.671  113.077 59.198 1.00 80.87  ? 503  PRO A C   1 
ATOM   3820 O  O   . PRO A 1  503 ? 76.511  113.473 59.398 1.00 83.26  ? 503  PRO A O   1 
ATOM   3821 C  CB  . PRO A 1  503 ? 79.101  115.054 59.318 1.00 82.22  ? 503  PRO A CB  1 
ATOM   3822 C  CG  . PRO A 1  503 ? 78.811  116.254 58.527 1.00 84.94  ? 503  PRO A CG  1 
ATOM   3823 C  CD  . PRO A 1  503 ? 77.505  115.953 57.928 1.00 82.87  ? 503  PRO A CD  1 
ATOM   3824 N  N   . TYR A 1  504 ? 78.114  111.914 59.621 1.00 75.37  ? 504  TYR A N   1 
ATOM   3825 C  CA  . TYR A 1  504 ? 77.186  111.150 60.423 1.00 76.91  ? 504  TYR A CA  1 
ATOM   3826 C  C   . TYR A 1  504 ? 77.960  110.260 61.342 1.00 73.19  ? 504  TYR A C   1 
ATOM   3827 O  O   . TYR A 1  504 ? 79.199  110.085 61.200 1.00 60.95  ? 504  TYR A O   1 
ATOM   3828 C  CB  . TYR A 1  504 ? 76.296  110.239 59.536 1.00 74.20  ? 504  TYR A CB  1 
ATOM   3829 C  CG  . TYR A 1  504 ? 77.072  109.125 58.833 1.00 68.16  ? 504  TYR A CG  1 
ATOM   3830 C  CD1 . TYR A 1  504 ? 77.728  109.358 57.635 1.00 62.39  ? 504  TYR A CD1 1 
ATOM   3831 C  CD2 . TYR A 1  504 ? 77.179  107.853 59.391 1.00 66.29  ? 504  TYR A CD2 1 
ATOM   3832 C  CE1 . TYR A 1  504 ? 78.445  108.376 57.005 1.00 64.00  ? 504  TYR A CE1 1 
ATOM   3833 C  CE2 . TYR A 1  504 ? 77.941  106.831 58.741 1.00 62.35  ? 504  TYR A CE2 1 
ATOM   3834 C  CZ  . TYR A 1  504 ? 78.555  107.102 57.548 1.00 63.63  ? 504  TYR A CZ  1 
ATOM   3835 O  OH  . TYR A 1  504 ? 79.227  106.100 56.832 1.00 76.36  ? 504  TYR A OH  1 
ATOM   3836 N  N   . PHE A 1  505 ? 77.212  109.674 62.259 1.00 67.41  ? 505  PHE A N   1 
ATOM   3837 C  CA  . PHE A 1  505 ? 77.818  108.641 63.043 1.00 74.21  ? 505  PHE A CA  1 
ATOM   3838 C  C   . PHE A 1  505 ? 76.664  107.846 63.681 1.00 72.69  ? 505  PHE A C   1 
ATOM   3839 O  O   . PHE A 1  505 ? 75.468  108.262 63.636 1.00 72.02  ? 505  PHE A O   1 
ATOM   3840 C  CB  . PHE A 1  505 ? 78.737  109.239 64.071 1.00 81.45  ? 505  PHE A CB  1 
ATOM   3841 C  CG  . PHE A 1  505 ? 78.009  109.739 65.225 1.00 83.23  ? 505  PHE A CG  1 
ATOM   3842 C  CD1 . PHE A 1  505 ? 77.617  108.862 66.228 1.00 83.73  ? 505  PHE A CD1 1 
ATOM   3843 C  CD2 . PHE A 1  505 ? 77.531  111.042 65.224 1.00 88.00  ? 505  PHE A CD2 1 
ATOM   3844 C  CE1 . PHE A 1  505 ? 76.740  109.277 67.199 1.00 88.08  ? 505  PHE A CE1 1 
ATOM   3845 C  CE2 . PHE A 1  505 ? 76.650  111.476 66.191 1.00 86.68  ? 505  PHE A CE2 1 
ATOM   3846 C  CZ  . PHE A 1  505 ? 76.245  110.598 67.180 1.00 89.68  ? 505  PHE A CZ  1 
ATOM   3847 N  N   . SER A 1  506 ? 77.015  106.701 64.265 1.00 67.18  ? 506  SER A N   1 
ATOM   3848 C  CA  . SER A 1  506 ? 76.008  105.839 64.890 1.00 71.61  ? 506  SER A CA  1 
ATOM   3849 C  C   . SER A 1  506 ? 76.607  104.616 65.547 1.00 61.64  ? 506  SER A C   1 
ATOM   3850 O  O   . SER A 1  506 ? 77.760  104.254 65.320 1.00 60.88  ? 506  SER A O   1 
ATOM   3851 C  CB  . SER A 1  506 ? 75.029  105.315 63.834 1.00 78.84  ? 506  SER A CB  1 
ATOM   3852 O  OG  . SER A 1  506 ? 75.672  104.279 63.067 1.00 62.26  ? 506  SER A OG  1 
ATOM   3853 N  N   . TYR A 1  507 ? 75.754  103.950 66.297 1.00 58.76  ? 507  TYR A N   1 
ATOM   3854 C  CA  . TYR A 1  507 ? 76.124  102.734 67.004 1.00 69.95  ? 507  TYR A CA  1 
ATOM   3855 C  C   . TYR A 1  507 ? 75.020  101.768 66.573 1.00 69.23  ? 507  TYR A C   1 
ATOM   3856 O  O   . TYR A 1  507 ? 73.830  102.201 66.460 1.00 62.10  ? 507  TYR A O   1 
ATOM   3857 C  CB  . TYR A 1  507 ? 76.053  102.963 68.533 1.00 60.56  ? 507  TYR A CB  1 
ATOM   3858 C  CG  . TYR A 1  507 ? 76.018  101.714 69.363 1.00 55.84  ? 507  TYR A CG  1 
ATOM   3859 C  CD1 . TYR A 1  507 ? 77.151  101.018 69.643 1.00 56.66  ? 507  TYR A CD1 1 
ATOM   3860 C  CD2 . TYR A 1  507 ? 74.829  101.185 69.782 1.00 57.85  ? 507  TYR A CD2 1 
ATOM   3861 C  CE1 . TYR A 1  507 ? 77.113  99.787  70.325 1.00 53.82  ? 507  TYR A CE1 1 
ATOM   3862 C  CE2 . TYR A 1  507 ? 74.767  99.953  70.474 1.00 60.91  ? 507  TYR A CE2 1 
ATOM   3863 C  CZ  . TYR A 1  507 ? 75.927  99.269  70.730 1.00 62.35  ? 507  TYR A CZ  1 
ATOM   3864 O  OH  . TYR A 1  507 ? 75.886  98.028  71.338 1.00 71.22  ? 507  TYR A OH  1 
ATOM   3865 N  N   . SER A 1  508 ? 75.396  100.497 66.321 1.00 62.82  ? 508  SER A N   1 
ATOM   3866 C  CA  . SER A 1  508 ? 74.408  99.489  65.911 1.00 67.00  ? 508  SER A CA  1 
ATOM   3867 C  C   . SER A 1  508 ? 74.718  98.066  66.318 1.00 59.36  ? 508  SER A C   1 
ATOM   3868 O  O   . SER A 1  508 ? 75.871  97.678  66.466 1.00 73.98  ? 508  SER A O   1 
ATOM   3869 C  CB  . SER A 1  508 ? 74.192  99.509  64.376 1.00 66.39  ? 508  SER A CB  1 
ATOM   3870 O  OG  . SER A 1  508 ? 73.174  98.555  64.010 1.00 78.88  ? 508  SER A OG  1 
ATOM   3871 N  N   . GLU A 1  509 ? 73.687  97.257  66.463 1.00 65.86  ? 509  GLU A N   1 
ATOM   3872 C  CA  . GLU A 1  509 ? 73.907  95.870  66.834 1.00 57.53  ? 509  GLU A CA  1 
ATOM   3873 C  C   . GLU A 1  509 ? 73.137  94.885  65.978 1.00 59.65  ? 509  GLU A C   1 
ATOM   3874 O  O   . GLU A 1  509 ? 72.108  95.241  65.311 1.00 64.26  ? 509  GLU A O   1 
ATOM   3875 C  CB  . GLU A 1  509 ? 73.456  95.635  68.252 1.00 63.46  ? 509  GLU A CB  1 
ATOM   3876 C  CG  . GLU A 1  509 ? 73.825  96.739  69.193 1.00 82.43  ? 509  GLU A CG  1 
ATOM   3877 C  CD  . GLU A 1  509 ? 73.073  96.627  70.492 1.00 72.64  ? 509  GLU A CD  1 
ATOM   3878 O  OE1 . GLU A 1  509 ? 71.836  96.627  70.425 1.00 86.84  ? 509  GLU A OE1 1 
ATOM   3879 O  OE2 . GLU A 1  509 ? 73.707  96.519  71.560 1.00 86.15  ? 509  GLU A OE2 1 
ATOM   3880 N  N   . SER A 1  510 ? 73.592  93.632  66.131 1.00 54.62  ? 510  SER A N   1 
ATOM   3881 C  CA  . SER A 1  510 ? 73.089  92.431  65.460 1.00 54.63  ? 510  SER A CA  1 
ATOM   3882 C  C   . SER A 1  510 ? 73.356  91.271  66.342 1.00 54.96  ? 510  SER A C   1 
ATOM   3883 O  O   . SER A 1  510 ? 74.254  91.339  67.140 1.00 56.33  ? 510  SER A O   1 
ATOM   3884 C  CB  . SER A 1  510 ? 73.893  92.164  64.182 1.00 74.03  ? 510  SER A CB  1 
ATOM   3885 O  OG  . SER A 1  510 ? 75.270  91.870  64.474 1.00 67.15  ? 510  SER A OG  1 
ATOM   3886 N  N   . PHE A 1  511 ? 72.609  90.195  66.164 1.00 55.59  ? 511  PHE A N   1 
ATOM   3887 C  CA  . PHE A 1  511 ? 72.827  88.950  66.913 1.00 56.36  ? 511  PHE A CA  1 
ATOM   3888 C  C   . PHE A 1  511 ? 72.600  87.782  65.945 1.00 56.64  ? 511  PHE A C   1 
ATOM   3889 O  O   . PHE A 1  511 ? 71.857  87.925  64.964 1.00 56.43  ? 511  PHE A O   1 
ATOM   3890 C  CB  . PHE A 1  511 ? 71.837  88.776  68.048 1.00 55.23  ? 511  PHE A CB  1 
ATOM   3891 C  CG  . PHE A 1  511 ? 70.479  88.367  67.583 1.00 56.24  ? 511  PHE A CG  1 
ATOM   3892 C  CD1 . PHE A 1  511 ? 69.593  89.330  67.010 1.00 54.93  ? 511  PHE A CD1 1 
ATOM   3893 C  CD2 . PHE A 1  511 ? 70.096  86.999  67.597 1.00 55.24  ? 511  PHE A CD2 1 
ATOM   3894 C  CE1 . PHE A 1  511 ? 68.377  88.944  66.456 1.00 53.13  ? 511  PHE A CE1 1 
ATOM   3895 C  CE2 . PHE A 1  511 ? 68.851  86.617  67.024 1.00 52.90  ? 511  PHE A CE2 1 
ATOM   3896 C  CZ  . PHE A 1  511 ? 68.006  87.590  66.460 1.00 51.42  ? 511  PHE A CZ  1 
ATOM   3897 N  N   . GLU A 1  512 ? 73.123  86.601  66.291 1.00 57.37  ? 512  GLU A N   1 
ATOM   3898 C  CA  . GLU A 1  512 ? 73.026  85.449  65.404 1.00 57.74  ? 512  GLU A CA  1 
ATOM   3899 C  C   . GLU A 1  512 ? 73.095  84.181  66.196 1.00 58.45  ? 512  GLU A C   1 
ATOM   3900 O  O   . GLU A 1  512 ? 74.115  83.884  66.799 1.00 60.99  ? 512  GLU A O   1 
ATOM   3901 C  CB  . GLU A 1  512 ? 74.230  85.505  64.443 1.00 61.78  ? 512  GLU A CB  1 
ATOM   3902 C  CG  . GLU A 1  512 ? 74.146  84.829  63.116 1.00 59.59  ? 512  GLU A CG  1 
ATOM   3903 C  CD  . GLU A 1  512 ? 75.216  85.337  62.082 1.00 77.64  ? 512  GLU A CD  1 
ATOM   3904 O  OE1 . GLU A 1  512 ? 76.353  85.718  62.481 1.00 77.23  ? 512  GLU A OE1 1 
ATOM   3905 O  OE2 . GLU A 1  512 ? 74.926  85.330  60.856 1.00 81.69  ? 512  GLU A OE2 1 
ATOM   3906 N  N   . PRO A 1  513 ? 72.023  83.384  66.174 1.00 58.47  ? 513  PRO A N   1 
ATOM   3907 C  CA  . PRO A 1  513 ? 72.038  82.134  66.921 1.00 58.20  ? 513  PRO A CA  1 
ATOM   3908 C  C   . PRO A 1  513 ? 73.105  81.175  66.401 1.00 58.15  ? 513  PRO A C   1 
ATOM   3909 O  O   . PRO A 1  513 ? 73.548  81.272  65.251 1.00 57.69  ? 513  PRO A O   1 
ATOM   3910 C  CB  . PRO A 1  513 ? 70.677  81.564  66.661 1.00 58.07  ? 513  PRO A CB  1 
ATOM   3911 C  CG  . PRO A 1  513 ? 69.838  82.740  66.314 1.00 58.35  ? 513  PRO A CG  1 
ATOM   3912 C  CD  . PRO A 1  513 ? 70.746  83.537  65.468 1.00 58.85  ? 513  PRO A CD  1 
ATOM   3913 N  N   . SER A 1  514 ? 73.509  80.246  67.264 1.00 56.61  ? 514  SER A N   1 
ATOM   3914 C  CA  . SER A 1  514 ? 74.471  79.239  66.886 1.00 54.22  ? 514  SER A CA  1 
ATOM   3915 C  C   . SER A 1  514 ? 73.619  78.059  66.518 1.00 53.06  ? 514  SER A C   1 
ATOM   3916 O  O   . SER A 1  514 ? 72.461  78.036  66.827 1.00 56.62  ? 514  SER A O   1 
ATOM   3917 C  CB  . SER A 1  514 ? 75.360  78.891  68.077 1.00 53.04  ? 514  SER A CB  1 
ATOM   3918 O  OG  . SER A 1  514 ? 76.244  77.817  67.748 1.00 74.13  ? 514  SER A OG  1 
ATOM   3919 N  N   . SER A 1  515 ? 74.155  77.073  65.855 1.00 52.03  ? 515  SER A N   1 
ATOM   3920 C  CA  . SER A 1  515 ? 73.378  75.886  65.524 1.00 52.49  ? 515  SER A CA  1 
ATOM   3921 C  C   . SER A 1  515 ? 74.212  74.676  66.048 1.00 53.90  ? 515  SER A C   1 
ATOM   3922 O  O   . SER A 1  515 ? 73.766  73.536  66.085 1.00 53.77  ? 515  SER A O   1 
ATOM   3923 C  CB  . SER A 1  515 ? 73.187  75.787  63.993 1.00 53.08  ? 515  SER A CB  1 
ATOM   3924 O  OG  . SER A 1  515 ? 74.375  75.339  63.370 1.00 47.20  ? 515  SER A OG  1 
ATOM   3925 N  N   . GLN A 1  516 ? 75.450  74.976  66.443 1.00 55.40  ? 516  GLN A N   1 
ATOM   3926 C  CA  . GLN A 1  516 ? 76.422  74.047  66.988 1.00 53.97  ? 516  GLN A CA  1 
ATOM   3927 C  C   . GLN A 1  516 ? 76.022  73.652  68.414 1.00 72.60  ? 516  GLN A C   1 
ATOM   3928 O  O   . GLN A 1  516 ? 75.314  74.394  69.166 1.00 52.89  ? 516  GLN A O   1 
ATOM   3929 C  CB  . GLN A 1  516 ? 77.763  74.744  67.000 1.00 63.09  ? 516  GLN A CB  1 
ATOM   3930 C  CG  . GLN A 1  516 ? 78.127  75.125  65.662 1.00 52.03  ? 516  GLN A CG  1 
ATOM   3931 C  CD  . GLN A 1  516 ? 77.858  73.975  64.771 1.00 57.46  ? 516  GLN A CD  1 
ATOM   3932 O  OE1 . GLN A 1  516 ? 78.482  72.931  64.930 1.00 76.64  ? 516  GLN A OE1 1 
ATOM   3933 N  NE2 . GLN A 1  516 ? 76.888  74.113  63.845 1.00 73.88  ? 516  GLN A NE2 1 
ATOM   3934 N  N   . VAL A 1  517 ? 76.497  72.484  68.801 1.00 71.52  ? 517  VAL A N   1 
ATOM   3935 C  CA  . VAL A 1  517 ? 76.144  71.994  70.108 1.00 72.14  ? 517  VAL A CA  1 
ATOM   3936 C  C   . VAL A 1  517 ? 77.409  71.642  70.872 1.00 74.51  ? 517  VAL A C   1 
ATOM   3937 O  O   . VAL A 1  517 ? 78.305  70.967  70.345 1.00 75.31  ? 517  VAL A O   1 
ATOM   3938 C  CB  . VAL A 1  517 ? 75.087  70.844  69.920 1.00 71.68  ? 517  VAL A CB  1 
ATOM   3939 C  CG1 . VAL A 1  517 ? 75.244  70.236  68.572 1.00 58.13  ? 517  VAL A CG1 1 
ATOM   3940 C  CG2 . VAL A 1  517 ? 75.151  69.827  71.032 1.00 73.50  ? 517  VAL A CG2 1 
ATOM   3941 N  N   . GLY A 1  518 ? 77.485  72.181  72.092 1.00 74.65  ? 518  GLY A N   1 
ATOM   3942 C  CA  . GLY A 1  518 ? 78.637  72.020  72.967 1.00 79.20  ? 518  GLY A CA  1 
ATOM   3943 C  C   . GLY A 1  518 ? 78.907  70.733  73.734 1.00 83.58  ? 518  GLY A C   1 
ATOM   3944 O  O   . GLY A 1  518 ? 78.260  69.695  73.513 1.00 71.48  ? 518  GLY A O   1 
ATOM   3945 N  N   . LYS A 1  519 ? 79.871  70.776  74.655 1.00 88.56  ? 519  LYS A N   1 
ATOM   3946 C  CA  . LYS A 1  519 ? 80.168  69.530  75.379 1.00 90.26  ? 519  LYS A CA  1 
ATOM   3947 C  C   . LYS A 1  519 ? 78.969  69.096  76.203 1.00 82.57  ? 519  LYS A C   1 
ATOM   3948 O  O   . LYS A 1  519 ? 78.713  67.906  76.359 1.00 77.38  ? 519  LYS A O   1 
ATOM   3949 C  CB  . LYS A 1  519 ? 81.395  69.673  76.294 1.00 95.73  ? 519  LYS A CB  1 
ATOM   3950 C  CG  . LYS A 1  519 ? 82.138  68.341  76.531 1.00 101.88 ? 519  LYS A CG  1 
ATOM   3951 C  CD  . LYS A 1  519 ? 83.518  68.571  77.219 1.00 113.13 ? 519  LYS A CD  1 
ATOM   3952 C  CE  . LYS A 1  519 ? 84.437  67.317  77.175 1.00 112.17 ? 519  LYS A CE  1 
ATOM   3953 N  NZ  . LYS A 1  519 ? 85.512  67.326  78.242 1.00 112.50 ? 519  LYS A NZ  1 
ATOM   3954 N  N   . ASP A 1  520 ? 78.201  70.057  76.692 1.00 74.72  ? 520  ASP A N   1 
ATOM   3955 C  CA  . ASP A 1  520 ? 77.088  69.672  77.511 1.00 73.03  ? 520  ASP A CA  1 
ATOM   3956 C  C   . ASP A 1  520 ? 75.826  69.220  76.776 1.00 73.92  ? 520  ASP A C   1 
ATOM   3957 O  O   . ASP A 1  520 ? 74.772  69.137  77.388 1.00 79.76  ? 520  ASP A O   1 
ATOM   3958 C  CB  . ASP A 1  520 ? 76.774  70.810  78.484 1.00 70.86  ? 520  ASP A CB  1 
ATOM   3959 C  CG  . ASP A 1  520 ? 76.154  72.014  77.800 1.00 86.66  ? 520  ASP A CG  1 
ATOM   3960 O  OD1 . ASP A 1  520 ? 76.003  71.971  76.544 1.00 90.93  ? 520  ASP A OD1 1 
ATOM   3961 O  OD2 . ASP A 1  520 ? 75.812  72.997  78.522 1.00 82.38  ? 520  ASP A OD2 1 
ATOM   3962 N  N   . GLY A 1  521 ? 75.914  68.896  75.485 1.00 79.19  ? 521  GLY A N   1 
ATOM   3963 C  CA  . GLY A 1  521 ? 74.733  68.484  74.718 1.00 70.58  ? 521  GLY A CA  1 
ATOM   3964 C  C   . GLY A 1  521 ? 73.705  69.593  74.378 1.00 76.49  ? 521  GLY A C   1 
ATOM   3965 O  O   . GLY A 1  521 ? 72.573  69.334  73.954 1.00 81.80  ? 521  GLY A O   1 
ATOM   3966 N  N   . ASN A 1  522 ? 74.085  70.845  74.571 1.00 73.31  ? 522  ASN A N   1 
ATOM   3967 C  CA  . ASN A 1  522 ? 73.201  71.933  74.271 1.00 71.31  ? 522  ASN A CA  1 
ATOM   3968 C  C   . ASN A 1  522 ? 73.678  72.796  73.102 1.00 77.67  ? 522  ASN A C   1 
ATOM   3969 O  O   . ASN A 1  522 ? 74.844  72.726  72.669 1.00 71.33  ? 522  ASN A O   1 
ATOM   3970 C  CB  . ASN A 1  522 ? 73.055  72.772  75.519 1.00 78.82  ? 522  ASN A CB  1 
ATOM   3971 C  CG  . ASN A 1  522 ? 72.116  72.118  76.536 1.00 87.00  ? 522  ASN A CG  1 
ATOM   3972 O  OD1 . ASN A 1  522 ? 72.322  72.226  77.745 1.00 87.35  ? 522  ASN A OD1 1 
ATOM   3973 N  ND2 . ASN A 1  522 ? 71.067  71.447  76.042 1.00 77.39  ? 522  ASN A ND2 1 
ATOM   3974 N  N   . ILE A 1  523 ? 72.769  73.616  72.590 1.00 74.23  ? 523  ILE A N   1 
ATOM   3975 C  CA  . ILE A 1  523 ? 73.106  74.491  71.487 1.00 67.76  ? 523  ILE A CA  1 
ATOM   3976 C  C   . ILE A 1  523 ? 73.691  75.742  72.093 1.00 63.99  ? 523  ILE A C   1 
ATOM   3977 O  O   . ILE A 1  523 ? 73.089  76.306  72.995 1.00 69.57  ? 523  ILE A O   1 
ATOM   3978 C  CB  . ILE A 1  523 ? 71.833  74.852  70.689 1.00 75.70  ? 523  ILE A CB  1 
ATOM   3979 C  CG1 . ILE A 1  523 ? 71.393  73.637  69.841 1.00 68.11  ? 523  ILE A CG1 1 
ATOM   3980 C  CG2 . ILE A 1  523 ? 72.061  76.157  69.884 1.00 76.75  ? 523  ILE A CG2 1 
ATOM   3981 C  CD1 . ILE A 1  523 ? 70.092  73.850  69.027 1.00 66.41  ? 523  ILE A CD1 1 
ATOM   3982 N  N   . PHE A 1  524 ? 74.854  76.190  71.626 1.00 59.48  ? 524  PHE A N   1 
ATOM   3983 C  CA  . PHE A 1  524 ? 75.445  77.413  72.185 1.00 61.32  ? 524  PHE A CA  1 
ATOM   3984 C  C   . PHE A 1  524 ? 74.522  78.634  72.117 1.00 62.77  ? 524  PHE A C   1 
ATOM   3985 O  O   . PHE A 1  524 ? 73.494  78.656  71.439 1.00 74.52  ? 524  PHE A O   1 
ATOM   3986 C  CB  . PHE A 1  524 ? 76.718  77.796  71.464 1.00 61.95  ? 524  PHE A CB  1 
ATOM   3987 C  CG  . PHE A 1  524 ? 77.732  76.726  71.410 1.00 64.11  ? 524  PHE A CG  1 
ATOM   3988 C  CD1 . PHE A 1  524 ? 78.603  76.517  72.474 1.00 64.27  ? 524  PHE A CD1 1 
ATOM   3989 C  CD2 . PHE A 1  524 ? 77.838  75.916  70.282 1.00 71.72  ? 524  PHE A CD2 1 
ATOM   3990 C  CE1 . PHE A 1  524 ? 79.573  75.503  72.409 1.00 67.78  ? 524  PHE A CE1 1 
ATOM   3991 C  CE2 . PHE A 1  524 ? 78.811  74.889  70.203 1.00 68.68  ? 524  PHE A CE2 1 
ATOM   3992 C  CZ  . PHE A 1  524 ? 79.673  74.685  71.263 1.00 67.98  ? 524  PHE A CZ  1 
ATOM   3993 N  N   . ALA A 1  525 ? 74.921  79.682  72.793 1.00 60.69  ? 525  ALA A N   1 
ATOM   3994 C  CA  . ALA A 1  525 ? 74.118  80.869  72.828 1.00 62.70  ? 525  ALA A CA  1 
ATOM   3995 C  C   . ALA A 1  525 ? 74.506  81.646  71.580 1.00 73.53  ? 525  ALA A C   1 
ATOM   3996 O  O   . ALA A 1  525 ? 75.497  81.324  70.941 1.00 73.89  ? 525  ALA A O   1 
ATOM   3997 C  CB  . ALA A 1  525 ? 74.483  81.675  74.068 1.00 64.04  ? 525  ALA A CB  1 
ATOM   3998 N  N   . PRO A 1  526 ? 73.737  82.695  71.228 1.00 74.36  ? 526  PRO A N   1 
ATOM   3999 C  CA  . PRO A 1  526 ? 73.926  83.581  70.083 1.00 70.35  ? 526  PRO A CA  1 
ATOM   4000 C  C   . PRO A 1  526 ? 75.267  84.284  70.064 1.00 70.30  ? 526  PRO A C   1 
ATOM   4001 O  O   . PRO A 1  526 ? 75.961  84.315  71.063 1.00 71.89  ? 526  PRO A O   1 
ATOM   4002 C  CB  . PRO A 1  526 ? 72.813  84.558  70.274 1.00 66.80  ? 526  PRO A CB  1 
ATOM   4003 C  CG  . PRO A 1  526 ? 71.753  83.687  70.680 1.00 67.46  ? 526  PRO A CG  1 
ATOM   4004 C  CD  . PRO A 1  526 ? 72.378  82.873  71.751 1.00 62.42  ? 526  PRO A CD  1 
ATOM   4005 N  N   . SER A 1  527 ? 75.672  84.811  68.924 1.00 62.53  ? 527  SER A N   1 
ATOM   4006 C  CA  . SER A 1  527 ? 76.907  85.554  68.952 1.00 61.54  ? 527  SER A CA  1 
ATOM   4007 C  C   . SER A 1  527 ? 76.375  86.926  68.680 1.00 56.28  ? 527  SER A C   1 
ATOM   4008 O  O   . SER A 1  527 ? 75.253  87.071  68.158 1.00 55.86  ? 527  SER A O   1 
ATOM   4009 C  CB  . SER A 1  527 ? 77.898  85.100  67.890 1.00 66.37  ? 527  SER A CB  1 
ATOM   4010 O  OG  . SER A 1  527 ? 77.432  85.294  66.586 1.00 70.32  ? 527  SER A OG  1 
ATOM   4011 N  N   . LYS A 1  528 ? 77.149  87.943  69.025 1.00 55.59  ? 528  LYS A N   1 
ATOM   4012 C  CA  . LYS A 1  528 ? 76.610  89.260  68.862 1.00 54.50  ? 528  LYS A CA  1 
ATOM   4013 C  C   . LYS A 1  528 ? 77.483  90.212  68.076 1.00 53.24  ? 528  LYS A C   1 
ATOM   4014 O  O   . LYS A 1  528 ? 78.710  90.038  68.028 1.00 52.64  ? 528  LYS A O   1 
ATOM   4015 C  CB  . LYS A 1  528 ? 76.308  89.849  70.257 1.00 53.40  ? 528  LYS A CB  1 
ATOM   4016 C  CG  . LYS A 1  528 ? 75.330  89.075  71.069 1.00 54.01  ? 528  LYS A CG  1 
ATOM   4017 C  CD  . LYS A 1  528 ? 74.589  89.978  72.039 1.00 79.88  ? 528  LYS A CD  1 
ATOM   4018 C  CE  . LYS A 1  528 ? 73.838  89.144  73.079 1.00 82.62  ? 528  LYS A CE  1 
ATOM   4019 N  NZ  . LYS A 1  528 ? 73.193  89.972  74.145 1.00 80.73  ? 528  LYS A NZ  1 
ATOM   4020 N  N   . GLY A 1  529 ? 76.815  91.228  67.508 1.00 53.01  ? 529  GLY A N   1 
ATOM   4021 C  CA  . GLY A 1  529 ? 77.463  92.284  66.739 1.00 67.11  ? 529  GLY A CA  1 
ATOM   4022 C  C   . GLY A 1  529 ? 77.367  93.675  67.386 1.00 62.88  ? 529  GLY A C   1 
ATOM   4023 O  O   . GLY A 1  529 ? 76.283  94.129  67.730 1.00 68.58  ? 529  GLY A O   1 
ATOM   4024 N  N   . LYS A 1  530 ? 78.516  94.340  67.528 1.00 64.18  ? 530  LYS A N   1 
ATOM   4025 C  CA  . LYS A 1  530 ? 78.641  95.662  68.119 1.00 64.33  ? 530  LYS A CA  1 
ATOM   4026 C  C   . LYS A 1  530 ? 79.502  96.519  67.191 1.00 67.58  ? 530  LYS A C   1 
ATOM   4027 O  O   . LYS A 1  530 ? 80.681  96.189  66.990 1.00 64.07  ? 530  LYS A O   1 
ATOM   4028 C  CB  . LYS A 1  530 ? 79.348  95.528  69.465 1.00 72.01  ? 530  LYS A CB  1 
ATOM   4029 C  CG  . LYS A 1  530 ? 78.657  94.604  70.443 1.00 51.17  ? 530  LYS A CG  1 
ATOM   4030 C  CD  . LYS A 1  530 ? 77.190  95.066  70.574 1.00 63.83  ? 530  LYS A CD  1 
ATOM   4031 C  CE  . LYS A 1  530 ? 76.572  94.472  71.823 1.00 73.65  ? 530  LYS A CE  1 
ATOM   4032 N  NZ  . LYS A 1  530 ? 75.206  94.026  71.529 1.00 74.94  ? 530  LYS A NZ  1 
ATOM   4033 N  N   . GLN A 1  531 ? 78.903  97.582  66.619 1.00 64.27  ? 531  GLN A N   1 
ATOM   4034 C  CA  . GLN A 1  531 ? 79.577  98.512  65.695 1.00 59.26  ? 531  GLN A CA  1 
ATOM   4035 C  C   . GLN A 1  531 ? 79.387  100.020 65.977 1.00 63.30  ? 531  GLN A C   1 
ATOM   4036 O  O   . GLN A 1  531 ? 78.231  100.580 66.104 1.00 61.09  ? 531  GLN A O   1 
ATOM   4037 C  CB  . GLN A 1  531 ? 79.159  98.237  64.199 1.00 69.62  ? 531  GLN A CB  1 
ATOM   4038 C  CG  . GLN A 1  531 ? 79.881  99.140  63.192 1.00 48.83  ? 531  GLN A CG  1 
ATOM   4039 C  CD  . GLN A 1  531 ? 79.434  98.997  61.712 1.00 82.12  ? 531  GLN A CD  1 
ATOM   4040 O  OE1 . GLN A 1  531 ? 80.188  98.429  60.878 1.00 58.17  ? 531  GLN A OE1 1 
ATOM   4041 N  NE2 . GLN A 1  531 ? 78.222  99.537  61.364 1.00 63.62  ? 531  GLN A NE2 1 
ATOM   4042 N  N   . TYR A 1  532 ? 80.544  100.682 66.025 1.00 65.43  ? 532  TYR A N   1 
ATOM   4043 C  CA  . TYR A 1  532 ? 80.631  102.156 66.202 1.00 68.98  ? 532  TYR A CA  1 
ATOM   4044 C  C   . TYR A 1  532 ? 81.066  102.641 64.808 1.00 61.49  ? 532  TYR A C   1 
ATOM   4045 O  O   . TYR A 1  532 ? 82.062  102.147 64.263 1.00 57.17  ? 532  TYR A O   1 
ATOM   4046 C  CB  . TYR A 1  532 ? 81.699  102.548 67.283 1.00 66.89  ? 532  TYR A CB  1 
ATOM   4047 C  CG  . TYR A 1  532 ? 81.262  102.309 68.735 1.00 75.41  ? 532  TYR A CG  1 
ATOM   4048 C  CD1 . TYR A 1  532 ? 80.342  103.159 69.352 1.00 74.91  ? 532  TYR A CD1 1 
ATOM   4049 C  CD2 . TYR A 1  532 ? 81.690  101.181 69.460 1.00 73.19  ? 532  TYR A CD2 1 
ATOM   4050 C  CE1 . TYR A 1  532 ? 79.846  102.880 70.643 1.00 75.37  ? 532  TYR A CE1 1 
ATOM   4051 C  CE2 . TYR A 1  532 ? 81.202  100.900 70.754 1.00 69.43  ? 532  TYR A CE2 1 
ATOM   4052 C  CZ  . TYR A 1  532 ? 80.274  101.748 71.327 1.00 74.76  ? 532  TYR A CZ  1 
ATOM   4053 O  OH  . TYR A 1  532 ? 79.683  101.453 72.539 1.00 77.14  ? 532  TYR A OH  1 
ATOM   4054 N  N   . GLU A 1  533 ? 80.307  103.525 64.178 1.00 63.83  ? 533  GLU A N   1 
ATOM   4055 C  CA  . GLU A 1  533 ? 80.772  103.986 62.866 1.00 77.41  ? 533  GLU A CA  1 
ATOM   4056 C  C   . GLU A 1  533 ? 80.637  105.490 62.803 1.00 77.00  ? 533  GLU A C   1 
ATOM   4057 O  O   . GLU A 1  533 ? 79.720  106.052 63.419 1.00 71.54  ? 533  GLU A O   1 
ATOM   4058 C  CB  . GLU A 1  533 ? 79.972  103.331 61.669 1.00 77.33  ? 533  GLU A CB  1 
ATOM   4059 C  CG  . GLU A 1  533 ? 80.353  103.924 60.280 1.00 74.10  ? 533  GLU A CG  1 
ATOM   4060 C  CD  . GLU A 1  533 ? 79.890  103.142 59.021 1.00 77.56  ? 533  GLU A CD  1 
ATOM   4061 O  OE1 . GLU A 1  533 ? 80.276  101.981 58.815 1.00 87.28  ? 533  GLU A OE1 1 
ATOM   4062 O  OE2 . GLU A 1  533 ? 79.151  103.701 58.194 1.00 71.01  ? 533  GLU A OE2 1 
ATOM   4063 N  N   . VAL A 1  534 ? 81.558  106.138 62.089 1.00 72.27  ? 534  VAL A N   1 
ATOM   4064 C  CA  . VAL A 1  534 ? 81.445  107.579 61.883 1.00 75.46  ? 534  VAL A CA  1 
ATOM   4065 C  C   . VAL A 1  534 ? 81.990  107.832 60.488 1.00 74.85  ? 534  VAL A C   1 
ATOM   4066 O  O   . VAL A 1  534 ? 82.818  107.049 59.986 1.00 86.49  ? 534  VAL A O   1 
ATOM   4067 C  CB  . VAL A 1  534 ? 82.310  108.377 62.842 1.00 78.52  ? 534  VAL A CB  1 
ATOM   4068 C  CG1 . VAL A 1  534 ? 82.585  107.591 64.087 1.00 71.44  ? 534  VAL A CG1 1 
ATOM   4069 C  CG2 . VAL A 1  534 ? 83.595  108.726 62.174 1.00 75.28  ? 534  VAL A CG2 1 
ATOM   4070 N  N   . GLY A 1  535 ? 81.545  108.897 59.841 1.00 72.32  ? 535  GLY A N   1 
ATOM   4071 C  CA  . GLY A 1  535 ? 82.094  109.194 58.528 1.00 67.04  ? 535  GLY A CA  1 
ATOM   4072 C  C   . GLY A 1  535 ? 81.255  110.267 57.874 1.00 74.00  ? 535  GLY A C   1 
ATOM   4073 O  O   . GLY A 1  535 ? 80.269  110.760 58.477 1.00 74.81  ? 535  GLY A O   1 
ATOM   4074 N  N   . VAL A 1  536 ? 81.631  110.672 56.667 1.00 67.90  ? 536  VAL A N   1 
ATOM   4075 C  CA  . VAL A 1  536 ? 80.791  111.637 55.995 1.00 72.36  ? 536  VAL A CA  1 
ATOM   4076 C  C   . VAL A 1  536 ? 80.359  111.270 54.572 1.00 74.44  ? 536  VAL A C   1 
ATOM   4077 O  O   . VAL A 1  536 ? 81.006  110.502 53.853 1.00 70.08  ? 536  VAL A O   1 
ATOM   4078 C  CB  . VAL A 1  536 ? 81.402  113.014 55.993 1.00 78.00  ? 536  VAL A CB  1 
ATOM   4079 C  CG1 . VAL A 1  536 ? 81.955  113.291 57.368 1.00 74.12  ? 536  VAL A CG1 1 
ATOM   4080 C  CG2 . VAL A 1  536 ? 82.423  113.141 54.864 1.00 72.65  ? 536  VAL A CG2 1 
ATOM   4081 N  N   . LYS A 1  537 ? 79.228  111.838 54.187 1.00 73.20  ? 537  LYS A N   1 
ATOM   4082 C  CA  . LYS A 1  537 ? 78.644  111.581 52.895 1.00 74.93  ? 537  LYS A CA  1 
ATOM   4083 C  C   . LYS A 1  537 ? 78.444  112.875 52.090 1.00 74.30  ? 537  LYS A C   1 
ATOM   4084 O  O   . LYS A 1  537 ? 77.692  113.805 52.488 1.00 72.10  ? 537  LYS A O   1 
ATOM   4085 C  CB  . LYS A 1  537 ? 77.308  110.828 53.107 1.00 75.54  ? 537  LYS A CB  1 
ATOM   4086 C  CG  . LYS A 1  537 ? 77.468  109.392 53.625 1.00 59.23  ? 537  LYS A CG  1 
ATOM   4087 C  CD  . LYS A 1  537 ? 76.151  108.680 53.733 1.00 64.86  ? 537  LYS A CD  1 
ATOM   4088 C  CE  . LYS A 1  537 ? 76.302  107.231 54.167 1.00 60.49  ? 537  LYS A CE  1 
ATOM   4089 N  NZ  . LYS A 1  537 ? 74.951  106.807 54.496 1.00 55.47  ? 537  LYS A NZ  1 
ATOM   4090 N  N   . TYR A 1  538 ? 79.142  112.936 50.964 1.00 69.40  ? 538  TYR A N   1 
ATOM   4091 C  CA  . TYR A 1  538 ? 79.038  114.092 50.092 1.00 72.76  ? 538  TYR A CA  1 
ATOM   4092 C  C   . TYR A 1  538 ? 78.091  113.713 49.009 1.00 73.53  ? 538  TYR A C   1 
ATOM   4093 O  O   . TYR A 1  538 ? 78.451  113.032 48.019 1.00 71.54  ? 538  TYR A O   1 
ATOM   4094 C  CB  . TYR A 1  538 ? 80.397  114.499 49.489 1.00 81.87  ? 538  TYR A CB  1 
ATOM   4095 C  CG  . TYR A 1  538 ? 80.312  115.639 48.472 1.00 93.70  ? 538  TYR A CG  1 
ATOM   4096 C  CD1 . TYR A 1  538 ? 79.426  116.698 48.661 1.00 98.02  ? 538  TYR A CD1 1 
ATOM   4097 C  CD2 . TYR A 1  538 ? 81.079  115.638 47.297 1.00 94.07  ? 538  TYR A CD2 1 
ATOM   4098 C  CE1 . TYR A 1  538 ? 79.290  117.709 47.716 1.00 95.65  ? 538  TYR A CE1 1 
ATOM   4099 C  CE2 . TYR A 1  538 ? 80.949  116.666 46.343 1.00 91.44  ? 538  TYR A CE2 1 
ATOM   4100 C  CZ  . TYR A 1  538 ? 80.047  117.687 46.560 1.00 88.01  ? 538  TYR A CZ  1 
ATOM   4101 O  OH  . TYR A 1  538 ? 79.850  118.677 45.619 1.00 92.79  ? 538  TYR A OH  1 
ATOM   4102 N  N   . VAL A 1  539 ? 76.861  114.157 49.207 1.00 74.72  ? 539  VAL A N   1 
ATOM   4103 C  CA  . VAL A 1  539 ? 75.814  113.870 48.257 1.00 78.07  ? 539  VAL A CA  1 
ATOM   4104 C  C   . VAL A 1  539 ? 75.253  115.183 47.760 1.00 81.22  ? 539  VAL A C   1 
ATOM   4105 O  O   . VAL A 1  539 ? 74.194  115.616 48.207 1.00 82.56  ? 539  VAL A O   1 
ATOM   4106 C  CB  . VAL A 1  539 ? 74.676  113.040 48.914 1.00 76.94  ? 539  VAL A CB  1 
ATOM   4107 C  CG1 . VAL A 1  539 ? 73.618  112.631 47.887 1.00 72.69  ? 539  VAL A CG1 1 
ATOM   4108 C  CG2 . VAL A 1  539 ? 75.250  111.848 49.562 1.00 68.65  ? 539  VAL A CG2 1 
ATOM   4109 N  N   . PRO A 1  540 ? 75.955  115.840 46.830 1.00 81.29  ? 540  PRO A N   1 
ATOM   4110 C  CA  . PRO A 1  540 ? 75.528  117.121 46.252 1.00 85.03  ? 540  PRO A CA  1 
ATOM   4111 C  C   . PRO A 1  540 ? 74.253  117.074 45.405 1.00 84.57  ? 540  PRO A C   1 
ATOM   4112 O  O   . PRO A 1  540 ? 74.134  116.294 44.471 1.00 87.20  ? 540  PRO A O   1 
ATOM   4113 C  CB  . PRO A 1  540 ? 76.734  117.523 45.411 1.00 87.67  ? 540  PRO A CB  1 
ATOM   4114 C  CG  . PRO A 1  540 ? 77.273  116.244 44.983 1.00 84.98  ? 540  PRO A CG  1 
ATOM   4115 C  CD  . PRO A 1  540 ? 77.267  115.470 46.290 1.00 85.58  ? 540  PRO A CD  1 
ATOM   4116 N  N   . GLU A 1  541 ? 73.312  117.951 45.697 1.00 86.85  ? 541  GLU A N   1 
ATOM   4117 C  CA  . GLU A 1  541 ? 72.077  117.948 44.936 1.00 92.01  ? 541  GLU A CA  1 
ATOM   4118 C  C   . GLU A 1  541 ? 72.184  118.586 43.548 1.00 92.15  ? 541  GLU A C   1 
ATOM   4119 O  O   . GLU A 1  541 ? 71.342  118.356 42.686 1.00 86.79  ? 541  GLU A O   1 
ATOM   4120 C  CB  . GLU A 1  541 ? 70.974  118.599 45.771 1.00 92.57  ? 541  GLU A CB  1 
ATOM   4121 C  CG  . GLU A 1  541 ? 69.622  118.702 45.078 1.00 115.86 ? 541  GLU A CG  1 
ATOM   4122 C  CD  . GLU A 1  541 ? 69.388  117.661 43.963 1.00 123.41 ? 541  GLU A CD  1 
ATOM   4123 O  OE1 . GLU A 1  541 ? 69.531  116.436 44.229 1.00 133.12 ? 541  GLU A OE1 1 
ATOM   4124 O  OE2 . GLU A 1  541 ? 69.051  118.080 42.818 1.00 123.78 ? 541  GLU A OE2 1 
ATOM   4125 N  N   . ASP A 1  542 ? 73.242  119.346 43.306 1.00 96.94  ? 542  ASP A N   1 
ATOM   4126 C  CA  . ASP A 1  542 ? 73.411  120.028 42.022 1.00 99.70  ? 542  ASP A CA  1 
ATOM   4127 C  C   . ASP A 1  542 ? 74.093  119.228 40.931 1.00 100.88 ? 542  ASP A C   1 
ATOM   4128 O  O   . ASP A 1  542 ? 73.580  119.141 39.823 1.00 109.72 ? 542  ASP A O   1 
ATOM   4129 C  CB  . ASP A 1  542 ? 74.165  121.329 42.247 1.00 101.88 ? 542  ASP A CB  1 
ATOM   4130 C  CG  . ASP A 1  542 ? 75.210  121.205 43.353 1.00 110.56 ? 542  ASP A CG  1 
ATOM   4131 O  OD1 . ASP A 1  542 ? 75.007  121.741 44.484 1.00 103.36 ? 542  ASP A OD1 1 
ATOM   4132 O  OD2 . ASP A 1  542 ? 76.241  120.543 43.082 1.00 116.52 ? 542  ASP A OD2 1 
ATOM   4133 N  N   . ARG A 1  543 ? 75.241  118.639 41.238 1.00 102.59 ? 543  ARG A N   1 
ATOM   4134 C  CA  . ARG A 1  543 ? 75.999  117.851 40.263 1.00 99.51  ? 543  ARG A CA  1 
ATOM   4135 C  C   . ARG A 1  543 ? 75.838  116.353 40.551 1.00 97.11  ? 543  ARG A C   1 
ATOM   4136 O  O   . ARG A 1  543 ? 75.577  115.953 41.705 1.00 96.57  ? 543  ARG A O   1 
ATOM   4137 C  CB  . ARG A 1  543 ? 77.477  118.232 40.348 1.00 99.31  ? 543  ARG A CB  1 
ATOM   4138 C  CG  . ARG A 1  543 ? 77.709  119.717 40.662 1.00 104.91 ? 543  ARG A CG  1 
ATOM   4139 C  CD  . ARG A 1  543 ? 79.016  119.961 41.451 1.00 108.43 ? 543  ARG A CD  1 
ATOM   4140 N  NE  . ARG A 1  543 ? 79.763  121.140 40.976 1.00 114.83 ? 543  ARG A NE  1 
ATOM   4141 C  CZ  . ARG A 1  543 ? 81.049  121.391 41.261 1.00 116.42 ? 543  ARG A CZ  1 
ATOM   4142 N  NH1 . ARG A 1  543 ? 81.730  120.543 42.027 1.00 120.17 ? 543  ARG A NH1 1 
ATOM   4143 N  NH2 . ARG A 1  543 ? 81.672  122.467 40.764 1.00 112.63 ? 543  ARG A NH2 1 
ATOM   4144 N  N   . PRO A 1  544 ? 76.037  115.498 39.519 1.00 93.47  ? 544  PRO A N   1 
ATOM   4145 C  CA  . PRO A 1  544 ? 75.896  114.046 39.705 1.00 85.20  ? 544  PRO A CA  1 
ATOM   4146 C  C   . PRO A 1  544 ? 77.171  113.403 40.267 1.00 79.86  ? 544  PRO A C   1 
ATOM   4147 O  O   . PRO A 1  544 ? 78.021  112.830 39.531 1.00 77.18  ? 544  PRO A O   1 
ATOM   4148 C  CB  . PRO A 1  544 ? 75.568  113.562 38.307 1.00 85.02  ? 544  PRO A CB  1 
ATOM   4149 C  CG  . PRO A 1  544 ? 76.575  114.368 37.490 1.00 89.41  ? 544  PRO A CG  1 
ATOM   4150 C  CD  . PRO A 1  544 ? 76.546  115.790 38.163 1.00 86.89  ? 544  PRO A CD  1 
ATOM   4151 N  N   . ILE A 1  545 ? 77.338  113.563 41.569 1.00 69.61  ? 545  ILE A N   1 
ATOM   4152 C  CA  . ILE A 1  545 ? 78.455  112.928 42.195 1.00 75.38  ? 545  ILE A CA  1 
ATOM   4153 C  C   . ILE A 1  545 ? 78.002  112.423 43.562 1.00 70.36  ? 545  ILE A C   1 
ATOM   4154 O  O   . ILE A 1  545 ? 77.027  112.885 44.104 1.00 64.92  ? 545  ILE A O   1 
ATOM   4155 C  CB  . ILE A 1  545 ? 79.608  113.885 42.387 1.00 83.61  ? 545  ILE A CB  1 
ATOM   4156 C  CG1 . ILE A 1  545 ? 79.353  114.690 43.656 1.00 88.28  ? 545  ILE A CG1 1 
ATOM   4157 C  CG2 . ILE A 1  545 ? 79.768  114.816 41.158 1.00 89.81  ? 545  ILE A CG2 1 
ATOM   4158 C  CD1 . ILE A 1  545 ? 80.038  116.038 43.673 1.00 97.60  ? 545  ILE A CD1 1 
ATOM   4159 N  N   . VAL A 1  546 ? 78.692  111.414 44.079 1.00 70.79  ? 546  VAL A N   1 
ATOM   4160 C  CA  . VAL A 1  546 ? 78.431  110.877 45.407 1.00 64.70  ? 546  VAL A CA  1 
ATOM   4161 C  C   . VAL A 1  546 ? 79.798  110.430 45.891 1.00 62.58  ? 546  VAL A C   1 
ATOM   4162 O  O   . VAL A 1  546 ? 80.594  109.838 45.143 1.00 58.45  ? 546  VAL A O   1 
ATOM   4163 C  CB  . VAL A 1  546 ? 77.508  109.668 45.371 1.00 68.24  ? 546  VAL A CB  1 
ATOM   4164 C  CG1 . VAL A 1  546 ? 76.746  109.601 46.636 1.00 64.17  ? 546  VAL A CG1 1 
ATOM   4165 C  CG2 . VAL A 1  546 ? 76.550  109.765 44.204 1.00 71.07  ? 546  VAL A CG2 1 
ATOM   4166 N  N   . VAL A 1  547 ? 80.097  110.753 47.133 1.00 61.99  ? 547  VAL A N   1 
ATOM   4167 C  CA  . VAL A 1  547 ? 81.367  110.362 47.693 1.00 59.77  ? 547  VAL A CA  1 
ATOM   4168 C  C   . VAL A 1  547 ? 81.039  110.111 49.127 1.00 62.95  ? 547  VAL A C   1 
ATOM   4169 O  O   . VAL A 1  547 ? 80.397  110.896 49.810 1.00 64.82  ? 547  VAL A O   1 
ATOM   4170 C  CB  . VAL A 1  547 ? 82.484  111.487 47.595 1.00 63.59  ? 547  VAL A CB  1 
ATOM   4171 C  CG1 . VAL A 1  547 ? 83.661  111.188 48.568 1.00 57.50  ? 547  VAL A CG1 1 
ATOM   4172 C  CG2 . VAL A 1  547 ? 83.046  111.567 46.197 1.00 56.27  ? 547  VAL A CG2 1 
ATOM   4173 N  N   . THR A 1  548 ? 81.486  108.971 49.591 1.00 70.77  ? 548  THR A N   1 
ATOM   4174 C  CA  . THR A 1  548 ? 81.239  108.589 50.949 1.00 70.24  ? 548  THR A CA  1 
ATOM   4175 C  C   . THR A 1  548 ? 82.573  108.148 51.507 1.00 74.94  ? 548  THR A C   1 
ATOM   4176 O  O   . THR A 1  548 ? 83.493  107.692 50.759 1.00 51.09  ? 548  THR A O   1 
ATOM   4177 C  CB  . THR A 1  548 ? 80.301  107.381 51.028 1.00 68.52  ? 548  THR A CB  1 
ATOM   4178 O  OG1 . THR A 1  548 ? 80.063  107.032 52.415 1.00 85.06  ? 548  THR A OG1 1 
ATOM   4179 C  CG2 . THR A 1  548 ? 80.995  106.174 50.329 1.00 62.59  ? 548  THR A CG2 1 
ATOM   4180 N  N   . GLY A 1  549 ? 82.654  108.288 52.829 1.00 49.62  ? 549  GLY A N   1 
ATOM   4181 C  CA  . GLY A 1  549 ? 83.832  107.874 53.550 1.00 48.76  ? 549  GLY A CA  1 
ATOM   4182 C  C   . GLY A 1  549 ? 83.312  107.429 54.920 1.00 75.07  ? 549  GLY A C   1 
ATOM   4183 O  O   . GLY A 1  549 ? 82.355  108.011 55.512 1.00 60.52  ? 549  GLY A O   1 
ATOM   4184 N  N   . ALA A 1  550 ? 83.908  106.370 55.442 1.00 67.73  ? 550  ALA A N   1 
ATOM   4185 C  CA  . ALA A 1  550 ? 83.484  105.939 56.742 1.00 68.93  ? 550  ALA A CA  1 
ATOM   4186 C  C   . ALA A 1  550 ? 84.622  105.180 57.355 1.00 69.68  ? 550  ALA A C   1 
ATOM   4187 O  O   . ALA A 1  550 ? 85.518  104.667 56.607 1.00 61.00  ? 550  ALA A O   1 
ATOM   4188 C  CB  . ALA A 1  550 ? 82.231  105.064 56.625 1.00 75.06  ? 550  ALA A CB  1 
ATOM   4189 N  N   . VAL A 1  551 ? 84.609  105.186 58.702 1.00 60.28  ? 551  VAL A N   1 
ATOM   4190 C  CA  . VAL A 1  551 ? 85.561  104.447 59.529 1.00 61.21  ? 551  VAL A CA  1 
ATOM   4191 C  C   . VAL A 1  551 ? 84.707  103.903 60.666 1.00 63.91  ? 551  VAL A C   1 
ATOM   4192 O  O   . VAL A 1  551 ? 83.731  104.546 61.144 1.00 59.13  ? 551  VAL A O   1 
ATOM   4193 C  CB  . VAL A 1  551 ? 86.745  105.334 59.996 1.00 77.22  ? 551  VAL A CB  1 
ATOM   4194 C  CG1 . VAL A 1  551 ? 86.325  106.762 59.990 1.00 67.40  ? 551  VAL A CG1 1 
ATOM   4195 C  CG2 . VAL A 1  551 ? 87.264  104.894 61.374 1.00 63.21  ? 551  VAL A CG2 1 
ATOM   4196 N  N   . TYR A 1  552 ? 85.062  102.689 61.082 1.00 67.99  ? 552  TYR A N   1 
ATOM   4197 C  CA  . TYR A 1  552 ? 84.231  101.961 62.030 1.00 60.21  ? 552  TYR A CA  1 
ATOM   4198 C  C   . TYR A 1  552 ? 84.949  100.938 62.889 1.00 64.03  ? 552  TYR A C   1 
ATOM   4199 O  O   . TYR A 1  552 ? 85.984  100.366 62.479 1.00 71.72  ? 552  TYR A O   1 
ATOM   4200 C  CB  . TYR A 1  552 ? 83.242  101.170 61.181 1.00 72.44  ? 552  TYR A CB  1 
ATOM   4201 C  CG  . TYR A 1  552 ? 83.905  100.031 60.369 1.00 54.32  ? 552  TYR A CG  1 
ATOM   4202 C  CD1 . TYR A 1  552 ? 84.068  98.751  60.923 1.00 53.32  ? 552  TYR A CD1 1 
ATOM   4203 C  CD2 . TYR A 1  552 ? 84.392  100.239 59.087 1.00 68.26  ? 552  TYR A CD2 1 
ATOM   4204 C  CE1 . TYR A 1  552 ? 84.702  97.706  60.220 1.00 52.61  ? 552  TYR A CE1 1 
ATOM   4205 C  CE2 . TYR A 1  552 ? 85.031  99.195  58.356 1.00 71.73  ? 552  TYR A CE2 1 
ATOM   4206 C  CZ  . TYR A 1  552 ? 85.179  97.936  58.944 1.00 54.44  ? 552  TYR A CZ  1 
ATOM   4207 O  OH  . TYR A 1  552 ? 85.821  96.929  58.267 1.00 53.04  ? 552  TYR A OH  1 
ATOM   4208 N  N   . ASN A 1  553 ? 84.346  100.643 64.036 1.00 62.81  ? 553  ASN A N   1 
ATOM   4209 C  CA  . ASN A 1  553 ? 84.854  99.589  64.918 1.00 65.37  ? 553  ASN A CA  1 
ATOM   4210 C  C   . ASN A 1  553 ? 83.720  98.564  65.028 1.00 64.80  ? 553  ASN A C   1 
ATOM   4211 O  O   . ASN A 1  553 ? 82.626  98.877  65.525 1.00 64.84  ? 553  ASN A O   1 
ATOM   4212 C  CB  . ASN A 1  553 ? 85.179  100.111 66.315 1.00 69.06  ? 553  ASN A CB  1 
ATOM   4213 C  CG  . ASN A 1  553 ? 86.110  99.177  67.092 1.00 66.93  ? 553  ASN A CG  1 
ATOM   4214 O  OD1 . ASN A 1  553 ? 85.664  98.515  68.030 1.00 72.71  ? 553  ASN A OD1 1 
ATOM   4215 N  ND2 . ASN A 1  553 ? 87.411  99.119  66.701 1.00 62.34  ? 553  ASN A ND2 1 
ATOM   4216 N  N   . LEU A 1  554 ? 83.969  97.358  64.522 1.00 62.37  ? 554  LEU A N   1 
ATOM   4217 C  CA  . LEU A 1  554 ? 82.964  96.284  64.562 1.00 57.37  ? 554  LEU A CA  1 
ATOM   4218 C  C   . LEU A 1  554 ? 83.422  95.068  65.354 1.00 56.50  ? 554  LEU A C   1 
ATOM   4219 O  O   . LEU A 1  554 ? 84.477  94.477  65.078 1.00 55.96  ? 554  LEU A O   1 
ATOM   4220 C  CB  . LEU A 1  554 ? 82.661  95.832  63.157 1.00 56.25  ? 554  LEU A CB  1 
ATOM   4221 C  CG  . LEU A 1  554 ? 81.716  94.680  62.980 1.00 54.97  ? 554  LEU A CG  1 
ATOM   4222 C  CD1 . LEU A 1  554 ? 80.422  95.051  63.532 1.00 53.18  ? 554  LEU A CD1 1 
ATOM   4223 C  CD2 . LEU A 1  554 ? 81.630  94.374  61.484 1.00 56.20  ? 554  LEU A CD2 1 
ATOM   4224 N  N   . THR A 1  555 ? 82.585  94.661  66.297 1.00 62.60  ? 555  THR A N   1 
ATOM   4225 C  CA  . THR A 1  555 ? 82.941  93.552  67.163 1.00 66.61  ? 555  THR A CA  1 
ATOM   4226 C  C   . THR A 1  555 ? 81.932  92.448  67.321 1.00 65.35  ? 555  THR A C   1 
ATOM   4227 O  O   . THR A 1  555 ? 80.757  92.669  67.601 1.00 67.40  ? 555  THR A O   1 
ATOM   4228 C  CB  . THR A 1  555 ? 83.333  94.105  68.536 1.00 67.91  ? 555  THR A CB  1 
ATOM   4229 O  OG1 . THR A 1  555 ? 84.683  94.580  68.458 1.00 61.54  ? 555  THR A OG1 1 
ATOM   4230 C  CG2 . THR A 1  555 ? 83.191  93.070  69.639 1.00 69.33  ? 555  THR A CG2 1 
ATOM   4231 N  N   . LYS A 1  556 ? 82.443  91.249  67.152 1.00 58.88  ? 556  LYS A N   1 
ATOM   4232 C  CA  . LYS A 1  556 ? 81.634  90.053  67.247 1.00 72.00  ? 556  LYS A CA  1 
ATOM   4233 C  C   . LYS A 1  556 ? 82.014  89.323  68.509 1.00 64.13  ? 556  LYS A C   1 
ATOM   4234 O  O   . LYS A 1  556 ? 83.147  88.968  68.688 1.00 62.79  ? 556  LYS A O   1 
ATOM   4235 C  CB  . LYS A 1  556 ? 81.904  89.127  66.044 1.00 69.61  ? 556  LYS A CB  1 
ATOM   4236 C  CG  . LYS A 1  556 ? 80.985  87.936  65.933 1.00 57.61  ? 556  LYS A CG  1 
ATOM   4237 C  CD  . LYS A 1  556 ? 81.575  86.787  65.061 1.00 58.49  ? 556  LYS A CD  1 
ATOM   4238 C  CE  . LYS A 1  556 ? 80.598  85.660  64.905 1.00 55.93  ? 556  LYS A CE  1 
ATOM   4239 N  NZ  . LYS A 1  556 ? 81.141  84.628  64.032 1.00 58.91  ? 556  LYS A NZ  1 
ATOM   4240 N  N   . THR A 1  557 ? 81.053  89.055  69.362 1.00 65.48  ? 557  THR A N   1 
ATOM   4241 C  CA  . THR A 1  557 ? 81.359  88.383  70.601 1.00 59.67  ? 557  THR A CA  1 
ATOM   4242 C  C   . THR A 1  557 ? 80.639  87.049  70.740 1.00 64.40  ? 557  THR A C   1 
ATOM   4243 O  O   . THR A 1  557 ? 79.582  86.780  70.165 1.00 67.06  ? 557  THR A O   1 
ATOM   4244 C  CB  . THR A 1  557 ? 81.056  89.319  71.795 1.00 60.22  ? 557  THR A CB  1 
ATOM   4245 O  OG1 . THR A 1  557 ? 79.670  89.691  71.822 1.00 59.89  ? 557  THR A OG1 1 
ATOM   4246 C  CG2 . THR A 1  557 ? 81.853  90.583  71.644 1.00 59.08  ? 557  THR A CG2 1 
ATOM   4247 N  N   . ASN A 1  558 ? 81.265  86.185  71.489 1.00 61.01  ? 558  ASN A N   1 
ATOM   4248 C  CA  . ASN A 1  558 ? 80.723  84.889  71.713 1.00 63.75  ? 558  ASN A CA  1 
ATOM   4249 C  C   . ASN A 1  558 ? 80.926  84.081  70.452 1.00 64.76  ? 558  ASN A C   1 
ATOM   4250 O  O   . ASN A 1  558 ? 80.076  83.312  69.993 1.00 63.68  ? 558  ASN A O   1 
ATOM   4251 C  CB  . ASN A 1  558 ? 79.252  84.955  72.133 1.00 67.18  ? 558  ASN A CB  1 
ATOM   4252 C  CG  . ASN A 1  558 ? 78.851  83.725  72.899 1.00 65.68  ? 558  ASN A CG  1 
ATOM   4253 O  OD1 . ASN A 1  558 ? 79.689  83.162  73.599 1.00 84.10  ? 558  ASN A OD1 1 
ATOM   4254 N  ND2 . ASN A 1  558 ? 77.593  83.285  72.777 1.00 56.38  ? 558  ASN A ND2 1 
ATOM   4255 N  N   . ASN A 1  559 ? 82.102  84.261  69.902 1.00 61.87  ? 559  ASN A N   1 
ATOM   4256 C  CA  . ASN A 1  559 ? 82.447  83.533  68.735 1.00 66.10  ? 559  ASN A CA  1 
ATOM   4257 C  C   . ASN A 1  559 ? 82.795  82.117  69.253 1.00 68.09  ? 559  ASN A C   1 
ATOM   4258 O  O   . ASN A 1  559 ? 83.496  81.956  70.250 1.00 70.20  ? 559  ASN A O   1 
ATOM   4259 C  CB  . ASN A 1  559 ? 83.646  84.229  68.070 1.00 59.81  ? 559  ASN A CB  1 
ATOM   4260 C  CG  . ASN A 1  559 ? 83.930  83.680  66.703 1.00 64.46  ? 559  ASN A CG  1 
ATOM   4261 O  OD1 . ASN A 1  559 ? 83.013  83.450  65.939 1.00 68.09  ? 559  ASN A OD1 1 
ATOM   4262 N  ND2 . ASN A 1  559 ? 85.192  83.451  66.396 1.00 53.12  ? 559  ASN A ND2 1 
ATOM   4263 N  N   . LEU A 1  560 ? 82.282  81.083  68.620 1.00 67.44  ? 560  LEU A N   1 
ATOM   4264 C  CA  . LEU A 1  560 ? 82.656  79.759  69.068 1.00 70.25  ? 560  LEU A CA  1 
ATOM   4265 C  C   . LEU A 1  560 ? 84.151  79.508  68.807 1.00 72.76  ? 560  LEU A C   1 
ATOM   4266 O  O   . LEU A 1  560 ? 84.627  79.807  67.702 1.00 76.60  ? 560  LEU A O   1 
ATOM   4267 C  CB  . LEU A 1  560 ? 81.856  78.681  68.341 1.00 61.12  ? 560  LEU A CB  1 
ATOM   4268 C  CG  . LEU A 1  560 ? 80.417  78.603  68.767 1.00 62.60  ? 560  LEU A CG  1 
ATOM   4269 C  CD1 . LEU A 1  560 ? 79.848  77.329  68.167 1.00 64.89  ? 560  LEU A CD1 1 
ATOM   4270 C  CD2 . LEU A 1  560 ? 80.313  78.571  70.314 1.00 67.75  ? 560  LEU A CD2 1 
ATOM   4271 N  N   . MET A 1  561 ? 84.870  78.948  69.801 1.00 73.86  ? 561  MET A N   1 
ATOM   4272 C  CA  . MET A 1  561 ? 86.288  78.637  69.641 1.00 72.49  ? 561  MET A CA  1 
ATOM   4273 C  C   . MET A 1  561 ? 86.711  77.242  70.094 1.00 73.69  ? 561  MET A C   1 
ATOM   4274 O  O   . MET A 1  561 ? 85.897  76.379  70.417 1.00 74.42  ? 561  MET A O   1 
ATOM   4275 C  CB  . MET A 1  561 ? 87.145  79.680  70.333 1.00 72.30  ? 561  MET A CB  1 
ATOM   4276 C  CG  . MET A 1  561 ? 87.243  79.516  71.816 1.00 76.32  ? 561  MET A CG  1 
ATOM   4277 S  SD  . MET A 1  561 ? 87.824  81.085  72.371 1.00 74.48  ? 561  MET A SD  1 
ATOM   4278 C  CE  . MET A 1  561 ? 87.327  80.951  74.110 1.00 73.07  ? 561  MET A CE  1 
ATOM   4279 N  N   . ALA A 1  562 ? 88.004  77.009  70.124 1.00 72.92  ? 562  ALA A N   1 
ATOM   4280 C  CA  . ALA A 1  562 ? 88.439  75.673  70.481 1.00 73.46  ? 562  ALA A CA  1 
ATOM   4281 C  C   . ALA A 1  562 ? 88.419  75.500  71.961 1.00 78.81  ? 562  ALA A C   1 
ATOM   4282 O  O   . ALA A 1  562 ? 88.725  76.455  72.736 1.00 70.13  ? 562  ALA A O   1 
ATOM   4283 C  CB  . ALA A 1  562 ? 89.841  75.390  69.932 1.00 72.41  ? 562  ALA A CB  1 
ATOM   4284 N  N   . ASP A 1  563 ? 88.043  74.272  72.336 1.00 78.10  ? 563  ASP A N   1 
ATOM   4285 C  CA  . ASP A 1  563 ? 87.973  73.868  73.730 1.00 78.03  ? 563  ASP A CA  1 
ATOM   4286 C  C   . ASP A 1  563 ? 89.338  74.004  74.299 1.00 79.20  ? 563  ASP A C   1 
ATOM   4287 O  O   . ASP A 1  563 ? 90.216  73.200  73.942 1.00 79.04  ? 563  ASP A O   1 
ATOM   4288 C  CB  . ASP A 1  563 ? 87.638  72.401  73.845 1.00 84.51  ? 563  ASP A CB  1 
ATOM   4289 C  CG  . ASP A 1  563 ? 87.376  71.930  75.316 1.00 83.98  ? 563  ASP A CG  1 
ATOM   4290 O  OD1 . ASP A 1  563 ? 87.768  72.592  76.339 1.00 81.62  ? 563  ASP A OD1 1 
ATOM   4291 O  OD2 . ASP A 1  563 ? 86.751  70.845  75.400 1.00 70.52  ? 563  ASP A OD2 1 
ATOM   4292 N  N   . PRO A 1  564 ? 89.536  74.976  75.203 1.00 75.12  ? 564  PRO A N   1 
ATOM   4293 C  CA  . PRO A 1  564 ? 90.845  75.177  75.813 1.00 82.14  ? 564  PRO A CA  1 
ATOM   4294 C  C   . PRO A 1  564 ? 91.437  73.819  76.272 1.00 91.76  ? 564  PRO A C   1 
ATOM   4295 O  O   . PRO A 1  564 ? 92.670  73.638  76.339 1.00 91.66  ? 564  PRO A O   1 
ATOM   4296 C  CB  . PRO A 1  564 ? 90.523  76.079  76.999 1.00 84.61  ? 564  PRO A CB  1 
ATOM   4297 C  CG  . PRO A 1  564 ? 89.197  76.720  76.637 1.00 78.57  ? 564  PRO A CG  1 
ATOM   4298 C  CD  . PRO A 1  564 ? 88.483  75.597  76.018 1.00 71.08  ? 564  PRO A CD  1 
ATOM   4299 N  N   . GLU A 1  565 ? 90.558  72.850  76.546 1.00 95.27  ? 565  GLU A N   1 
ATOM   4300 C  CA  . GLU A 1  565 ? 90.989  71.539  77.039 1.00 95.00  ? 565  GLU A CA  1 
ATOM   4301 C  C   . GLU A 1  565 ? 91.031  70.321  76.138 1.00 96.76  ? 565  GLU A C   1 
ATOM   4302 O  O   . GLU A 1  565 ? 90.760  69.225  76.609 1.00 92.38  ? 565  GLU A O   1 
ATOM   4303 C  CB  . GLU A 1  565 ? 90.173  71.211  78.262 1.00 91.05  ? 565  GLU A CB  1 
ATOM   4304 C  CG  . GLU A 1  565 ? 90.076  72.424  79.160 1.00 100.85 ? 565  GLU A CG  1 
ATOM   4305 C  CD  . GLU A 1  565 ? 89.091  72.189  80.267 1.00 110.57 ? 565  GLU A CD  1 
ATOM   4306 O  OE1 . GLU A 1  565 ? 88.430  71.126  80.199 1.00 109.70 ? 565  GLU A OE1 1 
ATOM   4307 O  OE2 . GLU A 1  565 ? 88.969  73.045  81.186 1.00 112.04 ? 565  GLU A OE2 1 
ATOM   4308 N  N   . GLY A 1  566 ? 91.371  70.518  74.861 1.00 99.88  ? 566  GLY A N   1 
ATOM   4309 C  CA  . GLY A 1  566 ? 91.508  69.430  73.903 1.00 104.26 ? 566  GLY A CA  1 
ATOM   4310 C  C   . GLY A 1  566 ? 90.393  68.524  73.385 1.00 106.41 ? 566  GLY A C   1 
ATOM   4311 O  O   . GLY A 1  566 ? 90.689  67.564  72.659 1.00 113.11 ? 566  GLY A O   1 
ATOM   4312 N  N   . SER A 1  567 ? 89.130  68.785  73.708 1.00 107.35 ? 567  SER A N   1 
ATOM   4313 C  CA  . SER A 1  567 ? 88.050  67.914  73.209 1.00 104.44 ? 567  SER A CA  1 
ATOM   4314 C  C   . SER A 1  567 ? 87.655  68.214  71.782 1.00 103.44 ? 567  SER A C   1 
ATOM   4315 O  O   . SER A 1  567 ? 88.228  69.077  71.094 1.00 103.25 ? 567  SER A O   1 
ATOM   4316 C  CB  . SER A 1  567 ? 86.776  68.050  74.034 1.00 102.00 ? 567  SER A CB  1 
ATOM   4317 O  OG  . SER A 1  567 ? 86.144  69.273  73.709 1.00 84.05  ? 567  SER A OG  1 
ATOM   4318 N  N   . PHE A 1  568 ? 86.629  67.504  71.357 1.00 100.37 ? 568  PHE A N   1 
ATOM   4319 C  CA  . PHE A 1  568 ? 86.129  67.685  70.020 1.00 100.50 ? 568  PHE A CA  1 
ATOM   4320 C  C   . PHE A 1  568 ? 85.000  68.717  69.934 1.00 96.29  ? 568  PHE A C   1 
ATOM   4321 O  O   . PHE A 1  568 ? 84.365  68.890  68.890 1.00 88.10  ? 568  PHE A O   1 
ATOM   4322 C  CB  . PHE A 1  568 ? 85.712  66.328  69.479 1.00 110.02 ? 568  PHE A CB  1 
ATOM   4323 C  CG  . PHE A 1  568 ? 86.880  65.481  69.078 1.00 121.86 ? 568  PHE A CG  1 
ATOM   4324 C  CD1 . PHE A 1  568 ? 88.191  65.877  69.441 1.00 124.65 ? 568  PHE A CD1 1 
ATOM   4325 C  CD2 . PHE A 1  568 ? 86.694  64.298  68.342 1.00 124.82 ? 568  PHE A CD2 1 
ATOM   4326 C  CE1 . PHE A 1  568 ? 89.315  65.120  69.073 1.00 126.24 ? 568  PHE A CE1 1 
ATOM   4327 C  CE2 . PHE A 1  568 ? 87.800  63.525  67.964 1.00 128.48 ? 568  PHE A CE2 1 
ATOM   4328 C  CZ  . PHE A 1  568 ? 89.126  63.938  68.338 1.00 129.91 ? 568  PHE A CZ  1 
ATOM   4329 N  N   . PHE A 1  569 ? 84.767  69.417  71.038 1.00 90.85  ? 569  PHE A N   1 
ATOM   4330 C  CA  . PHE A 1  569 ? 83.739  70.425  71.065 1.00 78.39  ? 569  PHE A CA  1 
ATOM   4331 C  C   . PHE A 1  569 ? 84.325  71.792  71.066 1.00 76.70  ? 569  PHE A C   1 
ATOM   4332 O  O   . PHE A 1  569 ? 85.526  71.989  71.302 1.00 77.50  ? 569  PHE A O   1 
ATOM   4333 C  CB  . PHE A 1  569 ? 82.876  70.273  72.279 1.00 77.19  ? 569  PHE A CB  1 
ATOM   4334 C  CG  . PHE A 1  569 ? 82.163  69.021  72.298 1.00 75.64  ? 569  PHE A CG  1 
ATOM   4335 C  CD1 . PHE A 1  569 ? 81.212  68.766  71.346 1.00 75.77  ? 569  PHE A CD1 1 
ATOM   4336 C  CD2 . PHE A 1  569 ? 82.475  68.054  73.231 1.00 75.68  ? 569  PHE A CD2 1 
ATOM   4337 C  CE1 . PHE A 1  569 ? 80.555  67.541  71.305 1.00 81.85  ? 569  PHE A CE1 1 
ATOM   4338 C  CE2 . PHE A 1  569 ? 81.839  66.822  73.222 1.00 81.19  ? 569  PHE A CE2 1 
ATOM   4339 C  CZ  . PHE A 1  569 ? 80.868  66.556  72.248 1.00 83.69  ? 569  PHE A CZ  1 
ATOM   4340 N  N   . SER A 1  570 ? 83.460  72.738  70.750 1.00 74.91  ? 570  SER A N   1 
ATOM   4341 C  CA  . SER A 1  570 ? 83.863  74.114  70.718 1.00 74.69  ? 570  SER A CA  1 
ATOM   4342 C  C   . SER A 1  570 ? 83.432  74.627  72.053 1.00 77.37  ? 570  SER A C   1 
ATOM   4343 O  O   . SER A 1  570 ? 82.769  73.944  72.816 1.00 76.90  ? 570  SER A O   1 
ATOM   4344 C  CB  . SER A 1  570 ? 83.136  74.891  69.616 1.00 78.14  ? 570  SER A CB  1 
ATOM   4345 O  OG  . SER A 1  570 ? 83.680  74.647  68.331 1.00 66.10  ? 570  SER A OG  1 
ATOM   4346 N  N   . VAL A 1  571 ? 83.730  75.883  72.285 1.00 78.81  ? 571  VAL A N   1 
ATOM   4347 C  CA  . VAL A 1  571 ? 83.441  76.476  73.557 1.00 70.45  ? 571  VAL A CA  1 
ATOM   4348 C  C   . VAL A 1  571 ? 83.172  77.863  73.109 1.00 68.22  ? 571  VAL A C   1 
ATOM   4349 O  O   . VAL A 1  571 ? 83.622  78.234  72.038 1.00 63.32  ? 571  VAL A O   1 
ATOM   4350 C  CB  . VAL A 1  571 ? 84.736  76.329  74.391 1.00 76.57  ? 571  VAL A CB  1 
ATOM   4351 C  CG1 . VAL A 1  571 ? 85.222  77.665  74.856 1.00 67.18  ? 571  VAL A CG1 1 
ATOM   4352 C  CG2 . VAL A 1  571 ? 84.517  75.285  75.486 1.00 57.46  ? 571  VAL A CG2 1 
ATOM   4353 N  N   . GLU A 1  572 ? 82.475  78.634  73.922 1.00 64.92  ? 572  GLU A N   1 
ATOM   4354 C  CA  . GLU A 1  572 ? 82.123  79.956  73.505 1.00 68.49  ? 572  GLU A CA  1 
ATOM   4355 C  C   . GLU A 1  572 ? 82.972  81.119  74.071 1.00 71.68  ? 572  GLU A C   1 
ATOM   4356 O  O   . GLU A 1  572 ? 84.142  80.945  74.412 1.00 80.29  ? 572  GLU A O   1 
ATOM   4357 C  CB  . GLU A 1  572 ? 80.592  80.148  73.687 1.00 62.96  ? 572  GLU A CB  1 
ATOM   4358 C  CG  . GLU A 1  572 ? 80.145  80.379  75.063 1.00 75.02  ? 572  GLU A CG  1 
ATOM   4359 C  CD  . GLU A 1  572 ? 78.614  80.459  75.212 1.00 83.75  ? 572  GLU A CD  1 
ATOM   4360 O  OE1 . GLU A 1  572 ? 77.911  79.552  74.666 1.00 77.45  ? 572  GLU A OE1 1 
ATOM   4361 O  OE2 . GLU A 1  572 ? 78.129  81.416  75.912 1.00 84.37  ? 572  GLU A OE2 1 
ATOM   4362 N  N   . GLY A 1  573 ? 82.434  82.329  74.109 1.00 69.40  ? 573  GLY A N   1 
ATOM   4363 C  CA  . GLY A 1  573 ? 83.246  83.417  74.605 1.00 66.30  ? 573  GLY A CA  1 
ATOM   4364 C  C   . GLY A 1  573 ? 84.349  83.931  73.692 1.00 59.14  ? 573  GLY A C   1 
ATOM   4365 O  O   . GLY A 1  573 ? 85.040  84.851  74.057 1.00 62.45  ? 573  GLY A O   1 
ATOM   4366 N  N   . GLY A 1  574 ? 84.536  83.395  72.503 1.00 63.19  ? 574  GLY A N   1 
ATOM   4367 C  CA  . GLY A 1  574 ? 85.595  83.947  71.651 1.00 59.69  ? 574  GLY A CA  1 
ATOM   4368 C  C   . GLY A 1  574 ? 85.198  85.325  71.169 1.00 65.06  ? 574  GLY A C   1 
ATOM   4369 O  O   . GLY A 1  574 ? 84.024  85.681  71.242 1.00 60.28  ? 574  GLY A O   1 
ATOM   4370 N  N   . GLU A 1  575 ? 86.147  86.117  70.685 1.00 63.55  ? 575  GLU A N   1 
ATOM   4371 C  CA  . GLU A 1  575 ? 85.794  87.431  70.220 1.00 60.33  ? 575  GLU A CA  1 
ATOM   4372 C  C   . GLU A 1  575 ? 86.632  87.919  69.027 1.00 76.10  ? 575  GLU A C   1 
ATOM   4373 O  O   . GLU A 1  575 ? 87.841  87.780  69.070 1.00 77.85  ? 575  GLU A O   1 
ATOM   4374 C  CB  . GLU A 1  575 ? 85.937  88.383  71.373 1.00 53.99  ? 575  GLU A CB  1 
ATOM   4375 C  CG  . GLU A 1  575 ? 85.690  89.853  71.061 1.00 78.66  ? 575  GLU A CG  1 
ATOM   4376 C  CD  . GLU A 1  575 ? 85.568  90.699  72.348 1.00 100.24 ? 575  GLU A CD  1 
ATOM   4377 O  OE1 . GLU A 1  575 ? 84.994  90.198  73.381 1.00 89.81  ? 575  GLU A OE1 1 
ATOM   4378 O  OE2 . GLU A 1  575 ? 86.045  91.867  72.314 1.00 90.92  ? 575  GLU A OE2 1 
ATOM   4379 N  N   . ILE A 1  576 ? 86.008  88.453  67.956 1.00 60.55  ? 576  ILE A N   1 
ATOM   4380 C  CA  . ILE A 1  576 ? 86.773  89.007  66.819 1.00 68.03  ? 576  ILE A CA  1 
ATOM   4381 C  C   . ILE A 1  576 ? 86.477  90.486  66.593 1.00 60.26  ? 576  ILE A C   1 
ATOM   4382 O  O   . ILE A 1  576 ? 85.324  90.905  66.710 1.00 66.49  ? 576  ILE A O   1 
ATOM   4383 C  CB  . ILE A 1  576 ? 86.460  88.333  65.459 1.00 55.23  ? 576  ILE A CB  1 
ATOM   4384 C  CG1 . ILE A 1  576 ? 87.196  87.020  65.310 1.00 58.49  ? 576  ILE A CG1 1 
ATOM   4385 C  CG2 . ILE A 1  576 ? 86.978  89.200  64.313 1.00 55.90  ? 576  ILE A CG2 1 
ATOM   4386 C  CD1 . ILE A 1  576 ? 86.294  85.917  64.932 1.00 59.54  ? 576  ILE A CD1 1 
ATOM   4387 N  N   . ARG A 1  577 ? 87.527  91.259  66.278 1.00 57.79  ? 577  ARG A N   1 
ATOM   4388 C  CA  . ARG A 1  577 ? 87.386  92.672  65.920 1.00 57.44  ? 577  ARG A CA  1 
ATOM   4389 C  C   . ARG A 1  577 ? 87.872  93.036  64.472 1.00 58.89  ? 577  ARG A C   1 
ATOM   4390 O  O   . ARG A 1  577 ? 88.902  92.559  64.002 1.00 56.65  ? 577  ARG A O   1 
ATOM   4391 C  CB  . ARG A 1  577 ? 88.179  93.627  66.827 1.00 66.00  ? 577  ARG A CB  1 
ATOM   4392 C  CG  . ARG A 1  577 ? 88.459  94.911  66.006 1.00 66.78  ? 577  ARG A CG  1 
ATOM   4393 C  CD  . ARG A 1  577 ? 89.398  95.960  66.484 1.00 81.88  ? 577  ARG A CD  1 
ATOM   4394 N  NE  . ARG A 1  577 ? 90.774  95.556  66.705 1.00 79.51  ? 577  ARG A NE  1 
ATOM   4395 C  CZ  . ARG A 1  577 ? 91.402  96.055  67.756 1.00 86.52  ? 577  ARG A CZ  1 
ATOM   4396 N  NH1 . ARG A 1  577 ? 90.702  96.906  68.507 1.00 81.79  ? 577  ARG A NH1 1 
ATOM   4397 N  NH2 . ARG A 1  577 ? 92.637  95.688  68.101 1.00 78.14  ? 577  ARG A NH2 1 
ATOM   4398 N  N   . ALA A 1  578 ? 87.122  93.939  63.840 1.00 59.66  ? 578  ALA A N   1 
ATOM   4399 C  CA  . ALA A 1  578 ? 87.369  94.534  62.544 1.00 58.82  ? 578  ALA A CA  1 
ATOM   4400 C  C   . ALA A 1  578 ? 87.213  96.099  62.672 1.00 72.23  ? 578  ALA A C   1 
ATOM   4401 O  O   . ALA A 1  578 ? 86.104  96.663  62.996 1.00 59.64  ? 578  ALA A O   1 
ATOM   4402 C  CB  . ALA A 1  578 ? 86.383  94.019  61.593 1.00 59.73  ? 578  ALA A CB  1 
ATOM   4403 N  N   . ARG A 1  579 ? 88.333  96.793  62.481 1.00 60.36  ? 579  ARG A N   1 
ATOM   4404 C  CA  . ARG A 1  579 ? 88.323  98.241  62.495 1.00 69.17  ? 579  ARG A CA  1 
ATOM   4405 C  C   . ARG A 1  579 ? 88.618  98.510  61.060 1.00 57.64  ? 579  ARG A C   1 
ATOM   4406 O  O   . ARG A 1  579 ? 89.443  97.778  60.481 1.00 56.68  ? 579  ARG A O   1 
ATOM   4407 C  CB  . ARG A 1  579 ? 89.461  98.898  63.326 1.00 70.69  ? 579  ARG A CB  1 
ATOM   4408 C  CG  . ARG A 1  579 ? 90.450  98.084  64.122 1.00 68.95  ? 579  ARG A CG  1 
ATOM   4409 C  CD  . ARG A 1  579 ? 90.952  98.980  65.332 1.00 83.54  ? 579  ARG A CD  1 
ATOM   4410 N  NE  . ARG A 1  579 ? 92.160  98.476  65.994 1.00 75.94  ? 579  ARG A NE  1 
ATOM   4411 C  CZ  . ARG A 1  579 ? 93.342  98.361  65.383 1.00 85.85  ? 579  ARG A CZ  1 
ATOM   4412 N  NH1 . ARG A 1  579 ? 93.496  98.729  64.096 1.00 91.50  ? 579  ARG A NH1 1 
ATOM   4413 N  NH2 . ARG A 1  579 ? 94.370  97.834  66.032 1.00 77.94  ? 579  ARG A NH2 1 
ATOM   4414 N  N   . GLY A 1  580 ? 87.987  99.525  60.465 1.00 57.99  ? 580  GLY A N   1 
ATOM   4415 C  CA  . GLY A 1  580 ? 88.335  99.757  59.074 1.00 57.47  ? 580  GLY A CA  1 
ATOM   4416 C  C   . GLY A 1  580 ? 87.942  101.103 58.503 1.00 57.69  ? 580  GLY A C   1 
ATOM   4417 O  O   . GLY A 1  580 ? 87.240  101.944 59.149 1.00 69.48  ? 580  GLY A O   1 
ATOM   4418 N  N   . VAL A 1  581 ? 88.366  101.284 57.254 1.00 56.85  ? 581  VAL A N   1 
ATOM   4419 C  CA  . VAL A 1  581 ? 88.060  102.492 56.507 1.00 57.05  ? 581  VAL A CA  1 
ATOM   4420 C  C   . VAL A 1  581 ? 87.544  102.179 55.099 1.00 57.50  ? 581  VAL A C   1 
ATOM   4421 O  O   . VAL A 1  581 ? 88.149  101.389 54.331 1.00 57.26  ? 581  VAL A O   1 
ATOM   4422 C  CB  . VAL A 1  581 ? 89.304  103.410 56.318 1.00 77.60  ? 581  VAL A CB  1 
ATOM   4423 C  CG1 . VAL A 1  581 ? 88.840  104.736 55.669 1.00 57.42  ? 581  VAL A CG1 1 
ATOM   4424 C  CG2 . VAL A 1  581 ? 90.047  103.625 57.670 1.00 63.90  ? 581  VAL A CG2 1 
ATOM   4425 N  N   . GLU A 1  582 ? 86.483  102.865 54.721 1.00 57.20  ? 582  GLU A N   1 
ATOM   4426 C  CA  . GLU A 1  582 ? 85.913  102.623 53.423 1.00 57.27  ? 582  GLU A CA  1 
ATOM   4427 C  C   . GLU A 1  582 ? 85.600  103.911 52.716 1.00 79.59  ? 582  GLU A C   1 
ATOM   4428 O  O   . GLU A 1  582 ? 85.000  104.819 53.304 1.00 58.23  ? 582  GLU A O   1 
ATOM   4429 C  CB  . GLU A 1  582 ? 84.577  101.839 53.554 1.00 57.60  ? 582  GLU A CB  1 
ATOM   4430 C  CG  . GLU A 1  582 ? 84.680  100.446 54.123 1.00 63.90  ? 582  GLU A CG  1 
ATOM   4431 C  CD  . GLU A 1  582 ? 83.371  99.951  54.703 1.00 68.80  ? 582  GLU A CD  1 
ATOM   4432 O  OE1 . GLU A 1  582 ? 82.433  100.764 54.760 1.00 62.04  ? 582  GLU A OE1 1 
ATOM   4433 O  OE2 . GLU A 1  582 ? 83.281  98.761  55.104 1.00 62.43  ? 582  GLU A OE2 1 
ATOM   4434 N  N   . ILE A 1  583 ? 86.025  104.026 51.471 1.00 55.55  ? 583  ILE A N   1 
ATOM   4435 C  CA  . ILE A 1  583 ? 85.576  105.193 50.777 1.00 55.73  ? 583  ILE A CA  1 
ATOM   4436 C  C   . ILE A 1  583 ? 85.107  104.721 49.423 1.00 57.59  ? 583  ILE A C   1 
ATOM   4437 O  O   . ILE A 1  583 ? 85.759  103.862 48.771 1.00 58.07  ? 583  ILE A O   1 
ATOM   4438 C  CB  . ILE A 1  583 ? 86.651  106.376 50.612 1.00 78.09  ? 583  ILE A CB  1 
ATOM   4439 C  CG1 . ILE A 1  583 ? 86.859  106.729 49.118 1.00 76.41  ? 583  ILE A CG1 1 
ATOM   4440 C  CG2 . ILE A 1  583 ? 87.965  106.060 51.277 1.00 51.17  ? 583  ILE A CG2 1 
ATOM   4441 C  CD1 . ILE A 1  583 ? 88.150  106.151 48.449 1.00 79.80  ? 583  ILE A CD1 1 
ATOM   4442 N  N   . GLU A 1  584 ? 83.947  105.263 49.051 1.00 64.05  ? 584  GLU A N   1 
ATOM   4443 C  CA  . GLU A 1  584 ? 83.331  105.015 47.774 1.00 56.99  ? 584  GLU A CA  1 
ATOM   4444 C  C   . GLU A 1  584 ? 83.142  106.352 47.062 1.00 72.41  ? 584  GLU A C   1 
ATOM   4445 O  O   . GLU A 1  584 ? 82.955  107.402 47.679 1.00 56.89  ? 584  GLU A O   1 
ATOM   4446 C  CB  . GLU A 1  584 ? 81.954  104.348 47.907 1.00 55.75  ? 584  GLU A CB  1 
ATOM   4447 C  CG  . GLU A 1  584 ? 81.530  103.562 46.603 1.00 54.84  ? 584  GLU A CG  1 
ATOM   4448 C  CD  . GLU A 1  584 ? 80.088  103.016 46.589 1.00 74.62  ? 584  GLU A CD  1 
ATOM   4449 O  OE1 . GLU A 1  584 ? 79.522  102.727 47.682 1.00 61.30  ? 584  GLU A OE1 1 
ATOM   4450 O  OE2 . GLU A 1  584 ? 79.518  102.865 45.468 1.00 63.92  ? 584  GLU A OE2 1 
ATOM   4451 N  N   . ALA A 1  585 ? 83.174  106.291 45.739 1.00 57.21  ? 585  ALA A N   1 
ATOM   4452 C  CA  . ALA A 1  585 ? 83.005  107.475 44.966 1.00 59.86  ? 585  ALA A CA  1 
ATOM   4453 C  C   . ALA A 1  585 ? 82.512  107.125 43.548 1.00 73.19  ? 585  ALA A C   1 
ATOM   4454 O  O   . ALA A 1  585 ? 83.049  106.181 42.906 1.00 56.81  ? 585  ALA A O   1 
ATOM   4455 C  CB  . ALA A 1  585 ? 84.293  108.142 44.917 1.00 65.88  ? 585  ALA A CB  1 
ATOM   4456 N  N   . LYS A 1  586 ? 81.483  107.875 43.103 1.00 58.28  ? 586  LYS A N   1 
ATOM   4457 C  CA  . LYS A 1  586 ? 80.826  107.727 41.782 1.00 70.31  ? 586  LYS A CA  1 
ATOM   4458 C  C   . LYS A 1  586 ? 80.507  109.142 41.266 1.00 74.10  ? 586  LYS A C   1 
ATOM   4459 O  O   . LYS A 1  586 ? 79.984  109.967 42.023 1.00 74.48  ? 586  LYS A O   1 
ATOM   4460 C  CB  . LYS A 1  586 ? 79.491  106.966 41.887 1.00 55.33  ? 586  LYS A CB  1 
ATOM   4461 C  CG  . LYS A 1  586 ? 79.519  105.564 42.552 1.00 67.74  ? 586  LYS A CG  1 
ATOM   4462 C  CD  . LYS A 1  586 ? 78.189  105.172 43.214 1.00 58.12  ? 586  LYS A CD  1 
ATOM   4463 C  CE  . LYS A 1  586 ? 77.180  104.705 42.198 1.00 82.59  ? 586  LYS A CE  1 
ATOM   4464 N  NZ  . LYS A 1  586 ? 75.769  104.758 42.691 1.00 58.79  ? 586  LYS A NZ  1 
ATOM   4465 N  N   . ALA A 1  587 ? 80.810  109.432 40.000 1.00 72.87  ? 587  ALA A N   1 
ATOM   4466 C  CA  . ALA A 1  587 ? 80.552  110.778 39.467 1.00 76.70  ? 587  ALA A CA  1 
ATOM   4467 C  C   . ALA A 1  587 ? 80.605  110.856 37.956 1.00 74.76  ? 587  ALA A C   1 
ATOM   4468 O  O   . ALA A 1  587 ? 81.359  110.109 37.318 1.00 67.98  ? 587  ALA A O   1 
ATOM   4469 C  CB  . ALA A 1  587 ? 81.546  111.751 40.030 1.00 74.37  ? 587  ALA A CB  1 
ATOM   4470 N  N   . ALA A 1  588 ? 79.768  111.721 37.381 1.00 74.79  ? 588  ALA A N   1 
ATOM   4471 C  CA  . ALA A 1  588 ? 79.805  111.936 35.916 1.00 80.85  ? 588  ALA A CA  1 
ATOM   4472 C  C   . ALA A 1  588 ? 80.958  112.993 35.768 1.00 77.49  ? 588  ALA A C   1 
ATOM   4473 O  O   . ALA A 1  588 ? 80.960  114.030 36.442 1.00 78.23  ? 588  ALA A O   1 
ATOM   4474 C  CB  . ALA A 1  588 ? 78.439  112.493 35.404 1.00 75.74  ? 588  ALA A CB  1 
ATOM   4475 N  N   . LEU A 1  589 ? 81.977  112.735 34.962 1.00 77.31  ? 589  LEU A N   1 
ATOM   4476 C  CA  . LEU A 1  589 ? 83.052  113.719 34.888 1.00 80.62  ? 589  LEU A CA  1 
ATOM   4477 C  C   . LEU A 1  589 ? 82.975  114.740 33.734 1.00 88.11  ? 589  LEU A C   1 
ATOM   4478 O  O   . LEU A 1  589 ? 83.687  115.754 33.733 1.00 85.89  ? 589  LEU A O   1 
ATOM   4479 C  CB  . LEU A 1  589 ? 84.403  113.006 34.858 1.00 74.12  ? 589  LEU A CB  1 
ATOM   4480 C  CG  . LEU A 1  589 ? 84.778  112.604 36.273 1.00 74.65  ? 589  LEU A CG  1 
ATOM   4481 C  CD1 . LEU A 1  589 ? 86.259  112.470 36.326 1.00 60.33  ? 589  LEU A CD1 1 
ATOM   4482 C  CD2 . LEU A 1  589 ? 84.323  113.638 37.285 1.00 69.10  ? 589  LEU A CD2 1 
ATOM   4483 N  N   . SER A 1  590 ? 82.071  114.485 32.793 1.00 85.70  ? 590  SER A N   1 
ATOM   4484 C  CA  . SER A 1  590 ? 81.891  115.296 31.602 1.00 87.64  ? 590  SER A CA  1 
ATOM   4485 C  C   . SER A 1  590 ? 80.725  114.544 30.990 1.00 88.14  ? 590  SER A C   1 
ATOM   4486 O  O   . SER A 1  590 ? 80.488  113.422 31.410 1.00 94.98  ? 590  SER A O   1 
ATOM   4487 C  CB  . SER A 1  590 ? 83.155  115.182 30.735 1.00 89.66  ? 590  SER A CB  1 
ATOM   4488 O  OG  . SER A 1  590 ? 83.304  113.880 30.205 1.00 84.32  ? 590  SER A OG  1 
ATOM   4489 N  N   . ALA A 1  591 ? 79.977  115.072 30.028 1.00 84.81  ? 591  ALA A N   1 
ATOM   4490 C  CA  . ALA A 1  591 ? 78.869  114.220 29.580 1.00 84.30  ? 591  ALA A CA  1 
ATOM   4491 C  C   . ALA A 1  591 ? 79.290  112.932 28.827 1.00 81.35  ? 591  ALA A C   1 
ATOM   4492 O  O   . ALA A 1  591 ? 78.447  112.101 28.460 1.00 71.01  ? 591  ALA A O   1 
ATOM   4493 C  CB  . ALA A 1  591 ? 77.847  115.021 28.765 1.00 88.55  ? 591  ALA A CB  1 
ATOM   4494 N  N   . SER A 1  592 ? 80.593  112.727 28.637 1.00 79.09  ? 592  SER A N   1 
ATOM   4495 C  CA  . SER A 1  592 ? 81.040  111.504 27.926 1.00 82.95  ? 592  SER A CA  1 
ATOM   4496 C  C   . SER A 1  592 ? 81.842  110.501 28.776 1.00 76.30  ? 592  SER A C   1 
ATOM   4497 O  O   . SER A 1  592 ? 82.074  109.365 28.347 1.00 74.24  ? 592  SER A O   1 
ATOM   4498 C  CB  . SER A 1  592 ? 81.861  111.930 26.720 1.00 75.84  ? 592  SER A CB  1 
ATOM   4499 O  OG  . SER A 1  592 ? 82.418  113.194 27.056 1.00 81.19  ? 592  SER A OG  1 
ATOM   4500 N  N   . VAL A 1  593 ? 82.225  110.964 29.970 1.00 74.45  ? 593  VAL A N   1 
ATOM   4501 C  CA  . VAL A 1  593 ? 83.031  110.254 30.944 1.00 73.80  ? 593  VAL A CA  1 
ATOM   4502 C  C   . VAL A 1  593 ? 82.434  110.069 32.323 1.00 79.04  ? 593  VAL A C   1 
ATOM   4503 O  O   . VAL A 1  593 ? 82.216  111.064 33.046 1.00 73.57  ? 593  VAL A O   1 
ATOM   4504 C  CB  . VAL A 1  593 ? 84.355  110.999 31.225 1.00 73.40  ? 593  VAL A CB  1 
ATOM   4505 C  CG1 . VAL A 1  593 ? 84.894  110.655 32.669 1.00 68.26  ? 593  VAL A CG1 1 
ATOM   4506 C  CG2 . VAL A 1  593 ? 85.371  110.644 30.186 1.00 60.50  ? 593  VAL A CG2 1 
ATOM   4507 N  N   . ASN A 1  594 ? 82.270  108.803 32.719 1.00 78.32  ? 594  ASN A N   1 
ATOM   4508 C  CA  . ASN A 1  594 ? 81.793  108.488 34.067 1.00 73.16  ? 594  ASN A CA  1 
ATOM   4509 C  C   . ASN A 1  594 ? 82.776  107.608 34.825 1.00 73.19  ? 594  ASN A C   1 
ATOM   4510 O  O   . ASN A 1  594 ? 83.468  106.709 34.236 1.00 69.99  ? 594  ASN A O   1 
ATOM   4511 C  CB  . ASN A 1  594 ? 80.484  107.723 34.057 1.00 72.67  ? 594  ASN A CB  1 
ATOM   4512 C  CG  . ASN A 1  594 ? 79.337  108.497 33.475 1.00 66.42  ? 594  ASN A CG  1 
ATOM   4513 O  OD1 . ASN A 1  594 ? 78.953  109.586 33.960 1.00 78.22  ? 594  ASN A OD1 1 
ATOM   4514 N  ND2 . ASN A 1  594 ? 78.755  107.929 32.435 1.00 60.51  ? 594  ASN A ND2 1 
ATOM   4515 N  N   . VAL A 1  595 ? 82.855  107.876 36.127 1.00 72.17  ? 595  VAL A N   1 
ATOM   4516 C  CA  . VAL A 1  595 ? 83.669  107.029 36.977 1.00 73.18  ? 595  VAL A CA  1 
ATOM   4517 C  C   . VAL A 1  595 ? 83.091  106.709 38.333 1.00 75.27  ? 595  VAL A C   1 
ATOM   4518 O  O   . VAL A 1  595 ? 82.286  107.456 38.950 1.00 68.99  ? 595  VAL A O   1 
ATOM   4519 C  CB  . VAL A 1  595 ? 85.060  107.530 37.157 1.00 77.40  ? 595  VAL A CB  1 
ATOM   4520 C  CG1 . VAL A 1  595 ? 85.561  108.000 35.813 1.00 58.78  ? 595  VAL A CG1 1 
ATOM   4521 C  CG2 . VAL A 1  595 ? 85.113  108.535 38.298 1.00 57.82  ? 595  VAL A CG2 1 
ATOM   4522 N  N   . VAL A 1  596 ? 83.583  105.576 38.804 1.00 73.96  ? 596  VAL A N   1 
ATOM   4523 C  CA  . VAL A 1  596 ? 83.085  104.982 40.018 1.00 67.77  ? 596  VAL A CA  1 
ATOM   4524 C  C   . VAL A 1  596 ? 84.254  104.156 40.587 1.00 67.11  ? 596  VAL A C   1 
ATOM   4525 O  O   . VAL A 1  596 ? 85.016  103.530 39.813 1.00 67.11  ? 596  VAL A O   1 
ATOM   4526 C  CB  . VAL A 1  596 ? 81.914  104.106 39.534 1.00 66.46  ? 596  VAL A CB  1 
ATOM   4527 C  CG1 . VAL A 1  596 ? 82.358  102.705 39.350 1.00 54.81  ? 596  VAL A CG1 1 
ATOM   4528 C  CG2 . VAL A 1  596 ? 80.698  104.298 40.375 1.00 81.53  ? 596  VAL A CG2 1 
ATOM   4529 N  N   . GLY A 1  597 ? 84.425  104.152 41.914 1.00 51.60  ? 597  GLY A N   1 
ATOM   4530 C  CA  . GLY A 1  597 ? 85.528  103.370 42.475 1.00 50.35  ? 597  GLY A CA  1 
ATOM   4531 C  C   . GLY A 1  597 ? 85.556  103.362 43.993 1.00 51.79  ? 597  GLY A C   1 
ATOM   4532 O  O   . GLY A 1  597 ? 84.728  104.072 44.661 1.00 75.94  ? 597  GLY A O   1 
ATOM   4533 N  N   . SER A 1  598 ? 86.478  102.591 44.589 1.00 50.68  ? 598  SER A N   1 
ATOM   4534 C  CA  . SER A 1  598 ? 86.474  102.621 46.032 1.00 49.56  ? 598  SER A CA  1 
ATOM   4535 C  C   . SER A 1  598 ? 87.761  102.142 46.618 1.00 51.45  ? 598  SER A C   1 
ATOM   4536 O  O   . SER A 1  598 ? 88.672  101.649 45.901 1.00 49.66  ? 598  SER A O   1 
ATOM   4537 C  CB  . SER A 1  598 ? 85.348  101.753 46.545 1.00 53.25  ? 598  SER A CB  1 
ATOM   4538 O  OG  . SER A 1  598 ? 85.617  100.340 46.371 1.00 56.30  ? 598  SER A OG  1 
ATOM   4539 N  N   . TYR A 1  599 ? 87.837  102.232 47.950 1.00 50.99  ? 599  TYR A N   1 
ATOM   4540 C  CA  . TYR A 1  599 ? 89.046  101.752 48.609 1.00 52.65  ? 599  TYR A CA  1 
ATOM   4541 C  C   . TYR A 1  599 ? 88.630  101.283 50.008 1.00 55.16  ? 599  TYR A C   1 
ATOM   4542 O  O   . TYR A 1  599 ? 87.807  101.959 50.713 1.00 56.13  ? 599  TYR A O   1 
ATOM   4543 C  CB  . TYR A 1  599 ? 90.127  102.868 48.735 1.00 51.88  ? 599  TYR A CB  1 
ATOM   4544 C  CG  . TYR A 1  599 ? 91.294  102.457 49.662 1.00 51.64  ? 599  TYR A CG  1 
ATOM   4545 C  CD1 . TYR A 1  599 ? 92.292  101.636 49.207 1.00 50.42  ? 599  TYR A CD1 1 
ATOM   4546 C  CD2 . TYR A 1  599 ? 91.298  102.808 51.045 1.00 49.64  ? 599  TYR A CD2 1 
ATOM   4547 C  CE1 . TYR A 1  599 ? 93.256  101.140 50.084 1.00 50.89  ? 599  TYR A CE1 1 
ATOM   4548 C  CE2 . TYR A 1  599 ? 92.244  102.335 51.933 1.00 46.52  ? 599  TYR A CE2 1 
ATOM   4549 C  CZ  . TYR A 1  599 ? 93.222  101.475 51.455 1.00 49.97  ? 599  TYR A CZ  1 
ATOM   4550 O  OH  . TYR A 1  599 ? 94.081  100.761 52.334 1.00 53.92  ? 599  TYR A OH  1 
ATOM   4551 N  N   . THR A 1  600 ? 89.224  100.169 50.426 1.00 55.08  ? 600  THR A N   1 
ATOM   4552 C  CA  . THR A 1  600 ? 88.870  99.614  51.701 1.00 53.43  ? 600  THR A CA  1 
ATOM   4553 C  C   . THR A 1  600 ? 90.064  99.221  52.473 1.00 53.44  ? 600  THR A C   1 
ATOM   4554 O  O   . THR A 1  600 ? 90.996  98.626  51.935 1.00 53.40  ? 600  THR A O   1 
ATOM   4555 C  CB  . THR A 1  600 ? 87.994  98.287  51.534 1.00 54.07  ? 600  THR A CB  1 
ATOM   4556 O  OG1 . THR A 1  600 ? 86.946  98.530  50.612 1.00 50.93  ? 600  THR A OG1 1 
ATOM   4557 C  CG2 . THR A 1  600 ? 87.332  97.823  52.879 1.00 51.30  ? 600  THR A CG2 1 
ATOM   4558 N  N   . TYR A 1  601 ? 90.017  99.523  53.752 1.00 52.78  ? 601  TYR A N   1 
ATOM   4559 C  CA  . TYR A 1  601 ? 91.087  99.085  54.605 1.00 53.87  ? 601  TYR A CA  1 
ATOM   4560 C  C   . TYR A 1  601 ? 90.383  98.337  55.722 1.00 55.73  ? 601  TYR A C   1 
ATOM   4561 O  O   . TYR A 1  601 ? 89.508  98.919  56.435 1.00 55.61  ? 601  TYR A O   1 
ATOM   4562 C  CB  . TYR A 1  601 ? 91.836  100.274 55.188 1.00 72.99  ? 601  TYR A CB  1 
ATOM   4563 C  CG  . TYR A 1  601 ? 92.839  99.929  56.279 1.00 67.76  ? 601  TYR A CG  1 
ATOM   4564 C  CD1 . TYR A 1  601 ? 94.091  99.333  55.980 1.00 74.89  ? 601  TYR A CD1 1 
ATOM   4565 C  CD2 . TYR A 1  601 ? 92.550  100.214 57.615 1.00 67.17  ? 601  TYR A CD2 1 
ATOM   4566 C  CE1 . TYR A 1  601 ? 95.037  99.037  57.023 1.00 73.99  ? 601  TYR A CE1 1 
ATOM   4567 C  CE2 . TYR A 1  601 ? 93.469  99.943  58.642 1.00 72.35  ? 601  TYR A CE2 1 
ATOM   4568 C  CZ  . TYR A 1  601 ? 94.705  99.361  58.354 1.00 74.11  ? 601  TYR A CZ  1 
ATOM   4569 O  OH  . TYR A 1  601 ? 95.583  99.153  59.411 1.00 73.47  ? 601  TYR A OH  1 
ATOM   4570 N  N   . THR A 1  602 ? 90.751  97.062  55.885 1.00 53.83  ? 602  THR A N   1 
ATOM   4571 C  CA  . THR A 1  602 ? 90.139  96.249  56.919 1.00 60.24  ? 602  THR A CA  1 
ATOM   4572 C  C   . THR A 1  602 ? 91.165  95.596  57.808 1.00 67.45  ? 602  THR A C   1 
ATOM   4573 O  O   . THR A 1  602 ? 91.942  94.760  57.349 1.00 75.16  ? 602  THR A O   1 
ATOM   4574 C  CB  . THR A 1  602 ? 89.327  95.110  56.337 1.00 70.10  ? 602  THR A CB  1 
ATOM   4575 O  OG1 . THR A 1  602 ? 88.661  95.544  55.151 1.00 79.60  ? 602  THR A OG1 1 
ATOM   4576 C  CG2 . THR A 1  602 ? 88.283  94.668  57.340 1.00 69.35  ? 602  THR A CG2 1 
ATOM   4577 N  N   . ASP A 1  603 ? 91.166  95.942  59.088 1.00 64.22  ? 603  ASP A N   1 
ATOM   4578 C  CA  . ASP A 1  603 ? 92.127  95.342  59.976 1.00 63.21  ? 603  ASP A CA  1 
ATOM   4579 C  C   . ASP A 1  603 ? 91.266  94.435  60.826 1.00 69.84  ? 603  ASP A C   1 
ATOM   4580 O  O   . ASP A 1  603 ? 90.584  94.894  61.729 1.00 75.15  ? 603  ASP A O   1 
ATOM   4581 C  CB  . ASP A 1  603 ? 92.806  96.434  60.796 1.00 69.60  ? 603  ASP A CB  1 
ATOM   4582 C  CG  . ASP A 1  603 ? 93.213  95.978  62.223 1.00 75.48  ? 603  ASP A CG  1 
ATOM   4583 O  OD1 . ASP A 1  603 ? 93.908  94.950  62.397 1.00 85.50  ? 603  ASP A OD1 1 
ATOM   4584 O  OD2 . ASP A 1  603 ? 92.838  96.668  63.192 1.00 91.25  ? 603  ASP A OD2 1 
ATOM   4585 N  N   . ALA A 1  604 ? 91.266  93.139  60.533 1.00 66.75  ? 604  ALA A N   1 
ATOM   4586 C  CA  . ALA A 1  604 ? 90.407  92.222  61.297 1.00 61.47  ? 604  ALA A CA  1 
ATOM   4587 C  C   . ALA A 1  604 ? 91.252  91.366  62.226 1.00 62.93  ? 604  ALA A C   1 
ATOM   4588 O  O   . ALA A 1  604 ? 92.303  90.813  61.838 1.00 71.23  ? 604  ALA A O   1 
ATOM   4589 C  CB  . ALA A 1  604 ? 89.520  91.351  60.322 1.00 57.98  ? 604  ALA A CB  1 
ATOM   4590 N  N   . GLU A 1  605 ? 90.801  91.259  63.469 1.00 65.24  ? 605  GLU A N   1 
ATOM   4591 C  CA  . GLU A 1  605 ? 91.588  90.562  64.470 1.00 65.34  ? 605  GLU A CA  1 
ATOM   4592 C  C   . GLU A 1  605 ? 90.938  89.589  65.431 1.00 62.57  ? 605  GLU A C   1 
ATOM   4593 O  O   . GLU A 1  605 ? 89.945  89.866  66.088 1.00 66.17  ? 605  GLU A O   1 
ATOM   4594 C  CB  . GLU A 1  605 ? 92.300  91.639  65.272 1.00 73.44  ? 605  GLU A CB  1 
ATOM   4595 C  CG  . GLU A 1  605 ? 93.189  91.176  66.418 1.00 96.03  ? 605  GLU A CG  1 
ATOM   4596 C  CD  . GLU A 1  605 ? 94.396  92.090  66.629 1.00 100.14 ? 605  GLU A CD  1 
ATOM   4597 O  OE1 . GLU A 1  605 ? 94.209  93.300  66.951 1.00 110.42 ? 605  GLU A OE1 1 
ATOM   4598 O  OE2 . GLU A 1  605 ? 95.533  91.583  66.456 1.00 101.38 ? 605  GLU A OE2 1 
ATOM   4599 N  N   . TYR A 1  606 ? 91.511  88.421  65.519 1.00 60.07  ? 606  TYR A N   1 
ATOM   4600 C  CA  . TYR A 1  606 ? 91.014  87.495  66.508 1.00 62.77  ? 606  TYR A CA  1 
ATOM   4601 C  C   . TYR A 1  606 ? 91.449  88.161  67.845 1.00 64.97  ? 606  TYR A C   1 
ATOM   4602 O  O   . TYR A 1  606 ? 92.652  88.280  68.138 1.00 70.74  ? 606  TYR A O   1 
ATOM   4603 C  CB  . TYR A 1  606 ? 91.695  86.114  66.339 1.00 59.60  ? 606  TYR A CB  1 
ATOM   4604 C  CG  . TYR A 1  606 ? 90.957  85.145  65.386 1.00 64.69  ? 606  TYR A CG  1 
ATOM   4605 C  CD1 . TYR A 1  606 ? 89.685  84.656  65.692 1.00 57.74  ? 606  TYR A CD1 1 
ATOM   4606 C  CD2 . TYR A 1  606 ? 91.554  84.697  64.202 1.00 58.63  ? 606  TYR A CD2 1 
ATOM   4607 C  CE1 . TYR A 1  606 ? 89.048  83.756  64.870 1.00 59.56  ? 606  TYR A CE1 1 
ATOM   4608 C  CE2 . TYR A 1  606 ? 90.911  83.803  63.360 1.00 68.07  ? 606  TYR A CE2 1 
ATOM   4609 C  CZ  . TYR A 1  606 ? 89.663  83.332  63.698 1.00 72.25  ? 606  TYR A CZ  1 
ATOM   4610 O  OH  . TYR A 1  606 ? 89.037  82.439  62.866 1.00 57.27  ? 606  TYR A OH  1 
ATOM   4611 N  N   . THR A 1  607 ? 90.479  88.645  68.609 1.00 60.75  ? 607  THR A N   1 
ATOM   4612 C  CA  . THR A 1  607 ? 90.705  89.229  69.933 1.00 61.35  ? 607  THR A CA  1 
ATOM   4613 C  C   . THR A 1  607 ? 90.802  88.223  71.090 1.00 64.98  ? 607  THR A C   1 
ATOM   4614 O  O   . THR A 1  607 ? 91.667  88.315  71.905 1.00 73.29  ? 607  THR A O   1 
ATOM   4615 C  CB  . THR A 1  607 ? 89.597  90.113  70.287 1.00 64.38  ? 607  THR A CB  1 
ATOM   4616 O  OG1 . THR A 1  607 ? 89.973  91.433  69.895 1.00 70.75  ? 607  THR A OG1 1 
ATOM   4617 C  CG2 . THR A 1  607 ? 89.258  90.015  71.828 1.00 65.62  ? 607  THR A CG2 1 
ATOM   4618 N  N   . THR A 1  608 ? 89.871  87.291  71.202 1.00 70.07  ? 608  THR A N   1 
ATOM   4619 C  CA  . THR A 1  608 ? 89.924  86.285  72.252 1.00 66.88  ? 608  THR A CA  1 
ATOM   4620 C  C   . THR A 1  608 ? 89.782  84.993  71.485 1.00 58.98  ? 608  THR A C   1 
ATOM   4621 O  O   . THR A 1  608 ? 88.772  84.806  70.837 1.00 57.90  ? 608  THR A O   1 
ATOM   4622 C  CB  . THR A 1  608 ? 88.691  86.310  73.228 1.00 63.24  ? 608  THR A CB  1 
ATOM   4623 O  OG1 . THR A 1  608 ? 88.445  87.635  73.706 1.00 67.50  ? 608  THR A OG1 1 
ATOM   4624 C  CG2 . THR A 1  608 ? 88.936  85.362  74.373 1.00 57.91  ? 608  THR A CG2 1 
ATOM   4625 N  N   . ASP A 1  609 ? 90.771  84.108  71.564 1.00 67.67  ? 609  ASP A N   1 
ATOM   4626 C  CA  . ASP A 1  609 ? 90.689  82.797  70.923 1.00 67.88  ? 609  ASP A CA  1 
ATOM   4627 C  C   . ASP A 1  609 ? 91.756  81.766  71.401 1.00 68.34  ? 609  ASP A C   1 
ATOM   4628 O  O   . ASP A 1  609 ? 93.011  81.972  71.405 1.00 65.35  ? 609  ASP A O   1 
ATOM   4629 C  CB  . ASP A 1  609 ? 90.693  82.917  69.382 1.00 66.80  ? 609  ASP A CB  1 
ATOM   4630 C  CG  . ASP A 1  609 ? 90.208  81.652  68.733 1.00 76.01  ? 609  ASP A CG  1 
ATOM   4631 O  OD1 . ASP A 1  609 ? 91.015  80.705  68.629 1.00 67.82  ? 609  ASP A OD1 1 
ATOM   4632 O  OD2 . ASP A 1  609 ? 89.006  81.580  68.370 1.00 81.41  ? 609  ASP A OD2 1 
ATOM   4633 N  N   . THR A 1  610 ? 91.203  80.640  71.799 1.00 60.61  ? 610  THR A N   1 
ATOM   4634 C  CA  . THR A 1  610 ? 91.958  79.541  72.323 1.00 62.82  ? 610  THR A CA  1 
ATOM   4635 C  C   . THR A 1  610 ? 93.190  79.351  71.467 1.00 68.67  ? 610  THR A C   1 
ATOM   4636 O  O   . THR A 1  610 ? 94.310  79.525  71.945 1.00 78.24  ? 610  THR A O   1 
ATOM   4637 C  CB  . THR A 1  610 ? 91.091  78.229  72.331 1.00 65.17  ? 610  THR A CB  1 
ATOM   4638 O  OG1 . THR A 1  610 ? 89.845  78.454  73.005 1.00 70.46  ? 610  THR A OG1 1 
ATOM   4639 C  CG2 . THR A 1  610 ? 91.817  77.093  73.020 1.00 73.32  ? 610  THR A CG2 1 
ATOM   4640 N  N   . THR A 1  611 ? 92.971  79.005  70.195 1.00 70.58  ? 611  THR A N   1 
ATOM   4641 C  CA  . THR A 1  611 ? 94.027  78.709  69.223 1.00 59.19  ? 611  THR A CA  1 
ATOM   4642 C  C   . THR A 1  611 ? 94.540  79.880  68.377 1.00 66.49  ? 611  THR A C   1 
ATOM   4643 O  O   . THR A 1  611 ? 95.594  79.727  67.756 1.00 68.69  ? 611  THR A O   1 
ATOM   4644 C  CB  . THR A 1  611 ? 93.537  77.603  68.256 1.00 64.68  ? 611  THR A CB  1 
ATOM   4645 O  OG1 . THR A 1  611 ? 92.879  76.564  69.015 1.00 70.28  ? 611  THR A OG1 1 
ATOM   4646 C  CG2 . THR A 1  611 ? 94.703  76.977  67.479 1.00 46.28  ? 611  THR A CG2 1 
ATOM   4647 N  N   . TYR A 1  612 ? 93.865  81.044  68.367 1.00 63.94  ? 612  TYR A N   1 
ATOM   4648 C  CA  . TYR A 1  612 ? 94.314  82.128  67.489 1.00 67.96  ? 612  TYR A CA  1 
ATOM   4649 C  C   . TYR A 1  612 ? 94.404  83.575  67.935 1.00 77.43  ? 612  TYR A C   1 
ATOM   4650 O  O   . TYR A 1  612 ? 94.545  84.397  67.015 1.00 80.01  ? 612  TYR A O   1 
ATOM   4651 C  CB  . TYR A 1  612 ? 93.486  82.212  66.152 1.00 63.70  ? 612  TYR A CB  1 
ATOM   4652 C  CG  . TYR A 1  612 ? 93.106  80.904  65.444 1.00 63.62  ? 612  TYR A CG  1 
ATOM   4653 C  CD1 . TYR A 1  612 ? 94.093  80.037  64.960 1.00 65.65  ? 612  TYR A CD1 1 
ATOM   4654 C  CD2 . TYR A 1  612 ? 91.775  80.450  65.438 1.00 45.42  ? 612  TYR A CD2 1 
ATOM   4655 C  CE1 . TYR A 1  612 ? 93.775  78.762  64.521 1.00 60.29  ? 612  TYR A CE1 1 
ATOM   4656 C  CE2 . TYR A 1  612 ? 91.460  79.173  65.016 1.00 46.43  ? 612  TYR A CE2 1 
ATOM   4657 C  CZ  . TYR A 1  612 ? 92.466  78.335  64.563 1.00 66.77  ? 612  TYR A CZ  1 
ATOM   4658 O  OH  . TYR A 1  612 ? 92.205  77.047  64.183 1.00 65.64  ? 612  TYR A OH  1 
ATOM   4659 N  N   . LYS A 1  613 ? 94.366  83.964  69.229 1.00 78.51  ? 613  LYS A N   1 
ATOM   4660 C  CA  . LYS A 1  613 ? 94.403  85.429  69.417 1.00 78.51  ? 613  LYS A CA  1 
ATOM   4661 C  C   . LYS A 1  613 ? 95.481  86.043  68.567 1.00 76.39  ? 613  LYS A C   1 
ATOM   4662 O  O   . LYS A 1  613 ? 96.459  85.369  68.227 1.00 77.57  ? 613  LYS A O   1 
ATOM   4663 C  CB  . LYS A 1  613 ? 94.449  85.942  70.891 1.00 80.78  ? 613  LYS A CB  1 
ATOM   4664 C  CG  . LYS A 1  613 ? 95.538  85.527  71.832 1.00 92.00  ? 613  LYS A CG  1 
ATOM   4665 C  CD  . LYS A 1  613 ? 94.993  85.513  73.305 1.00 98.97  ? 613  LYS A CD  1 
ATOM   4666 C  CE  . LYS A 1  613 ? 94.928  86.888  73.997 1.00 96.84  ? 613  LYS A CE  1 
ATOM   4667 N  NZ  . LYS A 1  613 ? 94.295  87.876  73.131 1.00 87.35  ? 613  LYS A NZ  1 
ATOM   4668 N  N   . GLY A 1  614 ? 95.218  87.273  68.111 1.00 76.96  ? 614  GLY A N   1 
ATOM   4669 C  CA  . GLY A 1  614 ? 96.163  87.990  67.268 1.00 78.92  ? 614  GLY A CA  1 
ATOM   4670 C  C   . GLY A 1  614 ? 96.151  87.756  65.755 1.00 76.15  ? 614  GLY A C   1 
ATOM   4671 O  O   . GLY A 1  614 ? 96.545  88.630  64.978 1.00 84.07  ? 614  GLY A O   1 
ATOM   4672 N  N   . ASN A 1  615 ? 95.711  86.581  65.322 1.00 76.13  ? 615  ASN A N   1 
ATOM   4673 C  CA  . ASN A 1  615 ? 95.660  86.229  63.893 1.00 69.02  ? 615  ASN A CA  1 
ATOM   4674 C  C   . ASN A 1  615 ? 94.549  86.991  63.192 1.00 69.18  ? 615  ASN A C   1 
ATOM   4675 O  O   . ASN A 1  615 ? 93.573  87.403  63.845 1.00 63.10  ? 615  ASN A O   1 
ATOM   4676 C  CB  . ASN A 1  615 ? 95.305  84.771  63.768 1.00 66.11  ? 615  ASN A CB  1 
ATOM   4677 C  CG  . ASN A 1  615 ? 96.421  83.862  64.124 1.00 69.84  ? 615  ASN A CG  1 
ATOM   4678 O  OD1 . ASN A 1  615 ? 97.494  84.309  64.580 1.00 71.34  ? 615  ASN A OD1 1 
ATOM   4679 N  ND2 . ASN A 1  615 ? 96.201  82.539  63.894 1.00 60.67  ? 615  ASN A ND2 1 
ATOM   4680 N  N   . THR A 1  616 ? 94.664  87.198  61.880 1.00 66.78  ? 616  THR A N   1 
ATOM   4681 C  CA  . THR A 1  616 ? 93.521  87.832  61.205 1.00 68.27  ? 616  THR A CA  1 
ATOM   4682 C  C   . THR A 1  616 ? 92.727  86.676  60.509 1.00 60.33  ? 616  THR A C   1 
ATOM   4683 O  O   . THR A 1  616 ? 93.304  85.664  60.124 1.00 59.11  ? 616  THR A O   1 
ATOM   4684 C  CB  . THR A 1  616 ? 93.940  88.914  60.162 1.00 65.79  ? 616  THR A CB  1 
ATOM   4685 O  OG1 . THR A 1  616 ? 94.547  88.269  59.058 1.00 72.44  ? 616  THR A OG1 1 
ATOM   4686 C  CG2 . THR A 1  616 ? 94.954  89.937  60.748 1.00 75.69  ? 616  THR A CG2 1 
ATOM   4687 N  N   . PRO A 1  617 ? 91.385  86.771  60.409 1.00 55.63  ? 617  PRO A N   1 
ATOM   4688 C  CA  . PRO A 1  617 ? 90.743  85.629  59.732 1.00 55.15  ? 617  PRO A CA  1 
ATOM   4689 C  C   . PRO A 1  617 ? 91.022  85.419  58.268 1.00 54.65  ? 617  PRO A C   1 
ATOM   4690 O  O   . PRO A 1  617 ? 91.294  86.335  57.506 1.00 65.05  ? 617  PRO A O   1 
ATOM   4691 C  CB  . PRO A 1  617 ? 89.256  85.826  60.000 1.00 55.11  ? 617  PRO A CB  1 
ATOM   4692 C  CG  . PRO A 1  617 ? 89.125  87.142  60.585 1.00 52.94  ? 617  PRO A CG  1 
ATOM   4693 C  CD  . PRO A 1  617 ? 90.405  87.482  61.252 1.00 54.01  ? 617  PRO A CD  1 
ATOM   4694 N  N   . ALA A 1  618 ? 90.970  84.171  57.889 1.00 52.46  ? 618  ALA A N   1 
ATOM   4695 C  CA  . ALA A 1  618 ? 91.255  83.823  56.544 1.00 51.47  ? 618  ALA A CA  1 
ATOM   4696 C  C   . ALA A 1  618 ? 90.358  84.512  55.565 1.00 52.15  ? 618  ALA A C   1 
ATOM   4697 O  O   . ALA A 1  618 ? 89.222  84.883  55.879 1.00 53.42  ? 618  ALA A O   1 
ATOM   4698 C  CB  . ALA A 1  618 ? 91.145  82.333  56.389 1.00 48.68  ? 618  ALA A CB  1 
ATOM   4699 N  N   . GLN A 1  619 ? 90.894  84.622  54.357 1.00 53.24  ? 619  GLN A N   1 
ATOM   4700 C  CA  . GLN A 1  619 ? 90.239  85.198  53.207 1.00 52.21  ? 619  GLN A CA  1 
ATOM   4701 C  C   . GLN A 1  619 ? 89.973  86.686  53.259 1.00 53.40  ? 619  GLN A C   1 
ATOM   4702 O  O   . GLN A 1  619 ? 89.360  87.216  52.322 1.00 53.17  ? 619  GLN A O   1 
ATOM   4703 C  CB  . GLN A 1  619 ? 88.948  84.456  52.930 1.00 51.49  ? 619  GLN A CB  1 
ATOM   4704 C  CG  . GLN A 1  619 ? 89.204  83.014  52.764 1.00 50.49  ? 619  GLN A CG  1 
ATOM   4705 C  CD  . GLN A 1  619 ? 88.008  82.257  52.288 1.00 49.04  ? 619  GLN A CD  1 
ATOM   4706 O  OE1 . GLN A 1  619 ? 87.149  82.001  53.059 1.00 48.32  ? 619  GLN A OE1 1 
ATOM   4707 N  NE2 . GLN A 1  619 ? 87.957  81.891  50.992 1.00 51.36  ? 619  GLN A NE2 1 
ATOM   4708 N  N   . VAL A 1  620 ? 90.411  87.384  54.306 1.00 53.46  ? 620  VAL A N   1 
ATOM   4709 C  CA  . VAL A 1  620 ? 90.171  88.814  54.284 1.00 54.17  ? 620  VAL A CA  1 
ATOM   4710 C  C   . VAL A 1  620 ? 91.398  89.652  54.231 1.00 54.65  ? 620  VAL A C   1 
ATOM   4711 O  O   . VAL A 1  620 ? 92.136  89.689  55.171 1.00 76.96  ? 620  VAL A O   1 
ATOM   4712 C  CB  . VAL A 1  620 ? 89.278  89.287  55.422 1.00 54.98  ? 620  VAL A CB  1 
ATOM   4713 C  CG1 . VAL A 1  620 ? 89.177  88.264  56.417 1.00 56.60  ? 620  VAL A CG1 1 
ATOM   4714 C  CG2 . VAL A 1  620 ? 89.717  90.659  55.963 1.00 51.89  ? 620  VAL A CG2 1 
ATOM   4715 N  N   . PRO A 1  621 ? 91.642  90.322  53.093 1.00 69.53  ? 621  PRO A N   1 
ATOM   4716 C  CA  . PRO A 1  621 ? 92.776  91.207  52.781 1.00 54.11  ? 621  PRO A CA  1 
ATOM   4717 C  C   . PRO A 1  621 ? 92.792  92.502  53.613 1.00 66.52  ? 621  PRO A C   1 
ATOM   4718 O  O   . PRO A 1  621 ? 91.744  92.983  54.020 1.00 79.34  ? 621  PRO A O   1 
ATOM   4719 C  CB  . PRO A 1  621 ? 92.579  91.466  51.273 1.00 53.02  ? 621  PRO A CB  1 
ATOM   4720 C  CG  . PRO A 1  621 ? 91.152  91.461  51.142 1.00 55.29  ? 621  PRO A CG  1 
ATOM   4721 C  CD  . PRO A 1  621 ? 90.732  90.260  51.947 1.00 54.76  ? 621  PRO A CD  1 
ATOM   4722 N  N   . LYS A 1  622 ? 93.946  93.110  53.842 1.00 66.78  ? 622  LYS A N   1 
ATOM   4723 C  CA  . LYS A 1  622 ? 93.936  94.314  54.666 1.00 68.03  ? 622  LYS A CA  1 
ATOM   4724 C  C   . LYS A 1  622 ? 93.557  95.489  53.773 1.00 56.39  ? 622  LYS A C   1 
ATOM   4725 O  O   . LYS A 1  622 ? 92.871  96.486  54.192 1.00 56.83  ? 622  LYS A O   1 
ATOM   4726 C  CB  . LYS A 1  622 ? 95.317  94.521  55.279 1.00 72.79  ? 622  LYS A CB  1 
ATOM   4727 C  CG  . LYS A 1  622 ? 95.323  95.223  56.621 1.00 75.90  ? 622  LYS A CG  1 
ATOM   4728 C  CD  . LYS A 1  622 ? 96.521  94.701  57.440 1.00 77.23  ? 622  LYS A CD  1 
ATOM   4729 C  CE  . LYS A 1  622 ? 96.709  95.429  58.775 1.00 85.12  ? 622  LYS A CE  1 
ATOM   4730 N  NZ  . LYS A 1  622 ? 97.121  96.866  58.574 1.00 84.56  ? 622  LYS A NZ  1 
ATOM   4731 N  N   . HIS A 1  623 ? 93.981  95.339  52.525 1.00 54.77  ? 623  HIS A N   1 
ATOM   4732 C  CA  . HIS A 1  623 ? 93.725  96.371  51.577 1.00 54.73  ? 623  HIS A CA  1 
ATOM   4733 C  C   . HIS A 1  623 ? 93.019  95.874  50.363 1.00 55.03  ? 623  HIS A C   1 
ATOM   4734 O  O   . HIS A 1  623 ? 93.425  94.818  49.812 1.00 56.03  ? 623  HIS A O   1 
ATOM   4735 C  CB  . HIS A 1  623 ? 95.047  96.956  51.058 1.00 70.90  ? 623  HIS A CB  1 
ATOM   4736 C  CG  . HIS A 1  623 ? 95.898  97.574  52.114 1.00 71.52  ? 623  HIS A CG  1 
ATOM   4737 N  ND1 . HIS A 1  623 ? 95.538  98.736  52.761 1.00 66.51  ? 623  HIS A ND1 1 
ATOM   4738 C  CD2 . HIS A 1  623 ? 97.043  97.139  52.704 1.00 46.44  ? 623  HIS A CD2 1 
ATOM   4739 C  CE1 . HIS A 1  623 ? 96.417  98.988  53.715 1.00 66.43  ? 623  HIS A CE1 1 
ATOM   4740 N  NE2 . HIS A 1  623 ? 97.333  98.036  53.699 1.00 76.57  ? 623  HIS A NE2 1 
ATOM   4741 N  N   . MET A 1  624 ? 91.973  96.589  49.933 1.00 53.41  ? 624  MET A N   1 
ATOM   4742 C  CA  . MET A 1  624 ? 91.435  96.251  48.591 1.00 52.21  ? 624  MET A CA  1 
ATOM   4743 C  C   . MET A 1  624 ? 90.965  97.514  47.940 1.00 50.91  ? 624  MET A C   1 
ATOM   4744 O  O   . MET A 1  624 ? 90.592  98.488  48.642 1.00 49.57  ? 624  MET A O   1 
ATOM   4745 C  CB  . MET A 1  624 ? 90.224  95.319  48.572 1.00 53.30  ? 624  MET A CB  1 
ATOM   4746 C  CG  . MET A 1  624 ? 90.023  94.369  49.715 1.00 99.64  ? 624  MET A CG  1 
ATOM   4747 S  SD  . MET A 1  624 ? 88.389  93.623  49.485 1.00 63.34  ? 624  MET A SD  1 
ATOM   4748 C  CE  . MET A 1  624 ? 87.503  94.360  50.960 1.00 37.05  ? 624  MET A CE  1 
ATOM   4749 N  N   . ALA A 1  625 ? 90.929  97.467  46.611 1.00 48.79  ? 625  ALA A N   1 
ATOM   4750 C  CA  . ALA A 1  625 ? 90.413  98.585  45.893 1.00 50.21  ? 625  ALA A CA  1 
ATOM   4751 C  C   . ALA A 1  625 ? 90.023  98.296  44.456 1.00 52.99  ? 625  ALA A C   1 
ATOM   4752 O  O   . ALA A 1  625 ? 90.393  97.319  43.794 1.00 51.70  ? 625  ALA A O   1 
ATOM   4753 C  CB  . ALA A 1  625 ? 91.401  99.765  45.947 1.00 52.47  ? 625  ALA A CB  1 
ATOM   4754 N  N   . SER A 1  626 ? 89.283  99.232  43.945 1.00 54.78  ? 626  SER A N   1 
ATOM   4755 C  CA  . SER A 1  626 ? 88.789  99.085  42.621 1.00 56.68  ? 626  SER A CA  1 
ATOM   4756 C  C   . SER A 1  626 ? 88.485  100.502 42.118 1.00 57.22  ? 626  SER A C   1 
ATOM   4757 O  O   . SER A 1  626 ? 88.152  101.464 42.928 1.00 55.07  ? 626  SER A O   1 
ATOM   4758 C  CB  . SER A 1  626 ? 87.475  98.255  42.644 1.00 57.47  ? 626  SER A CB  1 
ATOM   4759 O  OG  . SER A 1  626 ? 86.413  99.006  43.246 1.00 58.80  ? 626  SER A OG  1 
ATOM   4760 N  N   . LEU A 1  627 ? 88.587  100.601 40.794 1.00 55.49  ? 627  LEU A N   1 
ATOM   4761 C  CA  . LEU A 1  627 ? 88.273  101.830 40.144 1.00 57.12  ? 627  LEU A CA  1 
ATOM   4762 C  C   . LEU A 1  627 ? 87.857  101.556 38.674 1.00 58.02  ? 627  LEU A C   1 
ATOM   4763 O  O   . LEU A 1  627 ? 88.467  100.716 37.963 1.00 57.94  ? 627  LEU A O   1 
ATOM   4764 C  CB  . LEU A 1  627 ? 89.450  102.791 40.247 1.00 63.01  ? 627  LEU A CB  1 
ATOM   4765 C  CG  . LEU A 1  627 ? 88.929  104.048 39.536 1.00 83.08  ? 627  LEU A CG  1 
ATOM   4766 C  CD1 . LEU A 1  627 ? 88.735  105.188 40.549 1.00 66.73  ? 627  LEU A CD1 1 
ATOM   4767 C  CD2 . LEU A 1  627 ? 89.855  104.400 38.354 1.00 69.44  ? 627  LEU A CD2 1 
ATOM   4768 N  N   . TRP A 1  628 ? 86.766  102.212 38.259 1.00 60.07  ? 628  TRP A N   1 
ATOM   4769 C  CA  . TRP A 1  628 ? 86.209  102.051 36.905 1.00 68.54  ? 628  TRP A CA  1 
ATOM   4770 C  C   . TRP A 1  628 ? 85.893  103.348 36.170 1.00 69.17  ? 628  TRP A C   1 
ATOM   4771 O  O   . TRP A 1  628 ? 85.393  104.327 36.815 1.00 67.51  ? 628  TRP A O   1 
ATOM   4772 C  CB  . TRP A 1  628 ? 84.907  101.305 36.953 1.00 51.50  ? 628  TRP A CB  1 
ATOM   4773 C  CG  . TRP A 1  628 ? 84.504  100.819 35.648 1.00 73.31  ? 628  TRP A CG  1 
ATOM   4774 C  CD1 . TRP A 1  628 ? 84.936  99.652  35.012 1.00 84.41  ? 628  TRP A CD1 1 
ATOM   4775 C  CD2 . TRP A 1  628 ? 83.521  101.385 34.805 1.00 50.48  ? 628  TRP A CD2 1 
ATOM   4776 N  NE1 . TRP A 1  628 ? 84.263  99.457  33.828 1.00 58.86  ? 628  TRP A NE1 1 
ATOM   4777 C  CE2 . TRP A 1  628 ? 83.387  100.515 33.660 1.00 50.53  ? 628  TRP A CE2 1 
ATOM   4778 C  CE3 . TRP A 1  628 ? 82.729  102.534 34.886 1.00 67.86  ? 628  TRP A CE3 1 
ATOM   4779 C  CZ2 . TRP A 1  628 ? 82.476  100.767 32.620 1.00 46.94  ? 628  TRP A CZ2 1 
ATOM   4780 C  CZ3 . TRP A 1  628 ? 81.817  102.788 33.857 1.00 80.84  ? 628  TRP A CZ3 1 
ATOM   4781 C  CH2 . TRP A 1  628 ? 81.706  101.903 32.730 1.00 93.42  ? 628  TRP A CH2 1 
ATOM   4782 N  N   . ALA A 1  629 ? 86.129  103.321 34.842 1.00 61.98  ? 629  ALA A N   1 
ATOM   4783 C  CA  . ALA A 1  629 ? 85.860  104.474 33.952 1.00 67.27  ? 629  ALA A CA  1 
ATOM   4784 C  C   . ALA A 1  629 ? 85.286  104.084 32.584 1.00 67.33  ? 629  ALA A C   1 
ATOM   4785 O  O   . ALA A 1  629 ? 85.727  103.086 31.918 1.00 53.84  ? 629  ALA A O   1 
ATOM   4786 C  CB  . ALA A 1  629 ? 87.133  105.299 33.749 1.00 65.20  ? 629  ALA A CB  1 
ATOM   4787 N  N   . ASP A 1  630 ? 84.282  104.856 32.172 1.00 57.08  ? 630  ASP A N   1 
ATOM   4788 C  CA  . ASP A 1  630 ? 83.663  104.618 30.853 1.00 69.61  ? 630  ASP A CA  1 
ATOM   4789 C  C   . ASP A 1  630 ? 83.697  105.927 30.086 1.00 69.90  ? 630  ASP A C   1 
ATOM   4790 O  O   . ASP A 1  630 ? 83.512  107.028 30.652 1.00 77.31  ? 630  ASP A O   1 
ATOM   4791 C  CB  . ASP A 1  630 ? 82.172  104.132 30.959 1.00 65.22  ? 630  ASP A CB  1 
ATOM   4792 C  CG  . ASP A 1  630 ? 81.285  105.142 31.632 1.00 81.15  ? 630  ASP A CG  1 
ATOM   4793 O  OD1 . ASP A 1  630 ? 81.675  105.583 32.726 1.00 92.40  ? 630  ASP A OD1 1 
ATOM   4794 O  OD2 . ASP A 1  630 ? 80.227  105.535 31.098 1.00 84.97  ? 630  ASP A OD2 1 
ATOM   4795 N  N   . TYR A 1  631 ? 83.939  105.828 28.797 1.00 72.47  ? 631  TYR A N   1 
ATOM   4796 C  CA  . TYR A 1  631 ? 83.957  107.032 27.937 1.00 78.06  ? 631  TYR A CA  1 
ATOM   4797 C  C   . TYR A 1  631 ? 83.008  106.790 26.759 1.00 80.43  ? 631  TYR A C   1 
ATOM   4798 O  O   . TYR A 1  631 ? 83.096  105.744 26.019 1.00 70.34  ? 631  TYR A O   1 
ATOM   4799 C  CB  . TYR A 1  631 ? 85.372  107.332 27.384 1.00 84.98  ? 631  TYR A CB  1 
ATOM   4800 C  CG  . TYR A 1  631 ? 85.482  108.635 26.611 1.00 83.24  ? 631  TYR A CG  1 
ATOM   4801 C  CD1 . TYR A 1  631 ? 85.758  109.835 27.284 1.00 79.92  ? 631  TYR A CD1 1 
ATOM   4802 C  CD2 . TYR A 1  631 ? 85.248  108.677 25.222 1.00 77.98  ? 631  TYR A CD2 1 
ATOM   4803 C  CE1 . TYR A 1  631 ? 85.801  111.041 26.613 1.00 86.85  ? 631  TYR A CE1 1 
ATOM   4804 C  CE2 . TYR A 1  631 ? 85.279  109.875 24.534 1.00 81.82  ? 631  TYR A CE2 1 
ATOM   4805 C  CZ  . TYR A 1  631 ? 85.557  111.072 25.227 1.00 87.38  ? 631  TYR A CZ  1 
ATOM   4806 O  OH  . TYR A 1  631 ? 85.585  112.306 24.574 1.00 73.80  ? 631  TYR A OH  1 
ATOM   4807 N  N   . THR A 1  632 ? 82.085  107.735 26.599 1.00 80.52  ? 632  THR A N   1 
ATOM   4808 C  CA  . THR A 1  632 ? 81.137  107.587 25.524 1.00 88.40  ? 632  THR A CA  1 
ATOM   4809 C  C   . THR A 1  632 ? 81.354  108.715 24.558 1.00 91.04  ? 632  THR A C   1 
ATOM   4810 O  O   . THR A 1  632 ? 81.613  109.876 24.934 1.00 85.40  ? 632  THR A O   1 
ATOM   4811 C  CB  . THR A 1  632 ? 79.665  107.568 26.017 1.00 89.11  ? 632  THR A CB  1 
ATOM   4812 O  OG1 . THR A 1  632 ? 79.604  106.954 27.316 1.00 89.88  ? 632  THR A OG1 1 
ATOM   4813 C  CG2 . THR A 1  632 ? 78.775  106.796 25.026 1.00 74.44  ? 632  THR A CG2 1 
ATOM   4814 N  N   . PHE A 1  633 ? 81.239  108.311 23.309 1.00 89.03  ? 633  PHE A N   1 
ATOM   4815 C  CA  . PHE A 1  633 ? 81.428  109.136 22.163 1.00 91.73  ? 633  PHE A CA  1 
ATOM   4816 C  C   . PHE A 1  633 ? 80.162  109.562 21.459 1.00 95.56  ? 633  PHE A C   1 
ATOM   4817 O  O   . PHE A 1  633 ? 79.536  108.723 20.805 1.00 87.84  ? 633  PHE A O   1 
ATOM   4818 C  CB  . PHE A 1  633 ? 82.214  108.345 21.157 1.00 96.78  ? 633  PHE A CB  1 
ATOM   4819 C  CG  . PHE A 1  633 ? 83.659  108.505 21.272 1.00 98.98  ? 633  PHE A CG  1 
ATOM   4820 C  CD1 . PHE A 1  633 ? 84.205  109.761 21.483 1.00 99.12  ? 633  PHE A CD1 1 
ATOM   4821 C  CD2 . PHE A 1  633 ? 84.500  107.426 21.051 1.00 102.71 ? 633  PHE A CD2 1 
ATOM   4822 C  CE1 . PHE A 1  633 ? 85.575  109.945 21.463 1.00 99.67  ? 633  PHE A CE1 1 
ATOM   4823 C  CE2 . PHE A 1  633 ? 85.879  107.594 21.029 1.00 102.65 ? 633  PHE A CE2 1 
ATOM   4824 C  CZ  . PHE A 1  633 ? 86.417  108.861 21.235 1.00 102.81 ? 633  PHE A CZ  1 
ATOM   4825 N  N   . PHE A 1  634 ? 79.813  110.849 21.535 1.00 98.62  ? 634  PHE A N   1 
ATOM   4826 C  CA  . PHE A 1  634 ? 78.640  111.362 20.803 1.00 109.97 ? 634  PHE A CA  1 
ATOM   4827 C  C   . PHE A 1  634 ? 78.909  112.196 19.500 1.00 113.92 ? 634  PHE A C   1 
ATOM   4828 O  O   . PHE A 1  634 ? 77.946  112.657 18.867 1.00 111.81 ? 634  PHE A O   1 
ATOM   4829 C  CB  . PHE A 1  634 ? 77.780  112.213 21.712 1.00 109.10 ? 634  PHE A CB  1 
ATOM   4830 C  CG  . PHE A 1  634 ? 77.620  111.653 23.059 1.00 107.78 ? 634  PHE A CG  1 
ATOM   4831 C  CD1 . PHE A 1  634 ? 78.533  111.975 24.057 1.00 107.71 ? 634  PHE A CD1 1 
ATOM   4832 C  CD2 . PHE A 1  634 ? 76.558  110.798 23.346 1.00 101.32 ? 634  PHE A CD2 1 
ATOM   4833 C  CE1 . PHE A 1  634 ? 78.389  111.457 25.341 1.00 106.09 ? 634  PHE A CE1 1 
ATOM   4834 C  CE2 . PHE A 1  634 ? 76.404  110.268 24.622 1.00 99.82  ? 634  PHE A CE2 1 
ATOM   4835 C  CZ  . PHE A 1  634 ? 77.324  110.600 25.626 1.00 101.59 ? 634  PHE A CZ  1 
ATOM   4836 N  N   . ASP A 1  635 ? 80.187  112.383 19.116 1.00 116.04 ? 635  ASP A N   1 
ATOM   4837 C  CA  . ASP A 1  635 ? 80.602  113.149 17.914 1.00 113.13 ? 635  ASP A CA  1 
ATOM   4838 C  C   . ASP A 1  635 ? 81.348  112.261 16.916 1.00 112.00 ? 635  ASP A C   1 
ATOM   4839 O  O   . ASP A 1  635 ? 81.678  111.106 17.201 1.00 112.07 ? 635  ASP A O   1 
ATOM   4840 C  CB  . ASP A 1  635 ? 81.561  114.286 18.290 1.00 113.56 ? 635  ASP A CB  1 
ATOM   4841 C  CG  . ASP A 1  635 ? 81.358  114.783 19.714 1.00 120.85 ? 635  ASP A CG  1 
ATOM   4842 O  OD1 . ASP A 1  635 ? 80.286  115.379 19.983 1.00 115.91 ? 635  ASP A OD1 1 
ATOM   4843 O  OD2 . ASP A 1  635 ? 82.269  114.570 20.561 1.00 117.92 ? 635  ASP A OD2 1 
ATOM   4844 N  N   . GLY A 1  636 ? 81.645  112.810 15.750 1.00 108.96 ? 636  GLY A N   1 
ATOM   4845 C  CA  . GLY A 1  636 ? 82.376  112.026 14.775 1.00 109.68 ? 636  GLY A CA  1 
ATOM   4846 C  C   . GLY A 1  636 ? 81.616  110.804 14.285 1.00 111.02 ? 636  GLY A C   1 
ATOM   4847 O  O   . GLY A 1  636 ? 80.379  110.784 14.291 1.00 109.05 ? 636  GLY A O   1 
ATOM   4848 N  N   . PRO A 1  637 ? 82.342  109.775 13.812 1.00 114.20 ? 637  PRO A N   1 
ATOM   4849 C  CA  . PRO A 1  637 ? 81.794  108.508 13.294 1.00 113.42 ? 637  PRO A CA  1 
ATOM   4850 C  C   . PRO A 1  637 ? 81.850  107.375 14.340 1.00 111.04 ? 637  PRO A C   1 
ATOM   4851 O  O   . PRO A 1  637 ? 81.547  106.213 14.045 1.00 109.60 ? 637  PRO A O   1 
ATOM   4852 C  CB  . PRO A 1  637 ? 82.687  108.208 12.076 1.00 113.60 ? 637  PRO A CB  1 
ATOM   4853 C  CG  . PRO A 1  637 ? 83.623  109.445 11.948 1.00 107.79 ? 637  PRO A CG  1 
ATOM   4854 C  CD  . PRO A 1  637 ? 83.728  109.951 13.349 1.00 111.42 ? 637  PRO A CD  1 
ATOM   4855 N  N   . LEU A 1  638 ? 82.270  107.735 15.548 1.00 108.62 ? 638  LEU A N   1 
ATOM   4856 C  CA  . LEU A 1  638 ? 82.365  106.806 16.666 1.00 105.74 ? 638  LEU A CA  1 
ATOM   4857 C  C   . LEU A 1  638 ? 81.327  107.306 17.645 1.00 105.54 ? 638  LEU A C   1 
ATOM   4858 O  O   . LEU A 1  638 ? 81.563  107.352 18.870 1.00 104.13 ? 638  LEU A O   1 
ATOM   4859 C  CB  . LEU A 1  638 ? 83.739  106.895 17.321 1.00 99.04  ? 638  LEU A CB  1 
ATOM   4860 C  CG  . LEU A 1  638 ? 84.922  106.567 16.417 1.00 95.72  ? 638  LEU A CG  1 
ATOM   4861 C  CD1 . LEU A 1  638 ? 86.213  106.736 17.230 1.00 86.29  ? 638  LEU A CD1 1 
ATOM   4862 C  CD2 . LEU A 1  638 ? 84.783  105.142 15.873 1.00 81.81  ? 638  LEU A CD2 1 
ATOM   4863 N  N   . SER A 1  639 ? 80.188  107.715 17.087 1.00 100.19 ? 639  SER A N   1 
ATOM   4864 C  CA  . SER A 1  639 ? 79.099  108.249 17.894 1.00 94.41  ? 639  SER A CA  1 
ATOM   4865 C  C   . SER A 1  639 ? 78.285  107.076 18.388 1.00 87.79  ? 639  SER A C   1 
ATOM   4866 O  O   . SER A 1  639 ? 77.927  106.208 17.607 1.00 82.23  ? 639  SER A O   1 
ATOM   4867 C  CB  . SER A 1  639 ? 78.223  109.208 17.064 1.00 96.86  ? 639  SER A CB  1 
ATOM   4868 O  OG  . SER A 1  639 ? 77.557  110.195 17.860 1.00 88.17  ? 639  SER A OG  1 
ATOM   4869 N  N   . GLY A 1  640 ? 78.024  107.061 19.698 1.00 87.63  ? 640  GLY A N   1 
ATOM   4870 C  CA  . GLY A 1  640 ? 77.273  105.982 20.315 1.00 84.02  ? 640  GLY A CA  1 
ATOM   4871 C  C   . GLY A 1  640 ? 78.159  104.779 20.620 1.00 83.56  ? 640  GLY A C   1 
ATOM   4872 O  O   . GLY A 1  640 ? 77.688  103.630 20.702 1.00 85.33  ? 640  GLY A O   1 
ATOM   4873 N  N   . LEU A 1  641 ? 79.453  105.057 20.776 1.00 82.49  ? 641  LEU A N   1 
ATOM   4874 C  CA  . LEU A 1  641 ? 80.453  104.046 21.057 1.00 80.47  ? 641  LEU A CA  1 
ATOM   4875 C  C   . LEU A 1  641 ? 81.031  104.329 22.404 1.00 80.02  ? 641  LEU A C   1 
ATOM   4876 O  O   . LEU A 1  641 ? 81.587  105.420 22.658 1.00 78.77  ? 641  LEU A O   1 
ATOM   4877 C  CB  . LEU A 1  641 ? 81.558  104.082 20.025 1.00 82.83  ? 641  LEU A CB  1 
ATOM   4878 C  CG  . LEU A 1  641 ? 82.851  103.378 20.380 1.00 80.49  ? 641  LEU A CG  1 
ATOM   4879 C  CD1 . LEU A 1  641 ? 82.891  102.000 19.733 1.00 83.47  ? 641  LEU A CD1 1 
ATOM   4880 C  CD2 . LEU A 1  641 ? 83.987  104.253 19.884 1.00 75.50  ? 641  LEU A CD2 1 
ATOM   4881 N  N   . THR A 1  642 ? 80.882  103.332 23.273 1.00 81.85  ? 642  THR A N   1 
ATOM   4882 C  CA  . THR A 1  642 ? 81.350  103.452 24.629 1.00 72.91  ? 642  THR A CA  1 
ATOM   4883 C  C   . THR A 1  642 ? 82.490  102.534 24.828 1.00 67.78  ? 642  THR A C   1 
ATOM   4884 O  O   . THR A 1  642 ? 82.502  101.387 24.347 1.00 61.23  ? 642  THR A O   1 
ATOM   4885 C  CB  . THR A 1  642 ? 80.274  103.093 25.649 1.00 71.77  ? 642  THR A CB  1 
ATOM   4886 O  OG1 . THR A 1  642 ? 79.126  103.953 25.494 1.00 66.17  ? 642  THR A OG1 1 
ATOM   4887 C  CG2 . THR A 1  642 ? 80.846  103.266 27.036 1.00 71.92  ? 642  THR A CG2 1 
ATOM   4888 N  N   . LEU A 1  643 ? 83.480  103.078 25.504 1.00 64.50  ? 643  LEU A N   1 
ATOM   4889 C  CA  . LEU A 1  643 ? 84.621  102.286 25.829 1.00 62.97  ? 643  LEU A CA  1 
ATOM   4890 C  C   . LEU A 1  643 ? 84.745  102.447 27.322 1.00 69.50  ? 643  LEU A C   1 
ATOM   4891 O  O   . LEU A 1  643 ? 84.461  103.519 27.893 1.00 65.64  ? 643  LEU A O   1 
ATOM   4892 C  CB  . LEU A 1  643 ? 85.824  102.793 25.088 1.00 70.15  ? 643  LEU A CB  1 
ATOM   4893 C  CG  . LEU A 1  643 ? 85.563  102.551 23.597 1.00 71.41  ? 643  LEU A CG  1 
ATOM   4894 C  CD1 . LEU A 1  643 ? 86.173  103.671 22.783 1.00 71.78  ? 643  LEU A CD1 1 
ATOM   4895 C  CD2 . LEU A 1  643 ? 86.119  101.219 23.192 1.00 67.04  ? 643  LEU A CD2 1 
ATOM   4896 N  N   . GLY A 1  644 ? 85.091  101.350 27.977 1.00 65.87  ? 644  GLY A N   1 
ATOM   4897 C  CA  . GLY A 1  644 ? 85.213  101.406 29.413 1.00 58.21  ? 644  GLY A CA  1 
ATOM   4898 C  C   . GLY A 1  644 ? 86.187  100.361 29.863 1.00 58.94  ? 644  GLY A C   1 
ATOM   4899 O  O   . GLY A 1  644 ? 86.434  99.320  29.200 1.00 58.45  ? 644  GLY A O   1 
ATOM   4900 N  N   . THR A 1  645 ? 86.764  100.637 31.007 1.00 52.17  ? 645  THR A N   1 
ATOM   4901 C  CA  . THR A 1  645 ? 87.718  99.697  31.484 1.00 70.63  ? 645  THR A CA  1 
ATOM   4902 C  C   . THR A 1  645 ? 87.845  99.935  32.960 1.00 68.71  ? 645  THR A C   1 
ATOM   4903 O  O   . THR A 1  645 ? 87.546  101.049 33.449 1.00 69.25  ? 645  THR A O   1 
ATOM   4904 C  CB  . THR A 1  645 ? 89.042  99.915  30.799 1.00 75.12  ? 645  THR A CB  1 
ATOM   4905 O  OG1 . THR A 1  645 ? 89.907  98.821  31.110 1.00 89.37  ? 645  THR A OG1 1 
ATOM   4906 C  CG2 . THR A 1  645 ? 89.692  101.226 31.291 1.00 56.69  ? 645  THR A CG2 1 
ATOM   4907 N  N   . GLY A 1  646 ? 88.263  98.894  33.673 1.00 67.50  ? 646  GLY A N   1 
ATOM   4908 C  CA  . GLY A 1  646 ? 88.386  99.032  35.113 1.00 68.35  ? 646  GLY A CA  1 
ATOM   4909 C  C   . GLY A 1  646 ? 89.397  98.107  35.765 1.00 67.54  ? 646  GLY A C   1 
ATOM   4910 O  O   . GLY A 1  646 ? 89.884  97.122  35.183 1.00 69.30  ? 646  GLY A O   1 
ATOM   4911 N  N   . GLY A 1  647 ? 89.710  98.429  37.010 1.00 67.80  ? 647  GLY A N   1 
ATOM   4912 C  CA  . GLY A 1  647 ? 90.692  97.647  37.715 1.00 55.62  ? 647  GLY A CA  1 
ATOM   4913 C  C   . GLY A 1  647 ? 90.254  97.323  39.126 1.00 80.70  ? 647  GLY A C   1 
ATOM   4914 O  O   . GLY A 1  647 ? 89.774  98.171  39.955 1.00 57.14  ? 647  GLY A O   1 
ATOM   4915 N  N   . ARG A 1  648 ? 90.410  96.039  39.403 1.00 58.16  ? 648  ARG A N   1 
ATOM   4916 C  CA  . ARG A 1  648 ? 90.073  95.545  40.706 1.00 56.66  ? 648  ARG A CA  1 
ATOM   4917 C  C   . ARG A 1  648 ? 91.308  94.969  41.441 1.00 56.52  ? 648  ARG A C   1 
ATOM   4918 O  O   . ARG A 1  648 ? 91.947  93.954  41.036 1.00 55.89  ? 648  ARG A O   1 
ATOM   4919 C  CB  . ARG A 1  648 ? 88.997  94.504  40.582 1.00 57.67  ? 648  ARG A CB  1 
ATOM   4920 C  CG  . ARG A 1  648 ? 87.522  94.933  40.473 1.00 63.39  ? 648  ARG A CG  1 
ATOM   4921 C  CD  . ARG A 1  648 ? 86.707  93.688  40.861 1.00 83.02  ? 648  ARG A CD  1 
ATOM   4922 N  NE  . ARG A 1  648 ? 87.182  92.479  40.173 1.00 53.80  ? 648  ARG A NE  1 
ATOM   4923 C  CZ  . ARG A 1  648 ? 87.096  92.416  38.856 1.00 86.15  ? 648  ARG A CZ  1 
ATOM   4924 N  NH1 . ARG A 1  648 ? 86.581  93.505  38.277 1.00 55.44  ? 648  ARG A NH1 1 
ATOM   4925 N  NH2 . ARG A 1  648 ? 87.463  91.322  38.155 1.00 48.18  ? 648  ARG A NH2 1 
ATOM   4926 N  N   . TYR A 1  649 ? 91.625  95.660  42.540 1.00 55.55  ? 649  TYR A N   1 
ATOM   4927 C  CA  . TYR A 1  649 ? 92.750  95.306  43.368 1.00 56.09  ? 649  TYR A CA  1 
ATOM   4928 C  C   . TYR A 1  649 ? 92.317  94.517  44.589 1.00 56.16  ? 649  TYR A C   1 
ATOM   4929 O  O   . TYR A 1  649 ? 91.475  94.981  45.429 1.00 55.10  ? 649  TYR A O   1 
ATOM   4930 C  CB  . TYR A 1  649 ? 93.555  96.574  43.850 1.00 54.51  ? 649  TYR A CB  1 
ATOM   4931 C  CG  . TYR A 1  649 ? 94.745  96.228  44.737 1.00 53.46  ? 649  TYR A CG  1 
ATOM   4932 C  CD1 . TYR A 1  649 ? 95.780  95.440  44.233 1.00 54.32  ? 649  TYR A CD1 1 
ATOM   4933 C  CD2 . TYR A 1  649 ? 94.794  96.608  46.111 1.00 54.47  ? 649  TYR A CD2 1 
ATOM   4934 C  CE1 . TYR A 1  649 ? 96.867  95.008  45.048 1.00 53.83  ? 649  TYR A CE1 1 
ATOM   4935 C  CE2 . TYR A 1  649 ? 95.862  96.191  46.956 1.00 53.56  ? 649  TYR A CE2 1 
ATOM   4936 C  CZ  . TYR A 1  649 ? 96.897  95.384  46.392 1.00 55.39  ? 649  TYR A CZ  1 
ATOM   4937 O  OH  . TYR A 1  649 ? 97.971  94.938  47.112 1.00 68.07  ? 649  TYR A OH  1 
ATOM   4938 N  N   . THR A 1  650 ? 92.929  93.337  44.695 1.00 55.59  ? 650  THR A N   1 
ATOM   4939 C  CA  . THR A 1  650 ? 92.727  92.508  45.911 1.00 55.81  ? 650  THR A CA  1 
ATOM   4940 C  C   . THR A 1  650 ? 94.076  92.286  46.613 1.00 54.52  ? 650  THR A C   1 
ATOM   4941 O  O   . THR A 1  650 ? 94.983  91.624  46.053 1.00 50.60  ? 650  THR A O   1 
ATOM   4942 C  CB  . THR A 1  650 ? 92.054  91.101  45.644 1.00 56.45  ? 650  THR A CB  1 
ATOM   4943 O  OG1 . THR A 1  650 ? 90.775  91.285  45.011 1.00 57.98  ? 650  THR A OG1 1 
ATOM   4944 C  CG2 . THR A 1  650 ? 91.872  90.344  46.925 1.00 55.59  ? 650  THR A CG2 1 
ATOM   4945 N  N   . GLY A 1  651 ? 94.181  92.885  47.823 1.00 54.10  ? 651  GLY A N   1 
ATOM   4946 C  CA  . GLY A 1  651 ? 95.358  92.769  48.679 1.00 52.31  ? 651  GLY A CA  1 
ATOM   4947 C  C   . GLY A 1  651 ? 95.677  91.345  49.100 1.00 53.85  ? 651  GLY A C   1 
ATOM   4948 O  O   . GLY A 1  651 ? 94.935  90.356  48.797 1.00 52.86  ? 651  GLY A O   1 
ATOM   4949 N  N   . SER A 1  652 ? 96.796  91.186  49.800 1.00 55.42  ? 652  SER A N   1 
ATOM   4950 C  CA  . SER A 1  652 ? 97.223  89.817  50.200 1.00 56.05  ? 652  SER A CA  1 
ATOM   4951 C  C   . SER A 1  652 ? 96.300  89.424  51.355 1.00 55.31  ? 652  SER A C   1 
ATOM   4952 O  O   . SER A 1  652 ? 95.696  90.326  51.967 1.00 53.61  ? 652  SER A O   1 
ATOM   4953 C  CB  . SER A 1  652 ? 98.732  89.765  50.634 1.00 57.13  ? 652  SER A CB  1 
ATOM   4954 O  OG  . SER A 1  652 ? 99.023  90.293  51.962 1.00 69.95  ? 652  SER A OG  1 
ATOM   4955 N  N   . SER A 1  653 ? 96.200  88.114  51.626 1.00 54.89  ? 653  SER A N   1 
ATOM   4956 C  CA  . SER A 1  653 ? 95.370  87.570  52.717 1.00 54.25  ? 653  SER A CA  1 
ATOM   4957 C  C   . SER A 1  653 ? 95.896  86.234  53.183 1.00 53.78  ? 653  SER A C   1 
ATOM   4958 O  O   . SER A 1  653 ? 96.671  85.560  52.488 1.00 51.18  ? 653  SER A O   1 
ATOM   4959 C  CB  . SER A 1  653 ? 93.880  87.389  52.296 1.00 55.22  ? 653  SER A CB  1 
ATOM   4960 O  OG  . SER A 1  653 ? 93.698  86.290  51.381 1.00 56.59  ? 653  SER A OG  1 
ATOM   4961 N  N   . TYR A 1  654 ? 95.448  85.872  54.380 1.00 53.11  ? 654  TYR A N   1 
ATOM   4962 C  CA  . TYR A 1  654 ? 95.823  84.629  54.987 1.00 52.93  ? 654  TYR A CA  1 
ATOM   4963 C  C   . TYR A 1  654 ? 94.951  83.471  54.425 1.00 53.05  ? 654  TYR A C   1 
ATOM   4964 O  O   . TYR A 1  654 ? 93.771  83.655  54.109 1.00 54.06  ? 654  TYR A O   1 
ATOM   4965 C  CB  . TYR A 1  654 ? 95.693  84.784  56.532 1.00 53.39  ? 654  TYR A CB  1 
ATOM   4966 C  CG  . TYR A 1  654 ? 96.742  85.756  57.151 1.00 55.53  ? 654  TYR A CG  1 
ATOM   4967 C  CD1 . TYR A 1  654 ? 96.440  87.107  57.305 1.00 55.25  ? 654  TYR A CD1 1 
ATOM   4968 C  CD2 . TYR A 1  654 ? 98.091  85.341  57.443 1.00 55.04  ? 654  TYR A CD2 1 
ATOM   4969 C  CE1 . TYR A 1  654 ? 97.399  88.035  57.709 1.00 67.31  ? 654  TYR A CE1 1 
ATOM   4970 C  CE2 . TYR A 1  654 ? 99.054  86.250  57.833 1.00 64.65  ? 654  TYR A CE2 1 
ATOM   4971 C  CZ  . TYR A 1  654 ? 98.717  87.623  57.968 1.00 78.46  ? 654  TYR A CZ  1 
ATOM   4972 O  OH  . TYR A 1  654 ? 99.650  88.625  58.323 1.00 68.62  ? 654  TYR A OH  1 
ATOM   4973 N  N   . GLY A 1  655 ? 95.512  82.275  54.288 1.00 52.01  ? 655  GLY A N   1 
ATOM   4974 C  CA  . GLY A 1  655 ? 94.728  81.141  53.792 1.00 50.97  ? 655  GLY A CA  1 
ATOM   4975 C  C   . GLY A 1  655 ? 94.300  80.082  54.796 1.00 50.28  ? 655  GLY A C   1 
ATOM   4976 O  O   . GLY A 1  655 ? 94.063  78.959  54.407 1.00 50.90  ? 655  GLY A O   1 
ATOM   4977 N  N   . ASP A 1  656 ? 94.208  80.431  56.080 1.00 51.16  ? 656  ASP A N   1 
ATOM   4978 C  CA  . ASP A 1  656 ? 93.862  79.496  57.156 1.00 51.10  ? 656  ASP A CA  1 
ATOM   4979 C  C   . ASP A 1  656 ? 93.817  80.267  58.438 1.00 54.00  ? 656  ASP A C   1 
ATOM   4980 O  O   . ASP A 1  656 ? 94.470  81.291  58.551 1.00 54.11  ? 656  ASP A O   1 
ATOM   4981 C  CB  . ASP A 1  656 ? 94.841  78.325  57.252 1.00 52.09  ? 656  ASP A CB  1 
ATOM   4982 C  CG  . ASP A 1  656 ? 96.251  78.695  57.731 1.00 72.02  ? 656  ASP A CG  1 
ATOM   4983 O  OD1 . ASP A 1  656 ? 96.599  79.848  58.092 1.00 56.78  ? 656  ASP A OD1 1 
ATOM   4984 O  OD2 . ASP A 1  656 ? 97.043  77.736  57.749 1.00 63.06  ? 656  ASP A OD2 1 
ATOM   4985 N  N   . PRO A 1  657 ? 93.005  79.820  59.412 1.00 55.95  ? 657  PRO A N   1 
ATOM   4986 C  CA  . PRO A 1  657 ? 92.889  80.546  60.692 1.00 56.77  ? 657  PRO A CA  1 
ATOM   4987 C  C   . PRO A 1  657 ? 94.202  80.666  61.402 1.00 56.56  ? 657  PRO A C   1 
ATOM   4988 O  O   . PRO A 1  657 ? 94.442  81.680  62.048 1.00 57.31  ? 657  PRO A O   1 
ATOM   4989 C  CB  . PRO A 1  657 ? 91.859  79.725  61.511 1.00 57.32  ? 657  PRO A CB  1 
ATOM   4990 C  CG  . PRO A 1  657 ? 91.090  78.991  60.454 1.00 56.83  ? 657  PRO A CG  1 
ATOM   4991 C  CD  . PRO A 1  657 ? 92.162  78.607  59.403 1.00 55.77  ? 657  PRO A CD  1 
ATOM   4992 N  N   . ALA A 1  658 ? 95.035  79.628  61.272 1.00 55.97  ? 658  ALA A N   1 
ATOM   4993 C  CA  . ALA A 1  658 ? 96.392  79.570  61.874 1.00 56.23  ? 658  ALA A CA  1 
ATOM   4994 C  C   . ALA A 1  658 ? 97.286  80.657  61.338 1.00 75.66  ? 658  ALA A C   1 
ATOM   4995 O  O   . ALA A 1  658 ? 98.291  80.986  61.944 1.00 59.41  ? 658  ALA A O   1 
ATOM   4996 C  CB  . ALA A 1  658 ? 97.077  78.254  61.546 1.00 51.28  ? 658  ALA A CB  1 
ATOM   4997 N  N   . ASN A 1  659 ? 96.918  81.180  60.177 1.00 69.33  ? 659  ASN A N   1 
ATOM   4998 C  CA  . ASN A 1  659 ? 97.709  82.165  59.476 1.00 56.85  ? 659  ASN A CA  1 
ATOM   4999 C  C   . ASN A 1  659 ? 99.033  81.444  59.158 1.00 57.09  ? 659  ASN A C   1 
ATOM   5000 O  O   . ASN A 1  659 ? 100.083 82.018  59.179 1.00 57.72  ? 659  ASN A O   1 
ATOM   5001 C  CB  . ASN A 1  659 ? 97.990  83.431  60.319 1.00 54.88  ? 659  ASN A CB  1 
ATOM   5002 C  CG  . ASN A 1  659 ? 96.794  84.345  60.459 1.00 55.87  ? 659  ASN A CG  1 
ATOM   5003 O  OD1 . ASN A 1  659 ? 96.900  85.461  60.938 1.00 58.07  ? 659  ASN A OD1 1 
ATOM   5004 N  ND2 . ASN A 1  659 ? 95.654  83.877  60.061 1.00 55.07  ? 659  ASN A ND2 1 
ATOM   5005 N  N   . SER A 1  660 ? 99.026  80.170  58.866 1.00 67.64  ? 660  SER A N   1 
ATOM   5006 C  CA  . SER A 1  660 ? 100.329 79.613  58.580 1.00 60.38  ? 660  SER A CA  1 
ATOM   5007 C  C   . SER A 1  660 ? 100.850 80.000  57.173 1.00 62.05  ? 660  SER A C   1 
ATOM   5008 O  O   . SER A 1  660 ? 101.988 79.720  56.836 1.00 69.55  ? 660  SER A O   1 
ATOM   5009 C  CB  . SER A 1  660 ? 100.317 78.085  58.731 1.00 62.60  ? 660  SER A CB  1 
ATOM   5010 O  OG  . SER A 1  660 ? 99.980  77.475  57.501 1.00 60.19  ? 660  SER A OG  1 
ATOM   5011 N  N   . PHE A 1  661 ? 100.054 80.619  56.330 1.00 61.85  ? 661  PHE A N   1 
ATOM   5012 C  CA  . PHE A 1  661 ? 100.583 80.974  55.016 1.00 62.03  ? 661  PHE A CA  1 
ATOM   5013 C  C   . PHE A 1  661 ? 99.775  82.104  54.402 1.00 64.45  ? 661  PHE A C   1 
ATOM   5014 O  O   . PHE A 1  661 ? 98.792  82.574  54.981 1.00 62.48  ? 661  PHE A O   1 
ATOM   5015 C  CB  . PHE A 1  661 ? 100.644 79.758  54.065 1.00 60.56  ? 661  PHE A CB  1 
ATOM   5016 C  CG  . PHE A 1  661 ? 99.336  79.312  53.578 1.00 61.29  ? 661  PHE A CG  1 
ATOM   5017 C  CD1 . PHE A 1  661 ? 98.413  78.756  54.444 1.00 69.69  ? 661  PHE A CD1 1 
ATOM   5018 C  CD2 . PHE A 1  661 ? 99.032  79.370  52.225 1.00 72.74  ? 661  PHE A CD2 1 
ATOM   5019 C  CE1 . PHE A 1  661 ? 97.208  78.247  53.966 1.00 59.70  ? 661  PHE A CE1 1 
ATOM   5020 C  CE2 . PHE A 1  661 ? 97.800  78.849  51.732 1.00 65.49  ? 661  PHE A CE2 1 
ATOM   5021 C  CZ  . PHE A 1  661 ? 96.912  78.296  52.585 1.00 66.48  ? 661  PHE A CZ  1 
ATOM   5022 N  N   . LYS A 1  662 ? 100.175 82.562  53.234 1.00 67.16  ? 662  LYS A N   1 
ATOM   5023 C  CA  . LYS A 1  662 ? 99.457  83.686  52.662 1.00 55.70  ? 662  LYS A CA  1 
ATOM   5024 C  C   . LYS A 1  662 ? 99.224  83.588  51.198 1.00 55.87  ? 662  LYS A C   1 
ATOM   5025 O  O   . LYS A 1  662 ? 100.032 83.026  50.443 1.00 71.78  ? 662  LYS A O   1 
ATOM   5026 C  CB  . LYS A 1  662 ? 100.172 85.003  53.006 1.00 56.30  ? 662  LYS A CB  1 
ATOM   5027 C  CG  . LYS A 1  662 ? 100.211 85.216  54.548 1.00 56.12  ? 662  LYS A CG  1 
ATOM   5028 C  CD  . LYS A 1  662 ? 100.649 86.618  54.997 1.00 57.31  ? 662  LYS A CD  1 
ATOM   5029 C  CE  . LYS A 1  662 ? 99.972  87.804  54.295 1.00 59.38  ? 662  LYS A CE  1 
ATOM   5030 N  NZ  . LYS A 1  662 ? 100.361 89.158  54.994 1.00 59.68  ? 662  LYS A NZ  1 
ATOM   5031 N  N   . VAL A 1  663 ? 98.060  84.102  50.814 1.00 54.65  ? 663  VAL A N   1 
ATOM   5032 C  CA  . VAL A 1  663 ? 97.657  84.143  49.431 1.00 53.05  ? 663  VAL A CA  1 
ATOM   5033 C  C   . VAL A 1  663 ? 97.913  85.576  49.033 1.00 53.97  ? 663  VAL A C   1 
ATOM   5034 O  O   . VAL A 1  663 ? 97.520  86.514  49.741 1.00 53.25  ? 663  VAL A O   1 
ATOM   5035 C  CB  . VAL A 1  663 ? 96.216  83.836  49.300 1.00 53.13  ? 663  VAL A CB  1 
ATOM   5036 C  CG1 . VAL A 1  663 ? 95.739  84.226  47.950 1.00 52.27  ? 663  VAL A CG1 1 
ATOM   5037 C  CG2 . VAL A 1  663 ? 96.003  82.297  49.547 1.00 53.57  ? 663  VAL A CG2 1 
ATOM   5038 N  N   . GLY A 1  664 ? 98.558  85.728  47.871 1.00 54.44  ? 664  GLY A N   1 
ATOM   5039 C  CA  . GLY A 1  664 ? 98.933  87.041  47.366 1.00 53.90  ? 664  GLY A CA  1 
ATOM   5040 C  C   . GLY A 1  664 ? 97.970  88.013  46.720 1.00 53.13  ? 664  GLY A C   1 
ATOM   5041 O  O   . GLY A 1  664 ? 96.910  87.625  46.250 1.00 93.77  ? 664  GLY A O   1 
ATOM   5042 N  N   . SER A 1  665 ? 98.359  89.293  46.742 1.00 52.73  ? 665  SER A N   1 
ATOM   5043 C  CA  . SER A 1  665 ? 97.637  90.382  46.120 1.00 51.83  ? 665  SER A CA  1 
ATOM   5044 C  C   . SER A 1  665 ? 97.505  90.049  44.626 1.00 52.40  ? 665  SER A C   1 
ATOM   5045 O  O   . SER A 1  665 ? 98.184  89.168  44.103 1.00 53.82  ? 665  SER A O   1 
ATOM   5046 C  CB  . SER A 1  665 ? 98.418  91.681  46.285 1.00 86.67  ? 665  SER A CB  1 
ATOM   5047 O  OG  . SER A 1  665 ? 99.455  91.766  45.315 1.00 94.21  ? 665  SER A OG  1 
ATOM   5048 N  N   . TYR A 1  666 ? 96.551  90.720  43.982 1.00 53.21  ? 666  TYR A N   1 
ATOM   5049 C  CA  . TYR A 1  666 ? 96.212  90.577  42.569 1.00 52.54  ? 666  TYR A CA  1 
ATOM   5050 C  C   . TYR A 1  666 ? 95.396  91.749  42.097 1.00 88.01  ? 666  TYR A C   1 
ATOM   5051 O  O   . TYR A 1  666 ? 94.714  92.456  42.930 1.00 52.75  ? 666  TYR A O   1 
ATOM   5052 C  CB  . TYR A 1  666 ? 95.416  89.304  42.228 1.00 71.30  ? 666  TYR A CB  1 
ATOM   5053 C  CG  . TYR A 1  666 ? 94.190  88.908  43.074 1.00 66.03  ? 666  TYR A CG  1 
ATOM   5054 C  CD1 . TYR A 1  666 ? 92.945  89.536  42.945 1.00 68.19  ? 666  TYR A CD1 1 
ATOM   5055 C  CD2 . TYR A 1  666 ? 94.259  87.802  43.899 1.00 67.47  ? 666  TYR A CD2 1 
ATOM   5056 C  CE1 . TYR A 1  666 ? 91.808  89.054  43.616 1.00 69.41  ? 666  TYR A CE1 1 
ATOM   5057 C  CE2 . TYR A 1  666 ? 93.150  87.318  44.555 1.00 81.09  ? 666  TYR A CE2 1 
ATOM   5058 C  CZ  . TYR A 1  666 ? 91.918  87.925  44.421 1.00 79.28  ? 666  TYR A CZ  1 
ATOM   5059 O  OH  . TYR A 1  666 ? 90.840  87.306  45.072 1.00 76.94  ? 666  TYR A OH  1 
ATOM   5060 N  N   . THR A 1  667 ? 95.457  91.925  40.763 1.00 55.01  ? 667  THR A N   1 
ATOM   5061 C  CA  . THR A 1  667 ? 94.768  93.009  40.124 1.00 54.62  ? 667  THR A CA  1 
ATOM   5062 C  C   . THR A 1  667 ? 94.256  92.528  38.796 1.00 55.69  ? 667  THR A C   1 
ATOM   5063 O  O   . THR A 1  667 ? 95.001  92.063  37.940 1.00 54.70  ? 667  THR A O   1 
ATOM   5064 C  CB  . THR A 1  667 ? 95.680  94.222  39.951 1.00 55.58  ? 667  THR A CB  1 
ATOM   5065 O  OG1 . THR A 1  667 ? 96.031  94.746  41.243 1.00 66.77  ? 667  THR A OG1 1 
ATOM   5066 C  CG2 . THR A 1  667 ? 94.936  95.330  39.243 1.00 60.29  ? 667  THR A CG2 1 
ATOM   5067 N  N   . VAL A 1  668 ? 92.940  92.598  38.658 1.00 56.35  ? 668  VAL A N   1 
ATOM   5068 C  CA  . VAL A 1  668 ? 92.324  92.135  37.451 1.00 65.56  ? 668  VAL A CA  1 
ATOM   5069 C  C   . VAL A 1  668 ? 91.772  93.338  36.789 1.00 59.63  ? 668  VAL A C   1 
ATOM   5070 O  O   . VAL A 1  668 ? 91.313  94.296  37.451 1.00 62.55  ? 668  VAL A O   1 
ATOM   5071 C  CB  . VAL A 1  668 ? 91.199  91.117  37.680 1.00 54.96  ? 668  VAL A CB  1 
ATOM   5072 C  CG1 . VAL A 1  668 ? 90.426  90.971  36.384 1.00 77.60  ? 668  VAL A CG1 1 
ATOM   5073 C  CG2 . VAL A 1  668 ? 91.785  89.749  37.997 1.00 67.73  ? 668  VAL A CG2 1 
ATOM   5074 N  N   . VAL A 1  669 ? 91.824  93.265  35.471 1.00 58.39  ? 669  VAL A N   1 
ATOM   5075 C  CA  . VAL A 1  669 ? 91.405  94.347  34.614 1.00 62.24  ? 669  VAL A CA  1 
ATOM   5076 C  C   . VAL A 1  669 ? 90.339  93.827  33.727 1.00 63.31  ? 669  VAL A C   1 
ATOM   5077 O  O   . VAL A 1  669 ? 90.478  92.745  33.138 1.00 65.94  ? 669  VAL A O   1 
ATOM   5078 C  CB  . VAL A 1  669 ? 92.587  94.827  33.775 1.00 70.00  ? 669  VAL A CB  1 
ATOM   5079 C  CG1 . VAL A 1  669 ? 92.112  95.487  32.498 1.00 53.41  ? 669  VAL A CG1 1 
ATOM   5080 C  CG2 . VAL A 1  669 ? 93.452  95.775  34.636 1.00 54.17  ? 669  VAL A CG2 1 
ATOM   5081 N  N   . ASP A 1  670 ? 89.270  94.617  33.656 1.00 65.75  ? 670  ASP A N   1 
ATOM   5082 C  CA  . ASP A 1  670 ? 88.081  94.311  32.866 1.00 65.82  ? 670  ASP A CA  1 
ATOM   5083 C  C   . ASP A 1  670 ? 87.842  95.469  31.971 1.00 60.92  ? 670  ASP A C   1 
ATOM   5084 O  O   . ASP A 1  670 ? 88.200  96.638  32.315 1.00 58.76  ? 670  ASP A O   1 
ATOM   5085 C  CB  . ASP A 1  670 ? 86.834  94.160  33.769 1.00 72.16  ? 670  ASP A CB  1 
ATOM   5086 C  CG  . ASP A 1  670 ? 86.900  92.937  34.674 1.00 80.99  ? 670  ASP A CG  1 
ATOM   5087 O  OD1 . ASP A 1  670 ? 87.007  91.790  34.176 1.00 83.06  ? 670  ASP A OD1 1 
ATOM   5088 O  OD2 . ASP A 1  670 ? 86.855  93.131  35.883 1.00 65.14  ? 670  ASP A OD2 1 
ATOM   5089 N  N   . ALA A 1  671 ? 87.231  95.157  30.831 1.00 67.04  ? 671  ALA A N   1 
ATOM   5090 C  CA  . ALA A 1  671 ? 86.868  96.183  29.858 1.00 60.24  ? 671  ALA A CA  1 
ATOM   5091 C  C   . ALA A 1  671 ? 85.785  95.785  28.914 1.00 60.54  ? 671  ALA A C   1 
ATOM   5092 O  O   . ALA A 1  671 ? 85.502  94.584  28.661 1.00 66.63  ? 671  ALA A O   1 
ATOM   5093 C  CB  . ALA A 1  671 ? 88.025  96.560  29.082 1.00 67.99  ? 671  ALA A CB  1 
ATOM   5094 N  N   . LEU A 1  672 ? 85.197  96.826  28.356 1.00 62.90  ? 672  LEU A N   1 
ATOM   5095 C  CA  . LEU A 1  672 ? 84.151  96.638  27.380 1.00 69.26  ? 672  LEU A CA  1 
ATOM   5096 C  C   . LEU A 1  672 ? 84.150  97.718  26.305 1.00 64.39  ? 672  LEU A C   1 
ATOM   5097 O  O   . LEU A 1  672 ? 84.732  98.805  26.442 1.00 58.81  ? 672  LEU A O   1 
ATOM   5098 C  CB  . LEU A 1  672 ? 82.780  96.632  28.071 1.00 64.59  ? 672  LEU A CB  1 
ATOM   5099 C  CG  . LEU A 1  672 ? 82.316  97.887  28.805 1.00 55.34  ? 672  LEU A CG  1 
ATOM   5100 C  CD1 . LEU A 1  672 ? 81.568  98.826  27.837 1.00 55.66  ? 672  LEU A CD1 1 
ATOM   5101 C  CD2 . LEU A 1  672 ? 81.323  97.487  29.894 1.00 80.05  ? 672  LEU A CD2 1 
ATOM   5102 N  N   . VAL A 1  673 ? 83.453  97.388  25.243 1.00 62.72  ? 673  VAL A N   1 
ATOM   5103 C  CA  . VAL A 1  673 ? 83.227  98.286  24.133 1.00 69.82  ? 673  VAL A CA  1 
ATOM   5104 C  C   . VAL A 1  673 ? 81.777  97.947  23.733 1.00 72.95  ? 673  VAL A C   1 
ATOM   5105 O  O   . VAL A 1  673 ? 81.365  96.759  23.494 1.00 57.51  ? 673  VAL A O   1 
ATOM   5106 C  CB  . VAL A 1  673 ? 84.191  98.040  22.974 1.00 74.95  ? 673  VAL A CB  1 
ATOM   5107 C  CG1 . VAL A 1  673 ? 85.639  98.212  23.449 1.00 70.38  ? 673  VAL A CG1 1 
ATOM   5108 C  CG2 . VAL A 1  673 ? 83.970  96.627  22.415 1.00 79.15  ? 673  VAL A CG2 1 
ATOM   5109 N  N   . ARG A 1  674 ? 81.013  99.021  23.715 1.00 67.06  ? 674  ARG A N   1 
ATOM   5110 C  CA  . ARG A 1  674 ? 79.617  98.948  23.457 1.00 75.46  ? 674  ARG A CA  1 
ATOM   5111 C  C   . ARG A 1  674 ? 79.308  99.964  22.381 1.00 79.78  ? 674  ARG A C   1 
ATOM   5112 O  O   . ARG A 1  674 ? 79.854  101.091 22.369 1.00 68.05  ? 674  ARG A O   1 
ATOM   5113 C  CB  . ARG A 1  674 ? 78.879  99.319  24.744 1.00 74.53  ? 674  ARG A CB  1 
ATOM   5114 C  CG  . ARG A 1  674 ? 77.384  99.181  24.703 1.00 70.19  ? 674  ARG A CG  1 
ATOM   5115 C  CD  . ARG A 1  674 ? 76.877  100.065 25.774 1.00 70.70  ? 674  ARG A CD  1 
ATOM   5116 N  NE  . ARG A 1  674 ? 76.025  99.378  26.728 1.00 87.34  ? 674  ARG A NE  1 
ATOM   5117 C  CZ  . ARG A 1  674 ? 74.706  99.303  26.623 1.00 89.16  ? 674  ARG A CZ  1 
ATOM   5118 N  NH1 . ARG A 1  674 ? 74.113  99.880  25.590 1.00 84.32  ? 674  ARG A NH1 1 
ATOM   5119 N  NH2 . ARG A 1  674 ? 73.994  98.665  27.563 1.00 93.36  ? 674  ARG A NH2 1 
ATOM   5120 N  N   . TYR A 1  675 ? 78.430  99.531  21.481 1.00 80.42  ? 675  TYR A N   1 
ATOM   5121 C  CA  . TYR A 1  675 ? 77.959  100.344 20.377 1.00 75.07  ? 675  TYR A CA  1 
ATOM   5122 C  C   . TYR A 1  675 ? 76.422  100.542 20.395 1.00 73.89  ? 675  TYR A C   1 
ATOM   5123 O  O   . TYR A 1  675 ? 75.633  99.592  20.164 1.00 63.40  ? 675  TYR A O   1 
ATOM   5124 C  CB  . TYR A 1  675 ? 78.311  99.693  19.040 1.00 80.37  ? 675  TYR A CB  1 
ATOM   5125 C  CG  . TYR A 1  675 ? 77.984  100.642 17.918 1.00 81.14  ? 675  TYR A CG  1 
ATOM   5126 C  CD1 . TYR A 1  675 ? 78.275  101.977 18.071 1.00 84.91  ? 675  TYR A CD1 1 
ATOM   5127 C  CD2 . TYR A 1  675 ? 77.393  100.224 16.726 1.00 84.10  ? 675  TYR A CD2 1 
ATOM   5128 C  CE1 . TYR A 1  675 ? 77.992  102.878 17.105 1.00 87.88  ? 675  TYR A CE1 1 
ATOM   5129 C  CE2 . TYR A 1  675 ? 77.115  101.134 15.725 1.00 82.48  ? 675  TYR A CE2 1 
ATOM   5130 C  CZ  . TYR A 1  675 ? 77.421  102.470 15.940 1.00 87.42  ? 675  TYR A CZ  1 
ATOM   5131 O  OH  . TYR A 1  675 ? 77.164  103.475 15.046 1.00 87.96  ? 675  TYR A OH  1 
ATOM   5132 N  N   . ASP A 1  676 ? 76.001  101.764 20.661 1.00 54.25  ? 676  ASP A N   1 
ATOM   5133 C  CA  . ASP A 1  676 ? 74.588  102.098 20.650 1.00 66.26  ? 676  ASP A CA  1 
ATOM   5134 C  C   . ASP A 1  676 ? 73.827  101.872 19.302 1.00 71.18  ? 676  ASP A C   1 
ATOM   5135 O  O   . ASP A 1  676 ? 73.461  102.816 18.644 1.00 74.64  ? 676  ASP A O   1 
ATOM   5136 C  CB  . ASP A 1  676 ? 74.457  103.565 21.033 1.00 56.42  ? 676  ASP A CB  1 
ATOM   5137 C  CG  . ASP A 1  676 ? 73.022  104.007 21.175 1.00 68.07  ? 676  ASP A CG  1 
ATOM   5138 O  OD1 . ASP A 1  676 ? 72.058  103.222 20.894 1.00 64.76  ? 676  ASP A OD1 1 
ATOM   5139 O  OD2 . ASP A 1  676 ? 72.871  105.163 21.592 1.00 68.40  ? 676  ASP A OD2 1 
ATOM   5140 N  N   . LEU A 1  677 ? 73.592  100.636 18.895 1.00 77.91  ? 677  LEU A N   1 
ATOM   5141 C  CA  . LEU A 1  677 ? 72.859  100.341 17.687 1.00 75.15  ? 677  LEU A CA  1 
ATOM   5142 C  C   . LEU A 1  677 ? 71.940  101.464 17.177 1.00 87.16  ? 677  LEU A C   1 
ATOM   5143 O  O   . LEU A 1  677 ? 71.746  101.590 15.960 1.00 92.95  ? 677  LEU A O   1 
ATOM   5144 C  CB  . LEU A 1  677 ? 72.027  99.115  17.945 1.00 64.76  ? 677  LEU A CB  1 
ATOM   5145 C  CG  . LEU A 1  677 ? 72.230  98.039  16.935 1.00 66.68  ? 677  LEU A CG  1 
ATOM   5146 C  CD1 . LEU A 1  677 ? 73.675  98.074  16.508 1.00 67.23  ? 677  LEU A CD1 1 
ATOM   5147 C  CD2 . LEU A 1  677 ? 71.849  96.683  17.565 1.00 71.35  ? 677  LEU A CD2 1 
ATOM   5148 N  N   . ALA A 1  678 ? 71.359  102.247 18.098 1.00 88.94  ? 678  ALA A N   1 
ATOM   5149 C  CA  . ALA A 1  678 ? 70.436  103.357 17.777 1.00 96.66  ? 678  ALA A CA  1 
ATOM   5150 C  C   . ALA A 1  678 ? 70.607  103.813 16.334 1.00 100.21 ? 678  ALA A C   1 
ATOM   5151 O  O   . ALA A 1  678 ? 69.736  103.642 15.477 1.00 110.06 ? 678  ALA A O   1 
ATOM   5152 C  CB  . ALA A 1  678 ? 70.683  104.559 18.728 1.00 87.01  ? 678  ALA A CB  1 
ATOM   5153 N  N   . ARG A 1  679 ? 71.768  104.398 16.102 1.00 102.38 ? 679  ARG A N   1 
ATOM   5154 C  CA  . ARG A 1  679 ? 72.212  104.933 14.830 1.00 98.66  ? 679  ARG A CA  1 
ATOM   5155 C  C   . ARG A 1  679 ? 72.043  104.101 13.540 1.00 94.51  ? 679  ARG A C   1 
ATOM   5156 O  O   . ARG A 1  679 ? 72.669  104.431 12.561 1.00 90.71  ? 679  ARG A O   1 
ATOM   5157 C  CB  . ARG A 1  679 ? 73.676  105.300 15.014 1.00 96.20  ? 679  ARG A CB  1 
ATOM   5158 C  CG  . ARG A 1  679 ? 74.000  105.632 16.447 1.00 104.31 ? 679  ARG A CG  1 
ATOM   5159 C  CD  . ARG A 1  679 ? 75.466  105.836 16.662 1.00 117.52 ? 679  ARG A CD  1 
ATOM   5160 N  NE  . ARG A 1  679 ? 75.967  107.067 16.032 1.00 137.40 ? 679  ARG A NE  1 
ATOM   5161 C  CZ  . ARG A 1  679 ? 76.195  107.230 14.720 1.00 143.98 ? 679  ARG A CZ  1 
ATOM   5162 N  NH1 . ARG A 1  679 ? 75.966  106.227 13.878 1.00 151.18 ? 679  ARG A NH1 1 
ATOM   5163 N  NH2 . ARG A 1  679 ? 76.659  108.393 14.232 1.00 142.30 ? 679  ARG A NH2 1 
ATOM   5164 N  N   . VAL A 1  680 ? 71.245  103.033 13.547 1.00 91.22  ? 680  VAL A N   1 
ATOM   5165 C  CA  . VAL A 1  680 ? 70.992  102.181 12.370 1.00 92.11  ? 680  VAL A CA  1 
ATOM   5166 C  C   . VAL A 1  680 ? 69.486  101.959 12.486 1.00 94.43  ? 680  VAL A C   1 
ATOM   5167 O  O   . VAL A 1  680 ? 68.912  100.965 11.991 1.00 96.91  ? 680  VAL A O   1 
ATOM   5168 C  CB  . VAL A 1  680 ? 71.743  100.797 12.428 1.00 96.07  ? 680  VAL A CB  1 
ATOM   5169 C  CG1 . VAL A 1  680 ? 71.471  99.953  11.156 1.00 90.11  ? 680  VAL A CG1 1 
ATOM   5170 C  CG2 . VAL A 1  680 ? 73.221  101.030 12.573 1.00 95.83  ? 680  VAL A CG2 1 
ATOM   5171 N  N   . GLY A 1  681 ? 68.862  102.925 13.162 1.00 92.27  ? 681  GLY A N   1 
ATOM   5172 C  CA  . GLY A 1  681 ? 67.426  102.908 13.383 1.00 90.88  ? 681  GLY A CA  1 
ATOM   5173 C  C   . GLY A 1  681 ? 67.053  102.291 14.711 1.00 93.26  ? 681  GLY A C   1 
ATOM   5174 O  O   . GLY A 1  681 ? 66.389  102.902 15.561 1.00 95.94  ? 681  GLY A O   1 
ATOM   5175 N  N   . MET A 1  682 ? 67.498  101.053 14.872 1.00 94.13  ? 682  MET A N   1 
ATOM   5176 C  CA  . MET A 1  682 ? 67.261  100.280 16.062 1.00 92.25  ? 682  MET A CA  1 
ATOM   5177 C  C   . MET A 1  682 ? 67.680  101.071 17.298 1.00 90.32  ? 682  MET A C   1 
ATOM   5178 O  O   . MET A 1  682 ? 68.745  100.835 17.844 1.00 96.32  ? 682  MET A O   1 
ATOM   5179 C  CB  . MET A 1  682 ? 68.066  98.999  15.948 1.00 85.81  ? 682  MET A CB  1 
ATOM   5180 C  CG  . MET A 1  682 ? 67.563  98.096  14.881 1.00 90.02  ? 682  MET A CG  1 
ATOM   5181 S  SD  . MET A 1  682 ? 68.567  96.601  14.715 1.00 100.24 ? 682  MET A SD  1 
ATOM   5182 C  CE  . MET A 1  682 ? 69.745  97.136  13.456 1.00 104.93 ? 682  MET A CE  1 
ATOM   5183 N  N   . ALA A 1  683 ? 66.876  102.023 17.739 1.00 86.62  ? 683  ALA A N   1 
ATOM   5184 C  CA  . ALA A 1  683 ? 67.281  102.753 18.920 1.00 84.23  ? 683  ALA A CA  1 
ATOM   5185 C  C   . ALA A 1  683 ? 66.825  101.945 20.113 1.00 85.53  ? 683  ALA A C   1 
ATOM   5186 O  O   . ALA A 1  683 ? 65.782  101.216 20.058 1.00 75.86  ? 683  ALA A O   1 
ATOM   5187 C  CB  . ALA A 1  683 ? 66.676  104.140 18.969 1.00 86.46  ? 683  ALA A CB  1 
ATOM   5188 N  N   . GLY A 1  684 ? 67.632  102.095 21.177 1.00 84.88  ? 684  GLY A N   1 
ATOM   5189 C  CA  . GLY A 1  684 ? 67.433  101.385 22.425 1.00 72.38  ? 684  GLY A CA  1 
ATOM   5190 C  C   . GLY A 1  684 ? 68.107  100.032 22.340 1.00 69.33  ? 684  GLY A C   1 
ATOM   5191 O  O   . GLY A 1  684 ? 68.156  99.325  23.321 1.00 70.12  ? 684  GLY A O   1 
ATOM   5192 N  N   . SER A 1  685 ? 68.601  99.655  21.158 1.00 68.07  ? 685  SER A N   1 
ATOM   5193 C  CA  . SER A 1  685 ? 69.270  98.376  20.996 1.00 59.25  ? 685  SER A CA  1 
ATOM   5194 C  C   . SER A 1  685 ? 70.731  98.687  21.056 1.00 66.17  ? 685  SER A C   1 
ATOM   5195 O  O   . SER A 1  685 ? 71.120  99.847  21.006 1.00 67.02  ? 685  SER A O   1 
ATOM   5196 C  CB  . SER A 1  685 ? 68.909  97.726  19.678 1.00 65.62  ? 685  SER A CB  1 
ATOM   5197 O  OG  . SER A 1  685 ? 67.500  97.540  19.608 1.00 79.64  ? 685  SER A OG  1 
ATOM   5198 N  N   . ASN A 1  686 ? 71.536  97.662  21.259 1.00 58.57  ? 686  ASN A N   1 
ATOM   5199 C  CA  . ASN A 1  686 ? 72.959  97.834  21.333 1.00 54.06  ? 686  ASN A CA  1 
ATOM   5200 C  C   . ASN A 1  686 ? 73.638  96.526  21.246 1.00 59.76  ? 686  ASN A C   1 
ATOM   5201 O  O   . ASN A 1  686 ? 73.065  95.444  21.477 1.00 55.17  ? 686  ASN A O   1 
ATOM   5202 C  CB  . ASN A 1  686 ? 73.425  98.510  22.619 1.00 67.51  ? 686  ASN A CB  1 
ATOM   5203 C  CG  . ASN A 1  686 ? 73.161  97.671  23.872 1.00 75.64  ? 686  ASN A CG  1 
ATOM   5204 O  OD1 . ASN A 1  686 ? 72.080  97.757  24.472 1.00 77.15  ? 686  ASN A OD1 1 
ATOM   5205 N  ND2 . ASN A 1  686 ? 74.148  96.873  24.278 1.00 58.27  ? 686  ASN A ND2 1 
ATOM   5206 N  N   . VAL A 1  687 ? 74.897  96.645  20.908 1.00 57.27  ? 687  VAL A N   1 
ATOM   5207 C  CA  . VAL A 1  687 ? 75.720  95.492  20.749 1.00 66.23  ? 687  VAL A CA  1 
ATOM   5208 C  C   . VAL A 1  687 ? 76.903  95.734  21.623 1.00 62.96  ? 687  VAL A C   1 
ATOM   5209 O  O   . VAL A 1  687 ? 77.367  96.898  21.755 1.00 68.75  ? 687  VAL A O   1 
ATOM   5210 C  CB  . VAL A 1  687 ? 76.112  95.360  19.288 1.00 59.46  ? 687  VAL A CB  1 
ATOM   5211 C  CG1 . VAL A 1  687 ? 77.306  94.514  19.155 1.00 60.16  ? 687  VAL A CG1 1 
ATOM   5212 C  CG2 . VAL A 1  687 ? 74.949  94.699  18.542 1.00 69.42  ? 687  VAL A CG2 1 
ATOM   5213 N  N   . ALA A 1  688 ? 77.367  94.681  22.286 1.00 59.55  ? 688  ALA A N   1 
ATOM   5214 C  CA  . ALA A 1  688 ? 78.546  94.872  23.156 1.00 69.98  ? 688  ALA A CA  1 
ATOM   5215 C  C   . ALA A 1  688 ? 79.516  93.720  23.227 1.00 58.43  ? 688  ALA A C   1 
ATOM   5216 O  O   . ALA A 1  688 ? 79.195  92.537  22.972 1.00 64.09  ? 688  ALA A O   1 
ATOM   5217 C  CB  . ALA A 1  688 ? 78.154  95.283  24.589 1.00 58.19  ? 688  ALA A CB  1 
ATOM   5218 N  N   . LEU A 1  689 ? 80.739  94.094  23.556 1.00 58.60  ? 689  LEU A N   1 
ATOM   5219 C  CA  . LEU A 1  689 ? 81.780  93.107  23.686 1.00 58.05  ? 689  LEU A CA  1 
ATOM   5220 C  C   . LEU A 1  689 ? 82.428  93.316  25.079 1.00 57.64  ? 689  LEU A C   1 
ATOM   5221 O  O   . LEU A 1  689 ? 82.887  94.450  25.405 1.00 53.20  ? 689  LEU A O   1 
ATOM   5222 C  CB  . LEU A 1  689 ? 82.805  93.323  22.588 1.00 58.01  ? 689  LEU A CB  1 
ATOM   5223 C  CG  . LEU A 1  689 ? 83.809  92.206  22.661 1.00 59.14  ? 689  LEU A CG  1 
ATOM   5224 C  CD1 . LEU A 1  689 ? 83.138  90.951  22.120 1.00 57.89  ? 689  LEU A CD1 1 
ATOM   5225 C  CD2 . LEU A 1  689 ? 85.083  92.604  21.927 1.00 59.66  ? 689  LEU A CD2 1 
ATOM   5226 N  N   . HIS A 1  690 ? 82.427  92.244  25.902 1.00 58.52  ? 690  HIS A N   1 
ATOM   5227 C  CA  . HIS A 1  690 ? 83.031  92.332  27.282 1.00 59.01  ? 690  HIS A CA  1 
ATOM   5228 C  C   . HIS A 1  690 ? 84.174  91.340  27.521 1.00 58.93  ? 690  HIS A C   1 
ATOM   5229 O  O   . HIS A 1  690 ? 84.109  90.138  27.135 1.00 60.44  ? 690  HIS A O   1 
ATOM   5230 C  CB  . HIS A 1  690 ? 82.017  92.064  28.374 1.00 57.61  ? 690  HIS A CB  1 
ATOM   5231 C  CG  . HIS A 1  690 ? 80.823  92.958  28.357 1.00 71.55  ? 690  HIS A CG  1 
ATOM   5232 N  ND1 . HIS A 1  690 ? 80.670  94.001  29.255 1.00 62.36  ? 690  HIS A ND1 1 
ATOM   5233 C  CD2 . HIS A 1  690 ? 79.663  92.870  27.657 1.00 53.52  ? 690  HIS A CD2 1 
ATOM   5234 C  CE1 . HIS A 1  690 ? 79.455  94.511  29.128 1.00 61.72  ? 690  HIS A CE1 1 
ATOM   5235 N  NE2 . HIS A 1  690 ? 78.830  93.846  28.172 1.00 80.94  ? 690  HIS A NE2 1 
ATOM   5236 N  N   . VAL A 1  691 ? 85.230  91.844  28.131 1.00 58.11  ? 691  VAL A N   1 
ATOM   5237 C  CA  . VAL A 1  691 ? 86.337  90.964  28.405 1.00 58.94  ? 691  VAL A CA  1 
ATOM   5238 C  C   . VAL A 1  691 ? 86.659  91.142  29.845 1.00 59.25  ? 691  VAL A C   1 
ATOM   5239 O  O   . VAL A 1  691 ? 86.954  92.293  30.286 1.00 59.06  ? 691  VAL A O   1 
ATOM   5240 C  CB  . VAL A 1  691 ? 87.634  91.362  27.728 1.00 59.32  ? 691  VAL A CB  1 
ATOM   5241 C  CG1 . VAL A 1  691 ? 88.658  90.328  28.055 1.00 58.11  ? 691  VAL A CG1 1 
ATOM   5242 C  CG2 . VAL A 1  691 ? 87.458  91.476  26.227 1.00 59.43  ? 691  VAL A CG2 1 
ATOM   5243 N  N   . ASN A 1  692 ? 86.646  90.032  30.573 1.00 57.41  ? 692  ASN A N   1 
ATOM   5244 C  CA  . ASN A 1  692 ? 86.993  90.131  31.981 1.00 57.24  ? 692  ASN A CA  1 
ATOM   5245 C  C   . ASN A 1  692 ? 88.279  89.420  32.110 1.00 57.42  ? 692  ASN A C   1 
ATOM   5246 O  O   . ASN A 1  692 ? 88.461  88.357  31.504 1.00 56.74  ? 692  ASN A O   1 
ATOM   5247 C  CB  . ASN A 1  692 ? 85.995  89.448  32.895 1.00 58.05  ? 692  ASN A CB  1 
ATOM   5248 C  CG  . ASN A 1  692 ? 84.673  90.085  32.839 1.00 58.27  ? 692  ASN A CG  1 
ATOM   5249 O  OD1 . ASN A 1  692 ? 84.561  91.310  32.879 1.00 76.80  ? 692  ASN A OD1 1 
ATOM   5250 N  ND2 . ASN A 1  692 ? 83.651  89.276  32.725 1.00 59.11  ? 692  ASN A ND2 1 
ATOM   5251 N  N   . ASN A 1  693 ? 89.125  90.030  32.942 1.00 57.29  ? 693  ASN A N   1 
ATOM   5252 C  CA  . ASN A 1  693 ? 90.469  89.617  33.221 1.00 69.33  ? 693  ASN A CA  1 
ATOM   5253 C  C   . ASN A 1  693 ? 91.174  89.603  31.864 1.00 70.55  ? 693  ASN A C   1 
ATOM   5254 O  O   . ASN A 1  693 ? 91.603  88.560  31.292 1.00 58.40  ? 693  ASN A O   1 
ATOM   5255 C  CB  . ASN A 1  693 ? 90.501  88.276  33.902 1.00 58.29  ? 693  ASN A CB  1 
ATOM   5256 C  CG  . ASN A 1  693 ? 91.888  87.811  34.104 1.00 66.59  ? 693  ASN A CG  1 
ATOM   5257 O  OD1 . ASN A 1  693 ? 92.824  88.633  34.058 1.00 57.57  ? 693  ASN A OD1 1 
ATOM   5258 N  ND2 . ASN A 1  693 ? 92.064  86.502  34.323 1.00 55.51  ? 693  ASN A ND2 1 
ATOM   5259 N  N   . LEU A 1  694 ? 91.232  90.834  31.374 1.00 64.47  ? 694  LEU A N   1 
ATOM   5260 C  CA  . LEU A 1  694 ? 91.798  91.216  30.106 1.00 70.68  ? 694  LEU A CA  1 
ATOM   5261 C  C   . LEU A 1  694 ? 93.172  90.633  29.862 1.00 72.50  ? 694  LEU A C   1 
ATOM   5262 O  O   . LEU A 1  694 ? 93.444  90.092  28.781 1.00 68.50  ? 694  LEU A O   1 
ATOM   5263 C  CB  . LEU A 1  694 ? 91.880  92.704  30.122 1.00 70.68  ? 694  LEU A CB  1 
ATOM   5264 C  CG  . LEU A 1  694 ? 92.546  93.359  28.949 1.00 77.88  ? 694  LEU A CG  1 
ATOM   5265 C  CD1 . LEU A 1  694 ? 91.941  92.868  27.599 1.00 68.62  ? 694  LEU A CD1 1 
ATOM   5266 C  CD2 . LEU A 1  694 ? 92.347  94.871  29.219 1.00 55.43  ? 694  LEU A CD2 1 
ATOM   5267 N  N   . PHE A 1  695 ? 94.023  90.761  30.880 1.00 68.85  ? 695  PHE A N   1 
ATOM   5268 C  CA  . PHE A 1  695 ? 95.372  90.244  30.828 1.00 67.63  ? 695  PHE A CA  1 
ATOM   5269 C  C   . PHE A 1  695 ? 95.437  88.767  31.178 1.00 59.01  ? 695  PHE A C   1 
ATOM   5270 O  O   . PHE A 1  695 ? 96.495  88.291  31.546 1.00 68.28  ? 695  PHE A O   1 
ATOM   5271 C  CB  . PHE A 1  695 ? 96.273  91.008  31.793 1.00 60.57  ? 695  PHE A CB  1 
ATOM   5272 C  CG  . PHE A 1  695 ? 96.351  92.484  31.524 1.00 67.58  ? 695  PHE A CG  1 
ATOM   5273 C  CD1 . PHE A 1  695 ? 96.393  92.973  30.234 1.00 78.33  ? 695  PHE A CD1 1 
ATOM   5274 C  CD2 . PHE A 1  695 ? 96.428  93.382  32.559 1.00 75.19  ? 695  PHE A CD2 1 
ATOM   5275 C  CE1 . PHE A 1  695 ? 96.509  94.336  29.975 1.00 80.47  ? 695  PHE A CE1 1 
ATOM   5276 C  CE2 . PHE A 1  695 ? 96.547  94.760  32.324 1.00 80.99  ? 695  PHE A CE2 1 
ATOM   5277 C  CZ  . PHE A 1  695 ? 96.586  95.234  31.030 1.00 83.86  ? 695  PHE A CZ  1 
ATOM   5278 N  N   . ASP A 1  696 ? 94.336  88.038  31.039 1.00 59.52  ? 696  ASP A N   1 
ATOM   5279 C  CA  . ASP A 1  696 ? 94.303  86.613  31.421 1.00 63.95  ? 696  ASP A CA  1 
ATOM   5280 C  C   . ASP A 1  696 ? 95.273  86.228  32.565 1.00 69.97  ? 696  ASP A C   1 
ATOM   5281 O  O   . ASP A 1  696 ? 95.966  85.226  32.489 1.00 72.18  ? 696  ASP A O   1 
ATOM   5282 C  CB  . ASP A 1  696 ? 94.564  85.689  30.226 1.00 56.80  ? 696  ASP A CB  1 
ATOM   5283 C  CG  . ASP A 1  696 ? 94.122  84.273  30.483 1.00 61.72  ? 696  ASP A CG  1 
ATOM   5284 O  OD1 . ASP A 1  696 ? 93.986  83.885  31.671 1.00 76.57  ? 696  ASP A OD1 1 
ATOM   5285 O  OD2 . ASP A 1  696 ? 93.900  83.531  29.503 1.00 76.44  ? 696  ASP A OD2 1 
ATOM   5286 N  N   . ARG A 1  697 ? 95.337  87.024  33.624 1.00 57.12  ? 697  ARG A N   1 
ATOM   5287 C  CA  . ARG A 1  697 ? 96.173  86.700  34.767 1.00 51.72  ? 697  ARG A CA  1 
ATOM   5288 C  C   . ARG A 1  697 ? 95.842  85.362  35.471 1.00 55.16  ? 697  ARG A C   1 
ATOM   5289 O  O   . ARG A 1  697 ? 94.728  84.875  35.366 1.00 74.00  ? 697  ARG A O   1 
ATOM   5290 C  CB  . ARG A 1  697 ? 96.073  87.852  35.728 1.00 51.94  ? 697  ARG A CB  1 
ATOM   5291 C  CG  . ARG A 1  697 ? 96.645  87.605  36.965 1.00 49.79  ? 697  ARG A CG  1 
ATOM   5292 C  CD  . ARG A 1  697 ? 97.055  88.890  37.566 1.00 62.00  ? 697  ARG A CD  1 
ATOM   5293 N  NE  . ARG A 1  697 ? 98.031  88.617  38.627 1.00 76.09  ? 697  ARG A NE  1 
ATOM   5294 C  CZ  . ARG A 1  697 ? 98.562  89.546  39.414 1.00 81.26  ? 697  ARG A CZ  1 
ATOM   5295 N  NH1 . ARG A 1  697 ? 98.215  90.837  39.272 1.00 65.97  ? 697  ARG A NH1 1 
ATOM   5296 N  NH2 . ARG A 1  697 ? 99.438  89.182  40.354 1.00 90.92  ? 697  ARG A NH2 1 
ATOM   5297 N  N   . GLU A 1  698 ? 96.837  84.724  36.096 1.00 64.98  ? 698  GLU A N   1 
ATOM   5298 C  CA  . GLU A 1  698 ? 96.653  83.451  36.821 1.00 62.97  ? 698  GLU A CA  1 
ATOM   5299 C  C   . GLU A 1  698 ? 96.784  83.841  38.305 1.00 65.15  ? 698  GLU A C   1 
ATOM   5300 O  O   . GLU A 1  698 ? 97.858  84.259  38.738 1.00 63.14  ? 698  GLU A O   1 
ATOM   5301 C  CB  . GLU A 1  698 ? 97.752  82.370  36.505 1.00 65.29  ? 698  GLU A CB  1 
ATOM   5302 C  CG  . GLU A 1  698 ? 97.406  81.150  35.477 1.00 79.68  ? 698  GLU A CG  1 
ATOM   5303 C  CD  . GLU A 1  698 ? 98.319  79.759  35.536 1.00 93.31  ? 698  GLU A CD  1 
ATOM   5304 O  OE1 . GLU A 1  698 ? 98.938  79.347  36.621 1.00 71.67  ? 698  GLU A OE1 1 
ATOM   5305 O  OE2 . GLU A 1  698 ? 98.341  79.063  34.442 1.00 77.97  ? 698  GLU A OE2 1 
ATOM   5306 N  N   . TYR A 1  699 ? 95.715  83.741  39.088 1.00 62.90  ? 699  TYR A N   1 
ATOM   5307 C  CA  . TYR A 1  699 ? 95.828  84.059  40.515 1.00 52.59  ? 699  TYR A CA  1 
ATOM   5308 C  C   . TYR A 1  699 ? 94.989  83.072  41.300 1.00 70.60  ? 699  TYR A C   1 
ATOM   5309 O  O   . TYR A 1  699 ? 94.170  82.357  40.726 1.00 61.04  ? 699  TYR A O   1 
ATOM   5310 C  CB  . TYR A 1  699 ? 95.353  85.493  40.833 1.00 52.10  ? 699  TYR A CB  1 
ATOM   5311 C  CG  . TYR A 1  699 ? 93.926  85.769  40.475 1.00 67.17  ? 699  TYR A CG  1 
ATOM   5312 C  CD1 . TYR A 1  699 ? 93.496  85.771  39.139 1.00 65.49  ? 699  TYR A CD1 1 
ATOM   5313 C  CD2 . TYR A 1  699 ? 93.004  86.082  41.464 1.00 72.26  ? 699  TYR A CD2 1 
ATOM   5314 C  CE1 . TYR A 1  699 ? 92.169  86.092  38.819 1.00 70.44  ? 699  TYR A CE1 1 
ATOM   5315 C  CE2 . TYR A 1  699 ? 91.694  86.412  41.156 1.00 56.77  ? 699  TYR A CE2 1 
ATOM   5316 C  CZ  . TYR A 1  699 ? 91.278  86.431  39.844 1.00 55.93  ? 699  TYR A CZ  1 
ATOM   5317 O  OH  . TYR A 1  699 ? 90.034  86.934  39.555 1.00 59.10  ? 699  TYR A OH  1 
ATOM   5318 N  N   . VAL A 1  700 ? 95.214  83.017  42.614 1.00 54.81  ? 700  VAL A N   1 
ATOM   5319 C  CA  . VAL A 1  700 ? 94.467  82.124  43.473 1.00 53.14  ? 700  VAL A CA  1 
ATOM   5320 C  C   . VAL A 1  700 ? 93.639  83.157  44.183 1.00 55.72  ? 700  VAL A C   1 
ATOM   5321 O  O   . VAL A 1  700 ? 94.162  84.113  44.705 1.00 63.03  ? 700  VAL A O   1 
ATOM   5322 C  CB  . VAL A 1  700 ? 95.419  81.326  44.405 1.00 53.19  ? 700  VAL A CB  1 
ATOM   5323 C  CG1 . VAL A 1  700 ? 94.654  80.808  45.689 1.00 48.94  ? 700  VAL A CG1 1 
ATOM   5324 C  CG2 . VAL A 1  700 ? 96.014  80.159  43.627 1.00 46.29  ? 700  VAL A CG2 1 
ATOM   5325 N  N   . ALA A 1  701 ? 92.320  82.981  44.124 1.00 57.14  ? 701  ALA A N   1 
ATOM   5326 C  CA  . ALA A 1  701 ? 91.354  83.922  44.680 1.00 57.11  ? 701  ALA A CA  1 
ATOM   5327 C  C   . ALA A 1  701 ? 91.531  84.102  46.157 1.00 58.37  ? 701  ALA A C   1 
ATOM   5328 O  O   . ALA A 1  701 ? 91.630  85.248  46.672 1.00 62.48  ? 701  ALA A O   1 
ATOM   5329 C  CB  . ALA A 1  701 ? 89.969  83.424  44.386 1.00 54.08  ? 701  ALA A CB  1 
ATOM   5330 N  N   . SER A 1  702 ? 91.537  82.948  46.827 1.00 56.43  ? 702  SER A N   1 
ATOM   5331 C  CA  . SER A 1  702 ? 91.697  82.901  48.241 1.00 54.18  ? 702  SER A CA  1 
ATOM   5332 C  C   . SER A 1  702 ? 91.764  81.439  48.622 1.00 53.58  ? 702  SER A C   1 
ATOM   5333 O  O   . SER A 1  702 ? 91.660  80.533  47.742 1.00 53.23  ? 702  SER A O   1 
ATOM   5334 C  CB  . SER A 1  702 ? 90.500  83.585  48.897 1.00 56.06  ? 702  SER A CB  1 
ATOM   5335 O  OG  . SER A 1  702 ? 89.387  82.728  49.156 1.00 58.99  ? 702  SER A OG  1 
ATOM   5336 N  N   . CYS A 1  703 ? 91.978  81.219  49.922 1.00 52.30  ? 703  CYS A N   1 
ATOM   5337 C  CA  . CYS A 1  703 ? 92.009  79.880  50.513 1.00 53.31  ? 703  CYS A CA  1 
ATOM   5338 C  C   . CYS A 1  703 ? 91.345  80.033  51.864 1.00 52.23  ? 703  CYS A C   1 
ATOM   5339 O  O   . CYS A 1  703 ? 91.513  81.045  52.496 1.00 50.42  ? 703  CYS A O   1 
ATOM   5340 C  CB  . CYS A 1  703 ? 93.437  79.328  50.742 1.00 53.38  ? 703  CYS A CB  1 
ATOM   5341 S  SG  . CYS A 1  703 ? 94.475  79.229  49.268 1.00 52.87  ? 703  CYS A SG  1 
ATOM   5342 N  N   . PHE A 1  704 ? 90.570  79.040  52.300 1.00 51.74  ? 704  PHE A N   1 
ATOM   5343 C  CA  . PHE A 1  704 ? 89.931  79.203  53.594 1.00 51.45  ? 704  PHE A CA  1 
ATOM   5344 C  C   . PHE A 1  704 ? 90.694  78.349  54.512 1.00 53.28  ? 704  PHE A C   1 
ATOM   5345 O  O   . PHE A 1  704 ? 90.541  78.465  55.711 1.00 55.49  ? 704  PHE A O   1 
ATOM   5346 C  CB  . PHE A 1  704 ? 88.445  78.834  53.582 1.00 46.16  ? 704  PHE A CB  1 
ATOM   5347 C  CG  . PHE A 1  704 ? 88.167  77.406  53.348 1.00 43.03  ? 704  PHE A CG  1 
ATOM   5348 C  CD1 . PHE A 1  704 ? 88.247  76.505  54.379 1.00 41.68  ? 704  PHE A CD1 1 
ATOM   5349 C  CD2 . PHE A 1  704 ? 87.915  76.931  52.047 1.00 44.22  ? 704  PHE A CD2 1 
ATOM   5350 C  CE1 . PHE A 1  704 ? 88.112  75.152  54.143 1.00 39.89  ? 704  PHE A CE1 1 
ATOM   5351 C  CE2 . PHE A 1  704 ? 87.779  75.575  51.797 1.00 41.88  ? 704  PHE A CE2 1 
ATOM   5352 C  CZ  . PHE A 1  704 ? 87.888  74.674  52.859 1.00 42.37  ? 704  PHE A CZ  1 
ATOM   5353 N  N   . ASN A 1  705 ? 91.522  77.488  53.934 1.00 54.43  ? 705  ASN A N   1 
ATOM   5354 C  CA  . ASN A 1  705 ? 92.436  76.606  54.689 1.00 56.30  ? 705  ASN A CA  1 
ATOM   5355 C  C   . ASN A 1  705 ? 93.504  75.980  53.765 1.00 55.34  ? 705  ASN A C   1 
ATOM   5356 O  O   . ASN A 1  705 ? 93.341  76.022  52.560 1.00 56.50  ? 705  ASN A O   1 
ATOM   5357 C  CB  . ASN A 1  705 ? 91.685  75.473  55.443 1.00 57.27  ? 705  ASN A CB  1 
ATOM   5358 C  CG  . ASN A 1  705 ? 92.438  75.033  56.723 1.00 59.53  ? 705  ASN A CG  1 
ATOM   5359 O  OD1 . ASN A 1  705 ? 93.697  75.028  56.792 1.00 58.75  ? 705  ASN A OD1 1 
ATOM   5360 N  ND2 . ASN A 1  705 ? 91.679  74.670  57.725 1.00 60.01  ? 705  ASN A ND2 1 
ATOM   5361 N  N   . THR A 1  706 ? 94.546  75.355  54.315 1.00 54.80  ? 706  THR A N   1 
ATOM   5362 C  CA  . THR A 1  706 ? 95.602  74.743  53.480 1.00 54.70  ? 706  THR A CA  1 
ATOM   5363 C  C   . THR A 1  706 ? 95.154  73.726  52.401 1.00 55.61  ? 706  THR A C   1 
ATOM   5364 O  O   . THR A 1  706 ? 95.833  73.522  51.379 1.00 73.34  ? 706  THR A O   1 
ATOM   5365 C  CB  . THR A 1  706 ? 96.661  74.098  54.338 1.00 54.05  ? 706  THR A CB  1 
ATOM   5366 O  OG1 . THR A 1  706 ? 96.093  72.992  54.989 1.00 56.38  ? 706  THR A OG1 1 
ATOM   5367 C  CG2 . THR A 1  706 ? 97.175  75.053  55.372 1.00 52.77  ? 706  THR A CG2 1 
ATOM   5368 N  N   . TYR A 1  707 ? 94.008  73.102  52.621 1.00 54.70  ? 707  TYR A N   1 
ATOM   5369 C  CA  . TYR A 1  707 ? 93.463  72.195  51.653 1.00 54.64  ? 707  TYR A CA  1 
ATOM   5370 C  C   . TYR A 1  707 ? 92.241  72.820  50.882 1.00 55.71  ? 707  TYR A C   1 
ATOM   5371 O  O   . TYR A 1  707 ? 91.672  72.153  50.041 1.00 58.42  ? 707  TYR A O   1 
ATOM   5372 C  CB  . TYR A 1  707 ? 93.074  70.926  52.359 1.00 52.02  ? 707  TYR A CB  1 
ATOM   5373 C  CG  . TYR A 1  707 ? 92.238  71.224  53.553 1.00 52.39  ? 707  TYR A CG  1 
ATOM   5374 C  CD1 . TYR A 1  707 ? 90.851  71.421  53.422 1.00 51.94  ? 707  TYR A CD1 1 
ATOM   5375 C  CD2 . TYR A 1  707 ? 92.817  71.355  54.814 1.00 51.04  ? 707  TYR A CD2 1 
ATOM   5376 C  CE1 . TYR A 1  707 ? 90.031  71.735  54.544 1.00 51.12  ? 707  TYR A CE1 1 
ATOM   5377 C  CE2 . TYR A 1  707 ? 92.053  71.673  55.911 1.00 53.17  ? 707  TYR A CE2 1 
ATOM   5378 C  CZ  . TYR A 1  707 ? 90.650  71.853  55.788 1.00 53.97  ? 707  TYR A CZ  1 
ATOM   5379 O  OH  . TYR A 1  707 ? 89.908  72.064  56.920 1.00 50.41  ? 707  TYR A OH  1 
ATOM   5380 N  N   . GLY A 1  708 ? 91.883  74.090  51.147 1.00 55.19  ? 708  GLY A N   1 
ATOM   5381 C  CA  . GLY A 1  708 ? 90.770  74.767  50.464 1.00 52.21  ? 708  GLY A CA  1 
ATOM   5382 C  C   . GLY A 1  708 ? 91.120  76.064  49.717 1.00 50.99  ? 708  GLY A C   1 
ATOM   5383 O  O   . GLY A 1  708 ? 90.979  77.195  50.234 1.00 46.75  ? 708  GLY A O   1 
ATOM   5384 N  N   . CYS A 1  709 ? 91.544  75.885  48.456 1.00 52.17  ? 709  CYS A N   1 
ATOM   5385 C  CA  . CYS A 1  709 ? 92.008  77.024  47.626 1.00 52.63  ? 709  CYS A CA  1 
ATOM   5386 C  C   . CYS A 1  709 ? 91.321  77.118  46.335 1.00 51.44  ? 709  CYS A C   1 
ATOM   5387 O  O   . CYS A 1  709 ? 90.911  76.079  45.742 1.00 48.25  ? 709  CYS A O   1 
ATOM   5388 C  CB  . CYS A 1  709 ? 93.548  76.992  47.326 1.00 52.72  ? 709  CYS A CB  1 
ATOM   5389 S  SG  . CYS A 1  709 ? 94.658  77.302  48.751 1.00 54.47  ? 709  CYS A SG  1 
ATOM   5390 N  N   . PHE A 1  710 ? 91.278  78.361  45.866 1.00 50.56  ? 710  PHE A N   1 
ATOM   5391 C  CA  . PHE A 1  710 ? 90.537  78.602  44.637 1.00 50.75  ? 710  PHE A CA  1 
ATOM   5392 C  C   . PHE A 1  710 ? 91.175  79.376  43.488 1.00 50.18  ? 710  PHE A C   1 
ATOM   5393 O  O   . PHE A 1  710 ? 91.473  80.544  43.630 1.00 47.58  ? 710  PHE A O   1 
ATOM   5394 C  CB  . PHE A 1  710 ? 89.163  79.261  44.985 1.00 44.34  ? 710  PHE A CB  1 
ATOM   5395 C  CG  . PHE A 1  710 ? 88.426  78.550  46.024 1.00 42.36  ? 710  PHE A CG  1 
ATOM   5396 C  CD1 . PHE A 1  710 ? 87.943  77.273  45.790 1.00 41.68  ? 710  PHE A CD1 1 
ATOM   5397 C  CD2 . PHE A 1  710 ? 88.266  79.109  47.319 1.00 42.42  ? 710  PHE A CD2 1 
ATOM   5398 C  CE1 . PHE A 1  710 ? 87.323  76.536  46.845 1.00 41.40  ? 710  PHE A CE1 1 
ATOM   5399 C  CE2 . PHE A 1  710 ? 87.647  78.377  48.341 1.00 35.16  ? 710  PHE A CE2 1 
ATOM   5400 C  CZ  . PHE A 1  710 ? 87.196  77.114  48.102 1.00 37.10  ? 710  PHE A CZ  1 
ATOM   5401 N  N   . TRP A 1  711 ? 91.295  78.726  42.329 1.00 51.88  ? 711  TRP A N   1 
ATOM   5402 C  CA  . TRP A 1  711 ? 91.854  79.435  41.156 1.00 54.34  ? 711  TRP A CA  1 
ATOM   5403 C  C   . TRP A 1  711 ? 90.884  80.500  40.815 1.00 54.21  ? 711  TRP A C   1 
ATOM   5404 O  O   . TRP A 1  711 ? 89.660  80.258  40.847 1.00 55.14  ? 711  TRP A O   1 
ATOM   5405 C  CB  . TRP A 1  711 ? 92.033  78.538  39.895 1.00 55.24  ? 711  TRP A CB  1 
ATOM   5406 C  CG  . TRP A 1  711 ? 93.370  77.717  39.887 1.00 56.52  ? 711  TRP A CG  1 
ATOM   5407 C  CD1 . TRP A 1  711 ? 93.510  76.363  39.646 1.00 56.18  ? 711  TRP A CD1 1 
ATOM   5408 C  CD2 . TRP A 1  711 ? 94.694  78.218  40.107 1.00 54.21  ? 711  TRP A CD2 1 
ATOM   5409 N  NE1 . TRP A 1  711 ? 94.835  76.018  39.708 1.00 55.60  ? 711  TRP A NE1 1 
ATOM   5410 C  CE2 . TRP A 1  711 ? 95.574  77.131  39.974 1.00 54.32  ? 711  TRP A CE2 1 
ATOM   5411 C  CE3 . TRP A 1  711 ? 95.223  79.490  40.365 1.00 57.36  ? 711  TRP A CE3 1 
ATOM   5412 C  CZ2 . TRP A 1  711 ? 96.959  77.279  40.107 1.00 54.37  ? 711  TRP A CZ2 1 
ATOM   5413 C  CZ3 . TRP A 1  711 ? 96.641  79.642  40.492 1.00 56.57  ? 711  TRP A CZ3 1 
ATOM   5414 C  CH2 . TRP A 1  711 ? 97.474  78.542  40.352 1.00 53.49  ? 711  TRP A CH2 1 
ATOM   5415 N  N   . GLY A 1  712 ? 91.448  81.669  40.498 1.00 54.04  ? 712  GLY A N   1 
ATOM   5416 C  CA  . GLY A 1  712 ? 90.667  82.824  40.114 1.00 53.53  ? 712  GLY A CA  1 
ATOM   5417 C  C   . GLY A 1  712 ? 90.121  82.567  38.730 1.00 55.71  ? 712  GLY A C   1 
ATOM   5418 O  O   . GLY A 1  712 ? 90.352  81.505  38.132 1.00 58.44  ? 712  GLY A O   1 
ATOM   5419 N  N   . ALA A 1  713 ? 89.393  83.533  38.181 1.00 57.38  ? 713  ALA A N   1 
ATOM   5420 C  CA  . ALA A 1  713 ? 88.783  83.292  36.851 1.00 57.42  ? 713  ALA A CA  1 
ATOM   5421 C  C   . ALA A 1  713 ? 89.677  83.658  35.713 1.00 57.06  ? 713  ALA A C   1 
ATOM   5422 O  O   . ALA A 1  713 ? 90.288  84.745  35.665 1.00 56.94  ? 713  ALA A O   1 
ATOM   5423 C  CB  . ALA A 1  713 ? 87.450  84.039  36.720 1.00 56.74  ? 713  ALA A CB  1 
ATOM   5424 N  N   . GLU A 1  714 ? 89.781  82.748  34.784 1.00 56.56  ? 714  GLU A N   1 
ATOM   5425 C  CA  . GLU A 1  714 ? 90.628  83.081  33.687 1.00 65.69  ? 714  GLU A CA  1 
ATOM   5426 C  C   . GLU A 1  714 ? 89.813  83.896  32.744 1.00 59.55  ? 714  GLU A C   1 
ATOM   5427 O  O   . GLU A 1  714 ? 88.600  83.700  32.642 1.00 76.06  ? 714  GLU A O   1 
ATOM   5428 C  CB  . GLU A 1  714 ? 91.090  81.835  32.995 1.00 61.25  ? 714  GLU A CB  1 
ATOM   5429 C  CG  . GLU A 1  714 ? 89.947  81.095  32.506 1.00 73.14  ? 714  GLU A CG  1 
ATOM   5430 C  CD  . GLU A 1  714 ? 90.357  79.799  31.887 1.00 82.05  ? 714  GLU A CD  1 
ATOM   5431 O  OE1 . GLU A 1  714 ? 91.120  79.010  32.529 1.00 75.35  ? 714  GLU A OE1 1 
ATOM   5432 O  OE2 . GLU A 1  714 ? 89.897  79.579  30.743 1.00 91.58  ? 714  GLU A OE2 1 
ATOM   5433 N  N   . ARG A 1  715 ? 90.507  84.803  32.062 1.00 69.01  ? 715  ARG A N   1 
ATOM   5434 C  CA  . ARG A 1  715 ? 89.980  85.696  31.033 1.00 69.39  ? 715  ARG A CA  1 
ATOM   5435 C  C   . ARG A 1  715 ? 88.768  85.135  30.267 1.00 75.89  ? 715  ARG A C   1 
ATOM   5436 O  O   . ARG A 1  715 ? 88.779  83.961  29.801 1.00 48.96  ? 715  ARG A O   1 
ATOM   5437 C  CB  . ARG A 1  715 ? 91.104  86.062  30.056 1.00 66.87  ? 715  ARG A CB  1 
ATOM   5438 C  CG  . ARG A 1  715 ? 90.654  86.752  28.783 1.00 74.88  ? 715  ARG A CG  1 
ATOM   5439 C  CD  . ARG A 1  715 ? 91.510  87.989  28.339 1.00 72.66  ? 715  ARG A CD  1 
ATOM   5440 N  NE  . ARG A 1  715 ? 92.787  87.665  27.666 1.00 81.52  ? 715  ARG A NE  1 
ATOM   5441 C  CZ  . ARG A 1  715 ? 93.010  86.591  26.907 1.00 75.96  ? 715  ARG A CZ  1 
ATOM   5442 N  NH1 . ARG A 1  715 ? 92.080  85.650  26.668 1.00 80.96  ? 715  ARG A NH1 1 
ATOM   5443 N  NH2 . ARG A 1  715 ? 94.179  86.479  26.348 1.00 59.52  ? 715  ARG A NH2 1 
ATOM   5444 N  N   . GLN A 1  716 ? 87.726  85.995  30.194 1.00 76.13  ? 716  GLN A N   1 
ATOM   5445 C  CA  . GLN A 1  716 ? 86.470  85.705  29.521 1.00 57.07  ? 716  GLN A CA  1 
ATOM   5446 C  C   . GLN A 1  716 ? 86.120  86.773  28.483 1.00 55.92  ? 716  GLN A C   1 
ATOM   5447 O  O   . GLN A 1  716 ? 86.417  87.957  28.660 1.00 56.43  ? 716  GLN A O   1 
ATOM   5448 C  CB  . GLN A 1  716 ? 85.341  85.599  30.555 1.00 56.18  ? 716  GLN A CB  1 
ATOM   5449 C  CG  . GLN A 1  716 ? 84.038  84.907  30.042 1.00 73.14  ? 716  GLN A CG  1 
ATOM   5450 C  CD  . GLN A 1  716 ? 82.806  85.037  31.015 1.00 82.04  ? 716  GLN A CD  1 
ATOM   5451 O  OE1 . GLN A 1  716 ? 82.496  86.148  31.550 1.00 64.47  ? 716  GLN A OE1 1 
ATOM   5452 N  NE2 . GLN A 1  716 ? 82.097  83.901  31.226 1.00 58.13  ? 716  GLN A NE2 1 
ATOM   5453 N  N   . VAL A 1  717 ? 85.474  86.316  27.413 1.00 55.76  ? 717  VAL A N   1 
ATOM   5454 C  CA  . VAL A 1  717 ? 85.032  87.178  26.323 1.00 56.25  ? 717  VAL A CA  1 
ATOM   5455 C  C   . VAL A 1  717 ? 83.612  86.854  25.939 1.00 56.69  ? 717  VAL A C   1 
ATOM   5456 O  O   . VAL A 1  717 ? 83.255  85.716  25.593 1.00 54.34  ? 717  VAL A O   1 
ATOM   5457 C  CB  . VAL A 1  717 ? 85.909  87.032  25.045 1.00 57.86  ? 717  VAL A CB  1 
ATOM   5458 C  CG1 . VAL A 1  717 ? 85.574  88.148  24.054 1.00 78.87  ? 717  VAL A CG1 1 
ATOM   5459 C  CG2 . VAL A 1  717 ? 87.410  87.175  25.383 1.00 57.21  ? 717  VAL A CG2 1 
ATOM   5460 N  N   . VAL A 1  718 ? 82.800  87.894  25.950 1.00 56.93  ? 718  VAL A N   1 
ATOM   5461 C  CA  . VAL A 1  718 ? 81.372  87.717  25.704 1.00 57.40  ? 718  VAL A CA  1 
ATOM   5462 C  C   . VAL A 1  718 ? 80.880  88.816  24.820 1.00 57.17  ? 718  VAL A C   1 
ATOM   5463 O  O   . VAL A 1  718 ? 81.234  89.998  25.036 1.00 67.92  ? 718  VAL A O   1 
ATOM   5464 C  CB  . VAL A 1  718 ? 80.541  87.797  27.099 1.00 57.51  ? 718  VAL A CB  1 
ATOM   5465 C  CG1 . VAL A 1  718 ? 79.030  87.574  26.882 1.00 55.98  ? 718  VAL A CG1 1 
ATOM   5466 C  CG2 . VAL A 1  718 ? 81.119  86.819  28.084 1.00 56.41  ? 718  VAL A CG2 1 
ATOM   5467 N  N   . ALA A 1  719 ? 80.032  88.429  23.874 1.00 56.57  ? 719  ALA A N   1 
ATOM   5468 C  CA  . ALA A 1  719 ? 79.470  89.383  22.939 1.00 56.40  ? 719  ALA A CA  1 
ATOM   5469 C  C   . ALA A 1  719 ? 78.039  89.382  23.325 1.00 56.50  ? 719  ALA A C   1 
ATOM   5470 O  O   . ALA A 1  719 ? 77.432  88.269  23.497 1.00 65.11  ? 719  ALA A O   1 
ATOM   5471 C  CB  . ALA A 1  719 ? 79.604  88.867  21.480 1.00 54.55  ? 719  ALA A CB  1 
ATOM   5472 N  N   . THR A 1  720 ? 77.471  90.570  23.500 1.00 56.88  ? 720  THR A N   1 
ATOM   5473 C  CA  . THR A 1  720 ? 76.033  90.592  23.773 1.00 73.28  ? 720  THR A CA  1 
ATOM   5474 C  C   . THR A 1  720 ? 75.231  91.507  22.820 1.00 73.05  ? 720  THR A C   1 
ATOM   5475 O  O   . THR A 1  720 ? 75.618  92.653  22.510 1.00 79.23  ? 720  THR A O   1 
ATOM   5476 C  CB  . THR A 1  720 ? 75.674  90.983  25.234 1.00 64.50  ? 720  THR A CB  1 
ATOM   5477 O  OG1 . THR A 1  720 ? 76.470  90.266  26.173 1.00 61.90  ? 720  THR A OG1 1 
ATOM   5478 C  CG2 . THR A 1  720 ? 74.248  90.613  25.477 1.00 57.51  ? 720  THR A CG2 1 
ATOM   5479 N  N   . ALA A 1  721 ? 74.119  90.998  22.330 1.00 71.81  ? 721  ALA A N   1 
ATOM   5480 C  CA  . ALA A 1  721 ? 73.302  91.805  21.443 1.00 73.17  ? 721  ALA A CA  1 
ATOM   5481 C  C   . ALA A 1  721 ? 71.967  91.924  22.159 1.00 72.21  ? 721  ALA A C   1 
ATOM   5482 O  O   . ALA A 1  721 ? 71.297  90.914  22.467 1.00 65.93  ? 721  ALA A O   1 
ATOM   5483 C  CB  . ALA A 1  721 ? 73.119  91.116  20.104 1.00 48.61  ? 721  ALA A CB  1 
ATOM   5484 N  N   . THR A 1  722 ? 71.570  93.147  22.448 1.00 60.19  ? 722  THR A N   1 
ATOM   5485 C  CA  . THR A 1  722 ? 70.324  93.263  23.132 1.00 67.52  ? 722  THR A CA  1 
ATOM   5486 C  C   . THR A 1  722 ? 69.398  94.173  22.311 1.00 62.53  ? 722  THR A C   1 
ATOM   5487 O  O   . THR A 1  722 ? 69.636  95.349  22.055 1.00 59.10  ? 722  THR A O   1 
ATOM   5488 C  CB  . THR A 1  722 ? 70.619  93.667  24.644 1.00 63.05  ? 722  THR A CB  1 
ATOM   5489 O  OG1 . THR A 1  722 ? 69.907  94.847  25.032 1.00 56.52  ? 722  THR A OG1 1 
ATOM   5490 C  CG2 . THR A 1  722 ? 72.076  93.905  24.813 1.00 56.51  ? 722  THR A CG2 1 
ATOM   5491 N  N   . PHE A 1  723 ? 68.312  93.591  21.889 1.00 65.58  ? 723  PHE A N   1 
ATOM   5492 C  CA  . PHE A 1  723 ? 67.385  94.309  21.036 1.00 71.17  ? 723  PHE A CA  1 
ATOM   5493 C  C   . PHE A 1  723 ? 66.059  94.759  21.662 1.00 72.26  ? 723  PHE A C   1 
ATOM   5494 O  O   . PHE A 1  723 ? 65.378  93.966  22.338 1.00 73.09  ? 723  PHE A O   1 
ATOM   5495 C  CB  . PHE A 1  723 ? 67.071  93.422  19.834 1.00 68.63  ? 723  PHE A CB  1 
ATOM   5496 C  CG  . PHE A 1  723 ? 68.280  92.996  19.066 1.00 70.15  ? 723  PHE A CG  1 
ATOM   5497 C  CD1 . PHE A 1  723 ? 69.162  93.940  18.542 1.00 63.53  ? 723  PHE A CD1 1 
ATOM   5498 C  CD2 . PHE A 1  723 ? 68.497  91.641  18.799 1.00 68.83  ? 723  PHE A CD2 1 
ATOM   5499 C  CE1 . PHE A 1  723 ? 70.236  93.533  17.757 1.00 69.62  ? 723  PHE A CE1 1 
ATOM   5500 C  CE2 . PHE A 1  723 ? 69.572  91.221  18.013 1.00 65.70  ? 723  PHE A CE2 1 
ATOM   5501 C  CZ  . PHE A 1  723 ? 70.439  92.146  17.492 1.00 50.75  ? 723  PHE A CZ  1 
ATOM   5502 N  N   . ARG A 1  724 ? 65.685  96.007  21.399 1.00 66.29  ? 724  ARG A N   1 
ATOM   5503 C  CA  . ARG A 1  724 ? 64.437  96.543  21.900 1.00 72.37  ? 724  ARG A CA  1 
ATOM   5504 C  C   . ARG A 1  724 ? 63.441  96.839  20.793 1.00 74.10  ? 724  ARG A C   1 
ATOM   5505 O  O   . ARG A 1  724 ? 63.646  97.729  19.970 1.00 81.87  ? 724  ARG A O   1 
ATOM   5506 C  CB  . ARG A 1  724 ? 64.660  97.838  22.642 1.00 67.14  ? 724  ARG A CB  1 
ATOM   5507 C  CG  . ARG A 1  724 ? 65.578  97.712  23.762 1.00 66.33  ? 724  ARG A CG  1 
ATOM   5508 C  CD  . ARG A 1  724 ? 64.860  98.090  24.951 1.00 49.92  ? 724  ARG A CD  1 
ATOM   5509 N  NE  . ARG A 1  724 ? 65.612  97.710  26.113 1.00 64.80  ? 724  ARG A NE  1 
ATOM   5510 C  CZ  . ARG A 1  724 ? 65.621  98.419  27.225 1.00 68.19  ? 724  ARG A CZ  1 
ATOM   5511 N  NH1 . ARG A 1  724 ? 64.923  99.538  27.302 1.00 72.05  ? 724  ARG A NH1 1 
ATOM   5512 N  NH2 . ARG A 1  724 ? 66.317  98.013  28.250 1.00 57.52  ? 724  ARG A NH2 1 
ATOM   5513 N  N   . PHE A 1  725 ? 62.365  96.075  20.798 1.00 79.23  ? 725  PHE A N   1 
ATOM   5514 C  CA  . PHE A 1  725 ? 61.243  96.246  19.883 1.00 82.43  ? 725  PHE A CA  1 
ATOM   5515 C  C   . PHE A 1  725 ? 60.434  97.392  20.481 1.00 81.39  ? 725  PHE A C   1 
ATOM   5516 O  O   . PHE A 1  725 ? 60.777  97.874  21.587 1.00 87.02  ? 725  PHE A O   1 
ATOM   5517 C  CB  . PHE A 1  725 ? 60.336  94.994  19.862 1.00 82.32  ? 725  PHE A CB  1 
ATOM   5518 C  CG  . PHE A 1  725 ? 60.937  93.808  19.168 1.00 95.43  ? 725  PHE A CG  1 
ATOM   5519 C  CD1 . PHE A 1  725 ? 62.254  93.856  18.659 1.00 104.16 ? 725  PHE A CD1 1 
ATOM   5520 C  CD2 . PHE A 1  725 ? 60.179  92.641  18.985 1.00 104.43 ? 725  PHE A CD2 1 
ATOM   5521 C  CE1 . PHE A 1  725 ? 62.817  92.754  17.977 1.00 104.63 ? 725  PHE A CE1 1 
ATOM   5522 C  CE2 . PHE A 1  725 ? 60.721  91.525  18.304 1.00 109.19 ? 725  PHE A CE2 1 
ATOM   5523 C  CZ  . PHE A 1  725 ? 62.042  91.588  17.798 1.00 108.95 ? 725  PHE A CZ  1 
ATOM   5524 O  OXT . PHE A 1  725 ? 59.434  97.773  19.849 1.00 91.53  ? 725  PHE A OXT 1 
HETATM 5525 C  C1  . PA1 B 2  .   ? 54.919  73.783  59.680 1.00 58.83  ? 1    PA1 B C1  1 
HETATM 5526 O  O1  . PA1 B 2  .   ? 54.498  73.331  60.962 1.00 63.40  ? 1    PA1 B O1  1 
HETATM 5527 C  C2  . PA1 B 2  .   ? 53.965  74.757  59.006 1.00 57.26  ? 1    PA1 B C2  1 
HETATM 5528 N  N2  . PA1 B 2  .   ? 53.558  75.786  59.953 1.00 67.48  ? 1    PA1 B N2  1 
HETATM 5529 C  C3  . PA1 B 2  .   ? 52.749  74.036  58.500 1.00 57.50  ? 1    PA1 B C3  1 
HETATM 5530 C  C4  . PA1 B 2  .   ? 53.324  73.155  57.390 1.00 63.51  ? 1    PA1 B C4  1 
HETATM 5531 O  O4  . PA1 B 2  .   ? 52.305  72.456  56.651 1.00 65.71  ? 1    PA1 B O4  1 
HETATM 5532 C  C5  . PA1 B 2  .   ? 54.295  72.127  57.977 1.00 52.02  ? 1    PA1 B C5  1 
HETATM 5533 O  O5  . PA1 B 2  .   ? 55.300  72.725  58.807 1.00 48.81  ? 1    PA1 B O5  1 
HETATM 5534 C  C6  . PA1 B 2  .   ? 55.080  71.332  56.865 1.00 48.32  ? 1    PA1 B C6  1 
HETATM 5535 O  O6  . PA1 B 2  .   ? 54.457  71.532  55.560 1.00 61.72  ? 1    PA1 B O6  1 
HETATM 5536 C  C1  . GCN B 2  .   ? 55.346  71.460  54.523 1.00 42.83  ? 2    GCN B C1  1 
HETATM 5537 C  C2  . GCN B 2  .   ? 54.956  72.376  53.377 1.00 45.82  ? 2    GCN B C2  1 
HETATM 5538 C  C3  . GCN B 2  .   ? 54.595  71.649  52.019 1.00 44.02  ? 2    GCN B C3  1 
HETATM 5539 C  C4  . GCN B 2  .   ? 55.460  70.409  51.781 1.00 35.56  ? 2    GCN B C4  1 
HETATM 5540 C  C5  . GCN B 2  .   ? 55.215  69.546  52.939 1.00 46.40  ? 2    GCN B C5  1 
HETATM 5541 C  C6  . GCN B 2  .   ? 55.998  68.237  52.848 1.00 52.00  ? 2    GCN B C6  1 
HETATM 5542 N  N2  . GCN B 2  .   ? 54.016  73.417  53.831 1.00 49.54  ? 2    GCN B N2  1 
HETATM 5543 O  O4  . GCN B 2  .   ? 54.946  69.703  50.629 1.00 53.95  ? 2    GCN B O4  1 
HETATM 5544 O  O5  . GCN B 2  .   ? 55.568  70.122  54.205 1.00 39.25  ? 2    GCN B O5  1 
HETATM 5545 O  O6  . GCN B 2  .   ? 55.830  67.479  54.088 1.00 54.76  ? 2    GCN B O6  1 
HETATM 5546 C  C1  . KDO B 2  .   ? 55.454  65.494  52.870 1.00 54.58  ? 3    KDO B C1  1 
HETATM 5547 O  O1A . KDO B 2  .   ? 56.176  65.093  51.945 1.00 59.96  ? 3    KDO B O1A 1 
HETATM 5548 O  O1B . KDO B 2  .   ? 54.200  65.460  52.828 1.00 71.37  ? 3    KDO B O1B 1 
HETATM 5549 C  C2  . KDO B 2  .   ? 56.092  66.096  54.066 1.00 54.84  ? 3    KDO B C2  1 
HETATM 5550 C  C3  . KDO B 2  .   ? 55.537  65.393  55.330 1.00 49.81  ? 3    KDO B C3  1 
HETATM 5551 C  C4  . KDO B 2  .   ? 56.198  65.932  56.608 1.00 55.74  ? 3    KDO B C4  1 
HETATM 5552 O  O4  . KDO B 2  .   ? 55.795  65.142  57.706 1.00 63.76  ? 3    KDO B O4  1 
HETATM 5553 C  C5  . KDO B 2  .   ? 57.713  65.738  56.384 1.00 64.54  ? 3    KDO B C5  1 
HETATM 5554 O  O5  . KDO B 2  .   ? 57.920  64.328  56.139 1.00 59.61  ? 3    KDO B O5  1 
HETATM 5555 C  C6  . KDO B 2  .   ? 58.193  66.505  55.118 1.00 64.35  ? 3    KDO B C6  1 
HETATM 5556 O  O6  . KDO B 2  .   ? 57.510  65.923  53.965 1.00 60.88  ? 3    KDO B O6  1 
HETATM 5557 C  C7  . KDO B 2  .   ? 59.736  66.432  54.949 1.00 58.58  ? 3    KDO B C7  1 
HETATM 5558 O  O7  . KDO B 2  .   ? 60.302  67.342  55.852 1.00 56.41  ? 3    KDO B O7  1 
HETATM 5559 C  C8  . KDO B 2  .   ? 60.188  66.812  53.531 1.00 57.74  ? 3    KDO B C8  1 
HETATM 5560 O  O8  . KDO B 2  .   ? 59.872  68.186  53.247 1.00 60.06  ? 3    KDO B O8  1 
HETATM 5561 C  C1  . GMH B 2  .   ? 59.157  63.755  56.450 1.00 54.69  ? 4    GMH B C1  1 
HETATM 5562 C  C2  . GMH B 2  .   ? 59.123  62.296  56.050 1.00 52.46  ? 4    GMH B C2  1 
HETATM 5563 C  C3  . GMH B 2  .   ? 58.185  61.417  56.969 1.00 55.16  ? 4    GMH B C3  1 
HETATM 5564 C  C4  . GMH B 2  .   ? 58.550  61.655  58.469 1.00 53.34  ? 4    GMH B C4  1 
HETATM 5565 C  C5  . GMH B 2  .   ? 58.586  63.187  58.718 1.00 56.43  ? 4    GMH B C5  1 
HETATM 5566 C  C6  . GMH B 2  .   ? 58.889  63.559  60.161 1.00 63.63  ? 4    GMH B C6  1 
HETATM 5567 C  C7  . GMH B 2  .   ? 58.783  65.042  60.345 1.00 68.41  ? 4    GMH B C7  1 
HETATM 5568 O  O2  . GMH B 2  .   ? 60.448  61.831  56.102 1.00 68.52  ? 4    GMH B O2  1 
HETATM 5569 O  O3  . GMH B 2  .   ? 58.278  60.000  56.619 1.00 54.25  ? 4    GMH B O3  1 
HETATM 5570 O  O4  . GMH B 2  .   ? 57.472  61.137  59.295 1.00 62.34  ? 4    GMH B O4  1 
HETATM 5571 O  O5  . GMH B 2  .   ? 59.494  63.861  57.834 1.00 61.57  ? 4    GMH B O5  1 
HETATM 5572 O  O6  . GMH B 2  .   ? 60.165  63.114  60.584 1.00 62.85  ? 4    GMH B O6  1 
HETATM 5573 O  O7  . GMH B 2  .   ? 58.627  65.307  61.732 1.00 75.01  ? 4    GMH B O7  1 
HETATM 5574 C  C1  . GMH B 2  .   ? 57.538  59.414  55.521 1.00 59.14  ? 5    GMH B C1  1 
HETATM 5575 C  C2  . GMH B 2  .   ? 57.169  58.054  55.926 1.00 57.55  ? 5    GMH B C2  1 
HETATM 5576 C  C3  . GMH B 2  .   ? 56.709  57.167  54.683 1.00 70.18  ? 5    GMH B C3  1 
HETATM 5577 C  C4  . GMH B 2  .   ? 57.906  56.867  53.685 1.00 77.17  ? 5    GMH B C4  1 
HETATM 5578 C  C5  . GMH B 2  .   ? 58.878  58.138  53.818 1.00 73.61  ? 5    GMH B C5  1 
HETATM 5579 C  C6  . GMH B 2  .   ? 59.708  58.460  52.549 1.00 86.28  ? 5    GMH B C6  1 
HETATM 5580 C  C7  . GMH B 2  .   ? 60.914  59.463  52.857 1.00 96.22  ? 5    GMH B C7  1 
HETATM 5581 O  O2  . GMH B 2  .   ? 56.161  58.219  56.924 1.00 51.20  ? 5    GMH B O2  1 
HETATM 5582 O  O3  . GMH B 2  .   ? 55.576  57.765  53.987 1.00 67.62  ? 5    GMH B O3  1 
HETATM 5583 O  O4  . GMH B 2  .   ? 58.594  55.585  54.118 1.00 80.91  ? 5    GMH B O4  1 
HETATM 5584 O  O5  . GMH B 2  .   ? 58.155  59.368  54.202 1.00 64.61  ? 5    GMH B O5  1 
HETATM 5585 O  O6  . GMH B 2  .   ? 58.814  59.032  51.607 1.00 89.43  ? 5    GMH B O6  1 
HETATM 5586 O  O7  . GMH B 2  .   ? 61.766  59.793  51.726 1.00 97.62  ? 5    GMH B O7  1 
HETATM 5587 C  C1  . GLC B 2  .   ? 54.443  56.964  53.726 1.00 76.12  ? 6    GLC B C1  1 
HETATM 5588 C  C2  . GLC B 2  .   ? 53.351  57.766  53.001 1.00 82.22  ? 6    GLC B C2  1 
HETATM 5589 C  C3  . GLC B 2  .   ? 52.593  58.720  53.937 1.00 88.09  ? 6    GLC B C3  1 
HETATM 5590 C  C4  . GLC B 2  .   ? 52.138  58.039  55.207 1.00 86.98  ? 6    GLC B C4  1 
HETATM 5591 C  C5  . GLC B 2  .   ? 53.263  57.232  55.852 1.00 90.20  ? 6    GLC B C5  1 
HETATM 5592 C  C6  . GLC B 2  .   ? 52.635  56.319  56.876 1.00 93.60  ? 6    GLC B C6  1 
HETATM 5593 O  O2  . GLC B 2  .   ? 53.951  58.514  51.965 1.00 84.19  ? 6    GLC B O2  1 
HETATM 5594 O  O3  . GLC B 2  .   ? 51.416  59.187  53.278 1.00 98.85  ? 6    GLC B O3  1 
HETATM 5595 O  O4  . GLC B 2  .   ? 51.647  59.014  56.125 1.00 87.75  ? 6    GLC B O4  1 
HETATM 5596 O  O5  . GLC B 2  .   ? 53.896  56.347  54.884 1.00 85.89  ? 6    GLC B O5  1 
HETATM 5597 O  O6  . GLC B 2  .   ? 52.017  55.234  56.161 1.00 96.72  ? 6    GLC B O6  1 
HETATM 5598 C  C1  . GLC B 2  .   ? 51.117  60.551  53.444 1.00 104.54 ? 7    GLC B C1  1 
HETATM 5599 C  C2  . GLC B 2  .   ? 49.557  60.771  53.362 1.00 107.73 ? 7    GLC B C2  1 
HETATM 5600 C  C3  . GLC B 2  .   ? 49.054  60.141  52.069 1.00 105.34 ? 7    GLC B C3  1 
HETATM 5601 C  C4  . GLC B 2  .   ? 49.818  60.786  50.862 1.00 105.14 ? 7    GLC B C4  1 
HETATM 5602 C  C5  . GLC B 2  .   ? 51.386  60.726  51.080 1.00 104.22 ? 7    GLC B C5  1 
HETATM 5603 C  C6  . GLC B 2  .   ? 52.285  61.402  50.022 1.00 99.68  ? 7    GLC B C6  1 
HETATM 5604 O  O2  . GLC B 2  .   ? 48.825  60.239  54.485 1.00 109.68 ? 7    GLC B O2  1 
HETATM 5605 O  O3  . GLC B 2  .   ? 47.641  60.321  51.982 1.00 104.68 ? 7    GLC B O3  1 
HETATM 5606 O  O4  . GLC B 2  .   ? 49.457  60.136  49.641 1.00 101.38 ? 7    GLC B O4  1 
HETATM 5607 O  O5  . GLC B 2  .   ? 51.732  61.276  52.390 1.00 104.31 ? 7    GLC B O5  1 
HETATM 5608 O  O6  . GLC B 2  .   ? 53.190  62.340  50.611 1.00 93.55  ? 7    GLC B O6  1 
HETATM 5609 C  C1  . GLA B 2  .   ? 51.311  54.345  56.975 1.00 98.19  ? 8    GLA B C1  1 
HETATM 5610 C  C2  . GLA B 2  .   ? 50.717  53.241  56.057 1.00 97.34  ? 8    GLA B C2  1 
HETATM 5611 C  C3  . GLA B 2  .   ? 49.721  53.887  55.126 1.00 99.30  ? 8    GLA B C3  1 
HETATM 5612 C  C4  . GLA B 2  .   ? 48.624  54.612  55.962 1.00 99.19  ? 8    GLA B C4  1 
HETATM 5613 C  C5  . GLA B 2  .   ? 49.257  55.637  56.927 1.00 95.58  ? 8    GLA B C5  1 
HETATM 5614 C  C6  . GLA B 2  .   ? 48.226  56.230  57.862 1.00 94.80  ? 8    GLA B C6  1 
HETATM 5615 O  O2  . GLA B 2  .   ? 51.743  52.610  55.278 1.00 99.23  ? 8    GLA B O2  1 
HETATM 5616 O  O3  . GLA B 2  .   ? 49.179  52.895  54.259 1.00 103.08 ? 8    GLA B O3  1 
HETATM 5617 O  O4  . GLA B 2  .   ? 47.851  53.682  56.716 1.00 102.39 ? 8    GLA B O4  1 
HETATM 5618 O  O5  . GLA B 2  .   ? 50.280  55.003  57.741 1.00 92.89  ? 8    GLA B O5  1 
HETATM 5619 O  O6  . GLA B 2  .   ? 48.814  57.129  58.784 1.00 92.60  ? 8    GLA B O6  1 
HETATM 5620 C  C1  . KDO B 2  .   ? 54.940  67.009  58.936 1.00 77.99  ? 9    KDO B C1  1 
HETATM 5621 O  O1A . KDO B 2  .   ? 53.927  67.784  58.855 1.00 74.45  ? 9    KDO B O1A 1 
HETATM 5622 O  O1B . KDO B 2  .   ? 56.083  67.341  59.388 1.00 81.72  ? 9    KDO B O1B 1 
HETATM 5623 C  C2  . KDO B 2  .   ? 54.737  65.588  58.501 1.00 68.46  ? 9    KDO B C2  1 
HETATM 5624 C  C3  . KDO B 2  .   ? 54.592  64.717  59.780 1.00 68.63  ? 9    KDO B C3  1 
HETATM 5625 C  C4  . KDO B 2  .   ? 53.998  63.324  59.516 1.00 73.44  ? 9    KDO B C4  1 
HETATM 5626 O  O4  . KDO B 2  .   ? 53.727  62.710  60.768 1.00 74.68  ? 9    KDO B O4  1 
HETATM 5627 C  C5  . KDO B 2  .   ? 52.704  63.535  58.816 1.00 74.40  ? 9    KDO B C5  1 
HETATM 5628 O  O5  . KDO B 2  .   ? 51.932  64.302  59.719 1.00 69.42  ? 9    KDO B O5  1 
HETATM 5629 C  C6  . KDO B 2  .   ? 52.970  64.303  57.478 1.00 73.81  ? 9    KDO B C6  1 
HETATM 5630 O  O6  . KDO B 2  .   ? 53.537  65.606  57.737 1.00 76.10  ? 9    KDO B O6  1 
HETATM 5631 C  C7  . KDO B 2  .   ? 51.779  64.511  56.532 1.00 67.26  ? 9    KDO B C7  1 
HETATM 5632 O  O7  . KDO B 2  .   ? 50.741  65.231  57.175 1.00 64.55  ? 9    KDO B O7  1 
HETATM 5633 C  C8  . KDO B 2  .   ? 51.239  63.232  55.901 1.00 75.91  ? 9    KDO B C8  1 
HETATM 5634 O  O8  . KDO B 2  .   ? 51.143  63.426  54.481 1.00 83.12  ? 9    KDO B O8  1 
HETATM 5635 NI NI  . NI  C 3  .   ? 56.252  52.955  53.664 1.00 95.66  ? 1030 NI  A NI  1 
HETATM 5636 P  P   . PO4 D 4  .   ? 55.946  69.412  49.493 1.00 72.23  ? 2001 PO4 A P   1 
HETATM 5637 O  O1  . PO4 D 4  .   ? 55.243  68.330  48.699 1.00 54.47  ? 2001 PO4 A O1  1 
HETATM 5638 O  O2  . PO4 D 4  .   ? 57.163  68.978  50.236 1.00 68.78  ? 2001 PO4 A O2  1 
HETATM 5639 O  O3  . PO4 D 4  .   ? 55.982  70.785  48.866 1.00 68.06  ? 2001 PO4 A O3  1 
HETATM 5640 P  P   . PO4 E 4  .   ? 58.680  54.290  53.182 1.00 88.62  ? 2005 PO4 A P   1 
HETATM 5641 O  O2  . PO4 E 4  .   ? 60.199  54.323  52.967 1.00 83.23  ? 2005 PO4 A O2  1 
HETATM 5642 O  O3  . PO4 E 4  .   ? 58.223  53.478  54.330 1.00 69.58  ? 2005 PO4 A O3  1 
HETATM 5643 O  O4  . PO4 E 4  .   ? 57.800  54.167  51.873 1.00 68.04  ? 2005 PO4 A O4  1 
HETATM 5644 C  C1  . FTT F 5  .   ? 53.263  77.074  59.603 1.00 71.32  ? 1009 FTT A C1  1 
HETATM 5645 C  C2  . FTT F 5  .   ? 53.000  77.983  60.783 1.00 70.62  ? 1009 FTT A C2  1 
HETATM 5646 C  C3  . FTT F 5  .   ? 53.272  79.428  60.502 1.00 73.12  ? 1009 FTT A C3  1 
HETATM 5647 C  C4  . FTT F 5  .   ? 52.127  80.186  61.168 1.00 63.42  ? 1009 FTT A C4  1 
HETATM 5648 C  C5  . FTT F 5  .   ? 52.137  81.675  61.030 1.00 61.09  ? 1009 FTT A C5  1 
HETATM 5649 C  C6  . FTT F 5  .   ? 51.699  82.035  59.603 1.00 67.23  ? 1009 FTT A C6  1 
HETATM 5650 C  C7  . FTT F 5  .   ? 51.633  83.514  59.313 1.00 65.10  ? 1009 FTT A C7  1 
HETATM 5651 C  C8  . FTT F 5  .   ? 50.860  83.665  58.042 1.00 65.38  ? 1009 FTT A C8  1 
HETATM 5652 C  C9  . FTT F 5  .   ? 50.284  85.074  57.840 1.00 67.84  ? 1009 FTT A C9  1 
HETATM 5653 C  C10 . FTT F 5  .   ? 49.730  85.175  56.415 1.00 71.43  ? 1009 FTT A C10 1 
HETATM 5654 C  C11 . FTT F 5  .   ? 48.869  86.402  56.157 1.00 68.84  ? 1009 FTT A C11 1 
HETATM 5655 C  C12 . FTT F 5  .   ? 49.619  87.737  56.190 1.00 62.95  ? 1009 FTT A C12 1 
HETATM 5656 C  C13 . FTT F 5  .   ? 48.766  88.751  55.418 1.00 66.37  ? 1009 FTT A C13 1 
HETATM 5657 C  C14 . FTT F 5  .   ? 47.858  87.972  54.424 1.00 63.13  ? 1009 FTT A C14 1 
HETATM 5658 O  O2  . FTT F 5  .   ? 53.238  77.539  58.440 1.00 82.33  ? 1009 FTT A O2  1 
HETATM 5659 O  O3  . FTT F 5  .   ? 54.519  79.735  61.122 1.00 88.19  ? 1009 FTT A O3  1 
HETATM 5660 C  C1  . FTT G 5  .   ? 50.507  74.671  57.670 1.00 74.77  ? 1010 FTT A C1  1 
HETATM 5661 C  C2  . FTT G 5  .   ? 49.429  75.740  57.904 1.00 78.35  ? 1010 FTT A C2  1 
HETATM 5662 C  C3  . FTT G 5  .   ? 48.400  75.793  56.769 1.00 89.19  ? 1010 FTT A C3  1 
HETATM 5663 C  C4  . FTT G 5  .   ? 48.230  77.160  56.087 1.00 91.60  ? 1010 FTT A C4  1 
HETATM 5664 O  O2  . FTT G 5  .   ? 50.328  73.601  57.111 1.00 84.91  ? 1010 FTT A O2  1 
HETATM 5665 O  O3  . FTT G 5  .   ? 48.702  74.805  55.790 1.00 97.86  ? 1010 FTT A O3  1 
HETATM 5666 O  O1  . FTT G 5  .   ? 51.822  75.072  58.032 1.00 67.05  ? 1010 FTT A O1  1 
HETATM 5667 C  C1  . FTT H 5  .   ? 54.457  74.641  54.138 1.00 47.31  ? 1011 FTT A C1  1 
HETATM 5668 C  C2  . FTT H 5  .   ? 53.557  75.624  54.854 1.00 58.44  ? 1011 FTT A C2  1 
HETATM 5669 C  C3  . FTT H 5  .   ? 53.253  76.889  53.981 1.00 58.02  ? 1011 FTT A C3  1 
HETATM 5670 C  C4  . FTT H 5  .   ? 52.398  76.410  52.803 1.00 51.77  ? 1011 FTT A C4  1 
HETATM 5671 C  C5  . FTT H 5  .   ? 52.397  77.271  51.521 1.00 48.70  ? 1011 FTT A C5  1 
HETATM 5672 C  C6  . FTT H 5  .   ? 51.961  78.715  51.726 1.00 41.59  ? 1011 FTT A C6  1 
HETATM 5673 C  C7  . FTT H 5  .   ? 51.908  79.364  50.306 1.00 56.36  ? 1011 FTT A C7  1 
HETATM 5674 C  C8  . FTT H 5  .   ? 51.610  80.901  50.274 1.00 55.17  ? 1011 FTT A C8  1 
HETATM 5675 C  C9  . FTT H 5  .   ? 51.186  81.345  48.869 1.00 56.57  ? 1011 FTT A C9  1 
HETATM 5676 C  C10 . FTT H 5  .   ? 51.320  82.875  48.750 1.00 60.68  ? 1011 FTT A C10 1 
HETATM 5677 C  C11 . FTT H 5  .   ? 50.983  83.377  47.336 1.00 55.40  ? 1011 FTT A C11 1 
HETATM 5678 C  C12 . FTT H 5  .   ? 50.957  84.932  47.240 1.00 57.75  ? 1011 FTT A C12 1 
HETATM 5679 C  C13 . FTT H 5  .   ? 50.190  85.401  45.953 1.00 62.37  ? 1011 FTT A C13 1 
HETATM 5680 C  C14 . FTT H 5  .   ? 49.698  86.844  46.034 1.00 57.90  ? 1011 FTT A C14 1 
HETATM 5681 O  O2  . FTT H 5  .   ? 55.593  75.029  53.881 1.00 50.17  ? 1011 FTT A O2  1 
HETATM 5682 O  O3  . FTT H 5  .   ? 52.587  77.982  54.660 1.00 55.95  ? 1011 FTT A O3  1 
HETATM 5683 O  O2  . DAO I 6  .   ? 54.479  78.533  55.881 1.00 75.57  ? 1012 DAO A O2  1 
HETATM 5684 C  C1  . DAO I 6  .   ? 53.286  78.637  55.686 1.00 65.21  ? 1012 DAO A C1  1 
HETATM 5685 C  C2  . DAO I 6  .   ? 52.374  79.552  56.488 1.00 69.34  ? 1012 DAO A C2  1 
HETATM 5686 C  C3  . DAO I 6  .   ? 51.159  79.960  55.675 1.00 62.98  ? 1012 DAO A C3  1 
HETATM 5687 C  C4  . DAO I 6  .   ? 51.082  81.436  55.475 1.00 58.91  ? 1012 DAO A C4  1 
HETATM 5688 C  C5  . DAO I 6  .   ? 50.215  81.730  54.253 1.00 60.92  ? 1012 DAO A C5  1 
HETATM 5689 C  C6  . DAO I 6  .   ? 49.847  83.210  54.059 1.00 57.57  ? 1012 DAO A C6  1 
HETATM 5690 C  C7  . DAO I 6  .   ? 49.191  83.474  52.681 1.00 60.30  ? 1012 DAO A C7  1 
HETATM 5691 C  C8  . DAO I 6  .   ? 49.014  84.979  52.397 1.00 58.74  ? 1012 DAO A C8  1 
HETATM 5692 C  C9  . DAO I 6  .   ? 47.953  85.201  51.326 1.00 57.52  ? 1012 DAO A C9  1 
HETATM 5693 C  C10 . DAO I 6  .   ? 47.692  86.707  51.034 1.00 60.44  ? 1012 DAO A C10 1 
HETATM 5694 C  C11 . DAO I 6  .   ? 47.018  86.782  49.610 1.00 63.51  ? 1012 DAO A C11 1 
HETATM 5695 C  C12 . DAO I 6  .   ? 47.098  88.162  48.968 1.00 59.21  ? 1012 DAO A C12 1 
HETATM 5696 C  C1  . FTT J 5  .   ? 53.941  72.970  50.144 1.00 62.67  ? 1013 FTT A C1  1 
HETATM 5697 C  C2  . FTT J 5  .   ? 54.431  74.012  49.184 1.00 68.26  ? 1013 FTT A C2  1 
HETATM 5698 C  C3  . FTT J 5  .   ? 53.622  74.075  47.967 1.00 74.57  ? 1013 FTT A C3  1 
HETATM 5699 C  C4  . FTT J 5  .   ? 53.160  75.587  47.914 1.00 69.04  ? 1013 FTT A C4  1 
HETATM 5700 C  C5  . FTT J 5  .   ? 52.323  76.207  46.821 1.00 67.21  ? 1013 FTT A C5  1 
HETATM 5701 C  C6  . FTT J 5  .   ? 51.947  77.755  47.070 1.00 75.28  ? 1013 FTT A C6  1 
HETATM 5702 C  C7  . FTT J 5  .   ? 51.148  78.338  45.823 1.00 73.80  ? 1013 FTT A C7  1 
HETATM 5703 C  C8  . FTT J 5  .   ? 51.031  79.878  45.666 1.00 77.50  ? 1013 FTT A C8  1 
HETATM 5704 C  C9  . FTT J 5  .   ? 50.538  80.246  44.238 1.00 75.94  ? 1013 FTT A C9  1 
HETATM 5705 C  C10 . FTT J 5  .   ? 49.213  81.027  44.267 1.00 76.31  ? 1013 FTT A C10 1 
HETATM 5706 C  C11 . FTT J 5  .   ? 49.276  82.456  43.627 1.00 75.82  ? 1013 FTT A C11 1 
HETATM 5707 C  C12 . FTT J 5  .   ? 49.220  82.431  42.058 1.00 84.91  ? 1013 FTT A C12 1 
HETATM 5708 C  C13 . FTT J 5  .   ? 49.283  83.843  41.409 1.00 85.69  ? 1013 FTT A C13 1 
HETATM 5709 C  C14 . FTT J 5  .   ? 49.283  83.725  39.899 1.00 84.24  ? 1013 FTT A C14 1 
HETATM 5710 O  O2  . FTT J 5  .   ? 52.783  72.621  50.310 1.00 76.97  ? 1013 FTT A O2  1 
HETATM 5711 O  O3  . FTT J 5  .   ? 54.468  73.486  46.978 1.00 81.34  ? 1013 FTT A O3  1 
HETATM 5712 O  O1  . FTT J 5  .   ? 54.928  72.525  50.934 1.00 59.18  ? 1013 FTT A O1  1 
HETATM 5713 C  C1  . MYR K 7  .   ? 54.979  74.131  45.869 1.00 74.58  ? 1014 MYR A C1  1 
HETATM 5714 O  O2  . MYR K 7  .   ? 55.064  73.489  44.786 1.00 73.80  ? 1014 MYR A O2  1 
HETATM 5715 C  C2  . MYR K 7  .   ? 55.478  75.608  46.069 1.00 77.59  ? 1014 MYR A C2  1 
HETATM 5716 C  C3  . MYR K 7  .   ? 55.954  76.330  44.772 1.00 70.98  ? 1014 MYR A C3  1 
HETATM 5717 C  C4  . MYR K 7  .   ? 54.980  76.094  43.650 1.00 72.92  ? 1014 MYR A C4  1 
HETATM 5718 C  C5  . MYR K 7  .   ? 54.300  77.364  43.143 1.00 77.00  ? 1014 MYR A C5  1 
HETATM 5719 C  C6  . MYR K 7  .   ? 53.477  76.969  41.890 1.00 79.72  ? 1014 MYR A C6  1 
HETATM 5720 C  C7  . MYR K 7  .   ? 53.005  78.152  41.075 1.00 82.67  ? 1014 MYR A C7  1 
HETATM 5721 C  C8  . MYR K 7  .   ? 51.824  78.885  41.710 1.00 80.51  ? 1014 MYR A C8  1 
HETATM 5722 C  C9  . MYR K 7  .   ? 51.631  80.252  41.097 1.00 79.76  ? 1014 MYR A C9  1 
HETATM 5723 C  C10 . MYR K 7  .   ? 51.952  80.310  39.585 1.00 80.34  ? 1014 MYR A C10 1 
HETATM 5724 C  C11 . MYR K 7  .   ? 52.290  81.770  39.137 1.00 81.25  ? 1014 MYR A C11 1 
HETATM 5725 C  C12 . MYR K 7  .   ? 52.465  81.928  37.606 1.00 73.28  ? 1014 MYR A C12 1 
HETATM 5726 C  C13 . MYR K 7  .   ? 51.644  83.137  37.085 1.00 73.35  ? 1014 MYR A C13 1 
HETATM 5727 C  C14 . MYR K 7  .   ? 51.459  83.079  35.546 1.00 75.72  ? 1014 MYR A C14 1 
HETATM 5728 N  N1  . DDQ L 8  .   ? 54.317  82.650  66.142 1.00 94.11  ? 1100 DDQ A N1  1 
HETATM 5729 O  O1  . DDQ L 8  .   ? 53.229  82.359  66.986 1.00 97.58  ? 1100 DDQ A O1  1 
HETATM 5730 C  CM1 . DDQ L 8  .   ? 54.786  83.996  66.440 1.00 87.80  ? 1100 DDQ A CM1 1 
HETATM 5731 C  CM2 . DDQ L 8  .   ? 55.426  81.703  66.409 1.00 89.37  ? 1100 DDQ A CM2 1 
HETATM 5732 C  C1  . DDQ L 8  .   ? 53.825  82.558  64.686 1.00 89.31  ? 1100 DDQ A C1  1 
HETATM 5733 C  C2  . DDQ L 8  .   ? 52.923  83.789  64.379 1.00 80.43  ? 1100 DDQ A C2  1 
HETATM 5734 C  C3  . DDQ L 8  .   ? 53.179  84.365  63.018 1.00 81.20  ? 1100 DDQ A C3  1 
HETATM 5735 C  C4  . DDQ L 8  .   ? 52.260  85.551  62.819 1.00 85.98  ? 1100 DDQ A C4  1 
HETATM 5736 C  C5  . DDQ L 8  .   ? 52.409  86.196  61.440 1.00 82.65  ? 1100 DDQ A C5  1 
HETATM 5737 C  C6  . DDQ L 8  .   ? 51.980  87.668  61.473 1.00 80.27  ? 1100 DDQ A C6  1 
HETATM 5738 C  C7  . DDQ L 8  .   ? 51.201  88.065  60.214 1.00 77.30  ? 1100 DDQ A C7  1 
HETATM 5739 C  C8  . DDQ L 8  .   ? 50.794  89.538  60.251 1.00 76.05  ? 1100 DDQ A C8  1 
HETATM 5740 C  C9  . DDQ L 8  .   ? 49.716  89.851  59.166 1.00 84.30  ? 1100 DDQ A C9  1 
HETATM 5741 C  C10 . DDQ L 8  .   ? 49.271  91.348  59.098 1.00 85.89  ? 1100 DDQ A C10 1 
HETATM 5742 N  N1  . DDQ M 8  .   ? 100.094 97.634  50.092 1.00 99.36  ? 1101 DDQ A N1  1 
HETATM 5743 O  O1  . DDQ M 8  .   ? 100.594 97.363  51.365 1.00 108.90 ? 1101 DDQ A O1  1 
HETATM 5744 C  CM1 . DDQ M 8  .   ? 101.216 98.081  49.251 1.00 100.17 ? 1101 DDQ A CM1 1 
HETATM 5745 C  CM2 . DDQ M 8  .   ? 99.542  96.402  49.516 1.00 104.91 ? 1101 DDQ A CM2 1 
HETATM 5746 C  C1  . DDQ M 8  .   ? 99.036  98.725  50.253 1.00 84.68  ? 1101 DDQ A C1  1 
HETATM 5747 C  C2  . DDQ M 8  .   ? 98.414  98.964  48.862 1.00 78.01  ? 1101 DDQ A C2  1 
HETATM 5748 C  C3  . DDQ M 8  .   ? 97.280  99.946  48.849 1.00 72.00  ? 1101 DDQ A C3  1 
HETATM 5749 C  C4  . DDQ M 8  .   ? 96.793  100.041 47.394 1.00 73.20  ? 1101 DDQ A C4  1 
HETATM 5750 C  C5  . DDQ M 8  .   ? 95.622  101.022 47.282 1.00 78.26  ? 1101 DDQ A C5  1 
HETATM 5751 C  C6  . DDQ M 8  .   ? 95.165  101.323 45.823 1.00 85.20  ? 1101 DDQ A C6  1 
HETATM 5752 C  C7  . DDQ M 8  .   ? 94.136  102.455 45.925 1.00 88.21  ? 1101 DDQ A C7  1 
HETATM 5753 C  C8  . DDQ M 8  .   ? 93.492  102.937 44.621 1.00 82.60  ? 1101 DDQ A C8  1 
HETATM 5754 C  C9  . DDQ M 8  .   ? 92.308  103.945 44.951 1.00 76.08  ? 1101 DDQ A C9  1 
HETATM 5755 C  C10 . DDQ M 8  .   ? 91.368  104.286 43.767 1.00 62.13  ? 1101 DDQ A C10 1 
HETATM 5756 N  N1  . DDQ N 8  .   ? 102.133 95.223  46.574 1.00 135.96 ? 1102 DDQ A N1  1 
HETATM 5757 O  O1  . DDQ N 8  .   ? 102.274 95.420  47.944 1.00 138.09 ? 1102 DDQ A O1  1 
HETATM 5758 C  CM1 . DDQ N 8  .   ? 103.133 94.293  46.164 1.00 136.48 ? 1102 DDQ A CM1 1 
HETATM 5759 C  CM2 . DDQ N 8  .   ? 100.815 94.617  46.291 1.00 138.44 ? 1102 DDQ A CM2 1 
HETATM 5760 C  C1  . DDQ N 8  .   ? 102.441 96.572  45.898 1.00 125.78 ? 1102 DDQ A C1  1 
HETATM 5761 C  C2  . DDQ N 8  .   ? 101.568 96.753  44.641 1.00 113.99 ? 1102 DDQ A C2  1 
HETATM 5762 C  C3  . DDQ N 8  .   ? 100.305 97.549  44.964 1.00 99.97  ? 1102 DDQ A C3  1 
HETATM 5763 C  C4  . DDQ N 8  .   ? 99.486  97.638  43.697 1.00 86.66  ? 1102 DDQ A C4  1 
HETATM 5764 C  C5  . DDQ N 8  .   ? 98.197  98.420  43.896 1.00 74.32  ? 1102 DDQ A C5  1 
HETATM 5765 C  C6  . DDQ N 8  .   ? 97.327  98.382  42.611 1.00 63.34  ? 1102 DDQ A C6  1 
HETATM 5766 C  C7  . DDQ N 8  .   ? 96.124  99.300  42.789 1.00 59.39  ? 1102 DDQ A C7  1 
HETATM 5767 C  C8  . DDQ N 8  .   ? 95.246  99.256  41.573 1.00 53.67  ? 1102 DDQ A C8  1 
HETATM 5768 C  C9  . DDQ N 8  .   ? 93.917  100.041 41.796 1.00 59.36  ? 1102 DDQ A C9  1 
HETATM 5769 C  C10 . DDQ N 8  .   ? 92.825  99.672  40.757 1.00 57.12  ? 1102 DDQ A C10 1 
HETATM 5770 P  P1  . DPO O 9  .   ? 55.607  72.750  61.884 1.00 75.09  ? 2000 DPO A P1  1 
HETATM 5771 O  O1  . DPO O 9  .   ? 55.011  71.426  62.152 1.00 82.52  ? 2000 DPO A O1  1 
HETATM 5772 O  O2  . DPO O 9  .   ? 56.902  72.671  61.122 1.00 73.90  ? 2000 DPO A O2  1 
HETATM 5773 O  O4  . DPO O 9  .   ? 55.539  73.765  63.047 1.00 73.37  ? 2000 DPO A O4  1 
HETATM 5774 P  P2  . DPO O 9  .   ? 54.768  75.059  63.137 0.60 68.69  ? 2000 DPO A P2  1 
HETATM 5775 O  O5  . DPO O 9  .   ? 55.643  76.195  62.733 0.60 69.77  ? 2000 DPO A O5  1 
HETATM 5776 O  O6  . DPO O 9  .   ? 53.609  74.994  62.253 0.60 56.27  ? 2000 DPO A O6  1 
HETATM 5777 O  O7  . DPO O 9  .   ? 54.310  75.279  64.522 0.60 63.39  ? 2000 DPO A O7  1 
HETATM 5778 P  P1  . DPO P 9  .   ? 57.738  59.978  60.184 1.00 73.61  ? 2004 DPO A P1  1 
HETATM 5779 O  O2  . DPO P 9  .   ? 57.364  58.870  59.267 1.00 64.92  ? 2004 DPO A O2  1 
HETATM 5780 O  O3  . DPO P 9  .   ? 59.133  60.038  60.680 1.00 77.30  ? 2004 DPO A O3  1 
HETATM 5781 O  O4  . DPO P 9  .   ? 56.724  60.461  61.095 1.00 82.85  ? 2004 DPO A O4  1 
HETATM 5782 P  P2  . DPO P 9  .   ? 57.219  60.811  62.532 1.00 89.10  ? 2004 DPO A P2  1 
HETATM 5783 O  O5  . DPO P 9  .   ? 58.052  59.578  63.083 1.00 92.57  ? 2004 DPO A O5  1 
HETATM 5784 O  O6  . DPO P 9  .   ? 58.308  61.961  62.671 1.00 91.73  ? 2004 DPO A O6  1 
HETATM 5785 O  O7  . DPO P 9  .   ? 55.901  61.328  63.366 1.00 86.80  ? 2004 DPO A O7  1 
HETATM 5786 C  C1  . GOL Q 10 .   ? 54.936  85.584  69.441 1.00 83.10  ? 1103 GOL A C1  1 
HETATM 5787 O  O1  . GOL Q 10 .   ? 55.902  84.318  69.855 1.00 83.07  ? 1103 GOL A O1  1 
HETATM 5788 C  C2  . GOL Q 10 .   ? 55.157  86.688  70.295 1.00 81.52  ? 1103 GOL A C2  1 
HETATM 5789 O  O2  . GOL Q 10 .   ? 56.163  86.365  71.158 1.00 83.19  ? 1103 GOL A O2  1 
HETATM 5790 C  C3  . GOL Q 10 .   ? 55.509  87.685  69.654 1.00 81.38  ? 1103 GOL A C3  1 
HETATM 5791 O  O3  . GOL Q 10 .   ? 54.334  88.320  68.814 1.00 83.20  ? 1103 GOL A O3  1 
HETATM 5792 C  C1  . GOL R 10 .   ? 74.996  85.655  18.403 1.00 81.78  ? 1104 GOL A C1  1 
HETATM 5793 O  O1  . GOL R 10 .   ? 74.423  84.116  18.529 1.00 78.34  ? 1104 GOL A O1  1 
HETATM 5794 C  C2  . GOL R 10 .   ? 75.002  86.287  19.674 1.00 86.96  ? 1104 GOL A C2  1 
HETATM 5795 O  O2  . GOL R 10 .   ? 75.010  85.320  20.629 1.00 97.21  ? 1104 GOL A O2  1 
HETATM 5796 C  C3  . GOL R 10 .   ? 75.998  86.998  19.828 1.00 80.47  ? 1104 GOL A C3  1 
HETATM 5797 O  O3  . GOL R 10 .   ? 75.864  88.371  19.099 1.00 84.56  ? 1104 GOL A O3  1 
HETATM 5798 C  C1  . GOL S 10 .   ? 65.945  113.358 49.432 1.00 103.90 ? 1105 GOL A C1  1 
HETATM 5799 O  O1  . GOL S 10 .   ? 64.336  113.047 49.173 1.00 91.67  ? 1105 GOL A O1  1 
HETATM 5800 C  C2  . GOL S 10 .   ? 66.287  114.767 49.646 1.00 104.35 ? 1105 GOL A C2  1 
HETATM 5801 O  O2  . GOL S 10 .   ? 67.348  115.096 48.831 1.00 99.93  ? 1105 GOL A O2  1 
HETATM 5802 C  C3  . GOL S 10 .   ? 66.660  114.973 50.819 1.00 102.10 ? 1105 GOL A C3  1 
HETATM 5803 O  O3  . GOL S 10 .   ? 65.439  115.012 51.804 1.00 100.02 ? 1105 GOL A O3  1 
HETATM 5804 C  C1  . GOL T 10 .   ? 62.294  109.588 55.284 1.00 93.46  ? 1106 GOL A C1  1 
HETATM 5805 O  O1  . GOL T 10 .   ? 60.751  109.091 55.376 1.00 86.94  ? 1106 GOL A O1  1 
HETATM 5806 C  C2  . GOL T 10 .   ? 62.361  110.988 55.288 1.00 100.76 ? 1106 GOL A C2  1 
HETATM 5807 O  O2  . GOL T 10 .   ? 62.164  111.463 54.027 1.00 104.13 ? 1106 GOL A O2  1 
HETATM 5808 C  C3  . GOL T 10 .   ? 63.466  111.325 55.658 1.00 102.98 ? 1106 GOL A C3  1 
HETATM 5809 O  O3  . GOL T 10 .   ? 63.482  111.530 57.213 1.00 101.48 ? 1106 GOL A O3  1 
HETATM 5810 C  C1  . GOL U 10 .   ? 77.498  77.267  52.507 1.00 74.88  ? 1107 GOL A C1  1 
HETATM 5811 O  O1  . GOL U 10 .   ? 76.450  78.500  52.168 1.00 88.26  ? 1107 GOL A O1  1 
HETATM 5812 C  C2  . GOL U 10 .   ? 77.328  76.222  51.561 1.00 79.08  ? 1107 GOL A C2  1 
HETATM 5813 O  O2  . GOL U 10 .   ? 76.443  76.649  50.563 1.00 82.19  ? 1107 GOL A O2  1 
HETATM 5814 C  C3  . GOL U 10 .   ? 78.411  75.827  51.015 1.00 78.45  ? 1107 GOL A C3  1 
HETATM 5815 O  O3  . GOL U 10 .   ? 79.736  75.874  51.905 1.00 82.76  ? 1107 GOL A O3  1 
HETATM 5816 C  C1  . GOL V 10 .   ? 82.191  69.333  50.816 1.00 61.08  ? 1108 GOL A C1  1 
HETATM 5817 O  O1  . GOL V 10 .   ? 82.158  70.468  49.669 1.00 46.43  ? 1108 GOL A O1  1 
HETATM 5818 C  C2  . GOL V 10 .   ? 82.441  69.874  52.107 1.00 77.26  ? 1108 GOL A C2  1 
HETATM 5819 O  O2  . GOL V 10 .   ? 81.912  71.131  52.142 1.00 99.48  ? 1108 GOL A O2  1 
HETATM 5820 C  C3  . GOL V 10 .   ? 81.871  69.175  52.978 1.00 83.03  ? 1108 GOL A C3  1 
HETATM 5821 O  O3  . GOL V 10 .   ? 82.827  68.710  54.190 1.00 91.33  ? 1108 GOL A O3  1 
HETATM 5822 C  C1  . GOL W 10 .   ? 78.150  74.159  55.109 1.00 95.30  ? 1109 GOL A C1  1 
HETATM 5823 O  O1  . GOL W 10 .   ? 76.816  75.100  54.966 1.00 94.67  ? 1109 GOL A O1  1 
HETATM 5824 C  C2  . GOL W 10 .   ? 77.999  72.929  54.448 1.00 93.47  ? 1109 GOL A C2  1 
HETATM 5825 O  O2  . GOL W 10 .   ? 77.651  73.152  53.187 1.00 98.47  ? 1109 GOL A O2  1 
HETATM 5826 C  C3  . GOL W 10 .   ? 79.060  72.318  54.466 1.00 94.32  ? 1109 GOL A C3  1 
HETATM 5827 O  O3  . GOL W 10 .   ? 78.871  70.887  53.824 1.00 88.78  ? 1109 GOL A O3  1 
HETATM 5828 C  C1  . GOL X 10 .   ? 71.934  78.541  58.310 1.00 99.83  ? 1110 GOL A C1  1 
HETATM 5829 O  O1  . GOL X 10 .   ? 70.478  77.965  57.706 1.00 74.60  ? 1110 GOL A O1  1 
HETATM 5830 C  C2  . GOL X 10 .   ? 73.136  77.724  58.010 1.00 105.50 ? 1110 GOL A C2  1 
HETATM 5831 O  O2  . GOL X 10 .   ? 73.747  77.367  59.197 1.00 111.49 ? 1110 GOL A O2  1 
HETATM 5832 C  C3  . GOL X 10 .   ? 72.870  76.708  57.303 1.00 107.83 ? 1110 GOL A C3  1 
HETATM 5833 O  O3  . GOL X 10 .   ? 74.113  75.756  57.005 1.00 100.66 ? 1110 GOL A O3  1 
HETATM 5834 O  O   . HOH Y 11 .   ? 71.546  86.105  44.072 1.00 36.03  ? 2006 HOH A O   1 
HETATM 5835 O  O   . HOH Y 11 .   ? 66.701  87.447  60.257 1.00 39.16  ? 2007 HOH A O   1 
HETATM 5836 O  O   . HOH Y 11 .   ? 77.909  101.156 58.350 1.00 52.27  ? 2008 HOH A O   1 
HETATM 5837 O  O   . HOH Y 11 .   ? 72.108  87.054  32.778 1.00 31.31  ? 2009 HOH A O   1 
HETATM 5838 O  O   . HOH Y 11 .   ? 74.459  94.619  24.477 1.00 57.66  ? 2010 HOH A O   1 
HETATM 5839 O  O   . HOH Y 11 .   ? 59.290  88.290  40.385 1.00 40.84  ? 2011 HOH A O   1 
HETATM 5840 O  O   . HOH Y 11 .   ? 83.608  98.783  31.708 1.00 50.63  ? 2012 HOH A O   1 
HETATM 5841 O  O   . HOH Y 11 .   ? 87.136  98.730  48.129 1.00 47.32  ? 2013 HOH A O   1 
HETATM 5842 O  O   . HOH Y 11 .   ? 62.875  84.295  55.462 1.00 53.69  ? 2014 HOH A O   1 
HETATM 5843 O  O   . HOH Y 11 .   ? 83.102  64.427  52.377 1.00 53.43  ? 2015 HOH A O   1 
HETATM 5844 O  O   . HOH Y 11 .   ? 78.059  73.703  41.562 1.00 46.35  ? 2016 HOH A O   1 
HETATM 5845 O  O   . HOH Y 11 .   ? 89.717  86.877  37.255 1.00 43.41  ? 2017 HOH A O   1 
HETATM 5846 O  O   . HOH Y 11 .   ? 76.927  96.863  27.862 1.00 45.94  ? 2018 HOH A O   1 
HETATM 5847 O  O   . HOH Y 11 .   ? 62.947  91.595  56.830 1.00 43.00  ? 2019 HOH A O   1 
HETATM 5848 O  O   . HOH Y 11 .   ? 73.110  86.315  41.054 1.00 33.10  ? 2020 HOH A O   1 
HETATM 5849 O  O   . HOH Y 11 .   ? 92.838  83.725  51.230 1.00 40.72  ? 2021 HOH A O   1 
HETATM 5850 O  O   . HOH Y 11 .   ? 60.405  58.330  60.459 1.00 56.25  ? 2022 HOH A O   1 
HETATM 5851 O  O   . HOH Y 11 .   ? 80.488  82.342  43.549 1.00 36.74  ? 2023 HOH A O   1 
HETATM 5852 O  O   . HOH Y 11 .   ? 79.908  96.968  49.507 1.00 50.91  ? 2024 HOH A O   1 
HETATM 5853 O  O   . HOH Y 11 .   ? 50.828  71.578  53.964 1.00 51.18  ? 2025 HOH A O   1 
HETATM 5854 O  O   . HOH Y 11 .   ? 69.903  87.490  58.031 1.00 61.03  ? 2026 HOH A O   1 
HETATM 5855 O  O   . HOH Y 11 .   ? 97.004  70.441  51.122 1.00 48.45  ? 2027 HOH A O   1 
HETATM 5856 O  O   . HOH Y 11 .   ? 80.812  101.969 43.428 1.00 62.57  ? 2028 HOH A O   1 
HETATM 5857 O  O   . HOH Y 11 .   ? 61.138  88.378  42.196 1.00 47.16  ? 2029 HOH A O   1 
HETATM 5858 O  O   . HOH Y 11 .   ? 58.172  72.680  55.138 1.00 42.39  ? 2030 HOH A O   1 
HETATM 5859 O  O   . HOH Y 11 .   ? 89.932  95.736  53.159 1.00 54.91  ? 2031 HOH A O   1 
HETATM 5860 O  O   . HOH Y 11 .   ? 71.180  93.746  29.994 1.00 40.87  ? 2032 HOH A O   1 
HETATM 5861 O  O   . HOH Y 11 .   ? 63.453  98.112  35.172 1.00 66.62  ? 2033 HOH A O   1 
HETATM 5862 O  O   . HOH Y 11 .   ? 85.234  76.105  44.352 1.00 57.25  ? 2034 HOH A O   1 
HETATM 5863 O  O   . HOH Y 11 .   ? 41.216  108.359 46.301 1.00 69.13  ? 2035 HOH A O   1 
HETATM 5864 O  O   . HOH Y 11 .   ? 77.949  80.788  50.497 1.00 48.87  ? 2036 HOH A O   1 
HETATM 5865 O  O   . HOH Y 11 .   ? 100.596 62.280  37.577 1.00 58.52  ? 2037 HOH A O   1 
HETATM 5866 O  O   . HOH Y 11 .   ? 71.263  85.069  46.742 1.00 38.37  ? 2038 HOH A O   1 
HETATM 5867 O  O   . HOH Y 11 .   ? 77.605  85.184  54.748 1.00 51.77  ? 2039 HOH A O   1 
HETATM 5868 O  O   . HOH Y 11 .   ? 74.313  92.755  60.263 1.00 53.31  ? 2040 HOH A O   1 
HETATM 5869 O  O   . HOH Y 11 .   ? 89.134  74.893  43.745 1.00 50.86  ? 2041 HOH A O   1 
HETATM 5870 O  O   . HOH Y 11 .   ? 73.617  77.611  36.463 1.00 38.25  ? 2042 HOH A O   1 
HETATM 5871 O  O   . HOH Y 11 .   ? 68.298  76.463  46.947 1.00 53.54  ? 2043 HOH A O   1 
HETATM 5872 O  O   . HOH Y 11 .   ? 98.398  83.371  46.081 1.00 43.24  ? 2044 HOH A O   1 
HETATM 5873 O  O   . HOH Y 11 .   ? 87.173  89.696  46.134 1.00 59.88  ? 2045 HOH A O   1 
HETATM 5874 O  O   . HOH Y 11 .   ? 72.035  74.672  60.657 1.00 58.89  ? 2046 HOH A O   1 
HETATM 5875 O  O   . HOH Y 11 .   ? 79.496  89.998  30.703 1.00 66.13  ? 2047 HOH A O   1 
HETATM 5876 O  O   . HOH Y 11 .   ? 77.605  106.055 37.172 1.00 63.95  ? 2048 HOH A O   1 
HETATM 5877 O  O   . HOH Y 11 .   ? 81.288  93.822  35.681 1.00 54.97  ? 2049 HOH A O   1 
HETATM 5878 O  O   . HOH Y 11 .   ? 49.691  98.410  37.165 1.00 52.66  ? 2050 HOH A O   1 
HETATM 5879 O  O   . HOH Y 11 .   ? 68.210  79.270  68.464 1.00 55.04  ? 2051 HOH A O   1 
HETATM 5880 O  O   . HOH Y 11 .   ? 80.413  83.006  46.289 1.00 40.10  ? 2052 HOH A O   1 
HETATM 5881 O  O   . HOH Y 11 .   ? 83.083  86.300  48.017 1.00 38.03  ? 2053 HOH A O   1 
HETATM 5882 O  O   . HOH Y 11 .   ? 86.282  77.877  42.644 1.00 50.67  ? 2054 HOH A O   1 
HETATM 5883 O  O   . HOH Y 11 .   ? 73.423  92.274  69.847 1.00 67.18  ? 2055 HOH A O   1 
HETATM 5884 O  O   . HOH Y 11 .   ? 81.386  102.682 53.457 1.00 61.86  ? 2056 HOH A O   1 
HETATM 5885 O  O   . HOH Y 11 .   ? 62.052  87.540  60.932 1.00 55.11  ? 2057 HOH A O   1 
HETATM 5886 O  O   . HOH Y 11 .   ? 47.346  99.558  26.911 1.00 81.40  ? 2058 HOH A O   1 
HETATM 5887 O  O   . HOH Y 11 .   ? 93.478  87.038  55.505 1.00 47.90  ? 2059 HOH A O   1 
HETATM 5888 O  O   . HOH Y 11 .   ? 62.916  89.513  39.353 1.00 49.33  ? 2060 HOH A O   1 
HETATM 5889 O  O   . HOH Y 11 .   ? 85.427  69.002  43.353 1.00 50.88  ? 2061 HOH A O   1 
HETATM 5890 O  O   . HOH Y 11 .   ? 60.282  83.633  52.240 1.00 57.95  ? 2062 HOH A O   1 
HETATM 5891 O  O   . HOH Y 11 .   ? 69.410  87.809  29.161 1.00 47.01  ? 2063 HOH A O   1 
HETATM 5892 O  O   . HOH Y 11 .   ? 61.910  73.850  44.243 1.00 40.47  ? 2064 HOH A O   1 
HETATM 5893 O  O   . HOH Y 11 .   ? 66.696  68.102  43.693 1.00 55.87  ? 2065 HOH A O   1 
HETATM 5894 O  O   . HOH Y 11 .   ? 92.501  84.241  73.786 1.00 69.66  ? 2066 HOH A O   1 
HETATM 5895 O  O   . HOH Y 11 .   ? 90.300  77.877  68.767 1.00 69.17  ? 2067 HOH A O   1 
HETATM 5896 O  O   . HOH Y 11 .   ? 84.994  96.503  49.006 1.00 63.22  ? 2068 HOH A O   1 
HETATM 5897 O  O   . HOH Y 11 .   ? 76.502  101.954 41.472 1.00 69.70  ? 2069 HOH A O   1 
HETATM 5898 O  O   . HOH Y 11 .   ? 98.532  87.423  41.812 1.00 58.59  ? 2070 HOH A O   1 
HETATM 5899 O  O   . HOH Y 11 .   ? 97.173  85.615  44.565 1.00 59.23  ? 2071 HOH A O   1 
HETATM 5900 O  O   . HOH Y 11 .   ? 66.720  79.926  50.571 1.00 38.30  ? 2072 HOH A O   1 
HETATM 5901 O  O   . HOH Y 11 .   ? 85.848  96.800  55.690 1.00 53.40  ? 2073 HOH A O   1 
HETATM 5902 O  O   . HOH Y 11 .   ? 60.490  87.787  56.873 1.00 50.07  ? 2074 HOH A O   1 
HETATM 5903 O  O   . HOH Y 11 .   ? 70.649  84.361  52.052 1.00 55.56  ? 2075 HOH A O   1 
HETATM 5904 O  O   . HOH Y 11 .   ? 83.078  84.491  45.396 1.00 37.97  ? 2076 HOH A O   1 
HETATM 5905 O  O   . HOH Y 11 .   ? 80.041  79.461  49.440 1.00 53.22  ? 2077 HOH A O   1 
HETATM 5906 O  O   . HOH Y 11 .   ? 73.846  82.561  34.946 1.00 48.13  ? 2078 HOH A O   1 
HETATM 5907 O  O   . HOH Y 11 .   ? 104.146 70.149  48.154 1.00 63.23  ? 2079 HOH A O   1 
HETATM 5908 O  O   . HOH Y 11 .   ? 74.461  90.744  34.457 1.00 48.63  ? 2080 HOH A O   1 
HETATM 5909 O  O   . HOH Y 11 .   ? 85.184  92.156  54.190 1.00 43.59  ? 2081 HOH A O   1 
HETATM 5910 O  O   . HOH Y 11 .   ? 76.629  88.853  32.287 1.00 60.10  ? 2082 HOH A O   1 
HETATM 5911 O  O   . HOH Y 11 .   ? 73.432  86.138  58.665 1.00 57.25  ? 2083 HOH A O   1 
HETATM 5912 O  O   . HOH Y 11 .   ? 58.473  86.585  45.105 1.00 56.55  ? 2084 HOH A O   1 
HETATM 5913 O  O   . HOH Y 11 .   ? 69.075  71.339  75.172 1.00 66.94  ? 2085 HOH A O   1 
HETATM 5914 O  O   . HOH Y 11 .   ? 82.739  74.918  50.683 1.00 68.55  ? 2086 HOH A O   1 
HETATM 5915 O  O   . HOH Y 11 .   ? 59.016  72.539  44.417 1.00 52.03  ? 2087 HOH A O   1 
HETATM 5916 O  O   . HOH Y 11 .   ? 67.724  73.598  62.456 1.00 48.66  ? 2088 HOH A O   1 
HETATM 5917 O  O   . HOH Y 11 .   ? 103.547 77.224  53.706 1.00 62.07  ? 2089 HOH A O   1 
HETATM 5918 O  O   . HOH Y 11 .   ? 83.374  87.223  41.673 1.00 49.85  ? 2090 HOH A O   1 
HETATM 5919 O  O   . HOH Y 11 .   ? 83.730  95.477  36.051 1.00 65.35  ? 2091 HOH A O   1 
HETATM 5920 O  O   . HOH Y 11 .   ? 74.551  84.024  37.422 1.00 54.77  ? 2092 HOH A O   1 
HETATM 5921 O  O   . HOH Y 11 .   ? 75.377  94.607  27.182 1.00 47.75  ? 2093 HOH A O   1 
HETATM 5922 O  O   . HOH Y 11 .   ? 82.635  95.439  33.336 1.00 60.51  ? 2094 HOH A O   1 
HETATM 5923 O  O   . HOH Y 11 .   ? 65.906  95.200  30.363 1.00 69.55  ? 2095 HOH A O   1 
HETATM 5924 O  O   . HOH Y 11 .   ? 60.408  90.078  38.297 1.00 38.42  ? 2096 HOH A O   1 
HETATM 5925 O  O   . HOH Y 11 .   ? 64.252  85.584  57.728 1.00 53.22  ? 2097 HOH A O   1 
HETATM 5926 O  O   . HOH Y 11 .   ? 93.344  91.446  33.902 1.00 63.99  ? 2098 HOH A O   1 
HETATM 5927 O  O   . HOH Y 11 .   ? 76.835  101.639 73.599 1.00 64.33  ? 2099 HOH A O   1 
HETATM 5928 O  O   . HOH Y 11 .   ? 81.072  70.218  47.418 1.00 57.35  ? 2100 HOH A O   1 
HETATM 5929 O  O   . HOH Y 11 .   ? 52.508  87.665  33.129 1.00 42.66  ? 2101 HOH A O   1 
HETATM 5930 O  O   . HOH Y 11 .   ? 79.275  104.135 34.132 1.00 77.79  ? 2102 HOH A O   1 
HETATM 5931 O  O   . HOH Y 11 .   ? 97.692  103.160 52.284 1.00 55.78  ? 2103 HOH A O   1 
HETATM 5932 O  O   . HOH Y 11 .   ? 84.029  77.015  52.994 1.00 62.41  ? 2104 HOH A O   1 
HETATM 5933 O  O   . HOH Y 11 .   ? 59.907  90.093  35.593 1.00 41.92  ? 2105 HOH A O   1 
HETATM 5934 O  O   . HOH Y 11 .   ? 73.512  77.507  53.569 1.00 56.95  ? 2106 HOH A O   1 
HETATM 5935 O  O   . HOH Y 11 .   ? 73.667  84.058  39.997 1.00 51.28  ? 2107 HOH A O   1 
HETATM 5936 O  O   . HOH Y 11 .   ? 84.714  66.423  55.738 1.00 71.11  ? 2108 HOH A O   1 
HETATM 5937 O  O   . HOH Y 11 .   ? 71.033  81.531  53.562 1.00 49.52  ? 2109 HOH A O   1 
HETATM 5938 O  O   . HOH Y 11 .   ? 71.789  80.518  69.823 1.00 78.24  ? 2110 HOH A O   1 
HETATM 5939 O  O   . HOH Y 11 .   ? 82.346  105.070 52.656 1.00 60.13  ? 2111 HOH A O   1 
HETATM 5940 O  O   . HOH Y 11 .   ? 68.309  102.695 64.260 1.00 58.27  ? 2112 HOH A O   1 
HETATM 5941 O  O   . HOH Y 11 .   ? 66.106  101.197 62.975 1.00 53.23  ? 2113 HOH A O   1 
HETATM 5942 O  O   . HOH Y 11 .   ? 72.467  94.544  27.352 1.00 71.71  ? 2114 HOH A O   1 
HETATM 5943 O  O   . HOH Y 11 .   ? 63.063  80.227  30.103 1.00 58.21  ? 2115 HOH A O   1 
HETATM 5944 O  O   . HOH Y 11 .   ? 87.315  88.028  35.830 1.00 52.51  ? 2116 HOH A O   1 
HETATM 5945 O  O   . HOH Y 11 .   ? 69.107  81.173  50.259 1.00 45.27  ? 2117 HOH A O   1 
HETATM 5946 O  O   . HOH Y 11 .   ? 72.588  84.061  56.823 1.00 49.22  ? 2118 HOH A O   1 
HETATM 5947 O  O   . HOH Y 11 .   ? 67.356  102.255 72.741 1.00 66.51  ? 2119 HOH A O   1 
HETATM 5948 O  O   . HOH Y 11 .   ? 72.721  79.401  77.440 1.00 58.51  ? 2120 HOH A O   1 
HETATM 5949 O  O   . HOH Y 11 .   ? 100.911 59.820  57.149 1.00 68.64  ? 2121 HOH A O   1 
HETATM 5950 O  O   . HOH Y 11 .   ? 75.996  105.769 39.697 1.00 68.27  ? 2122 HOH A O   1 
HETATM 5951 O  O   . HOH Y 11 .   ? 54.374  104.366 62.959 1.00 66.67  ? 2123 HOH A O   1 
HETATM 5952 O  O   . HOH Y 11 .   ? 67.125  91.850  68.053 1.00 73.54  ? 2124 HOH A O   1 
HETATM 5953 O  O   . HOH Y 11 .   ? 90.584  76.248  41.898 1.00 53.88  ? 2125 HOH A O   1 
HETATM 5954 O  O   . HOH Y 11 .   ? 88.865  79.603  57.360 1.00 48.46  ? 2126 HOH A O   1 
HETATM 5955 O  O   . HOH Y 11 .   ? 103.296 81.321  51.526 1.00 48.22  ? 2127 HOH A O   1 
HETATM 5956 O  O   . HOH Y 11 .   ? 87.801  60.416  39.465 1.00 56.57  ? 2128 HOH A O   1 
HETATM 5957 O  O   . HOH Y 11 .   ? 62.326  83.171  50.407 1.00 56.43  ? 2129 HOH A O   1 
HETATM 5958 O  O   . HOH Y 11 .   ? 76.956  103.261 45.691 1.00 64.88  ? 2130 HOH A O   1 
HETATM 5959 O  O   . HOH Y 11 .   ? 41.610  100.070 46.710 1.00 61.16  ? 2131 HOH A O   1 
HETATM 5960 O  O   . HOH Y 11 .   ? 90.684  75.279  39.178 1.00 60.39  ? 2132 HOH A O   1 
HETATM 5961 O  O   . HOH Y 11 .   ? 45.468  91.148  41.284 1.00 69.35  ? 2133 HOH A O   1 
HETATM 5962 O  O   . HOH Y 11 .   ? 80.490  80.253  47.005 1.00 42.05  ? 2134 HOH A O   1 
HETATM 5963 O  O   . HOH Y 11 .   ? 94.339  94.806  70.466 1.00 73.09  ? 2135 HOH A O   1 
HETATM 5964 O  O   . HOH Y 11 .   ? 82.818  86.901  74.031 1.00 66.47  ? 2136 HOH A O   1 
HETATM 5965 O  O   . HOH Y 11 .   ? 70.358  77.467  63.436 1.00 50.38  ? 2137 HOH A O   1 
HETATM 5966 O  O   . HOH Y 11 .   ? 105.382 56.215  47.575 1.00 64.60  ? 2138 HOH A O   1 
HETATM 5967 O  O   . HOH Y 11 .   ? 84.162  55.046  47.643 1.00 61.59  ? 2139 HOH A O   1 
HETATM 5968 O  O   . HOH Y 11 .   ? 66.820  80.568  65.199 1.00 66.74  ? 2140 HOH A O   1 
HETATM 5969 O  O   . HOH Y 11 .   ? 52.153  104.455 49.631 1.00 64.48  ? 2141 HOH A O   1 
HETATM 5970 O  O   . HOH Y 11 .   ? 87.232  83.512  68.846 1.00 69.34  ? 2142 HOH A O   1 
HETATM 5971 O  O   . HOH Y 11 .   ? 71.403  110.114 61.330 1.00 70.47  ? 2143 HOH A O   1 
HETATM 5972 O  O   . HOH Y 11 .   ? 86.315  94.626  54.112 1.00 47.89  ? 2144 HOH A O   1 
HETATM 5973 O  O   . HOH Y 11 .   ? 86.765  92.679  43.050 1.00 59.36  ? 2145 HOH A O   1 
HETATM 5974 O  O   . HOH Y 11 .   ? 54.442  90.601  59.473 1.00 51.49  ? 2146 HOH A O   1 
HETATM 5975 O  O   . HOH Y 11 .   ? 71.668  81.774  63.044 1.00 53.03  ? 2147 HOH A O   1 
HETATM 5976 O  O   . HOH Y 11 .   ? 103.771 56.889  56.712 1.00 68.79  ? 2148 HOH A O   1 
HETATM 5977 O  O   . HOH Y 11 .   ? 63.367  65.653  48.982 1.00 60.28  ? 2149 HOH A O   1 
HETATM 5978 O  O   . HOH Y 11 .   ? 67.118  70.628  73.449 1.00 76.08  ? 2150 HOH A O   1 
HETATM 5979 O  O   . HOH Y 11 .   ? 91.196  106.843 47.453 1.00 79.11  ? 2151 HOH A O   1 
HETATM 5980 O  O   . HOH Y 11 .   ? 51.505  69.570  47.375 1.00 58.92  ? 2152 HOH A O   1 
HETATM 5981 O  O   . HOH Y 11 .   ? 68.058  95.293  32.717 1.00 55.36  ? 2153 HOH A O   1 
HETATM 5982 O  O   . HOH Y 11 .   ? 72.436  109.867 33.005 1.00 68.45  ? 2154 HOH A O   1 
HETATM 5983 O  O   . HOH Y 11 .   ? 43.071  92.521  41.506 1.00 64.33  ? 2155 HOH A O   1 
HETATM 5984 O  O   . HOH Y 11 .   ? 88.901  87.643  46.868 1.00 64.29  ? 2156 HOH A O   1 
HETATM 5985 O  O   . HOH Y 11 .   ? 75.121  88.741  64.632 1.00 54.16  ? 2157 HOH A O   1 
HETATM 5986 O  O   . HOH Y 11 .   ? 51.954  68.387  49.986 1.00 67.38  ? 2158 HOH A O   1 
HETATM 5987 O  O   . HOH Y 11 .   ? 50.432  117.187 52.731 1.00 70.90  ? 2159 HOH A O   1 
HETATM 5988 O  O   . HOH Y 11 .   ? 101.720 88.379  50.077 1.00 55.06  ? 2160 HOH A O   1 
HETATM 5989 O  O   . HOH Y 11 .   ? 88.704  87.556  42.389 1.00 62.00  ? 2161 HOH A O   1 
HETATM 5990 O  O   . HOH Y 11 .   ? 60.066  88.547  46.503 1.00 59.46  ? 2162 HOH A O   1 
HETATM 5991 O  O   . HOH Y 11 .   ? 78.652  108.409 37.193 1.00 82.78  ? 2163 HOH A O   1 
HETATM 5992 O  O   . HOH Y 11 .   ? 77.920  94.121  61.192 1.00 86.03  ? 2164 HOH A O   1 
HETATM 5993 O  O   . HOH Y 11 .   ? 105.693 67.136  34.528 1.00 63.30  ? 2165 HOH A O   1 
HETATM 5994 O  O   . HOH Y 11 .   ? 75.919  104.946 48.402 1.00 45.50  ? 2166 HOH A O   1 
HETATM 5995 O  O   . HOH Y 11 .   ? 67.715  70.011  42.440 1.00 69.27  ? 2167 HOH A O   1 
HETATM 5996 O  O   . HOH Y 11 .   ? 86.530  82.743  30.256 1.00 79.30  ? 2168 HOH A O   1 
HETATM 5997 O  O   . HOH Y 11 .   ? 76.683  61.418  39.144 1.00 46.48  ? 2169 HOH A O   1 
HETATM 5998 O  O   . HOH Y 11 .   ? 76.567  85.683  51.234 1.00 61.10  ? 2170 HOH A O   1 
HETATM 5999 O  O   . HOH Y 11 .   ? 77.626  70.919  37.895 1.00 50.93  ? 2171 HOH A O   1 
HETATM 6000 O  O   . HOH Y 11 .   ? 89.028  98.968  68.874 1.00 68.74  ? 2172 HOH A O   1 
HETATM 6001 O  O   . HOH Y 11 .   ? 77.382  78.626  65.218 1.00 57.97  ? 2173 HOH A O   1 
HETATM 6002 O  O   . HOH Y 11 .   ? 88.209  106.156 45.370 1.00 68.93  ? 2174 HOH A O   1 
HETATM 6003 O  O   . HOH Y 11 .   ? 74.988  79.069  18.498 1.00 73.16  ? 2175 HOH A O   1 
HETATM 6004 O  O   . HOH Y 11 .   ? 79.489  100.730 41.243 1.00 47.18  ? 2176 HOH A O   1 
HETATM 6005 O  O   . HOH Y 11 .   ? 76.448  105.380 51.652 1.00 61.44  ? 2177 HOH A O   1 
HETATM 6006 O  O   . HOH Y 11 .   ? 83.488  93.533  30.888 1.00 53.58  ? 2178 HOH A O   1 
HETATM 6007 O  O   . HOH Y 11 .   ? 61.010  70.401  41.601 1.00 66.78  ? 2179 HOH A O   1 
HETATM 6008 O  O   . HOH Y 11 .   ? 56.225  97.790  42.702 1.00 62.38  ? 2180 HOH A O   1 
HETATM 6009 O  O   . HOH Y 11 .   ? 82.774  54.878  50.087 1.00 56.64  ? 2181 HOH A O   1 
HETATM 6010 O  O   . HOH Y 11 .   ? 61.604  95.963  47.820 1.00 69.87  ? 2182 HOH A O   1 
HETATM 6011 O  O   . HOH Y 11 .   ? 64.403  101.974 70.892 1.00 54.65  ? 2183 HOH A O   1 
HETATM 6012 O  O   . HOH Y 11 .   ? 60.264  94.043  54.202 1.00 46.07  ? 2184 HOH A O   1 
HETATM 6013 O  O   . HOH Y 11 .   ? 88.663  92.011  46.536 1.00 65.54  ? 2185 HOH A O   1 
HETATM 6014 O  O   . HOH Y 11 .   ? 65.071  65.545  51.922 1.00 58.57  ? 2186 HOH A O   1 
HETATM 6015 O  O   . HOH Y 11 .   ? 86.081  81.819  64.018 1.00 64.35  ? 2187 HOH A O   1 
HETATM 6016 O  O   . HOH Y 11 .   ? 98.463  83.249  42.867 1.00 64.65  ? 2188 HOH A O   1 
HETATM 6017 O  O   . HOH Y 11 .   ? 97.011  60.374  39.860 1.00 60.87  ? 2189 HOH A O   1 
HETATM 6018 O  O   . HOH Y 11 .   ? 60.716  89.759  76.900 1.00 66.24  ? 2190 HOH A O   1 
HETATM 6019 O  O   . HOH Y 11 .   ? 92.287  73.071  60.279 1.00 73.22  ? 2191 HOH A O   1 
HETATM 6020 O  O   . HOH Y 11 .   ? 75.504  91.284  75.878 1.00 80.44  ? 2192 HOH A O   1 
HETATM 6021 O  O   . HOH Y 11 .   ? 47.929  90.626  41.387 1.00 74.16  ? 2193 HOH A O   1 
HETATM 6022 O  O   . HOH Y 11 .   ? 60.013  97.141  50.558 1.00 64.64  ? 2194 HOH A O   1 
HETATM 6023 O  O   . HOH Y 11 .   ? 88.677  114.049 23.150 1.00 70.70  ? 2195 HOH A O   1 
HETATM 6024 O  O   . HOH Y 11 .   ? 80.659  84.483  39.849 1.00 65.73  ? 2196 HOH A O   1 
HETATM 6025 O  O   . HOH Y 11 .   ? 51.916  60.083  61.290 1.00 74.95  ? 2197 HOH A O   1 
HETATM 6026 O  O   . HOH Y 11 .   ? 43.139  99.517  49.174 1.00 80.62  ? 2198 HOH A O   1 
HETATM 6027 O  O   . HOH Y 11 .   ? 73.694  90.968  77.797 1.00 84.67  ? 2199 HOH A O   1 
HETATM 6028 O  O   . HOH Y 11 .   ? 60.971  100.819 29.300 1.00 66.36  ? 2200 HOH A O   1 
HETATM 6029 O  O   . HOH Y 11 .   ? 101.902 91.036  52.388 1.00 84.56  ? 2201 HOH A O   1 
HETATM 6030 O  O   . HOH Y 11 .   ? 79.175  69.966  35.515 1.00 49.77  ? 2202 HOH A O   1 
HETATM 6031 O  O   . HOH Y 11 .   ? 99.331  92.487  41.584 1.00 70.70  ? 2203 HOH A O   1 
HETATM 6032 O  O   . HOH Y 11 .   ? 41.475  100.866 33.379 1.00 54.70  ? 2204 HOH A O   1 
HETATM 6033 O  O   . HOH Y 11 .   ? 69.234  80.340  63.406 1.00 55.49  ? 2205 HOH A O   1 
HETATM 6034 O  O   . HOH Y 11 .   ? 103.115 84.655  57.200 1.00 58.31  ? 2206 HOH A O   1 
HETATM 6035 O  O   . HOH Y 11 .   ? 53.299  100.140 36.362 1.00 53.31  ? 2207 HOH A O   1 
HETATM 6036 O  O   . HOH Y 11 .   ? 74.995  105.231 45.683 1.00 53.10  ? 2208 HOH A O   1 
HETATM 6037 O  O   . HOH Y 11 .   ? 80.412  79.596  44.286 1.00 53.05  ? 2209 HOH A O   1 
HETATM 6038 O  O   . HOH Y 11 .   ? 83.403  83.964  42.897 1.00 50.54  ? 2210 HOH A O   1 
HETATM 6039 O  O   . HOH Y 11 .   ? 94.950  80.816  32.990 1.00 59.45  ? 2211 HOH A O   1 
HETATM 6040 O  O   . HOH Y 11 .   ? 90.183  87.699  49.394 1.00 57.13  ? 2212 HOH A O   1 
HETATM 6041 O  O   . HOH Y 11 .   ? 104.189 92.265  53.674 1.00 63.70  ? 2213 HOH A O   1 
HETATM 6042 O  O   . HOH Y 11 .   ? 41.830  101.188 28.798 1.00 78.58  ? 2214 HOH A O   1 
HETATM 6043 O  O   . HOH Y 11 .   ? 72.836  92.328  74.923 1.00 75.93  ? 2215 HOH A O   1 
HETATM 6044 O  O   . HOH Y 11 .   ? 69.577  66.276  66.127 1.00 53.89  ? 2216 HOH A O   1 
HETATM 6045 O  O   . HOH Y 11 .   ? 81.329  67.262  35.797 1.00 61.26  ? 2217 HOH A O   1 
HETATM 6046 O  O   . HOH Y 11 .   ? 103.948 81.022  48.482 1.00 59.32  ? 2218 HOH A O   1 
HETATM 6047 O  O   . HOH Y 11 .   ? 57.286  68.125  61.532 1.00 66.29  ? 2219 HOH A O   1 
HETATM 6048 O  O   . HOH Y 11 .   ? 105.696 63.417  54.920 1.00 75.26  ? 2220 HOH A O   1 
HETATM 6049 O  O   . HOH Y 11 .   ? 84.938  51.959  49.012 1.00 70.35  ? 2221 HOH A O   1 
HETATM 6050 O  O   . HOH Y 11 .   ? 71.523  93.083  32.548 1.00 56.03  ? 2222 HOH A O   1 
HETATM 6051 O  O   . HOH Y 11 .   ? 70.401  76.306  27.140 1.00 74.03  ? 2223 HOH A O   1 
HETATM 6052 O  O   . HOH Y 11 .   ? 60.635  73.347  70.776 1.00 76.42  ? 2224 HOH A O   1 
HETATM 6053 O  O   . HOH Y 11 .   ? 61.204  68.401  64.229 1.00 60.85  ? 2225 HOH A O   1 
HETATM 6054 O  O   . HOH Y 11 .   ? 73.663  69.690  46.891 1.00 63.63  ? 2226 HOH A O   1 
HETATM 6055 O  O   . HOH Y 11 .   ? 64.522  99.503  63.956 1.00 67.43  ? 2227 HOH A O   1 
HETATM 6056 O  O   . HOH Y 11 .   ? 71.388  67.882  63.698 1.00 57.86  ? 2228 HOH A O   1 
HETATM 6057 O  O   . HOH Y 11 .   ? 62.968  59.932  60.433 1.00 49.21  ? 2229 HOH A O   1 
HETATM 6058 O  O   . HOH Y 11 .   ? 80.633  87.905  32.813 1.00 49.92  ? 2230 HOH A O   1 
HETATM 6059 O  O   . HOH Y 11 .   ? 58.482  73.595  64.596 1.00 60.44  ? 2231 HOH A O   1 
HETATM 6060 O  O   . HOH Y 11 .   ? 39.253  94.419  35.143 1.00 77.84  ? 2232 HOH A O   1 
HETATM 6061 O  O   . HOH Y 11 .   ? 81.101  89.065  35.212 1.00 49.23  ? 2233 HOH A O   1 
HETATM 6062 O  O   . HOH Y 11 .   ? 60.569  70.946  54.663 1.00 65.46  ? 2234 HOH A O   1 
HETATM 6063 O  O   . HOH Y 11 .   ? 83.981  82.035  53.199 1.00 60.46  ? 2235 HOH A O   1 
HETATM 6064 O  O   . HOH Y 11 .   ? 41.265  105.293 29.397 1.00 58.43  ? 2236 HOH A O   1 
HETATM 6065 O  O   . HOH Y 11 .   ? 63.999  63.225  69.461 1.00 68.52  ? 2237 HOH A O   1 
HETATM 6066 O  O   . HOH Y 11 .   ? 64.045  70.124  63.028 1.00 65.98  ? 2238 HOH A O   1 
HETATM 6067 O  O   . HOH Y 11 .   ? 76.055  62.140  36.279 1.00 54.57  ? 2239 HOH A O   1 
HETATM 6068 O  O   . HOH Y 11 .   ? 63.268  101.252 21.060 1.00 74.82  ? 2240 HOH A O   1 
HETATM 6069 O  O   . HOH Y 11 .   ? 71.179  116.066 40.069 1.00 72.63  ? 2241 HOH A O   1 
HETATM 6070 O  O   . HOH Y 11 .   ? 80.167  98.089  42.038 1.00 66.37  ? 2242 HOH A O   1 
HETATM 6071 O  O   . HOH Y 11 .   ? 88.608  51.849  52.414 1.00 72.10  ? 2243 HOH A O   1 
HETATM 6072 O  O   . HOH Y 11 .   ? 87.424  53.443  49.051 1.00 84.76  ? 2244 HOH A O   1 
HETATM 6073 O  O   . HOH Y 11 .   ? 62.491  101.089 18.644 1.00 76.92  ? 2245 HOH A O   1 
HETATM 6074 O  O   . HOH Y 11 .   ? 62.984  98.783  16.201 1.00 73.74  ? 2246 HOH A O   1 
HETATM 6075 O  O   . HOH Y 11 .   ? 50.609  73.996  63.534 1.00 73.83  ? 2247 HOH A O   1 
HETATM 6076 O  O   . HOH Y 11 .   ? 88.371  78.139  40.773 1.00 65.07  ? 2248 HOH A O   1 
HETATM 6077 O  O   . HOH Y 11 .   ? 94.761  66.886  27.058 1.00 75.07  ? 2249 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   ?   ?   ?   A . n 
A 1 2   VAL 2   2   ?   ?   ?   A . n 
A 1 3   GLU 3   3   ?   ?   ?   A . n 
A 1 4   PRO 4   4   ?   ?   ?   A . n 
A 1 5   LYS 5   5   ?   ?   ?   A . n 
A 1 6   GLU 6   6   ?   ?   ?   A . n 
A 1 7   ASP 7   7   ?   ?   ?   A . n 
A 1 8   THR 8   8   ?   ?   ?   A . n 
A 1 9   ILE 9   9   ?   ?   ?   A . n 
A 1 10  THR 10  10  ?   ?   ?   A . n 
A 1 11  VAL 11  11  ?   ?   ?   A . n 
A 1 12  THR 12  12  ?   ?   ?   A . n 
A 1 13  ALA 13  13  ?   ?   ?   A . n 
A 1 14  ALA 14  14  ?   ?   ?   A . n 
A 1 15  PRO 15  15  ?   ?   ?   A . n 
A 1 16  ALA 16  16  ?   ?   ?   A . n 
A 1 17  PRO 17  17  ?   ?   ?   A . n 
A 1 18  GLN 18  18  ?   ?   ?   A . n 
A 1 19  GLU 19  19  19  GLU GLU A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  TRP 22  22  22  TRP TRP A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  ILE 28  28  28  ILE ILE A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  SER 33  33  33  SER SER A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  THR 35  35  35  THR THR A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  ILE 43  43  43  ILE ILE A . n 
A 1 44  GLN 44  44  44  GLN GLN A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  GLN 48  48  48  GLN GLN A . n 
A 1 49  SER 49  49  49  SER SER A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  MET 58  58  58  MET MET A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  HIS 61  61  61  HIS HIS A . n 
A 1 62  GLN 62  62  62  GLN GLN A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  LYS 64  64  64  LYS LYS A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  GLU 68  68  68  GLU GLU A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  PRO 74  74  74  PRO PRO A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  THR 80  80  80  THR THR A . n 
A 1 81  ARG 81  81  81  ARG ARG A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  THR 86  86  86  THR THR A . n 
A 1 87  TYR 87  87  87  TYR TYR A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  HIS 89  89  89  HIS HIS A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  ARG 93  93  93  ARG ARG A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  PHE 95  95  95  PHE PHE A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  GLU 98  98  98  GLU GLU A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 GLN 100 100 100 GLN GLN A . n 
A 1 101 SER 101 101 101 SER SER A . n 
A 1 102 GLN 102 102 102 GLN GLN A . n 
A 1 103 ASN 103 103 103 ASN ASN A . n 
A 1 104 ASN 104 104 104 ASN ASN A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 ASN 107 107 107 ASN ASN A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 GLN 112 112 112 GLN GLN A . n 
A 1 113 GLY 113 113 113 GLY GLY A . n 
A 1 114 ASN 114 114 114 ASN ASN A . n 
A 1 115 PHE 115 115 115 PHE PHE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 PRO 123 123 123 PRO PRO A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 MET 125 125 125 MET MET A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 ARG 128 128 128 ARG ARG A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 ILE 131 131 131 ILE ILE A . n 
A 1 132 MET 132 132 132 MET MET A . n 
A 1 133 ARG 133 133 133 ARG ARG A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 PRO 135 135 135 PRO PRO A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 VAL 138 138 138 VAL VAL A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 TYR 140 140 140 TYR TYR A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 LYS 142 142 142 LYS LYS A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 SER 144 144 144 SER SER A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 GLY 146 146 146 GLY GLY A . n 
A 1 147 GLY 147 147 147 GLY GLY A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 MET 151 151 151 MET MET A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 SER 153 153 153 SER SER A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 PRO 156 156 156 PRO PRO A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 GLU 159 159 159 GLU GLU A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 GLN 165 165 165 GLN GLN A . n 
A 1 166 PHE 166 166 166 PHE PHE A . n 
A 1 167 LYS 167 167 167 LYS LYS A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 THR 170 170 170 THR THR A . n 
A 1 171 ASP 171 171 171 ASP ASP A . n 
A 1 172 SER 172 172 172 SER SER A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 PHE 174 174 174 PHE PHE A . n 
A 1 175 GLN 175 175 175 GLN GLN A . n 
A 1 176 THR 176 176 176 THR THR A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 PHE 178 178 178 PHE PHE A . n 
A 1 179 ASP 179 179 179 ASP ASP A . n 
A 1 180 PHE 180 180 180 PHE PHE A . n 
A 1 181 SER 181 181 181 SER SER A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 ASP 186 186 186 ASP ASP A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 TYR 190 190 190 TYR TYR A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 TYR 192 192 192 TYR TYR A . n 
A 1 193 ARG 193 193 193 ARG ARG A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 ALA 198 198 198 ALA ALA A . n 
A 1 199 ARG 199 199 199 ARG ARG A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 ASN 202 202 202 ASN ASN A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 GLN 204 204 204 GLN GLN A . n 
A 1 205 GLN 205 205 205 GLN GLN A . n 
A 1 206 LYS 206 206 206 LYS LYS A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 GLU 209 209 209 GLU GLU A . n 
A 1 210 GLU 210 210 210 GLU GLU A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 ARG 212 212 212 ARG ARG A . n 
A 1 213 TYR 213 213 213 TYR TYR A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 ILE 215 215 215 ILE ILE A . n 
A 1 216 ALA 216 216 216 ALA ALA A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 ALA 218 218 218 ALA ALA A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 THR 220 220 220 THR THR A . n 
A 1 221 TRP 221 221 221 TRP TRP A . n 
A 1 222 ARG 222 222 222 ARG ARG A . n 
A 1 223 PRO 223 223 223 PRO PRO A . n 
A 1 224 ASP 224 224 224 ASP ASP A . n 
A 1 225 ASP 225 225 225 ASP ASP A . n 
A 1 226 LYS 226 226 226 LYS LYS A . n 
A 1 227 THR 227 227 227 THR THR A . n 
A 1 228 ASN 228 228 228 ASN ASN A . n 
A 1 229 PHE 229 229 229 PHE PHE A . n 
A 1 230 THR 230 230 230 THR THR A . n 
A 1 231 PHE 231 231 231 PHE PHE A . n 
A 1 232 LEU 232 232 232 LEU LEU A . n 
A 1 233 SER 233 233 233 SER SER A . n 
A 1 234 TYR 234 234 234 TYR TYR A . n 
A 1 235 PHE 235 235 235 PHE PHE A . n 
A 1 236 GLN 236 236 236 GLN GLN A . n 
A 1 237 ASN 237 237 237 ASN ASN A . n 
A 1 238 GLU 238 238 238 GLU GLU A . n 
A 1 239 PRO 239 239 239 PRO PRO A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 THR 241 241 241 THR THR A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 TYR 243 243 243 TYR TYR A . n 
A 1 244 TYR 244 244 244 TYR TYR A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 TRP 246 246 246 TRP TRP A . n 
A 1 247 LEU 247 247 247 LEU LEU A . n 
A 1 248 PRO 248 248 248 PRO PRO A . n 
A 1 249 LYS 249 249 249 LYS LYS A . n 
A 1 250 GLU 250 250 250 GLU GLU A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 THR 252 252 252 THR THR A . n 
A 1 253 VAL 253 253 253 VAL VAL A . n 
A 1 254 GLU 254 254 254 GLU GLU A . n 
A 1 255 PRO 255 255 255 PRO PRO A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 PRO 257 257 257 PRO PRO A . n 
A 1 258 ASN 258 258 258 ASN ASN A . n 
A 1 259 GLY 259 259 259 GLY GLY A . n 
A 1 260 LYS 260 260 260 LYS LYS A . n 
A 1 261 ARG 261 261 261 ARG ARG A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 PRO 263 263 263 PRO PRO A . n 
A 1 264 THR 264 264 264 THR THR A . n 
A 1 265 ASP 265 265 265 ASP ASP A . n 
A 1 266 PHE 266 266 266 PHE PHE A . n 
A 1 267 ASN 267 267 267 ASN ASN A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 GLY 269 269 269 GLY GLY A . n 
A 1 270 ALA 270 270 270 ALA ALA A . n 
A 1 271 LYS 271 271 271 LYS LYS A . n 
A 1 272 ASN 272 272 272 ASN ASN A . n 
A 1 273 ASN 273 273 273 ASN ASN A . n 
A 1 274 THR 274 274 274 THR THR A . n 
A 1 275 TYR 275 275 275 TYR TYR A . n 
A 1 276 SER 276 276 276 SER SER A . n 
A 1 277 ARG 277 277 277 ARG ARG A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 GLU 279 279 279 GLU GLU A . n 
A 1 280 LYS 280 280 280 LYS LYS A . n 
A 1 281 MET 281 281 281 MET MET A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 TYR 284 284 284 TYR TYR A . n 
A 1 285 SER 285 285 285 SER SER A . n 
A 1 286 PHE 286 286 286 PHE PHE A . n 
A 1 287 ASP 287 287 287 ASP ASP A . n 
A 1 288 HIS 288 288 288 HIS HIS A . n 
A 1 289 GLU 289 289 289 GLU GLU A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 ASN 291 291 291 ASN ASN A . n 
A 1 292 ASP 292 292 292 ASP ASP A . n 
A 1 293 THR 293 293 293 THR THR A . n 
A 1 294 PHE 294 294 294 PHE PHE A . n 
A 1 295 THR 295 295 295 THR THR A . n 
A 1 296 VAL 296 296 296 VAL VAL A . n 
A 1 297 ARG 297 297 297 ARG ARG A . n 
A 1 298 GLN 298 298 298 GLN GLN A . n 
A 1 299 ASN 299 299 299 ASN ASN A . n 
A 1 300 LEU 300 300 300 LEU LEU A . n 
A 1 301 ARG 301 301 301 ARG ARG A . n 
A 1 302 PHE 302 302 302 PHE PHE A . n 
A 1 303 ALA 303 303 303 ALA ALA A . n 
A 1 304 GLU 304 304 304 GLU GLU A . n 
A 1 305 ASN 305 305 305 ASN ASN A . n 
A 1 306 LYS 306 306 306 LYS LYS A . n 
A 1 307 THR 307 307 307 THR THR A . n 
A 1 308 SER 308 308 308 SER SER A . n 
A 1 309 GLN 309 309 309 GLN GLN A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 VAL 312 312 312 VAL VAL A . n 
A 1 313 TYR 313 313 313 TYR TYR A . n 
A 1 314 GLY 314 314 314 GLY GLY A . n 
A 1 315 TYR 315 315 315 TYR TYR A . n 
A 1 316 GLY 316 316 316 GLY GLY A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 CYS 318 318 318 CYS CYS A . n 
A 1 319 SER 319 319 319 SER SER A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PRO 321 321 321 PRO PRO A . n 
A 1 322 ALA 322 322 322 ALA ALA A . n 
A 1 323 ASN 323 323 323 ASN ASN A . n 
A 1 324 ALA 324 324 324 ALA ALA A . n 
A 1 325 TYR 325 325 325 TYR TYR A . n 
A 1 326 SER 326 326 326 SER SER A . n 
A 1 327 LYS 327 327 327 LYS LYS A . n 
A 1 328 GLN 328 328 328 GLN GLN A . n 
A 1 329 CYS 329 329 329 CYS CYS A . n 
A 1 330 ALA 330 330 330 ALA ALA A . n 
A 1 331 ALA 331 331 331 ALA ALA A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 ALA 333 333 333 ALA ALA A . n 
A 1 334 PRO 334 334 334 PRO PRO A . n 
A 1 335 ALA 335 335 335 ALA ALA A . n 
A 1 336 ASP 336 336 336 ASP ASP A . n 
A 1 337 LYS 337 337 337 LYS LYS A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 HIS 339 339 339 HIS HIS A . n 
A 1 340 TYR 340 340 340 TYR TYR A . n 
A 1 341 LEU 341 341 341 LEU LEU A . n 
A 1 342 ALA 342 342 342 ALA ALA A . n 
A 1 343 ARG 343 343 343 ARG ARG A . n 
A 1 344 LYS 344 344 344 LYS LYS A . n 
A 1 345 TYR 345 345 345 TYR TYR A . n 
A 1 346 VAL 346 346 346 VAL VAL A . n 
A 1 347 VAL 347 347 347 VAL VAL A . n 
A 1 348 ASP 348 348 348 ASP ASP A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 LYS 351 351 351 LYS LYS A . n 
A 1 352 LEU 352 352 352 LEU LEU A . n 
A 1 353 GLN 353 353 353 GLN GLN A . n 
A 1 354 ASN 354 354 354 ASN ASN A . n 
A 1 355 PHE 355 355 355 PHE PHE A . n 
A 1 356 SER 356 356 356 SER SER A . n 
A 1 357 VAL 357 357 357 VAL VAL A . n 
A 1 358 ASP 358 358 358 ASP ASP A . n 
A 1 359 THR 359 359 359 THR THR A . n 
A 1 360 GLN 360 360 360 GLN GLN A . n 
A 1 361 LEU 361 361 361 LEU LEU A . n 
A 1 362 GLN 362 362 362 GLN GLN A . n 
A 1 363 SER 363 363 363 SER SER A . n 
A 1 364 LYS 364 364 364 LYS LYS A . n 
A 1 365 PHE 365 365 365 PHE PHE A . n 
A 1 366 ALA 366 366 366 ALA ALA A . n 
A 1 367 THR 367 367 367 THR THR A . n 
A 1 368 GLY 368 368 368 GLY GLY A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ILE 370 370 370 ILE ILE A . n 
A 1 371 ASP 371 371 371 ASP ASP A . n 
A 1 372 HIS 372 372 372 HIS HIS A . n 
A 1 373 THR 373 373 373 THR THR A . n 
A 1 374 LEU 374 374 374 LEU LEU A . n 
A 1 375 LEU 375 375 375 LEU LEU A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 GLY 377 377 377 GLY GLY A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 ASP 379 379 379 ASP ASP A . n 
A 1 380 PHE 380 380 380 PHE PHE A . n 
A 1 381 MET 381 381 381 MET MET A . n 
A 1 382 ARG 382 382 382 ARG ARG A . n 
A 1 383 MET 383 383 383 MET MET A . n 
A 1 384 ARG 384 384 384 ARG ARG A . n 
A 1 385 ASN 385 385 385 ASN ASN A . n 
A 1 386 ASP 386 386 386 ASP ASP A . n 
A 1 387 ILE 387 387 387 ILE ILE A . n 
A 1 388 ASN 388 388 388 ASN ASN A . n 
A 1 389 ALA 389 389 389 ALA ALA A . n 
A 1 390 TRP 390 390 390 TRP TRP A . n 
A 1 391 PHE 391 391 391 PHE PHE A . n 
A 1 392 GLY 392 392 392 GLY GLY A . n 
A 1 393 TYR 393 393 393 TYR TYR A . n 
A 1 394 ASP 394 394 394 ASP ASP A . n 
A 1 395 ASP 395 395 395 ASP ASP A . n 
A 1 396 SER 396 396 396 SER SER A . n 
A 1 397 VAL 397 397 397 VAL VAL A . n 
A 1 398 PRO 398 398 398 PRO PRO A . n 
A 1 399 LEU 399 399 399 LEU LEU A . n 
A 1 400 LEU 400 400 400 LEU LEU A . n 
A 1 401 ASN 401 401 401 ASN ASN A . n 
A 1 402 LEU 402 402 402 LEU LEU A . n 
A 1 403 TYR 403 403 403 TYR TYR A . n 
A 1 404 ASN 404 404 404 ASN ASN A . n 
A 1 405 PRO 405 405 405 PRO PRO A . n 
A 1 406 SER 406 406 406 SER SER A . n 
A 1 407 SER 407 407 407 SER SER A . n 
A 1 408 HIS 408 408 408 HIS HIS A . n 
A 1 409 HIS 409 409 409 HIS HIS A . n 
A 1 410 HIS 410 410 410 HIS HIS A . n 
A 1 411 HIS 411 411 411 HIS HIS A . n 
A 1 412 HIS 412 412 412 HIS HIS A . n 
A 1 413 HIS 413 413 413 HIS HIS A . n 
A 1 414 GLY 414 414 414 GLY GLY A . n 
A 1 415 SER 415 415 415 SER SER A . n 
A 1 416 SER 416 416 416 SER SER A . n 
A 1 417 VAL 417 417 417 VAL VAL A . n 
A 1 418 ASN 418 418 418 ASN ASN A . n 
A 1 419 THR 419 419 419 THR THR A . n 
A 1 420 ASP 420 420 420 ASP ASP A . n 
A 1 421 PHE 421 421 421 PHE PHE A . n 
A 1 422 ASP 422 422 422 ASP ASP A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 ALA 425 425 425 ALA ALA A . n 
A 1 426 LYS 426 426 426 LYS LYS A . n 
A 1 427 ASP 427 427 427 ASP ASP A . n 
A 1 428 PRO 428 428 428 PRO PRO A . n 
A 1 429 ALA 429 429 429 ALA ALA A . n 
A 1 430 ASN 430 430 430 ASN ASN A . n 
A 1 431 SER 431 431 431 SER SER A . n 
A 1 432 GLY 432 432 432 GLY GLY A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 TYR 434 434 434 TYR TYR A . n 
A 1 435 ARG 435 435 435 ARG ARG A . n 
A 1 436 ILE 436 436 436 ILE ILE A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 ASN 438 438 438 ASN ASN A . n 
A 1 439 LYS 439 439 439 LYS LYS A . n 
A 1 440 GLN 440 440 440 GLN GLN A . n 
A 1 441 LYS 441 441 441 LYS LYS A . n 
A 1 442 GLN 442 442 442 GLN GLN A . n 
A 1 443 THR 443 443 443 THR THR A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 TYR 446 446 446 TYR TYR A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 GLN 448 448 448 GLN GLN A . n 
A 1 449 ASP 449 449 449 ASP ASP A . n 
A 1 450 GLN 450 450 450 GLN GLN A . n 
A 1 451 ALA 451 451 451 ALA ALA A . n 
A 1 452 GLN 452 452 452 GLN GLN A . n 
A 1 453 TRP 453 453 453 TRP TRP A . n 
A 1 454 ASP 454 454 454 ASP ASP A . n 
A 1 455 LYS 455 455 455 LYS LYS A . n 
A 1 456 VAL 456 456 456 VAL VAL A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 VAL 458 458 458 VAL VAL A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 LEU 460 460 460 LEU LEU A . n 
A 1 461 GLY 461 461 461 GLY GLY A . n 
A 1 462 GLY 462 462 462 GLY GLY A . n 
A 1 463 ARG 463 463 463 ARG ARG A . n 
A 1 464 TYR 464 464 464 TYR TYR A . n 
A 1 465 ASP 465 465 465 ASP ASP A . n 
A 1 466 TRP 466 466 466 TRP TRP A . n 
A 1 467 ALA 467 467 467 ALA ALA A . n 
A 1 468 ASP 468 468 468 ASP ASP A . n 
A 1 469 GLN 469 469 469 GLN GLN A . n 
A 1 470 GLU 470 470 470 GLU GLU A . n 
A 1 471 SER 471 471 471 SER SER A . n 
A 1 472 LEU 472 472 472 LEU LEU A . n 
A 1 473 ASN 473 473 473 ASN ASN A . n 
A 1 474 ARG 474 474 474 ARG ARG A . n 
A 1 475 VAL 475 475 475 VAL VAL A . n 
A 1 476 ALA 476 476 476 ALA ALA A . n 
A 1 477 GLY 477 477 477 GLY GLY A . n 
A 1 478 THR 478 478 478 THR THR A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 ASP 480 480 480 ASP ASP A . n 
A 1 481 LYS 481 481 481 LYS LYS A . n 
A 1 482 ARG 482 482 482 ARG ARG A . n 
A 1 483 ASP 483 483 483 ASP ASP A . n 
A 1 484 ASP 484 484 484 ASP ASP A . n 
A 1 485 LYS 485 485 485 LYS LYS A . n 
A 1 486 GLN 486 486 486 GLN GLN A . n 
A 1 487 PHE 487 487 487 PHE PHE A . n 
A 1 488 THR 488 488 488 THR THR A . n 
A 1 489 TRP 489 489 489 TRP TRP A . n 
A 1 490 ARG 490 490 490 ARG ARG A . n 
A 1 491 GLY 491 491 491 GLY GLY A . n 
A 1 492 GLY 492 492 492 GLY GLY A . n 
A 1 493 VAL 493 493 493 VAL VAL A . n 
A 1 494 ASN 494 494 494 ASN ASN A . n 
A 1 495 TYR 495 495 495 TYR TYR A . n 
A 1 496 LEU 496 496 496 LEU LEU A . n 
A 1 497 PHE 497 497 497 PHE PHE A . n 
A 1 498 ASP 498 498 498 ASP ASP A . n 
A 1 499 ASN 499 499 499 ASN ASN A . n 
A 1 500 GLY 500 500 500 GLY GLY A . n 
A 1 501 VAL 501 501 501 VAL VAL A . n 
A 1 502 THR 502 502 502 THR THR A . n 
A 1 503 PRO 503 503 503 PRO PRO A . n 
A 1 504 TYR 504 504 504 TYR TYR A . n 
A 1 505 PHE 505 505 505 PHE PHE A . n 
A 1 506 SER 506 506 506 SER SER A . n 
A 1 507 TYR 507 507 507 TYR TYR A . n 
A 1 508 SER 508 508 508 SER SER A . n 
A 1 509 GLU 509 509 509 GLU GLU A . n 
A 1 510 SER 510 510 510 SER SER A . n 
A 1 511 PHE 511 511 511 PHE PHE A . n 
A 1 512 GLU 512 512 512 GLU GLU A . n 
A 1 513 PRO 513 513 513 PRO PRO A . n 
A 1 514 SER 514 514 514 SER SER A . n 
A 1 515 SER 515 515 515 SER SER A . n 
A 1 516 GLN 516 516 516 GLN GLN A . n 
A 1 517 VAL 517 517 517 VAL VAL A . n 
A 1 518 GLY 518 518 518 GLY GLY A . n 
A 1 519 LYS 519 519 519 LYS LYS A . n 
A 1 520 ASP 520 520 520 ASP ASP A . n 
A 1 521 GLY 521 521 521 GLY GLY A . n 
A 1 522 ASN 522 522 522 ASN ASN A . n 
A 1 523 ILE 523 523 523 ILE ILE A . n 
A 1 524 PHE 524 524 524 PHE PHE A . n 
A 1 525 ALA 525 525 525 ALA ALA A . n 
A 1 526 PRO 526 526 526 PRO PRO A . n 
A 1 527 SER 527 527 527 SER SER A . n 
A 1 528 LYS 528 528 528 LYS LYS A . n 
A 1 529 GLY 529 529 529 GLY GLY A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 GLN 531 531 531 GLN GLN A . n 
A 1 532 TYR 532 532 532 TYR TYR A . n 
A 1 533 GLU 533 533 533 GLU GLU A . n 
A 1 534 VAL 534 534 534 VAL VAL A . n 
A 1 535 GLY 535 535 535 GLY GLY A . n 
A 1 536 VAL 536 536 536 VAL VAL A . n 
A 1 537 LYS 537 537 537 LYS LYS A . n 
A 1 538 TYR 538 538 538 TYR TYR A . n 
A 1 539 VAL 539 539 539 VAL VAL A . n 
A 1 540 PRO 540 540 540 PRO PRO A . n 
A 1 541 GLU 541 541 541 GLU GLU A . n 
A 1 542 ASP 542 542 542 ASP ASP A . n 
A 1 543 ARG 543 543 543 ARG ARG A . n 
A 1 544 PRO 544 544 544 PRO PRO A . n 
A 1 545 ILE 545 545 545 ILE ILE A . n 
A 1 546 VAL 546 546 546 VAL VAL A . n 
A 1 547 VAL 547 547 547 VAL VAL A . n 
A 1 548 THR 548 548 548 THR THR A . n 
A 1 549 GLY 549 549 549 GLY GLY A . n 
A 1 550 ALA 550 550 550 ALA ALA A . n 
A 1 551 VAL 551 551 551 VAL VAL A . n 
A 1 552 TYR 552 552 552 TYR TYR A . n 
A 1 553 ASN 553 553 553 ASN ASN A . n 
A 1 554 LEU 554 554 554 LEU LEU A . n 
A 1 555 THR 555 555 555 THR THR A . n 
A 1 556 LYS 556 556 556 LYS LYS A . n 
A 1 557 THR 557 557 557 THR THR A . n 
A 1 558 ASN 558 558 558 ASN ASN A . n 
A 1 559 ASN 559 559 559 ASN ASN A . n 
A 1 560 LEU 560 560 560 LEU LEU A . n 
A 1 561 MET 561 561 561 MET MET A . n 
A 1 562 ALA 562 562 562 ALA ALA A . n 
A 1 563 ASP 563 563 563 ASP ASP A . n 
A 1 564 PRO 564 564 564 PRO PRO A . n 
A 1 565 GLU 565 565 565 GLU GLU A . n 
A 1 566 GLY 566 566 566 GLY GLY A . n 
A 1 567 SER 567 567 567 SER SER A . n 
A 1 568 PHE 568 568 568 PHE PHE A . n 
A 1 569 PHE 569 569 569 PHE PHE A . n 
A 1 570 SER 570 570 570 SER SER A . n 
A 1 571 VAL 571 571 571 VAL VAL A . n 
A 1 572 GLU 572 572 572 GLU GLU A . n 
A 1 573 GLY 573 573 573 GLY GLY A . n 
A 1 574 GLY 574 574 574 GLY GLY A . n 
A 1 575 GLU 575 575 575 GLU GLU A . n 
A 1 576 ILE 576 576 576 ILE ILE A . n 
A 1 577 ARG 577 577 577 ARG ARG A . n 
A 1 578 ALA 578 578 578 ALA ALA A . n 
A 1 579 ARG 579 579 579 ARG ARG A . n 
A 1 580 GLY 580 580 580 GLY GLY A . n 
A 1 581 VAL 581 581 581 VAL VAL A . n 
A 1 582 GLU 582 582 582 GLU GLU A . n 
A 1 583 ILE 583 583 583 ILE ILE A . n 
A 1 584 GLU 584 584 584 GLU GLU A . n 
A 1 585 ALA 585 585 585 ALA ALA A . n 
A 1 586 LYS 586 586 586 LYS LYS A . n 
A 1 587 ALA 587 587 587 ALA ALA A . n 
A 1 588 ALA 588 588 588 ALA ALA A . n 
A 1 589 LEU 589 589 589 LEU LEU A . n 
A 1 590 SER 590 590 590 SER SER A . n 
A 1 591 ALA 591 591 591 ALA ALA A . n 
A 1 592 SER 592 592 592 SER SER A . n 
A 1 593 VAL 593 593 593 VAL VAL A . n 
A 1 594 ASN 594 594 594 ASN ASN A . n 
A 1 595 VAL 595 595 595 VAL VAL A . n 
A 1 596 VAL 596 596 596 VAL VAL A . n 
A 1 597 GLY 597 597 597 GLY GLY A . n 
A 1 598 SER 598 598 598 SER SER A . n 
A 1 599 TYR 599 599 599 TYR TYR A . n 
A 1 600 THR 600 600 600 THR THR A . n 
A 1 601 TYR 601 601 601 TYR TYR A . n 
A 1 602 THR 602 602 602 THR THR A . n 
A 1 603 ASP 603 603 603 ASP ASP A . n 
A 1 604 ALA 604 604 604 ALA ALA A . n 
A 1 605 GLU 605 605 605 GLU GLU A . n 
A 1 606 TYR 606 606 606 TYR TYR A . n 
A 1 607 THR 607 607 607 THR THR A . n 
A 1 608 THR 608 608 608 THR THR A . n 
A 1 609 ASP 609 609 609 ASP ASP A . n 
A 1 610 THR 610 610 610 THR THR A . n 
A 1 611 THR 611 611 611 THR THR A . n 
A 1 612 TYR 612 612 612 TYR TYR A . n 
A 1 613 LYS 613 613 613 LYS LYS A . n 
A 1 614 GLY 614 614 614 GLY GLY A . n 
A 1 615 ASN 615 615 615 ASN ASN A . n 
A 1 616 THR 616 616 616 THR THR A . n 
A 1 617 PRO 617 617 617 PRO PRO A . n 
A 1 618 ALA 618 618 618 ALA ALA A . n 
A 1 619 GLN 619 619 619 GLN GLN A . n 
A 1 620 VAL 620 620 620 VAL VAL A . n 
A 1 621 PRO 621 621 621 PRO PRO A . n 
A 1 622 LYS 622 622 622 LYS LYS A . n 
A 1 623 HIS 623 623 623 HIS HIS A . n 
A 1 624 MET 624 624 624 MET MET A . n 
A 1 625 ALA 625 625 625 ALA ALA A . n 
A 1 626 SER 626 626 626 SER SER A . n 
A 1 627 LEU 627 627 627 LEU LEU A . n 
A 1 628 TRP 628 628 628 TRP TRP A . n 
A 1 629 ALA 629 629 629 ALA ALA A . n 
A 1 630 ASP 630 630 630 ASP ASP A . n 
A 1 631 TYR 631 631 631 TYR TYR A . n 
A 1 632 THR 632 632 632 THR THR A . n 
A 1 633 PHE 633 633 633 PHE PHE A . n 
A 1 634 PHE 634 634 634 PHE PHE A . n 
A 1 635 ASP 635 635 635 ASP ASP A . n 
A 1 636 GLY 636 636 636 GLY GLY A . n 
A 1 637 PRO 637 637 637 PRO PRO A . n 
A 1 638 LEU 638 638 638 LEU LEU A . n 
A 1 639 SER 639 639 639 SER SER A . n 
A 1 640 GLY 640 640 640 GLY GLY A . n 
A 1 641 LEU 641 641 641 LEU LEU A . n 
A 1 642 THR 642 642 642 THR THR A . n 
A 1 643 LEU 643 643 643 LEU LEU A . n 
A 1 644 GLY 644 644 644 GLY GLY A . n 
A 1 645 THR 645 645 645 THR THR A . n 
A 1 646 GLY 646 646 646 GLY GLY A . n 
A 1 647 GLY 647 647 647 GLY GLY A . n 
A 1 648 ARG 648 648 648 ARG ARG A . n 
A 1 649 TYR 649 649 649 TYR TYR A . n 
A 1 650 THR 650 650 650 THR THR A . n 
A 1 651 GLY 651 651 651 GLY GLY A . n 
A 1 652 SER 652 652 652 SER SER A . n 
A 1 653 SER 653 653 653 SER SER A . n 
A 1 654 TYR 654 654 654 TYR TYR A . n 
A 1 655 GLY 655 655 655 GLY GLY A . n 
A 1 656 ASP 656 656 656 ASP ASP A . n 
A 1 657 PRO 657 657 657 PRO PRO A . n 
A 1 658 ALA 658 658 658 ALA ALA A . n 
A 1 659 ASN 659 659 659 ASN ASN A . n 
A 1 660 SER 660 660 660 SER SER A . n 
A 1 661 PHE 661 661 661 PHE PHE A . n 
A 1 662 LYS 662 662 662 LYS LYS A . n 
A 1 663 VAL 663 663 663 VAL VAL A . n 
A 1 664 GLY 664 664 664 GLY GLY A . n 
A 1 665 SER 665 665 665 SER SER A . n 
A 1 666 TYR 666 666 666 TYR TYR A . n 
A 1 667 THR 667 667 667 THR THR A . n 
A 1 668 VAL 668 668 668 VAL VAL A . n 
A 1 669 VAL 669 669 669 VAL VAL A . n 
A 1 670 ASP 670 670 670 ASP ASP A . n 
A 1 671 ALA 671 671 671 ALA ALA A . n 
A 1 672 LEU 672 672 672 LEU LEU A . n 
A 1 673 VAL 673 673 673 VAL VAL A . n 
A 1 674 ARG 674 674 674 ARG ARG A . n 
A 1 675 TYR 675 675 675 TYR TYR A . n 
A 1 676 ASP 676 676 676 ASP ASP A . n 
A 1 677 LEU 677 677 677 LEU LEU A . n 
A 1 678 ALA 678 678 678 ALA ALA A . n 
A 1 679 ARG 679 679 679 ARG ARG A . n 
A 1 680 VAL 680 680 680 VAL VAL A . n 
A 1 681 GLY 681 681 681 GLY GLY A . n 
A 1 682 MET 682 682 682 MET MET A . n 
A 1 683 ALA 683 683 683 ALA ALA A . n 
A 1 684 GLY 684 684 684 GLY GLY A . n 
A 1 685 SER 685 685 685 SER SER A . n 
A 1 686 ASN 686 686 686 ASN ASN A . n 
A 1 687 VAL 687 687 687 VAL VAL A . n 
A 1 688 ALA 688 688 688 ALA ALA A . n 
A 1 689 LEU 689 689 689 LEU LEU A . n 
A 1 690 HIS 690 690 690 HIS HIS A . n 
A 1 691 VAL 691 691 691 VAL VAL A . n 
A 1 692 ASN 692 692 692 ASN ASN A . n 
A 1 693 ASN 693 693 693 ASN ASN A . n 
A 1 694 LEU 694 694 694 LEU LEU A . n 
A 1 695 PHE 695 695 695 PHE PHE A . n 
A 1 696 ASP 696 696 696 ASP ASP A . n 
A 1 697 ARG 697 697 697 ARG ARG A . n 
A 1 698 GLU 698 698 698 GLU GLU A . n 
A 1 699 TYR 699 699 699 TYR TYR A . n 
A 1 700 VAL 700 700 700 VAL VAL A . n 
A 1 701 ALA 701 701 701 ALA ALA A . n 
A 1 702 SER 702 702 702 SER SER A . n 
A 1 703 CYS 703 703 703 CYS CYS A . n 
A 1 704 PHE 704 704 704 PHE PHE A . n 
A 1 705 ASN 705 705 705 ASN ASN A . n 
A 1 706 THR 706 706 706 THR THR A . n 
A 1 707 TYR 707 707 707 TYR TYR A . n 
A 1 708 GLY 708 708 708 GLY GLY A . n 
A 1 709 CYS 709 709 709 CYS CYS A . n 
A 1 710 PHE 710 710 710 PHE PHE A . n 
A 1 711 TRP 711 711 711 TRP TRP A . n 
A 1 712 GLY 712 712 712 GLY GLY A . n 
A 1 713 ALA 713 713 713 ALA ALA A . n 
A 1 714 GLU 714 714 714 GLU GLU A . n 
A 1 715 ARG 715 715 715 ARG ARG A . n 
A 1 716 GLN 716 716 716 GLN GLN A . n 
A 1 717 VAL 717 717 717 VAL VAL A . n 
A 1 718 VAL 718 718 718 VAL VAL A . n 
A 1 719 ALA 719 719 719 ALA ALA A . n 
A 1 720 THR 720 720 720 THR THR A . n 
A 1 721 ALA 721 721 721 ALA ALA A . n 
A 1 722 THR 722 722 722 THR THR A . n 
A 1 723 PHE 723 723 723 PHE PHE A . n 
A 1 724 ARG 724 724 724 ARG ARG A . n 
A 1 725 PHE 725 725 725 PHE PHE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3  NI  1   1030 1030 NI  NI  A . 
D 4  PO4 1   2001 2001 PO4 PO4 A . 
E 4  PO4 1   2005 2005 PO4 PO4 A . 
F 5  FTT 1   1009 1009 FTT FTT A . 
G 5  FTT 1   1010 1010 FTT FTT A . 
H 5  FTT 1   1011 1011 FTT FTT A . 
I 6  DAO 1   1012 1012 DAO DAO A . 
J 5  FTT 1   1013 1013 FTT FTT A . 
K 7  MYR 1   1014 1014 MYR MYR A . 
L 8  DDQ 1   1100 1100 DDQ DDQ A . 
M 8  DDQ 1   1101 1101 DDQ DDQ A . 
N 8  DDQ 1   1102 1102 DDQ DDQ A . 
O 9  DPO 1   2000 2000 DPO DPO A . 
P 9  DPO 1   2004 2004 DPO DPO A . 
Q 10 GOL 1   1103 1103 GOL GOL A . 
R 10 GOL 1   1104 1104 GOL GOL A . 
S 10 GOL 1   1105 1105 GOL GOL A . 
T 10 GOL 1   1106 1106 GOL GOL A . 
U 10 GOL 1   1107 1107 GOL GOL A . 
V 10 GOL 1   1108 1108 GOL GOL A . 
W 10 GOL 1   1109 1109 GOL GOL A . 
X 10 GOL 1   1110 1110 GOL GOL A . 
Y 11 HOH 1   2006 1    HOH HOH A . 
Y 11 HOH 2   2007 2    HOH HOH A . 
Y 11 HOH 3   2008 3    HOH HOH A . 
Y 11 HOH 4   2009 4    HOH HOH A . 
Y 11 HOH 5   2010 5    HOH HOH A . 
Y 11 HOH 6   2011 6    HOH HOH A . 
Y 11 HOH 7   2012 7    HOH HOH A . 
Y 11 HOH 8   2013 8    HOH HOH A . 
Y 11 HOH 9   2014 9    HOH HOH A . 
Y 11 HOH 10  2015 10   HOH HOH A . 
Y 11 HOH 11  2016 11   HOH HOH A . 
Y 11 HOH 12  2017 12   HOH HOH A . 
Y 11 HOH 13  2018 13   HOH HOH A . 
Y 11 HOH 14  2019 14   HOH HOH A . 
Y 11 HOH 15  2020 15   HOH HOH A . 
Y 11 HOH 16  2021 16   HOH HOH A . 
Y 11 HOH 17  2022 17   HOH HOH A . 
Y 11 HOH 18  2023 18   HOH HOH A . 
Y 11 HOH 19  2024 19   HOH HOH A . 
Y 11 HOH 20  2025 20   HOH HOH A . 
Y 11 HOH 21  2026 21   HOH HOH A . 
Y 11 HOH 22  2027 22   HOH HOH A . 
Y 11 HOH 23  2028 23   HOH HOH A . 
Y 11 HOH 24  2029 24   HOH HOH A . 
Y 11 HOH 25  2030 25   HOH HOH A . 
Y 11 HOH 26  2031 26   HOH HOH A . 
Y 11 HOH 27  2032 27   HOH HOH A . 
Y 11 HOH 28  2033 28   HOH HOH A . 
Y 11 HOH 29  2034 29   HOH HOH A . 
Y 11 HOH 30  2035 30   HOH HOH A . 
Y 11 HOH 31  2036 31   HOH HOH A . 
Y 11 HOH 32  2037 32   HOH HOH A . 
Y 11 HOH 33  2038 33   HOH HOH A . 
Y 11 HOH 34  2039 34   HOH HOH A . 
Y 11 HOH 35  2040 35   HOH HOH A . 
Y 11 HOH 36  2041 36   HOH HOH A . 
Y 11 HOH 37  2042 37   HOH HOH A . 
Y 11 HOH 38  2043 38   HOH HOH A . 
Y 11 HOH 39  2044 39   HOH HOH A . 
Y 11 HOH 40  2045 40   HOH HOH A . 
Y 11 HOH 41  2046 41   HOH HOH A . 
Y 11 HOH 42  2047 42   HOH HOH A . 
Y 11 HOH 43  2048 43   HOH HOH A . 
Y 11 HOH 44  2049 44   HOH HOH A . 
Y 11 HOH 45  2050 45   HOH HOH A . 
Y 11 HOH 46  2051 46   HOH HOH A . 
Y 11 HOH 47  2052 47   HOH HOH A . 
Y 11 HOH 48  2053 48   HOH HOH A . 
Y 11 HOH 49  2054 49   HOH HOH A . 
Y 11 HOH 50  2055 50   HOH HOH A . 
Y 11 HOH 51  2056 51   HOH HOH A . 
Y 11 HOH 52  2057 52   HOH HOH A . 
Y 11 HOH 53  2058 53   HOH HOH A . 
Y 11 HOH 54  2059 54   HOH HOH A . 
Y 11 HOH 55  2060 55   HOH HOH A . 
Y 11 HOH 56  2061 56   HOH HOH A . 
Y 11 HOH 57  2062 57   HOH HOH A . 
Y 11 HOH 58  2063 58   HOH HOH A . 
Y 11 HOH 59  2064 59   HOH HOH A . 
Y 11 HOH 60  2065 60   HOH HOH A . 
Y 11 HOH 61  2066 61   HOH HOH A . 
Y 11 HOH 62  2067 62   HOH HOH A . 
Y 11 HOH 63  2068 63   HOH HOH A . 
Y 11 HOH 64  2069 64   HOH HOH A . 
Y 11 HOH 65  2070 65   HOH HOH A . 
Y 11 HOH 66  2071 66   HOH HOH A . 
Y 11 HOH 67  2072 67   HOH HOH A . 
Y 11 HOH 68  2073 68   HOH HOH A . 
Y 11 HOH 69  2074 69   HOH HOH A . 
Y 11 HOH 70  2075 70   HOH HOH A . 
Y 11 HOH 71  2076 71   HOH HOH A . 
Y 11 HOH 72  2077 72   HOH HOH A . 
Y 11 HOH 73  2078 73   HOH HOH A . 
Y 11 HOH 74  2079 74   HOH HOH A . 
Y 11 HOH 75  2080 75   HOH HOH A . 
Y 11 HOH 76  2081 76   HOH HOH A . 
Y 11 HOH 77  2082 77   HOH HOH A . 
Y 11 HOH 78  2083 78   HOH HOH A . 
Y 11 HOH 79  2084 79   HOH HOH A . 
Y 11 HOH 80  2085 80   HOH HOH A . 
Y 11 HOH 81  2086 81   HOH HOH A . 
Y 11 HOH 82  2087 82   HOH HOH A . 
Y 11 HOH 83  2088 83   HOH HOH A . 
Y 11 HOH 84  2089 84   HOH HOH A . 
Y 11 HOH 85  2090 85   HOH HOH A . 
Y 11 HOH 86  2091 86   HOH HOH A . 
Y 11 HOH 87  2092 87   HOH HOH A . 
Y 11 HOH 88  2093 88   HOH HOH A . 
Y 11 HOH 89  2094 89   HOH HOH A . 
Y 11 HOH 90  2095 90   HOH HOH A . 
Y 11 HOH 91  2096 91   HOH HOH A . 
Y 11 HOH 92  2097 92   HOH HOH A . 
Y 11 HOH 93  2098 93   HOH HOH A . 
Y 11 HOH 94  2099 94   HOH HOH A . 
Y 11 HOH 95  2100 95   HOH HOH A . 
Y 11 HOH 96  2101 96   HOH HOH A . 
Y 11 HOH 97  2102 97   HOH HOH A . 
Y 11 HOH 98  2103 98   HOH HOH A . 
Y 11 HOH 99  2104 99   HOH HOH A . 
Y 11 HOH 100 2105 100  HOH HOH A . 
Y 11 HOH 101 2106 101  HOH HOH A . 
Y 11 HOH 102 2107 102  HOH HOH A . 
Y 11 HOH 103 2108 103  HOH HOH A . 
Y 11 HOH 104 2109 104  HOH HOH A . 
Y 11 HOH 105 2110 105  HOH HOH A . 
Y 11 HOH 106 2111 106  HOH HOH A . 
Y 11 HOH 107 2112 107  HOH HOH A . 
Y 11 HOH 108 2113 108  HOH HOH A . 
Y 11 HOH 109 2114 109  HOH HOH A . 
Y 11 HOH 110 2115 110  HOH HOH A . 
Y 11 HOH 111 2116 111  HOH HOH A . 
Y 11 HOH 112 2117 112  HOH HOH A . 
Y 11 HOH 113 2118 113  HOH HOH A . 
Y 11 HOH 114 2119 114  HOH HOH A . 
Y 11 HOH 115 2120 115  HOH HOH A . 
Y 11 HOH 116 2121 116  HOH HOH A . 
Y 11 HOH 117 2122 117  HOH HOH A . 
Y 11 HOH 118 2123 118  HOH HOH A . 
Y 11 HOH 119 2124 119  HOH HOH A . 
Y 11 HOH 120 2125 120  HOH HOH A . 
Y 11 HOH 121 2126 121  HOH HOH A . 
Y 11 HOH 122 2127 122  HOH HOH A . 
Y 11 HOH 123 2128 123  HOH HOH A . 
Y 11 HOH 124 2129 124  HOH HOH A . 
Y 11 HOH 125 2130 125  HOH HOH A . 
Y 11 HOH 126 2131 126  HOH HOH A . 
Y 11 HOH 127 2132 127  HOH HOH A . 
Y 11 HOH 128 2133 128  HOH HOH A . 
Y 11 HOH 129 2134 129  HOH HOH A . 
Y 11 HOH 130 2135 130  HOH HOH A . 
Y 11 HOH 131 2136 131  HOH HOH A . 
Y 11 HOH 132 2137 132  HOH HOH A . 
Y 11 HOH 133 2138 133  HOH HOH A . 
Y 11 HOH 134 2139 134  HOH HOH A . 
Y 11 HOH 135 2140 135  HOH HOH A . 
Y 11 HOH 136 2141 136  HOH HOH A . 
Y 11 HOH 137 2142 137  HOH HOH A . 
Y 11 HOH 138 2143 138  HOH HOH A . 
Y 11 HOH 139 2144 139  HOH HOH A . 
Y 11 HOH 140 2145 140  HOH HOH A . 
Y 11 HOH 141 2146 141  HOH HOH A . 
Y 11 HOH 142 2147 142  HOH HOH A . 
Y 11 HOH 143 2148 143  HOH HOH A . 
Y 11 HOH 144 2149 144  HOH HOH A . 
Y 11 HOH 145 2150 145  HOH HOH A . 
Y 11 HOH 146 2151 146  HOH HOH A . 
Y 11 HOH 147 2152 147  HOH HOH A . 
Y 11 HOH 148 2153 148  HOH HOH A . 
Y 11 HOH 149 2154 149  HOH HOH A . 
Y 11 HOH 150 2155 150  HOH HOH A . 
Y 11 HOH 151 2156 151  HOH HOH A . 
Y 11 HOH 152 2157 152  HOH HOH A . 
Y 11 HOH 153 2158 153  HOH HOH A . 
Y 11 HOH 154 2159 154  HOH HOH A . 
Y 11 HOH 155 2160 155  HOH HOH A . 
Y 11 HOH 156 2161 156  HOH HOH A . 
Y 11 HOH 157 2162 157  HOH HOH A . 
Y 11 HOH 158 2163 158  HOH HOH A . 
Y 11 HOH 159 2164 159  HOH HOH A . 
Y 11 HOH 160 2165 160  HOH HOH A . 
Y 11 HOH 161 2166 161  HOH HOH A . 
Y 11 HOH 162 2167 162  HOH HOH A . 
Y 11 HOH 163 2168 163  HOH HOH A . 
Y 11 HOH 164 2169 164  HOH HOH A . 
Y 11 HOH 165 2170 165  HOH HOH A . 
Y 11 HOH 166 2171 166  HOH HOH A . 
Y 11 HOH 167 2172 167  HOH HOH A . 
Y 11 HOH 168 2173 168  HOH HOH A . 
Y 11 HOH 169 2174 169  HOH HOH A . 
Y 11 HOH 170 2175 170  HOH HOH A . 
Y 11 HOH 171 2176 171  HOH HOH A . 
Y 11 HOH 172 2177 172  HOH HOH A . 
Y 11 HOH 173 2178 173  HOH HOH A . 
Y 11 HOH 174 2179 174  HOH HOH A . 
Y 11 HOH 175 2180 175  HOH HOH A . 
Y 11 HOH 176 2181 176  HOH HOH A . 
Y 11 HOH 177 2182 177  HOH HOH A . 
Y 11 HOH 178 2183 178  HOH HOH A . 
Y 11 HOH 179 2184 179  HOH HOH A . 
Y 11 HOH 180 2185 180  HOH HOH A . 
Y 11 HOH 181 2186 181  HOH HOH A . 
Y 11 HOH 182 2187 182  HOH HOH A . 
Y 11 HOH 183 2188 183  HOH HOH A . 
Y 11 HOH 184 2189 184  HOH HOH A . 
Y 11 HOH 185 2190 185  HOH HOH A . 
Y 11 HOH 186 2191 186  HOH HOH A . 
Y 11 HOH 187 2192 187  HOH HOH A . 
Y 11 HOH 188 2193 188  HOH HOH A . 
Y 11 HOH 189 2194 189  HOH HOH A . 
Y 11 HOH 190 2195 190  HOH HOH A . 
Y 11 HOH 191 2196 191  HOH HOH A . 
Y 11 HOH 192 2197 192  HOH HOH A . 
Y 11 HOH 193 2198 193  HOH HOH A . 
Y 11 HOH 194 2199 194  HOH HOH A . 
Y 11 HOH 195 2200 195  HOH HOH A . 
Y 11 HOH 196 2201 196  HOH HOH A . 
Y 11 HOH 197 2202 197  HOH HOH A . 
Y 11 HOH 198 2203 198  HOH HOH A . 
Y 11 HOH 199 2204 199  HOH HOH A . 
Y 11 HOH 200 2205 200  HOH HOH A . 
Y 11 HOH 201 2206 201  HOH HOH A . 
Y 11 HOH 202 2207 202  HOH HOH A . 
Y 11 HOH 203 2208 203  HOH HOH A . 
Y 11 HOH 204 2209 204  HOH HOH A . 
Y 11 HOH 205 2210 205  HOH HOH A . 
Y 11 HOH 206 2211 206  HOH HOH A . 
Y 11 HOH 207 2212 207  HOH HOH A . 
Y 11 HOH 208 2213 208  HOH HOH A . 
Y 11 HOH 209 2214 209  HOH HOH A . 
Y 11 HOH 210 2215 210  HOH HOH A . 
Y 11 HOH 211 2216 211  HOH HOH A . 
Y 11 HOH 212 2217 212  HOH HOH A . 
Y 11 HOH 213 2218 213  HOH HOH A . 
Y 11 HOH 214 2219 214  HOH HOH A . 
Y 11 HOH 215 2220 215  HOH HOH A . 
Y 11 HOH 216 2221 216  HOH HOH A . 
Y 11 HOH 217 2222 217  HOH HOH A . 
Y 11 HOH 218 2223 218  HOH HOH A . 
Y 11 HOH 219 2224 219  HOH HOH A . 
Y 11 HOH 220 2225 220  HOH HOH A . 
Y 11 HOH 221 2226 221  HOH HOH A . 
Y 11 HOH 222 2227 222  HOH HOH A . 
Y 11 HOH 223 2228 223  HOH HOH A . 
Y 11 HOH 224 2229 224  HOH HOH A . 
Y 11 HOH 225 2230 225  HOH HOH A . 
Y 11 HOH 226 2231 226  HOH HOH A . 
Y 11 HOH 227 2232 227  HOH HOH A . 
Y 11 HOH 228 2233 228  HOH HOH A . 
Y 11 HOH 229 2234 229  HOH HOH A . 
Y 11 HOH 230 2235 230  HOH HOH A . 
Y 11 HOH 231 2236 231  HOH HOH A . 
Y 11 HOH 232 2237 232  HOH HOH A . 
Y 11 HOH 233 2238 233  HOH HOH A . 
Y 11 HOH 234 2239 234  HOH HOH A . 
Y 11 HOH 235 2240 235  HOH HOH A . 
Y 11 HOH 236 2241 236  HOH HOH A . 
Y 11 HOH 237 2242 237  HOH HOH A . 
Y 11 HOH 238 2243 238  HOH HOH A . 
Y 11 HOH 239 2244 239  HOH HOH A . 
Y 11 HOH 240 2245 240  HOH HOH A . 
Y 11 HOH 241 2246 241  HOH HOH A . 
Y 11 HOH 242 2247 242  HOH HOH A . 
Y 11 HOH 243 2248 243  HOH HOH A . 
Y 11 HOH 244 2249 244  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_conn_angle.id                    1 
_pdbx_struct_conn_angle.ptnr1_label_atom_id   O3 
_pdbx_struct_conn_angle.ptnr1_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr1_label_asym_id   E 
_pdbx_struct_conn_angle.ptnr1_label_comp_id   PO4 
_pdbx_struct_conn_angle.ptnr1_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id    PO4 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id     2005 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr1_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr2_label_atom_id   NI 
_pdbx_struct_conn_angle.ptnr2_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr2_label_asym_id   C 
_pdbx_struct_conn_angle.ptnr2_label_comp_id   NI 
_pdbx_struct_conn_angle.ptnr2_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id    NI 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id     1030 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr2_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr3_label_atom_id   O4 
_pdbx_struct_conn_angle.ptnr3_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr3_label_asym_id   E 
_pdbx_struct_conn_angle.ptnr3_label_comp_id   PO4 
_pdbx_struct_conn_angle.ptnr3_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id    PO4 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id     2005 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr3_symmetry        1_555 
_pdbx_struct_conn_angle.value                 64.1 
_pdbx_struct_conn_angle.value_esd             ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-07-26 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2012-06-20 
5 'Structure model' 1 4 2017-10-04 
6 'Structure model' 1 5 2019-11-27 
7 'Structure model' 1 6 2020-06-24 
8 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 8 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Non-polymer description'   
3  3 'Structure model' 'Version format compliance' 
4  4 'Structure model' 'Non-polymer description'   
5  5 'Structure model' 'Data collection'           
6  5 'Structure model' 'Refinement description'    
7  6 'Structure model' 'Data collection'           
8  6 'Structure model' 'Database references'       
9  6 'Structure model' 'Derived calculations'      
10 7 'Structure model' 'Data collection'           
11 7 'Structure model' 'Derived calculations'      
12 8 'Structure model' Advisory                    
13 8 'Structure model' 'Atomic model'              
14 8 'Structure model' 'Data collection'           
15 8 'Structure model' 'Derived calculations'      
16 8 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  5 'Structure model' diffrn_source                 
2  5 'Structure model' software                      
3  6 'Structure model' chem_comp                     
4  6 'Structure model' citation                      
5  6 'Structure model' struct_conn                   
6  7 'Structure model' chem_comp                     
7  7 'Structure model' struct_conn                   
8  8 'Structure model' atom_site                     
9  8 'Structure model' chem_comp                     
10 8 'Structure model' entity                        
11 8 'Structure model' pdbx_branch_scheme            
12 8 'Structure model' pdbx_chem_comp_identifier     
13 8 'Structure model' pdbx_entity_branch            
14 8 'Structure model' pdbx_entity_branch_descriptor 
15 8 'Structure model' pdbx_entity_branch_link       
16 8 'Structure model' pdbx_entity_branch_list       
17 8 'Structure model' pdbx_entity_nonpoly           
18 8 'Structure model' pdbx_nonpoly_scheme           
19 8 'Structure model' pdbx_struct_assembly_gen      
20 8 'Structure model' pdbx_struct_conn_angle        
21 8 'Structure model' pdbx_unobs_or_zero_occ_atoms  
22 8 'Structure model' pdbx_validate_close_contact   
23 8 'Structure model' struct_asym                   
24 8 'Structure model' struct_conn                   
25 8 'Structure model' struct_site                   
26 8 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  5 'Structure model' '_diffrn_source.pdbx_synchrotron_site'        
2  6 'Structure model' '_chem_comp.type'                             
3  6 'Structure model' '_citation.page_last'                         
4  6 'Structure model' '_citation.pdbx_database_id_DOI'              
5  6 'Structure model' '_citation.pdbx_database_id_PubMed'           
6  6 'Structure model' '_citation.title'                             
7  6 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
8  7 'Structure model' '_chem_comp.type'                             
9  8 'Structure model' '_atom_site.B_iso_or_equiv'                   
10 8 'Structure model' '_atom_site.Cartn_x'                          
11 8 'Structure model' '_atom_site.Cartn_y'                          
12 8 'Structure model' '_atom_site.Cartn_z'                          
13 8 'Structure model' '_atom_site.auth_asym_id'                     
14 8 'Structure model' '_atom_site.auth_atom_id'                     
15 8 'Structure model' '_atom_site.auth_comp_id'                     
16 8 'Structure model' '_atom_site.auth_seq_id'                      
17 8 'Structure model' '_atom_site.label_asym_id'                    
18 8 'Structure model' '_atom_site.label_atom_id'                    
19 8 'Structure model' '_atom_site.label_comp_id'                    
20 8 'Structure model' '_atom_site.label_entity_id'                  
21 8 'Structure model' '_atom_site.type_symbol'                      
22 8 'Structure model' '_chem_comp.name'                             
23 8 'Structure model' '_chem_comp.type'                             
24 8 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
25 8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
26 8 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
27 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
28 8 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.label_asym_id' 
29 8 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_1' 
30 8 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_1'  
31 8 'Structure model' '_struct_conn.conn_type_id'                   
32 8 'Structure model' '_struct_conn.id'                             
33 8 'Structure model' '_struct_conn.pdbx_dist_value'                
34 8 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
35 8 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
36 8 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
37 8 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
38 8 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
39 8 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
40 8 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
41 8 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
42 8 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
43 8 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
44 8 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
45 8 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
46 8 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345 'data collection' .   ? 1 
XDS    'data reduction'  .   ? 2 
SOLVE  phasing           .   ? 3 
CNS    refinement        1.0 ? 4 
XDS    'data scaling'    .   ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O4  B GMH 4    ? ? P1  A DPO 2004 ? ? 1.48 
2  1 O4  B GCN 2    ? ? P   A PO4 2001 ? ? 1.54 
3  1 O4  B GMH 5    ? ? P   A PO4 2005 ? ? 1.60 
4  1 N   A GLY 146  ? ? O   A HOH 2164 ? ? 2.04 
5  1 O4  B GMH 4    ? ? O4  A DPO 2004 ? ? 2.06 
6  1 NE1 A TRP 390  ? ? OG  A SER 431  ? ? 2.06 
7  1 O   A GLN 32   ? ? NH2 A ARG 128  ? ? 2.07 
8  1 O3  A DPO 2004 ? ? O   A HOH 2022 ? ? 2.14 
9  1 O4  B GMH 5    ? ? O3  A PO4 2005 ? ? 2.15 
10 1 ND2 A ASN 522  ? ? O   A HOH 2085 ? ? 2.18 
11 1 O   A THR 35   ? ? OH  A TYR 140  ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB A VAL 66  ? ? CG2 A VAL 66  ? ? 1.325 1.524 -0.199 0.021 N 
2 1 CZ A TYR 275 ? ? CE2 A TYR 275 ? ? 1.302 1.381 -0.079 0.013 N 
3 1 CZ A ARG 277 ? ? NH1 A ARG 277 ? ? 1.413 1.326 0.087  0.013 N 
4 1 CA A VAL 397 ? ? CB  A VAL 397 ? ? 1.682 1.543 0.139  0.021 N 
5 1 CB A GLU 698 ? ? CG  A GLU 698 ? ? 1.632 1.517 0.115  0.019 N 
6 1 CG A GLU 698 ? ? CD  A GLU 698 ? ? 1.665 1.515 0.150  0.015 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 C  A VAL 46  ? ? N  A PRO 47  ? ? CA  A PRO 47  ? ? 141.58 119.30 22.28  1.50 Y 
2  1 C  A VAL 46  ? ? N  A PRO 47  ? ? CD  A PRO 47  ? ? 107.79 128.40 -20.61 2.10 Y 
3  1 CG A MET 125 ? ? SD A MET 125 ? ? CE  A MET 125 ? ? 85.71  100.20 -14.49 1.60 N 
4  1 C  A PRO 145 ? ? N  A GLY 146 ? ? CA  A GLY 146 ? ? 109.06 122.30 -13.24 2.10 Y 
5  1 NE A ARG 193 ? ? CZ A ARG 193 ? ? NH1 A ARG 193 ? ? 116.77 120.30 -3.53  0.50 N 
6  1 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 117.17 120.30 -3.13  0.50 N 
7  1 NE A ARG 212 ? ? CZ A ARG 212 ? ? NH2 A ARG 212 ? ? 116.55 120.30 -3.75  0.50 N 
8  1 C  A GLU 238 ? ? N  A PRO 239 ? ? CA  A PRO 239 ? ? 132.61 119.30 13.31  1.50 Y 
9  1 NE A ARG 277 ? ? CZ A ARG 277 ? ? NH2 A ARG 277 ? ? 116.57 120.30 -3.73  0.50 N 
10 1 NE A ARG 297 ? ? CZ A ARG 297 ? ? NH1 A ARG 297 ? ? 123.71 120.30 3.41   0.50 N 
11 1 CB A ASP 320 ? ? CG A ASP 320 ? ? OD1 A ASP 320 ? ? 123.74 118.30 5.44   0.90 N 
12 1 CA A LEU 332 ? ? CB A LEU 332 ? ? CG  A LEU 332 ? ? 131.32 115.30 16.02  2.30 N 
13 1 CA A LEU 352 ? ? CB A LEU 352 ? ? CG  A LEU 352 ? ? 136.52 115.30 21.22  2.30 N 
14 1 C  A ASP 394 ? ? N  A ASP 395 ? ? CA  A ASP 395 ? ? 106.67 121.70 -15.03 2.50 Y 
15 1 CA A LEU 400 ? ? CB A LEU 400 ? ? CG  A LEU 400 ? ? 129.32 115.30 14.02  2.30 N 
16 1 C  A ASP 427 ? ? N  A PRO 428 ? ? CA  A PRO 428 ? ? 129.32 119.30 10.02  1.50 Y 
17 1 NE A ARG 474 ? ? CZ A ARG 474 ? ? NH1 A ARG 474 ? ? 124.35 120.30 4.05   0.50 N 
18 1 NE A ARG 577 ? ? CZ A ARG 577 ? ? NH1 A ARG 577 ? ? 116.05 120.30 -4.25  0.50 N 
19 1 NE A ARG 648 ? ? CZ A ARG 648 ? ? NH1 A ARG 648 ? ? 114.71 120.30 -5.59  0.50 N 
20 1 CB A ASP 656 ? ? CG A ASP 656 ? ? OD1 A ASP 656 ? ? 124.41 118.30 6.11   0.90 N 
21 1 NE A ARG 715 ? ? CZ A ARG 715 ? ? NH1 A ARG 715 ? ? 123.30 120.30 3.00   0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 34  ? ? -149.76 -15.51  
2  1 THR A 37  ? ? -143.23 -3.07   
3  1 PRO A 47  ? ? -61.12  4.91    
4  1 ASP A 88  ? ? -105.24 78.35   
5  1 GLN A 100 ? ? 89.64   11.20   
6  1 PHE A 115 ? ? 53.18   -139.91 
7  1 VAL A 136 ? ? -148.40 24.28   
8  1 SER A 172 ? ? 77.77   33.62   
9  1 ASP A 224 ? ? -170.41 -172.62 
10 1 TYR A 244 ? ? -149.65 36.81   
11 1 THR A 252 ? ? -133.72 -84.90  
12 1 ASN A 258 ? ? -67.70  9.79    
13 1 THR A 264 ? ? -39.24  -19.88  
14 1 ALA A 270 ? ? -59.27  -158.67 
15 1 ASN A 291 ? ? -161.32 -164.35 
16 1 TYR A 315 ? ? -144.55 39.98   
17 1 PRO A 321 ? ? -38.39  -38.44  
18 1 ALA A 331 ? ? -63.44  27.98   
19 1 PRO A 334 ? ? -21.37  -46.49  
20 1 HIS A 339 ? ? -140.21 16.20   
21 1 LYS A 344 ? ? -128.39 -161.00 
22 1 TYR A 393 ? ? -105.69 -155.51 
23 1 PRO A 398 ? ? -39.41  167.01  
24 1 ASN A 418 ? ? -94.11  -149.36 
25 1 ASP A 420 ? ? -56.79  -159.63 
26 1 PHE A 421 ? ? -178.36 130.16  
27 1 ALA A 425 ? ? -66.57  94.76   
28 1 ASP A 454 ? ? 64.61   -112.56 
29 1 ASN A 558 ? ? 74.68   41.57   
30 1 GLU A 572 ? ? -101.32 -156.73 
31 1 ASP A 676 ? ? -59.66  70.79   
32 1 LEU A 677 ? ? -21.54  -33.17  
33 1 ALA A 678 ? ? -20.10  -67.94  
34 1 ARG A 679 ? ? -46.56  14.21   
35 1 MET A 682 ? ? -52.05  77.69   
36 1 ASP A 696 ? ? 29.03   44.64   
37 1 ARG A 715 ? ? -28.48  130.23  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 TYR A 72  ? ? 0.068 'SIDE CHAIN' 
2 1 TYR A 116 ? ? 0.076 'SIDE CHAIN' 
3 1 TYR A 213 ? ? 0.128 'SIDE CHAIN' 
4 1 TYR A 234 ? ? 0.072 'SIDE CHAIN' 
5 1 TYR A 599 ? ? 0.095 'SIDE CHAIN' 
6 1 TYR A 612 ? ? 0.076 'SIDE CHAIN' 
7 1 TYR A 699 ? ? 0.062 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 N 1 A PO4 2001 ? O4  ? D PO4 1 O4  
2  1 N 1 A PO4 2005 ? O1  ? E PO4 1 O1  
3  1 N 1 A FTT 1010 ? C5  ? G FTT 1 C5  
4  1 N 1 A FTT 1010 ? C6  ? G FTT 1 C6  
5  1 N 1 A FTT 1010 ? C7  ? G FTT 1 C7  
6  1 N 1 A FTT 1010 ? C8  ? G FTT 1 C8  
7  1 N 1 A FTT 1010 ? C9  ? G FTT 1 C9  
8  1 N 1 A FTT 1010 ? C10 ? G FTT 1 C10 
9  1 N 1 A FTT 1010 ? C11 ? G FTT 1 C11 
10 1 N 1 A FTT 1010 ? C12 ? G FTT 1 C12 
11 1 N 1 A FTT 1010 ? C13 ? G FTT 1 C13 
12 1 N 1 A FTT 1010 ? C14 ? G FTT 1 C14 
13 1 N 1 A DPO 2004 ? O1  ? P DPO 1 O1  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 1  ? A ALA 1  
2  1 Y 1 A VAL 2  ? A VAL 2  
3  1 Y 1 A GLU 3  ? A GLU 3  
4  1 Y 1 A PRO 4  ? A PRO 4  
5  1 Y 1 A LYS 5  ? A LYS 5  
6  1 Y 1 A GLU 6  ? A GLU 6  
7  1 Y 1 A ASP 7  ? A ASP 7  
8  1 Y 1 A THR 8  ? A THR 8  
9  1 Y 1 A ILE 9  ? A ILE 9  
10 1 Y 1 A THR 10 ? A THR 10 
11 1 Y 1 A VAL 11 ? A VAL 11 
12 1 Y 1 A THR 12 ? A THR 12 
13 1 Y 1 A ALA 13 ? A ALA 13 
14 1 Y 1 A ALA 14 ? A ALA 14 
15 1 Y 1 A PRO 15 ? A PRO 15 
16 1 Y 1 A ALA 16 ? A ALA 16 
17 1 Y 1 A PRO 17 ? A PRO 17 
18 1 Y 1 A GLN 18 ? A GLN 18 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 PA1 1 B PA1 1 X GCN 1000 n 
B 2 GCN 2 B GCN 2 X GCN 1001 n 
B 2 KDO 3 B KDO 3 X KDO 1002 n 
B 2 GMH 4 B GMH 4 X GMH 1004 n 
B 2 GMH 5 B GMH 5 X GMH 1005 n 
B 2 GLC 6 B GLC 6 X GLC 1006 n 
B 2 GLC 7 B GLC 7 X GLC 1007 n 
B 2 GLA 8 B GLA 8 X GAL 1008 n 
B 2 KDO 9 B KDO 9 X KDO 1003 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
GCN 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-3-deoxy-GlcpN     
GLA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGalpa                
GLA 'COMMON NAME'                         GMML     1.0 a-D-galactopyranose   
GLA 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Galp              
GLA 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Gal                   
GLC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpa                
GLC 'COMMON NAME'                         GMML     1.0 a-D-glucopyranose     
GLC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Glcp              
GLC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Glc                   
GMH 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 LDmanHep              
GMH 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 L-gro-a-D-manHepp     
KDO 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DKdopa                
KDO 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Kdop              
KDO 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Kdo                   
PA1 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNa               
PA1 'COMMON NAME'                         GMML     1.0 a-D-glucopyranosamine 
PA1 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-GlcpN             
PA1 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcN                  
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 
;WURCS=2.0/6,9,8/[a2122h-1a_1-5_2*N][a2d22h-1a_1-5_2*N][Aad1122h-2a_2-6][a11221h-1a_1-5][a2122h-1a_1-5][a2112h-1a_1-5]/1-2-3-3-4-4-5-5-6/a6-b1_b6-c2_c4-d2_c5-e1_e3-f1_f3-g1_g3-h1_g6-i1
;
WURCS  PDB2Glycan 1.1.0 
2 2 
;[][a-D-3-deoxy-GlcpN]{[(6+1)][a-D-3-deoxy-GlcpN]{[(6+2)][a-D-Kdop]{[(4+2)][a-D-Kdop]{}[(5+1)][a-D-Manp]{[(3+1)][a-D-Manp]{[(3+1)][a-D-Glcp]{[(3+1)][a-D-Glcp]{}[(6+1)][a-D-Galp]{}}}}}}}
;
LINUCS PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 GCN C1 O1 1 PA1 O6 HO6 sing ? 
2 2 3 KDO C2 O2 2 GCN O6 HO6 sing ? 
3 2 4 GMH C1 O1 3 KDO O5 HO5 sing ? 
4 2 5 GMH C1 O1 4 GMH O3 HO3 sing ? 
5 2 6 GLC C1 O1 5 GMH O3 HO3 sing ? 
6 2 7 GLC C1 O1 6 GLC O3 HO3 sing ? 
7 2 8 GLA C1 O1 6 GLC O6 HO6 sing ? 
8 2 9 KDO C2 O2 3 KDO O4 HO4 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 PA1 1 n 
2 GCN 2 n 
2 KDO 3 n 
2 GMH 4 n 
2 GMH 5 n 
2 GLC 6 n 
2 GLC 7 n 
2 GLA 8 n 
2 KDO 9 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3  'NICKEL (II) ION'               NI  
4  'PHOSPHATE ION'                 PO4 
5  '3-HYDROXY-TETRADECANOIC ACID'  FTT 
6  'LAURIC ACID'                   DAO 
7  'MYRISTIC ACID'                 MYR 
8  DECYLAMINE-N,N-DIMETHYL-N-OXIDE DDQ 
9  DIPHOSPHATE                     DPO 
10 GLYCEROL                        GOL 
11 water                           HOH 
#