data_1QFM
# 
_entry.id   1QFM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QFM         
RCSB  RCSB000831   
WWPDB D_1000000831 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QFM 
_pdbx_database_status.recvd_initial_deposition_date   1999-04-12 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Fulop, V.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Prolyl oligopeptidase: an unusual beta-propeller domain regulates proteolysis.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            94 
_citation.page_first                161 
_citation.page_last                 170 
_citation.year                      1998 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9695945 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(00)81416-6' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fulop, V.'   1 
primary 'Bocskei, Z.' 2 
primary 'Polgar, L.'  3 
# 
_cell.entry_id           1QFM 
_cell.length_a           70.700 
_cell.length_b           99.600 
_cell.length_c           110.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QFM 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'PROTEIN (PROLYL OLIGOPEPTIDASE)' 80976.344 1   3.4.21.26 ? ? ? 
2 non-polymer syn 1-HYDROXY-1-THIO-GLYCEROL         124.159   2   ?         ? ? ? 
3 non-polymer syn MONOTHIOGLYCEROL                  108.159   2   ?         ? ? ? 
4 non-polymer syn GLYCEROL                          92.094    4   ?         ? ? ? 
5 water       nat water                             18.015    887 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PROLYL ENDOPEPTIDASE, POST-PROLINE CLEAVING ENZYME' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MLSFQYPDVYRDETAIQDYHGHKV(CSX)DPYAWLEDPDSEQTKAFVEAQNKITVPFLEQ(CSX)PIRGLYKERMTELYD
YPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNILSDDGTVALRGYAFSEDGEYFAYGLSASGSDWVT
IKFMKVDGAKELPDVLERVKFS(CSD)MAWTHDGKGMFYNAYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEF
PDEPKWMGGAELSDDGRYVLLSIREG(CSX)DPVNRLWYCDLQQESNGITGILKWVKLIDNFEGEYDYVTNEGTVFTFKT
NRHSPNYRLINIDFTDPEESKWKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNTLQLHDLATGALLKIFPLEVGSVVG
YSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPSKDGTKIPMFIVHKKGIKLDG
SHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANIRGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTS
PKRLTINGGSNGGLLVATCANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYG(CSD)SDSKQHFEWLIKYSPLHNV
KLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIVGRSRKQNNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFI
ARCLNIDWIP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MLSFQYPDVYRDETAIQDYHGHKVCDPYAWLEDPDSEQTKAFVEAQNKITVPFLEQCPIRGLYKERMTELYDYPKYSCHF
KKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNILSDDGTVALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDG
AKELPDVLERVKFSCMAWTHDGKGMFYNAYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEFPDEPKWMGGAEL
SDDGRYVLLSIREGCDPVNRLWYCDLQQESNGITGILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTD
PEESKWKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNTLQLHDLATGALLKIFPLEVGSVVGYSGQKKDTEIFYQFTS
FLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPSKDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISI
TPNYSVSRLIFVRHMGGVLAVANIRGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLV
ATCANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLIKYSPLHNVKLPEADDIQYPSMLLLTADH
DDRVVPLHSLKFIATLQYIVGRSRKQNNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDWIP
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LEU n 
1 3   SER n 
1 4   PHE n 
1 5   GLN n 
1 6   TYR n 
1 7   PRO n 
1 8   ASP n 
1 9   VAL n 
1 10  TYR n 
1 11  ARG n 
1 12  ASP n 
1 13  GLU n 
1 14  THR n 
1 15  ALA n 
1 16  ILE n 
1 17  GLN n 
1 18  ASP n 
1 19  TYR n 
1 20  HIS n 
1 21  GLY n 
1 22  HIS n 
1 23  LYS n 
1 24  VAL n 
1 25  CSX n 
1 26  ASP n 
1 27  PRO n 
1 28  TYR n 
1 29  ALA n 
1 30  TRP n 
1 31  LEU n 
1 32  GLU n 
1 33  ASP n 
1 34  PRO n 
1 35  ASP n 
1 36  SER n 
1 37  GLU n 
1 38  GLN n 
1 39  THR n 
1 40  LYS n 
1 41  ALA n 
1 42  PHE n 
1 43  VAL n 
1 44  GLU n 
1 45  ALA n 
1 46  GLN n 
1 47  ASN n 
1 48  LYS n 
1 49  ILE n 
1 50  THR n 
1 51  VAL n 
1 52  PRO n 
1 53  PHE n 
1 54  LEU n 
1 55  GLU n 
1 56  GLN n 
1 57  CSX n 
1 58  PRO n 
1 59  ILE n 
1 60  ARG n 
1 61  GLY n 
1 62  LEU n 
1 63  TYR n 
1 64  LYS n 
1 65  GLU n 
1 66  ARG n 
1 67  MET n 
1 68  THR n 
1 69  GLU n 
1 70  LEU n 
1 71  TYR n 
1 72  ASP n 
1 73  TYR n 
1 74  PRO n 
1 75  LYS n 
1 76  TYR n 
1 77  SER n 
1 78  CYS n 
1 79  HIS n 
1 80  PHE n 
1 81  LYS n 
1 82  LYS n 
1 83  GLY n 
1 84  LYS n 
1 85  ARG n 
1 86  TYR n 
1 87  PHE n 
1 88  TYR n 
1 89  PHE n 
1 90  TYR n 
1 91  ASN n 
1 92  THR n 
1 93  GLY n 
1 94  LEU n 
1 95  GLN n 
1 96  ASN n 
1 97  GLN n 
1 98  ARG n 
1 99  VAL n 
1 100 LEU n 
1 101 TYR n 
1 102 VAL n 
1 103 GLN n 
1 104 ASP n 
1 105 SER n 
1 106 LEU n 
1 107 GLU n 
1 108 GLY n 
1 109 GLU n 
1 110 ALA n 
1 111 ARG n 
1 112 VAL n 
1 113 PHE n 
1 114 LEU n 
1 115 ASP n 
1 116 PRO n 
1 117 ASN n 
1 118 ILE n 
1 119 LEU n 
1 120 SER n 
1 121 ASP n 
1 122 ASP n 
1 123 GLY n 
1 124 THR n 
1 125 VAL n 
1 126 ALA n 
1 127 LEU n 
1 128 ARG n 
1 129 GLY n 
1 130 TYR n 
1 131 ALA n 
1 132 PHE n 
1 133 SER n 
1 134 GLU n 
1 135 ASP n 
1 136 GLY n 
1 137 GLU n 
1 138 TYR n 
1 139 PHE n 
1 140 ALA n 
1 141 TYR n 
1 142 GLY n 
1 143 LEU n 
1 144 SER n 
1 145 ALA n 
1 146 SER n 
1 147 GLY n 
1 148 SER n 
1 149 ASP n 
1 150 TRP n 
1 151 VAL n 
1 152 THR n 
1 153 ILE n 
1 154 LYS n 
1 155 PHE n 
1 156 MET n 
1 157 LYS n 
1 158 VAL n 
1 159 ASP n 
1 160 GLY n 
1 161 ALA n 
1 162 LYS n 
1 163 GLU n 
1 164 LEU n 
1 165 PRO n 
1 166 ASP n 
1 167 VAL n 
1 168 LEU n 
1 169 GLU n 
1 170 ARG n 
1 171 VAL n 
1 172 LYS n 
1 173 PHE n 
1 174 SER n 
1 175 CSD n 
1 176 MET n 
1 177 ALA n 
1 178 TRP n 
1 179 THR n 
1 180 HIS n 
1 181 ASP n 
1 182 GLY n 
1 183 LYS n 
1 184 GLY n 
1 185 MET n 
1 186 PHE n 
1 187 TYR n 
1 188 ASN n 
1 189 ALA n 
1 190 TYR n 
1 191 PRO n 
1 192 GLN n 
1 193 GLN n 
1 194 ASP n 
1 195 GLY n 
1 196 LYS n 
1 197 SER n 
1 198 ASP n 
1 199 GLY n 
1 200 THR n 
1 201 GLU n 
1 202 THR n 
1 203 SER n 
1 204 THR n 
1 205 ASN n 
1 206 LEU n 
1 207 HIS n 
1 208 GLN n 
1 209 LYS n 
1 210 LEU n 
1 211 TYR n 
1 212 TYR n 
1 213 HIS n 
1 214 VAL n 
1 215 LEU n 
1 216 GLY n 
1 217 THR n 
1 218 ASP n 
1 219 GLN n 
1 220 SER n 
1 221 GLU n 
1 222 ASP n 
1 223 ILE n 
1 224 LEU n 
1 225 CYS n 
1 226 ALA n 
1 227 GLU n 
1 228 PHE n 
1 229 PRO n 
1 230 ASP n 
1 231 GLU n 
1 232 PRO n 
1 233 LYS n 
1 234 TRP n 
1 235 MET n 
1 236 GLY n 
1 237 GLY n 
1 238 ALA n 
1 239 GLU n 
1 240 LEU n 
1 241 SER n 
1 242 ASP n 
1 243 ASP n 
1 244 GLY n 
1 245 ARG n 
1 246 TYR n 
1 247 VAL n 
1 248 LEU n 
1 249 LEU n 
1 250 SER n 
1 251 ILE n 
1 252 ARG n 
1 253 GLU n 
1 254 GLY n 
1 255 CSX n 
1 256 ASP n 
1 257 PRO n 
1 258 VAL n 
1 259 ASN n 
1 260 ARG n 
1 261 LEU n 
1 262 TRP n 
1 263 TYR n 
1 264 CYS n 
1 265 ASP n 
1 266 LEU n 
1 267 GLN n 
1 268 GLN n 
1 269 GLU n 
1 270 SER n 
1 271 ASN n 
1 272 GLY n 
1 273 ILE n 
1 274 THR n 
1 275 GLY n 
1 276 ILE n 
1 277 LEU n 
1 278 LYS n 
1 279 TRP n 
1 280 VAL n 
1 281 LYS n 
1 282 LEU n 
1 283 ILE n 
1 284 ASP n 
1 285 ASN n 
1 286 PHE n 
1 287 GLU n 
1 288 GLY n 
1 289 GLU n 
1 290 TYR n 
1 291 ASP n 
1 292 TYR n 
1 293 VAL n 
1 294 THR n 
1 295 ASN n 
1 296 GLU n 
1 297 GLY n 
1 298 THR n 
1 299 VAL n 
1 300 PHE n 
1 301 THR n 
1 302 PHE n 
1 303 LYS n 
1 304 THR n 
1 305 ASN n 
1 306 ARG n 
1 307 HIS n 
1 308 SER n 
1 309 PRO n 
1 310 ASN n 
1 311 TYR n 
1 312 ARG n 
1 313 LEU n 
1 314 ILE n 
1 315 ASN n 
1 316 ILE n 
1 317 ASP n 
1 318 PHE n 
1 319 THR n 
1 320 ASP n 
1 321 PRO n 
1 322 GLU n 
1 323 GLU n 
1 324 SER n 
1 325 LYS n 
1 326 TRP n 
1 327 LYS n 
1 328 VAL n 
1 329 LEU n 
1 330 VAL n 
1 331 PRO n 
1 332 GLU n 
1 333 HIS n 
1 334 GLU n 
1 335 LYS n 
1 336 ASP n 
1 337 VAL n 
1 338 LEU n 
1 339 GLU n 
1 340 TRP n 
1 341 VAL n 
1 342 ALA n 
1 343 CYS n 
1 344 VAL n 
1 345 ARG n 
1 346 SER n 
1 347 ASN n 
1 348 PHE n 
1 349 LEU n 
1 350 VAL n 
1 351 LEU n 
1 352 CYS n 
1 353 TYR n 
1 354 LEU n 
1 355 HIS n 
1 356 ASP n 
1 357 VAL n 
1 358 LYS n 
1 359 ASN n 
1 360 THR n 
1 361 LEU n 
1 362 GLN n 
1 363 LEU n 
1 364 HIS n 
1 365 ASP n 
1 366 LEU n 
1 367 ALA n 
1 368 THR n 
1 369 GLY n 
1 370 ALA n 
1 371 LEU n 
1 372 LEU n 
1 373 LYS n 
1 374 ILE n 
1 375 PHE n 
1 376 PRO n 
1 377 LEU n 
1 378 GLU n 
1 379 VAL n 
1 380 GLY n 
1 381 SER n 
1 382 VAL n 
1 383 VAL n 
1 384 GLY n 
1 385 TYR n 
1 386 SER n 
1 387 GLY n 
1 388 GLN n 
1 389 LYS n 
1 390 LYS n 
1 391 ASP n 
1 392 THR n 
1 393 GLU n 
1 394 ILE n 
1 395 PHE n 
1 396 TYR n 
1 397 GLN n 
1 398 PHE n 
1 399 THR n 
1 400 SER n 
1 401 PHE n 
1 402 LEU n 
1 403 SER n 
1 404 PRO n 
1 405 GLY n 
1 406 ILE n 
1 407 ILE n 
1 408 TYR n 
1 409 HIS n 
1 410 CYS n 
1 411 ASP n 
1 412 LEU n 
1 413 THR n 
1 414 LYS n 
1 415 GLU n 
1 416 GLU n 
1 417 LEU n 
1 418 GLU n 
1 419 PRO n 
1 420 ARG n 
1 421 VAL n 
1 422 PHE n 
1 423 ARG n 
1 424 GLU n 
1 425 VAL n 
1 426 THR n 
1 427 VAL n 
1 428 LYS n 
1 429 GLY n 
1 430 ILE n 
1 431 ASP n 
1 432 ALA n 
1 433 SER n 
1 434 ASP n 
1 435 TYR n 
1 436 GLN n 
1 437 THR n 
1 438 VAL n 
1 439 GLN n 
1 440 ILE n 
1 441 PHE n 
1 442 TYR n 
1 443 PRO n 
1 444 SER n 
1 445 LYS n 
1 446 ASP n 
1 447 GLY n 
1 448 THR n 
1 449 LYS n 
1 450 ILE n 
1 451 PRO n 
1 452 MET n 
1 453 PHE n 
1 454 ILE n 
1 455 VAL n 
1 456 HIS n 
1 457 LYS n 
1 458 LYS n 
1 459 GLY n 
1 460 ILE n 
1 461 LYS n 
1 462 LEU n 
1 463 ASP n 
1 464 GLY n 
1 465 SER n 
1 466 HIS n 
1 467 PRO n 
1 468 ALA n 
1 469 PHE n 
1 470 LEU n 
1 471 TYR n 
1 472 GLY n 
1 473 TYR n 
1 474 GLY n 
1 475 GLY n 
1 476 PHE n 
1 477 ASN n 
1 478 ILE n 
1 479 SER n 
1 480 ILE n 
1 481 THR n 
1 482 PRO n 
1 483 ASN n 
1 484 TYR n 
1 485 SER n 
1 486 VAL n 
1 487 SER n 
1 488 ARG n 
1 489 LEU n 
1 490 ILE n 
1 491 PHE n 
1 492 VAL n 
1 493 ARG n 
1 494 HIS n 
1 495 MET n 
1 496 GLY n 
1 497 GLY n 
1 498 VAL n 
1 499 LEU n 
1 500 ALA n 
1 501 VAL n 
1 502 ALA n 
1 503 ASN n 
1 504 ILE n 
1 505 ARG n 
1 506 GLY n 
1 507 GLY n 
1 508 GLY n 
1 509 GLU n 
1 510 TYR n 
1 511 GLY n 
1 512 GLU n 
1 513 THR n 
1 514 TRP n 
1 515 HIS n 
1 516 LYS n 
1 517 GLY n 
1 518 GLY n 
1 519 ILE n 
1 520 LEU n 
1 521 ALA n 
1 522 ASN n 
1 523 LYS n 
1 524 GLN n 
1 525 ASN n 
1 526 CYS n 
1 527 PHE n 
1 528 ASP n 
1 529 ASP n 
1 530 PHE n 
1 531 GLN n 
1 532 CYS n 
1 533 ALA n 
1 534 ALA n 
1 535 GLU n 
1 536 TYR n 
1 537 LEU n 
1 538 ILE n 
1 539 LYS n 
1 540 GLU n 
1 541 GLY n 
1 542 TYR n 
1 543 THR n 
1 544 SER n 
1 545 PRO n 
1 546 LYS n 
1 547 ARG n 
1 548 LEU n 
1 549 THR n 
1 550 ILE n 
1 551 ASN n 
1 552 GLY n 
1 553 GLY n 
1 554 SER n 
1 555 ASN n 
1 556 GLY n 
1 557 GLY n 
1 558 LEU n 
1 559 LEU n 
1 560 VAL n 
1 561 ALA n 
1 562 THR n 
1 563 CYS n 
1 564 ALA n 
1 565 ASN n 
1 566 GLN n 
1 567 ARG n 
1 568 PRO n 
1 569 ASP n 
1 570 LEU n 
1 571 PHE n 
1 572 GLY n 
1 573 CYS n 
1 574 VAL n 
1 575 ILE n 
1 576 ALA n 
1 577 GLN n 
1 578 VAL n 
1 579 GLY n 
1 580 VAL n 
1 581 MET n 
1 582 ASP n 
1 583 MET n 
1 584 LEU n 
1 585 LYS n 
1 586 PHE n 
1 587 HIS n 
1 588 LYS n 
1 589 TYR n 
1 590 THR n 
1 591 ILE n 
1 592 GLY n 
1 593 HIS n 
1 594 ALA n 
1 595 TRP n 
1 596 THR n 
1 597 THR n 
1 598 ASP n 
1 599 TYR n 
1 600 GLY n 
1 601 CSD n 
1 602 SER n 
1 603 ASP n 
1 604 SER n 
1 605 LYS n 
1 606 GLN n 
1 607 HIS n 
1 608 PHE n 
1 609 GLU n 
1 610 TRP n 
1 611 LEU n 
1 612 ILE n 
1 613 LYS n 
1 614 TYR n 
1 615 SER n 
1 616 PRO n 
1 617 LEU n 
1 618 HIS n 
1 619 ASN n 
1 620 VAL n 
1 621 LYS n 
1 622 LEU n 
1 623 PRO n 
1 624 GLU n 
1 625 ALA n 
1 626 ASP n 
1 627 ASP n 
1 628 ILE n 
1 629 GLN n 
1 630 TYR n 
1 631 PRO n 
1 632 SER n 
1 633 MET n 
1 634 LEU n 
1 635 LEU n 
1 636 LEU n 
1 637 THR n 
1 638 ALA n 
1 639 ASP n 
1 640 HIS n 
1 641 ASP n 
1 642 ASP n 
1 643 ARG n 
1 644 VAL n 
1 645 VAL n 
1 646 PRO n 
1 647 LEU n 
1 648 HIS n 
1 649 SER n 
1 650 LEU n 
1 651 LYS n 
1 652 PHE n 
1 653 ILE n 
1 654 ALA n 
1 655 THR n 
1 656 LEU n 
1 657 GLN n 
1 658 TYR n 
1 659 ILE n 
1 660 VAL n 
1 661 GLY n 
1 662 ARG n 
1 663 SER n 
1 664 ARG n 
1 665 LYS n 
1 666 GLN n 
1 667 ASN n 
1 668 ASN n 
1 669 PRO n 
1 670 LEU n 
1 671 LEU n 
1 672 ILE n 
1 673 HIS n 
1 674 VAL n 
1 675 ASP n 
1 676 THR n 
1 677 LYS n 
1 678 ALA n 
1 679 GLY n 
1 680 HIS n 
1 681 GLY n 
1 682 ALA n 
1 683 GLY n 
1 684 LYS n 
1 685 PRO n 
1 686 THR n 
1 687 ALA n 
1 688 LYS n 
1 689 VAL n 
1 690 ILE n 
1 691 GLU n 
1 692 GLU n 
1 693 VAL n 
1 694 SER n 
1 695 ASP n 
1 696 MET n 
1 697 PHE n 
1 698 ALA n 
1 699 PHE n 
1 700 ILE n 
1 701 ALA n 
1 702 ARG n 
1 703 CYS n 
1 704 LEU n 
1 705 ASN n 
1 706 ILE n 
1 707 ASP n 
1 708 TRP n 
1 709 ILE n 
1 710 PRO n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                pig 
_entity_src_nat.pdbx_organism_scientific   'Sus scrofa' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9823 
_entity_src_nat.genus                      Sus 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     MUSCLE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     CYTOPLASM 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    'PORCINE BRAIN SEQUENCE WAS USED FOR STRUCTURE DETERMINATION AND REFINEMENT' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PPCE_PIG 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P23687 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1QFM 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 710 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P23687 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  710 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       710 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1QFM CSX A 25  ? UNP P23687 CYS 25  'SEE REMARK 999' 25  1 
1 1QFM CSX A 57  ? UNP P23687 CYS 57  'SEE REMARK 999' 57  2 
1 1QFM CSX A 255 ? UNP P23687 CYS 255 'SEE REMARK 999' 255 3 
1 1QFM CSD A 175 ? UNP P23687 CYS 175 'SEE REMARK 999' 175 4 
1 1QFM CSD A 601 ? UNP P23687 CYS 601 'SEE REMARK 999' 601 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                   ?                                            'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                  ?                                            'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                ?                                            'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ?                                            'C4 H7 N O4'     133.103 
CSD 'L-peptide linking' n 3-SULFINOALANINE          'S-CYSTEINESULFINIC ACID; S-SULFINOCYSTEINE' 'C3 H7 N O4 S'   153.157 
CSX 'L-peptide linking' n 'S-OXY CYSTEINE'          ?                                            'C3 H7 N O3 S'   137.158 
CYS 'L-peptide linking' y CYSTEINE                  ?                                            'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                 ?                                            'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ?                                            'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                   ?                                            'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                  'GLYCERIN; PROPANE-1,2,3-TRIOL'              'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE                 ?                                            'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                     ?                                            'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                ?                                            'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                   ?                                            'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                    ?                                            'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                ?                                            'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE             ?                                            'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                   ?                                            'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                    ?                                            'C3 H7 N O3'     105.093 
SGL non-polymer         . 1-HYDROXY-1-THIO-GLYCEROL ?                                            'C3 H8 O3 S'     124.159 
SGM non-polymer         . MONOTHIOGLYCEROL          ?                                            'C3 H8 O2 S'     108.159 
THR 'L-peptide linking' y THREONINE                 ?                                            'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                ?                                            'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                  ?                                            'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                    ?                                            'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QFM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.40 
_exptl_crystal.density_percent_sol   48.0000 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.50 
_exptl_crystal_grow.pdbx_details    'SEE REFERENCE, pH 8.50' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.00 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-06 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.87 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX9.6' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX9.6 
_diffrn_source.pdbx_wavelength             0.87 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QFM 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            1.400 
_reflns.number_obs                   140350 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         91.000 
_reflns.pdbx_Rmerge_I_obs            0.057 
_reflns.pdbx_Rsym_value              0.057 
_reflns.pdbx_netI_over_sigmaI        16.4000 
_reflns.B_iso_Wilson_estimate        14.70 
_reflns.pdbx_redundancy              2.600 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.400 
_reflns_shell.d_res_low              1.440 
_reflns_shell.percent_possible_all   80.00 
_reflns_shell.Rmerge_I_obs           0.324 
_reflns_shell.pdbx_Rsym_value        0.324 
_reflns_shell.meanI_over_sigI_obs    2.400 
_reflns_shell.pdbx_redundancy        2.400 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1QFM 
_refine.ls_number_reflns_obs                     139056 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.000 
_refine.ls_d_res_high                            1.400 
_refine.ls_percent_reflns_obs                    91.000 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19 
_refine.ls_R_factor_R_free                       0.206 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.000 
_refine.ls_number_reflns_R_free                  5631 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               13.50 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5708 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         50 
_refine_hist.number_atoms_solvent             887 
_refine_hist.number_atoms_total               6645 
_refine_hist.d_res_high                       1.400 
_refine_hist.d_res_low                        30.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.00  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1QFM 
_struct.title                     'PROLYL OLIGOPEPTIDASE FROM PORCINE MUSCLE' 
_struct.pdbx_descriptor           'PROLYL OLIGOPEPTIDASE (E.C.3.4.21.26)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QFM 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'PROLYL OLIGOPEPTIDASE, AMNESIA, ALPHA/BETA-HYDROLASE, BETA-PROPELLER, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 29  ? GLU A 32  ? ALA A 29  GLU A 32  5 ? 4  
HELX_P HELX_P2  2  GLU A 37  ? GLU A 55  ? GLU A 37  GLU A 55  1 ? 19 
HELX_P HELX_P3  3  PRO A 58  ? LEU A 70  ? PRO A 58  LEU A 70  1 ? 13 
HELX_P HELX_P4  4  PRO A 116 ? LEU A 119 ? PRO A 116 LEU A 119 5 ? 4  
HELX_P HELX_P5  5  GLN A 219 ? GLU A 221 ? GLN A 219 GLU A 221 5 ? 3  
HELX_P HELX_P6  6  LEU A 266 ? GLN A 268 ? LEU A 266 GLN A 268 5 ? 3  
HELX_P HELX_P7  7  PHE A 318 ? ASP A 320 ? PHE A 318 ASP A 320 5 ? 3  
HELX_P HELX_P8  8  GLU A 323 ? LYS A 325 ? GLU A 323 LYS A 325 5 ? 3  
HELX_P HELX_P9  9  ALA A 432 ? ASP A 434 ? ALA A 432 ASP A 434 5 ? 3  
HELX_P HELX_P10 10 VAL A 486 ? MET A 495 ? VAL A 486 MET A 495 1 ? 10 
HELX_P HELX_P11 11 GLY A 511 ? GLY A 518 ? GLY A 511 GLY A 518 1 ? 8  
HELX_P HELX_P12 12 LEU A 520 ? LYS A 539 ? LEU A 520 LYS A 539 5 ? 20 
HELX_P HELX_P13 13 PRO A 545 ? ARG A 547 ? PRO A 545 ARG A 547 5 ? 3  
HELX_P HELX_P14 14 SER A 554 ? GLN A 566 ? SER A 554 GLN A 566 5 ? 13 
HELX_P HELX_P15 15 PRO A 568 ? LEU A 570 ? PRO A 568 LEU A 570 5 ? 3  
HELX_P HELX_P16 16 PHE A 586 ? LYS A 588 ? PHE A 586 LYS A 588 5 ? 3  
HELX_P HELX_P17 17 GLY A 592 ? TYR A 599 ? GLY A 592 TYR A 599 5 ? 8  
HELX_P HELX_P18 18 LYS A 605 ? TYR A 614 ? LYS A 605 TYR A 614 1 ? 10 
HELX_P HELX_P19 19 PRO A 616 ? HIS A 618 ? PRO A 616 HIS A 618 5 ? 3  
HELX_P HELX_P20 20 PRO A 646 ? ILE A 659 ? PRO A 646 ILE A 659 5 ? 14 
HELX_P HELX_P21 21 THR A 686 ? LEU A 704 ? THR A 686 LEU A 704 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A SER 554 OG ? ? ? 1_555 B SGL .   C2 ? ? A SER 554 A SGL 781 1_555 ? ? ? ? ? ? ? 1.437 ? 
covale2  covale ? ? A CYS 78  SG ? ? ? 1_555 D SGM .   S1 ? ? A CYS 78  A SGM 783 1_555 ? ? ? ? ? ? ? 1.992 ? 
covale3  covale ? ? A CYS 532 SG ? ? ? 1_555 E SGM .   S1 ? ? A CYS 532 A SGM 784 1_555 ? ? ? ? ? ? ? 2.021 ? 
covale4  covale ? ? A VAL 24  C  ? ? ? 1_555 A CSX 25  N  ? ? A VAL 24  A CSX 25  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale5  covale ? ? A CSX 25  C  ? ? ? 1_555 A ASP 26  N  ? ? A CSX 25  A ASP 26  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale6  covale ? ? A GLN 56  C  ? ? ? 1_555 A CSX 57  N  ? ? A GLN 56  A CSX 57  1_555 ? ? ? ? ? ? ? 1.323 ? 
covale7  covale ? ? A CSX 57  C  ? ? ? 1_555 A PRO 58  N  ? ? A CSX 57  A PRO 58  1_555 ? ? ? ? ? ? ? 1.342 ? 
covale8  covale ? ? A SER 174 C  ? ? ? 1_555 A CSD 175 N  ? ? A SER 174 A CSD 175 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale9  covale ? ? A CSD 175 C  ? ? ? 1_555 A MET 176 N  ? ? A CSD 175 A MET 176 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale10 covale ? ? A GLY 254 C  ? ? ? 1_555 A CSX 255 N  ? ? A GLY 254 A CSX 255 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale11 covale ? ? A CSX 255 C  ? ? ? 1_555 A ASP 256 N  ? ? A CSX 255 A ASP 256 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale12 covale ? ? A GLY 600 C  ? ? ? 1_555 A CSD 601 N  ? ? A GLY 600 A CSD 601 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale13 covale ? ? A CSD 601 C  ? ? ? 1_555 A SER 602 N  ? ? A CSD 601 A SER 602 1_555 ? ? ? ? ? ? ? 1.329 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
C ? 3 ? 
D ? 2 ? 
E ? 4 ? 
F ? 3 ? 
G ? 4 ? 
H ? 4 ? 
I ? 4 ? 
J ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? parallel      
J 4 5 ? parallel      
J 5 6 ? parallel      
J 6 7 ? parallel      
J 7 8 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 16  ? TYR A 19  ? ILE A 16  TYR A 19  
A 2 HIS A 22  ? CSX A 25  ? HIS A 22  CSX A 25  
B 1 PHE A 80  ? LYS A 82  ? PHE A 80  LYS A 82  
B 2 ARG A 85  ? TYR A 90  ? ARG A 85  TYR A 90  
B 3 VAL A 99  ? GLN A 103 ? VAL A 99  GLN A 103 
B 4 ALA A 110 ? LEU A 114 ? ALA A 110 LEU A 114 
C 1 VAL A 125 ? LEU A 127 ? VAL A 125 LEU A 127 
C 2 TYR A 138 ? ALA A 145 ? TYR A 138 ALA A 145 
C 3 THR A 152 ? LYS A 157 ? THR A 152 LYS A 157 
D 1 TYR A 130 ? PHE A 132 ? TYR A 130 PHE A 132 
D 2 PHE A 139 ? TYR A 141 ? PHE A 139 TYR A 141 
E 1 MET A 176 ? TRP A 178 ? MET A 176 TRP A 178 
E 2 GLY A 184 ? ALA A 189 ? GLY A 184 ALA A 189 
E 3 LYS A 209 ? VAL A 214 ? LYS A 209 VAL A 214 
E 4 ILE A 223 ? ALA A 226 ? ILE A 223 ALA A 226 
F 1 MET A 235 ? LEU A 240 ? MET A 235 LEU A 240 
F 2 TYR A 246 ? ARG A 252 ? TYR A 246 ARG A 252 
F 3 ARG A 260 ? ASP A 265 ? ARG A 260 ASP A 265 
G 1 TYR A 290 ? GLU A 296 ? TYR A 290 GLU A 296 
G 2 VAL A 299 ? THR A 304 ? VAL A 299 THR A 304 
G 3 ARG A 312 ? ASP A 317 ? ARG A 312 ASP A 317 
G 4 LYS A 327 ? VAL A 330 ? LYS A 327 VAL A 330 
H 1 VAL A 337 ? VAL A 344 ? VAL A 337 VAL A 344 
H 2 PHE A 348 ? HIS A 355 ? PHE A 348 HIS A 355 
H 3 LYS A 358 ? ASP A 365 ? LYS A 358 ASP A 365 
H 4 LEU A 371 ? PHE A 375 ? LEU A 371 PHE A 375 
I 1 SER A 381 ? SER A 386 ? SER A 381 SER A 386 
I 2 GLU A 393 ? THR A 399 ? GLU A 393 THR A 399 
I 3 ILE A 406 ? ASP A 411 ? ILE A 406 ASP A 411 
I 4 ARG A 420 ? GLU A 424 ? ARG A 420 GLU A 424 
J 1 TYR A 435 ? PRO A 443 ? TYR A 435 PRO A 443 
J 2 LYS A 449 ? LYS A 457 ? LYS A 449 LYS A 457 
J 3 VAL A 498 ? ALA A 502 ? VAL A 498 ALA A 502 
J 4 ALA A 468 ? TYR A 471 ? ALA A 468 TYR A 471 
J 5 LEU A 548 ? GLY A 553 ? LEU A 548 GLY A 553 
J 6 CYS A 573 ? GLN A 577 ? CYS A 573 GLN A 577 
J 7 SER A 632 ? ALA A 638 ? SER A 632 ALA A 638 
J 8 LEU A 670 ? ASP A 675 ? LEU A 670 ASP A 675 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLN A 17  ? O GLN A 17  N VAL A 24  ? N VAL A 24  
B 1 2 O PHE A 80  ? O PHE A 80  N PHE A 87  ? N PHE A 87  
B 2 3 O TYR A 86  ? O TYR A 86  N GLN A 103 ? N GLN A 103 
B 3 4 O LEU A 100 ? O LEU A 100 N LEU A 114 ? N LEU A 114 
C 1 2 O ALA A 126 ? O ALA A 126 N SER A 144 ? N SER A 144 
C 2 3 O PHE A 139 ? O PHE A 139 N MET A 156 ? N MET A 156 
D 1 2 O ALA A 131 ? O ALA A 131 N ALA A 140 ? N ALA A 140 
E 1 2 O ALA A 177 ? O ALA A 177 N PHE A 186 ? N PHE A 186 
E 2 3 O MET A 185 ? O MET A 185 N HIS A 213 ? N HIS A 213 
E 3 4 O LEU A 210 ? O LEU A 210 N ALA A 226 ? N ALA A 226 
F 1 2 O MET A 235 ? O MET A 235 N ARG A 252 ? N ARG A 252 
F 2 3 O VAL A 247 ? O VAL A 247 N CYS A 264 ? N CYS A 264 
G 1 2 O ASP A 291 ? O ASP A 291 N LYS A 303 ? N LYS A 303 
G 2 3 O PHE A 300 ? O PHE A 300 N ILE A 316 ? N ILE A 316 
G 3 4 O LEU A 313 ? O LEU A 313 N VAL A 330 ? N VAL A 330 
H 1 2 O VAL A 337 ? O VAL A 337 N LEU A 354 ? N LEU A 354 
H 2 3 O LEU A 349 ? O LEU A 349 N HIS A 364 ? N HIS A 364 
H 3 4 O LEU A 361 ? O LEU A 361 N PHE A 375 ? N PHE A 375 
I 1 2 O SER A 381 ? O SER A 381 N THR A 399 ? N THR A 399 
I 2 3 O ILE A 394 ? O ILE A 394 N CYS A 410 ? N CYS A 410 
I 3 4 O ILE A 407 ? O ILE A 407 N ARG A 423 ? N ARG A 423 
J 1 2 O GLN A 436 ? O GLN A 436 N HIS A 456 ? N HIS A 456 
J 2 3 O PHE A 453 ? O PHE A 453 N VAL A 501 ? N VAL A 501 
J 3 4 O VAL A 498 ? O VAL A 498 N PHE A 469 ? N PHE A 469 
J 4 5 O ALA A 468 ? O ALA A 468 N THR A 549 ? N THR A 549 
J 5 6 O ILE A 550 ? O ILE A 550 N CYS A 573 ? N CYS A 573 
J 6 7 O VAL A 574 ? O VAL A 574 N SER A 632 ? N SER A 632 
J 7 8 O MET A 633 ? O MET A 633 N LEU A 671 ? N LEU A 671 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SGL A 781' 
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SGL A 782' 
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SGM A 783' 
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SGM A 784' 
AC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 790' 
AC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 791' 
AC7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL A 792' 
AC8 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE GOL A 793' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  TYR A 473 ? TYR A 473  . ? 1_555 ? 
2  AC1 7  SER A 554 ? SER A 554  . ? 1_555 ? 
3  AC1 7  ASN A 555 ? ASN A 555  . ? 1_555 ? 
4  AC1 7  VAL A 580 ? VAL A 580  . ? 1_555 ? 
5  AC1 7  TRP A 595 ? TRP A 595  . ? 1_555 ? 
6  AC1 7  HIS A 680 ? HIS A 680  . ? 1_555 ? 
7  AC1 7  HOH J .   ? HOH A 838  . ? 1_555 ? 
8  AC2 7  CSX A 255 ? CSX A 255  . ? 1_555 ? 
9  AC2 7  ILE A 591 ? ILE A 591  . ? 1_555 ? 
10 AC2 7  TRP A 595 ? TRP A 595  . ? 1_555 ? 
11 AC2 7  ARG A 643 ? ARG A 643  . ? 1_555 ? 
12 AC2 7  HOH J .   ? HOH A 838  . ? 1_555 ? 
13 AC2 7  HOH J .   ? HOH A 1473 . ? 1_555 ? 
14 AC2 7  HOH J .   ? HOH A 1586 . ? 1_555 ? 
15 AC3 7  CYS A 78  ? CYS A 78   . ? 1_555 ? 
16 AC3 7  HIS A 79  ? HIS A 79   . ? 1_555 ? 
17 AC3 7  PHE A 80  ? PHE A 80   . ? 1_555 ? 
18 AC3 7  TYR A 385 ? TYR A 385  . ? 1_555 ? 
19 AC3 7  SER A 386 ? SER A 386  . ? 1_555 ? 
20 AC3 7  HOH J .   ? HOH A 1212 . ? 1_555 ? 
21 AC3 7  HOH J .   ? HOH A 1460 . ? 1_555 ? 
22 AC4 3  PRO A 443 ? PRO A 443  . ? 1_555 ? 
23 AC4 3  CYS A 532 ? CYS A 532  . ? 1_555 ? 
24 AC4 3  GLU A 535 ? GLU A 535  . ? 1_555 ? 
25 AC5 9  ILE A 118 ? ILE A 118  . ? 3_646 ? 
26 AC5 9  LEU A 119 ? LEU A 119  . ? 3_646 ? 
27 AC5 9  SER A 120 ? SER A 120  . ? 3_646 ? 
28 AC5 9  ASP A 121 ? ASP A 121  . ? 3_646 ? 
29 AC5 9  ASP A 446 ? ASP A 446  . ? 1_555 ? 
30 AC5 9  ASN A 522 ? ASN A 522  . ? 1_555 ? 
31 AC5 9  ASN A 525 ? ASN A 525  . ? 1_555 ? 
32 AC5 9  HOH J .   ? HOH A 1163 . ? 1_555 ? 
33 AC5 9  HOH J .   ? HOH A 1418 . ? 1_555 ? 
34 AC6 8  ALA A 226 ? ALA A 226  . ? 1_555 ? 
35 AC6 8  GLU A 227 ? GLU A 227  . ? 1_555 ? 
36 AC6 8  PHE A 228 ? PHE A 228  . ? 1_555 ? 
37 AC6 8  TRP A 262 ? TRP A 262  . ? 1_555 ? 
38 AC6 8  ILE A 276 ? ILE A 276  . ? 1_555 ? 
39 AC6 8  LYS A 281 ? LYS A 281  . ? 1_555 ? 
40 AC6 8  HOH J .   ? HOH A 1238 . ? 1_555 ? 
41 AC6 8  HOH J .   ? HOH A 1529 . ? 1_555 ? 
42 AC7 7  TRP A 150 ? TRP A 150  . ? 1_555 ? 
43 AC7 7  VAL A 151 ? VAL A 151  . ? 1_555 ? 
44 AC7 7  GLU A 169 ? GLU A 169  . ? 1_555 ? 
45 AC7 7  ARG A 170 ? ARG A 170  . ? 1_555 ? 
46 AC7 7  VAL A 171 ? VAL A 171  . ? 1_555 ? 
47 AC7 7  SER A 197 ? SER A 197  . ? 1_555 ? 
48 AC7 7  HOH J .   ? HOH A 1021 . ? 1_555 ? 
49 AC8 11 PRO A 7   ? PRO A 7    . ? 1_555 ? 
50 AC8 11 ASP A 8   ? ASP A 8    . ? 1_555 ? 
51 AC8 11 VAL A 9   ? VAL A 9    . ? 1_555 ? 
52 AC8 11 TRP A 30  ? TRP A 30   . ? 1_555 ? 
53 AC8 11 GLN A 38  ? GLN A 38   . ? 1_555 ? 
54 AC8 11 ALA A 41  ? ALA A 41   . ? 1_555 ? 
55 AC8 11 PHE A 42  ? PHE A 42   . ? 1_555 ? 
56 AC8 11 HOH J .   ? HOH A 929  . ? 2_664 ? 
57 AC8 11 HOH J .   ? HOH A 959  . ? 1_555 ? 
58 AC8 11 HOH J .   ? HOH A 1412 . ? 1_555 ? 
59 AC8 11 HOH J .   ? HOH A 1507 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QFM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QFM 
_atom_sites.fract_transf_matrix[1][1]   0.014144 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010040 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009042 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? 17.537 53.492 58.721  1.00 41.35 ? 1    MET A N   1 
ATOM   2    C CA  . MET A 1 1   ? 18.112 54.105 59.940  1.00 41.29 ? 1    MET A CA  1 
ATOM   3    C C   . MET A 1 1   ? 19.625 54.271 59.779  1.00 40.98 ? 1    MET A C   1 
ATOM   4    O O   . MET A 1 1   ? 20.253 55.029 60.508  1.00 40.89 ? 1    MET A O   1 
ATOM   5    C CB  . MET A 1 1   ? 17.800 53.242 61.160  1.00 41.43 ? 1    MET A CB  1 
ATOM   6    C CG  . MET A 1 1   ? 18.140 53.885 62.488  1.00 41.79 ? 1    MET A CG  1 
ATOM   7    S SD  . MET A 1 1   ? 17.583 52.877 63.864  1.00 42.02 ? 1    MET A SD  1 
ATOM   8    C CE  . MET A 1 1   ? 18.746 51.535 63.765  1.00 41.75 ? 1    MET A CE  1 
ATOM   9    N N   . LEU A 1 2   ? 20.203 53.528 58.840  1.00 40.30 ? 2    LEU A N   1 
ATOM   10   C CA  . LEU A 1 2   ? 21.637 53.603 58.573  1.00 39.74 ? 2    LEU A CA  1 
ATOM   11   C C   . LEU A 1 2   ? 21.921 54.682 57.534  1.00 39.21 ? 2    LEU A C   1 
ATOM   12   O O   . LEU A 1 2   ? 21.936 54.415 56.336  1.00 39.25 ? 2    LEU A O   1 
ATOM   13   C CB  . LEU A 1 2   ? 22.168 52.244 58.099  1.00 39.84 ? 2    LEU A CB  1 
ATOM   14   C CG  . LEU A 1 2   ? 22.567 51.225 59.170  1.00 40.13 ? 2    LEU A CG  1 
ATOM   15   C CD1 . LEU A 1 2   ? 21.465 51.062 60.202  1.00 39.96 ? 2    LEU A CD1 1 
ATOM   16   C CD2 . LEU A 1 2   ? 22.904 49.892 58.521  1.00 40.05 ? 2    LEU A CD2 1 
ATOM   17   N N   . SER A 1 3   ? 22.112 55.906 58.011  1.00 38.36 ? 3    SER A N   1 
ATOM   18   C CA  . SER A 1 3   ? 22.393 57.042 57.138  1.00 37.53 ? 3    SER A CA  1 
ATOM   19   C C   . SER A 1 3   ? 23.899 57.180 56.920  1.00 36.88 ? 3    SER A C   1 
ATOM   20   O O   . SER A 1 3   ? 24.376 58.186 56.396  1.00 37.12 ? 3    SER A O   1 
ATOM   21   C CB  . SER A 1 3   ? 21.844 58.325 57.768  1.00 37.56 ? 3    SER A CB  1 
ATOM   22   O OG  . SER A 1 3   ? 20.493 58.158 58.176  1.00 37.53 ? 3    SER A OG  1 
ATOM   23   N N   . PHE A 1 4   ? 24.641 56.175 57.367  1.00 35.74 ? 4    PHE A N   1 
ATOM   24   C CA  . PHE A 1 4   ? 26.092 56.163 57.249  1.00 34.40 ? 4    PHE A CA  1 
ATOM   25   C C   . PHE A 1 4   ? 26.545 54.940 56.458  1.00 33.18 ? 4    PHE A C   1 
ATOM   26   O O   . PHE A 1 4   ? 25.766 54.014 56.226  1.00 33.11 ? 4    PHE A O   1 
ATOM   27   C CB  . PHE A 1 4   ? 26.711 56.115 58.647  1.00 35.30 ? 4    PHE A CB  1 
ATOM   28   C CG  . PHE A 1 4   ? 26.212 54.969 59.488  1.00 36.06 ? 4    PHE A CG  1 
ATOM   29   C CD1 . PHE A 1 4   ? 26.783 53.702 59.375  1.00 36.48 ? 4    PHE A CD1 1 
ATOM   30   C CD2 . PHE A 1 4   ? 25.144 55.145 60.362  1.00 36.32 ? 4    PHE A CD2 1 
ATOM   31   C CE1 . PHE A 1 4   ? 26.299 52.631 60.120  1.00 36.35 ? 4    PHE A CE1 1 
ATOM   32   C CE2 . PHE A 1 4   ? 24.650 54.080 61.113  1.00 36.60 ? 4    PHE A CE2 1 
ATOM   33   C CZ  . PHE A 1 4   ? 25.227 52.820 60.990  1.00 36.59 ? 4    PHE A CZ  1 
ATOM   34   N N   . GLN A 1 5   ? 27.812 54.936 56.062  1.00 31.12 ? 5    GLN A N   1 
ATOM   35   C CA  . GLN A 1 5   ? 28.375 53.807 55.337  1.00 28.78 ? 5    GLN A CA  1 
ATOM   36   C C   . GLN A 1 5   ? 29.537 53.251 56.157  1.00 25.80 ? 5    GLN A C   1 
ATOM   37   O O   . GLN A 1 5   ? 30.262 54.004 56.808  1.00 25.52 ? 5    GLN A O   1 
ATOM   38   C CB  . GLN A 1 5   ? 28.853 54.227 53.943  1.00 30.89 ? 5    GLN A CB  1 
ATOM   39   C CG  . GLN A 1 5   ? 29.977 55.251 53.918  1.00 33.27 ? 5    GLN A CG  1 
ATOM   40   C CD  . GLN A 1 5   ? 30.366 55.654 52.511  1.00 34.73 ? 5    GLN A CD  1 
ATOM   41   O OE1 . GLN A 1 5   ? 29.836 56.621 51.961  1.00 35.44 ? 5    GLN A OE1 1 
ATOM   42   N NE2 . GLN A 1 5   ? 31.285 54.905 51.913  1.00 35.52 ? 5    GLN A NE2 1 
ATOM   43   N N   . TYR A 1 6   ? 29.659 51.929 56.179  1.00 22.43 ? 6    TYR A N   1 
ATOM   44   C CA  . TYR A 1 6   ? 30.727 51.271 56.910  1.00 19.21 ? 6    TYR A CA  1 
ATOM   45   C C   . TYR A 1 6   ? 32.070 51.614 56.285  1.00 18.67 ? 6    TYR A C   1 
ATOM   46   O O   . TYR A 1 6   ? 32.210 51.647 55.056  1.00 18.80 ? 6    TYR A O   1 
ATOM   47   C CB  . TYR A 1 6   ? 30.502 49.754 56.951  1.00 16.25 ? 6    TYR A CB  1 
ATOM   48   C CG  . TYR A 1 6   ? 29.340 49.357 57.831  1.00 12.60 ? 6    TYR A CG  1 
ATOM   49   C CD1 . TYR A 1 6   ? 28.312 48.538 57.351  1.00 11.81 ? 6    TYR A CD1 1 
ATOM   50   C CD2 . TYR A 1 6   ? 29.246 49.837 59.135  1.00 11.22 ? 6    TYR A CD2 1 
ATOM   51   C CE1 . TYR A 1 6   ? 27.222 48.215 58.154  1.00 11.07 ? 6    TYR A CE1 1 
ATOM   52   C CE2 . TYR A 1 6   ? 28.166 49.526 59.937  1.00 10.25 ? 6    TYR A CE2 1 
ATOM   53   C CZ  . TYR A 1 6   ? 27.164 48.722 59.447  1.00 9.64  ? 6    TYR A CZ  1 
ATOM   54   O OH  . TYR A 1 6   ? 26.119 48.441 60.283  1.00 9.08  ? 6    TYR A OH  1 
ATOM   55   N N   . PRO A 1 7   ? 33.068 51.916 57.126  1.00 17.93 ? 7    PRO A N   1 
ATOM   56   C CA  . PRO A 1 7   ? 34.402 52.267 56.639  1.00 17.41 ? 7    PRO A CA  1 
ATOM   57   C C   . PRO A 1 7   ? 35.020 51.145 55.806  1.00 17.38 ? 7    PRO A C   1 
ATOM   58   O O   . PRO A 1 7   ? 34.752 49.959 56.026  1.00 16.17 ? 7    PRO A O   1 
ATOM   59   C CB  . PRO A 1 7   ? 35.191 52.479 57.934  1.00 18.51 ? 7    PRO A CB  1 
ATOM   60   C CG  . PRO A 1 7   ? 34.144 52.867 58.942  1.00 18.31 ? 7    PRO A CG  1 
ATOM   61   C CD  . PRO A 1 7   ? 33.025 51.926 58.599  1.00 18.09 ? 7    PRO A CD  1 
ATOM   62   N N   . ASP A 1 8   ? 35.804 51.513 54.802  1.00 17.10 ? 8    ASP A N   1 
ATOM   63   C CA  . ASP A 1 8   ? 36.468 50.498 54.002  1.00 17.63 ? 8    ASP A CA  1 
ATOM   64   C C   . ASP A 1 8   ? 37.615 50.002 54.868  1.00 16.32 ? 8    ASP A C   1 
ATOM   65   O O   . ASP A 1 8   ? 38.311 50.790 55.513  1.00 16.91 ? 8    ASP A O   1 
ATOM   66   C CB  . ASP A 1 8   ? 36.962 51.065 52.676  1.00 20.44 ? 8    ASP A CB  1 
ATOM   67   C CG  . ASP A 1 8   ? 35.823 51.379 51.729  1.00 21.96 ? 8    ASP A CG  1 
ATOM   68   O OD1 . ASP A 1 8   ? 35.159 52.418 51.929  1.00 24.54 ? 8    ASP A OD1 1 
ATOM   69   O OD2 . ASP A 1 8   ? 35.577 50.576 50.803  1.00 24.80 ? 8    ASP A OD2 1 
ATOM   70   N N   . VAL A 1 9   ? 37.739 48.683 54.965  1.00 13.94 ? 9    VAL A N   1 
ATOM   71   C CA  . VAL A 1 9   ? 38.765 48.065 55.792  1.00 11.75 ? 9    VAL A CA  1 
ATOM   72   C C   . VAL A 1 9   ? 39.515 47.004 54.992  1.00 10.69 ? 9    VAL A C   1 
ATOM   73   O O   . VAL A 1 9   ? 38.920 46.059 54.494  1.00 10.21 ? 9    VAL A O   1 
ATOM   74   C CB  . VAL A 1 9   ? 38.122 47.431 57.059  1.00 11.00 ? 9    VAL A CB  1 
ATOM   75   C CG1 . VAL A 1 9   ? 39.192 46.861 57.962  1.00 11.36 ? 9    VAL A CG1 1 
ATOM   76   C CG2 . VAL A 1 9   ? 37.265 48.468 57.802  1.00 11.70 ? 9    VAL A CG2 1 
ATOM   77   N N   . TYR A 1 10  ? 40.824 47.183 54.866  1.00 9.41  ? 10   TYR A N   1 
ATOM   78   C CA  . TYR A 1 10  ? 41.659 46.261 54.109  1.00 9.45  ? 10   TYR A CA  1 
ATOM   79   C C   . TYR A 1 10  ? 41.628 44.838 54.637  1.00 9.48  ? 10   TYR A C   1 
ATOM   80   O O   . TYR A 1 10  ? 41.751 44.600 55.834  1.00 9.96  ? 10   TYR A O   1 
ATOM   81   C CB  . TYR A 1 10  ? 43.114 46.745 54.066  1.00 8.98  ? 10   TYR A CB  1 
ATOM   82   C CG  . TYR A 1 10  ? 44.008 45.862 53.223  1.00 9.09  ? 10   TYR A CG  1 
ATOM   83   C CD1 . TYR A 1 10  ? 43.905 45.865 51.835  1.00 9.48  ? 10   TYR A CD1 1 
ATOM   84   C CD2 . TYR A 1 10  ? 44.940 45.003 53.812  1.00 9.40  ? 10   TYR A CD2 1 
ATOM   85   C CE1 . TYR A 1 10  ? 44.704 45.032 51.049  1.00 9.33  ? 10   TYR A CE1 1 
ATOM   86   C CE2 . TYR A 1 10  ? 45.740 44.171 53.035  1.00 9.89  ? 10   TYR A CE2 1 
ATOM   87   C CZ  . TYR A 1 10  ? 45.617 44.192 51.661  1.00 9.38  ? 10   TYR A CZ  1 
ATOM   88   O OH  . TYR A 1 10  ? 46.404 43.360 50.911  1.00 10.21 ? 10   TYR A OH  1 
ATOM   89   N N   . ARG A 1 11  ? 41.505 43.896 53.715  1.00 8.96  ? 11   ARG A N   1 
ATOM   90   C CA  . ARG A 1 11  ? 41.488 42.483 54.036  1.00 8.86  ? 11   ARG A CA  1 
ATOM   91   C C   . ARG A 1 11  ? 42.787 41.839 53.576  1.00 8.82  ? 11   ARG A C   1 
ATOM   92   O O   . ARG A 1 11  ? 43.071 41.813 52.373  1.00 8.53  ? 11   ARG A O   1 
ATOM   93   C CB  . ARG A 1 11  ? 40.318 41.784 53.342  1.00 9.05  ? 11   ARG A CB  1 
ATOM   94   C CG  . ARG A 1 11  ? 38.967 42.121 53.932  1.00 9.86  ? 11   ARG A CG  1 
ATOM   95   C CD  . ARG A 1 11  ? 37.820 41.469 53.176  1.00 10.57 ? 11   ARG A CD  1 
ATOM   96   N NE  . ARG A 1 11  ? 37.929 40.013 53.096  1.00 10.89 ? 11   ARG A NE  1 
ATOM   97   C CZ  . ARG A 1 11  ? 37.581 39.166 54.061  1.00 11.21 ? 11   ARG A CZ  1 
ATOM   98   N NH1 . ARG A 1 11  ? 37.090 39.615 55.206  1.00 10.91 ? 11   ARG A NH1 1 
ATOM   99   N NH2 . ARG A 1 11  ? 37.720 37.860 53.869  1.00 11.14 ? 11   ARG A NH2 1 
ATOM   100  N N   . ASP A 1 12  ? 43.604 41.392 54.525  1.00 8.93  ? 12   ASP A N   1 
ATOM   101  C CA  . ASP A 1 12  ? 44.848 40.702 54.184  1.00 9.50  ? 12   ASP A CA  1 
ATOM   102  C C   . ASP A 1 12  ? 44.462 39.249 53.924  1.00 10.20 ? 12   ASP A C   1 
ATOM   103  O O   . ASP A 1 12  ? 44.460 38.422 54.836  1.00 9.66  ? 12   ASP A O   1 
ATOM   104  C CB  . ASP A 1 12  ? 45.876 40.778 55.321  1.00 10.40 ? 12   ASP A CB  1 
ATOM   105  C CG  . ASP A 1 12  ? 47.144 39.976 55.026  1.00 11.16 ? 12   ASP A CG  1 
ATOM   106  O OD1 . ASP A 1 12  ? 47.315 39.524 53.875  1.00 10.67 ? 12   ASP A OD1 1 
ATOM   107  O OD2 . ASP A 1 12  ? 47.966 39.793 55.944  1.00 11.24 ? 12   ASP A OD2 1 
ATOM   108  N N   . GLU A 1 13  ? 44.151 38.934 52.678  1.00 10.65 ? 13   GLU A N   1 
ATOM   109  C CA  . GLU A 1 13  ? 43.749 37.586 52.329  1.00 12.01 ? 13   GLU A CA  1 
ATOM   110  C C   . GLU A 1 13  ? 44.879 36.560 52.246  1.00 12.71 ? 13   GLU A C   1 
ATOM   111  O O   . GLU A 1 13  ? 44.643 35.410 51.899  1.00 12.76 ? 13   GLU A O   1 
ATOM   112  C CB  . GLU A 1 13  ? 42.851 37.617 51.094  1.00 14.42 ? 13   GLU A CB  1 
ATOM   113  C CG  . GLU A 1 13  ? 41.657 38.541 51.346  1.00 16.90 ? 13   GLU A CG  1 
ATOM   114  C CD  . GLU A 1 13  ? 40.550 38.433 50.333  1.00 19.07 ? 13   GLU A CD  1 
ATOM   115  O OE1 . GLU A 1 13  ? 40.839 38.115 49.164  1.00 19.86 ? 13   GLU A OE1 1 
ATOM   116  O OE2 . GLU A 1 13  ? 39.384 38.683 50.719  1.00 19.13 ? 13   GLU A OE2 1 
ATOM   117  N N   . THR A 1 14  ? 46.093 36.976 52.598  1.00 12.23 ? 14   THR A N   1 
ATOM   118  C CA  . THR A 1 14  ? 47.242 36.069 52.620  1.00 12.75 ? 14   THR A CA  1 
ATOM   119  C C   . THR A 1 14  ? 47.458 35.561 54.057  1.00 13.22 ? 14   THR A C   1 
ATOM   120  O O   . THR A 1 14  ? 48.231 34.635 54.280  1.00 12.98 ? 14   THR A O   1 
ATOM   121  C CB  . THR A 1 14  ? 48.552 36.762 52.168  1.00 12.37 ? 14   THR A CB  1 
ATOM   122  O OG1 . THR A 1 14  ? 49.012 37.641 53.203  1.00 12.52 ? 14   THR A OG1 1 
ATOM   123  C CG2 . THR A 1 14  ? 48.342 37.567 50.888  1.00 11.84 ? 14   THR A CG2 1 
ATOM   124  N N   . ALA A 1 15  ? 46.770 36.170 55.024  1.00 13.48 ? 15   ALA A N   1 
ATOM   125  C CA  . ALA A 1 15  ? 46.907 35.780 56.429  1.00 14.66 ? 15   ALA A CA  1 
ATOM   126  C C   . ALA A 1 15  ? 46.176 34.478 56.729  1.00 15.87 ? 15   ALA A C   1 
ATOM   127  O O   . ALA A 1 15  ? 45.090 34.479 57.315  1.00 16.44 ? 15   ALA A O   1 
ATOM   128  C CB  . ALA A 1 15  ? 46.400 36.901 57.332  1.00 14.36 ? 15   ALA A CB  1 
ATOM   129  N N   . ILE A 1 16  ? 46.798 33.364 56.363  1.00 16.52 ? 16   ILE A N   1 
ATOM   130  C CA  . ILE A 1 16  ? 46.209 32.047 56.563  1.00 17.97 ? 16   ILE A CA  1 
ATOM   131  C C   . ILE A 1 16  ? 47.077 31.201 57.489  1.00 18.73 ? 16   ILE A C   1 
ATOM   132  O O   . ILE A 1 16  ? 48.283 31.107 57.295  1.00 18.65 ? 16   ILE A O   1 
ATOM   133  C CB  . ILE A 1 16  ? 46.057 31.317 55.217  1.00 18.22 ? 16   ILE A CB  1 
ATOM   134  C CG1 . ILE A 1 16  ? 45.198 32.154 54.267  1.00 18.17 ? 16   ILE A CG1 1 
ATOM   135  C CG2 . ILE A 1 16  ? 45.433 29.939 55.425  1.00 18.67 ? 16   ILE A CG2 1 
ATOM   136  C CD1 . ILE A 1 16  ? 45.257 31.706 52.821  1.00 19.26 ? 16   ILE A CD1 1 
ATOM   137  N N   . GLN A 1 17  ? 46.456 30.610 58.506  1.00 19.27 ? 17   GLN A N   1 
ATOM   138  C CA  . GLN A 1 17  ? 47.168 29.765 59.458  1.00 20.26 ? 17   GLN A CA  1 
ATOM   139  C C   . GLN A 1 17  ? 46.529 28.391 59.527  1.00 19.93 ? 17   GLN A C   1 
ATOM   140  O O   . GLN A 1 17  ? 45.306 28.255 59.489  1.00 18.70 ? 17   GLN A O   1 
ATOM   141  C CB  . GLN A 1 17  ? 47.166 30.391 60.851  1.00 21.79 ? 17   GLN A CB  1 
ATOM   142  C CG  . GLN A 1 17  ? 47.912 31.708 60.965  1.00 24.32 ? 17   GLN A CG  1 
ATOM   143  C CD  . GLN A 1 17  ? 47.950 32.225 62.388  1.00 25.35 ? 17   GLN A CD  1 
ATOM   144  O OE1 . GLN A 1 17  ? 47.947 31.449 63.342  1.00 26.34 ? 17   GLN A OE1 1 
ATOM   145  N NE2 . GLN A 1 17  ? 47.967 33.545 62.540  1.00 26.41 ? 17   GLN A NE2 1 
ATOM   146  N N   . ASP A 1 18  ? 47.365 27.367 59.611  1.00 20.04 ? 18   ASP A N   1 
ATOM   147  C CA  . ASP A 1 18  ? 46.885 26.002 59.696  1.00 20.39 ? 18   ASP A CA  1 
ATOM   148  C C   . ASP A 1 18  ? 46.749 25.588 61.155  1.00 19.76 ? 18   ASP A C   1 
ATOM   149  O O   . ASP A 1 18  ? 47.700 25.675 61.923  1.00 19.87 ? 18   ASP A O   1 
ATOM   150  C CB  . ASP A 1 18  ? 47.835 25.036 58.981  1.00 21.45 ? 18   ASP A CB  1 
ATOM   151  C CG  . ASP A 1 18  ? 47.389 23.593 59.104  1.00 22.15 ? 18   ASP A CG  1 
ATOM   152  O OD1 . ASP A 1 18  ? 46.446 23.202 58.387  1.00 23.76 ? 18   ASP A OD1 1 
ATOM   153  O OD2 . ASP A 1 18  ? 47.960 22.867 59.944  1.00 23.63 ? 18   ASP A OD2 1 
ATOM   154  N N   . TYR A 1 19  ? 45.552 25.146 61.519  1.00 19.49 ? 19   TYR A N   1 
ATOM   155  C CA  . TYR A 1 19  ? 45.282 24.676 62.871  1.00 19.47 ? 19   TYR A CA  1 
ATOM   156  C C   . TYR A 1 19  ? 44.915 23.201 62.769  1.00 19.86 ? 19   TYR A C   1 
ATOM   157  O O   . TYR A 1 19  ? 43.757 22.862 62.515  1.00 19.65 ? 19   TYR A O   1 
ATOM   158  C CB  . TYR A 1 19  ? 44.115 25.445 63.498  1.00 18.38 ? 19   TYR A CB  1 
ATOM   159  C CG  . TYR A 1 19  ? 44.420 26.864 63.926  1.00 16.70 ? 19   TYR A CG  1 
ATOM   160  C CD1 . TYR A 1 19  ? 44.307 27.919 63.027  1.00 15.94 ? 19   TYR A CD1 1 
ATOM   161  C CD2 . TYR A 1 19  ? 44.769 27.155 65.246  1.00 16.29 ? 19   TYR A CD2 1 
ATOM   162  C CE1 . TYR A 1 19  ? 44.524 29.231 63.425  1.00 14.78 ? 19   TYR A CE1 1 
ATOM   163  C CE2 . TYR A 1 19  ? 44.992 28.468 65.661  1.00 15.49 ? 19   TYR A CE2 1 
ATOM   164  C CZ  . TYR A 1 19  ? 44.862 29.502 64.744  1.00 14.89 ? 19   TYR A CZ  1 
ATOM   165  O OH  . TYR A 1 19  ? 45.016 30.805 65.159  1.00 14.20 ? 19   TYR A OH  1 
ATOM   166  N N   . HIS A 1 20  ? 45.915 22.335 62.894  1.00 20.83 ? 20   HIS A N   1 
ATOM   167  C CA  . HIS A 1 20  ? 45.714 20.888 62.842  1.00 22.22 ? 20   HIS A CA  1 
ATOM   168  C C   . HIS A 1 20  ? 45.000 20.434 61.560  1.00 22.50 ? 20   HIS A C   1 
ATOM   169  O O   . HIS A 1 20  ? 44.143 19.554 61.601  1.00 23.01 ? 20   HIS A O   1 
ATOM   170  C CB  . HIS A 1 20  ? 44.910 20.433 64.071  1.00 22.64 ? 20   HIS A CB  1 
ATOM   171  C CG  . HIS A 1 20  ? 45.258 21.169 65.325  1.00 23.23 ? 20   HIS A CG  1 
ATOM   172  N ND1 . HIS A 1 20  ? 46.357 20.850 66.094  1.00 23.84 ? 20   HIS A ND1 1 
ATOM   173  C CD2 . HIS A 1 20  ? 44.679 22.242 65.914  1.00 23.61 ? 20   HIS A CD2 1 
ATOM   174  C CE1 . HIS A 1 20  ? 46.443 21.698 67.098  1.00 24.22 ? 20   HIS A CE1 1 
ATOM   175  N NE2 . HIS A 1 20  ? 45.439 22.555 67.013  1.00 23.84 ? 20   HIS A NE2 1 
ATOM   176  N N   . GLY A 1 21  ? 45.353 21.049 60.435  1.00 22.64 ? 21   GLY A N   1 
ATOM   177  C CA  . GLY A 1 21  ? 44.723 20.693 59.177  1.00 22.87 ? 21   GLY A CA  1 
ATOM   178  C C   . GLY A 1 21  ? 43.582 21.618 58.795  1.00 23.14 ? 21   GLY A C   1 
ATOM   179  O O   . GLY A 1 21  ? 43.169 21.660 57.639  1.00 23.09 ? 21   GLY A O   1 
ATOM   180  N N   . HIS A 1 22  ? 43.079 22.375 59.765  1.00 22.78 ? 22   HIS A N   1 
ATOM   181  C CA  . HIS A 1 22  ? 41.982 23.311 59.527  1.00 22.73 ? 22   HIS A CA  1 
ATOM   182  C C   . HIS A 1 22  ? 42.579 24.682 59.218  1.00 21.81 ? 22   HIS A C   1 
ATOM   183  O O   . HIS A 1 22  ? 43.148 25.325 60.087  1.00 21.72 ? 22   HIS A O   1 
ATOM   184  C CB  . HIS A 1 22  ? 41.082 23.385 60.773  1.00 23.93 ? 22   HIS A CB  1 
ATOM   185  C CG  . HIS A 1 22  ? 39.810 24.158 60.573  1.00 25.16 ? 22   HIS A CG  1 
ATOM   186  N ND1 . HIS A 1 22  ? 38.584 23.686 60.997  1.00 25.90 ? 22   HIS A ND1 1 
ATOM   187  C CD2 . HIS A 1 22  ? 39.579 25.374 60.023  1.00 25.59 ? 22   HIS A CD2 1 
ATOM   188  C CE1 . HIS A 1 22  ? 37.652 24.580 60.713  1.00 25.69 ? 22   HIS A CE1 1 
ATOM   189  N NE2 . HIS A 1 22  ? 38.227 25.612 60.123  1.00 26.22 ? 22   HIS A NE2 1 
ATOM   190  N N   . LYS A 1 23  ? 42.462 25.111 57.970  1.00 20.78 ? 23   LYS A N   1 
ATOM   191  C CA  . LYS A 1 23  ? 42.980 26.405 57.535  1.00 19.70 ? 23   LYS A CA  1 
ATOM   192  C C   . LYS A 1 23  ? 42.053 27.513 58.016  1.00 17.82 ? 23   LYS A C   1 
ATOM   193  O O   . LYS A 1 23  ? 40.831 27.406 57.905  1.00 17.98 ? 23   LYS A O   1 
ATOM   194  C CB  . LYS A 1 23  ? 43.087 26.470 56.008  1.00 20.67 ? 23   LYS A CB  1 
ATOM   195  C CG  . LYS A 1 23  ? 43.938 25.386 55.366  1.00 21.98 ? 23   LYS A CG  1 
ATOM   196  C CD  . LYS A 1 23  ? 45.383 25.457 55.811  1.00 23.01 ? 23   LYS A CD  1 
ATOM   197  C CE  . LYS A 1 23  ? 46.213 24.388 55.123  1.00 24.21 ? 23   LYS A CE  1 
ATOM   198  N NZ  . LYS A 1 23  ? 47.635 24.422 55.561  1.00 25.20 ? 23   LYS A NZ  1 
ATOM   199  N N   . VAL A 1 24  ? 42.643 28.558 58.585  1.00 15.35 ? 24   VAL A N   1 
ATOM   200  C CA  . VAL A 1 24  ? 41.879 29.701 59.082  1.00 13.50 ? 24   VAL A CA  1 
ATOM   201  C C   . VAL A 1 24  ? 42.478 30.997 58.541  1.00 12.44 ? 24   VAL A C   1 
ATOM   202  O O   . VAL A 1 24  ? 43.668 31.257 58.719  1.00 12.15 ? 24   VAL A O   1 
ATOM   203  C CB  . VAL A 1 24  ? 41.890 29.764 60.635  1.00 13.35 ? 24   VAL A CB  1 
ATOM   204  C CG1 . VAL A 1 24  ? 41.168 31.022 61.125  1.00 14.31 ? 24   VAL A CG1 1 
ATOM   205  C CG2 . VAL A 1 24  ? 41.242 28.515 61.233  1.00 13.60 ? 24   VAL A CG2 1 
HETATM 206  N N   . CSX A 1 25  ? 41.659 31.786 57.854  1.00 11.82 ? 25   CSX A N   1 
HETATM 207  C CA  . CSX A 1 25  ? 42.086 33.075 57.316  1.00 11.69 ? 25   CSX A CA  1 
HETATM 208  C CB  . CSX A 1 25  ? 41.364 33.411 56.000  1.00 12.36 ? 25   CSX A CB  1 
HETATM 209  S SG  . CSX A 1 25  ? 42.074 34.830 55.077  1.00 15.20 ? 25   CSX A SG  1 
HETATM 210  C C   . CSX A 1 25  ? 41.751 34.115 58.379  1.00 10.93 ? 25   CSX A C   1 
HETATM 211  O O   . CSX A 1 25  ? 40.683 34.061 59.006  1.00 11.23 ? 25   CSX A O   1 
HETATM 212  O OD  . CSX A 1 25  ? 40.973 35.450 54.275  1.00 13.26 ? 25   CSX A OD  1 
ATOM   213  N N   . ASP A 1 26  ? 42.677 35.039 58.598  1.00 10.11 ? 26   ASP A N   1 
ATOM   214  C CA  . ASP A 1 26  ? 42.513 36.100 59.588  1.00 9.58  ? 26   ASP A CA  1 
ATOM   215  C C   . ASP A 1 26  ? 42.859 37.405 58.861  1.00 9.06  ? 26   ASP A C   1 
ATOM   216  O O   . ASP A 1 26  ? 43.856 38.071 59.175  1.00 9.28  ? 26   ASP A O   1 
ATOM   217  C CB  . ASP A 1 26  ? 43.466 35.840 60.760  1.00 11.18 ? 26   ASP A CB  1 
ATOM   218  C CG  . ASP A 1 26  ? 43.055 36.562 62.022  1.00 11.42 ? 26   ASP A CG  1 
ATOM   219  O OD1 . ASP A 1 26  ? 41.843 36.709 62.264  1.00 10.25 ? 26   ASP A OD1 1 
ATOM   220  O OD2 . ASP A 1 26  ? 43.948 36.983 62.782  1.00 12.98 ? 26   ASP A OD2 1 
ATOM   221  N N   . PRO A 1 27  ? 41.996 37.816 57.916  1.00 8.44  ? 27   PRO A N   1 
ATOM   222  C CA  . PRO A 1 27  ? 42.205 39.029 57.121  1.00 8.56  ? 27   PRO A CA  1 
ATOM   223  C C   . PRO A 1 27  ? 42.386 40.343 57.854  1.00 7.84  ? 27   PRO A C   1 
ATOM   224  O O   . PRO A 1 27  ? 42.915 41.295 57.282  1.00 8.59  ? 27   PRO A O   1 
ATOM   225  C CB  . PRO A 1 27  ? 41.002 39.041 56.186  1.00 8.40  ? 27   PRO A CB  1 
ATOM   226  C CG  . PRO A 1 27  ? 39.939 38.343 56.971  1.00 8.53  ? 27   PRO A CG  1 
ATOM   227  C CD  . PRO A 1 27  ? 40.684 37.209 57.617  1.00 8.17  ? 27   PRO A CD  1 
ATOM   228  N N   . TYR A 1 28  ? 41.960 40.407 59.110  1.00 7.85  ? 28   TYR A N   1 
ATOM   229  C CA  . TYR A 1 28  ? 42.102 41.623 59.900  1.00 7.87  ? 28   TYR A CA  1 
ATOM   230  C C   . TYR A 1 28  ? 43.149 41.483 61.002  1.00 7.72  ? 28   TYR A C   1 
ATOM   231  O O   . TYR A 1 28  ? 43.145 42.234 61.976  1.00 7.89  ? 28   TYR A O   1 
ATOM   232  C CB  . TYR A 1 28  ? 40.745 42.043 60.471  1.00 8.31  ? 28   TYR A CB  1 
ATOM   233  C CG  . TYR A 1 28  ? 39.674 42.156 59.412  1.00 7.41  ? 28   TYR A CG  1 
ATOM   234  C CD1 . TYR A 1 28  ? 38.576 41.287 59.414  1.00 7.88  ? 28   TYR A CD1 1 
ATOM   235  C CD2 . TYR A 1 28  ? 39.764 43.104 58.385  1.00 7.46  ? 28   TYR A CD2 1 
ATOM   236  C CE1 . TYR A 1 28  ? 37.593 41.351 58.415  1.00 7.68  ? 28   TYR A CE1 1 
ATOM   237  C CE2 . TYR A 1 28  ? 38.781 43.179 57.380  1.00 8.12  ? 28   TYR A CE2 1 
ATOM   238  C CZ  . TYR A 1 28  ? 37.702 42.293 57.407  1.00 8.14  ? 28   TYR A CZ  1 
ATOM   239  O OH  . TYR A 1 28  ? 36.750 42.315 56.416  1.00 8.92  ? 28   TYR A OH  1 
ATOM   240  N N   . ALA A 1 29  ? 44.084 40.556 60.809  1.00 8.55  ? 29   ALA A N   1 
ATOM   241  C CA  . ALA A 1 29  ? 45.146 40.324 61.780  1.00 8.25  ? 29   ALA A CA  1 
ATOM   242  C C   . ALA A 1 29  ? 45.960 41.584 62.057  1.00 8.39  ? 29   ALA A C   1 
ATOM   243  O O   . ALA A 1 29  ? 46.470 41.775 63.161  1.00 9.38  ? 29   ALA A O   1 
ATOM   244  C CB  . ALA A 1 29  ? 46.060 39.192 61.311  1.00 8.71  ? 29   ALA A CB  1 
ATOM   245  N N   . TRP A 1 30  ? 46.042 42.471 61.069  1.00 8.09  ? 30   TRP A N   1 
ATOM   246  C CA  . TRP A 1 30  ? 46.807 43.707 61.226  1.00 7.96  ? 30   TRP A CA  1 
ATOM   247  C C   . TRP A 1 30  ? 46.248 44.620 62.321  1.00 8.09  ? 30   TRP A C   1 
ATOM   248  O O   . TRP A 1 30  ? 46.955 45.484 62.844  1.00 8.99  ? 30   TRP A O   1 
ATOM   249  C CB  . TRP A 1 30  ? 46.943 44.444 59.890  1.00 8.47  ? 30   TRP A CB  1 
ATOM   250  C CG  . TRP A 1 30  ? 45.640 44.705 59.199  1.00 8.35  ? 30   TRP A CG  1 
ATOM   251  C CD1 . TRP A 1 30  ? 45.024 43.901 58.281  1.00 8.11  ? 30   TRP A CD1 1 
ATOM   252  C CD2 . TRP A 1 30  ? 44.810 45.863 59.336  1.00 8.86  ? 30   TRP A CD2 1 
ATOM   253  N NE1 . TRP A 1 30  ? 43.869 44.489 57.837  1.00 8.65  ? 30   TRP A NE1 1 
ATOM   254  C CE2 . TRP A 1 30  ? 43.714 45.697 58.464  1.00 8.27  ? 30   TRP A CE2 1 
ATOM   255  C CE3 . TRP A 1 30  ? 44.889 47.038 60.099  1.00 8.45  ? 30   TRP A CE3 1 
ATOM   256  C CZ2 . TRP A 1 30  ? 42.702 46.648 58.338  1.00 8.33  ? 30   TRP A CZ2 1 
ATOM   257  C CZ3 . TRP A 1 30  ? 43.885 47.985 59.970  1.00 8.46  ? 30   TRP A CZ3 1 
ATOM   258  C CH2 . TRP A 1 30  ? 42.805 47.786 59.093  1.00 8.92  ? 30   TRP A CH2 1 
ATOM   259  N N   . LEU A 1 31  ? 44.975 44.440 62.644  1.00 8.25  ? 31   LEU A N   1 
ATOM   260  C CA  . LEU A 1 31  ? 44.361 45.225 63.703  1.00 7.95  ? 31   LEU A CA  1 
ATOM   261  C C   . LEU A 1 31  ? 44.905 44.838 65.090  1.00 8.45  ? 31   LEU A C   1 
ATOM   262  O O   . LEU A 1 31  ? 44.562 45.451 66.094  1.00 8.55  ? 31   LEU A O   1 
ATOM   263  C CB  . LEU A 1 31  ? 42.840 45.092 63.652  1.00 7.98  ? 31   LEU A CB  1 
ATOM   264  C CG  . LEU A 1 31  ? 42.157 45.903 62.553  1.00 8.31  ? 31   LEU A CG  1 
ATOM   265  C CD1 . LEU A 1 31  ? 40.692 45.542 62.483  1.00 7.99  ? 31   LEU A CD1 1 
ATOM   266  C CD2 . LEU A 1 31  ? 42.326 47.387 62.836  1.00 7.56  ? 31   LEU A CD2 1 
ATOM   267  N N   . GLU A 1 32  ? 45.756 43.818 65.124  1.00 7.97  ? 32   GLU A N   1 
ATOM   268  C CA  . GLU A 1 32  ? 46.373 43.375 66.365  1.00 8.78  ? 32   GLU A CA  1 
ATOM   269  C C   . GLU A 1 32  ? 47.445 44.356 66.827  1.00 8.50  ? 32   GLU A C   1 
ATOM   270  O O   . GLU A 1 32  ? 47.890 44.300 67.965  1.00 9.20  ? 32   GLU A O   1 
ATOM   271  C CB  . GLU A 1 32  ? 46.983 41.986 66.185  1.00 8.99  ? 32   GLU A CB  1 
ATOM   272  C CG  . GLU A 1 32  ? 45.946 40.887 66.033  1.00 10.25 ? 32   GLU A CG  1 
ATOM   273  C CD  . GLU A 1 32  ? 46.480 39.613 65.393  1.00 11.00 ? 32   GLU A CD  1 
ATOM   274  O OE1 . GLU A 1 32  ? 47.692 39.505 65.113  1.00 12.79 ? 32   GLU A OE1 1 
ATOM   275  O OE2 . GLU A 1 32  ? 45.661 38.719 65.128  1.00 10.75 ? 32   GLU A OE2 1 
ATOM   276  N N   . ASP A 1 33  ? 47.866 45.247 65.931  1.00 8.15  ? 33   ASP A N   1 
ATOM   277  C CA  . ASP A 1 33  ? 48.876 46.243 66.258  1.00 9.00  ? 33   ASP A CA  1 
ATOM   278  C C   . ASP A 1 33  ? 48.168 47.541 66.608  1.00 9.37  ? 33   ASP A C   1 
ATOM   279  O O   . ASP A 1 33  ? 47.699 48.263 65.727  1.00 9.18  ? 33   ASP A O   1 
ATOM   280  C CB  . ASP A 1 33  ? 49.831 46.456 65.072  1.00 8.71  ? 33   ASP A CB  1 
ATOM   281  C CG  . ASP A 1 33  ? 50.974 47.416 65.394  1.00 9.69  ? 33   ASP A CG  1 
ATOM   282  O OD1 . ASP A 1 33  ? 50.985 48.001 66.497  1.00 10.05 ? 33   ASP A OD1 1 
ATOM   283  O OD2 . ASP A 1 33  ? 51.872 47.584 64.534  1.00 11.18 ? 33   ASP A OD2 1 
ATOM   284  N N   . PRO A 1 34  ? 48.107 47.872 67.908  1.00 9.83  ? 34   PRO A N   1 
ATOM   285  C CA  . PRO A 1 34  ? 47.438 49.101 68.351  1.00 9.80  ? 34   PRO A CA  1 
ATOM   286  C C   . PRO A 1 34  ? 48.135 50.396 67.951  1.00 10.40 ? 34   PRO A C   1 
ATOM   287  O O   . PRO A 1 34  ? 47.499 51.443 67.867  1.00 10.82 ? 34   PRO A O   1 
ATOM   288  C CB  . PRO A 1 34  ? 47.418 48.938 69.873  1.00 9.66  ? 34   PRO A CB  1 
ATOM   289  C CG  . PRO A 1 34  ? 48.690 48.187 70.142  1.00 10.26 ? 34   PRO A CG  1 
ATOM   290  C CD  . PRO A 1 34  ? 48.681 47.142 69.053  1.00 9.77  ? 34   PRO A CD  1 
ATOM   291  N N   . ASP A 1 35  ? 49.419 50.313 67.643  1.00 10.59 ? 35   ASP A N   1 
ATOM   292  C CA  . ASP A 1 35  ? 50.191 51.504 67.317  1.00 11.34 ? 35   ASP A CA  1 
ATOM   293  C C   . ASP A 1 35  ? 50.279 51.925 65.862  1.00 10.85 ? 35   ASP A C   1 
ATOM   294  O O   . ASP A 1 35  ? 50.758 53.019 65.563  1.00 11.09 ? 35   ASP A O   1 
ATOM   295  C CB  . ASP A 1 35  ? 51.609 51.353 67.866  1.00 12.94 ? 35   ASP A CB  1 
ATOM   296  C CG  . ASP A 1 35  ? 51.628 51.136 69.351  1.00 14.53 ? 35   ASP A CG  1 
ATOM   297  O OD1 . ASP A 1 35  ? 51.012 51.947 70.057  1.00 16.85 ? 35   ASP A OD1 1 
ATOM   298  O OD2 . ASP A 1 35  ? 52.244 50.150 69.796  1.00 16.19 ? 35   ASP A OD2 1 
ATOM   299  N N   . SER A 1 36  ? 49.867 51.059 64.951  1.00 9.44  ? 36   SER A N   1 
ATOM   300  C CA  . SER A 1 36  ? 49.967 51.394 63.536  1.00 8.35  ? 36   SER A CA  1 
ATOM   301  C C   . SER A 1 36  ? 49.013 52.499 63.095  1.00 8.60  ? 36   SER A C   1 
ATOM   302  O O   . SER A 1 36  ? 47.942 52.695 63.666  1.00 8.88  ? 36   SER A O   1 
ATOM   303  C CB  . SER A 1 36  ? 49.723 50.158 62.682  1.00 9.12  ? 36   SER A CB  1 
ATOM   304  O OG  . SER A 1 36  ? 48.375 49.762 62.783  1.00 7.74  ? 36   SER A OG  1 
ATOM   305  N N   . GLU A 1 37  ? 49.397 53.192 62.029  1.00 9.17  ? 37   GLU A N   1 
ATOM   306  C CA  . GLU A 1 37  ? 48.559 54.244 61.480  1.00 9.51  ? 37   GLU A CA  1 
ATOM   307  C C   . GLU A 1 37  ? 47.270 53.626 60.962  1.00 8.83  ? 37   GLU A C   1 
ATOM   308  O O   . GLU A 1 37  ? 46.193 54.203 61.102  1.00 8.65  ? 37   GLU A O   1 
ATOM   309  C CB  . GLU A 1 37  ? 49.281 54.988 60.356  1.00 10.13 ? 37   GLU A CB  1 
ATOM   310  C CG  . GLU A 1 37  ? 50.484 55.794 60.815  1.00 13.05 ? 37   GLU A CG  1 
ATOM   311  C CD  . GLU A 1 37  ? 50.144 56.778 61.922  1.00 14.64 ? 37   GLU A CD  1 
ATOM   312  O OE1 . GLU A 1 37  ? 49.125 57.496 61.809  1.00 17.15 ? 37   GLU A OE1 1 
ATOM   313  O OE2 . GLU A 1 37  ? 50.898 56.821 62.917  1.00 16.95 ? 37   GLU A OE2 1 
ATOM   314  N N   . GLN A 1 38  ? 47.384 52.419 60.423  1.00 9.68  ? 38   GLN A N   1 
ATOM   315  C CA  . GLN A 1 38  ? 46.237 51.691 59.899  1.00 9.67  ? 38   GLN A CA  1 
ATOM   316  C C   . GLN A 1 38  ? 45.193 51.412 60.984  1.00 9.53  ? 38   GLN A C   1 
ATOM   317  O O   . GLN A 1 38  ? 44.003 51.646 60.789  1.00 9.40  ? 38   GLN A O   1 
ATOM   318  C CB  . GLN A 1 38  ? 46.686 50.369 59.262  1.00 10.92 ? 38   GLN A CB  1 
ATOM   319  C CG  . GLN A 1 38  ? 47.626 50.514 58.067  1.00 12.38 ? 38   GLN A CG  1 
ATOM   320  C CD  . GLN A 1 38  ? 49.115 50.535 58.425  1.00 13.65 ? 38   GLN A CD  1 
ATOM   321  O OE1 . GLN A 1 38  ? 49.523 50.997 59.496  1.00 13.92 ? 38   GLN A OE1 1 
ATOM   322  N NE2 . GLN A 1 38  ? 49.933 50.018 57.522  1.00 14.40 ? 38   GLN A NE2 1 
ATOM   323  N N   . THR A 1 39  ? 45.641 50.904 62.126  1.00 8.39  ? 39   THR A N   1 
ATOM   324  C CA  . THR A 1 39  ? 44.717 50.609 63.212  1.00 8.47  ? 39   THR A CA  1 
ATOM   325  C C   . THR A 1 39  ? 44.109 51.877 63.801  1.00 8.44  ? 39   THR A C   1 
ATOM   326  O O   . THR A 1 39  ? 42.894 51.945 64.032  1.00 8.24  ? 39   THR A O   1 
ATOM   327  C CB  . THR A 1 39  ? 45.394 49.744 64.284  1.00 8.40  ? 39   THR A CB  1 
ATOM   328  O OG1 . THR A 1 39  ? 45.795 48.506 63.678  1.00 8.81  ? 39   THR A OG1 1 
ATOM   329  C CG2 . THR A 1 39  ? 44.444 49.466 65.449  1.00 9.41  ? 39   THR A CG2 1 
ATOM   330  N N   . LYS A 1 40  ? 44.932 52.906 63.964  1.00 9.26  ? 40   LYS A N   1 
ATOM   331  C CA  . LYS A 1 40  ? 44.445 54.170 64.492  1.00 9.45  ? 40   LYS A CA  1 
ATOM   332  C C   . LYS A 1 40  ? 43.397 54.777 63.562  1.00 9.28  ? 40   LYS A C   1 
ATOM   333  O O   . LYS A 1 40  ? 42.379 55.293 64.020  1.00 9.16  ? 40   LYS A O   1 
ATOM   334  C CB  . LYS A 1 40  ? 45.607 55.137 64.734  1.00 10.02 ? 40   LYS A CB  1 
ATOM   335  C CG  . LYS A 1 40  ? 46.487 54.724 65.908  1.00 12.10 ? 40   LYS A CG  1 
ATOM   336  C CD  . LYS A 1 40  ? 47.519 55.783 66.255  1.00 14.22 ? 40   LYS A CD  1 
ATOM   337  C CE  . LYS A 1 40  ? 48.534 55.963 65.146  1.00 15.95 ? 40   LYS A CE  1 
ATOM   338  N NZ  . LYS A 1 40  ? 49.582 56.954 65.527  1.00 17.61 ? 40   LYS A NZ  1 
ATOM   339  N N   . ALA A 1 41  ? 43.615 54.657 62.256  1.00 8.84  ? 41   ALA A N   1 
ATOM   340  C CA  . ALA A 1 41  ? 42.674 55.183 61.275  1.00 8.63  ? 41   ALA A CA  1 
ATOM   341  C C   . ALA A 1 41  ? 41.379 54.378 61.308  1.00 8.84  ? 41   ALA A C   1 
ATOM   342  O O   . ALA A 1 41  ? 40.298 54.942 61.184  1.00 8.91  ? 41   ALA A O   1 
ATOM   343  C CB  . ALA A 1 41  ? 43.282 55.164 59.884  1.00 8.70  ? 41   ALA A CB  1 
ATOM   344  N N   . PHE A 1 42  ? 41.498 53.072 61.533  1.00 8.36  ? 42   PHE A N   1 
ATOM   345  C CA  . PHE A 1 42  ? 40.326 52.192 61.631  1.00 8.66  ? 42   PHE A CA  1 
ATOM   346  C C   . PHE A 1 42  ? 39.447 52.614 62.810  1.00 8.20  ? 42   PHE A C   1 
ATOM   347  O O   . PHE A 1 42  ? 38.223 52.749 62.687  1.00 7.81  ? 42   PHE A O   1 
ATOM   348  C CB  . PHE A 1 42  ? 40.775 50.734 61.815  1.00 8.99  ? 42   PHE A CB  1 
ATOM   349  C CG  . PHE A 1 42  ? 39.644 49.766 62.080  1.00 8.63  ? 42   PHE A CG  1 
ATOM   350  C CD1 . PHE A 1 42  ? 39.024 49.101 61.031  1.00 8.36  ? 42   PHE A CD1 1 
ATOM   351  C CD2 . PHE A 1 42  ? 39.229 49.488 63.385  1.00 8.72  ? 42   PHE A CD2 1 
ATOM   352  C CE1 . PHE A 1 42  ? 38.006 48.174 61.270  1.00 8.46  ? 42   PHE A CE1 1 
ATOM   353  C CE2 . PHE A 1 42  ? 38.212 48.564 63.634  1.00 8.77  ? 42   PHE A CE2 1 
ATOM   354  C CZ  . PHE A 1 42  ? 37.602 47.901 62.577  1.00 8.61  ? 42   PHE A CZ  1 
ATOM   355  N N   . VAL A 1 43  ? 40.073 52.811 63.961  1.00 8.57  ? 43   VAL A N   1 
ATOM   356  C CA  . VAL A 1 43  ? 39.351 53.220 65.154  1.00 8.69  ? 43   VAL A CA  1 
ATOM   357  C C   . VAL A 1 43  ? 38.646 54.562 64.944  1.00 9.00  ? 43   VAL A C   1 
ATOM   358  O O   . VAL A 1 43  ? 37.458 54.708 65.247  1.00 9.48  ? 43   VAL A O   1 
ATOM   359  C CB  . VAL A 1 43  ? 40.307 53.277 66.360  1.00 8.40  ? 43   VAL A CB  1 
ATOM   360  C CG1 . VAL A 1 43  ? 39.629 53.941 67.550  1.00 9.30  ? 43   VAL A CG1 1 
ATOM   361  C CG2 . VAL A 1 43  ? 40.767 51.865 66.729  1.00 8.82  ? 43   VAL A CG2 1 
ATOM   362  N N   . GLU A 1 44  ? 39.359 55.521 64.361  1.00 8.81  ? 44   GLU A N   1 
ATOM   363  C CA  . GLU A 1 44  ? 38.778 56.836 64.105  1.00 10.20 ? 44   GLU A CA  1 
ATOM   364  C C   . GLU A 1 44  ? 37.569 56.731 63.185  1.00 9.48  ? 44   GLU A C   1 
ATOM   365  O O   . GLU A 1 44  ? 36.519 57.316 63.455  1.00 9.65  ? 44   GLU A O   1 
ATOM   366  C CB  . GLU A 1 44  ? 39.809 57.779 63.482  1.00 12.94 ? 44   GLU A CB  1 
ATOM   367  C CG  . GLU A 1 44  ? 40.912 58.218 64.411  1.00 17.27 ? 44   GLU A CG  1 
ATOM   368  C CD  . GLU A 1 44  ? 41.885 59.176 63.749  1.00 19.61 ? 44   GLU A CD  1 
ATOM   369  O OE1 . GLU A 1 44  ? 41.425 60.172 63.152  1.00 22.11 ? 44   GLU A OE1 1 
ATOM   370  O OE2 . GLU A 1 44  ? 43.108 58.930 63.823  1.00 21.61 ? 44   GLU A OE2 1 
ATOM   371  N N   . ALA A 1 45  ? 37.709 55.976 62.099  1.00 8.17  ? 45   ALA A N   1 
ATOM   372  C CA  . ALA A 1 45  ? 36.613 55.820 61.152  1.00 8.41  ? 45   ALA A CA  1 
ATOM   373  C C   . ALA A 1 45  ? 35.388 55.153 61.766  1.00 8.18  ? 45   ALA A C   1 
ATOM   374  O O   . ALA A 1 45  ? 34.257 55.491 61.429  1.00 8.55  ? 45   ALA A O   1 
ATOM   375  C CB  . ALA A 1 45  ? 37.071 55.061 59.921  1.00 9.09  ? 45   ALA A CB  1 
ATOM   376  N N   . GLN A 1 46  ? 35.612 54.206 62.670  1.00 8.34  ? 46   GLN A N   1 
ATOM   377  C CA  . GLN A 1 46  ? 34.505 53.529 63.332  1.00 8.17  ? 46   GLN A CA  1 
ATOM   378  C C   . GLN A 1 46  ? 33.805 54.459 64.301  1.00 7.38  ? 46   GLN A C   1 
ATOM   379  O O   . GLN A 1 46  ? 32.574 54.529 64.321  1.00 7.92  ? 46   GLN A O   1 
ATOM   380  C CB  . GLN A 1 46  ? 34.993 52.297 64.079  1.00 8.63  ? 46   GLN A CB  1 
ATOM   381  C CG  . GLN A 1 46  ? 35.484 51.178 63.187  1.00 8.04  ? 46   GLN A CG  1 
ATOM   382  C CD  . GLN A 1 46  ? 34.411 50.578 62.283  1.00 8.93  ? 46   GLN A CD  1 
ATOM   383  O OE1 . GLN A 1 46  ? 33.216 50.743 62.501  1.00 8.82  ? 46   GLN A OE1 1 
ATOM   384  N NE2 . GLN A 1 46  ? 34.846 49.858 61.269  1.00 9.66  ? 46   GLN A NE2 1 
ATOM   385  N N   . ASN A 1 47  ? 34.574 55.169 65.117  1.00 7.53  ? 47   ASN A N   1 
ATOM   386  C CA  . ASN A 1 47  ? 33.970 56.093 66.066  1.00 7.75  ? 47   ASN A CA  1 
ATOM   387  C C   . ASN A 1 47  ? 33.210 57.202 65.338  1.00 8.65  ? 47   ASN A C   1 
ATOM   388  O O   . ASN A 1 47  ? 32.195 57.704 65.836  1.00 8.67  ? 47   ASN A O   1 
ATOM   389  C CB  . ASN A 1 47  ? 35.026 56.715 66.980  1.00 7.54  ? 47   ASN A CB  1 
ATOM   390  C CG  . ASN A 1 47  ? 35.460 55.796 68.102  1.00 8.51  ? 47   ASN A CG  1 
ATOM   391  O OD1 . ASN A 1 47  ? 34.769 54.849 68.465  1.00 8.65  ? 47   ASN A OD1 1 
ATOM   392  N ND2 . ASN A 1 47  ? 36.607 56.096 68.679  1.00 8.37  ? 47   ASN A ND2 1 
ATOM   393  N N   . LYS A 1 48  ? 33.684 57.561 64.151  1.00 9.20  ? 48   LYS A N   1 
ATOM   394  C CA  . LYS A 1 48  ? 33.052 58.604 63.351  1.00 10.48 ? 48   LYS A CA  1 
ATOM   395  C C   . LYS A 1 48  ? 31.616 58.282 62.967  1.00 9.81  ? 48   LYS A C   1 
ATOM   396  O O   . LYS A 1 48  ? 30.807 59.198 62.806  1.00 10.77 ? 48   LYS A O   1 
ATOM   397  C CB  . LYS A 1 48  ? 33.862 58.899 62.094  1.00 11.96 ? 48   LYS A CB  1 
ATOM   398  C CG  . LYS A 1 48  ? 35.113 59.726 62.311  1.00 16.29 ? 48   LYS A CG  1 
ATOM   399  C CD  . LYS A 1 48  ? 35.209 60.851 61.289  1.00 18.65 ? 48   LYS A CD  1 
ATOM   400  C CE  . LYS A 1 48  ? 35.110 60.334 59.860  1.00 20.16 ? 48   LYS A CE  1 
ATOM   401  N NZ  . LYS A 1 48  ? 35.181 61.441 58.861  1.00 21.90 ? 48   LYS A NZ  1 
ATOM   402  N N   . ILE A 1 49  ? 31.304 57.005 62.755  1.00 10.10 ? 49   ILE A N   1 
ATOM   403  C CA  . ILE A 1 49  ? 29.930 56.635 62.426  1.00 9.74  ? 49   ILE A CA  1 
ATOM   404  C C   . ILE A 1 49  ? 29.091 56.272 63.658  1.00 9.69  ? 49   ILE A C   1 
ATOM   405  O O   . ILE A 1 49  ? 27.901 56.574 63.717  1.00 10.07 ? 49   ILE A O   1 
ATOM   406  C CB  . ILE A 1 49  ? 29.839 55.507 61.359  1.00 10.75 ? 49   ILE A CB  1 
ATOM   407  C CG1 . ILE A 1 49  ? 30.536 54.230 61.822  1.00 10.77 ? 49   ILE A CG1 1 
ATOM   408  C CG2 . ILE A 1 49  ? 30.381 56.005 60.020  1.00 10.60 ? 49   ILE A CG2 1 
ATOM   409  C CD1 . ILE A 1 49  ? 30.243 53.043 60.916  1.00 11.82 ? 49   ILE A CD1 1 
ATOM   410  N N   . THR A 1 50  ? 29.734 55.715 64.673  1.00 9.26  ? 50   THR A N   1 
ATOM   411  C CA  . THR A 1 50  ? 29.020 55.327 65.877  1.00 8.96  ? 50   THR A CA  1 
ATOM   412  C C   . THR A 1 50  ? 28.530 56.490 66.734  1.00 8.92  ? 50   THR A C   1 
ATOM   413  O O   . THR A 1 50  ? 27.361 56.527 67.139  1.00 8.98  ? 50   THR A O   1 
ATOM   414  C CB  . THR A 1 50  ? 29.893 54.415 66.742  1.00 8.01  ? 50   THR A CB  1 
ATOM   415  O OG1 . THR A 1 50  ? 30.216 53.236 65.990  1.00 8.02  ? 50   THR A OG1 1 
ATOM   416  C CG2 . THR A 1 50  ? 29.179 54.016 68.034  1.00 8.76  ? 50   THR A CG2 1 
ATOM   417  N N   . VAL A 1 51  ? 29.404 57.459 66.981  1.00 8.84  ? 51   VAL A N   1 
ATOM   418  C CA  . VAL A 1 51  ? 29.030 58.576 67.830  1.00 9.61  ? 51   VAL A CA  1 
ATOM   419  C C   . VAL A 1 51  ? 27.802 59.348 67.347  1.00 9.72  ? 51   VAL A C   1 
ATOM   420  O O   . VAL A 1 51  ? 26.876 59.580 68.128  1.00 9.95  ? 51   VAL A O   1 
ATOM   421  C CB  . VAL A 1 51  ? 30.233 59.480 68.145  1.00 10.53 ? 51   VAL A CB  1 
ATOM   422  C CG1 . VAL A 1 51  ? 29.796 60.668 68.978  1.00 11.44 ? 51   VAL A CG1 1 
ATOM   423  C CG2 . VAL A 1 51  ? 31.286 58.680 68.911  1.00 11.97 ? 51   VAL A CG2 1 
ATOM   424  N N   . PRO A 1 52  ? 27.764 59.750 66.058  1.00 9.45  ? 52   PRO A N   1 
ATOM   425  C CA  . PRO A 1 52  ? 26.563 60.479 65.624  1.00 10.09 ? 52   PRO A CA  1 
ATOM   426  C C   . PRO A 1 52  ? 25.296 59.617 65.712  1.00 10.33 ? 52   PRO A C   1 
ATOM   427  O O   . PRO A 1 52  ? 24.211 60.119 66.028  1.00 10.94 ? 52   PRO A O   1 
ATOM   428  C CB  . PRO A 1 52  ? 26.895 60.852 64.181  1.00 9.94  ? 52   PRO A CB  1 
ATOM   429  C CG  . PRO A 1 52  ? 28.386 61.002 64.201  1.00 10.32 ? 52   PRO A CG  1 
ATOM   430  C CD  . PRO A 1 52  ? 28.817 59.814 65.033  1.00 9.97  ? 52   PRO A CD  1 
ATOM   431  N N   . PHE A 1 53  ? 25.439 58.312 65.490  1.00 10.02 ? 53   PHE A N   1 
ATOM   432  C CA  . PHE A 1 53  ? 24.289 57.419 65.573  1.00 10.02 ? 53   PHE A CA  1 
ATOM   433  C C   . PHE A 1 53  ? 23.727 57.403 66.993  1.00 10.52 ? 53   PHE A C   1 
ATOM   434  O O   . PHE A 1 53  ? 22.515 57.467 67.189  1.00 10.83 ? 53   PHE A O   1 
ATOM   435  C CB  . PHE A 1 53  ? 24.662 55.995 65.143  1.00 10.41 ? 53   PHE A CB  1 
ATOM   436  C CG  . PHE A 1 53  ? 23.501 55.045 65.136  1.00 9.95  ? 53   PHE A CG  1 
ATOM   437  C CD1 . PHE A 1 53  ? 22.664 54.968 64.030  1.00 10.25 ? 53   PHE A CD1 1 
ATOM   438  C CD2 . PHE A 1 53  ? 23.218 54.264 66.252  1.00 9.95  ? 53   PHE A CD2 1 
ATOM   439  C CE1 . PHE A 1 53  ? 21.559 54.123 64.028  1.00 10.92 ? 53   PHE A CE1 1 
ATOM   440  C CE2 . PHE A 1 53  ? 22.114 53.415 66.261  1.00 10.11 ? 53   PHE A CE2 1 
ATOM   441  C CZ  . PHE A 1 53  ? 21.281 53.345 65.152  1.00 10.76 ? 53   PHE A CZ  1 
ATOM   442  N N   . LEU A 1 54  ? 24.617 57.344 67.976  1.00 9.94  ? 54   LEU A N   1 
ATOM   443  C CA  . LEU A 1 54  ? 24.215 57.317 69.381  1.00 11.00 ? 54   LEU A CA  1 
ATOM   444  C C   . LEU A 1 54  ? 23.661 58.642 69.894  1.00 11.71 ? 54   LEU A C   1 
ATOM   445  O O   . LEU A 1 54  ? 22.794 58.666 70.764  1.00 11.80 ? 54   LEU A O   1 
ATOM   446  C CB  . LEU A 1 54  ? 25.394 56.897 70.260  1.00 10.86 ? 54   LEU A CB  1 
ATOM   447  C CG  . LEU A 1 54  ? 26.015 55.518 70.029  1.00 11.45 ? 54   LEU A CG  1 
ATOM   448  C CD1 . LEU A 1 54  ? 27.245 55.364 70.903  1.00 11.69 ? 54   LEU A CD1 1 
ATOM   449  C CD2 . LEU A 1 54  ? 24.997 54.428 70.334  1.00 11.38 ? 54   LEU A CD2 1 
ATOM   450  N N   . GLU A 1 55  ? 24.157 59.743 69.338  1.00 12.53 ? 55   GLU A N   1 
ATOM   451  C CA  . GLU A 1 55  ? 23.747 61.075 69.774  1.00 13.83 ? 55   GLU A CA  1 
ATOM   452  C C   . GLU A 1 55  ? 22.684 61.777 68.932  1.00 14.15 ? 55   GLU A C   1 
ATOM   453  O O   . GLU A 1 55  ? 22.241 62.869 69.282  1.00 14.64 ? 55   GLU A O   1 
ATOM   454  C CB  . GLU A 1 55  ? 24.987 61.974 69.896  1.00 14.52 ? 55   GLU A CB  1 
ATOM   455  C CG  . GLU A 1 55  ? 26.068 61.418 70.822  1.00 16.93 ? 55   GLU A CG  1 
ATOM   456  C CD  . GLU A 1 55  ? 27.303 62.297 70.921  1.00 18.39 ? 55   GLU A CD  1 
ATOM   457  O OE1 . GLU A 1 55  ? 27.548 63.099 69.996  1.00 17.65 ? 55   GLU A OE1 1 
ATOM   458  O OE2 . GLU A 1 55  ? 28.041 62.158 71.921  1.00 19.70 ? 55   GLU A OE2 1 
ATOM   459  N N   . GLN A 1 56  ? 22.260 61.160 67.837  1.00 15.00 ? 56   GLN A N   1 
ATOM   460  C CA  . GLN A 1 56  ? 21.265 61.786 66.970  1.00 16.58 ? 56   GLN A CA  1 
ATOM   461  C C   . GLN A 1 56  ? 19.931 62.107 67.629  1.00 16.65 ? 56   GLN A C   1 
ATOM   462  O O   . GLN A 1 56  ? 19.449 63.238 67.561  1.00 16.86 ? 56   GLN A O   1 
ATOM   463  C CB  . GLN A 1 56  ? 21.021 60.941 65.716  1.00 17.51 ? 56   GLN A CB  1 
ATOM   464  C CG  . GLN A 1 56  ? 19.933 61.518 64.808  1.00 21.03 ? 56   GLN A CG  1 
ATOM   465  C CD  . GLN A 1 56  ? 19.785 60.785 63.491  1.00 22.65 ? 56   GLN A CD  1 
ATOM   466  O OE1 . GLN A 1 56  ? 18.709 60.314 63.147  1.00 24.62 ? 56   GLN A OE1 1 
ATOM   467  N NE2 . GLN A 1 56  ? 20.861 60.710 62.736  1.00 23.92 ? 56   GLN A NE2 1 
HETATM 468  N N   . CSX A 1 57  ? 19.336 61.102 68.250  1.00 16.50 ? 57   CSX A N   1 
HETATM 469  C CA  . CSX A 1 57  ? 18.039 61.250 68.888  1.00 16.16 ? 57   CSX A CA  1 
HETATM 470  C CB  . CSX A 1 57  ? 17.336 59.886 68.905  1.00 16.81 ? 57   CSX A CB  1 
HETATM 471  S SG  . CSX A 1 57  ? 17.165 59.129 67.255  1.00 19.58 ? 57   CSX A SG  1 
HETATM 472  C C   . CSX A 1 57  ? 18.077 61.866 70.289  1.00 15.45 ? 57   CSX A C   1 
HETATM 473  O O   . CSX A 1 57  ? 19.046 61.712 71.031  1.00 15.67 ? 57   CSX A O   1 
HETATM 474  O OD  . CSX A 1 57  ? 16.017 59.819 66.631  1.00 18.11 ? 57   CSX A OD  1 
ATOM   475  N N   . PRO A 1 58  ? 17.001 62.567 70.677  1.00 14.39 ? 58   PRO A N   1 
ATOM   476  C CA  . PRO A 1 58  ? 16.927 63.198 72.000  1.00 13.80 ? 58   PRO A CA  1 
ATOM   477  C C   . PRO A 1 58  ? 17.053 62.211 73.170  1.00 13.13 ? 58   PRO A C   1 
ATOM   478  O O   . PRO A 1 58  ? 17.421 62.608 74.278  1.00 12.80 ? 58   PRO A O   1 
ATOM   479  C CB  . PRO A 1 58  ? 15.545 63.854 71.978  1.00 14.44 ? 58   PRO A CB  1 
ATOM   480  C CG  . PRO A 1 58  ? 15.388 64.235 70.544  1.00 15.18 ? 58   PRO A CG  1 
ATOM   481  C CD  . PRO A 1 58  ? 15.882 63.004 69.824  1.00 14.80 ? 58   PRO A CD  1 
ATOM   482  N N   . ILE A 1 59  ? 16.771 60.933 72.918  1.00 12.42 ? 59   ILE A N   1 
ATOM   483  C CA  . ILE A 1 59  ? 16.821 59.904 73.962  1.00 12.63 ? 59   ILE A CA  1 
ATOM   484  C C   . ILE A 1 59  ? 18.123 59.846 74.757  1.00 11.26 ? 59   ILE A C   1 
ATOM   485  O O   . ILE A 1 59  ? 18.088 59.746 75.980  1.00 11.37 ? 59   ILE A O   1 
ATOM   486  C CB  . ILE A 1 59  ? 16.481 58.482 73.415  1.00 13.69 ? 59   ILE A CB  1 
ATOM   487  C CG1 . ILE A 1 59  ? 16.446 57.473 74.565  1.00 14.59 ? 59   ILE A CG1 1 
ATOM   488  C CG2 . ILE A 1 59  ? 17.507 58.035 72.385  1.00 13.85 ? 59   ILE A CG2 1 
ATOM   489  C CD1 . ILE A 1 59  ? 15.281 57.656 75.496  1.00 15.96 ? 59   ILE A CD1 1 
ATOM   490  N N   . ARG A 1 60  ? 19.270 59.959 74.094  1.00 10.66 ? 60   ARG A N   1 
ATOM   491  C CA  . ARG A 1 60  ? 20.527 59.890 74.838  1.00 10.96 ? 60   ARG A CA  1 
ATOM   492  C C   . ARG A 1 60  ? 20.633 60.988 75.888  1.00 10.54 ? 60   ARG A C   1 
ATOM   493  O O   . ARG A 1 60  ? 21.078 60.747 77.013  1.00 10.98 ? 60   ARG A O   1 
ATOM   494  C CB  . ARG A 1 60  ? 21.745 59.931 73.918  1.00 11.89 ? 60   ARG A CB  1 
ATOM   495  C CG  . ARG A 1 60  ? 23.042 59.651 74.654  1.00 11.81 ? 60   ARG A CG  1 
ATOM   496  C CD  . ARG A 1 60  ? 24.240 59.672 73.742  1.00 12.77 ? 60   ARG A CD  1 
ATOM   497  N NE  . ARG A 1 60  ? 25.448 59.265 74.447  1.00 13.37 ? 60   ARG A NE  1 
ATOM   498  C CZ  . ARG A 1 60  ? 26.141 60.028 75.283  1.00 13.34 ? 60   ARG A CZ  1 
ATOM   499  N NH1 . ARG A 1 60  ? 25.759 61.269 75.543  1.00 15.27 ? 60   ARG A NH1 1 
ATOM   500  N NH2 . ARG A 1 60  ? 27.238 59.539 75.850  1.00 13.64 ? 60   ARG A NH2 1 
ATOM   501  N N   . GLY A 1 61  ? 20.216 62.195 75.521  1.00 10.55 ? 61   GLY A N   1 
ATOM   502  C CA  . GLY A 1 61  ? 20.264 63.323 76.434  1.00 10.65 ? 61   GLY A CA  1 
ATOM   503  C C   . GLY A 1 61  ? 19.303 63.150 77.592  1.00 10.28 ? 61   GLY A C   1 
ATOM   504  O O   . GLY A 1 61  ? 19.617 63.516 78.728  1.00 11.27 ? 61   GLY A O   1 
ATOM   505  N N   . LEU A 1 62  ? 18.118 62.618 77.303  1.00 10.70 ? 62   LEU A N   1 
ATOM   506  C CA  . LEU A 1 62  ? 17.120 62.375 78.338  1.00 10.80 ? 62   LEU A CA  1 
ATOM   507  C C   . LEU A 1 62  ? 17.661 61.354 79.339  1.00 11.06 ? 62   LEU A C   1 
ATOM   508  O O   . LEU A 1 62  ? 17.576 61.548 80.553  1.00 11.77 ? 62   LEU A O   1 
ATOM   509  C CB  . LEU A 1 62  ? 15.819 61.859 77.716  1.00 10.86 ? 62   LEU A CB  1 
ATOM   510  C CG  . LEU A 1 62  ? 15.000 62.883 76.928  1.00 11.05 ? 62   LEU A CG  1 
ATOM   511  C CD1 . LEU A 1 62  ? 13.982 62.177 76.050  1.00 12.99 ? 62   LEU A CD1 1 
ATOM   512  C CD2 . LEU A 1 62  ? 14.321 63.861 77.893  1.00 12.24 ? 62   LEU A CD2 1 
ATOM   513  N N   . TYR A 1 63  ? 18.247 60.284 78.815  1.00 10.58 ? 63   TYR A N   1 
ATOM   514  C CA  . TYR A 1 63  ? 18.812 59.248 79.662  1.00 9.59  ? 63   TYR A CA  1 
ATOM   515  C C   . TYR A 1 63  ? 19.974 59.793 80.486  1.00 9.61  ? 63   TYR A C   1 
ATOM   516  O O   . TYR A 1 63  ? 20.032 59.583 81.698  1.00 9.87  ? 63   TYR A O   1 
ATOM   517  C CB  . TYR A 1 63  ? 19.251 58.042 78.820  1.00 9.46  ? 63   TYR A CB  1 
ATOM   518  C CG  . TYR A 1 63  ? 19.710 56.875 79.678  1.00 8.97  ? 63   TYR A CG  1 
ATOM   519  C CD1 . TYR A 1 63  ? 18.865 55.795 79.936  1.00 9.52  ? 63   TYR A CD1 1 
ATOM   520  C CD2 . TYR A 1 63  ? 20.963 56.892 80.296  1.00 9.42  ? 63   TYR A CD2 1 
ATOM   521  C CE1 . TYR A 1 63  ? 19.254 54.765 80.791  1.00 10.31 ? 63   TYR A CE1 1 
ATOM   522  C CE2 . TYR A 1 63  ? 21.356 55.872 81.158  1.00 9.32  ? 63   TYR A CE2 1 
ATOM   523  C CZ  . TYR A 1 63  ? 20.495 54.816 81.397  1.00 8.87  ? 63   TYR A CZ  1 
ATOM   524  O OH  . TYR A 1 63  ? 20.882 53.824 82.264  1.00 8.89  ? 63   TYR A OH  1 
ATOM   525  N N   . LYS A 1 64  ? 20.880 60.517 79.840  1.00 9.58  ? 64   LYS A N   1 
ATOM   526  C CA  . LYS A 1 64  ? 22.033 61.074 80.538  1.00 10.78 ? 64   LYS A CA  1 
ATOM   527  C C   . LYS A 1 64  ? 21.617 62.017 81.671  1.00 11.18 ? 64   LYS A C   1 
ATOM   528  O O   . LYS A 1 64  ? 22.172 61.972 82.768  1.00 10.75 ? 64   LYS A O   1 
ATOM   529  C CB  . LYS A 1 64  ? 22.960 61.790 79.560  1.00 10.90 ? 64   LYS A CB  1 
ATOM   530  C CG  . LYS A 1 64  ? 24.241 62.297 80.201  1.00 12.55 ? 64   LYS A CG  1 
ATOM   531  C CD  . LYS A 1 64  ? 25.160 62.948 79.190  1.00 14.14 ? 64   LYS A CD  1 
ATOM   532  C CE  . LYS A 1 64  ? 26.203 63.792 79.894  1.00 15.01 ? 64   LYS A CE  1 
ATOM   533  N NZ  . LYS A 1 64  ? 27.137 64.449 78.943  1.00 15.53 ? 64   LYS A NZ  1 
ATOM   534  N N   . GLU A 1 65  ? 20.618 62.852 81.413  1.00 12.20 ? 65   GLU A N   1 
ATOM   535  C CA  . GLU A 1 65  ? 20.125 63.779 82.430  1.00 13.44 ? 65   GLU A CA  1 
ATOM   536  C C   . GLU A 1 65  ? 19.618 63.001 83.639  1.00 12.74 ? 65   GLU A C   1 
ATOM   537  O O   . GLU A 1 65  ? 19.958 63.303 84.787  1.00 12.64 ? 65   GLU A O   1 
ATOM   538  C CB  . GLU A 1 65  ? 18.959 64.608 81.882  1.00 15.65 ? 65   GLU A CB  1 
ATOM   539  C CG  . GLU A 1 65  ? 19.295 65.649 80.842  1.00 19.67 ? 65   GLU A CG  1 
ATOM   540  C CD  . GLU A 1 65  ? 18.056 66.299 80.238  1.00 21.13 ? 65   GLU A CD  1 
ATOM   541  O OE1 . GLU A 1 65  ? 16.970 66.224 80.860  1.00 23.16 ? 65   GLU A OE1 1 
ATOM   542  O OE2 . GLU A 1 65  ? 18.168 66.875 79.133  1.00 22.94 ? 65   GLU A OE2 1 
ATOM   543  N N   . ARG A 1 66  ? 18.783 62.003 83.371  1.00 12.19 ? 66   ARG A N   1 
ATOM   544  C CA  . ARG A 1 66  ? 18.198 61.188 84.425  1.00 12.06 ? 66   ARG A CA  1 
ATOM   545  C C   . ARG A 1 66  ? 19.248 60.399 85.203  1.00 11.99 ? 66   ARG A C   1 
ATOM   546  O O   . ARG A 1 66  ? 19.173 60.290 86.426  1.00 11.80 ? 66   ARG A O   1 
ATOM   547  C CB  . ARG A 1 66  ? 17.136 60.251 83.846  1.00 13.54 ? 66   ARG A CB  1 
ATOM   548  C CG  . ARG A 1 66  ? 16.182 59.705 84.887  1.00 15.61 ? 66   ARG A CG  1 
ATOM   549  C CD  . ARG A 1 66  ? 15.426 60.840 85.578  1.00 18.21 ? 66   ARG A CD  1 
ATOM   550  N NE  . ARG A 1 66  ? 14.553 60.352 86.644  1.00 20.50 ? 66   ARG A NE  1 
ATOM   551  C CZ  . ARG A 1 66  ? 14.214 61.055 87.721  1.00 22.15 ? 66   ARG A CZ  1 
ATOM   552  N NH1 . ARG A 1 66  ? 14.672 62.286 87.890  1.00 22.24 ? 66   ARG A NH1 1 
ATOM   553  N NH2 . ARG A 1 66  ? 13.412 60.520 88.630  1.00 23.17 ? 66   ARG A NH2 1 
ATOM   554  N N   . MET A 1 67  ? 20.224 59.850 84.492  1.00 11.15 ? 67   MET A N   1 
ATOM   555  C CA  . MET A 1 67  ? 21.297 59.088 85.121  1.00 11.49 ? 67   MET A CA  1 
ATOM   556  C C   . MET A 1 67  ? 22.092 60.005 86.045  1.00 11.56 ? 67   MET A C   1 
ATOM   557  O O   . MET A 1 67  ? 22.348 59.663 87.197  1.00 11.38 ? 67   MET A O   1 
ATOM   558  C CB  . MET A 1 67  ? 22.212 58.487 84.047  1.00 11.06 ? 67   MET A CB  1 
ATOM   559  C CG  . MET A 1 67  ? 23.392 57.696 84.593  1.00 10.38 ? 67   MET A CG  1 
ATOM   560  S SD  . MET A 1 67  ? 22.912 56.219 85.515  1.00 10.72 ? 67   MET A SD  1 
ATOM   561  C CE  . MET A 1 67  ? 24.486 55.729 86.199  1.00 10.39 ? 67   MET A CE  1 
ATOM   562  N N   . THR A 1 68  ? 22.415 61.197 85.555  1.00 12.02 ? 68   THR A N   1 
ATOM   563  C CA  . THR A 1 68  ? 23.177 62.167 86.332  1.00 13.16 ? 68   THR A CA  1 
ATOM   564  C C   . THR A 1 68  ? 22.422 62.591 87.588  1.00 13.37 ? 68   THR A C   1 
ATOM   565  O O   . THR A 1 68  ? 23.022 62.771 88.649  1.00 14.14 ? 68   THR A O   1 
ATOM   566  C CB  . THR A 1 68  ? 23.530 63.386 85.477  1.00 14.03 ? 68   THR A CB  1 
ATOM   567  O OG1 . THR A 1 68  ? 24.266 62.946 84.331  1.00 14.27 ? 68   THR A OG1 1 
ATOM   568  C CG2 . THR A 1 68  ? 24.376 64.400 86.261  1.00 14.47 ? 68   THR A CG2 1 
ATOM   569  N N   . GLU A 1 69  ? 21.103 62.697 87.481  1.00 13.32 ? 69   GLU A N   1 
ATOM   570  C CA  . GLU A 1 69  ? 20.288 63.074 88.624  1.00 14.49 ? 69   GLU A CA  1 
ATOM   571  C C   . GLU A 1 69  ? 20.173 61.931 89.632  1.00 13.92 ? 69   GLU A C   1 
ATOM   572  O O   . GLU A 1 69  ? 20.486 62.094 90.807  1.00 14.04 ? 69   GLU A O   1 
ATOM   573  C CB  . GLU A 1 69  ? 18.893 63.497 88.157  1.00 15.41 ? 69   GLU A CB  1 
ATOM   574  C CG  . GLU A 1 69  ? 18.860 64.812 87.405  1.00 18.73 ? 69   GLU A CG  1 
ATOM   575  C CD  . GLU A 1 69  ? 17.537 65.091 86.699  1.00 20.79 ? 69   GLU A CD  1 
ATOM   576  O OE1 . GLU A 1 69  ? 17.395 66.207 86.156  1.00 22.78 ? 69   GLU A OE1 1 
ATOM   577  O OE2 . GLU A 1 69  ? 16.652 64.207 86.668  1.00 22.02 ? 69   GLU A OE2 1 
ATOM   578  N N   . LEU A 1 70  ? 19.786 60.756 89.144  1.00 13.14 ? 70   LEU A N   1 
ATOM   579  C CA  . LEU A 1 70  ? 19.597 59.592 90.005  1.00 13.06 ? 70   LEU A CA  1 
ATOM   580  C C   . LEU A 1 70  ? 20.863 58.965 90.582  1.00 12.85 ? 70   LEU A C   1 
ATOM   581  O O   . LEU A 1 70  ? 20.843 58.443 91.692  1.00 12.39 ? 70   LEU A O   1 
ATOM   582  C CB  . LEU A 1 70  ? 18.760 58.523 89.296  1.00 13.46 ? 70   LEU A CB  1 
ATOM   583  C CG  . LEU A 1 70  ? 17.339 58.902 88.879  1.00 14.25 ? 70   LEU A CG  1 
ATOM   584  C CD1 . LEU A 1 70  ? 16.661 57.697 88.244  1.00 14.64 ? 70   LEU A CD1 1 
ATOM   585  C CD2 . LEU A 1 70  ? 16.532 59.386 90.072  1.00 15.34 ? 70   LEU A CD2 1 
ATOM   586  N N   . TYR A 1 71  ? 21.958 58.998 89.832  1.00 12.38 ? 71   TYR A N   1 
ATOM   587  C CA  . TYR A 1 71  ? 23.208 58.421 90.314  1.00 12.66 ? 71   TYR A CA  1 
ATOM   588  C C   . TYR A 1 71  ? 23.877 59.347 91.326  1.00 12.62 ? 71   TYR A C   1 
ATOM   589  O O   . TYR A 1 71  ? 24.835 58.964 92.002  1.00 13.18 ? 71   TYR A O   1 
ATOM   590  C CB  . TYR A 1 71  ? 24.151 58.136 89.143  1.00 13.61 ? 71   TYR A CB  1 
ATOM   591  C CG  . TYR A 1 71  ? 25.352 57.304 89.527  1.00 15.32 ? 71   TYR A CG  1 
ATOM   592  C CD1 . TYR A 1 71  ? 25.201 55.994 89.990  1.00 15.44 ? 71   TYR A CD1 1 
ATOM   593  C CD2 . TYR A 1 71  ? 26.639 57.833 89.452  1.00 17.20 ? 71   TYR A CD2 1 
ATOM   594  C CE1 . TYR A 1 71  ? 26.301 55.235 90.368  1.00 16.73 ? 71   TYR A CE1 1 
ATOM   595  C CE2 . TYR A 1 71  ? 27.747 57.083 89.830  1.00 17.98 ? 71   TYR A CE2 1 
ATOM   596  C CZ  . TYR A 1 71  ? 27.565 55.788 90.284  1.00 18.00 ? 71   TYR A CZ  1 
ATOM   597  O OH  . TYR A 1 71  ? 28.642 55.032 90.655  1.00 18.58 ? 71   TYR A OH  1 
ATOM   598  N N   . ASP A 1 72  ? 23.352 60.563 91.430  1.00 12.70 ? 72   ASP A N   1 
ATOM   599  C CA  . ASP A 1 72  ? 23.872 61.553 92.363  1.00 13.56 ? 72   ASP A CA  1 
ATOM   600  C C   . ASP A 1 72  ? 23.295 61.325 93.750  1.00 13.93 ? 72   ASP A C   1 
ATOM   601  O O   . ASP A 1 72  ? 22.316 61.963 94.143  1.00 14.76 ? 72   ASP A O   1 
ATOM   602  C CB  . ASP A 1 72  ? 23.547 62.972 91.869  1.00 14.18 ? 72   ASP A CB  1 
ATOM   603  C CG  . ASP A 1 72  ? 24.172 64.066 92.734  1.00 14.62 ? 72   ASP A CG  1 
ATOM   604  O OD1 . ASP A 1 72  ? 25.005 63.767 93.616  1.00 15.24 ? 72   ASP A OD1 1 
ATOM   605  O OD2 . ASP A 1 72  ? 23.824 65.243 92.502  1.00 16.28 ? 72   ASP A OD2 1 
ATOM   606  N N   . TYR A 1 73  ? 23.857 60.349 94.451  1.00 14.27 ? 73   TYR A N   1 
ATOM   607  C CA  . TYR A 1 73  ? 23.434 60.042 95.807  1.00 14.97 ? 73   TYR A CA  1 
ATOM   608  C C   . TYR A 1 73  ? 24.696 59.663 96.576  1.00 14.79 ? 73   TYR A C   1 
ATOM   609  O O   . TYR A 1 73  ? 25.642 59.132 95.992  1.00 13.40 ? 73   TYR A O   1 
ATOM   610  C CB  . TYR A 1 73  ? 22.394 58.909 95.823  1.00 15.40 ? 73   TYR A CB  1 
ATOM   611  C CG  . TYR A 1 73  ? 22.896 57.551 95.378  1.00 16.06 ? 73   TYR A CG  1 
ATOM   612  C CD1 . TYR A 1 73  ? 23.399 56.639 96.307  1.00 16.63 ? 73   TYR A CD1 1 
ATOM   613  C CD2 . TYR A 1 73  ? 22.841 57.166 94.040  1.00 16.80 ? 73   TYR A CD2 1 
ATOM   614  C CE1 . TYR A 1 73  ? 23.839 55.378 95.917  1.00 17.39 ? 73   TYR A CE1 1 
ATOM   615  C CE2 . TYR A 1 73  ? 23.276 55.902 93.636  1.00 17.06 ? 73   TYR A CE2 1 
ATOM   616  C CZ  . TYR A 1 73  ? 23.773 55.014 94.582  1.00 17.28 ? 73   TYR A CZ  1 
ATOM   617  O OH  . TYR A 1 73  ? 24.190 53.760 94.195  1.00 19.31 ? 73   TYR A OH  1 
ATOM   618  N N   . PRO A 1 74  ? 24.756 59.997 97.878  1.00 14.96 ? 74   PRO A N   1 
ATOM   619  C CA  . PRO A 1 74  ? 25.928 59.676 98.703  1.00 14.76 ? 74   PRO A CA  1 
ATOM   620  C C   . PRO A 1 74  ? 26.234 58.179 98.728  1.00 14.01 ? 74   PRO A C   1 
ATOM   621  O O   . PRO A 1 74  ? 25.362 57.360 99.027  1.00 14.81 ? 74   PRO A O   1 
ATOM   622  C CB  . PRO A 1 74  ? 25.530 60.215 100.081 1.00 15.05 ? 74   PRO A CB  1 
ATOM   623  C CG  . PRO A 1 74  ? 24.027 60.166 100.068 1.00 16.36 ? 74   PRO A CG  1 
ATOM   624  C CD  . PRO A 1 74  ? 23.710 60.657 98.680  1.00 15.37 ? 74   PRO A CD  1 
ATOM   625  N N   . LYS A 1 75  ? 27.480 57.828 98.415  1.00 13.33 ? 75   LYS A N   1 
ATOM   626  C CA  . LYS A 1 75  ? 27.913 56.435 98.383  1.00 13.49 ? 75   LYS A CA  1 
ATOM   627  C C   . LYS A 1 75  ? 29.032 56.155 99.391  1.00 13.93 ? 75   LYS A C   1 
ATOM   628  O O   . LYS A 1 75  ? 30.099 56.763 99.329  1.00 13.67 ? 75   LYS A O   1 
ATOM   629  C CB  . LYS A 1 75  ? 28.365 56.056 96.971  1.00 13.58 ? 75   LYS A CB  1 
ATOM   630  C CG  . LYS A 1 75  ? 27.206 55.893 95.989  1.00 14.98 ? 75   LYS A CG  1 
ATOM   631  C CD  . LYS A 1 75  ? 27.674 55.666 94.569  1.00 16.87 ? 75   LYS A CD  1 
ATOM   632  C CE  . LYS A 1 75  ? 27.966 56.986 93.893  1.00 16.91 ? 75   LYS A CE  1 
ATOM   633  N NZ  . LYS A 1 75  ? 26.713 57.758 93.636  1.00 17.11 ? 75   LYS A NZ  1 
ATOM   634  N N   . TYR A 1 76  ? 28.753 55.253 100.329 1.00 13.67 ? 76   TYR A N   1 
ATOM   635  C CA  . TYR A 1 76  ? 29.693 54.873 101.376 1.00 13.80 ? 76   TYR A CA  1 
ATOM   636  C C   . TYR A 1 76  ? 30.076 53.406 101.312 1.00 13.75 ? 76   TYR A C   1 
ATOM   637  O O   . TYR A 1 76  ? 29.298 52.560 100.884 1.00 13.94 ? 76   TYR A O   1 
ATOM   638  C CB  . TYR A 1 76  ? 29.063 55.066 102.763 1.00 14.28 ? 76   TYR A CB  1 
ATOM   639  C CG  . TYR A 1 76  ? 28.713 56.475 103.157 1.00 14.77 ? 76   TYR A CG  1 
ATOM   640  C CD1 . TYR A 1 76  ? 27.481 57.026 102.812 1.00 14.78 ? 76   TYR A CD1 1 
ATOM   641  C CD2 . TYR A 1 76  ? 29.595 57.243 103.913 1.00 15.52 ? 76   TYR A CD2 1 
ATOM   642  C CE1 . TYR A 1 76  ? 27.133 58.304 103.211 1.00 15.24 ? 76   TYR A CE1 1 
ATOM   643  C CE2 . TYR A 1 76  ? 29.259 58.524 104.318 1.00 16.51 ? 76   TYR A CE2 1 
ATOM   644  C CZ  . TYR A 1 76  ? 28.022 59.043 103.958 1.00 16.07 ? 76   TYR A CZ  1 
ATOM   645  O OH  . TYR A 1 76  ? 27.639 60.304 104.311 1.00 16.92 ? 76   TYR A OH  1 
ATOM   646  N N   . SER A 1 77  ? 31.288 53.115 101.756 1.00 13.28 ? 77   SER A N   1 
ATOM   647  C CA  . SER A 1 77  ? 31.750 51.739 101.872 1.00 12.99 ? 77   SER A CA  1 
ATOM   648  C C   . SER A 1 77  ? 31.624 51.535 103.385 1.00 12.93 ? 77   SER A C   1 
ATOM   649  O O   . SER A 1 77  ? 31.438 52.501 104.135 1.00 12.86 ? 77   SER A O   1 
ATOM   650  C CB  . SER A 1 77  ? 33.223 51.609 101.493 1.00 13.27 ? 77   SER A CB  1 
ATOM   651  O OG  . SER A 1 77  ? 34.067 52.114 102.518 1.00 12.56 ? 77   SER A OG  1 
ATOM   652  N N   . CYS A 1 78  ? 31.719 50.303 103.853 1.00 13.09 ? 78   CYS A N   1 
ATOM   653  C CA  . CYS A 1 78  ? 31.643 50.131 105.287 1.00 13.56 ? 78   CYS A CA  1 
ATOM   654  C C   . CYS A 1 78  ? 32.991 50.533 105.908 1.00 12.49 ? 78   CYS A C   1 
ATOM   655  O O   . CYS A 1 78  ? 33.989 50.731 105.211 1.00 12.21 ? 78   CYS A O   1 
ATOM   656  C CB  . CYS A 1 78  ? 31.203 48.710 105.648 1.00 16.27 ? 78   CYS A CB  1 
ATOM   657  S SG  . CYS A 1 78  ? 31.883 47.384 104.563 1.00 19.81 ? 78   CYS A SG  1 
ATOM   658  N N   . HIS A 1 79  ? 32.953 50.845 107.194 1.00 10.75 ? 79   HIS A N   1 
ATOM   659  C CA  . HIS A 1 79  ? 34.152 51.245 107.914 1.00 10.78 ? 79   HIS A CA  1 
ATOM   660  C C   . HIS A 1 79  ? 35.055 50.051 108.138 1.00 10.86 ? 79   HIS A C   1 
ATOM   661  O O   . HIS A 1 79  ? 34.598 48.911 108.168 1.00 11.08 ? 79   HIS A O   1 
ATOM   662  C CB  . HIS A 1 79  ? 33.783 51.780 109.300 1.00 9.95  ? 79   HIS A CB  1 
ATOM   663  C CG  . HIS A 1 79  ? 33.392 53.224 109.321 1.00 10.88 ? 79   HIS A CG  1 
ATOM   664  N ND1 . HIS A 1 79  ? 32.444 53.761 108.475 1.00 10.80 ? 79   HIS A ND1 1 
ATOM   665  C CD2 . HIS A 1 79  ? 33.803 54.235 110.122 1.00 11.41 ? 79   HIS A CD2 1 
ATOM   666  C CE1 . HIS A 1 79  ? 32.289 55.042 108.752 1.00 12.40 ? 79   HIS A CE1 1 
ATOM   667  N NE2 . HIS A 1 79  ? 33.100 55.351 109.748 1.00 11.28 ? 79   HIS A NE2 1 
ATOM   668  N N   . PHE A 1 80  ? 36.335 50.332 108.335 1.00 10.39 ? 80   PHE A N   1 
ATOM   669  C CA  . PHE A 1 80  ? 37.312 49.308 108.650 1.00 10.66 ? 80   PHE A CA  1 
ATOM   670  C C   . PHE A 1 80  ? 38.365 49.967 109.517 1.00 10.55 ? 80   PHE A C   1 
ATOM   671  O O   . PHE A 1 80  ? 38.699 51.139 109.333 1.00 11.29 ? 80   PHE A O   1 
ATOM   672  C CB  . PHE A 1 80  ? 37.892 48.606 107.407 1.00 10.40 ? 80   PHE A CB  1 
ATOM   673  C CG  . PHE A 1 80  ? 38.704 49.486 106.499 1.00 10.53 ? 80   PHE A CG  1 
ATOM   674  C CD1 . PHE A 1 80  ? 40.088 49.578 106.644 1.00 10.80 ? 80   PHE A CD1 1 
ATOM   675  C CD2 . PHE A 1 80  ? 38.098 50.154 105.439 1.00 11.48 ? 80   PHE A CD2 1 
ATOM   676  C CE1 . PHE A 1 80  ? 40.850 50.318 105.749 1.00 11.70 ? 80   PHE A CE1 1 
ATOM   677  C CE2 . PHE A 1 80  ? 38.854 50.902 104.532 1.00 11.13 ? 80   PHE A CE2 1 
ATOM   678  C CZ  . PHE A 1 80  ? 40.232 50.980 104.687 1.00 10.48 ? 80   PHE A CZ  1 
ATOM   679  N N   . LYS A 1 81  ? 38.811 49.242 110.532 1.00 10.24 ? 81   LYS A N   1 
ATOM   680  C CA  . LYS A 1 81  ? 39.797 49.767 111.456 1.00 10.55 ? 81   LYS A CA  1 
ATOM   681  C C   . LYS A 1 81  ? 41.209 49.290 111.140 1.00 10.31 ? 81   LYS A C   1 
ATOM   682  O O   . LYS A 1 81  ? 41.413 48.135 110.785 1.00 10.34 ? 81   LYS A O   1 
ATOM   683  C CB  . LYS A 1 81  ? 39.423 49.367 112.886 1.00 11.51 ? 81   LYS A CB  1 
ATOM   684  C CG  . LYS A 1 81  ? 40.201 50.108 113.951 1.00 13.58 ? 81   LYS A CG  1 
ATOM   685  C CD  . LYS A 1 81  ? 39.675 49.818 115.339 1.00 15.60 ? 81   LYS A CD  1 
ATOM   686  C CE  . LYS A 1 81  ? 40.411 50.663 116.351 1.00 16.88 ? 81   LYS A CE  1 
ATOM   687  N NZ  . LYS A 1 81  ? 39.980 50.373 117.723 1.00 18.51 ? 81   LYS A NZ  1 
ATOM   688  N N   . LYS A 1 82  ? 42.167 50.206 111.242 1.00 10.34 ? 82   LYS A N   1 
ATOM   689  C CA  . LYS A 1 82  ? 43.582 49.900 111.031 1.00 11.25 ? 82   LYS A CA  1 
ATOM   690  C C   . LYS A 1 82  ? 44.315 50.649 112.136 1.00 11.39 ? 82   LYS A C   1 
ATOM   691  O O   . LYS A 1 82  ? 44.270 51.874 112.205 1.00 12.00 ? 82   LYS A O   1 
ATOM   692  C CB  . LYS A 1 82  ? 44.057 50.360 109.650 1.00 11.61 ? 82   LYS A CB  1 
ATOM   693  C CG  . LYS A 1 82  ? 43.494 49.534 108.504 1.00 14.03 ? 82   LYS A CG  1 
ATOM   694  C CD  . LYS A 1 82  ? 43.951 48.085 108.585 1.00 15.70 ? 82   LYS A CD  1 
ATOM   695  C CE  . LYS A 1 82  ? 43.349 47.228 107.489 1.00 16.82 ? 82   LYS A CE  1 
ATOM   696  N NZ  . LYS A 1 82  ? 43.940 45.862 107.508 1.00 17.72 ? 82   LYS A NZ  1 
ATOM   697  N N   . GLY A 1 83  ? 44.929 49.897 113.041 1.00 11.93 ? 83   GLY A N   1 
ATOM   698  C CA  . GLY A 1 83  ? 45.613 50.510 114.162 1.00 11.86 ? 83   GLY A CA  1 
ATOM   699  C C   . GLY A 1 83  ? 44.557 51.168 115.033 1.00 12.78 ? 83   GLY A C   1 
ATOM   700  O O   . GLY A 1 83  ? 43.508 50.576 115.291 1.00 13.20 ? 83   GLY A O   1 
ATOM   701  N N   . LYS A 1 84  ? 44.784 52.417 115.410 1.00 14.08 ? 84   LYS A N   1 
ATOM   702  C CA  . LYS A 1 84  ? 43.836 53.135 116.245 1.00 14.96 ? 84   LYS A CA  1 
ATOM   703  C C   . LYS A 1 84  ? 42.904 54.071 115.476 1.00 14.40 ? 84   LYS A C   1 
ATOM   704  O O   . LYS A 1 84  ? 42.290 54.956 116.069 1.00 15.96 ? 84   LYS A O   1 
ATOM   705  C CB  . LYS A 1 84  ? 44.582 53.921 117.313 1.00 17.17 ? 84   LYS A CB  1 
ATOM   706  C CG  . LYS A 1 84  ? 45.598 54.895 116.804 1.00 19.24 ? 84   LYS A CG  1 
ATOM   707  C CD  . LYS A 1 84  ? 46.297 55.442 118.010 1.00 20.70 ? 84   LYS A CD  1 
ATOM   708  C CE  . LYS A 1 84  ? 47.402 56.458 117.454 1.00 21.05 ? 84   LYS A CE  1 
ATOM   709  N NZ  . LYS A 1 84  ? 48.332 56.977 118.459 1.00 22.53 ? 84   LYS A NZ  1 
ATOM   710  N N   . ARG A 1 85  ? 42.796 53.878 114.165 1.00 12.99 ? 85   ARG A N   1 
ATOM   711  C CA  . ARG A 1 85  ? 41.942 54.731 113.344 1.00 12.05 ? 85   ARG A CA  1 
ATOM   712  C C   . ARG A 1 85  ? 40.945 53.949 112.505 1.00 11.87 ? 85   ARG A C   1 
ATOM   713  O O   . ARG A 1 85  ? 41.141 52.766 112.235 1.00 11.74 ? 85   ARG A O   1 
ATOM   714  C CB  . ARG A 1 85  ? 42.803 55.591 112.408 1.00 12.24 ? 85   ARG A CB  1 
ATOM   715  C CG  . ARG A 1 85  ? 43.798 56.484 113.120 1.00 12.21 ? 85   ARG A CG  1 
ATOM   716  C CD  . ARG A 1 85  ? 44.633 57.280 112.134 1.00 11.88 ? 85   ARG A CD  1 
ATOM   717  N NE  . ARG A 1 85  ? 45.682 58.051 112.797 1.00 12.76 ? 85   ARG A NE  1 
ATOM   718  C CZ  . ARG A 1 85  ? 46.885 57.578 113.113 1.00 13.65 ? 85   ARG A CZ  1 
ATOM   719  N NH1 . ARG A 1 85  ? 47.219 56.331 112.831 1.00 13.04 ? 85   ARG A NH1 1 
ATOM   720  N NH2 . ARG A 1 85  ? 47.753 58.360 113.739 1.00 14.73 ? 85   ARG A NH2 1 
ATOM   721  N N   . TYR A 1 86  ? 39.860 54.615 112.128 1.00 11.50 ? 86   TYR A N   1 
ATOM   722  C CA  . TYR A 1 86  ? 38.844 54.023 111.267 1.00 10.91 ? 86   TYR A CA  1 
ATOM   723  C C   . TYR A 1 86  ? 38.936 54.679 109.902 1.00 10.44 ? 86   TYR A C   1 
ATOM   724  O O   . TYR A 1 86  ? 39.228 55.871 109.788 1.00 11.28 ? 86   TYR A O   1 
ATOM   725  C CB  . TYR A 1 86  ? 37.435 54.232 111.824 1.00 11.55 ? 86   TYR A CB  1 
ATOM   726  C CG  . TYR A 1 86  ? 37.116 53.364 113.005 1.00 11.74 ? 86   TYR A CG  1 
ATOM   727  C CD1 . TYR A 1 86  ? 37.402 53.798 114.294 1.00 12.33 ? 86   TYR A CD1 1 
ATOM   728  C CD2 . TYR A 1 86  ? 36.530 52.105 112.839 1.00 11.83 ? 86   TYR A CD2 1 
ATOM   729  C CE1 . TYR A 1 86  ? 37.115 53.003 115.394 1.00 12.69 ? 86   TYR A CE1 1 
ATOM   730  C CE2 . TYR A 1 86  ? 36.237 51.303 113.930 1.00 12.30 ? 86   TYR A CE2 1 
ATOM   731  C CZ  . TYR A 1 86  ? 36.534 51.765 115.203 1.00 13.22 ? 86   TYR A CZ  1 
ATOM   732  O OH  . TYR A 1 86  ? 36.248 51.017 116.303 1.00 14.48 ? 86   TYR A OH  1 
ATOM   733  N N   . PHE A 1 87  ? 38.637 53.897 108.875 1.00 9.68  ? 87   PHE A N   1 
ATOM   734  C CA  . PHE A 1 87  ? 38.675 54.367 107.500 1.00 9.60  ? 87   PHE A CA  1 
ATOM   735  C C   . PHE A 1 87  ? 37.405 53.940 106.768 1.00 9.84  ? 87   PHE A C   1 
ATOM   736  O O   . PHE A 1 87  ? 36.742 52.977 107.151 1.00 10.33 ? 87   PHE A O   1 
ATOM   737  C CB  . PHE A 1 87  ? 39.887 53.769 106.761 1.00 9.74  ? 87   PHE A CB  1 
ATOM   738  C CG  . PHE A 1 87  ? 41.214 54.168 107.330 1.00 9.65  ? 87   PHE A CG  1 
ATOM   739  C CD1 . PHE A 1 87  ? 41.737 53.503 108.436 1.00 9.40  ? 87   PHE A CD1 1 
ATOM   740  C CD2 . PHE A 1 87  ? 41.939 55.205 106.760 1.00 10.17 ? 87   PHE A CD2 1 
ATOM   741  C CE1 . PHE A 1 87  ? 42.964 53.874 108.975 1.00 9.08  ? 87   PHE A CE1 1 
ATOM   742  C CE2 . PHE A 1 87  ? 43.166 55.589 107.282 1.00 9.42  ? 87   PHE A CE2 1 
ATOM   743  C CZ  . PHE A 1 87  ? 43.681 54.918 108.396 1.00 10.68 ? 87   PHE A CZ  1 
ATOM   744  N N   . TYR A 1 88  ? 37.060 54.681 105.722 1.00 9.31  ? 88   TYR A N   1 
ATOM   745  C CA  . TYR A 1 88  ? 35.906 54.351 104.895 1.00 9.81  ? 88   TYR A CA  1 
ATOM   746  C C   . TYR A 1 88  ? 35.993 55.159 103.617 1.00 9.38  ? 88   TYR A C   1 
ATOM   747  O O   . TYR A 1 88  ? 36.630 56.211 103.588 1.00 9.53  ? 88   TYR A O   1 
ATOM   748  C CB  . TYR A 1 88  ? 34.581 54.652 105.606 1.00 10.74 ? 88   TYR A CB  1 
ATOM   749  C CG  . TYR A 1 88  ? 34.324 56.115 105.903 1.00 11.14 ? 88   TYR A CG  1 
ATOM   750  C CD1 . TYR A 1 88  ? 33.587 56.916 105.024 1.00 11.52 ? 88   TYR A CD1 1 
ATOM   751  C CD2 . TYR A 1 88  ? 34.790 56.691 107.084 1.00 11.31 ? 88   TYR A CD2 1 
ATOM   752  C CE1 . TYR A 1 88  ? 33.322 58.255 105.324 1.00 12.05 ? 88   TYR A CE1 1 
ATOM   753  C CE2 . TYR A 1 88  ? 34.528 58.022 107.391 1.00 11.63 ? 88   TYR A CE2 1 
ATOM   754  C CZ  . TYR A 1 88  ? 33.798 58.794 106.513 1.00 11.70 ? 88   TYR A CZ  1 
ATOM   755  O OH  . TYR A 1 88  ? 33.547 60.109 106.824 1.00 12.44 ? 88   TYR A OH  1 
ATOM   756  N N   . PHE A 1 89  ? 35.419 54.625 102.546 1.00 10.04 ? 89   PHE A N   1 
ATOM   757  C CA  . PHE A 1 89  ? 35.397 55.329 101.271 1.00 9.88  ? 89   PHE A CA  1 
ATOM   758  C C   . PHE A 1 89  ? 34.060 56.047 101.173 1.00 10.49 ? 89   PHE A C   1 
ATOM   759  O O   . PHE A 1 89  ? 33.043 55.555 101.676 1.00 11.20 ? 89   PHE A O   1 
ATOM   760  C CB  . PHE A 1 89  ? 35.566 54.364 100.096 1.00 10.63 ? 89   PHE A CB  1 
ATOM   761  C CG  . PHE A 1 89  ? 36.947 53.800 99.973  1.00 10.50 ? 89   PHE A CG  1 
ATOM   762  C CD1 . PHE A 1 89  ? 37.270 52.582 100.559 1.00 10.54 ? 89   PHE A CD1 1 
ATOM   763  C CD2 . PHE A 1 89  ? 37.931 54.474 99.258  1.00 10.18 ? 89   PHE A CD2 1 
ATOM   764  C CE1 . PHE A 1 89  ? 38.549 52.045 100.437 1.00 11.07 ? 89   PHE A CE1 1 
ATOM   765  C CE2 . PHE A 1 89  ? 39.213 53.944 99.131  1.00 10.94 ? 89   PHE A CE2 1 
ATOM   766  C CZ  . PHE A 1 89  ? 39.521 52.727 99.720  1.00 10.93 ? 89   PHE A CZ  1 
ATOM   767  N N   . TYR A 1 90  ? 34.060 57.202 100.522 1.00 11.11 ? 90   TYR A N   1 
ATOM   768  C CA  . TYR A 1 90  ? 32.847 57.994 100.378 1.00 11.43 ? 90   TYR A CA  1 
ATOM   769  C C   . TYR A 1 90  ? 32.908 58.846 99.122  1.00 11.29 ? 90   TYR A C   1 
ATOM   770  O O   . TYR A 1 90  ? 33.951 59.372 98.761  1.00 11.26 ? 90   TYR A O   1 
ATOM   771  C CB  . TYR A 1 90  ? 32.666 58.877 101.620 1.00 13.09 ? 90   TYR A CB  1 
ATOM   772  C CG  . TYR A 1 90  ? 31.590 59.940 101.525 1.00 13.64 ? 90   TYR A CG  1 
ATOM   773  C CD1 . TYR A 1 90  ? 30.255 59.597 101.308 1.00 15.36 ? 90   TYR A CD1 1 
ATOM   774  C CD2 . TYR A 1 90  ? 31.907 61.288 101.683 1.00 15.46 ? 90   TYR A CD2 1 
ATOM   775  C CE1 . TYR A 1 90  ? 29.266 60.571 101.256 1.00 15.61 ? 90   TYR A CE1 1 
ATOM   776  C CE2 . TYR A 1 90  ? 30.925 62.268 101.630 1.00 15.78 ? 90   TYR A CE2 1 
ATOM   777  C CZ  . TYR A 1 90  ? 29.608 61.902 101.419 1.00 15.99 ? 90   TYR A CZ  1 
ATOM   778  O OH  . TYR A 1 90  ? 28.634 62.873 101.377 1.00 17.52 ? 90   TYR A OH  1 
ATOM   779  N N   . ASN A 1 91  ? 31.781 58.910 98.429  1.00 11.34 ? 91   ASN A N   1 
ATOM   780  C CA  . ASN A 1 91  ? 31.646 59.707 97.220  1.00 11.07 ? 91   ASN A CA  1 
ATOM   781  C C   . ASN A 1 91  ? 30.397 60.532 97.485  1.00 11.24 ? 91   ASN A C   1 
ATOM   782  O O   . ASN A 1 91  ? 29.339 59.966 97.771  1.00 11.10 ? 91   ASN A O   1 
ATOM   783  C CB  . ASN A 1 91  ? 31.427 58.794 96.015  1.00 10.18 ? 91   ASN A CB  1 
ATOM   784  C CG  . ASN A 1 91  ? 31.421 59.551 94.703  1.00 9.37  ? 91   ASN A CG  1 
ATOM   785  O OD1 . ASN A 1 91  ? 30.957 60.694 94.623  1.00 9.52  ? 91   ASN A OD1 1 
ATOM   786  N ND2 . ASN A 1 91  ? 31.925 58.908 93.661  1.00 9.31  ? 91   ASN A ND2 1 
ATOM   787  N N   . THR A 1 92  ? 30.520 61.856 97.459  1.00 11.89 ? 92   THR A N   1 
ATOM   788  C CA  . THR A 1 92  ? 29.375 62.720 97.718  1.00 13.46 ? 92   THR A CA  1 
ATOM   789  C C   . THR A 1 92  ? 28.238 62.450 96.735  1.00 13.22 ? 92   THR A C   1 
ATOM   790  O O   . THR A 1 92  ? 27.080 62.762 97.015  1.00 13.97 ? 92   THR A O   1 
ATOM   791  C CB  . THR A 1 92  ? 29.753 64.208 97.673  1.00 15.12 ? 92   THR A CB  1 
ATOM   792  O OG1 . THR A 1 92  ? 30.341 64.513 96.406  1.00 16.35 ? 92   THR A OG1 1 
ATOM   793  C CG2 . THR A 1 92  ? 30.717 64.569 98.813  1.00 15.68 ? 92   THR A CG2 1 
ATOM   794  N N   . GLY A 1 93  ? 28.577 61.880 95.584  1.00 12.35 ? 93   GLY A N   1 
ATOM   795  C CA  . GLY A 1 93  ? 27.570 61.555 94.591  1.00 11.62 ? 93   GLY A CA  1 
ATOM   796  C C   . GLY A 1 93  ? 28.102 61.383 93.180  1.00 10.83 ? 93   GLY A C   1 
ATOM   797  O O   . GLY A 1 93  ? 28.021 60.301 92.601  1.00 10.83 ? 93   GLY A O   1 
ATOM   798  N N   . LEU A 1 94  ? 28.695 62.442 92.643  1.00 10.41 ? 94   LEU A N   1 
ATOM   799  C CA  . LEU A 1 94  ? 29.198 62.434 91.279  1.00 9.78  ? 94   LEU A CA  1 
ATOM   800  C C   . LEU A 1 94  ? 30.699 62.642 91.154  1.00 9.75  ? 94   LEU A C   1 
ATOM   801  O O   . LEU A 1 94  ? 31.191 62.980 90.080  1.00 10.40 ? 94   LEU A O   1 
ATOM   802  C CB  . LEU A 1 94  ? 28.455 63.478 90.442  1.00 10.85 ? 94   LEU A CB  1 
ATOM   803  C CG  . LEU A 1 94  ? 26.948 63.252 90.309  1.00 10.49 ? 94   LEU A CG  1 
ATOM   804  C CD1 . LEU A 1 94  ? 26.298 64.432 89.609  1.00 11.69 ? 94   LEU A CD1 1 
ATOM   805  C CD2 . LEU A 1 94  ? 26.670 61.955 89.547  1.00 10.62 ? 94   LEU A CD2 1 
ATOM   806  N N   . GLN A 1 95  ? 31.425 62.499 92.253  1.00 8.90  ? 95   GLN A N   1 
ATOM   807  C CA  . GLN A 1 95  ? 32.867 62.640 92.158  1.00 8.91  ? 95   GLN A CA  1 
ATOM   808  C C   . GLN A 1 95  ? 33.350 61.523 91.243  1.00 8.45  ? 95   GLN A C   1 
ATOM   809  O O   . GLN A 1 95  ? 32.819 60.413 91.274  1.00 8.42  ? 95   GLN A O   1 
ATOM   810  C CB  . GLN A 1 95  ? 33.506 62.517 93.536  1.00 8.79  ? 95   GLN A CB  1 
ATOM   811  C CG  . GLN A 1 95  ? 33.030 63.583 94.511  1.00 9.64  ? 95   GLN A CG  1 
ATOM   812  C CD  . GLN A 1 95  ? 33.734 63.499 95.835  1.00 10.51 ? 95   GLN A CD  1 
ATOM   813  O OE1 . GLN A 1 95  ? 33.294 62.791 96.736  1.00 10.47 ? 95   GLN A OE1 1 
ATOM   814  N NE2 . GLN A 1 95  ? 34.837 64.218 95.962  1.00 10.82 ? 95   GLN A NE2 1 
ATOM   815  N N   . ASN A 1 96  ? 34.367 61.801 90.445  1.00 8.57  ? 96   ASN A N   1 
ATOM   816  C CA  . ASN A 1 96  ? 34.873 60.805 89.518  1.00 8.58  ? 96   ASN A CA  1 
ATOM   817  C C   . ASN A 1 96  ? 35.392 59.565 90.207  1.00 8.87  ? 96   ASN A C   1 
ATOM   818  O O   . ASN A 1 96  ? 35.194 58.457 89.717  1.00 8.27  ? 96   ASN A O   1 
ATOM   819  C CB  . ASN A 1 96  ? 35.929 61.401 88.597  1.00 8.87  ? 96   ASN A CB  1 
ATOM   820  C CG  . ASN A 1 96  ? 35.324 62.165 87.451  1.00 9.39  ? 96   ASN A CG  1 
ATOM   821  O OD1 . ASN A 1 96  ? 34.281 61.792 86.927  1.00 9.71  ? 96   ASN A OD1 1 
ATOM   822  N ND2 . ASN A 1 96  ? 35.975 63.244 87.055  1.00 10.61 ? 96   ASN A ND2 1 
ATOM   823  N N   . GLN A 1 97  ? 36.011 59.757 91.366  1.00 7.91  ? 97   GLN A N   1 
ATOM   824  C CA  . GLN A 1 97  ? 36.556 58.657 92.156  1.00 8.44  ? 97   GLN A CA  1 
ATOM   825  C C   . GLN A 1 97  ? 36.119 58.806 93.600  1.00 8.90  ? 97   GLN A C   1 
ATOM   826  O O   . GLN A 1 97  ? 36.018 59.929 94.111  1.00 8.97  ? 97   GLN A O   1 
ATOM   827  C CB  . GLN A 1 97  ? 38.083 58.692 92.125  1.00 7.16  ? 97   GLN A CB  1 
ATOM   828  C CG  . GLN A 1 97  ? 38.681 58.493 90.746  1.00 6.84  ? 97   GLN A CG  1 
ATOM   829  C CD  . GLN A 1 97  ? 38.429 57.101 90.203  1.00 6.84  ? 97   GLN A CD  1 
ATOM   830  O OE1 . GLN A 1 97  ? 38.244 56.148 90.965  1.00 8.10  ? 97   GLN A OE1 1 
ATOM   831  N NE2 . GLN A 1 97  ? 38.463 56.965 88.890  1.00 7.47  ? 97   GLN A NE2 1 
ATOM   832  N N   . ARG A 1 98  ? 35.835 57.689 94.259  1.00 9.14  ? 98   ARG A N   1 
ATOM   833  C CA  . ARG A 1 98  ? 35.459 57.760 95.661  1.00 9.77  ? 98   ARG A CA  1 
ATOM   834  C C   . ARG A 1 98  ? 36.712 58.139 96.450  1.00 9.70  ? 98   ARG A C   1 
ATOM   835  O O   . ARG A 1 98  ? 37.845 57.910 96.010  1.00 9.47  ? 98   ARG A O   1 
ATOM   836  C CB  . ARG A 1 98  ? 34.837 56.450 96.151  1.00 10.52 ? 98   ARG A CB  1 
ATOM   837  C CG  . ARG A 1 98  ? 35.739 55.241 96.123  1.00 11.89 ? 98   ARG A CG  1 
ATOM   838  C CD  . ARG A 1 98  ? 34.928 54.001 96.447  1.00 14.13 ? 98   ARG A CD  1 
ATOM   839  N NE  . ARG A 1 98  ? 35.774 52.842 96.696  1.00 16.63 ? 98   ARG A NE  1 
ATOM   840  C CZ  . ARG A 1 98  ? 35.368 51.741 97.320  1.00 17.83 ? 98   ARG A CZ  1 
ATOM   841  N NH1 . ARG A 1 98  ? 34.121 51.646 97.755  1.00 17.93 ? 98   ARG A NH1 1 
ATOM   842  N NH2 . ARG A 1 98  ? 36.216 50.744 97.519  1.00 18.64 ? 98   ARG A NH2 1 
ATOM   843  N N   . VAL A 1 99  ? 36.487 58.748 97.605  1.00 8.95  ? 99   VAL A N   1 
ATOM   844  C CA  . VAL A 1 99  ? 37.565 59.243 98.451  1.00 8.82  ? 99   VAL A CA  1 
ATOM   845  C C   . VAL A 1 99  ? 37.708 58.458 99.746  1.00 8.69  ? 99   VAL A C   1 
ATOM   846  O O   . VAL A 1 99  ? 36.714 58.036 100.331 1.00 8.79  ? 99   VAL A O   1 
ATOM   847  C CB  . VAL A 1 99  ? 37.317 60.744 98.767  1.00 8.37  ? 99   VAL A CB  1 
ATOM   848  C CG1 . VAL A 1 99  ? 38.398 61.306 99.688  1.00 9.38  ? 99   VAL A CG1 1 
ATOM   849  C CG2 . VAL A 1 99  ? 37.251 61.544 97.461  1.00 9.42  ? 99   VAL A CG2 1 
ATOM   850  N N   . LEU A 1 100 ? 38.951 58.226 100.159 1.00 8.33  ? 100  LEU A N   1 
ATOM   851  C CA  . LEU A 1 100 ? 39.227 57.504 101.395 1.00 8.23  ? 100  LEU A CA  1 
ATOM   852  C C   . LEU A 1 100 ? 39.339 58.501 102.543 1.00 8.34  ? 100  LEU A C   1 
ATOM   853  O O   . LEU A 1 100 ? 40.139 59.442 102.474 1.00 8.54  ? 100  LEU A O   1 
ATOM   854  C CB  . LEU A 1 100 ? 40.527 56.698 101.280 1.00 9.36  ? 100  LEU A CB  1 
ATOM   855  C CG  . LEU A 1 100 ? 40.912 55.811 102.469 1.00 8.86  ? 100  LEU A CG  1 
ATOM   856  C CD1 . LEU A 1 100 ? 39.763 54.872 102.843 1.00 9.91  ? 100  LEU A CD1 1 
ATOM   857  C CD2 . LEU A 1 100 ? 42.160 55.010 102.109 1.00 9.31  ? 100  LEU A CD2 1 
ATOM   858  N N   . TYR A 1 101 ? 38.506 58.301 103.562 1.00 8.59  ? 101  TYR A N   1 
ATOM   859  C CA  . TYR A 1 101 ? 38.464 59.142 104.758 1.00 9.31  ? 101  TYR A CA  1 
ATOM   860  C C   . TYR A 1 101 ? 39.021 58.403 105.959 1.00 9.85  ? 101  TYR A C   1 
ATOM   861  O O   . TYR A 1 101 ? 39.069 57.169 105.988 1.00 9.42  ? 101  TYR A O   1 
ATOM   862  C CB  . TYR A 1 101 ? 37.027 59.543 105.087 1.00 9.50  ? 101  TYR A CB  1 
ATOM   863  C CG  . TYR A 1 101 ? 36.450 60.558 104.140 1.00 10.01 ? 101  TYR A CG  1 
ATOM   864  C CD1 . TYR A 1 101 ? 35.986 60.176 102.882 1.00 10.52 ? 101  TYR A CD1 1 
ATOM   865  C CD2 . TYR A 1 101 ? 36.404 61.911 104.483 1.00 11.20 ? 101  TYR A CD2 1 
ATOM   866  C CE1 . TYR A 1 101 ? 35.496 61.111 101.987 1.00 11.89 ? 101  TYR A CE1 1 
ATOM   867  C CE2 . TYR A 1 101 ? 35.910 62.857 103.590 1.00 11.42 ? 101  TYR A CE2 1 
ATOM   868  C CZ  . TYR A 1 101 ? 35.463 62.443 102.341 1.00 11.10 ? 101  TYR A CZ  1 
ATOM   869  O OH  . TYR A 1 101 ? 35.008 63.369 101.434 1.00 12.77 ? 101  TYR A OH  1 
ATOM   870  N N   . VAL A 1 102 ? 39.407 59.179 106.965 1.00 10.47 ? 102  VAL A N   1 
ATOM   871  C CA  . VAL A 1 102 ? 39.949 58.636 108.196 1.00 11.44 ? 102  VAL A CA  1 
ATOM   872  C C   . VAL A 1 102 ? 39.375 59.401 109.381 1.00 12.39 ? 102  VAL A C   1 
ATOM   873  O O   . VAL A 1 102 ? 39.034 60.579 109.268 1.00 12.27 ? 102  VAL A O   1 
ATOM   874  C CB  . VAL A 1 102 ? 41.504 58.726 108.220 1.00 11.50 ? 102  VAL A CB  1 
ATOM   875  C CG1 . VAL A 1 102 ? 41.970 60.175 108.144 1.00 11.18 ? 102  VAL A CG1 1 
ATOM   876  C CG2 . VAL A 1 102 ? 42.060 58.051 109.464 1.00 11.04 ? 102  VAL A CG2 1 
ATOM   877  N N   . GLN A 1 103 ? 39.177 58.691 110.484 1.00 13.30 ? 103  GLN A N   1 
ATOM   878  C CA  . GLN A 1 103 ? 38.689 59.304 111.713 1.00 15.38 ? 103  GLN A CA  1 
ATOM   879  C C   . GLN A 1 103 ? 39.337 58.569 112.872 1.00 16.02 ? 103  GLN A C   1 
ATOM   880  O O   . GLN A 1 103 ? 39.635 57.389 112.773 1.00 15.65 ? 103  GLN A O   1 
ATOM   881  C CB  . GLN A 1 103 ? 37.161 59.294 111.794 1.00 17.34 ? 103  GLN A CB  1 
ATOM   882  C CG  . GLN A 1 103 ? 36.502 57.950 111.736 1.00 19.99 ? 103  GLN A CG  1 
ATOM   883  C CD  . GLN A 1 103 ? 35.016 58.059 111.463 1.00 21.19 ? 103  GLN A CD  1 
ATOM   884  O OE1 . GLN A 1 103 ? 34.445 57.197 110.814 1.00 22.50 ? 103  GLN A OE1 1 
ATOM   885  N NE2 . GLN A 1 103 ? 34.386 59.121 111.947 1.00 21.92 ? 103  GLN A NE2 1 
ATOM   886  N N   . ASP A 1 104 ? 39.642 59.299 113.933 1.00 17.09 ? 104  ASP A N   1 
ATOM   887  C CA  . ASP A 1 104 ? 40.299 58.736 115.103 1.00 18.65 ? 104  ASP A CA  1 
ATOM   888  C C   . ASP A 1 104 ? 39.392 57.908 116.017 1.00 18.89 ? 104  ASP A C   1 
ATOM   889  O O   . ASP A 1 104 ? 39.866 57.198 116.902 1.00 19.55 ? 104  ASP A O   1 
ATOM   890  C CB  . ASP A 1 104 ? 41.026 59.850 115.864 1.00 20.13 ? 104  ASP A CB  1 
ATOM   891  C CG  . ASP A 1 104 ? 42.087 60.536 115.008 1.00 21.50 ? 104  ASP A CG  1 
ATOM   892  O OD1 . ASP A 1 104 ? 42.103 61.781 114.958 1.00 22.71 ? 104  ASP A OD1 1 
ATOM   893  O OD2 . ASP A 1 104 ? 42.890 59.832 114.364 1.00 23.16 ? 104  ASP A OD2 1 
ATOM   894  N N   . SER A 1 105 ? 38.090 57.966 115.762 1.00 19.44 ? 105  SER A N   1 
ATOM   895  C CA  . SER A 1 105 ? 37.101 57.208 116.521 1.00 20.17 ? 105  SER A CA  1 
ATOM   896  C C   . SER A 1 105 ? 35.799 57.261 115.720 1.00 20.92 ? 105  SER A C   1 
ATOM   897  O O   . SER A 1 105 ? 35.661 58.103 114.836 1.00 20.74 ? 105  SER A O   1 
ATOM   898  C CB  . SER A 1 105 ? 36.905 57.820 117.917 1.00 20.03 ? 105  SER A CB  1 
ATOM   899  O OG  . SER A 1 105 ? 36.392 59.141 117.851 1.00 19.86 ? 105  SER A OG  1 
ATOM   900  N N   . LEU A 1 106 ? 34.852 56.376 116.025 1.00 21.42 ? 106  LEU A N   1 
ATOM   901  C CA  . LEU A 1 106 ? 33.572 56.350 115.314 1.00 22.41 ? 106  LEU A CA  1 
ATOM   902  C C   . LEU A 1 106 ? 32.763 57.634 115.476 1.00 23.37 ? 106  LEU A C   1 
ATOM   903  O O   . LEU A 1 106 ? 32.040 58.036 114.572 1.00 23.70 ? 106  LEU A O   1 
ATOM   904  C CB  . LEU A 1 106 ? 32.722 55.146 115.739 1.00 22.37 ? 106  LEU A CB  1 
ATOM   905  C CG  . LEU A 1 106 ? 33.160 53.769 115.239 1.00 21.94 ? 106  LEU A CG  1 
ATOM   906  C CD1 . LEU A 1 106 ? 32.227 52.689 115.769 1.00 21.62 ? 106  LEU A CD1 1 
ATOM   907  C CD2 . LEU A 1 106 ? 33.172 53.762 113.716 1.00 21.40 ? 106  LEU A CD2 1 
ATOM   908  N N   . GLU A 1 107 ? 32.872 58.253 116.646 1.00 24.00 ? 107  GLU A N   1 
ATOM   909  C CA  . GLU A 1 107 ? 32.156 59.495 116.915 1.00 24.47 ? 107  GLU A CA  1 
ATOM   910  C C   . GLU A 1 107 ? 32.991 60.698 116.486 1.00 24.10 ? 107  GLU A C   1 
ATOM   911  O O   . GLU A 1 107 ? 32.493 61.821 116.426 1.00 24.43 ? 107  GLU A O   1 
ATOM   912  C CB  . GLU A 1 107 ? 31.808 59.603 118.405 1.00 25.06 ? 107  GLU A CB  1 
ATOM   913  C CG  . GLU A 1 107 ? 30.945 58.459 118.933 1.00 25.95 ? 107  GLU A CG  1 
ATOM   914  C CD  . GLU A 1 107 ? 30.563 58.625 120.396 1.00 26.77 ? 107  GLU A CD  1 
ATOM   915  O OE1 . GLU A 1 107 ? 31.459 58.542 121.265 1.00 27.11 ? 107  GLU A OE1 1 
ATOM   916  O OE2 . GLU A 1 107 ? 29.363 58.838 120.678 1.00 26.95 ? 107  GLU A OE2 1 
ATOM   917  N N   . GLY A 1 108 ? 34.261 60.447 116.181 1.00 23.65 ? 108  GLY A N   1 
ATOM   918  C CA  . GLY A 1 108 ? 35.160 61.510 115.771 1.00 22.66 ? 108  GLY A CA  1 
ATOM   919  C C   . GLY A 1 108 ? 34.901 62.099 114.397 1.00 21.85 ? 108  GLY A C   1 
ATOM   920  O O   . GLY A 1 108 ? 34.278 61.480 113.536 1.00 22.40 ? 108  GLY A O   1 
ATOM   921  N N   . GLU A 1 109 ? 35.417 63.304 114.186 1.00 20.98 ? 109  GLU A N   1 
ATOM   922  C CA  . GLU A 1 109 ? 35.274 64.014 112.923 1.00 20.20 ? 109  GLU A CA  1 
ATOM   923  C C   . GLU A 1 109 ? 36.152 63.326 111.881 1.00 19.06 ? 109  GLU A C   1 
ATOM   924  O O   . GLU A 1 109 ? 37.289 62.954 112.167 1.00 18.62 ? 109  GLU A O   1 
ATOM   925  C CB  . GLU A 1 109 ? 35.706 65.472 113.101 1.00 21.08 ? 109  GLU A CB  1 
ATOM   926  C CG  . GLU A 1 109 ? 35.511 66.352 111.882 1.00 22.90 ? 109  GLU A CG  1 
ATOM   927  C CD  . GLU A 1 109 ? 35.839 67.807 112.168 1.00 24.00 ? 109  GLU A CD  1 
ATOM   928  O OE1 . GLU A 1 109 ? 36.807 68.328 111.574 1.00 24.99 ? 109  GLU A OE1 1 
ATOM   929  O OE2 . GLU A 1 109 ? 35.135 68.421 113.001 1.00 24.92 ? 109  GLU A OE2 1 
ATOM   930  N N   . ALA A 1 110 ? 35.605 63.108 110.693 1.00 17.54 ? 110  ALA A N   1 
ATOM   931  C CA  . ALA A 1 110 ? 36.343 62.458 109.617 1.00 17.23 ? 110  ALA A CA  1 
ATOM   932  C C   . ALA A 1 110 ? 37.047 63.488 108.746 1.00 16.56 ? 110  ALA A C   1 
ATOM   933  O O   . ALA A 1 110 ? 36.589 64.625 108.608 1.00 16.86 ? 110  ALA A O   1 
ATOM   934  C CB  . ALA A 1 110 ? 35.408 61.608 108.773 1.00 16.89 ? 110  ALA A CB  1 
ATOM   935  N N   . ARG A 1 111 ? 38.169 63.085 108.162 1.00 16.16 ? 111  ARG A N   1 
ATOM   936  C CA  . ARG A 1 111 ? 38.931 63.964 107.292 1.00 15.93 ? 111  ARG A CA  1 
ATOM   937  C C   . ARG A 1 111 ? 39.420 63.180 106.082 1.00 14.85 ? 111  ARG A C   1 
ATOM   938  O O   . ARG A 1 111 ? 39.505 61.951 106.113 1.00 13.96 ? 111  ARG A O   1 
ATOM   939  C CB  . ARG A 1 111 ? 40.117 64.571 108.047 1.00 18.00 ? 111  ARG A CB  1 
ATOM   940  C CG  . ARG A 1 111 ? 41.087 63.544 108.589 1.00 19.98 ? 111  ARG A CG  1 
ATOM   941  C CD  . ARG A 1 111 ? 42.159 64.163 109.473 1.00 22.36 ? 111  ARG A CD  1 
ATOM   942  N NE  . ARG A 1 111 ? 43.096 63.150 109.960 1.00 24.10 ? 111  ARG A NE  1 
ATOM   943  C CZ  . ARG A 1 111 ? 42.895 62.381 111.027 1.00 24.82 ? 111  ARG A CZ  1 
ATOM   944  N NH1 . ARG A 1 111 ? 41.788 62.507 111.743 1.00 25.44 ? 111  ARG A NH1 1 
ATOM   945  N NH2 . ARG A 1 111 ? 43.786 61.453 111.349 1.00 25.58 ? 111  ARG A NH2 1 
ATOM   946  N N   . VAL A 1 112 ? 39.684 63.892 104.999 1.00 13.84 ? 112  VAL A N   1 
ATOM   947  C CA  . VAL A 1 112 ? 40.169 63.264 103.781 1.00 13.11 ? 112  VAL A CA  1 
ATOM   948  C C   . VAL A 1 112 ? 41.549 62.663 104.036 1.00 13.21 ? 112  VAL A C   1 
ATOM   949  O O   . VAL A 1 112 ? 42.410 63.300 104.638 1.00 13.91 ? 112  VAL A O   1 
ATOM   950  C CB  . VAL A 1 112 ? 40.259 64.289 102.627 1.00 13.27 ? 112  VAL A CB  1 
ATOM   951  C CG1 . VAL A 1 112 ? 40.965 63.672 101.427 1.00 13.48 ? 112  VAL A CG1 1 
ATOM   952  C CG2 . VAL A 1 112 ? 38.865 64.763 102.239 1.00 13.59 ? 112  VAL A CG2 1 
ATOM   953  N N   . PHE A 1 113 ? 41.707 61.403 103.648 1.00 11.65 ? 113  PHE A N   1 
ATOM   954  C CA  . PHE A 1 113 ? 42.979 60.713 103.801 1.00 11.18 ? 113  PHE A CA  1 
ATOM   955  C C   . PHE A 1 113 ? 43.651 60.575 102.436 1.00 10.51 ? 113  PHE A C   1 
ATOM   956  O O   . PHE A 1 113 ? 44.819 60.909 102.293 1.00 11.36 ? 113  PHE A O   1 
ATOM   957  C CB  . PHE A 1 113 ? 42.780 59.340 104.438 1.00 10.93 ? 113  PHE A CB  1 
ATOM   958  C CG  . PHE A 1 113 ? 44.061 58.597 104.662 1.00 10.78 ? 113  PHE A CG  1 
ATOM   959  C CD1 . PHE A 1 113 ? 45.003 59.088 105.557 1.00 11.33 ? 113  PHE A CD1 1 
ATOM   960  C CD2 . PHE A 1 113 ? 44.350 57.443 103.943 1.00 11.01 ? 113  PHE A CD2 1 
ATOM   961  C CE1 . PHE A 1 113 ? 46.220 58.448 105.736 1.00 11.33 ? 113  PHE A CE1 1 
ATOM   962  C CE2 . PHE A 1 113 ? 45.569 56.785 104.110 1.00 11.88 ? 113  PHE A CE2 1 
ATOM   963  C CZ  . PHE A 1 113 ? 46.509 57.292 105.009 1.00 12.07 ? 113  PHE A CZ  1 
ATOM   964  N N   . LEU A 1 114 ? 42.920 60.048 101.454 1.00 10.48 ? 114  LEU A N   1 
ATOM   965  C CA  . LEU A 1 114 ? 43.447 59.901 100.092 1.00 10.63 ? 114  LEU A CA  1 
ATOM   966  C C   . LEU A 1 114 ? 42.338 60.252 99.107  1.00 10.10 ? 114  LEU A C   1 
ATOM   967  O O   . LEU A 1 114 ? 41.322 59.578 99.036  1.00 8.90  ? 114  LEU A O   1 
ATOM   968  C CB  . LEU A 1 114 ? 43.951 58.478 99.826  1.00 11.66 ? 114  LEU A CB  1 
ATOM   969  C CG  . LEU A 1 114 ? 44.546 58.244 98.432  1.00 12.97 ? 114  LEU A CG  1 
ATOM   970  C CD1 . LEU A 1 114 ? 45.807 59.078 98.240  1.00 13.82 ? 114  LEU A CD1 1 
ATOM   971  C CD2 . LEU A 1 114 ? 44.856 56.764 98.235  1.00 13.89 ? 114  LEU A CD2 1 
ATOM   972  N N   . ASP A 1 115 ? 42.552 61.316 98.345  1.00 9.82  ? 115  ASP A N   1 
ATOM   973  C CA  . ASP A 1 115 ? 41.593 61.779 97.349  1.00 9.36  ? 115  ASP A CA  1 
ATOM   974  C C   . ASP A 1 115 ? 42.196 61.616 95.958  1.00 9.65  ? 115  ASP A C   1 
ATOM   975  O O   . ASP A 1 115 ? 42.915 62.494 95.488  1.00 9.67  ? 115  ASP A O   1 
ATOM   976  C CB  . ASP A 1 115 ? 41.251 63.258 97.602  1.00 10.67 ? 115  ASP A CB  1 
ATOM   977  C CG  . ASP A 1 115 ? 40.191 63.790 96.657  1.00 11.03 ? 115  ASP A CG  1 
ATOM   978  O OD1 . ASP A 1 115 ? 39.778 63.078 95.719  1.00 11.00 ? 115  ASP A OD1 1 
ATOM   979  O OD2 . ASP A 1 115 ? 39.775 64.943 96.848  1.00 12.12 ? 115  ASP A OD2 1 
ATOM   980  N N   . PRO A 1 116 ? 41.847 60.527 95.256  1.00 9.39  ? 116  PRO A N   1 
ATOM   981  C CA  . PRO A 1 116 ? 42.384 60.296 93.911  1.00 9.98  ? 116  PRO A CA  1 
ATOM   982  C C   . PRO A 1 116 ? 41.962 61.334 92.864  1.00 10.31 ? 116  PRO A C   1 
ATOM   983  O O   . PRO A 1 116 ? 42.623 61.494 91.850  1.00 9.88  ? 116  PRO A O   1 
ATOM   984  C CB  . PRO A 1 116 ? 41.840 58.911 93.553  1.00 10.46 ? 116  PRO A CB  1 
ATOM   985  C CG  . PRO A 1 116 ? 41.589 58.267 94.881  1.00 10.09 ? 116  PRO A CG  1 
ATOM   986  C CD  . PRO A 1 116 ? 41.027 59.384 95.695  1.00 9.49  ? 116  PRO A CD  1 
ATOM   987  N N   . ASN A 1 117 ? 40.869 62.042 93.121  1.00 10.33 ? 117  ASN A N   1 
ATOM   988  C CA  . ASN A 1 117 ? 40.372 63.039 92.174  1.00 10.47 ? 117  ASN A CA  1 
ATOM   989  C C   . ASN A 1 117 ? 41.354 64.145 91.835  1.00 10.97 ? 117  ASN A C   1 
ATOM   990  O O   . ASN A 1 117 ? 41.358 64.656 90.719  1.00 11.56 ? 117  ASN A O   1 
ATOM   991  C CB  . ASN A 1 117 ? 39.070 63.672 92.667  1.00 9.89  ? 117  ASN A CB  1 
ATOM   992  C CG  . ASN A 1 117 ? 37.945 62.673 92.762  1.00 9.90  ? 117  ASN A CG  1 
ATOM   993  O OD1 . ASN A 1 117 ? 37.417 62.220 91.746  1.00 10.26 ? 117  ASN A OD1 1 
ATOM   994  N ND2 . ASN A 1 117 ? 37.580 62.304 93.981  1.00 10.00 ? 117  ASN A ND2 1 
ATOM   995  N N   . ILE A 1 118 ? 42.197 64.517 92.785  1.00 10.12 ? 118  ILE A N   1 
ATOM   996  C CA  . ILE A 1 118 ? 43.151 65.589 92.523  1.00 10.62 ? 118  ILE A CA  1 
ATOM   997  C C   . ILE A 1 118 ? 44.377 65.107 91.746  1.00 9.97  ? 118  ILE A C   1 
ATOM   998  O O   . ILE A 1 118 ? 45.277 65.891 91.442  1.00 10.14 ? 118  ILE A O   1 
ATOM   999  C CB  . ILE A 1 118 ? 43.570 66.315 93.827  1.00 11.98 ? 118  ILE A CB  1 
ATOM   1000 C CG1 . ILE A 1 118 ? 44.333 65.369 94.747  1.00 12.57 ? 118  ILE A CG1 1 
ATOM   1001 C CG2 . ILE A 1 118 ? 42.344 66.864 94.537  1.00 12.78 ? 118  ILE A CG2 1 
ATOM   1002 C CD1 . ILE A 1 118 ? 44.820 66.033 96.025  1.00 13.82 ? 118  ILE A CD1 1 
ATOM   1003 N N   . LEU A 1 119 ? 44.398 63.824 91.402  1.00 9.75  ? 119  LEU A N   1 
ATOM   1004 C CA  . LEU A 1 119 ? 45.518 63.264 90.657  1.00 10.15 ? 119  LEU A CA  1 
ATOM   1005 C C   . LEU A 1 119 ? 45.367 63.397 89.144  1.00 9.95  ? 119  LEU A C   1 
ATOM   1006 O O   . LEU A 1 119 ? 46.301 63.096 88.397  1.00 10.72 ? 119  LEU A O   1 
ATOM   1007 C CB  . LEU A 1 119 ? 45.751 61.805 91.049  1.00 10.24 ? 119  LEU A CB  1 
ATOM   1008 C CG  . LEU A 1 119 ? 45.989 61.611 92.546  1.00 10.16 ? 119  LEU A CG  1 
ATOM   1009 C CD1 . LEU A 1 119 ? 46.131 60.124 92.849  1.00 11.04 ? 119  LEU A CD1 1 
ATOM   1010 C CD2 . LEU A 1 119 ? 47.234 62.369 93.007  1.00 11.57 ? 119  LEU A CD2 1 
ATOM   1011 N N   . SER A 1 120 ? 44.194 63.827 88.690  1.00 10.43 ? 120  SER A N   1 
ATOM   1012 C CA  . SER A 1 120 ? 43.959 64.013 87.259  1.00 11.31 ? 120  SER A CA  1 
ATOM   1013 C C   . SER A 1 120 ? 42.763 64.937 87.040  1.00 12.44 ? 120  SER A C   1 
ATOM   1014 O O   . SER A 1 120 ? 41.890 65.042 87.889  1.00 13.94 ? 120  SER A O   1 
ATOM   1015 C CB  . SER A 1 120 ? 43.722 62.674 86.545  1.00 11.41 ? 120  SER A CB  1 
ATOM   1016 O OG  . SER A 1 120 ? 42.487 62.093 86.903  1.00 11.86 ? 120  SER A OG  1 
ATOM   1017 N N   . ASP A 1 121 ? 42.716 65.570 85.877  1.00 12.81 ? 121  ASP A N   1 
ATOM   1018 C CA  . ASP A 1 121 ? 41.624 66.478 85.540  1.00 13.57 ? 121  ASP A CA  1 
ATOM   1019 C C   . ASP A 1 121 ? 40.320 65.731 85.270  1.00 13.59 ? 121  ASP A C   1 
ATOM   1020 O O   . ASP A 1 121 ? 39.233 66.201 85.610  1.00 14.35 ? 121  ASP A O   1 
ATOM   1021 C CB  . ASP A 1 121 ? 41.979 67.266 84.279  1.00 14.72 ? 121  ASP A CB  1 
ATOM   1022 C CG  . ASP A 1 121 ? 42.603 68.600 84.578  1.00 15.78 ? 121  ASP A CG  1 
ATOM   1023 O OD1 . ASP A 1 121 ? 43.235 68.751 85.639  1.00 15.31 ? 121  ASP A OD1 1 
ATOM   1024 O OD2 . ASP A 1 121 ? 42.439 69.505 83.734  1.00 16.31 ? 121  ASP A OD2 1 
ATOM   1025 N N   . ASP A 1 122 ? 40.451 64.553 84.674  1.00 12.34 ? 122  ASP A N   1 
ATOM   1026 C CA  . ASP A 1 122 ? 39.302 63.751 84.282  1.00 11.52 ? 122  ASP A CA  1 
ATOM   1027 C C   . ASP A 1 122 ? 39.008 62.502 85.103  1.00 11.41 ? 122  ASP A C   1 
ATOM   1028 O O   . ASP A 1 122 ? 38.233 61.647 84.676  1.00 12.13 ? 122  ASP A O   1 
ATOM   1029 C CB  . ASP A 1 122 ? 39.464 63.371 82.806  1.00 10.96 ? 122  ASP A CB  1 
ATOM   1030 C CG  . ASP A 1 122 ? 40.773 62.630 82.522  1.00 11.05 ? 122  ASP A CG  1 
ATOM   1031 O OD1 . ASP A 1 122 ? 41.499 62.268 83.481  1.00 11.48 ? 122  ASP A OD1 1 
ATOM   1032 O OD2 . ASP A 1 122 ? 41.062 62.406 81.328  1.00 13.42 ? 122  ASP A OD2 1 
ATOM   1033 N N   . GLY A 1 123 ? 39.655 62.380 86.251  1.00 10.19 ? 123  GLY A N   1 
ATOM   1034 C CA  . GLY A 1 123 ? 39.435 61.219 87.093  1.00 9.61  ? 123  GLY A CA  1 
ATOM   1035 C C   . GLY A 1 123 ? 39.920 59.890 86.535  1.00 9.00  ? 123  GLY A C   1 
ATOM   1036 O O   . GLY A 1 123 ? 39.423 58.839 86.927  1.00 9.40  ? 123  GLY A O   1 
ATOM   1037 N N   . THR A 1 124 ? 40.919 59.924 85.661  1.00 9.00  ? 124  THR A N   1 
ATOM   1038 C CA  . THR A 1 124 ? 41.426 58.685 85.091  1.00 9.18  ? 124  THR A CA  1 
ATOM   1039 C C   . THR A 1 124 ? 42.591 58.032 85.819  1.00 9.77  ? 124  THR A C   1 
ATOM   1040 O O   . THR A 1 124 ? 43.212 57.114 85.299  1.00 9.75  ? 124  THR A O   1 
ATOM   1041 C CB  . THR A 1 124 ? 41.721 58.812 83.592  1.00 8.10  ? 124  THR A CB  1 
ATOM   1042 O OG1 . THR A 1 124 ? 42.626 59.898 83.365  1.00 9.51  ? 124  THR A OG1 1 
ATOM   1043 C CG2 . THR A 1 124 ? 40.432 59.042 82.805  1.00 8.92  ? 124  THR A CG2 1 
ATOM   1044 N N   . VAL A 1 125 ? 42.942 58.573 86.979  1.00 9.13  ? 125  VAL A N   1 
ATOM   1045 C CA  . VAL A 1 125 ? 43.968 57.956 87.823  1.00 9.05  ? 125  VAL A CA  1 
ATOM   1046 C C   . VAL A 1 125 ? 43.138 57.417 88.988  1.00 9.23  ? 125  VAL A C   1 
ATOM   1047 O O   . VAL A 1 125 ? 42.366 58.152 89.609  1.00 9.92  ? 125  VAL A O   1 
ATOM   1048 C CB  . VAL A 1 125 ? 45.049 58.945 88.293  1.00 9.30  ? 125  VAL A CB  1 
ATOM   1049 C CG1 . VAL A 1 125 ? 45.984 58.267 89.310  1.00 10.94 ? 125  VAL A CG1 1 
ATOM   1050 C CG2 . VAL A 1 125 ? 45.856 59.409 87.100  1.00 10.09 ? 125  VAL A CG2 1 
ATOM   1051 N N   . ALA A 1 126 ? 43.225 56.113 89.215  1.00 8.61  ? 126  ALA A N   1 
ATOM   1052 C CA  . ALA A 1 126 ? 42.426 55.481 90.248  1.00 8.11  ? 126  ALA A CA  1 
ATOM   1053 C C   . ALA A 1 126 ? 43.230 54.594 91.159  1.00 8.28  ? 126  ALA A C   1 
ATOM   1054 O O   . ALA A 1 126 ? 44.281 54.095 90.793  1.00 8.03  ? 126  ALA A O   1 
ATOM   1055 C CB  . ALA A 1 126 ? 41.314 54.654 89.600  1.00 8.24  ? 126  ALA A CB  1 
ATOM   1056 N N   . LEU A 1 127 ? 42.719 54.431 92.366  1.00 8.31  ? 127  LEU A N   1 
ATOM   1057 C CA  . LEU A 1 127 ? 43.310 53.556 93.359  1.00 9.21  ? 127  LEU A CA  1 
ATOM   1058 C C   . LEU A 1 127 ? 43.059 52.117 92.880  1.00 9.33  ? 127  LEU A C   1 
ATOM   1059 O O   . LEU A 1 127 ? 41.964 51.790 92.399  1.00 10.46 ? 127  LEU A O   1 
ATOM   1060 C CB  . LEU A 1 127 ? 42.613 53.783 94.703  1.00 10.55 ? 127  LEU A CB  1 
ATOM   1061 C CG  . LEU A 1 127 ? 42.947 52.870 95.881  1.00 10.54 ? 127  LEU A CG  1 
ATOM   1062 C CD1 . LEU A 1 127 ? 44.388 53.076 96.303  1.00 10.45 ? 127  LEU A CD1 1 
ATOM   1063 C CD2 . LEU A 1 127 ? 42.011 53.168 97.037  1.00 12.10 ? 127  LEU A CD2 1 
ATOM   1064 N N   . ARG A 1 128 ? 44.090 51.284 92.951  1.00 8.70  ? 128  ARG A N   1 
ATOM   1065 C CA  . ARG A 1 128 ? 43.986 49.879 92.569  1.00 9.74  ? 128  ARG A CA  1 
ATOM   1066 C C   . ARG A 1 128 ? 44.807 49.076 93.564  1.00 9.44  ? 128  ARG A C   1 
ATOM   1067 O O   . ARG A 1 128 ? 46.000 48.857 93.348  1.00 8.81  ? 128  ARG A O   1 
ATOM   1068 C CB  . ARG A 1 128 ? 44.553 49.631 91.173  1.00 10.68 ? 128  ARG A CB  1 
ATOM   1069 C CG  . ARG A 1 128 ? 44.341 48.193 90.702  1.00 13.18 ? 128  ARG A CG  1 
ATOM   1070 C CD  . ARG A 1 128 ? 43.006 48.058 90.030  1.00 16.72 ? 128  ARG A CD  1 
ATOM   1071 N NE  . ARG A 1 128 ? 43.029 48.723 88.734  1.00 18.32 ? 128  ARG A NE  1 
ATOM   1072 C CZ  . ARG A 1 128 ? 42.792 48.108 87.583  1.00 17.29 ? 128  ARG A CZ  1 
ATOM   1073 N NH1 . ARG A 1 128 ? 42.511 46.818 87.579  1.00 18.22 ? 128  ARG A NH1 1 
ATOM   1074 N NH2 . ARG A 1 128 ? 42.828 48.783 86.444  1.00 15.86 ? 128  ARG A NH2 1 
ATOM   1075 N N   . GLY A 1 129 ? 44.169 48.673 94.659  1.00 8.92  ? 129  GLY A N   1 
ATOM   1076 C CA  . GLY A 1 129 ? 44.836 47.901 95.693  1.00 8.54  ? 129  GLY A CA  1 
ATOM   1077 C C   . GLY A 1 129 ? 45.521 48.777 96.720  1.00 8.18  ? 129  GLY A C   1 
ATOM   1078 O O   . GLY A 1 129 ? 45.924 49.896 96.413  1.00 8.08  ? 129  GLY A O   1 
ATOM   1079 N N   . TYR A 1 130 ? 45.597 48.284 97.952  1.00 8.19  ? 130  TYR A N   1 
ATOM   1080 C CA  . TYR A 1 130 ? 46.250 49.005 99.036  1.00 8.12  ? 130  TYR A CA  1 
ATOM   1081 C C   . TYR A 1 130 ? 46.495 48.062 100.197 1.00 7.86  ? 130  TYR A C   1 
ATOM   1082 O O   . TYR A 1 130 ? 45.901 46.988 100.263 1.00 8.03  ? 130  TYR A O   1 
ATOM   1083 C CB  . TYR A 1 130 ? 45.417 50.212 99.502  1.00 9.22  ? 130  TYR A CB  1 
ATOM   1084 C CG  . TYR A 1 130 ? 44.040 49.889 100.051 1.00 10.37 ? 130  TYR A CG  1 
ATOM   1085 C CD1 . TYR A 1 130 ? 43.862 49.551 101.392 1.00 11.46 ? 130  TYR A CD1 1 
ATOM   1086 C CD2 . TYR A 1 130 ? 42.918 49.936 99.228  1.00 11.05 ? 130  TYR A CD2 1 
ATOM   1087 C CE1 . TYR A 1 130 ? 42.605 49.268 101.899 1.00 11.99 ? 130  TYR A CE1 1 
ATOM   1088 C CE2 . TYR A 1 130 ? 41.653 49.653 99.726  1.00 12.18 ? 130  TYR A CE2 1 
ATOM   1089 C CZ  . TYR A 1 130 ? 41.505 49.320 101.062 1.00 12.97 ? 130  TYR A CZ  1 
ATOM   1090 O OH  . TYR A 1 130 ? 40.270 49.031 101.577 1.00 15.59 ? 130  TYR A OH  1 
ATOM   1091 N N   . ALA A 1 131 ? 47.401 48.447 101.086 1.00 8.65  ? 131  ALA A N   1 
ATOM   1092 C CA  . ALA A 1 131 ? 47.699 47.647 102.257 1.00 8.47  ? 131  ALA A CA  1 
ATOM   1093 C C   . ALA A 1 131 ? 48.280 48.517 103.343 1.00 8.67  ? 131  ALA A C   1 
ATOM   1094 O O   . ALA A 1 131 ? 49.202 49.294 103.106 1.00 7.36  ? 131  ALA A O   1 
ATOM   1095 C CB  . ALA A 1 131 ? 48.673 46.531 101.917 1.00 9.35  ? 131  ALA A CB  1 
ATOM   1096 N N   . PHE A 1 132 ? 47.690 48.423 104.523 1.00 8.56  ? 132  PHE A N   1 
ATOM   1097 C CA  . PHE A 1 132 ? 48.173 49.154 105.678 1.00 8.98  ? 132  PHE A CA  1 
ATOM   1098 C C   . PHE A 1 132 ? 49.166 48.266 106.407 1.00 9.57  ? 132  PHE A C   1 
ATOM   1099 O O   . PHE A 1 132 ? 49.072 47.031 106.350 1.00 8.76  ? 132  PHE A O   1 
ATOM   1100 C CB  . PHE A 1 132 ? 47.027 49.442 106.649 1.00 9.37  ? 132  PHE A CB  1 
ATOM   1101 C CG  . PHE A 1 132 ? 46.132 50.568 106.226 1.00 9.23  ? 132  PHE A CG  1 
ATOM   1102 C CD1 . PHE A 1 132 ? 45.072 50.345 105.358 1.00 9.17  ? 132  PHE A CD1 1 
ATOM   1103 C CD2 . PHE A 1 132 ? 46.330 51.845 106.727 1.00 9.89  ? 132  PHE A CD2 1 
ATOM   1104 C CE1 . PHE A 1 132 ? 44.221 51.392 104.993 1.00 9.17  ? 132  PHE A CE1 1 
ATOM   1105 C CE2 . PHE A 1 132 ? 45.486 52.888 106.367 1.00 8.72  ? 132  PHE A CE2 1 
ATOM   1106 C CZ  . PHE A 1 132 ? 44.428 52.659 105.501 1.00 10.22 ? 132  PHE A CZ  1 
ATOM   1107 N N   . SER A 1 133 ? 50.126 48.884 107.085 1.00 9.37  ? 133  SER A N   1 
ATOM   1108 C CA  . SER A 1 133 ? 51.066 48.115 107.883 1.00 9.70  ? 133  SER A CA  1 
ATOM   1109 C C   . SER A 1 133 ? 50.240 47.501 109.023 1.00 9.98  ? 133  SER A C   1 
ATOM   1110 O O   . SER A 1 133 ? 49.134 47.958 109.306 1.00 8.90  ? 133  SER A O   1 
ATOM   1111 C CB  . SER A 1 133 ? 52.158 49.024 108.447 1.00 8.74  ? 133  SER A CB  1 
ATOM   1112 O OG  . SER A 1 133 ? 51.616 50.127 109.152 1.00 9.77  ? 133  SER A OG  1 
ATOM   1113 N N   . GLU A 1 134 ? 50.773 46.476 109.680 1.00 9.41  ? 134  GLU A N   1 
ATOM   1114 C CA  . GLU A 1 134 ? 50.068 45.814 110.771 1.00 10.03 ? 134  GLU A CA  1 
ATOM   1115 C C   . GLU A 1 134 ? 49.626 46.777 111.865 1.00 9.22  ? 134  GLU A C   1 
ATOM   1116 O O   . GLU A 1 134 ? 48.521 46.661 112.371 1.00 9.56  ? 134  GLU A O   1 
ATOM   1117 C CB  . GLU A 1 134 ? 50.932 44.686 111.349 1.00 11.05 ? 134  GLU A CB  1 
ATOM   1118 C CG  . GLU A 1 134 ? 50.352 43.954 112.573 1.00 12.30 ? 134  GLU A CG  1 
ATOM   1119 C CD  . GLU A 1 134 ? 49.048 43.208 112.314 1.00 13.55 ? 134  GLU A CD  1 
ATOM   1120 O OE1 . GLU A 1 134 ? 48.723 42.923 111.145 1.00 14.26 ? 134  GLU A OE1 1 
ATOM   1121 O OE2 . GLU A 1 134 ? 48.348 42.896 113.300 1.00 16.22 ? 134  GLU A OE2 1 
ATOM   1122 N N   . ASP A 1 135 ? 50.471 47.748 112.198 1.00 8.95  ? 135  ASP A N   1 
ATOM   1123 C CA  . ASP A 1 135 ? 50.115 48.706 113.241 1.00 8.84  ? 135  ASP A CA  1 
ATOM   1124 C C   . ASP A 1 135 ? 49.237 49.852 112.736 1.00 8.83  ? 135  ASP A C   1 
ATOM   1125 O O   . ASP A 1 135 ? 48.859 50.727 113.508 1.00 9.05  ? 135  ASP A O   1 
ATOM   1126 C CB  . ASP A 1 135 ? 51.367 49.246 113.972 1.00 8.94  ? 135  ASP A CB  1 
ATOM   1127 C CG  . ASP A 1 135 ? 52.275 50.100 113.079 1.00 7.99  ? 135  ASP A CG  1 
ATOM   1128 O OD1 . ASP A 1 135 ? 51.935 50.377 111.909 1.00 9.06  ? 135  ASP A OD1 1 
ATOM   1129 O OD2 . ASP A 1 135 ? 53.362 50.500 113.554 1.00 8.91  ? 135  ASP A OD2 1 
ATOM   1130 N N   . GLY A 1 136 ? 48.960 49.849 111.434 1.00 8.57  ? 136  GLY A N   1 
ATOM   1131 C CA  . GLY A 1 136 ? 48.129 50.887 110.831 1.00 8.28  ? 136  GLY A CA  1 
ATOM   1132 C C   . GLY A 1 136 ? 48.757 52.267 110.714 1.00 7.88  ? 136  GLY A C   1 
ATOM   1133 O O   . GLY A 1 136 ? 48.082 53.232 110.359 1.00 8.22  ? 136  GLY A O   1 
ATOM   1134 N N   . GLU A 1 137 ? 50.059 52.360 110.953 1.00 7.94  ? 137  GLU A N   1 
ATOM   1135 C CA  . GLU A 1 137 ? 50.728 53.653 110.880 1.00 8.05  ? 137  GLU A CA  1 
ATOM   1136 C C   . GLU A 1 137 ? 51.301 53.994 109.508 1.00 8.45  ? 137  GLU A C   1 
ATOM   1137 O O   . GLU A 1 137 ? 51.680 55.140 109.268 1.00 7.63  ? 137  GLU A O   1 
ATOM   1138 C CB  . GLU A 1 137 ? 51.824 53.768 111.945 1.00 9.20  ? 137  GLU A CB  1 
ATOM   1139 C CG  . GLU A 1 137 ? 51.338 53.640 113.389 1.00 10.59 ? 137  GLU A CG  1 
ATOM   1140 C CD  . GLU A 1 137 ? 50.354 54.715 113.837 1.00 10.07 ? 137  GLU A CD  1 
ATOM   1141 O OE1 . GLU A 1 137 ? 49.849 54.577 114.965 1.00 13.49 ? 137  GLU A OE1 1 
ATOM   1142 O OE2 . GLU A 1 137 ? 50.079 55.673 113.093 1.00 10.89 ? 137  GLU A OE2 1 
ATOM   1143 N N   . TYR A 1 138 ? 51.399 53.002 108.624 1.00 8.25  ? 138  TYR A N   1 
ATOM   1144 C CA  . TYR A 1 138 ? 51.922 53.232 107.278 1.00 8.90  ? 138  TYR A CA  1 
ATOM   1145 C C   . TYR A 1 138 ? 50.948 52.669 106.268 1.00 9.08  ? 138  TYR A C   1 
ATOM   1146 O O   . TYR A 1 138 ? 50.216 51.727 106.556 1.00 8.71  ? 138  TYR A O   1 
ATOM   1147 C CB  . TYR A 1 138 ? 53.333 52.670 107.112 1.00 9.32  ? 138  TYR A CB  1 
ATOM   1148 C CG  . TYR A 1 138 ? 54.356 53.561 107.775 1.00 9.91  ? 138  TYR A CG  1 
ATOM   1149 C CD1 . TYR A 1 138 ? 54.668 53.411 109.124 1.00 10.40 ? 138  TYR A CD1 1 
ATOM   1150 C CD2 . TYR A 1 138 ? 54.957 54.599 107.072 1.00 10.58 ? 138  TYR A CD2 1 
ATOM   1151 C CE1 . TYR A 1 138 ? 55.552 54.279 109.758 1.00 9.95  ? 138  TYR A CE1 1 
ATOM   1152 C CE2 . TYR A 1 138 ? 55.838 55.466 107.691 1.00 10.45 ? 138  TYR A CE2 1 
ATOM   1153 C CZ  . TYR A 1 138 ? 56.133 55.305 109.030 1.00 10.76 ? 138  TYR A CZ  1 
ATOM   1154 O OH  . TYR A 1 138 ? 57.024 56.174 109.609 1.00 11.21 ? 138  TYR A OH  1 
ATOM   1155 N N   . PHE A 1 139 ? 50.962 53.244 105.077 1.00 8.97  ? 139  PHE A N   1 
ATOM   1156 C CA  . PHE A 1 139 ? 50.005 52.875 104.042 1.00 9.45  ? 139  PHE A CA  1 
ATOM   1157 C C   . PHE A 1 139 ? 50.617 52.795 102.656 1.00 9.13  ? 139  PHE A C   1 
ATOM   1158 O O   . PHE A 1 139 ? 51.308 53.714 102.231 1.00 9.59  ? 139  PHE A O   1 
ATOM   1159 C CB  . PHE A 1 139 ? 48.904 53.949 104.077 1.00 9.54  ? 139  PHE A CB  1 
ATOM   1160 C CG  . PHE A 1 139 ? 47.852 53.828 103.009 1.00 8.61  ? 139  PHE A CG  1 
ATOM   1161 C CD1 . PHE A 1 139 ? 46.890 52.826 103.058 1.00 9.65  ? 139  PHE A CD1 1 
ATOM   1162 C CD2 . PHE A 1 139 ? 47.763 54.787 102.009 1.00 9.36  ? 139  PHE A CD2 1 
ATOM   1163 C CE1 . PHE A 1 139 ? 45.841 52.795 102.128 1.00 9.22  ? 139  PHE A CE1 1 
ATOM   1164 C CE2 . PHE A 1 139 ? 46.726 54.763 101.083 1.00 10.06 ? 139  PHE A CE2 1 
ATOM   1165 C CZ  . PHE A 1 139 ? 45.766 53.773 101.140 1.00 9.89  ? 139  PHE A CZ  1 
ATOM   1166 N N   . ALA A 1 140 ? 50.364 51.683 101.973 1.00 7.75  ? 140  ALA A N   1 
ATOM   1167 C CA  . ALA A 1 140 ? 50.831 51.474 100.608 1.00 7.89  ? 140  ALA A CA  1 
ATOM   1168 C C   . ALA A 1 140 ? 49.583 51.446 99.739  1.00 7.76  ? 140  ALA A C   1 
ATOM   1169 O O   . ALA A 1 140 ? 48.569 50.859 100.107 1.00 8.64  ? 140  ALA A O   1 
ATOM   1170 C CB  . ALA A 1 140 ? 51.567 50.164 100.484 1.00 7.81  ? 140  ALA A CB  1 
ATOM   1171 N N   . TYR A 1 141 ? 49.657 52.073 98.576  1.00 7.74  ? 141  TYR A N   1 
ATOM   1172 C CA  . TYR A 1 141 ? 48.510 52.095 97.680  1.00 7.55  ? 141  TYR A CA  1 
ATOM   1173 C C   . TYR A 1 141 ? 48.925 52.070 96.223  1.00 7.21  ? 141  TYR A C   1 
ATOM   1174 O O   . TYR A 1 141 ? 49.960 52.623 95.849  1.00 7.13  ? 141  TYR A O   1 
ATOM   1175 C CB  . TYR A 1 141 ? 47.624 53.314 97.977  1.00 7.50  ? 141  TYR A CB  1 
ATOM   1176 C CG  . TYR A 1 141 ? 48.299 54.654 97.768  1.00 7.36  ? 141  TYR A CG  1 
ATOM   1177 C CD1 . TYR A 1 141 ? 48.025 55.423 96.636  1.00 7.26  ? 141  TYR A CD1 1 
ATOM   1178 C CD2 . TYR A 1 141 ? 49.204 55.159 98.703  1.00 7.63  ? 141  TYR A CD2 1 
ATOM   1179 C CE1 . TYR A 1 141 ? 48.631 56.657 96.440  1.00 8.83  ? 141  TYR A CE1 1 
ATOM   1180 C CE2 . TYR A 1 141 ? 49.815 56.389 98.513  1.00 9.30  ? 141  TYR A CE2 1 
ATOM   1181 C CZ  . TYR A 1 141 ? 49.525 57.134 97.380  1.00 9.08  ? 141  TYR A CZ  1 
ATOM   1182 O OH  . TYR A 1 141 ? 50.125 58.356 97.178  1.00 10.58 ? 141  TYR A OH  1 
ATOM   1183 N N   . GLY A 1 142 ? 48.149 51.358 95.421  1.00 7.48  ? 142  GLY A N   1 
ATOM   1184 C CA  . GLY A 1 142 ? 48.438 51.279 94.010  1.00 7.91  ? 142  GLY A CA  1 
ATOM   1185 C C   . GLY A 1 142 ? 47.644 52.301 93.220  1.00 7.92  ? 142  GLY A C   1 
ATOM   1186 O O   . GLY A 1 142 ? 46.516 52.622 93.570  1.00 8.09  ? 142  GLY A O   1 
ATOM   1187 N N   . LEU A 1 143 ? 48.261 52.849 92.180  1.00 7.71  ? 143  LEU A N   1 
ATOM   1188 C CA  . LEU A 1 143 ? 47.594 53.799 91.299  1.00 7.90  ? 143  LEU A CA  1 
ATOM   1189 C C   . LEU A 1 143 ? 47.657 53.291 89.865  1.00 8.28  ? 143  LEU A C   1 
ATOM   1190 O O   . LEU A 1 143 ? 48.720 52.874 89.398  1.00 8.61  ? 143  LEU A O   1 
ATOM   1191 C CB  . LEU A 1 143 ? 48.271 55.163 91.358  1.00 8.01  ? 143  LEU A CB  1 
ATOM   1192 C CG  . LEU A 1 143 ? 48.123 55.965 92.645  1.00 7.53  ? 143  LEU A CG  1 
ATOM   1193 C CD1 . LEU A 1 143 ? 48.905 57.259 92.495  1.00 8.91  ? 143  LEU A CD1 1 
ATOM   1194 C CD2 . LEU A 1 143 ? 46.663 56.266 92.935  1.00 8.96  ? 143  LEU A CD2 1 
ATOM   1195 N N   . SER A 1 144 ? 46.517 53.310 89.183  1.00 8.22  ? 144  SER A N   1 
ATOM   1196 C CA  . SER A 1 144 ? 46.441 52.894 87.787  1.00 8.45  ? 144  SER A CA  1 
ATOM   1197 C C   . SER A 1 144 ? 45.997 54.094 86.967  1.00 8.72  ? 144  SER A C   1 
ATOM   1198 O O   . SER A 1 144 ? 45.129 54.860 87.392  1.00 8.88  ? 144  SER A O   1 
ATOM   1199 C CB  . SER A 1 144 ? 45.440 51.756 87.607  1.00 9.36  ? 144  SER A CB  1 
ATOM   1200 O OG  . SER A 1 144 ? 45.938 50.559 88.179  1.00 10.26 ? 144  SER A OG  1 
ATOM   1201 N N   . ALA A 1 145 ? 46.601 54.256 85.797  1.00 8.57  ? 145  ALA A N   1 
ATOM   1202 C CA  . ALA A 1 145 ? 46.269 55.358 84.914  1.00 8.57  ? 145  ALA A CA  1 
ATOM   1203 C C   . ALA A 1 145 ? 45.528 54.887 83.672  1.00 8.94  ? 145  ALA A C   1 
ATOM   1204 O O   . ALA A 1 145 ? 45.836 53.846 83.094  1.00 8.55  ? 145  ALA A O   1 
ATOM   1205 C CB  . ALA A 1 145 ? 47.530 56.111 84.524  1.00 8.19  ? 145  ALA A CB  1 
ATOM   1206 N N   . SER A 1 146 ? 44.498 55.639 83.312  1.00 8.95  ? 146  SER A N   1 
ATOM   1207 C CA  . SER A 1 146 ? 43.702 55.346 82.128  1.00 8.68  ? 146  SER A CA  1 
ATOM   1208 C C   . SER A 1 146 ? 43.052 53.965 82.064  1.00 7.96  ? 146  SER A C   1 
ATOM   1209 O O   . SER A 1 146 ? 42.783 53.446 80.978  1.00 8.59  ? 146  SER A O   1 
ATOM   1210 C CB  . SER A 1 146 ? 44.518 55.628 80.875  1.00 10.13 ? 146  SER A CB  1 
ATOM   1211 O OG  . SER A 1 146 ? 44.713 57.025 80.783  1.00 11.09 ? 146  SER A OG  1 
ATOM   1212 N N   . GLY A 1 147 ? 42.808 53.378 83.229  1.00 8.06  ? 147  GLY A N   1 
ATOM   1213 C CA  . GLY A 1 147 ? 42.152 52.082 83.301  1.00 8.39  ? 147  GLY A CA  1 
ATOM   1214 C C   . GLY A 1 147 ? 43.038 50.868 83.123  1.00 8.31  ? 147  GLY A C   1 
ATOM   1215 O O   . GLY A 1 147 ? 42.545 49.740 83.174  1.00 8.32  ? 147  GLY A O   1 
ATOM   1216 N N   . SER A 1 148 ? 44.336 51.092 82.929  1.00 7.86  ? 148  SER A N   1 
ATOM   1217 C CA  . SER A 1 148 ? 45.276 49.985 82.755  1.00 7.49  ? 148  SER A CA  1 
ATOM   1218 C C   . SER A 1 148 ? 45.454 49.157 84.030  1.00 8.16  ? 148  SER A C   1 
ATOM   1219 O O   . SER A 1 148 ? 45.311 49.660 85.136  1.00 7.57  ? 148  SER A O   1 
ATOM   1220 C CB  . SER A 1 148 ? 46.652 50.509 82.319  1.00 8.24  ? 148  SER A CB  1 
ATOM   1221 O OG  . SER A 1 148 ? 47.644 49.487 82.346  1.00 8.72  ? 148  SER A OG  1 
ATOM   1222 N N   . ASP A 1 149 ? 45.780 47.884 83.848  1.00 7.93  ? 149  ASP A N   1 
ATOM   1223 C CA  . ASP A 1 149 ? 46.050 46.984 84.966  1.00 7.75  ? 149  ASP A CA  1 
ATOM   1224 C C   . ASP A 1 149 ? 47.386 47.330 85.620  1.00 7.77  ? 149  ASP A C   1 
ATOM   1225 O O   . ASP A 1 149 ? 47.635 46.926 86.748  1.00 8.19  ? 149  ASP A O   1 
ATOM   1226 C CB  . ASP A 1 149 ? 46.084 45.524 84.501  1.00 7.57  ? 149  ASP A CB  1 
ATOM   1227 C CG  . ASP A 1 149 ? 44.709 44.896 84.445  1.00 7.94  ? 149  ASP A CG  1 
ATOM   1228 O OD1 . ASP A 1 149 ? 43.853 45.229 85.288  1.00 8.61  ? 149  ASP A OD1 1 
ATOM   1229 O OD2 . ASP A 1 149 ? 44.502 44.048 83.555  1.00 7.80  ? 149  ASP A OD2 1 
ATOM   1230 N N   . TRP A 1 150 ? 48.277 48.000 84.890  1.00 7.43  ? 150  TRP A N   1 
ATOM   1231 C CA  . TRP A 1 150 ? 49.565 48.383 85.466  1.00 7.82  ? 150  TRP A CA  1 
ATOM   1232 C C   . TRP A 1 150 ? 49.348 49.268 86.681  1.00 8.08  ? 150  TRP A C   1 
ATOM   1233 O O   . TRP A 1 150 ? 48.491 50.150 86.689  1.00 7.70  ? 150  TRP A O   1 
ATOM   1234 C CB  . TRP A 1 150 ? 50.445 49.125 84.458  1.00 8.16  ? 150  TRP A CB  1 
ATOM   1235 C CG  . TRP A 1 150 ? 51.033 48.243 83.417  1.00 8.60  ? 150  TRP A CG  1 
ATOM   1236 C CD1 . TRP A 1 150 ? 50.754 48.270 82.086  1.00 9.07  ? 150  TRP A CD1 1 
ATOM   1237 C CD2 . TRP A 1 150 ? 52.001 47.195 83.605  1.00 8.57  ? 150  TRP A CD2 1 
ATOM   1238 N NE1 . TRP A 1 150 ? 51.482 47.311 81.437  1.00 9.99  ? 150  TRP A NE1 1 
ATOM   1239 C CE2 . TRP A 1 150 ? 52.257 46.632 82.338  1.00 8.99  ? 150  TRP A CE2 1 
ATOM   1240 C CE3 . TRP A 1 150 ? 52.678 46.676 84.723  1.00 8.79  ? 150  TRP A CE3 1 
ATOM   1241 C CZ2 . TRP A 1 150 ? 53.160 45.577 82.147  1.00 9.67  ? 150  TRP A CZ2 1 
ATOM   1242 C CZ3 . TRP A 1 150 ? 53.577 45.624 84.533  1.00 10.06 ? 150  TRP A CZ3 1 
ATOM   1243 C CH2 . TRP A 1 150 ? 53.809 45.086 83.252  1.00 10.12 ? 150  TRP A CH2 1 
ATOM   1244 N N   . VAL A 1 151 ? 50.157 49.016 87.693  1.00 7.86  ? 151  VAL A N   1 
ATOM   1245 C CA  . VAL A 1 151 ? 50.092 49.740 88.943  1.00 8.26  ? 151  VAL A CA  1 
ATOM   1246 C C   . VAL A 1 151 ? 51.440 50.349 89.342  1.00 7.85  ? 151  VAL A C   1 
ATOM   1247 O O   . VAL A 1 151 ? 52.497 49.790 89.047  1.00 8.83  ? 151  VAL A O   1 
ATOM   1248 C CB  . VAL A 1 151 ? 49.655 48.755 90.082  1.00 8.45  ? 151  VAL A CB  1 
ATOM   1249 C CG1 . VAL A 1 151 ? 49.843 49.386 91.460  1.00 9.24  ? 151  VAL A CG1 1 
ATOM   1250 C CG2 . VAL A 1 151 ? 48.205 48.299 89.881  1.00 9.16  ? 151  VAL A CG2 1 
ATOM   1251 N N   . THR A 1 152 ? 51.375 51.514 89.983  1.00 8.11  ? 152  THR A N   1 
ATOM   1252 C CA  . THR A 1 152 ? 52.546 52.170 90.552  1.00 8.57  ? 152  THR A CA  1 
ATOM   1253 C C   . THR A 1 152 ? 52.168 52.219 92.030  1.00 7.79  ? 152  THR A C   1 
ATOM   1254 O O   . THR A 1 152 ? 51.099 52.723 92.371  1.00 8.16  ? 152  THR A O   1 
ATOM   1255 C CB  . THR A 1 152 ? 52.724 53.616 90.061  1.00 9.05  ? 152  THR A CB  1 
ATOM   1256 O OG1 . THR A 1 152 ? 53.024 53.609 88.661  1.00 9.62  ? 152  THR A OG1 1 
ATOM   1257 C CG2 . THR A 1 152 ? 53.865 54.302 90.802  1.00 9.69  ? 152  THR A CG2 1 
ATOM   1258 N N   . ILE A 1 153 ? 52.982 51.610 92.892  1.00 8.03  ? 153  ILE A N   1 
ATOM   1259 C CA  . ILE A 1 153 ? 52.694 51.619 94.323  1.00 8.32  ? 153  ILE A CA  1 
ATOM   1260 C C   . ILE A 1 153 ? 53.402 52.787 94.994  1.00 8.88  ? 153  ILE A C   1 
ATOM   1261 O O   . ILE A 1 153 ? 54.608 52.996 94.795  1.00 8.68  ? 153  ILE A O   1 
ATOM   1262 C CB  . ILE A 1 153 ? 53.132 50.302 95.034  1.00 8.40  ? 153  ILE A CB  1 
ATOM   1263 C CG1 . ILE A 1 153 ? 52.436 49.085 94.415  1.00 8.87  ? 153  ILE A CG1 1 
ATOM   1264 C CG2 . ILE A 1 153 ? 52.776 50.359 96.524  1.00 9.32  ? 153  ILE A CG2 1 
ATOM   1265 C CD1 . ILE A 1 153 ? 52.912 47.760 94.991  1.00 8.82  ? 153  ILE A CD1 1 
ATOM   1266 N N   . LYS A 1 154 ? 52.635 53.554 95.756  1.00 9.02  ? 154  LYS A N   1 
ATOM   1267 C CA  . LYS A 1 154 ? 53.151 54.694 96.504  1.00 9.17  ? 154  LYS A CA  1 
ATOM   1268 C C   . LYS A 1 154 ? 52.885 54.466 97.991  1.00 8.52  ? 154  LYS A C   1 
ATOM   1269 O O   . LYS A 1 154 ? 52.134 53.555 98.367  1.00 8.19  ? 154  LYS A O   1 
ATOM   1270 C CB  . LYS A 1 154 ? 52.547 56.006 95.995  1.00 10.05 ? 154  LYS A CB  1 
ATOM   1271 C CG  . LYS A 1 154 ? 53.033 56.347 94.591  1.00 11.46 ? 154  LYS A CG  1 
ATOM   1272 C CD  . LYS A 1 154 ? 52.504 57.660 94.064  1.00 13.32 ? 154  LYS A CD  1 
ATOM   1273 C CE  . LYS A 1 154 ? 53.061 57.885 92.671  1.00 15.70 ? 154  LYS A CE  1 
ATOM   1274 N NZ  . LYS A 1 154 ? 52.856 59.266 92.157  1.00 17.91 ? 154  LYS A NZ  1 
ATOM   1275 N N   . PHE A 1 155 ? 53.526 55.281 98.826  1.00 8.65  ? 155  PHE A N   1 
ATOM   1276 C CA  . PHE A 1 155 ? 53.431 55.125 100.273 1.00 8.84  ? 155  PHE A CA  1 
ATOM   1277 C C   . PHE A 1 155 ? 53.166 56.413 101.035 1.00 8.83  ? 155  PHE A C   1 
ATOM   1278 O O   . PHE A 1 155 ? 53.551 57.493 100.609 1.00 8.77  ? 155  PHE A O   1 
ATOM   1279 C CB  . PHE A 1 155 ? 54.728 54.510 100.810 1.00 8.73  ? 155  PHE A CB  1 
ATOM   1280 C CG  . PHE A 1 155 ? 54.992 53.099 100.337 1.00 8.09  ? 155  PHE A CG  1 
ATOM   1281 C CD1 . PHE A 1 155 ? 55.435 52.844 99.040  1.00 9.05  ? 155  PHE A CD1 1 
ATOM   1282 C CD2 . PHE A 1 155 ? 54.838 52.030 101.219 1.00 8.41  ? 155  PHE A CD2 1 
ATOM   1283 C CE1 . PHE A 1 155 ? 55.728 51.540 98.630  1.00 8.33  ? 155  PHE A CE1 1 
ATOM   1284 C CE2 . PHE A 1 155 ? 55.129 50.728 100.822 1.00 9.06  ? 155  PHE A CE2 1 
ATOM   1285 C CZ  . PHE A 1 155 ? 55.571 50.476 99.524  1.00 9.35  ? 155  PHE A CZ  1 
ATOM   1286 N N   . MET A 1 156 ? 52.559 56.268 102.206 1.00 9.14  ? 156  MET A N   1 
ATOM   1287 C CA  . MET A 1 156 ? 52.243 57.386 103.072 1.00 10.24 ? 156  MET A CA  1 
ATOM   1288 C C   . MET A 1 156 ? 52.353 56.989 104.526 1.00 10.05 ? 156  MET A C   1 
ATOM   1289 O O   . MET A 1 156 ? 52.159 55.821 104.881 1.00 10.07 ? 156  MET A O   1 
ATOM   1290 C CB  . MET A 1 156 ? 50.793 57.831 102.868 1.00 11.61 ? 156  MET A CB  1 
ATOM   1291 C CG  . MET A 1 156 ? 50.478 58.510 101.565 1.00 12.50 ? 156  MET A CG  1 
ATOM   1292 S SD  . MET A 1 156 ? 48.696 58.577 101.304 1.00 14.93 ? 156  MET A SD  1 
ATOM   1293 C CE  . MET A 1 156 ? 48.287 59.842 102.450 1.00 13.50 ? 156  MET A CE  1 
ATOM   1294 N N   . LYS A 1 157 ? 52.733 57.952 105.356 1.00 9.77  ? 157  LYS A N   1 
ATOM   1295 C CA  . LYS A 1 157 ? 52.732 57.735 106.792 1.00 9.55  ? 157  LYS A CA  1 
ATOM   1296 C C   . LYS A 1 157 ? 51.311 58.199 107.135 1.00 9.88  ? 157  LYS A C   1 
ATOM   1297 O O   . LYS A 1 157 ? 50.897 59.295 106.732 1.00 9.50  ? 157  LYS A O   1 
ATOM   1298 C CB  . LYS A 1 157 ? 53.768 58.600 107.513 1.00 9.99  ? 157  LYS A CB  1 
ATOM   1299 C CG  . LYS A 1 157 ? 53.818 58.255 108.994 1.00 12.05 ? 157  LYS A CG  1 
ATOM   1300 C CD  . LYS A 1 157 ? 54.936 58.928 109.768 1.00 13.54 ? 157  LYS A CD  1 
ATOM   1301 C CE  . LYS A 1 157 ? 54.627 60.378 110.045 1.00 15.73 ? 157  LYS A CE  1 
ATOM   1302 N NZ  . LYS A 1 157 ? 55.433 60.843 111.211 1.00 15.16 ? 157  LYS A NZ  1 
ATOM   1303 N N   . VAL A 1 158 ? 50.551 57.366 107.834 1.00 9.59  ? 158  VAL A N   1 
ATOM   1304 C CA  . VAL A 1 158 ? 49.160 57.680 108.158 1.00 10.01 ? 158  VAL A CA  1 
ATOM   1305 C C   . VAL A 1 158 ? 48.949 58.948 108.965 1.00 11.02 ? 158  VAL A C   1 
ATOM   1306 O O   . VAL A 1 158 ? 48.114 59.776 108.614 1.00 11.56 ? 158  VAL A O   1 
ATOM   1307 C CB  . VAL A 1 158 ? 48.454 56.469 108.817 1.00 9.86  ? 158  VAL A CB  1 
ATOM   1308 C CG1 . VAL A 1 158 ? 47.026 56.821 109.216 1.00 11.15 ? 158  VAL A CG1 1 
ATOM   1309 C CG2 . VAL A 1 158 ? 48.449 55.287 107.850 1.00 10.67 ? 158  VAL A CG2 1 
ATOM   1310 N N   . ASP A 1 159 ? 49.682 59.092 110.057 1.00 11.96 ? 159  ASP A N   1 
ATOM   1311 C CA  . ASP A 1 159 ? 49.572 60.276 110.895 1.00 13.51 ? 159  ASP A CA  1 
ATOM   1312 C C   . ASP A 1 159 ? 50.032 61.500 110.102 1.00 13.56 ? 159  ASP A C   1 
ATOM   1313 O O   . ASP A 1 159 ? 51.217 61.656 109.827 1.00 13.93 ? 159  ASP A O   1 
ATOM   1314 C CB  . ASP A 1 159 ? 50.419 60.097 112.150 1.00 14.63 ? 159  ASP A CB  1 
ATOM   1315 C CG  . ASP A 1 159 ? 50.470 61.340 113.002 1.00 16.19 ? 159  ASP A CG  1 
ATOM   1316 O OD1 . ASP A 1 159 ? 51.549 61.604 113.559 1.00 18.01 ? 159  ASP A OD1 1 
ATOM   1317 O OD2 . ASP A 1 159 ? 49.452 62.051 113.106 1.00 16.43 ? 159  ASP A OD2 1 
ATOM   1318 N N   . GLY A 1 160 ? 49.079 62.359 109.744 1.00 13.79 ? 160  GLY A N   1 
ATOM   1319 C CA  . GLY A 1 160 ? 49.388 63.549 108.966 1.00 13.85 ? 160  GLY A CA  1 
ATOM   1320 C C   . GLY A 1 160 ? 49.305 63.341 107.458 1.00 13.98 ? 160  GLY A C   1 
ATOM   1321 O O   . GLY A 1 160 ? 49.553 64.268 106.684 1.00 14.67 ? 160  GLY A O   1 
ATOM   1322 N N   . ALA A 1 161 ? 48.950 62.121 107.047 1.00 13.77 ? 161  ALA A N   1 
ATOM   1323 C CA  . ALA A 1 161 ? 48.844 61.762 105.630 1.00 13.72 ? 161  ALA A CA  1 
ATOM   1324 C C   . ALA A 1 161 ? 50.065 62.266 104.850 1.00 13.64 ? 161  ALA A C   1 
ATOM   1325 O O   . ALA A 1 161 ? 49.944 62.923 103.812 1.00 13.40 ? 161  ALA A O   1 
ATOM   1326 C CB  . ALA A 1 161 ? 47.553 62.317 105.043 1.00 14.13 ? 161  ALA A CB  1 
ATOM   1327 N N   . LYS A 1 162 ? 51.243 61.947 105.371 1.00 13.72 ? 162  LYS A N   1 
ATOM   1328 C CA  . LYS A 1 162 ? 52.507 62.368 104.782 1.00 14.04 ? 162  LYS A CA  1 
ATOM   1329 C C   . LYS A 1 162 ? 52.954 61.482 103.634 1.00 14.11 ? 162  LYS A C   1 
ATOM   1330 O O   . LYS A 1 162 ? 53.021 60.268 103.776 1.00 13.57 ? 162  LYS A O   1 
ATOM   1331 C CB  . LYS A 1 162 ? 53.605 62.389 105.850 1.00 15.77 ? 162  LYS A CB  1 
ATOM   1332 C CG  . LYS A 1 162 ? 53.292 63.243 107.071 1.00 18.09 ? 162  LYS A CG  1 
ATOM   1333 C CD  . LYS A 1 162 ? 52.956 64.672 106.668 1.00 21.01 ? 162  LYS A CD  1 
ATOM   1334 C CE  . LYS A 1 162 ? 54.130 65.365 105.997 1.00 22.73 ? 162  LYS A CE  1 
ATOM   1335 N NZ  . LYS A 1 162 ? 53.785 66.754 105.566 1.00 24.76 ? 162  LYS A NZ  1 
ATOM   1336 N N   . GLU A 1 163 ? 53.284 62.100 102.509 1.00 13.74 ? 163  GLU A N   1 
ATOM   1337 C CA  . GLU A 1 163 ? 53.748 61.369 101.341 1.00 13.93 ? 163  GLU A CA  1 
ATOM   1338 C C   . GLU A 1 163 ? 55.198 60.956 101.551 1.00 13.18 ? 163  GLU A C   1 
ATOM   1339 O O   . GLU A 1 163 ? 56.019 61.751 102.012 1.00 13.26 ? 163  GLU A O   1 
ATOM   1340 C CB  . GLU A 1 163 ? 53.638 62.229 100.081 1.00 15.60 ? 163  GLU A CB  1 
ATOM   1341 C CG  . GLU A 1 163 ? 52.212 62.440 99.605  1.00 19.01 ? 163  GLU A CG  1 
ATOM   1342 C CD  . GLU A 1 163 ? 52.127 63.336 98.380  1.00 21.06 ? 163  GLU A CD  1 
ATOM   1343 O OE1 . GLU A 1 163 ? 51.157 64.119 98.284  1.00 23.62 ? 163  GLU A OE1 1 
ATOM   1344 O OE2 . GLU A 1 163 ? 53.033 63.264 97.522  1.00 22.61 ? 163  GLU A OE2 1 
ATOM   1345 N N   . LEU A 1 164 ? 55.493 59.694 101.264 1.00 11.52 ? 164  LEU A N   1 
ATOM   1346 C CA  . LEU A 1 164 ? 56.852 59.183 101.397 1.00 10.97 ? 164  LEU A CA  1 
ATOM   1347 C C   . LEU A 1 164 ? 57.464 59.076 100.001 1.00 10.71 ? 164  LEU A C   1 
ATOM   1348 O O   . LEU A 1 164 ? 56.747 59.070 99.001  1.00 10.71 ? 164  LEU A O   1 
ATOM   1349 C CB  . LEU A 1 164 ? 56.832 57.828 102.103 1.00 10.52 ? 164  LEU A CB  1 
ATOM   1350 C CG  . LEU A 1 164 ? 56.186 57.857 103.485 1.00 10.03 ? 164  LEU A CG  1 
ATOM   1351 C CD1 . LEU A 1 164 ? 56.126 56.452 104.050 1.00 10.77 ? 164  LEU A CD1 1 
ATOM   1352 C CD2 . LEU A 1 164 ? 56.949 58.789 104.416 1.00 10.99 ? 164  LEU A CD2 1 
ATOM   1353 N N   . PRO A 1 165 ? 58.799 58.983 99.909  1.00 10.62 ? 165  PRO A N   1 
ATOM   1354 C CA  . PRO A 1 165 ? 59.462 58.885 98.600  1.00 10.57 ? 165  PRO A CA  1 
ATOM   1355 C C   . PRO A 1 165 ? 59.344 57.554 97.851  1.00 10.30 ? 165  PRO A C   1 
ATOM   1356 O O   . PRO A 1 165 ? 59.502 57.512 96.627  1.00 10.95 ? 165  PRO A O   1 
ATOM   1357 C CB  . PRO A 1 165 ? 60.929 59.174 98.928  1.00 10.29 ? 165  PRO A CB  1 
ATOM   1358 C CG  . PRO A 1 165 ? 60.880 59.874 100.276 1.00 13.06 ? 165  PRO A CG  1 
ATOM   1359 C CD  . PRO A 1 165 ? 59.787 59.157 100.987 1.00 10.93 ? 165  PRO A CD  1 
ATOM   1360 N N   . ASP A 1 166 ? 59.096 56.474 98.585  1.00 10.75 ? 166  ASP A N   1 
ATOM   1361 C CA  . ASP A 1 166 ? 59.002 55.138 97.996  1.00 10.05 ? 166  ASP A CA  1 
ATOM   1362 C C   . ASP A 1 166 ? 58.019 55.006 96.833  1.00 9.56  ? 166  ASP A C   1 
ATOM   1363 O O   . ASP A 1 166 ? 56.845 55.331 96.972  1.00 9.21  ? 166  ASP A O   1 
ATOM   1364 C CB  . ASP A 1 166 ? 58.635 54.114 99.074  1.00 9.56  ? 166  ASP A CB  1 
ATOM   1365 C CG  . ASP A 1 166 ? 59.529 54.197 100.299 1.00 10.30 ? 166  ASP A CG  1 
ATOM   1366 O OD1 . ASP A 1 166 ? 59.528 55.249 100.970 1.00 10.73 ? 166  ASP A OD1 1 
ATOM   1367 O OD2 . ASP A 1 166 ? 60.235 53.211 100.591 1.00 9.29  ? 166  ASP A OD2 1 
ATOM   1368 N N   . VAL A 1 167 ? 58.508 54.486 95.712  1.00 9.91  ? 167  VAL A N   1 
ATOM   1369 C CA  . VAL A 1 167 ? 57.698 54.277 94.514  1.00 10.44 ? 167  VAL A CA  1 
ATOM   1370 C C   . VAL A 1 167 ? 58.102 52.951 93.868  1.00 10.07 ? 167  VAL A C   1 
ATOM   1371 O O   . VAL A 1 167 ? 59.287 52.705 93.624  1.00 10.40 ? 167  VAL A O   1 
ATOM   1372 C CB  . VAL A 1 167 ? 57.878 55.441 93.496  1.00 10.80 ? 167  VAL A CB  1 
ATOM   1373 C CG1 . VAL A 1 167 ? 57.160 55.125 92.187  1.00 12.85 ? 167  VAL A CG1 1 
ATOM   1374 C CG2 . VAL A 1 167 ? 57.331 56.742 94.070  1.00 12.74 ? 167  VAL A CG2 1 
ATOM   1375 N N   . LEU A 1 168 ? 57.128 52.068 93.666  1.00 9.08  ? 168  LEU A N   1 
ATOM   1376 C CA  . LEU A 1 168 ? 57.378 50.762 93.059  1.00 9.31  ? 168  LEU A CA  1 
ATOM   1377 C C   . LEU A 1 168 ? 56.701 50.689 91.696  1.00 9.26  ? 168  LEU A C   1 
ATOM   1378 O O   . LEU A 1 168 ? 55.491 50.908 91.586  1.00 8.83  ? 168  LEU A O   1 
ATOM   1379 C CB  . LEU A 1 168 ? 56.865 49.639 93.972  1.00 9.23  ? 168  LEU A CB  1 
ATOM   1380 C CG  . LEU A 1 168 ? 57.341 49.704 95.425  1.00 9.04  ? 168  LEU A CG  1 
ATOM   1381 C CD1 . LEU A 1 168 ? 56.674 48.602 96.253  1.00 8.58  ? 168  LEU A CD1 1 
ATOM   1382 C CD2 . LEU A 1 168 ? 58.862 49.568 95.473  1.00 10.26 ? 168  LEU A CD2 1 
ATOM   1383 N N   . GLU A 1 169 ? 57.493 50.380 90.672  1.00 10.13 ? 169  GLU A N   1 
ATOM   1384 C CA  . GLU A 1 169 ? 57.021 50.271 89.292  1.00 10.71 ? 169  GLU A CA  1 
ATOM   1385 C C   . GLU A 1 169 ? 57.010 48.809 88.833  1.00 10.71 ? 169  GLU A C   1 
ATOM   1386 O O   . GLU A 1 169 ? 57.534 47.931 89.518  1.00 10.31 ? 169  GLU A O   1 
ATOM   1387 C CB  . GLU A 1 169 ? 57.937 51.081 88.361  1.00 12.53 ? 169  GLU A CB  1 
ATOM   1388 C CG  . GLU A 1 169 ? 58.073 52.561 88.708  1.00 15.73 ? 169  GLU A CG  1 
ATOM   1389 C CD  . GLU A 1 169 ? 56.816 53.375 88.431  1.00 17.70 ? 169  GLU A CD  1 
ATOM   1390 O OE1 . GLU A 1 169 ? 55.802 52.810 87.967  1.00 18.95 ? 169  GLU A OE1 1 
ATOM   1391 O OE2 . GLU A 1 169 ? 56.845 54.597 88.683  1.00 19.44 ? 169  GLU A OE2 1 
ATOM   1392 N N   . ARG A 1 170 ? 56.409 48.574 87.662  1.00 10.74 ? 170  ARG A N   1 
ATOM   1393 C CA  . ARG A 1 170 ? 56.298 47.254 87.029  1.00 10.99 ? 170  ARG A CA  1 
ATOM   1394 C C   . ARG A 1 170 ? 55.406 46.287 87.793  1.00 10.46 ? 170  ARG A C   1 
ATOM   1395 O O   . ARG A 1 170 ? 55.530 45.064 87.670  1.00 9.58  ? 170  ARG A O   1 
ATOM   1396 C CB  . ARG A 1 170 ? 57.680 46.648 86.810  1.00 13.51 ? 170  ARG A CB  1 
ATOM   1397 C CG  . ARG A 1 170 ? 58.533 47.389 85.793  1.00 16.10 ? 170  ARG A CG  1 
ATOM   1398 C CD  . ARG A 1 170 ? 60.020 47.120 86.026  1.00 19.77 ? 170  ARG A CD  1 
ATOM   1399 N NE  . ARG A 1 170 ? 60.310 45.718 86.338  1.00 22.25 ? 170  ARG A NE  1 
ATOM   1400 C CZ  . ARG A 1 170 ? 60.597 45.256 87.554  1.00 23.15 ? 170  ARG A CZ  1 
ATOM   1401 N NH1 . ARG A 1 170 ? 60.635 46.077 88.592  1.00 24.73 ? 170  ARG A NH1 1 
ATOM   1402 N NH2 . ARG A 1 170 ? 60.828 43.964 87.734  1.00 23.45 ? 170  ARG A NH2 1 
ATOM   1403 N N   . VAL A 1 171 ? 54.485 46.854 88.559  1.00 9.36  ? 171  VAL A N   1 
ATOM   1404 C CA  . VAL A 1 171 ? 53.553 46.086 89.367  1.00 8.74  ? 171  VAL A CA  1 
ATOM   1405 C C   . VAL A 1 171 ? 52.257 45.796 88.605  1.00 8.56  ? 171  VAL A C   1 
ATOM   1406 O O   . VAL A 1 171 ? 51.676 46.687 88.000  1.00 8.87  ? 171  VAL A O   1 
ATOM   1407 C CB  . VAL A 1 171 ? 53.220 46.873 90.649  1.00 8.00  ? 171  VAL A CB  1 
ATOM   1408 C CG1 . VAL A 1 171 ? 52.201 46.132 91.490  1.00 7.70  ? 171  VAL A CG1 1 
ATOM   1409 C CG2 . VAL A 1 171 ? 54.506 47.135 91.445  1.00 8.39  ? 171  VAL A CG2 1 
ATOM   1410 N N   . LYS A 1 172 ? 51.841 44.534 88.612  1.00 8.79  ? 172  LYS A N   1 
ATOM   1411 C CA  . LYS A 1 172 ? 50.587 44.118 87.978  1.00 8.77  ? 172  LYS A CA  1 
ATOM   1412 C C   . LYS A 1 172 ? 50.141 42.802 88.619  1.00 8.22  ? 172  LYS A C   1 
ATOM   1413 O O   . LYS A 1 172 ? 50.972 41.945 88.911  1.00 8.64  ? 172  LYS A O   1 
ATOM   1414 C CB  . LYS A 1 172 ? 50.732 43.956 86.454  1.00 10.78 ? 172  LYS A CB  1 
ATOM   1415 C CG  . LYS A 1 172 ? 49.379 43.950 85.739  1.00 12.89 ? 172  LYS A CG  1 
ATOM   1416 C CD  . LYS A 1 172 ? 49.439 44.508 84.321  1.00 15.26 ? 172  LYS A CD  1 
ATOM   1417 C CE  . LYS A 1 172 ? 49.994 43.522 83.341  1.00 14.59 ? 172  LYS A CE  1 
ATOM   1418 N NZ  . LYS A 1 172 ? 49.255 43.653 82.050  1.00 12.31 ? 172  LYS A NZ  1 
ATOM   1419 N N   . PHE A 1 173 ? 48.830 42.668 88.844  1.00 7.59  ? 173  PHE A N   1 
ATOM   1420 C CA  . PHE A 1 173 ? 48.209 41.481 89.462  1.00 8.10  ? 173  PHE A CA  1 
ATOM   1421 C C   . PHE A 1 173 ? 49.003 41.135 90.713  1.00 8.48  ? 173  PHE A C   1 
ATOM   1422 O O   . PHE A 1 173 ? 49.408 39.994 90.933  1.00 8.69  ? 173  PHE A O   1 
ATOM   1423 C CB  . PHE A 1 173 ? 48.219 40.301 88.486  1.00 8.71  ? 173  PHE A CB  1 
ATOM   1424 C CG  . PHE A 1 173 ? 47.653 40.622 87.132  1.00 10.41 ? 173  PHE A CG  1 
ATOM   1425 C CD1 . PHE A 1 173 ? 48.382 40.343 85.987  1.00 11.55 ? 173  PHE A CD1 1 
ATOM   1426 C CD2 . PHE A 1 173 ? 46.400 41.216 87.004  1.00 11.92 ? 173  PHE A CD2 1 
ATOM   1427 C CE1 . PHE A 1 173 ? 47.876 40.647 84.724  1.00 12.76 ? 173  PHE A CE1 1 
ATOM   1428 C CE2 . PHE A 1 173 ? 45.884 41.526 85.739  1.00 12.18 ? 173  PHE A CE2 1 
ATOM   1429 C CZ  . PHE A 1 173 ? 46.629 41.240 84.605  1.00 12.60 ? 173  PHE A CZ  1 
ATOM   1430 N N   . SER A 1 174 ? 49.184 42.154 91.535  1.00 8.89  ? 174  SER A N   1 
ATOM   1431 C CA  . SER A 1 174 ? 49.988 42.048 92.733  1.00 9.20  ? 174  SER A CA  1 
ATOM   1432 C C   . SER A 1 174 ? 49.225 42.041 94.038  1.00 9.46  ? 174  SER A C   1 
ATOM   1433 O O   . SER A 1 174 ? 48.162 42.659 94.155  1.00 10.30 ? 174  SER A O   1 
ATOM   1434 C CB  . SER A 1 174 ? 50.961 43.237 92.756  1.00 9.08  ? 174  SER A CB  1 
ATOM   1435 O OG  . SER A 1 174 ? 51.774 43.264 93.918  1.00 9.54  ? 174  SER A OG  1 
HETATM 1436 N N   . CSD A 1 175 ? 49.727 41.251 94.977  1.00 10.22 ? 175  CSD A N   1 
HETATM 1437 C CA  . CSD A 1 175 ? 49.183 41.246 96.326  1.00 10.99 ? 175  CSD A CA  1 
HETATM 1438 C CB  . CSD A 1 175 ? 49.306 39.847 96.947  1.00 12.84 ? 175  CSD A CB  1 
HETATM 1439 S SG  . CSD A 1 175 ? 48.087 38.599 96.374  1.00 16.80 ? 175  CSD A SG  1 
HETATM 1440 C C   . CSD A 1 175 ? 50.102 42.270 97.041  1.00 10.80 ? 175  CSD A C   1 
HETATM 1441 O O   . CSD A 1 175 ? 51.121 42.702 96.485  1.00 11.69 ? 175  CSD A O   1 
HETATM 1442 O OD1 . CSD A 1 175 ? 46.743 39.176 96.527  1.00 15.65 ? 175  CSD A OD1 1 
HETATM 1443 O OD2 . CSD A 1 175 ? 48.410 38.219 94.994  1.00 17.35 ? 175  CSD A OD2 1 
ATOM   1444 N N   . MET A 1 176 ? 49.680 42.767 98.194  1.00 9.67  ? 176  MET A N   1 
ATOM   1445 C CA  . MET A 1 176 ? 50.467 43.721 98.982  1.00 9.60  ? 176  MET A CA  1 
ATOM   1446 C C   . MET A 1 176 ? 50.356 43.260 100.422 1.00 9.17  ? 176  MET A C   1 
ATOM   1447 O O   . MET A 1 176 ? 49.259 43.167 100.943 1.00 9.95  ? 176  MET A O   1 
ATOM   1448 C CB  . MET A 1 176 ? 49.915 45.144 98.846  1.00 10.48 ? 176  MET A CB  1 
ATOM   1449 C CG  . MET A 1 176 ? 50.092 45.765 97.475  1.00 10.72 ? 176  MET A CG  1 
ATOM   1450 S SD  . MET A 1 176 ? 49.623 47.508 97.521  1.00 13.14 ? 176  MET A SD  1 
ATOM   1451 C CE  . MET A 1 176 ? 49.116 47.777 95.819  1.00 12.17 ? 176  MET A CE  1 
ATOM   1452 N N   . ALA A 1 177 ? 51.483 42.969 101.061 1.00 8.30  ? 177  ALA A N   1 
ATOM   1453 C CA  . ALA A 1 177 ? 51.444 42.488 102.432 1.00 7.91  ? 177  ALA A CA  1 
ATOM   1454 C C   . ALA A 1 177 ? 52.668 42.914 103.217 1.00 7.01  ? 177  ALA A C   1 
ATOM   1455 O O   . ALA A 1 177 ? 53.798 42.570 102.873 1.00 6.78  ? 177  ALA A O   1 
ATOM   1456 C CB  . ALA A 1 177 ? 51.317 40.983 102.437 1.00 7.45  ? 177  ALA A CB  1 
ATOM   1457 N N   . TRP A 1 178 ? 52.446 43.651 104.296 1.00 7.01  ? 178  TRP A N   1 
ATOM   1458 C CA  . TRP A 1 178 ? 53.537 44.127 105.133 1.00 7.85  ? 178  TRP A CA  1 
ATOM   1459 C C   . TRP A 1 178 ? 53.968 43.090 106.162 1.00 7.51  ? 178  TRP A C   1 
ATOM   1460 O O   . TRP A 1 178 ? 53.128 42.388 106.717 1.00 7.85  ? 178  TRP A O   1 
ATOM   1461 C CB  . TRP A 1 178 ? 53.092 45.352 105.933 1.00 7.62  ? 178  TRP A CB  1 
ATOM   1462 C CG  . TRP A 1 178 ? 52.869 46.601 105.149 1.00 7.18  ? 178  TRP A CG  1 
ATOM   1463 C CD1 . TRP A 1 178 ? 51.779 46.911 104.373 1.00 7.27  ? 178  TRP A CD1 1 
ATOM   1464 C CD2 . TRP A 1 178 ? 53.710 47.760 105.133 1.00 7.14  ? 178  TRP A CD2 1 
ATOM   1465 N NE1 . TRP A 1 178 ? 51.894 48.195 103.894 1.00 8.06  ? 178  TRP A NE1 1 
ATOM   1466 C CE2 . TRP A 1 178 ? 53.066 48.738 104.348 1.00 7.38  ? 178  TRP A CE2 1 
ATOM   1467 C CE3 . TRP A 1 178 ? 54.946 48.068 105.722 1.00 7.69  ? 178  TRP A CE3 1 
ATOM   1468 C CZ2 . TRP A 1 178 ? 53.612 50.006 104.138 1.00 8.39  ? 178  TRP A CZ2 1 
ATOM   1469 C CZ3 . TRP A 1 178 ? 55.485 49.336 105.507 1.00 9.08  ? 178  TRP A CZ3 1 
ATOM   1470 C CH2 . TRP A 1 178 ? 54.818 50.285 104.725 1.00 7.91  ? 178  TRP A CH2 1 
ATOM   1471 N N   . THR A 1 179 ? 55.273 42.969 106.401 1.00 7.82  ? 179  THR A N   1 
ATOM   1472 C CA  . THR A 1 179 ? 55.706 42.075 107.461 1.00 7.55  ? 179  THR A CA  1 
ATOM   1473 C C   . THR A 1 179 ? 55.327 42.811 108.757 1.00 7.55  ? 179  THR A C   1 
ATOM   1474 O O   . THR A 1 179 ? 55.360 44.045 108.818 1.00 7.45  ? 179  THR A O   1 
ATOM   1475 C CB  . THR A 1 179 ? 57.223 41.802 107.417 1.00 7.75  ? 179  THR A CB  1 
ATOM   1476 O OG1 . THR A 1 179 ? 57.939 43.029 107.233 1.00 8.15  ? 179  THR A OG1 1 
ATOM   1477 C CG2 . THR A 1 179 ? 57.552 40.835 106.293 1.00 8.33  ? 179  THR A CG2 1 
ATOM   1478 N N   . HIS A 1 180 ? 54.987 42.065 109.795 1.00 8.02  ? 180  HIS A N   1 
ATOM   1479 C CA  . HIS A 1 180 ? 54.558 42.675 111.038 1.00 8.73  ? 180  HIS A CA  1 
ATOM   1480 C C   . HIS A 1 180 ? 55.620 43.458 111.809 1.00 8.85  ? 180  HIS A C   1 
ATOM   1481 O O   . HIS A 1 180 ? 55.298 44.180 112.751 1.00 9.04  ? 180  HIS A O   1 
ATOM   1482 C CB  . HIS A 1 180 ? 53.845 41.644 111.907 1.00 8.58  ? 180  HIS A CB  1 
ATOM   1483 C CG  . HIS A 1 180 ? 52.540 41.173 111.327 1.00 8.83  ? 180  HIS A CG  1 
ATOM   1484 N ND1 . HIS A 1 180 ? 51.541 40.615 112.094 1.00 9.73  ? 180  HIS A ND1 1 
ATOM   1485 C CD2 . HIS A 1 180 ? 52.079 41.157 110.045 1.00 9.78  ? 180  HIS A CD2 1 
ATOM   1486 C CE1 . HIS A 1 180 ? 50.526 40.271 111.324 1.00 9.60  ? 180  HIS A CE1 1 
ATOM   1487 N NE2 . HIS A 1 180 ? 50.829 40.592 110.077 1.00 9.91  ? 180  HIS A NE2 1 
ATOM   1488 N N   . ASP A 1 181 ? 56.879 43.347 111.405 1.00 8.82  ? 181  ASP A N   1 
ATOM   1489 C CA  . ASP A 1 181 ? 57.917 44.132 112.064 1.00 8.52  ? 181  ASP A CA  1 
ATOM   1490 C C   . ASP A 1 181 ? 57.895 45.573 111.520 1.00 8.70  ? 181  ASP A C   1 
ATOM   1491 O O   . ASP A 1 181 ? 58.644 46.433 111.989 1.00 9.84  ? 181  ASP A O   1 
ATOM   1492 C CB  . ASP A 1 181 ? 59.303 43.496 111.875 1.00 9.29  ? 181  ASP A CB  1 
ATOM   1493 C CG  . ASP A 1 181 ? 59.728 43.401 110.414 1.00 8.89  ? 181  ASP A CG  1 
ATOM   1494 O OD1 . ASP A 1 181 ? 58.971 43.821 109.517 1.00 8.70  ? 181  ASP A OD1 1 
ATOM   1495 O OD2 . ASP A 1 181 ? 60.848 42.924 110.165 1.00 9.82  ? 181  ASP A OD2 1 
ATOM   1496 N N   . GLY A 1 182 ? 57.031 45.826 110.536 1.00 8.29  ? 182  GLY A N   1 
ATOM   1497 C CA  . GLY A 1 182 ? 56.910 47.150 109.950 1.00 8.38  ? 182  GLY A CA  1 
ATOM   1498 C C   . GLY A 1 182 ? 58.082 47.582 109.087 1.00 8.20  ? 182  GLY A C   1 
ATOM   1499 O O   . GLY A 1 182 ? 58.150 48.728 108.654 1.00 8.76  ? 182  GLY A O   1 
ATOM   1500 N N   . LYS A 1 183 ? 58.978 46.652 108.777 1.00 8.46  ? 183  LYS A N   1 
ATOM   1501 C CA  . LYS A 1 183 ? 60.159 46.963 107.972 1.00 8.70  ? 183  LYS A CA  1 
ATOM   1502 C C   . LYS A 1 183 ? 59.909 47.178 106.477 1.00 9.17  ? 183  LYS A C   1 
ATOM   1503 O O   . LYS A 1 183 ? 60.547 48.022 105.844 1.00 9.02  ? 183  LYS A O   1 
ATOM   1504 C CB  . LYS A 1 183 ? 61.214 45.869 108.141 1.00 9.21  ? 183  LYS A CB  1 
ATOM   1505 C CG  . LYS A 1 183 ? 62.532 46.219 107.485 1.00 11.40 ? 183  LYS A CG  1 
ATOM   1506 C CD  . LYS A 1 183 ? 63.631 45.237 107.829 1.00 13.49 ? 183  LYS A CD  1 
ATOM   1507 C CE  . LYS A 1 183 ? 64.943 45.675 107.210 1.00 15.57 ? 183  LYS A CE  1 
ATOM   1508 N NZ  . LYS A 1 183 ? 66.084 44.969 107.842 1.00 17.02 ? 183  LYS A NZ  1 
ATOM   1509 N N   . GLY A 1 184 ? 59.019 46.370 105.912 1.00 8.81  ? 184  GLY A N   1 
ATOM   1510 C CA  . GLY A 1 184 ? 58.757 46.475 104.490 1.00 8.36  ? 184  GLY A CA  1 
ATOM   1511 C C   . GLY A 1 184 ? 57.513 45.736 104.079 1.00 8.30  ? 184  GLY A C   1 
ATOM   1512 O O   . GLY A 1 184 ? 56.779 45.218 104.916 1.00 7.98  ? 184  GLY A O   1 
ATOM   1513 N N   . MET A 1 185 ? 57.366 45.590 102.769 1.00 8.58  ? 185  MET A N   1 
ATOM   1514 C CA  . MET A 1 185 ? 56.178 44.978 102.197 1.00 8.47  ? 185  MET A CA  1 
ATOM   1515 C C   . MET A 1 185 ? 56.448 44.099 100.988 1.00 8.30  ? 185  MET A C   1 
ATOM   1516 O O   . MET A 1 185 ? 57.259 44.439 100.131 1.00 8.24  ? 185  MET A O   1 
ATOM   1517 C CB  . MET A 1 185 ? 55.239 46.114 101.785 1.00 9.09  ? 185  MET A CB  1 
ATOM   1518 C CG  . MET A 1 185 ? 53.851 45.684 101.377 1.00 8.19  ? 185  MET A CG  1 
ATOM   1519 S SD  . MET A 1 185 ? 52.915 47.072 100.700 1.00 7.72  ? 185  MET A SD  1 
ATOM   1520 C CE  . MET A 1 185 ? 53.474 47.009 98.973  1.00 10.35 ? 185  MET A CE  1 
ATOM   1521 N N   . PHE A 1 186 ? 55.759 42.962 100.938 1.00 7.79  ? 186  PHE A N   1 
ATOM   1522 C CA  . PHE A 1 186 ? 55.854 42.038 99.811  1.00 7.31  ? 186  PHE A CA  1 
ATOM   1523 C C   . PHE A 1 186 ? 54.924 42.552 98.710  1.00 7.50  ? 186  PHE A C   1 
ATOM   1524 O O   . PHE A 1 186 ? 53.856 43.094 98.995  1.00 8.02  ? 186  PHE A O   1 
ATOM   1525 C CB  . PHE A 1 186 ? 55.368 40.644 100.213 1.00 6.96  ? 186  PHE A CB  1 
ATOM   1526 C CG  . PHE A 1 186 ? 56.321 39.894 101.090 1.00 8.19  ? 186  PHE A CG  1 
ATOM   1527 C CD1 . PHE A 1 186 ? 56.056 39.724 102.443 1.00 7.96  ? 186  PHE A CD1 1 
ATOM   1528 C CD2 . PHE A 1 186 ? 57.474 39.330 100.552 1.00 7.63  ? 186  PHE A CD2 1 
ATOM   1529 C CE1 . PHE A 1 186 ? 56.929 38.996 103.252 1.00 8.44  ? 186  PHE A CE1 1 
ATOM   1530 C CE2 . PHE A 1 186 ? 58.352 38.601 101.354 1.00 8.09  ? 186  PHE A CE2 1 
ATOM   1531 C CZ  . PHE A 1 186 ? 58.078 38.435 102.703 1.00 9.17  ? 186  PHE A CZ  1 
ATOM   1532 N N   . TYR A 1 187 ? 55.317 42.340 97.460  1.00 7.43  ? 187  TYR A N   1 
ATOM   1533 C CA  . TYR A 1 187 ? 54.523 42.739 96.303  1.00 7.04  ? 187  TYR A CA  1 
ATOM   1534 C C   . TYR A 1 187 ? 55.049 41.950 95.102  1.00 7.22  ? 187  TYR A C   1 
ATOM   1535 O O   . TYR A 1 187 ? 56.092 41.300 95.192  1.00 7.68  ? 187  TYR A O   1 
ATOM   1536 C CB  . TYR A 1 187 ? 54.618 44.257 96.041  1.00 8.43  ? 187  TYR A CB  1 
ATOM   1537 C CG  . TYR A 1 187 ? 55.958 44.700 95.492  1.00 8.02  ? 187  TYR A CG  1 
ATOM   1538 C CD1 . TYR A 1 187 ? 56.126 44.928 94.129  1.00 8.04  ? 187  TYR A CD1 1 
ATOM   1539 C CD2 . TYR A 1 187 ? 57.072 44.826 96.328  1.00 8.81  ? 187  TYR A CD2 1 
ATOM   1540 C CE1 . TYR A 1 187 ? 57.377 45.261 93.602  1.00 9.07  ? 187  TYR A CE1 1 
ATOM   1541 C CE2 . TYR A 1 187 ? 58.321 45.159 95.817  1.00 9.12  ? 187  TYR A CE2 1 
ATOM   1542 C CZ  . TYR A 1 187 ? 58.465 45.373 94.450  1.00 9.43  ? 187  TYR A CZ  1 
ATOM   1543 O OH  . TYR A 1 187 ? 59.698 45.691 93.922  1.00 8.77  ? 187  TYR A OH  1 
ATOM   1544 N N   . ASN A 1 188 ? 54.333 42.016 93.988  1.00 7.04  ? 188  ASN A N   1 
ATOM   1545 C CA  . ASN A 1 188 ? 54.719 41.314 92.763  1.00 7.02  ? 188  ASN A CA  1 
ATOM   1546 C C   . ASN A 1 188 ? 55.064 42.294 91.668  1.00 8.04  ? 188  ASN A C   1 
ATOM   1547 O O   . ASN A 1 188 ? 54.451 43.354 91.552  1.00 8.95  ? 188  ASN A O   1 
ATOM   1548 C CB  . ASN A 1 188 ? 53.574 40.440 92.244  1.00 7.51  ? 188  ASN A CB  1 
ATOM   1549 C CG  . ASN A 1 188 ? 53.208 39.341 93.190  1.00 6.81  ? 188  ASN A CG  1 
ATOM   1550 O OD1 . ASN A 1 188 ? 52.145 39.375 93.812  1.00 8.16  ? 188  ASN A OD1 1 
ATOM   1551 N ND2 . ASN A 1 188 ? 54.064 38.337 93.283  1.00 7.38  ? 188  ASN A ND2 1 
ATOM   1552 N N   . ALA A 1 189 ? 56.008 41.894 90.827  1.00 8.87  ? 189  ALA A N   1 
ATOM   1553 C CA  . ALA A 1 189 ? 56.409 42.724 89.704  1.00 9.12  ? 189  ALA A CA  1 
ATOM   1554 C C   . ALA A 1 189 ? 56.871 41.846 88.556  1.00 9.73  ? 189  ALA A C   1 
ATOM   1555 O O   . ALA A 1 189 ? 57.270 40.695 88.764  1.00 9.63  ? 189  ALA A O   1 
ATOM   1556 C CB  . ALA A 1 189 ? 57.509 43.703 90.106  1.00 10.15 ? 189  ALA A CB  1 
ATOM   1557 N N   . TYR A 1 190 ? 56.708 42.377 87.349  1.00 10.57 ? 190  TYR A N   1 
ATOM   1558 C CA  . TYR A 1 190 ? 57.110 41.706 86.122  1.00 11.49 ? 190  TYR A CA  1 
ATOM   1559 C C   . TYR A 1 190 ? 58.442 42.276 85.665  1.00 13.51 ? 190  TYR A C   1 
ATOM   1560 O O   . TYR A 1 190 ? 58.756 43.428 85.945  1.00 14.37 ? 190  TYR A O   1 
ATOM   1561 C CB  . TYR A 1 190 ? 56.058 41.924 85.033  1.00 10.83 ? 190  TYR A CB  1 
ATOM   1562 C CG  . TYR A 1 190 ? 54.843 41.046 85.190  1.00 9.77  ? 190  TYR A CG  1 
ATOM   1563 C CD1 . TYR A 1 190 ? 53.701 41.502 85.854  1.00 10.55 ? 190  TYR A CD1 1 
ATOM   1564 C CD2 . TYR A 1 190 ? 54.842 39.751 84.686  1.00 9.65  ? 190  TYR A CD2 1 
ATOM   1565 C CE1 . TYR A 1 190 ? 52.587 40.679 86.011  1.00 9.57  ? 190  TYR A CE1 1 
ATOM   1566 C CE2 . TYR A 1 190 ? 53.737 38.922 84.837  1.00 9.67  ? 190  TYR A CE2 1 
ATOM   1567 C CZ  . TYR A 1 190 ? 52.609 39.396 85.503  1.00 9.35  ? 190  TYR A CZ  1 
ATOM   1568 O OH  . TYR A 1 190 ? 51.506 38.598 85.667  1.00 10.91 ? 190  TYR A OH  1 
ATOM   1569 N N   . PRO A 1 191 ? 59.252 41.470 84.961  1.00 15.00 ? 191  PRO A N   1 
ATOM   1570 C CA  . PRO A 1 191 ? 60.550 41.955 84.487  1.00 16.57 ? 191  PRO A CA  1 
ATOM   1571 C C   . PRO A 1 191 ? 60.403 43.017 83.397  1.00 17.85 ? 191  PRO A C   1 
ATOM   1572 O O   . PRO A 1 191 ? 59.331 43.182 82.811  1.00 16.95 ? 191  PRO A O   1 
ATOM   1573 C CB  . PRO A 1 191 ? 61.213 40.681 83.952  1.00 16.85 ? 191  PRO A CB  1 
ATOM   1574 C CG  . PRO A 1 191 ? 60.056 39.853 83.496  1.00 17.31 ? 191  PRO A CG  1 
ATOM   1575 C CD  . PRO A 1 191 ? 59.046 40.056 84.602  1.00 15.82 ? 191  PRO A CD  1 
ATOM   1576 N N   . GLN A 1 192 ? 61.484 43.749 83.149  1.00 19.34 ? 192  GLN A N   1 
ATOM   1577 C CA  . GLN A 1 192 ? 61.516 44.788 82.126  1.00 21.24 ? 192  GLN A CA  1 
ATOM   1578 C C   . GLN A 1 192 ? 61.150 44.175 80.782  1.00 21.85 ? 192  GLN A C   1 
ATOM   1579 O O   . GLN A 1 192 ? 61.497 43.031 80.507  1.00 21.65 ? 192  GLN A O   1 
ATOM   1580 C CB  . GLN A 1 192 ? 62.924 45.376 82.018  1.00 22.46 ? 192  GLN A CB  1 
ATOM   1581 C CG  . GLN A 1 192 ? 62.973 46.888 82.076  1.00 23.96 ? 192  GLN A CG  1 
ATOM   1582 C CD  . GLN A 1 192 ? 62.634 47.425 83.452  1.00 24.79 ? 192  GLN A CD  1 
ATOM   1583 O OE1 . GLN A 1 192 ? 62.033 48.488 83.584  1.00 25.64 ? 192  GLN A OE1 1 
ATOM   1584 N NE2 . GLN A 1 192 ? 63.028 46.692 84.489  1.00 25.47 ? 192  GLN A NE2 1 
ATOM   1585 N N   . GLN A 1 193 ? 60.433 44.925 79.954  1.00 22.36 ? 193  GLN A N   1 
ATOM   1586 C CA  . GLN A 1 193 ? 60.060 44.429 78.635  1.00 22.98 ? 193  GLN A CA  1 
ATOM   1587 C C   . GLN A 1 193 ? 60.188 45.518 77.584  1.00 23.77 ? 193  GLN A C   1 
ATOM   1588 O O   . GLN A 1 193 ? 60.113 46.704 77.899  1.00 24.04 ? 193  GLN A O   1 
ATOM   1589 C CB  . GLN A 1 193 ? 58.636 43.864 78.631  1.00 22.10 ? 193  GLN A CB  1 
ATOM   1590 C CG  . GLN A 1 193 ? 57.515 44.872 78.851  1.00 20.72 ? 193  GLN A CG  1 
ATOM   1591 C CD  . GLN A 1 193 ? 56.141 44.241 78.682  1.00 20.10 ? 193  GLN A CD  1 
ATOM   1592 O OE1 . GLN A 1 193 ? 56.024 43.038 78.439  1.00 19.58 ? 193  GLN A OE1 1 
ATOM   1593 N NE2 . GLN A 1 193 ? 55.099 45.046 78.800  1.00 19.03 ? 193  GLN A NE2 1 
ATOM   1594 N N   . ASP A 1 194 ? 60.437 45.102 76.346  1.00 24.93 ? 194  ASP A N   1 
ATOM   1595 C CA  . ASP A 1 194 ? 60.562 46.034 75.234  1.00 25.61 ? 194  ASP A CA  1 
ATOM   1596 C C   . ASP A 1 194 ? 59.187 46.618 74.940  1.00 25.07 ? 194  ASP A C   1 
ATOM   1597 O O   . ASP A 1 194 ? 58.165 45.969 75.166  1.00 24.58 ? 194  ASP A O   1 
ATOM   1598 C CB  . ASP A 1 194 ? 61.090 45.321 73.981  1.00 27.83 ? 194  ASP A CB  1 
ATOM   1599 C CG  . ASP A 1 194 ? 62.494 44.767 74.158  1.00 29.42 ? 194  ASP A CG  1 
ATOM   1600 O OD1 . ASP A 1 194 ? 63.251 45.294 74.998  1.00 30.51 ? 194  ASP A OD1 1 
ATOM   1601 O OD2 . ASP A 1 194 ? 62.834 43.798 73.441  1.00 30.82 ? 194  ASP A OD2 1 
ATOM   1602 N N   . GLY A 1 195 ? 59.174 47.828 74.397  1.00 23.73 ? 195  GLY A N   1 
ATOM   1603 C CA  . GLY A 1 195 ? 57.919 48.475 74.079  1.00 21.76 ? 195  GLY A CA  1 
ATOM   1604 C C   . GLY A 1 195 ? 57.313 49.175 75.275  1.00 19.99 ? 195  GLY A C   1 
ATOM   1605 O O   . GLY A 1 195 ? 57.987 49.418 76.272  1.00 20.11 ? 195  GLY A O   1 
ATOM   1606 N N   . LYS A 1 196 ? 56.034 49.507 75.158  1.00 18.64 ? 196  LYS A N   1 
ATOM   1607 C CA  . LYS A 1 196 ? 55.307 50.201 76.212  1.00 17.11 ? 196  LYS A CA  1 
ATOM   1608 C C   . LYS A 1 196 ? 54.736 49.283 77.290  1.00 15.48 ? 196  LYS A C   1 
ATOM   1609 O O   . LYS A 1 196 ? 54.528 48.092 77.073  1.00 15.49 ? 196  LYS A O   1 
ATOM   1610 C CB  . LYS A 1 196 ? 54.166 51.016 75.597  1.00 17.55 ? 196  LYS A CB  1 
ATOM   1611 C CG  . LYS A 1 196 ? 54.622 52.099 74.634  1.00 18.81 ? 196  LYS A CG  1 
ATOM   1612 C CD  . LYS A 1 196 ? 53.443 52.869 74.070  1.00 19.81 ? 196  LYS A CD  1 
ATOM   1613 C CE  . LYS A 1 196 ? 52.648 52.029 73.085  1.00 19.74 ? 196  LYS A CE  1 
ATOM   1614 N NZ  . LYS A 1 196 ? 51.464 52.785 72.598  1.00 20.40 ? 196  LYS A NZ  1 
ATOM   1615 N N   . SER A 1 197 ? 54.472 49.874 78.447  1.00 14.69 ? 197  SER A N   1 
ATOM   1616 C CA  . SER A 1 197 ? 53.873 49.191 79.582  1.00 13.17 ? 197  SER A CA  1 
ATOM   1617 C C   . SER A 1 197 ? 52.917 50.210 80.184  1.00 12.47 ? 197  SER A C   1 
ATOM   1618 O O   . SER A 1 197 ? 53.039 50.583 81.342  1.00 13.12 ? 197  SER A O   1 
ATOM   1619 C CB  . SER A 1 197 ? 54.934 48.781 80.599  1.00 12.41 ? 197  SER A CB  1 
ATOM   1620 O OG  . SER A 1 197 ? 55.741 47.743 80.079  1.00 12.02 ? 197  SER A OG  1 
ATOM   1621 N N   . ASP A 1 198 ? 51.980 50.676 79.366  1.00 11.54 ? 198  ASP A N   1 
ATOM   1622 C CA  . ASP A 1 198 ? 51.013 51.677 79.809  1.00 10.47 ? 198  ASP A CA  1 
ATOM   1623 C C   . ASP A 1 198 ? 49.563 51.240 79.633  1.00 9.67  ? 198  ASP A C   1 
ATOM   1624 O O   . ASP A 1 198 ? 48.644 52.012 79.907  1.00 9.59  ? 198  ASP A O   1 
ATOM   1625 C CB  . ASP A 1 198 ? 51.238 53.013 79.072  1.00 10.86 ? 198  ASP A CB  1 
ATOM   1626 C CG  . ASP A 1 198 ? 50.990 52.928 77.563  1.00 11.76 ? 198  ASP A CG  1 
ATOM   1627 O OD1 . ASP A 1 198 ? 50.777 51.829 77.021  1.00 11.02 ? 198  ASP A OD1 1 
ATOM   1628 O OD2 . ASP A 1 198 ? 51.024 53.984 76.905  1.00 13.67 ? 198  ASP A OD2 1 
ATOM   1629 N N   . GLY A 1 199 ? 49.363 50.031 79.118  1.00 8.93  ? 199  GLY A N   1 
ATOM   1630 C CA  . GLY A 1 199 ? 48.014 49.539 78.911  1.00 8.92  ? 199  GLY A CA  1 
ATOM   1631 C C   . GLY A 1 199 ? 47.588 49.489 77.452  1.00 9.22  ? 199  GLY A C   1 
ATOM   1632 O O   . GLY A 1 199 ? 46.527 48.955 77.156  1.00 9.22  ? 199  GLY A O   1 
ATOM   1633 N N   . THR A 1 200 ? 48.376 50.085 76.557  1.00 8.67  ? 200  THR A N   1 
ATOM   1634 C CA  . THR A 1 200 ? 48.048 50.078 75.127  1.00 8.83  ? 200  THR A CA  1 
ATOM   1635 C C   . THR A 1 200 ? 48.779 48.951 74.394  1.00 8.93  ? 200  THR A C   1 
ATOM   1636 O O   . THR A 1 200 ? 48.481 48.664 73.242  1.00 9.59  ? 200  THR A O   1 
ATOM   1637 C CB  . THR A 1 200 ? 48.403 51.424 74.435  1.00 8.98  ? 200  THR A CB  1 
ATOM   1638 O OG1 . THR A 1 200 ? 49.818 51.649 74.501  1.00 9.45  ? 200  THR A OG1 1 
ATOM   1639 C CG2 . THR A 1 200 ? 47.679 52.599 75.096  1.00 10.19 ? 200  THR A CG2 1 
ATOM   1640 N N   . GLU A 1 201 ? 49.761 48.344 75.056  1.00 8.94  ? 201  GLU A N   1 
ATOM   1641 C CA  . GLU A 1 201 ? 50.514 47.245 74.454  1.00 9.33  ? 201  GLU A CA  1 
ATOM   1642 C C   . GLU A 1 201 ? 49.751 45.928 74.587  1.00 9.38  ? 201  GLU A C   1 
ATOM   1643 O O   . GLU A 1 201 ? 48.814 45.821 75.377  1.00 10.00 ? 201  GLU A O   1 
ATOM   1644 C CB  . GLU A 1 201 ? 51.907 47.118 75.090  1.00 9.43  ? 201  GLU A CB  1 
ATOM   1645 C CG  . GLU A 1 201 ? 51.965 46.356 76.412  1.00 9.75  ? 201  GLU A CG  1 
ATOM   1646 C CD  . GLU A 1 201 ? 51.452 47.126 77.626  1.00 9.06  ? 201  GLU A CD  1 
ATOM   1647 O OE1 . GLU A 1 201 ? 51.442 46.511 78.706  1.00 9.39  ? 201  GLU A OE1 1 
ATOM   1648 O OE2 . GLU A 1 201 ? 51.082 48.320 77.537  1.00 9.92  ? 201  GLU A OE2 1 
ATOM   1649 N N   . THR A 1 202 ? 50.154 44.928 73.812  1.00 8.84  ? 202  THR A N   1 
ATOM   1650 C CA  . THR A 1 202 ? 49.497 43.622 73.859  1.00 8.87  ? 202  THR A CA  1 
ATOM   1651 C C   . THR A 1 202 ? 50.433 42.534 74.402  1.00 8.60  ? 202  THR A C   1 
ATOM   1652 O O   . THR A 1 202 ? 50.040 41.377 74.507  1.00 8.20  ? 202  THR A O   1 
ATOM   1653 C CB  . THR A 1 202 ? 49.052 43.183 72.460  1.00 9.25  ? 202  THR A CB  1 
ATOM   1654 O OG1 . THR A 1 202 ? 50.212 43.051 71.632  1.00 10.78 ? 202  THR A OG1 1 
ATOM   1655 C CG2 . THR A 1 202 ? 48.111 44.202 71.832  1.00 9.19  ? 202  THR A CG2 1 
ATOM   1656 N N   . SER A 1 203 ? 51.665 42.921 74.725  1.00 9.21  ? 203  SER A N   1 
ATOM   1657 C CA  . SER A 1 203 ? 52.694 42.014 75.219  1.00 10.64 ? 203  SER A CA  1 
ATOM   1658 C C   . SER A 1 203 ? 52.241 41.077 76.330  1.00 9.85  ? 203  SER A C   1 
ATOM   1659 O O   . SER A 1 203 ? 51.695 41.516 77.342  1.00 9.78  ? 203  SER A O   1 
ATOM   1660 C CB  . SER A 1 203 ? 53.904 42.823 75.675  1.00 10.47 ? 203  SER A CB  1 
ATOM   1661 O OG  . SER A 1 203 ? 54.269 43.757 74.671  1.00 12.94 ? 203  SER A OG  1 
ATOM   1662 N N   . THR A 1 204 ? 52.502 39.789 76.134  1.00 10.19 ? 204  THR A N   1 
ATOM   1663 C CA  . THR A 1 204 ? 52.139 38.765 77.105  1.00 9.77  ? 204  THR A CA  1 
ATOM   1664 C C   . THR A 1 204 ? 52.924 38.976 78.398  1.00 10.00 ? 204  THR A C   1 
ATOM   1665 O O   . THR A 1 204 ? 54.083 39.373 78.367  1.00 10.26 ? 204  THR A O   1 
ATOM   1666 C CB  . THR A 1 204 ? 52.365 37.350 76.542  1.00 9.86  ? 204  THR A CB  1 
ATOM   1667 O OG1 . THR A 1 204 ? 51.826 36.399 77.466  1.00 10.76 ? 204  THR A OG1 1 
ATOM   1668 C CG2 . THR A 1 204 ? 53.851 37.064 76.295  1.00 9.81  ? 204  THR A CG2 1 
ATOM   1669 N N   . ASN A 1 205 ? 52.261 38.769 79.530  1.00 9.37  ? 205  ASN A N   1 
ATOM   1670 C CA  . ASN A 1 205 ? 52.873 38.970 80.841  1.00 9.24  ? 205  ASN A CA  1 
ATOM   1671 C C   . ASN A 1 205 ? 53.279 37.642 81.437  1.00 8.65  ? 205  ASN A C   1 
ATOM   1672 O O   . ASN A 1 205 ? 52.430 36.822 81.777  1.00 8.30  ? 205  ASN A O   1 
ATOM   1673 C CB  . ASN A 1 205 ? 51.890 39.679 81.775  1.00 9.75  ? 205  ASN A CB  1 
ATOM   1674 C CG  . ASN A 1 205 ? 51.407 40.995 81.212  1.00 9.98  ? 205  ASN A CG  1 
ATOM   1675 O OD1 . ASN A 1 205 ? 50.212 41.188 81.003  1.00 11.11 ? 205  ASN A OD1 1 
ATOM   1676 N ND2 . ASN A 1 205 ? 52.334 41.904 80.944  1.00 10.48 ? 205  ASN A ND2 1 
ATOM   1677 N N   . LEU A 1 206 ? 54.586 37.448 81.555  1.00 7.88  ? 206  LEU A N   1 
ATOM   1678 C CA  . LEU A 1 206 ? 55.158 36.223 82.078  1.00 8.10  ? 206  LEU A CA  1 
ATOM   1679 C C   . LEU A 1 206 ? 56.258 36.512 83.090  1.00 7.95  ? 206  LEU A C   1 
ATOM   1680 O O   . LEU A 1 206 ? 56.759 37.631 83.176  1.00 7.87  ? 206  LEU A O   1 
ATOM   1681 C CB  . LEU A 1 206 ? 55.735 35.391 80.925  1.00 9.09  ? 206  LEU A CB  1 
ATOM   1682 C CG  . LEU A 1 206 ? 54.765 34.899 79.848  1.00 10.90 ? 206  LEU A CG  1 
ATOM   1683 C CD1 . LEU A 1 206 ? 55.544 34.252 78.715  1.00 11.72 ? 206  LEU A CD1 1 
ATOM   1684 C CD2 . LEU A 1 206 ? 53.771 33.906 80.441  1.00 11.81 ? 206  LEU A CD2 1 
ATOM   1685 N N   . HIS A 1 207 ? 56.643 35.480 83.836  1.00 8.31  ? 207  HIS A N   1 
ATOM   1686 C CA  . HIS A 1 207 ? 57.704 35.574 84.831  1.00 8.48  ? 207  HIS A CA  1 
ATOM   1687 C C   . HIS A 1 207 ? 57.456 36.558 85.969  1.00 8.39  ? 207  HIS A C   1 
ATOM   1688 O O   . HIS A 1 207 ? 58.358 37.285 86.392  1.00 8.47  ? 207  HIS A O   1 
ATOM   1689 C CB  . HIS A 1 207 ? 59.056 35.837 84.158  1.00 10.70 ? 207  HIS A CB  1 
ATOM   1690 C CG  . HIS A 1 207 ? 59.527 34.701 83.306  1.00 12.93 ? 207  HIS A CG  1 
ATOM   1691 N ND1 . HIS A 1 207 ? 60.016 33.525 83.834  1.00 14.56 ? 207  HIS A ND1 1 
ATOM   1692 C CD2 . HIS A 1 207 ? 59.560 34.551 81.957  1.00 13.90 ? 207  HIS A CD2 1 
ATOM   1693 C CE1 . HIS A 1 207 ? 60.328 32.701 82.852  1.00 14.81 ? 207  HIS A CE1 1 
ATOM   1694 N NE2 . HIS A 1 207 ? 60.058 33.304 81.705  1.00 14.96 ? 207  HIS A NE2 1 
ATOM   1695 N N   . GLN A 1 208 ? 56.225 36.594 86.462  1.00 8.02  ? 208  GLN A N   1 
ATOM   1696 C CA  . GLN A 1 208 ? 55.925 37.465 87.579  1.00 7.97  ? 208  GLN A CA  1 
ATOM   1697 C C   . GLN A 1 208 ? 56.718 36.943 88.776  1.00 8.42  ? 208  GLN A C   1 
ATOM   1698 O O   . GLN A 1 208 ? 56.807 35.727 88.994  1.00 8.16  ? 208  GLN A O   1 
ATOM   1699 C CB  . GLN A 1 208 ? 54.434 37.441 87.894  1.00 7.35  ? 208  GLN A CB  1 
ATOM   1700 C CG  . GLN A 1 208 ? 54.024 38.572 88.817  1.00 7.52  ? 208  GLN A CG  1 
ATOM   1701 C CD  . GLN A 1 208 ? 52.741 38.292 89.569  1.00 7.12  ? 208  GLN A CD  1 
ATOM   1702 O OE1 . GLN A 1 208 ? 52.623 37.279 90.245  1.00 8.53  ? 208  GLN A OE1 1 
ATOM   1703 N NE2 . GLN A 1 208 ? 51.801 39.222 89.505  1.00 8.30  ? 208  GLN A NE2 1 
ATOM   1704 N N   . LYS A 1 209 ? 57.307 37.859 89.538  1.00 8.62  ? 209  LYS A N   1 
ATOM   1705 C CA  . LYS A 1 209 ? 58.089 37.465 90.694  1.00 9.37  ? 209  LYS A CA  1 
ATOM   1706 C C   . LYS A 1 209 ? 57.602 38.136 91.962  1.00 8.36  ? 209  LYS A C   1 
ATOM   1707 O O   . LYS A 1 209 ? 56.814 39.082 91.918  1.00 8.84  ? 209  LYS A O   1 
ATOM   1708 C CB  . LYS A 1 209 ? 59.570 37.771 90.461  1.00 10.95 ? 209  LYS A CB  1 
ATOM   1709 C CG  . LYS A 1 209 ? 60.146 37.070 89.248  1.00 12.05 ? 209  LYS A CG  1 
ATOM   1710 C CD  . LYS A 1 209 ? 61.611 37.380 89.065  1.00 13.50 ? 209  LYS A CD  1 
ATOM   1711 C CE  . LYS A 1 209 ? 62.107 36.957 87.697  1.00 14.52 ? 209  LYS A CE  1 
ATOM   1712 N NZ  . LYS A 1 209 ? 61.387 37.693 86.642  1.00 15.88 ? 209  LYS A NZ  1 
ATOM   1713 N N   . LEU A 1 210 ? 58.056 37.608 93.089  1.00 8.32  ? 210  LEU A N   1 
ATOM   1714 C CA  . LEU A 1 210 ? 57.709 38.131 94.407  1.00 7.68  ? 210  LEU A CA  1 
ATOM   1715 C C   . LEU A 1 210 ? 58.909 38.869 94.973  1.00 8.42  ? 210  LEU A C   1 
ATOM   1716 O O   . LEU A 1 210 ? 59.993 38.289 95.125  1.00 8.57  ? 210  LEU A O   1 
ATOM   1717 C CB  . LEU A 1 210 ? 57.347 36.991 95.366  1.00 8.59  ? 210  LEU A CB  1 
ATOM   1718 C CG  . LEU A 1 210 ? 57.054 37.418 96.809  1.00 9.15  ? 210  LEU A CG  1 
ATOM   1719 C CD1 . LEU A 1 210 ? 55.706 38.113 96.870  1.00 9.61  ? 210  LEU A CD1 1 
ATOM   1720 C CD2 . LEU A 1 210 ? 57.074 36.222 97.735  1.00 9.28  ? 210  LEU A CD2 1 
ATOM   1721 N N   . TYR A 1 211 ? 58.694 40.133 95.310  1.00 8.22  ? 211  TYR A N   1 
ATOM   1722 C CA  . TYR A 1 211 ? 59.728 40.985 95.882  1.00 8.61  ? 211  TYR A CA  1 
ATOM   1723 C C   . TYR A 1 211 ? 59.346 41.501 97.263  1.00 8.35  ? 211  TYR A C   1 
ATOM   1724 O O   . TYR A 1 211 ? 58.169 41.512 97.640  1.00 8.48  ? 211  TYR A O   1 
ATOM   1725 C CB  . TYR A 1 211 ? 59.979 42.190 94.981  1.00 9.97  ? 211  TYR A CB  1 
ATOM   1726 C CG  . TYR A 1 211 ? 60.640 41.857 93.675  1.00 10.65 ? 211  TYR A CG  1 
ATOM   1727 C CD1 . TYR A 1 211 ? 59.886 41.687 92.514  1.00 11.43 ? 211  TYR A CD1 1 
ATOM   1728 C CD2 . TYR A 1 211 ? 62.023 41.699 93.595  1.00 11.61 ? 211  TYR A CD2 1 
ATOM   1729 C CE1 . TYR A 1 211 ? 60.487 41.367 91.309  1.00 12.69 ? 211  TYR A CE1 1 
ATOM   1730 C CE2 . TYR A 1 211 ? 62.639 41.376 92.386  1.00 11.71 ? 211  TYR A CE2 1 
ATOM   1731 C CZ  . TYR A 1 211 ? 61.846 41.212 91.250  1.00 11.96 ? 211  TYR A CZ  1 
ATOM   1732 O OH  . TYR A 1 211 ? 62.382 40.877 90.037  1.00 14.46 ? 211  TYR A OH  1 
ATOM   1733 N N   . TYR A 1 212 ? 60.360 41.953 97.993  1.00 7.99  ? 212  TYR A N   1 
ATOM   1734 C CA  . TYR A 1 212 ? 60.183 42.526 99.318  1.00 8.20  ? 212  TYR A CA  1 
ATOM   1735 C C   . TYR A 1 212 ? 60.819 43.911 99.301  1.00 8.41  ? 212  TYR A C   1 
ATOM   1736 O O   . TYR A 1 212 ? 62.014 44.051 99.028  1.00 9.49  ? 212  TYR A O   1 
ATOM   1737 C CB  . TYR A 1 212 ? 60.872 41.664 100.379 1.00 7.99  ? 212  TYR A CB  1 
ATOM   1738 C CG  . TYR A 1 212 ? 60.663 42.173 101.790 1.00 7.74  ? 212  TYR A CG  1 
ATOM   1739 C CD1 . TYR A 1 212 ? 59.399 42.139 102.375 1.00 8.30  ? 212  TYR A CD1 1 
ATOM   1740 C CD2 . TYR A 1 212 ? 61.726 42.691 102.538 1.00 8.36  ? 212  TYR A CD2 1 
ATOM   1741 C CE1 . TYR A 1 212 ? 59.196 42.604 103.672 1.00 8.93  ? 212  TYR A CE1 1 
ATOM   1742 C CE2 . TYR A 1 212 ? 61.532 43.159 103.833 1.00 8.80  ? 212  TYR A CE2 1 
ATOM   1743 C CZ  . TYR A 1 212 ? 60.266 43.108 104.394 1.00 8.98  ? 212  TYR A CZ  1 
ATOM   1744 O OH  . TYR A 1 212 ? 60.072 43.518 105.695 1.00 9.49  ? 212  TYR A OH  1 
ATOM   1745 N N   . HIS A 1 213 ? 60.006 44.940 99.514  1.00 7.96  ? 213  HIS A N   1 
ATOM   1746 C CA  . HIS A 1 213 ? 60.515 46.308 99.548  1.00 8.29  ? 213  HIS A CA  1 
ATOM   1747 C C   . HIS A 1 213 ? 60.694 46.798 100.976 1.00 8.24  ? 213  HIS A C   1 
ATOM   1748 O O   . HIS A 1 213 ? 59.743 46.826 101.747 1.00 8.79  ? 213  HIS A O   1 
ATOM   1749 C CB  . HIS A 1 213 ? 59.556 47.264 98.840  1.00 8.21  ? 213  HIS A CB  1 
ATOM   1750 C CG  . HIS A 1 213 ? 59.986 48.697 98.913  1.00 8.82  ? 213  HIS A CG  1 
ATOM   1751 N ND1 . HIS A 1 213 ? 61.137 49.154 98.306  1.00 8.78  ? 213  HIS A ND1 1 
ATOM   1752 C CD2 . HIS A 1 213 ? 59.436 49.761 99.541  1.00 8.25  ? 213  HIS A CD2 1 
ATOM   1753 C CE1 . HIS A 1 213 ? 61.279 50.439 98.556  1.00 8.97  ? 213  HIS A CE1 1 
ATOM   1754 N NE2 . HIS A 1 213 ? 60.264 50.831 99.301  1.00 8.67  ? 213  HIS A NE2 1 
ATOM   1755 N N   . VAL A 1 214 ? 61.913 47.213 101.297 1.00 9.09  ? 214  VAL A N   1 
ATOM   1756 C CA  . VAL A 1 214 ? 62.222 47.774 102.606 1.00 9.75  ? 214  VAL A CA  1 
ATOM   1757 C C   . VAL A 1 214 ? 61.864 49.263 102.538 1.00 9.33  ? 214  VAL A C   1 
ATOM   1758 O O   . VAL A 1 214 ? 62.353 49.989 101.662 1.00 9.19  ? 214  VAL A O   1 
ATOM   1759 C CB  . VAL A 1 214 ? 63.722 47.597 102.938 1.00 9.90  ? 214  VAL A CB  1 
ATOM   1760 C CG1 . VAL A 1 214 ? 64.101 48.383 104.190 1.00 9.69  ? 214  VAL A CG1 1 
ATOM   1761 C CG2 . VAL A 1 214 ? 64.037 46.126 103.134 1.00 9.80  ? 214  VAL A CG2 1 
ATOM   1762 N N   . LEU A 1 215 ? 60.955 49.704 103.402 1.00 9.35  ? 215  LEU A N   1 
ATOM   1763 C CA  . LEU A 1 215 ? 60.545 51.108 103.411 1.00 9.30  ? 215  LEU A CA  1 
ATOM   1764 C C   . LEU A 1 215 ? 61.762 52.018 103.643 1.00 9.33  ? 215  LEU A C   1 
ATOM   1765 O O   . LEU A 1 215 ? 62.596 51.759 104.510 1.00 9.73  ? 215  LEU A O   1 
ATOM   1766 C CB  . LEU A 1 215 ? 59.468 51.355 104.476 1.00 9.84  ? 215  LEU A CB  1 
ATOM   1767 C CG  . LEU A 1 215 ? 58.755 52.712 104.453 1.00 10.18 ? 215  LEU A CG  1 
ATOM   1768 C CD1 . LEU A 1 215 ? 57.797 52.766 103.269 1.00 11.18 ? 215  LEU A CD1 1 
ATOM   1769 C CD2 . LEU A 1 215 ? 58.000 52.938 105.762 1.00 10.64 ? 215  LEU A CD2 1 
ATOM   1770 N N   . GLY A 1 216 ? 61.851 53.068 102.839 1.00 9.17  ? 216  GLY A N   1 
ATOM   1771 C CA  . GLY A 1 216 ? 62.946 54.020 102.931 1.00 9.91  ? 216  GLY A CA  1 
ATOM   1772 C C   . GLY A 1 216 ? 64.106 53.724 101.999 1.00 10.37 ? 216  GLY A C   1 
ATOM   1773 O O   . GLY A 1 216 ? 65.173 54.319 102.137 1.00 12.31 ? 216  GLY A O   1 
ATOM   1774 N N   . THR A 1 217 ? 63.917 52.789 101.072 1.00 10.27 ? 217  THR A N   1 
ATOM   1775 C CA  . THR A 1 217 ? 64.966 52.427 100.127 1.00 10.75 ? 217  THR A CA  1 
ATOM   1776 C C   . THR A 1 217 ? 64.459 52.545 98.688  1.00 11.41 ? 217  THR A C   1 
ATOM   1777 O O   . THR A 1 217 ? 63.259 52.699 98.448  1.00 11.92 ? 217  THR A O   1 
ATOM   1778 C CB  . THR A 1 217 ? 65.451 50.972 100.351 1.00 10.57 ? 217  THR A CB  1 
ATOM   1779 O OG1 . THR A 1 217 ? 64.386 50.054 100.051 1.00 10.49 ? 217  THR A OG1 1 
ATOM   1780 C CG2 . THR A 1 217 ? 65.925 50.767 101.793 1.00 11.64 ? 217  THR A CG2 1 
ATOM   1781 N N   . ASP A 1 218 ? 65.379 52.420 97.740  1.00 12.16 ? 218  ASP A N   1 
ATOM   1782 C CA  . ASP A 1 218 ? 65.027 52.464 96.328  1.00 12.27 ? 218  ASP A CA  1 
ATOM   1783 C C   . ASP A 1 218 ? 64.584 51.069 95.903  1.00 11.83 ? 218  ASP A C   1 
ATOM   1784 O O   . ASP A 1 218 ? 65.066 50.065 96.433  1.00 11.67 ? 218  ASP A O   1 
ATOM   1785 C CB  . ASP A 1 218 ? 66.233 52.897 95.478  1.00 14.56 ? 218  ASP A CB  1 
ATOM   1786 C CG  . ASP A 1 218 ? 66.635 54.346 95.706  1.00 16.62 ? 218  ASP A CG  1 
ATOM   1787 O OD1 . ASP A 1 218 ? 65.755 55.206 95.921  1.00 18.15 ? 218  ASP A OD1 1 
ATOM   1788 O OD2 . ASP A 1 218 ? 67.850 54.621 95.655  1.00 19.18 ? 218  ASP A OD2 1 
ATOM   1789 N N   . GLN A 1 219 ? 63.681 51.011 94.930  1.00 12.00 ? 219  GLN A N   1 
ATOM   1790 C CA  . GLN A 1 219 ? 63.175 49.747 94.415  1.00 11.80 ? 219  GLN A CA  1 
ATOM   1791 C C   . GLN A 1 219 ? 64.272 48.816 93.906  1.00 11.49 ? 219  GLN A C   1 
ATOM   1792 O O   . GLN A 1 219 ? 64.129 47.601 93.968  1.00 11.12 ? 219  GLN A O   1 
ATOM   1793 C CB  . GLN A 1 219 ? 62.143 49.969 93.309  1.00 11.43 ? 219  GLN A CB  1 
ATOM   1794 C CG  . GLN A 1 219 ? 61.552 48.651 92.788  1.00 11.19 ? 219  GLN A CG  1 
ATOM   1795 C CD  . GLN A 1 219 ? 60.354 48.851 91.887  1.00 10.68 ? 219  GLN A CD  1 
ATOM   1796 O OE1 . GLN A 1 219 ? 60.221 49.878 91.227  1.00 9.69  ? 219  GLN A OE1 1 
ATOM   1797 N NE2 . GLN A 1 219 ? 59.467 47.865 91.861  1.00 10.70 ? 219  GLN A NE2 1 
ATOM   1798 N N   . SER A 1 220 ? 65.372 49.390 93.435  1.00 12.28 ? 220  SER A N   1 
ATOM   1799 C CA  . SER A 1 220 ? 66.488 48.601 92.926  1.00 12.62 ? 220  SER A CA  1 
ATOM   1800 C C   . SER A 1 220 ? 67.116 47.728 94.011  1.00 12.55 ? 220  SER A C   1 
ATOM   1801 O O   . SER A 1 220 ? 67.784 46.755 93.700  1.00 13.99 ? 220  SER A O   1 
ATOM   1802 C CB  . SER A 1 220 ? 67.556 49.508 92.317  1.00 14.04 ? 220  SER A CB  1 
ATOM   1803 O OG  . SER A 1 220 ? 67.945 50.505 93.237  1.00 15.83 ? 220  SER A OG  1 
ATOM   1804 N N   . GLU A 1 221 ? 66.886 48.080 95.275  1.00 12.16 ? 221  GLU A N   1 
ATOM   1805 C CA  . GLU A 1 221 ? 67.437 47.319 96.399  1.00 12.42 ? 221  GLU A CA  1 
ATOM   1806 C C   . GLU A 1 221 ? 66.512 46.189 96.858  1.00 11.76 ? 221  GLU A C   1 
ATOM   1807 O O   . GLU A 1 221 ? 66.887 45.382 97.704  1.00 11.79 ? 221  GLU A O   1 
ATOM   1808 C CB  . GLU A 1 221 ? 67.688 48.257 97.585  1.00 13.62 ? 221  GLU A CB  1 
ATOM   1809 C CG  . GLU A 1 221 ? 68.609 49.440 97.301  1.00 16.57 ? 221  GLU A CG  1 
ATOM   1810 C CD  . GLU A 1 221 ? 68.660 50.434 98.455  1.00 18.10 ? 221  GLU A CD  1 
ATOM   1811 O OE1 . GLU A 1 221 ? 68.330 51.627 98.242  1.00 19.73 ? 221  GLU A OE1 1 
ATOM   1812 O OE2 . GLU A 1 221 ? 69.012 50.017 99.584  1.00 20.29 ? 221  GLU A OE2 1 
ATOM   1813 N N   . ASP A 1 222 ? 65.302 46.140 96.305  1.00 10.67 ? 222  ASP A N   1 
ATOM   1814 C CA  . ASP A 1 222 ? 64.334 45.119 96.703  1.00 11.42 ? 222  ASP A CA  1 
ATOM   1815 C C   . ASP A 1 222 ? 64.845 43.686 96.630  1.00 11.11 ? 222  ASP A C   1 
ATOM   1816 O O   . ASP A 1 222 ? 65.609 43.317 95.735  1.00 12.44 ? 222  ASP A O   1 
ATOM   1817 C CB  . ASP A 1 222 ? 63.023 45.279 95.929  1.00 11.04 ? 222  ASP A CB  1 
ATOM   1818 C CG  . ASP A 1 222 ? 62.281 46.557 96.304  1.00 11.14 ? 222  ASP A CG  1 
ATOM   1819 O OD1 . ASP A 1 222 ? 62.810 47.341 97.126  1.00 10.21 ? 222  ASP A OD1 1 
ATOM   1820 O OD2 . ASP A 1 222 ? 61.166 46.801 95.789  1.00 10.10 ? 222  ASP A OD2 1 
ATOM   1821 N N   . ILE A 1 223 ? 64.395 42.878 97.581  1.00 11.27 ? 223  ILE A N   1 
ATOM   1822 C CA  . ILE A 1 223 ? 64.811 41.488 97.685  1.00 10.79 ? 223  ILE A CA  1 
ATOM   1823 C C   . ILE A 1 223 ? 63.899 40.549 96.915  1.00 10.89 ? 223  ILE A C   1 
ATOM   1824 O O   . ILE A 1 223 ? 62.688 40.616 97.055  1.00 11.39 ? 223  ILE A O   1 
ATOM   1825 C CB  . ILE A 1 223 ? 64.807 40.998 99.165  1.00 11.64 ? 223  ILE A CB  1 
ATOM   1826 C CG1 . ILE A 1 223 ? 65.599 41.946 100.069 1.00 12.49 ? 223  ILE A CG1 1 
ATOM   1827 C CG2 . ILE A 1 223 ? 65.371 39.595 99.260  1.00 10.59 ? 223  ILE A CG2 1 
ATOM   1828 C CD1 . ILE A 1 223 ? 64.813 43.151 100.525 1.00 16.19 ? 223  ILE A CD1 1 
ATOM   1829 N N   . LEU A 1 224 ? 64.491 39.702 96.078  1.00 9.76  ? 224  LEU A N   1 
ATOM   1830 C CA  . LEU A 1 224 ? 63.757 38.697 95.315  1.00 10.25 ? 224  LEU A CA  1 
ATOM   1831 C C   . LEU A 1 224 ? 63.528 37.530 96.287  1.00 10.09 ? 224  LEU A C   1 
ATOM   1832 O O   . LEU A 1 224 ? 64.490 36.921 96.765  1.00 10.00 ? 224  LEU A O   1 
ATOM   1833 C CB  . LEU A 1 224 ? 64.582 38.231 94.110  1.00 10.18 ? 224  LEU A CB  1 
ATOM   1834 C CG  . LEU A 1 224 ? 63.915 37.132 93.284  1.00 11.05 ? 224  LEU A CG  1 
ATOM   1835 C CD1 . LEU A 1 224 ? 62.620 37.644 92.656  1.00 11.11 ? 224  LEU A CD1 1 
ATOM   1836 C CD2 . LEU A 1 224 ? 64.879 36.647 92.221  1.00 11.13 ? 224  LEU A CD2 1 
ATOM   1837 N N   . CYS A 1 225 ? 62.266 37.258 96.613  1.00 9.26  ? 225  CYS A N   1 
ATOM   1838 C CA  . CYS A 1 225 ? 61.934 36.194 97.561  1.00 8.80  ? 225  CYS A CA  1 
ATOM   1839 C C   . CYS A 1 225 ? 61.393 34.897 96.968  1.00 8.42  ? 225  CYS A C   1 
ATOM   1840 O O   . CYS A 1 225 ? 61.419 33.856 97.624  1.00 8.14  ? 225  CYS A O   1 
ATOM   1841 C CB  . CYS A 1 225 ? 60.973 36.728 98.617  1.00 9.02  ? 225  CYS A CB  1 
ATOM   1842 S SG  . CYS A 1 225 ? 61.701 38.048 99.617  1.00 11.41 ? 225  CYS A SG  1 
ATOM   1843 N N   . ALA A 1 226 ? 60.835 34.980 95.769  1.00 8.95  ? 226  ALA A N   1 
ATOM   1844 C CA  . ALA A 1 226 ? 60.308 33.807 95.082  1.00 9.03  ? 226  ALA A CA  1 
ATOM   1845 C C   . ALA A 1 226 ? 60.201 34.085 93.594  1.00 9.39  ? 226  ALA A C   1 
ATOM   1846 O O   . ALA A 1 226 ? 59.831 35.184 93.179  1.00 8.88  ? 226  ALA A O   1 
ATOM   1847 C CB  . ALA A 1 226 ? 58.940 33.405 95.643  1.00 9.89  ? 226  ALA A CB  1 
ATOM   1848 N N   . GLU A 1 227 ? 60.580 33.094 92.799  1.00 9.77  ? 227  GLU A N   1 
ATOM   1849 C CA  . GLU A 1 227 ? 60.506 33.172 91.354  1.00 10.77 ? 227  GLU A CA  1 
ATOM   1850 C C   . GLU A 1 227 ? 60.373 31.758 90.821  1.00 10.50 ? 227  GLU A C   1 
ATOM   1851 O O   . GLU A 1 227 ? 60.801 30.803 91.468  1.00 10.75 ? 227  GLU A O   1 
ATOM   1852 C CB  . GLU A 1 227 ? 61.722 33.880 90.744  1.00 11.95 ? 227  GLU A CB  1 
ATOM   1853 C CG  . GLU A 1 227 ? 63.048 33.161 90.858  1.00 14.14 ? 227  GLU A CG  1 
ATOM   1854 C CD  . GLU A 1 227 ? 64.097 33.750 89.927  1.00 14.74 ? 227  GLU A CD  1 
ATOM   1855 O OE1 . GLU A 1 227 ? 63.722 34.278 88.862  1.00 17.80 ? 227  GLU A OE1 1 
ATOM   1856 O OE2 . GLU A 1 227 ? 65.297 33.683 90.253  1.00 17.14 ? 227  GLU A OE2 1 
ATOM   1857 N N   . PHE A 1 228 ? 59.792 31.641 89.634  1.00 9.91  ? 228  PHE A N   1 
ATOM   1858 C CA  . PHE A 1 228 ? 59.547 30.348 89.009  1.00 10.34 ? 228  PHE A CA  1 
ATOM   1859 C C   . PHE A 1 228 ? 60.025 30.403 87.555  1.00 11.42 ? 228  PHE A C   1 
ATOM   1860 O O   . PHE A 1 228 ? 59.226 30.413 86.618  1.00 10.99 ? 228  PHE A O   1 
ATOM   1861 C CB  . PHE A 1 228 ? 58.041 30.058 89.093  1.00 9.06  ? 228  PHE A CB  1 
ATOM   1862 C CG  . PHE A 1 228 ? 57.409 30.522 90.393  1.00 9.45  ? 228  PHE A CG  1 
ATOM   1863 C CD1 . PHE A 1 228 ? 56.641 31.677 90.435  1.00 8.99  ? 228  PHE A CD1 1 
ATOM   1864 C CD2 . PHE A 1 228 ? 57.628 29.825 91.580  1.00 9.83  ? 228  PHE A CD2 1 
ATOM   1865 C CE1 . PHE A 1 228 ? 56.103 32.137 91.641  1.00 9.43  ? 228  PHE A CE1 1 
ATOM   1866 C CE2 . PHE A 1 228 ? 57.091 30.282 92.788  1.00 9.84  ? 228  PHE A CE2 1 
ATOM   1867 C CZ  . PHE A 1 228 ? 56.331 31.437 92.814  1.00 10.61 ? 228  PHE A CZ  1 
ATOM   1868 N N   . PRO A 1 229 ? 61.354 30.449 87.352  1.00 12.53 ? 229  PRO A N   1 
ATOM   1869 C CA  . PRO A 1 229 ? 61.946 30.514 86.012  1.00 12.50 ? 229  PRO A CA  1 
ATOM   1870 C C   . PRO A 1 229 ? 61.526 29.450 84.996  1.00 12.71 ? 229  PRO A C   1 
ATOM   1871 O O   . PRO A 1 229 ? 61.458 29.743 83.800  1.00 12.98 ? 229  PRO A O   1 
ATOM   1872 C CB  . PRO A 1 229 ? 63.450 30.476 86.298  1.00 13.43 ? 229  PRO A CB  1 
ATOM   1873 C CG  . PRO A 1 229 ? 63.545 29.771 87.613  1.00 14.21 ? 229  PRO A CG  1 
ATOM   1874 C CD  . PRO A 1 229 ? 62.403 30.359 88.381  1.00 13.35 ? 229  PRO A CD  1 
ATOM   1875 N N   . ASP A 1 230 ? 61.237 28.238 85.460  1.00 12.56 ? 230  ASP A N   1 
ATOM   1876 C CA  . ASP A 1 230 ? 60.838 27.157 84.558  1.00 13.25 ? 230  ASP A CA  1 
ATOM   1877 C C   . ASP A 1 230 ? 59.323 27.081 84.361  1.00 12.93 ? 230  ASP A C   1 
ATOM   1878 O O   . ASP A 1 230 ? 58.824 26.229 83.633  1.00 12.44 ? 230  ASP A O   1 
ATOM   1879 C CB  . ASP A 1 230 ? 61.364 25.812 85.080  1.00 14.96 ? 230  ASP A CB  1 
ATOM   1880 C CG  . ASP A 1 230 ? 62.886 25.759 85.157  1.00 17.10 ? 230  ASP A CG  1 
ATOM   1881 O OD1 . ASP A 1 230 ? 63.402 25.072 86.064  1.00 19.56 ? 230  ASP A OD1 1 
ATOM   1882 O OD2 . ASP A 1 230 ? 63.557 26.392 84.314  1.00 19.19 ? 230  ASP A OD2 1 
ATOM   1883 N N   . GLU A 1 231 ? 58.596 27.975 85.022  1.00 12.32 ? 231  GLU A N   1 
ATOM   1884 C CA  . GLU A 1 231 ? 57.139 28.017 84.937  1.00 11.82 ? 231  GLU A CA  1 
ATOM   1885 C C   . GLU A 1 231 ? 56.725 29.474 84.768  1.00 10.81 ? 231  GLU A C   1 
ATOM   1886 O O   . GLU A 1 231 ? 56.203 30.115 85.690  1.00 10.44 ? 231  GLU A O   1 
ATOM   1887 C CB  . GLU A 1 231 ? 56.533 27.416 86.204  1.00 12.24 ? 231  GLU A CB  1 
ATOM   1888 C CG  . GLU A 1 231 ? 56.790 25.922 86.371  1.00 14.14 ? 231  GLU A CG  1 
ATOM   1889 C CD  . GLU A 1 231 ? 56.035 25.057 85.363  1.00 15.16 ? 231  GLU A CD  1 
ATOM   1890 O OE1 . GLU A 1 231 ? 55.211 25.589 84.587  1.00 16.69 ? 231  GLU A OE1 1 
ATOM   1891 O OE2 . GLU A 1 231 ? 56.268 23.830 85.347  1.00 17.89 ? 231  GLU A OE2 1 
ATOM   1892 N N   . PRO A 1 232 ? 56.907 30.004 83.554  1.00 9.84  ? 232  PRO A N   1 
ATOM   1893 C CA  . PRO A 1 232 ? 56.584 31.394 83.225  1.00 9.59  ? 232  PRO A CA  1 
ATOM   1894 C C   . PRO A 1 232 ? 55.190 31.912 83.544  1.00 8.26  ? 232  PRO A C   1 
ATOM   1895 O O   . PRO A 1 232 ? 55.018 33.115 83.714  1.00 8.43  ? 232  PRO A O   1 
ATOM   1896 C CB  . PRO A 1 232 ? 56.892 31.468 81.728  1.00 9.91  ? 232  PRO A CB  1 
ATOM   1897 C CG  . PRO A 1 232 ? 57.947 30.392 81.527  1.00 11.00 ? 232  PRO A CG  1 
ATOM   1898 C CD  . PRO A 1 232 ? 57.381 29.278 82.362  1.00 10.40 ? 232  PRO A CD  1 
ATOM   1899 N N   . LYS A 1 233 ? 54.211 31.024 83.664  1.00 8.29  ? 233  LYS A N   1 
ATOM   1900 C CA  . LYS A 1 233 ? 52.847 31.450 83.936  1.00 9.07  ? 233  LYS A CA  1 
ATOM   1901 C C   . LYS A 1 233 ? 52.455 31.481 85.408  1.00 9.14  ? 233  LYS A C   1 
ATOM   1902 O O   . LYS A 1 233 ? 51.397 32.009 85.759  1.00 8.97  ? 233  LYS A O   1 
ATOM   1903 C CB  . LYS A 1 233 ? 51.858 30.599 83.139  1.00 10.23 ? 233  LYS A CB  1 
ATOM   1904 C CG  . LYS A 1 233 ? 52.037 30.707 81.636  1.00 12.91 ? 233  LYS A CG  1 
ATOM   1905 C CD  . LYS A 1 233 ? 50.985 29.897 80.892  1.00 14.09 ? 233  LYS A CD  1 
ATOM   1906 C CE  . LYS A 1 233 ? 51.003 28.430 81.294  1.00 16.31 ? 233  LYS A CE  1 
ATOM   1907 N NZ  . LYS A 1 233 ? 50.097 27.599 80.445  1.00 18.01 ? 233  LYS A NZ  1 
ATOM   1908 N N   . TRP A 1 234 ? 53.293 30.908 86.266  1.00 8.92  ? 234  TRP A N   1 
ATOM   1909 C CA  . TRP A 1 234 ? 53.000 30.895 87.692  1.00 8.17  ? 234  TRP A CA  1 
ATOM   1910 C C   . TRP A 1 234 ? 53.035 32.300 88.289  1.00 7.88  ? 234  TRP A C   1 
ATOM   1911 O O   . TRP A 1 234 ? 53.869 33.135 87.924  1.00 8.32  ? 234  TRP A O   1 
ATOM   1912 C CB  . TRP A 1 234 ? 53.990 30.009 88.440  1.00 8.47  ? 234  TRP A CB  1 
ATOM   1913 C CG  . TRP A 1 234 ? 53.814 28.536 88.230  1.00 9.22  ? 234  TRP A CG  1 
ATOM   1914 C CD1 . TRP A 1 234 ? 53.086 27.918 87.250  1.00 9.58  ? 234  TRP A CD1 1 
ATOM   1915 C CD2 . TRP A 1 234 ? 54.412 27.494 89.002  1.00 9.67  ? 234  TRP A CD2 1 
ATOM   1916 N NE1 . TRP A 1 234 ? 53.204 26.550 87.366  1.00 9.83  ? 234  TRP A NE1 1 
ATOM   1917 C CE2 . TRP A 1 234 ? 54.015 26.264 88.434  1.00 9.63  ? 234  TRP A CE2 1 
ATOM   1918 C CE3 . TRP A 1 234 ? 55.252 27.483 90.124  1.00 10.26 ? 234  TRP A CE3 1 
ATOM   1919 C CZ2 . TRP A 1 234 ? 54.430 25.034 88.948  1.00 9.58  ? 234  TRP A CZ2 1 
ATOM   1920 C CZ3 . TRP A 1 234 ? 55.664 26.259 90.637  1.00 10.30 ? 234  TRP A CZ3 1 
ATOM   1921 C CH2 . TRP A 1 234 ? 55.255 25.049 90.049  1.00 9.60  ? 234  TRP A CH2 1 
ATOM   1922 N N   . MET A 1 235 ? 52.133 32.535 89.236  1.00 7.50  ? 235  MET A N   1 
ATOM   1923 C CA  . MET A 1 235 ? 52.025 33.820 89.914  1.00 8.26  ? 235  MET A CA  1 
ATOM   1924 C C   . MET A 1 235 ? 51.915 33.517 91.404  1.00 8.48  ? 235  MET A C   1 
ATOM   1925 O O   . MET A 1 235 ? 51.009 32.800 91.818  1.00 8.40  ? 235  MET A O   1 
ATOM   1926 C CB  . MET A 1 235 ? 50.780 34.554 89.396  1.00 8.40  ? 235  MET A CB  1 
ATOM   1927 C CG  . MET A 1 235 ? 50.877 34.867 87.910  1.00 8.78  ? 235  MET A CG  1 
ATOM   1928 S SD  . MET A 1 235 ? 49.349 35.424 87.163  1.00 9.23  ? 235  MET A SD  1 
ATOM   1929 C CE  . MET A 1 235 ? 49.298 37.097 87.765  1.00 10.38 ? 235  MET A CE  1 
ATOM   1930 N N   . GLY A 1 236 ? 52.889 33.988 92.180  1.00 8.19  ? 236  GLY A N   1 
ATOM   1931 C CA  . GLY A 1 236 ? 52.897 33.748 93.617  1.00 8.06  ? 236  GLY A CA  1 
ATOM   1932 C C   . GLY A 1 236 ? 52.509 34.955 94.460  1.00 8.26  ? 236  GLY A C   1 
ATOM   1933 O O   . GLY A 1 236 ? 53.260 35.935 94.541  1.00 9.09  ? 236  GLY A O   1 
ATOM   1934 N N   . GLY A 1 237 ? 51.339 34.876 95.090  1.00 8.48  ? 237  GLY A N   1 
ATOM   1935 C CA  . GLY A 1 237 ? 50.856 35.953 95.937  1.00 8.31  ? 237  GLY A CA  1 
ATOM   1936 C C   . GLY A 1 237 ? 51.172 35.672 97.396  1.00 7.86  ? 237  GLY A C   1 
ATOM   1937 O O   . GLY A 1 237 ? 50.910 34.573 97.887  1.00 8.50  ? 237  GLY A O   1 
ATOM   1938 N N   . ALA A 1 238 ? 51.743 36.655 98.082  1.00 8.33  ? 238  ALA A N   1 
ATOM   1939 C CA  . ALA A 1 238 ? 52.109 36.514 99.486  1.00 8.48  ? 238  ALA A CA  1 
ATOM   1940 C C   . ALA A 1 238 ? 51.196 37.257 100.447 1.00 8.18  ? 238  ALA A C   1 
ATOM   1941 O O   . ALA A 1 238 ? 50.657 38.316 100.129 1.00 9.18  ? 238  ALA A O   1 
ATOM   1942 C CB  . ALA A 1 238 ? 53.536 36.999 99.705  1.00 9.71  ? 238  ALA A CB  1 
ATOM   1943 N N   . GLU A 1 239 ? 51.039 36.686 101.633 1.00 8.50  ? 239  GLU A N   1 
ATOM   1944 C CA  . GLU A 1 239 ? 50.272 37.302 102.706 1.00 8.38  ? 239  GLU A CA  1 
ATOM   1945 C C   . GLU A 1 239 ? 50.930 36.833 103.993 1.00 7.84  ? 239  GLU A C   1 
ATOM   1946 O O   . GLU A 1 239 ? 51.662 35.846 103.994 1.00 7.26  ? 239  GLU A O   1 
ATOM   1947 C CB  . GLU A 1 239 ? 48.813 36.858 102.680 1.00 8.89  ? 239  GLU A CB  1 
ATOM   1948 C CG  . GLU A 1 239 ? 48.603 35.424 103.105 1.00 10.27 ? 239  GLU A CG  1 
ATOM   1949 C CD  . GLU A 1 239 ? 47.181 34.970 102.911 1.00 11.07 ? 239  GLU A CD  1 
ATOM   1950 O OE1 . GLU A 1 239 ? 46.966 34.057 102.093 1.00 12.36 ? 239  GLU A OE1 1 
ATOM   1951 O OE2 . GLU A 1 239 ? 46.276 35.534 103.555 1.00 11.30 ? 239  GLU A OE2 1 
ATOM   1952 N N   . LEU A 1 240 ? 50.764 37.599 105.060 1.00 7.37  ? 240  LEU A N   1 
ATOM   1953 C CA  . LEU A 1 240 ? 51.306 37.215 106.354 1.00 7.41  ? 240  LEU A CA  1 
ATOM   1954 C C   . LEU A 1 240 ? 50.194 36.592 107.179 1.00 7.28  ? 240  LEU A C   1 
ATOM   1955 O O   . LEU A 1 240 ? 49.035 37.011 107.095 1.00 8.16  ? 240  LEU A O   1 
ATOM   1956 C CB  . LEU A 1 240 ? 51.855 38.430 107.116 1.00 8.23  ? 240  LEU A CB  1 
ATOM   1957 C CG  . LEU A 1 240 ? 53.296 38.887 106.877 1.00 8.88  ? 240  LEU A CG  1 
ATOM   1958 C CD1 . LEU A 1 240 ? 54.267 37.782 107.243 1.00 8.97  ? 240  LEU A CD1 1 
ATOM   1959 C CD2 . LEU A 1 240 ? 53.489 39.295 105.446 1.00 8.48  ? 240  LEU A CD2 1 
ATOM   1960 N N   . SER A 1 241 ? 50.543 35.591 107.977 1.00 7.38  ? 241  SER A N   1 
ATOM   1961 C CA  . SER A 1 241 ? 49.567 34.977 108.874 1.00 7.89  ? 241  SER A CA  1 
ATOM   1962 C C   . SER A 1 241 ? 49.164 36.052 109.900 1.00 8.17  ? 241  SER A C   1 
ATOM   1963 O O   . SER A 1 241 ? 49.882 37.044 110.077 1.00 7.95  ? 241  SER A O   1 
ATOM   1964 C CB  . SER A 1 241 ? 50.188 33.775 109.589 1.00 7.65  ? 241  SER A CB  1 
ATOM   1965 O OG  . SER A 1 241 ? 51.410 34.112 110.222 1.00 8.29  ? 241  SER A OG  1 
ATOM   1966 N N   . ASP A 1 242 ? 48.037 35.858 110.575 1.00 8.65  ? 242  ASP A N   1 
ATOM   1967 C CA  . ASP A 1 242 ? 47.541 36.824 111.545 1.00 8.77  ? 242  ASP A CA  1 
ATOM   1968 C C   . ASP A 1 242 ? 48.513 37.163 112.673 1.00 8.88  ? 242  ASP A C   1 
ATOM   1969 O O   . ASP A 1 242 ? 48.512 38.292 113.164 1.00 9.87  ? 242  ASP A O   1 
ATOM   1970 C CB  . ASP A 1 242 ? 46.196 36.361 112.123 1.00 9.71  ? 242  ASP A CB  1 
ATOM   1971 C CG  . ASP A 1 242 ? 45.078 36.339 111.091 1.00 10.75 ? 242  ASP A CG  1 
ATOM   1972 O OD1 . ASP A 1 242 ? 45.212 36.988 110.034 1.00 12.53 ? 242  ASP A OD1 1 
ATOM   1973 O OD2 . ASP A 1 242 ? 44.050 35.678 111.361 1.00 11.46 ? 242  ASP A OD2 1 
ATOM   1974 N N   . ASP A 1 243 ? 49.326 36.194 113.081 1.00 8.41  ? 243  ASP A N   1 
ATOM   1975 C CA  . ASP A 1 243 ? 50.303 36.412 114.139 1.00 8.76  ? 243  ASP A CA  1 
ATOM   1976 C C   . ASP A 1 243 ? 51.637 36.965 113.611 1.00 8.44  ? 243  ASP A C   1 
ATOM   1977 O O   . ASP A 1 243 ? 52.572 37.169 114.374 1.00 9.40  ? 243  ASP A O   1 
ATOM   1978 C CB  . ASP A 1 243 ? 50.540 35.119 114.935 1.00 8.74  ? 243  ASP A CB  1 
ATOM   1979 C CG  . ASP A 1 243 ? 50.971 33.938 114.060 1.00 8.50  ? 243  ASP A CG  1 
ATOM   1980 O OD1 . ASP A 1 243 ? 50.849 32.790 114.538 1.00 8.40  ? 243  ASP A OD1 1 
ATOM   1981 O OD2 . ASP A 1 243 ? 51.430 34.143 112.918 1.00 9.42  ? 243  ASP A OD2 1 
ATOM   1982 N N   . GLY A 1 244 ? 51.709 37.165 112.296 1.00 8.05  ? 244  GLY A N   1 
ATOM   1983 C CA  . GLY A 1 244 ? 52.907 37.688 111.654 1.00 8.55  ? 244  GLY A CA  1 
ATOM   1984 C C   . GLY A 1 244 ? 54.085 36.741 111.533 1.00 8.78  ? 244  GLY A C   1 
ATOM   1985 O O   . GLY A 1 244 ? 55.122 37.117 110.991 1.00 9.28  ? 244  GLY A O   1 
ATOM   1986 N N   . ARG A 1 245 ? 53.917 35.496 111.954 1.00 8.87  ? 245  ARG A N   1 
ATOM   1987 C CA  . ARG A 1 245 ? 55.029 34.559 111.905 1.00 9.54  ? 245  ARG A CA  1 
ATOM   1988 C C   . ARG A 1 245 ? 55.330 33.892 110.568 1.00 9.54  ? 245  ARG A C   1 
ATOM   1989 O O   . ARG A 1 245 ? 56.485 33.582 110.281 1.00 9.45  ? 245  ARG A O   1 
ATOM   1990 C CB  . ARG A 1 245 ? 54.843 33.480 112.970 1.00 11.76 ? 245  ARG A CB  1 
ATOM   1991 C CG  . ARG A 1 245 ? 56.000 32.518 113.039 1.00 14.93 ? 245  ARG A CG  1 
ATOM   1992 C CD  . ARG A 1 245 ? 55.811 31.509 114.121 1.00 18.20 ? 245  ARG A CD  1 
ATOM   1993 N NE  . ARG A 1 245 ? 56.876 30.517 114.090 1.00 21.00 ? 245  ARG A NE  1 
ATOM   1994 C CZ  . ARG A 1 245 ? 57.077 29.613 115.038 1.00 22.69 ? 245  ARG A CZ  1 
ATOM   1995 N NH1 . ARG A 1 245 ? 56.286 29.582 116.098 1.00 24.27 ? 245  ARG A NH1 1 
ATOM   1996 N NH2 . ARG A 1 245 ? 58.048 28.719 114.903 1.00 24.50 ? 245  ARG A NH2 1 
ATOM   1997 N N   . TYR A 1 246 ? 54.301 33.684 109.758 1.00 8.69  ? 246  TYR A N   1 
ATOM   1998 C CA  . TYR A 1 246 ? 54.463 32.994 108.488 1.00 8.03  ? 246  TYR A CA  1 
ATOM   1999 C C   . TYR A 1 246 ? 54.083 33.783 107.253 1.00 8.68  ? 246  TYR A C   1 
ATOM   2000 O O   . TYR A 1 246 ? 53.077 34.484 107.248 1.00 8.70  ? 246  TYR A O   1 
ATOM   2001 C CB  . TYR A 1 246 ? 53.589 31.734 108.467 1.00 8.74  ? 246  TYR A CB  1 
ATOM   2002 C CG  . TYR A 1 246 ? 53.833 30.761 109.583 1.00 8.79  ? 246  TYR A CG  1 
ATOM   2003 C CD1 . TYR A 1 246 ? 53.159 30.879 110.802 1.00 9.13  ? 246  TYR A CD1 1 
ATOM   2004 C CD2 . TYR A 1 246 ? 54.707 29.687 109.406 1.00 9.05  ? 246  TYR A CD2 1 
ATOM   2005 C CE1 . TYR A 1 246 ? 53.348 29.944 111.813 1.00 9.49  ? 246  TYR A CE1 1 
ATOM   2006 C CE2 . TYR A 1 246 ? 54.898 28.753 110.411 1.00 9.94  ? 246  TYR A CE2 1 
ATOM   2007 C CZ  . TYR A 1 246 ? 54.214 28.890 111.604 1.00 10.28 ? 246  TYR A CZ  1 
ATOM   2008 O OH  . TYR A 1 246 ? 54.371 27.962 112.600 1.00 12.62 ? 246  TYR A OH  1 
ATOM   2009 N N   . VAL A 1 247 ? 54.891 33.657 106.207 1.00 8.71  ? 247  VAL A N   1 
ATOM   2010 C CA  . VAL A 1 247 ? 54.547 34.260 104.926 1.00 8.71  ? 247  VAL A CA  1 
ATOM   2011 C C   . VAL A 1 247 ? 53.884 33.086 104.198 1.00 8.32  ? 247  VAL A C   1 
ATOM   2012 O O   . VAL A 1 247 ? 54.442 31.987 104.169 1.00 9.43  ? 247  VAL A O   1 
ATOM   2013 C CB  . VAL A 1 247 ? 55.779 34.704 104.103 1.00 9.56  ? 247  VAL A CB  1 
ATOM   2014 C CG1 . VAL A 1 247 ? 55.327 35.377 102.800 1.00 9.85  ? 247  VAL A CG1 1 
ATOM   2015 C CG2 . VAL A 1 247 ? 56.639 35.643 104.898 1.00 9.91  ? 247  VAL A CG2 1 
ATOM   2016 N N   . LEU A 1 248 ? 52.653 33.276 103.739 1.00 8.39  ? 248  LEU A N   1 
ATOM   2017 C CA  . LEU A 1 248 ? 51.941 32.234 103.011 1.00 8.16  ? 248  LEU A CA  1 
ATOM   2018 C C   . LEU A 1 248 ? 51.949 32.628 101.539 1.00 7.82  ? 248  LEU A C   1 
ATOM   2019 O O   . LEU A 1 248 ? 51.496 33.715 101.178 1.00 7.80  ? 248  LEU A O   1 
ATOM   2020 C CB  . LEU A 1 248 ? 50.503 32.114 103.505 1.00 8.82  ? 248  LEU A CB  1 
ATOM   2021 C CG  . LEU A 1 248 ? 50.353 31.872 105.003 1.00 10.65 ? 248  LEU A CG  1 
ATOM   2022 C CD1 . LEU A 1 248 ? 48.883 31.775 105.321 1.00 12.45 ? 248  LEU A CD1 1 
ATOM   2023 C CD2 . LEU A 1 248 ? 51.104 30.618 105.460 1.00 11.80 ? 248  LEU A CD2 1 
ATOM   2024 N N   . LEU A 1 249 ? 52.482 31.739 100.711 1.00 7.11  ? 249  LEU A N   1 
ATOM   2025 C CA  . LEU A 1 249 ? 52.565 31.970 99.274  1.00 6.96  ? 249  LEU A CA  1 
ATOM   2026 C C   . LEU A 1 249 ? 51.566 31.098 98.531  1.00 6.80  ? 249  LEU A C   1 
ATOM   2027 O O   . LEU A 1 249 ? 51.634 29.867 98.602  1.00 7.50  ? 249  LEU A O   1 
ATOM   2028 C CB  . LEU A 1 249 ? 53.980 31.673 98.784  1.00 7.65  ? 249  LEU A CB  1 
ATOM   2029 C CG  . LEU A 1 249 ? 54.280 32.038 97.336  1.00 7.67  ? 249  LEU A CG  1 
ATOM   2030 C CD1 . LEU A 1 249 ? 54.285 33.551 97.182  1.00 8.97  ? 249  LEU A CD1 1 
ATOM   2031 C CD2 . LEU A 1 249 ? 55.628 31.446 96.942  1.00 8.32  ? 249  LEU A CD2 1 
ATOM   2032 N N   . SER A 1 250 ? 50.608 31.742 97.876  1.00 7.14  ? 250  SER A N   1 
ATOM   2033 C CA  . SER A 1 250 ? 49.597 31.058 97.088  1.00 6.68  ? 250  SER A CA  1 
ATOM   2034 C C   . SER A 1 250 ? 50.010 31.171 95.635  1.00 7.36  ? 250  SER A C   1 
ATOM   2035 O O   . SER A 1 250 ? 50.033 32.271 95.073  1.00 7.96  ? 250  SER A O   1 
ATOM   2036 C CB  . SER A 1 250 ? 48.233 31.717 97.282  1.00 7.24  ? 250  SER A CB  1 
ATOM   2037 O OG  . SER A 1 250 ? 47.802 31.572 98.618  1.00 8.42  ? 250  SER A OG  1 
ATOM   2038 N N   . ILE A 1 251 ? 50.396 30.047 95.044  1.00 7.35  ? 251  ILE A N   1 
ATOM   2039 C CA  . ILE A 1 251 ? 50.827 30.057 93.650  1.00 7.42  ? 251  ILE A CA  1 
ATOM   2040 C C   . ILE A 1 251 ? 49.696 29.634 92.730  1.00 7.65  ? 251  ILE A C   1 
ATOM   2041 O O   . ILE A 1 251 ? 49.083 28.589 92.920  1.00 7.58  ? 251  ILE A O   1 
ATOM   2042 C CB  . ILE A 1 251 ? 52.035 29.132 93.430  1.00 7.59  ? 251  ILE A CB  1 
ATOM   2043 C CG1 . ILE A 1 251 ? 53.148 29.517 94.400  1.00 8.09  ? 251  ILE A CG1 1 
ATOM   2044 C CG2 . ILE A 1 251 ? 52.535 29.241 91.986  1.00 8.67  ? 251  ILE A CG2 1 
ATOM   2045 C CD1 . ILE A 1 251 ? 54.290 28.559 94.420  1.00 7.95  ? 251  ILE A CD1 1 
ATOM   2046 N N   . ARG A 1 252 ? 49.444 30.455 91.721  1.00 8.59  ? 252  ARG A N   1 
ATOM   2047 C CA  . ARG A 1 252 ? 48.385 30.197 90.750  1.00 9.72  ? 252  ARG A CA  1 
ATOM   2048 C C   . ARG A 1 252 ? 48.950 30.065 89.346  1.00 9.27  ? 252  ARG A C   1 
ATOM   2049 O O   . ARG A 1 252 ? 49.983 30.651 89.024  1.00 9.01  ? 252  ARG A O   1 
ATOM   2050 C CB  . ARG A 1 252 ? 47.408 31.374 90.708  1.00 11.63 ? 252  ARG A CB  1 
ATOM   2051 C CG  . ARG A 1 252 ? 46.959 31.873 92.035  1.00 15.84 ? 252  ARG A CG  1 
ATOM   2052 C CD  . ARG A 1 252 ? 45.847 31.042 92.560  1.00 17.37 ? 252  ARG A CD  1 
ATOM   2053 N NE  . ARG A 1 252 ? 45.294 31.630 93.772  1.00 18.66 ? 252  ARG A NE  1 
ATOM   2054 C CZ  . ARG A 1 252 ? 44.077 31.373 94.224  1.00 18.94 ? 252  ARG A CZ  1 
ATOM   2055 N NH1 . ARG A 1 252 ? 43.285 30.549 93.556  1.00 19.38 ? 252  ARG A NH1 1 
ATOM   2056 N NH2 . ARG A 1 252 ? 43.677 31.904 95.371  1.00 19.38 ? 252  ARG A NH2 1 
ATOM   2057 N N   . GLU A 1 253 ? 48.259 29.284 88.525  1.00 9.69  ? 253  GLU A N   1 
ATOM   2058 C CA  . GLU A 1 253 ? 48.590 29.125 87.116  1.00 10.55 ? 253  GLU A CA  1 
ATOM   2059 C C   . GLU A 1 253 ? 47.244 28.975 86.431  1.00 11.27 ? 253  GLU A C   1 
ATOM   2060 O O   . GLU A 1 253 ? 46.612 27.916 86.492  1.00 12.07 ? 253  GLU A O   1 
ATOM   2061 C CB  . GLU A 1 253 ? 49.445 27.900 86.826  1.00 11.19 ? 253  GLU A CB  1 
ATOM   2062 C CG  . GLU A 1 253 ? 49.705 27.787 85.334  1.00 12.88 ? 253  GLU A CG  1 
ATOM   2063 C CD  . GLU A 1 253 ? 50.635 26.661 84.976  1.00 14.47 ? 253  GLU A CD  1 
ATOM   2064 O OE1 . GLU A 1 253 ? 50.370 25.510 85.375  1.00 16.82 ? 253  GLU A OE1 1 
ATOM   2065 O OE2 . GLU A 1 253 ? 51.630 26.941 84.284  1.00 15.36 ? 253  GLU A OE2 1 
ATOM   2066 N N   . GLY A 1 254 ? 46.762 30.066 85.863  1.00 11.21 ? 254  GLY A N   1 
ATOM   2067 C CA  . GLY A 1 254 ? 45.470 30.027 85.215  1.00 11.04 ? 254  GLY A CA  1 
ATOM   2068 C C   . GLY A 1 254 ? 44.406 30.628 86.115  1.00 10.74 ? 254  GLY A C   1 
ATOM   2069 O O   . GLY A 1 254 ? 44.710 31.206 87.161  1.00 10.38 ? 254  GLY A O   1 
HETATM 2070 N N   . CSX A 1 255 ? 43.153 30.381 85.763  1.00 10.13 ? 255  CSX A N   1 
HETATM 2071 C CA  . CSX A 1 255 ? 42.025 30.950 86.484  1.00 10.18 ? 255  CSX A CA  1 
HETATM 2072 C CB  . CSX A 1 255 ? 41.159 31.748 85.512  1.00 10.48 ? 255  CSX A CB  1 
HETATM 2073 S SG  . CSX A 1 255 ? 41.938 33.305 84.978  1.00 11.64 ? 255  CSX A SG  1 
HETATM 2074 C C   . CSX A 1 255 ? 41.152 30.007 87.302  1.00 10.21 ? 255  CSX A C   1 
HETATM 2075 O O   . CSX A 1 255 ? 40.116 30.423 87.819  1.00 10.22 ? 255  CSX A O   1 
HETATM 2076 O OD  . CSX A 1 255 ? 41.705 34.278 86.087  1.00 14.01 ? 255  CSX A OD  1 
ATOM   2077 N N   . ASP A 1 256 ? 41.516 28.734 87.382  1.00 9.80  ? 256  ASP A N   1 
ATOM   2078 C CA  . ASP A 1 256 ? 40.735 27.807 88.189  1.00 9.96  ? 256  ASP A CA  1 
ATOM   2079 C C   . ASP A 1 256 ? 40.944 28.118 89.658  1.00 9.71  ? 256  ASP A C   1 
ATOM   2080 O O   . ASP A 1 256 ? 41.970 28.693 90.055  1.00 9.15  ? 256  ASP A O   1 
ATOM   2081 C CB  . ASP A 1 256 ? 41.164 26.354 87.965  1.00 9.86  ? 256  ASP A CB  1 
ATOM   2082 C CG  . ASP A 1 256 ? 40.515 25.716 86.757  1.00 10.28 ? 256  ASP A CG  1 
ATOM   2083 O OD1 . ASP A 1 256 ? 39.421 26.151 86.322  1.00 10.10 ? 256  ASP A OD1 1 
ATOM   2084 O OD2 . ASP A 1 256 ? 41.098 24.733 86.259  1.00 10.96 ? 256  ASP A OD2 1 
ATOM   2085 N N   . PRO A 1 257 ? 39.966 27.753 90.490  1.00 10.09 ? 257  PRO A N   1 
ATOM   2086 C CA  . PRO A 1 257 ? 40.103 28.007 91.918  1.00 9.85  ? 257  PRO A CA  1 
ATOM   2087 C C   . PRO A 1 257 ? 40.952 26.904 92.548  1.00 9.66  ? 257  PRO A C   1 
ATOM   2088 O O   . PRO A 1 257 ? 40.435 25.983 93.193  1.00 9.93  ? 257  PRO A O   1 
ATOM   2089 C CB  . PRO A 1 257 ? 38.653 27.988 92.406  1.00 10.36 ? 257  PRO A CB  1 
ATOM   2090 C CG  . PRO A 1 257 ? 38.024 26.965 91.525  1.00 10.91 ? 257  PRO A CG  1 
ATOM   2091 C CD  . PRO A 1 257 ? 38.607 27.278 90.164  1.00 10.14 ? 257  PRO A CD  1 
ATOM   2092 N N   . VAL A 1 258 ? 42.251 26.964 92.271  1.00 9.04  ? 258  VAL A N   1 
ATOM   2093 C CA  . VAL A 1 258 ? 43.230 26.025 92.802  1.00 7.94  ? 258  VAL A CA  1 
ATOM   2094 C C   . VAL A 1 258 ? 44.517 26.807 93.012  1.00 8.02  ? 258  VAL A C   1 
ATOM   2095 O O   . VAL A 1 258 ? 44.750 27.821 92.350  1.00 8.75  ? 258  VAL A O   1 
ATOM   2096 C CB  . VAL A 1 258 ? 43.537 24.840 91.848  1.00 7.98  ? 258  VAL A CB  1 
ATOM   2097 C CG1 . VAL A 1 258 ? 42.333 23.916 91.726  1.00 9.14  ? 258  VAL A CG1 1 
ATOM   2098 C CG2 . VAL A 1 258 ? 43.953 25.351 90.477  1.00 8.88  ? 258  VAL A CG2 1 
ATOM   2099 N N   . ASN A 1 259 ? 45.330 26.357 93.955  1.00 6.77  ? 259  ASN A N   1 
ATOM   2100 C CA  . ASN A 1 259 ? 46.598 27.021 94.207  1.00 7.14  ? 259  ASN A CA  1 
ATOM   2101 C C   . ASN A 1 259 ? 47.535 26.152 95.018  1.00 7.43  ? 259  ASN A C   1 
ATOM   2102 O O   . ASN A 1 259 ? 47.094 25.286 95.774  1.00 8.02  ? 259  ASN A O   1 
ATOM   2103 C CB  . ASN A 1 259 ? 46.406 28.352 94.962  1.00 7.43  ? 259  ASN A CB  1 
ATOM   2104 C CG  . ASN A 1 259 ? 45.775 28.174 96.341  1.00 7.07  ? 259  ASN A CG  1 
ATOM   2105 O OD1 . ASN A 1 259 ? 44.563 28.010 96.457  1.00 7.92  ? 259  ASN A OD1 1 
ATOM   2106 N ND2 . ASN A 1 259 ? 46.589 28.244 97.387  1.00 7.26  ? 259  ASN A ND2 1 
ATOM   2107 N N   . ARG A 1 260 ? 48.833 26.323 94.778  1.00 7.65  ? 260  ARG A N   1 
ATOM   2108 C CA  . ARG A 1 260 ? 49.839 25.656 95.588  1.00 8.31  ? 260  ARG A CA  1 
ATOM   2109 C C   . ARG A 1 260 ? 49.893 26.566 96.820  1.00 8.33  ? 260  ARG A C   1 
ATOM   2110 O O   . ARG A 1 260 ? 49.493 27.741 96.763  1.00 7.93  ? 260  ARG A O   1 
ATOM   2111 C CB  . ARG A 1 260 ? 51.205 25.640 94.894  1.00 8.55  ? 260  ARG A CB  1 
ATOM   2112 C CG  . ARG A 1 260 ? 51.237 24.781 93.650  1.00 12.17 ? 260  ARG A CG  1 
ATOM   2113 C CD  . ARG A 1 260 ? 52.640 24.537 93.089  1.00 13.98 ? 260  ARG A CD  1 
ATOM   2114 N NE  . ARG A 1 260 ? 52.577 23.647 91.925  1.00 17.23 ? 260  ARG A NE  1 
ATOM   2115 C CZ  . ARG A 1 260 ? 53.489 22.734 91.601  1.00 16.98 ? 260  ARG A CZ  1 
ATOM   2116 N NH1 . ARG A 1 260 ? 54.571 22.560 92.337  1.00 18.63 ? 260  ARG A NH1 1 
ATOM   2117 N NH2 . ARG A 1 260 ? 53.308 21.979 90.527  1.00 17.95 ? 260  ARG A NH2 1 
ATOM   2118 N N   . LEU A 1 261 ? 50.311 26.009 97.947  1.00 8.02  ? 261  LEU A N   1 
ATOM   2119 C CA  . LEU A 1 261 ? 50.416 26.770 99.178  1.00 7.73  ? 261  LEU A CA  1 
ATOM   2120 C C   . LEU A 1 261 ? 51.747 26.425 99.818  1.00 7.41  ? 261  LEU A C   1 
ATOM   2121 O O   . LEU A 1 261 ? 51.962 25.284 100.262 1.00 8.06  ? 261  LEU A O   1 
ATOM   2122 C CB  . LEU A 1 261 ? 49.270 26.425 100.134 1.00 9.43  ? 261  LEU A CB  1 
ATOM   2123 C CG  . LEU A 1 261 ? 48.978 27.352 101.328 1.00 10.09 ? 261  LEU A CG  1 
ATOM   2124 C CD1 . LEU A 1 261 ? 50.154 27.455 102.305 1.00 11.49 ? 261  LEU A CD1 1 
ATOM   2125 C CD2 . LEU A 1 261 ? 48.573 28.738 100.833 1.00 10.65 ? 261  LEU A CD2 1 
ATOM   2126 N N   . TRP A 1 262 ? 52.659 27.389 99.781  1.00 7.79  ? 262  TRP A N   1 
ATOM   2127 C CA  . TRP A 1 262 ? 53.960 27.218 100.408 1.00 7.95  ? 262  TRP A CA  1 
ATOM   2128 C C   . TRP A 1 262 ? 53.996 28.188 101.577 1.00 7.71  ? 262  TRP A C   1 
ATOM   2129 O O   . TRP A 1 262 ? 53.267 29.182 101.587 1.00 8.11  ? 262  TRP A O   1 
ATOM   2130 C CB  . TRP A 1 262 ? 55.094 27.606 99.463  1.00 7.76  ? 262  TRP A CB  1 
ATOM   2131 C CG  . TRP A 1 262 ? 55.232 26.794 98.216  1.00 8.05  ? 262  TRP A CG  1 
ATOM   2132 C CD1 . TRP A 1 262 ? 54.498 25.704 97.846  1.00 8.33  ? 262  TRP A CD1 1 
ATOM   2133 C CD2 . TRP A 1 262 ? 56.166 27.033 97.164  1.00 7.74  ? 262  TRP A CD2 1 
ATOM   2134 N NE1 . TRP A 1 262 ? 54.922 25.246 96.618  1.00 8.84  ? 262  TRP A NE1 1 
ATOM   2135 C CE2 . TRP A 1 262 ? 55.945 26.047 96.176  1.00 7.76  ? 262  TRP A CE2 1 
ATOM   2136 C CE3 . TRP A 1 262 ? 57.170 27.991 96.949  1.00 7.97  ? 262  TRP A CE3 1 
ATOM   2137 C CZ2 . TRP A 1 262 ? 56.696 25.991 94.992  1.00 8.74  ? 262  TRP A CZ2 1 
ATOM   2138 C CZ3 . TRP A 1 262 ? 57.916 27.933 95.770  1.00 8.09  ? 262  TRP A CZ3 1 
ATOM   2139 C CH2 . TRP A 1 262 ? 57.671 26.938 94.808  1.00 8.07  ? 262  TRP A CH2 1 
ATOM   2140 N N   . TYR A 1 263 ? 54.839 27.917 102.566 1.00 7.83  ? 263  TYR A N   1 
ATOM   2141 C CA  . TYR A 1 263 ? 54.945 28.836 103.690 1.00 7.92  ? 263  TYR A CA  1 
ATOM   2142 C C   . TYR A 1 263 ? 56.377 29.032 104.123 1.00 8.34  ? 263  TYR A C   1 
ATOM   2143 O O   . TYR A 1 263 ? 57.241 28.181 103.885 1.00 8.61  ? 263  TYR A O   1 
ATOM   2144 C CB  . TYR A 1 263 ? 54.093 28.396 104.893 1.00 8.48  ? 263  TYR A CB  1 
ATOM   2145 C CG  . TYR A 1 263 ? 54.571 27.166 105.630 1.00 8.11  ? 263  TYR A CG  1 
ATOM   2146 C CD1 . TYR A 1 263 ? 55.568 27.248 106.613 1.00 8.07  ? 263  TYR A CD1 1 
ATOM   2147 C CD2 . TYR A 1 263 ? 53.993 25.927 105.384 1.00 8.78  ? 263  TYR A CD2 1 
ATOM   2148 C CE1 . TYR A 1 263 ? 55.961 26.120 107.326 1.00 7.84  ? 263  TYR A CE1 1 
ATOM   2149 C CE2 . TYR A 1 263 ? 54.379 24.803 106.088 1.00 9.02  ? 263  TYR A CE2 1 
ATOM   2150 C CZ  . TYR A 1 263 ? 55.359 24.900 107.059 1.00 8.62  ? 263  TYR A CZ  1 
ATOM   2151 O OH  . TYR A 1 263 ? 55.717 23.784 107.782 1.00 9.43  ? 263  TYR A OH  1 
ATOM   2152 N N   . CYS A 1 264 ? 56.631 30.200 104.701 1.00 8.94  ? 264  CYS A N   1 
ATOM   2153 C CA  . CYS A 1 264 ? 57.942 30.516 105.238 1.00 9.64  ? 264  CYS A CA  1 
ATOM   2154 C C   . CYS A 1 264 ? 57.783 30.935 106.684 1.00 9.81  ? 264  CYS A C   1 
ATOM   2155 O O   . CYS A 1 264 ? 57.041 31.870 106.993 1.00 9.47  ? 264  CYS A O   1 
ATOM   2156 C CB  . CYS A 1 264 ? 58.622 31.652 104.482 1.00 9.35  ? 264  CYS A CB  1 
ATOM   2157 S SG  . CYS A 1 264 ? 60.182 32.150 105.278 1.00 11.31 ? 264  CYS A SG  1 
ATOM   2158 N N   . ASP A 1 265 ? 58.402 30.179 107.580 1.00 10.15 ? 265  ASP A N   1 
ATOM   2159 C CA  . ASP A 1 265 ? 58.386 30.512 108.992 1.00 11.11 ? 265  ASP A CA  1 
ATOM   2160 C C   . ASP A 1 265 ? 59.472 31.589 109.099 1.00 10.90 ? 265  ASP A C   1 
ATOM   2161 O O   . ASP A 1 265 ? 60.662 31.280 109.049 1.00 10.18 ? 265  ASP A O   1 
ATOM   2162 C CB  . ASP A 1 265 ? 58.765 29.273 109.812 1.00 12.54 ? 265  ASP A CB  1 
ATOM   2163 C CG  . ASP A 1 265 ? 58.674 29.505 111.305 1.00 14.15 ? 265  ASP A CG  1 
ATOM   2164 O OD1 . ASP A 1 265 ? 58.743 30.674 111.743 1.00 13.72 ? 265  ASP A OD1 1 
ATOM   2165 O OD2 . ASP A 1 265 ? 58.537 28.500 112.040 1.00 16.38 ? 265  ASP A OD2 1 
ATOM   2166 N N   . LEU A 1 266 ? 59.069 32.847 109.240 1.00 10.87 ? 266  LEU A N   1 
ATOM   2167 C CA  . LEU A 1 266 ? 60.028 33.947 109.305 1.00 12.02 ? 266  LEU A CA  1 
ATOM   2168 C C   . LEU A 1 266 ? 61.072 33.859 110.416 1.00 12.58 ? 266  LEU A C   1 
ATOM   2169 O O   . LEU A 1 266 ? 62.199 34.322 110.252 1.00 12.80 ? 266  LEU A O   1 
ATOM   2170 C CB  . LEU A 1 266 ? 59.306 35.297 109.346 1.00 11.23 ? 266  LEU A CB  1 
ATOM   2171 C CG  . LEU A 1 266 ? 58.658 35.686 108.017 1.00 11.47 ? 266  LEU A CG  1 
ATOM   2172 C CD1 . LEU A 1 266 ? 57.871 36.972 108.184 1.00 12.09 ? 266  LEU A CD1 1 
ATOM   2173 C CD2 . LEU A 1 266 ? 59.725 35.851 106.933 1.00 12.38 ? 266  LEU A CD2 1 
ATOM   2174 N N   . GLN A 1 267 ? 60.704 33.237 111.529 1.00 13.48 ? 267  GLN A N   1 
ATOM   2175 C CA  . GLN A 1 267 ? 61.632 33.096 112.645 1.00 14.96 ? 267  GLN A CA  1 
ATOM   2176 C C   . GLN A 1 267 ? 62.776 32.156 112.266 1.00 14.45 ? 267  GLN A C   1 
ATOM   2177 O O   . GLN A 1 267 ? 63.860 32.217 112.843 1.00 14.69 ? 267  GLN A O   1 
ATOM   2178 C CB  . GLN A 1 267 ? 60.902 32.554 113.875 1.00 16.65 ? 267  GLN A CB  1 
ATOM   2179 C CG  . GLN A 1 267 ? 61.729 32.602 115.158 1.00 20.26 ? 267  GLN A CG  1 
ATOM   2180 C CD  . GLN A 1 267 ? 60.986 32.090 116.390 1.00 21.72 ? 267  GLN A CD  1 
ATOM   2181 O OE1 . GLN A 1 267 ? 61.537 32.069 117.492 1.00 24.00 ? 267  GLN A OE1 1 
ATOM   2182 N NE2 . GLN A 1 267 ? 59.737 31.683 116.211 1.00 21.82 ? 267  GLN A NE2 1 
ATOM   2183 N N   . GLN A 1 268 ? 62.515 31.270 111.311 1.00 13.86 ? 268  GLN A N   1 
ATOM   2184 C CA  . GLN A 1 268 ? 63.521 30.316 110.866 1.00 13.73 ? 268  GLN A CA  1 
ATOM   2185 C C   . GLN A 1 268 ? 64.488 30.861 109.821 1.00 13.98 ? 268  GLN A C   1 
ATOM   2186 O O   . GLN A 1 268 ? 65.404 30.162 109.398 1.00 13.52 ? 268  GLN A O   1 
ATOM   2187 C CB  . GLN A 1 268 ? 62.852 29.035 110.377 1.00 13.44 ? 268  GLN A CB  1 
ATOM   2188 C CG  . GLN A 1 268 ? 62.322 28.171 111.506 1.00 13.67 ? 268  GLN A CG  1 
ATOM   2189 C CD  . GLN A 1 268 ? 63.433 27.591 112.374 1.00 14.69 ? 268  GLN A CD  1 
ATOM   2190 O OE1 . GLN A 1 268 ? 64.208 26.759 111.928 1.00 14.54 ? 268  GLN A OE1 1 
ATOM   2191 N NE2 . GLN A 1 268 ? 63.508 28.030 113.615 1.00 13.59 ? 268  GLN A NE2 1 
ATOM   2192 N N   . GLU A 1 269 ? 64.266 32.087 109.359 1.00 14.70 ? 269  GLU A N   1 
ATOM   2193 C CA  . GLU A 1 269 ? 65.192 32.670 108.392 1.00 16.24 ? 269  GLU A CA  1 
ATOM   2194 C C   . GLU A 1 269 ? 66.507 32.939 109.125 1.00 17.51 ? 269  GLU A C   1 
ATOM   2195 O O   . GLU A 1 269 ? 66.498 33.396 110.263 1.00 18.05 ? 269  GLU A O   1 
ATOM   2196 C CB  . GLU A 1 269 ? 64.617 33.948 107.769 1.00 15.34 ? 269  GLU A CB  1 
ATOM   2197 C CG  . GLU A 1 269 ? 63.491 33.689 106.772 1.00 14.36 ? 269  GLU A CG  1 
ATOM   2198 C CD  . GLU A 1 269 ? 63.942 32.870 105.572 1.00 13.36 ? 269  GLU A CD  1 
ATOM   2199 O OE1 . GLU A 1 269 ? 64.933 33.254 104.918 1.00 14.73 ? 269  GLU A OE1 1 
ATOM   2200 O OE2 . GLU A 1 269 ? 63.304 31.839 105.280 1.00 13.18 ? 269  GLU A OE2 1 
ATOM   2201 N N   . SER A 1 270 ? 67.626 32.630 108.479 1.00 18.64 ? 270  SER A N   1 
ATOM   2202 C CA  . SER A 1 270 ? 68.947 32.807 109.083 1.00 20.22 ? 270  SER A CA  1 
ATOM   2203 C C   . SER A 1 270 ? 69.295 34.227 109.545 1.00 20.74 ? 270  SER A C   1 
ATOM   2204 O O   . SER A 1 270 ? 69.916 34.409 110.594 1.00 21.16 ? 270  SER A O   1 
ATOM   2205 C CB  . SER A 1 270 ? 70.027 32.279 108.136 1.00 20.48 ? 270  SER A CB  1 
ATOM   2206 O OG  . SER A 1 270 ? 69.806 30.912 107.825 1.00 22.15 ? 270  SER A OG  1 
ATOM   2207 N N   . ASN A 1 271 ? 68.864 35.231 108.785 1.00 20.56 ? 271  ASN A N   1 
ATOM   2208 C CA  . ASN A 1 271 ? 69.163 36.625 109.120 1.00 19.69 ? 271  ASN A CA  1 
ATOM   2209 C C   . ASN A 1 271 ? 68.155 37.575 108.470 1.00 18.88 ? 271  ASN A C   1 
ATOM   2210 O O   . ASN A 1 271 ? 68.524 38.491 107.740 1.00 19.32 ? 271  ASN A O   1 
ATOM   2211 C CB  . ASN A 1 271 ? 70.588 36.959 108.657 1.00 21.15 ? 271  ASN A CB  1 
ATOM   2212 C CG  . ASN A 1 271 ? 71.041 38.340 109.088 1.00 22.06 ? 271  ASN A CG  1 
ATOM   2213 O OD1 . ASN A 1 271 ? 70.721 38.804 110.181 1.00 22.86 ? 271  ASN A OD1 1 
ATOM   2214 N ND2 . ASN A 1 271 ? 71.811 38.998 108.231 1.00 23.38 ? 271  ASN A ND2 1 
ATOM   2215 N N   . GLY A 1 272 ? 66.878 37.352 108.753 1.00 16.87 ? 272  GLY A N   1 
ATOM   2216 C CA  . GLY A 1 272 ? 65.826 38.173 108.182 1.00 15.16 ? 272  GLY A CA  1 
ATOM   2217 C C   . GLY A 1 272 ? 65.611 37.876 106.707 1.00 14.58 ? 272  GLY A C   1 
ATOM   2218 O O   . GLY A 1 272 ? 66.095 36.866 106.195 1.00 14.63 ? 272  GLY A O   1 
ATOM   2219 N N   . ILE A 1 273 ? 64.880 38.751 106.026 1.00 13.50 ? 273  ILE A N   1 
ATOM   2220 C CA  . ILE A 1 273 ? 64.603 38.585 104.603 1.00 13.23 ? 273  ILE A CA  1 
ATOM   2221 C C   . ILE A 1 273 ? 65.780 39.135 103.795 1.00 13.23 ? 273  ILE A C   1 
ATOM   2222 O O   . ILE A 1 273 ? 65.935 40.351 103.646 1.00 13.80 ? 273  ILE A O   1 
ATOM   2223 C CB  . ILE A 1 273 ? 63.293 39.311 104.225 1.00 11.95 ? 273  ILE A CB  1 
ATOM   2224 C CG1 . ILE A 1 273 ? 62.131 38.690 105.000 1.00 10.56 ? 273  ILE A CG1 1 
ATOM   2225 C CG2 . ILE A 1 273 ? 63.053 39.251 102.717 1.00 11.32 ? 273  ILE A CG2 1 
ATOM   2226 C CD1 . ILE A 1 273 ? 60.835 39.447 104.887 1.00 11.54 ? 273  ILE A CD1 1 
ATOM   2227 N N   . THR A 1 274 ? 66.605 38.232 103.274 1.00 13.45 ? 274  THR A N   1 
ATOM   2228 C CA  . THR A 1 274 ? 67.788 38.619 102.510 1.00 13.91 ? 274  THR A CA  1 
ATOM   2229 C C   . THR A 1 274 ? 67.878 38.003 101.115 1.00 13.69 ? 274  THR A C   1 
ATOM   2230 O O   . THR A 1 274 ? 68.775 38.341 100.344 1.00 13.84 ? 274  THR A O   1 
ATOM   2231 C CB  . THR A 1 274 ? 69.082 38.243 103.268 1.00 15.16 ? 274  THR A CB  1 
ATOM   2232 O OG1 . THR A 1 274 ? 69.109 36.827 103.490 1.00 15.81 ? 274  THR A OG1 1 
ATOM   2233 C CG2 . THR A 1 274 ? 69.159 38.963 104.607 1.00 15.53 ? 274  THR A CG2 1 
ATOM   2234 N N   . GLY A 1 275 ? 66.975 37.077 100.810 1.00 13.09 ? 275  GLY A N   1 
ATOM   2235 C CA  . GLY A 1 275 ? 66.989 36.451 99.500  1.00 12.92 ? 275  GLY A CA  1 
ATOM   2236 C C   . GLY A 1 275 ? 65.826 35.497 99.354  1.00 12.16 ? 275  GLY A C   1 
ATOM   2237 O O   . GLY A 1 275 ? 64.760 35.709 99.950  1.00 12.05 ? 275  GLY A O   1 
ATOM   2238 N N   . ILE A 1 276 ? 66.027 34.439 98.580  1.00 11.73 ? 276  ILE A N   1 
ATOM   2239 C CA  . ILE A 1 276 ? 64.986 33.440 98.382  1.00 12.07 ? 276  ILE A CA  1 
ATOM   2240 C C   . ILE A 1 276 ? 64.698 32.828 99.755  1.00 11.98 ? 276  ILE A C   1 
ATOM   2241 O O   . ILE A 1 276 ? 65.610 32.358 100.442 1.00 11.56 ? 276  ILE A O   1 
ATOM   2242 C CB  . ILE A 1 276 ? 65.423 32.348 97.379  1.00 12.17 ? 276  ILE A CB  1 
ATOM   2243 C CG1 . ILE A 1 276 ? 65.688 32.968 96.005  1.00 11.96 ? 276  ILE A CG1 1 
ATOM   2244 C CG2 . ILE A 1 276 ? 64.361 31.259 97.288  1.00 12.64 ? 276  ILE A CG2 1 
ATOM   2245 C CD1 . ILE A 1 276 ? 64.456 33.572 95.315  1.00 12.35 ? 276  ILE A CD1 1 
ATOM   2246 N N   . LEU A 1 277 ? 63.443 32.894 100.180 1.00 10.88 ? 277  LEU A N   1 
ATOM   2247 C CA  . LEU A 1 277 ? 63.069 32.376 101.483 1.00 11.12 ? 277  LEU A CA  1 
ATOM   2248 C C   . LEU A 1 277 ? 63.095 30.849 101.551 1.00 10.52 ? 277  LEU A C   1 
ATOM   2249 O O   . LEU A 1 277 ? 63.055 30.164 100.528 1.00 10.56 ? 277  LEU A O   1 
ATOM   2250 C CB  . LEU A 1 277 ? 61.692 32.920 101.881 1.00 11.11 ? 277  LEU A CB  1 
ATOM   2251 C CG  . LEU A 1 277 ? 61.554 34.447 101.865 1.00 11.99 ? 277  LEU A CG  1 
ATOM   2252 C CD1 . LEU A 1 277 ? 60.162 34.852 102.321 1.00 12.57 ? 277  LEU A CD1 1 
ATOM   2253 C CD2 . LEU A 1 277 ? 62.608 35.069 102.761 1.00 11.01 ? 277  LEU A CD2 1 
ATOM   2254 N N   . LYS A 1 278 ? 63.178 30.330 102.771 1.00 10.59 ? 278  LYS A N   1 
ATOM   2255 C CA  . LYS A 1 278 ? 63.197 28.889 103.018 1.00 11.11 ? 278  LYS A CA  1 
ATOM   2256 C C   . LYS A 1 278 ? 61.771 28.356 102.955 1.00 10.55 ? 278  LYS A C   1 
ATOM   2257 O O   . LYS A 1 278 ? 61.177 27.988 103.963 1.00 11.31 ? 278  LYS A O   1 
ATOM   2258 C CB  . LYS A 1 278 ? 63.838 28.597 104.375 1.00 12.84 ? 278  LYS A CB  1 
ATOM   2259 C CG  . LYS A 1 278 ? 65.316 28.959 104.404 1.00 14.60 ? 278  LYS A CG  1 
ATOM   2260 C CD  . LYS A 1 278 ? 65.856 29.248 105.791 1.00 17.43 ? 278  LYS A CD  1 
ATOM   2261 C CE  . LYS A 1 278 ? 65.817 28.043 106.692 1.00 18.65 ? 278  LYS A CE  1 
ATOM   2262 N NZ  . LYS A 1 278 ? 66.690 28.288 107.874 1.00 18.79 ? 278  LYS A NZ  1 
ATOM   2263 N N   . TRP A 1 279 ? 61.235 28.311 101.747 1.00 8.89  ? 279  TRP A N   1 
ATOM   2264 C CA  . TRP A 1 279 ? 59.869 27.860 101.536 1.00 8.48  ? 279  TRP A CA  1 
ATOM   2265 C C   . TRP A 1 279 ? 59.654 26.391 101.868 1.00 8.31  ? 279  TRP A C   1 
ATOM   2266 O O   . TRP A 1 279 ? 60.480 25.538 101.526 1.00 8.93  ? 279  TRP A O   1 
ATOM   2267 C CB  . TRP A 1 279 ? 59.457 28.089 100.078 1.00 8.58  ? 279  TRP A CB  1 
ATOM   2268 C CG  . TRP A 1 279 ? 59.485 29.530 99.652  1.00 8.64  ? 279  TRP A CG  1 
ATOM   2269 C CD1 . TRP A 1 279 ? 60.367 30.121 98.790  1.00 8.35  ? 279  TRP A CD1 1 
ATOM   2270 C CD2 . TRP A 1 279 ? 58.589 30.560 100.073 1.00 8.17  ? 279  TRP A CD2 1 
ATOM   2271 N NE1 . TRP A 1 279 ? 60.070 31.459 98.653  1.00 9.03  ? 279  TRP A NE1 1 
ATOM   2272 C CE2 . TRP A 1 279 ? 58.980 31.752 99.428  1.00 8.23  ? 279  TRP A CE2 1 
ATOM   2273 C CE3 . TRP A 1 279 ? 57.486 30.591 100.936 1.00 7.29  ? 279  TRP A CE3 1 
ATOM   2274 C CZ2 . TRP A 1 279 ? 58.313 32.959 99.618  1.00 7.88  ? 279  TRP A CZ2 1 
ATOM   2275 C CZ3 . TRP A 1 279 ? 56.820 31.799 101.129 1.00 7.45  ? 279  TRP A CZ3 1 
ATOM   2276 C CH2 . TRP A 1 279 ? 57.236 32.965 100.468 1.00 8.19  ? 279  TRP A CH2 1 
ATOM   2277 N N   . VAL A 1 280 ? 58.552 26.117 102.560 1.00 7.47  ? 280  VAL A N   1 
ATOM   2278 C CA  . VAL A 1 280 ? 58.147 24.748 102.887 1.00 7.82  ? 280  VAL A CA  1 
ATOM   2279 C C   . VAL A 1 280 ? 56.936 24.542 101.972 1.00 8.14  ? 280  VAL A C   1 
ATOM   2280 O O   . VAL A 1 280 ? 55.925 25.255 102.080 1.00 7.28  ? 280  VAL A O   1 
ATOM   2281 C CB  . VAL A 1 280 ? 57.753 24.604 104.362 1.00 8.34  ? 280  VAL A CB  1 
ATOM   2282 C CG1 . VAL A 1 280 ? 57.311 23.173 104.636 1.00 9.57  ? 280  VAL A CG1 1 
ATOM   2283 C CG2 . VAL A 1 280 ? 58.935 24.995 105.259 1.00 9.14  ? 280  VAL A CG2 1 
ATOM   2284 N N   . LYS A 1 281 ? 57.050 23.589 101.057 1.00 8.10  ? 281  LYS A N   1 
ATOM   2285 C CA  . LYS A 1 281 ? 56.010 23.323 100.078 1.00 9.09  ? 281  LYS A CA  1 
ATOM   2286 C C   . LYS A 1 281 ? 54.898 22.422 100.622 1.00 9.50  ? 281  LYS A C   1 
ATOM   2287 O O   . LYS A 1 281 ? 54.731 21.278 100.200 1.00 10.96 ? 281  LYS A O   1 
ATOM   2288 C CB  . LYS A 1 281 ? 56.650 22.773 98.793  1.00 9.54  ? 281  LYS A CB  1 
ATOM   2289 C CG  . LYS A 1 281 ? 57.803 23.672 98.321  1.00 11.22 ? 281  LYS A CG  1 
ATOM   2290 C CD  . LYS A 1 281 ? 58.396 23.260 96.992  1.00 11.64 ? 281  LYS A CD  1 
ATOM   2291 C CE  . LYS A 1 281 ? 59.444 24.271 96.542  1.00 13.28 ? 281  LYS A CE  1 
ATOM   2292 N NZ  . LYS A 1 281 ? 60.072 23.915 95.241  1.00 14.52 ? 281  LYS A NZ  1 
ATOM   2293 N N   . LEU A 1 282 ? 54.090 23.003 101.504 1.00 9.00  ? 282  LEU A N   1 
ATOM   2294 C CA  . LEU A 1 282 ? 52.979 22.301 102.149 1.00 9.43  ? 282  LEU A CA  1 
ATOM   2295 C C   . LEU A 1 282 ? 52.062 21.608 101.144 1.00 9.26  ? 282  LEU A C   1 
ATOM   2296 O O   . LEU A 1 282 ? 51.793 20.412 101.259 1.00 9.30  ? 282  LEU A O   1 
ATOM   2297 C CB  . LEU A 1 282 ? 52.175 23.280 103.012 1.00 9.40  ? 282  LEU A CB  1 
ATOM   2298 C CG  . LEU A 1 282 ? 51.001 22.697 103.798 1.00 10.67 ? 282  LEU A CG  1 
ATOM   2299 C CD1 . LEU A 1 282 ? 51.511 21.867 104.960 1.00 11.11 ? 282  LEU A CD1 1 
ATOM   2300 C CD2 . LEU A 1 282 ? 50.138 23.823 104.312 1.00 11.52 ? 282  LEU A CD2 1 
ATOM   2301 N N   . ILE A 1 283 ? 51.508 22.395 100.227 1.00 9.47  ? 283  ILE A N   1 
ATOM   2302 C CA  . ILE A 1 283 ? 50.646 21.871 99.174  1.00 9.31  ? 283  ILE A CA  1 
ATOM   2303 C C   . ILE A 1 283 ? 51.369 22.224 97.881  1.00 9.11  ? 283  ILE A C   1 
ATOM   2304 O O   . ILE A 1 283 ? 51.357 23.371 97.444  1.00 9.05  ? 283  ILE A O   1 
ATOM   2305 C CB  . ILE A 1 283 ? 49.264 22.539 99.179  1.00 10.33 ? 283  ILE A CB  1 
ATOM   2306 C CG1 . ILE A 1 283 ? 48.616 22.420 100.563 1.00 11.89 ? 283  ILE A CG1 1 
ATOM   2307 C CG2 . ILE A 1 283 ? 48.396 21.914 98.089  1.00 10.54 ? 283  ILE A CG2 1 
ATOM   2308 C CD1 . ILE A 1 283 ? 48.227 21.021 100.936 1.00 13.33 ? 283  ILE A CD1 1 
ATOM   2309 N N   . ASP A 1 284 ? 51.987 21.234 97.256  1.00 8.44  ? 284  ASP A N   1 
ATOM   2310 C CA  . ASP A 1 284 ? 52.773 21.486 96.062  1.00 9.45  ? 284  ASP A CA  1 
ATOM   2311 C C   . ASP A 1 284 ? 52.170 20.956 94.770  1.00 9.42  ? 284  ASP A C   1 
ATOM   2312 O O   . ASP A 1 284 ? 52.813 20.232 94.013  1.00 10.20 ? 284  ASP A O   1 
ATOM   2313 C CB  . ASP A 1 284 ? 54.186 20.936 96.280  1.00 10.44 ? 284  ASP A CB  1 
ATOM   2314 C CG  . ASP A 1 284 ? 55.218 21.603 95.398  1.00 11.14 ? 284  ASP A CG  1 
ATOM   2315 O OD1 . ASP A 1 284 ? 56.232 20.947 95.074  1.00 13.25 ? 284  ASP A OD1 1 
ATOM   2316 O OD2 . ASP A 1 284 ? 55.019 22.777 95.024  1.00 10.76 ? 284  ASP A OD2 1 
ATOM   2317 N N   . ASN A 1 285 ? 50.923 21.322 94.519  1.00 8.62  ? 285  ASN A N   1 
ATOM   2318 C CA  . ASN A 1 285 ? 50.222 20.904 93.313  1.00 8.63  ? 285  ASN A CA  1 
ATOM   2319 C C   . ASN A 1 285 ? 49.051 21.866 93.128  1.00 9.01  ? 285  ASN A C   1 
ATOM   2320 O O   . ASN A 1 285 ? 48.804 22.707 93.985  1.00 8.42  ? 285  ASN A O   1 
ATOM   2321 C CB  . ASN A 1 285 ? 49.710 19.472 93.467  1.00 9.22  ? 285  ASN A CB  1 
ATOM   2322 C CG  . ASN A 1 285 ? 48.825 19.303 94.677  1.00 9.96  ? 285  ASN A CG  1 
ATOM   2323 O OD1 . ASN A 1 285 ? 47.724 19.866 94.739  1.00 10.37 ? 285  ASN A OD1 1 
ATOM   2324 N ND2 . ASN A 1 285 ? 49.305 18.549 95.664  1.00 10.52 ? 285  ASN A ND2 1 
ATOM   2325 N N   . PHE A 1 286 ? 48.358 21.745 92.004  1.00 8.68  ? 286  PHE A N   1 
ATOM   2326 C CA  . PHE A 1 286 ? 47.212 22.594 91.683  1.00 8.58  ? 286  PHE A CA  1 
ATOM   2327 C C   . PHE A 1 286 ? 45.894 21.807 91.736  1.00 9.59  ? 286  PHE A C   1 
ATOM   2328 O O   . PHE A 1 286 ? 44.983 22.053 90.951  1.00 9.94  ? 286  PHE A O   1 
ATOM   2329 C CB  . PHE A 1 286 ? 47.376 23.203 90.285  1.00 9.00  ? 286  PHE A CB  1 
ATOM   2330 C CG  . PHE A 1 286 ? 48.524 24.169 90.154  1.00 9.12  ? 286  PHE A CG  1 
ATOM   2331 C CD1 . PHE A 1 286 ? 49.551 23.924 89.248  1.00 10.02 ? 286  PHE A CD1 1 
ATOM   2332 C CD2 . PHE A 1 286 ? 48.542 25.362 90.872  1.00 9.68  ? 286  PHE A CD2 1 
ATOM   2333 C CE1 . PHE A 1 286 ? 50.574 24.852 89.053  1.00 10.78 ? 286  PHE A CE1 1 
ATOM   2334 C CE2 . PHE A 1 286 ? 49.563 26.300 90.685  1.00 10.48 ? 286  PHE A CE2 1 
ATOM   2335 C CZ  . PHE A 1 286 ? 50.578 26.048 89.771  1.00 10.53 ? 286  PHE A CZ  1 
ATOM   2336 N N   . GLU A 1 287 ? 45.783 20.895 92.691  1.00 9.38  ? 287  GLU A N   1 
ATOM   2337 C CA  . GLU A 1 287 ? 44.578 20.085 92.814  1.00 10.05 ? 287  GLU A CA  1 
ATOM   2338 C C   . GLU A 1 287 ? 43.427 20.722 93.592  1.00 9.56  ? 287  GLU A C   1 
ATOM   2339 O O   . GLU A 1 287 ? 42.283 20.283 93.484  1.00 10.86 ? 287  GLU A O   1 
ATOM   2340 C CB  . GLU A 1 287 ? 44.940 18.730 93.419  1.00 11.35 ? 287  GLU A CB  1 
ATOM   2341 C CG  . GLU A 1 287 ? 45.924 17.947 92.561  1.00 14.73 ? 287  GLU A CG  1 
ATOM   2342 C CD  . GLU A 1 287 ? 46.420 16.678 93.220  1.00 17.36 ? 287  GLU A CD  1 
ATOM   2343 O OE1 . GLU A 1 287 ? 45.606 15.955 93.826  1.00 19.02 ? 287  GLU A OE1 1 
ATOM   2344 O OE2 . GLU A 1 287 ? 47.634 16.406 93.131  1.00 19.46 ? 287  GLU A OE2 1 
ATOM   2345 N N   . GLY A 1 288 ? 43.719 21.750 94.375  1.00 8.75  ? 288  GLY A N   1 
ATOM   2346 C CA  . GLY A 1 288 ? 42.661 22.384 95.145  1.00 8.41  ? 288  GLY A CA  1 
ATOM   2347 C C   . GLY A 1 288 ? 42.977 23.796 95.584  1.00 8.07  ? 288  GLY A C   1 
ATOM   2348 O O   . GLY A 1 288 ? 44.112 24.252 95.477  1.00 8.32  ? 288  GLY A O   1 
ATOM   2349 N N   . GLU A 1 289 ? 41.946 24.491 96.052  1.00 8.25  ? 289  GLU A N   1 
ATOM   2350 C CA  . GLU A 1 289 ? 42.074 25.853 96.547  1.00 8.90  ? 289  GLU A CA  1 
ATOM   2351 C C   . GLU A 1 289 ? 42.289 25.791 98.056  1.00 7.60  ? 289  GLU A C   1 
ATOM   2352 O O   . GLU A 1 289 ? 41.671 24.978 98.734  1.00 7.86  ? 289  GLU A O   1 
ATOM   2353 C CB  . GLU A 1 289 ? 40.787 26.640 96.263  1.00 10.60 ? 289  GLU A CB  1 
ATOM   2354 C CG  . GLU A 1 289 ? 40.810 28.093 96.733  1.00 14.46 ? 289  GLU A CG  1 
ATOM   2355 C CD  . GLU A 1 289 ? 41.435 29.048 95.739  1.00 15.44 ? 289  GLU A CD  1 
ATOM   2356 O OE1 . GLU A 1 289 ? 41.636 30.227 96.087  1.00 16.11 ? 289  GLU A OE1 1 
ATOM   2357 O OE2 . GLU A 1 289 ? 41.724 28.639 94.603  1.00 17.30 ? 289  GLU A OE2 1 
ATOM   2358 N N   . TYR A 1 290 ? 43.206 26.614 98.556  1.00 7.13  ? 290  TYR A N   1 
ATOM   2359 C CA  . TYR A 1 290 ? 43.492 26.716 99.983  1.00 6.82  ? 290  TYR A CA  1 
ATOM   2360 C C   . TYR A 1 290 ? 43.623 28.196 100.287 1.00 7.38  ? 290  TYR A C   1 
ATOM   2361 O O   . TYR A 1 290 ? 44.613 28.826 99.917  1.00 7.86  ? 290  TYR A O   1 
ATOM   2362 C CB  . TYR A 1 290 ? 44.769 25.960 100.355 1.00 7.56  ? 290  TYR A CB  1 
ATOM   2363 C CG  . TYR A 1 290 ? 44.674 24.484 100.034 1.00 6.95  ? 290  TYR A CG  1 
ATOM   2364 C CD1 . TYR A 1 290 ? 45.120 23.995 98.811  1.00 8.08  ? 290  TYR A CD1 1 
ATOM   2365 C CD2 . TYR A 1 290 ? 44.058 23.593 100.917 1.00 8.21  ? 290  TYR A CD2 1 
ATOM   2366 C CE1 . TYR A 1 290 ? 44.945 22.663 98.462  1.00 8.34  ? 290  TYR A CE1 1 
ATOM   2367 C CE2 . TYR A 1 290 ? 43.884 22.259 100.582 1.00 8.07  ? 290  TYR A CE2 1 
ATOM   2368 C CZ  . TYR A 1 290 ? 44.326 21.798 99.354  1.00 8.83  ? 290  TYR A CZ  1 
ATOM   2369 O OH  . TYR A 1 290 ? 44.149 20.471 99.031  1.00 10.28 ? 290  TYR A OH  1 
ATOM   2370 N N   . ASP A 1 291 ? 42.571 28.751 100.873 1.00 7.73  ? 291  ASP A N   1 
ATOM   2371 C CA  . ASP A 1 291 ? 42.504 30.160 101.228 1.00 7.86  ? 291  ASP A CA  1 
ATOM   2372 C C   . ASP A 1 291 ? 42.661 30.298 102.723 1.00 7.47  ? 291  ASP A C   1 
ATOM   2373 O O   . ASP A 1 291 ? 41.866 29.767 103.487 1.00 6.96  ? 291  ASP A O   1 
ATOM   2374 C CB  . ASP A 1 291 ? 41.162 30.755 100.781 1.00 9.79  ? 291  ASP A CB  1 
ATOM   2375 C CG  . ASP A 1 291 ? 41.049 30.870 99.278  1.00 11.92 ? 291  ASP A CG  1 
ATOM   2376 O OD1 . ASP A 1 291 ? 42.063 30.639 98.592  1.00 14.23 ? 291  ASP A OD1 1 
ATOM   2377 O OD2 . ASP A 1 291 ? 39.946 31.207 98.787  1.00 15.30 ? 291  ASP A OD2 1 
ATOM   2378 N N   . TYR A 1 292 ? 43.696 31.016 103.130 1.00 7.22  ? 292  TYR A N   1 
ATOM   2379 C CA  . TYR A 1 292 ? 43.989 31.207 104.537 1.00 7.11  ? 292  TYR A CA  1 
ATOM   2380 C C   . TYR A 1 292 ? 42.916 31.996 105.268 1.00 7.12  ? 292  TYR A C   1 
ATOM   2381 O O   . TYR A 1 292 ? 42.562 33.090 104.853 1.00 7.42  ? 292  TYR A O   1 
ATOM   2382 C CB  . TYR A 1 292 ? 45.315 31.947 104.698 1.00 7.39  ? 292  TYR A CB  1 
ATOM   2383 C CG  . TYR A 1 292 ? 45.652 32.333 106.115 1.00 7.84  ? 292  TYR A CG  1 
ATOM   2384 C CD1 . TYR A 1 292 ? 46.007 31.371 107.057 1.00 7.55  ? 292  TYR A CD1 1 
ATOM   2385 C CD2 . TYR A 1 292 ? 45.656 33.669 106.503 1.00 8.08  ? 292  TYR A CD2 1 
ATOM   2386 C CE1 . TYR A 1 292 ? 46.368 31.737 108.358 1.00 8.03  ? 292  TYR A CE1 1 
ATOM   2387 C CE2 . TYR A 1 292 ? 46.013 34.049 107.804 1.00 7.30  ? 292  TYR A CE2 1 
ATOM   2388 C CZ  . TYR A 1 292 ? 46.367 33.078 108.723 1.00 8.47  ? 292  TYR A CZ  1 
ATOM   2389 O OH  . TYR A 1 292 ? 46.704 33.475 109.998 1.00 7.99  ? 292  TYR A OH  1 
ATOM   2390 N N   . VAL A 1 293 ? 42.440 31.439 106.380 1.00 7.21  ? 293  VAL A N   1 
ATOM   2391 C CA  . VAL A 1 293 ? 41.439 32.101 107.218 1.00 8.20  ? 293  VAL A CA  1 
ATOM   2392 C C   . VAL A 1 293 ? 42.132 32.619 108.484 1.00 8.60  ? 293  VAL A C   1 
ATOM   2393 O O   . VAL A 1 293 ? 42.052 33.806 108.812 1.00 9.36  ? 293  VAL A O   1 
ATOM   2394 C CB  . VAL A 1 293 ? 40.277 31.149 107.563 1.00 8.31  ? 293  VAL A CB  1 
ATOM   2395 C CG1 . VAL A 1 293 ? 39.322 31.830 108.545 1.00 8.89  ? 293  VAL A CG1 1 
ATOM   2396 C CG2 . VAL A 1 293 ? 39.527 30.754 106.287 1.00 7.83  ? 293  VAL A CG2 1 
ATOM   2397 N N   . THR A 1 294 ? 42.794 31.724 109.212 1.00 8.29  ? 294  THR A N   1 
ATOM   2398 C CA  . THR A 1 294 ? 43.538 32.113 110.412 1.00 8.46  ? 294  THR A CA  1 
ATOM   2399 C C   . THR A 1 294 ? 44.376 30.934 110.884 1.00 8.15  ? 294  THR A C   1 
ATOM   2400 O O   . THR A 1 294 ? 44.377 29.873 110.255 1.00 7.30  ? 294  THR A O   1 
ATOM   2401 C CB  . THR A 1 294 ? 42.600 32.565 111.578 1.00 9.18  ? 294  THR A CB  1 
ATOM   2402 O OG1 . THR A 1 294 ? 43.372 33.270 112.564 1.00 8.40  ? 294  THR A OG1 1 
ATOM   2403 C CG2 . THR A 1 294 ? 41.912 31.372 112.246 1.00 9.57  ? 294  THR A CG2 1 
ATOM   2404 N N   . ASN A 1 295 ? 45.173 31.162 111.913 1.00 8.74  ? 295  ASN A N   1 
ATOM   2405 C CA  . ASN A 1 295 ? 45.946 30.079 112.501 1.00 8.43  ? 295  ASN A CA  1 
ATOM   2406 C C   . ASN A 1 295 ? 46.064 30.289 113.996 1.00 9.32  ? 295  ASN A C   1 
ATOM   2407 O O   . ASN A 1 295 ? 45.852 31.395 114.498 1.00 9.93  ? 295  ASN A O   1 
ATOM   2408 C CB  . ASN A 1 295 ? 47.346 29.935 111.881 1.00 7.93  ? 295  ASN A CB  1 
ATOM   2409 C CG  . ASN A 1 295 ? 48.280 31.085 112.226 1.00 8.52  ? 295  ASN A CG  1 
ATOM   2410 O OD1 . ASN A 1 295 ? 48.124 32.191 111.733 1.00 7.38  ? 295  ASN A OD1 1 
ATOM   2411 N ND2 . ASN A 1 295 ? 49.267 30.814 113.065 1.00 8.61  ? 295  ASN A ND2 1 
ATOM   2412 N N   . GLU A 1 296 ? 46.319 29.194 114.698 1.00 9.89  ? 296  GLU A N   1 
ATOM   2413 C CA  . GLU A 1 296 ? 46.529 29.206 116.137 1.00 9.87  ? 296  GLU A CA  1 
ATOM   2414 C C   . GLU A 1 296 ? 47.773 28.346 116.260 1.00 9.35  ? 296  GLU A C   1 
ATOM   2415 O O   . GLU A 1 296 ? 47.710 27.115 116.181 1.00 9.61  ? 296  GLU A O   1 
ATOM   2416 C CB  . GLU A 1 296 ? 45.340 28.587 116.863 1.00 10.96 ? 296  GLU A CB  1 
ATOM   2417 C CG  . GLU A 1 296 ? 44.116 29.490 116.910 1.00 11.97 ? 296  GLU A CG  1 
ATOM   2418 C CD  . GLU A 1 296 ? 44.339 30.759 117.720 1.00 13.98 ? 296  GLU A CD  1 
ATOM   2419 O OE1 . GLU A 1 296 ? 45.198 30.769 118.628 1.00 15.62 ? 296  GLU A OE1 1 
ATOM   2420 O OE2 . GLU A 1 296 ? 43.642 31.750 117.450 1.00 14.00 ? 296  GLU A OE2 1 
ATOM   2421 N N   . GLY A 1 297 ? 48.921 29.002 116.349 1.00 9.44  ? 297  GLY A N   1 
ATOM   2422 C CA  . GLY A 1 297 ? 50.164 28.260 116.389 1.00 9.46  ? 297  GLY A CA  1 
ATOM   2423 C C   . GLY A 1 297 ? 50.317 27.583 115.035 1.00 9.82  ? 297  GLY A C   1 
ATOM   2424 O O   . GLY A 1 297 ? 50.079 28.201 114.004 1.00 10.12 ? 297  GLY A O   1 
ATOM   2425 N N   . THR A 1 298 ? 50.655 26.302 115.035 1.00 9.34  ? 298  THR A N   1 
ATOM   2426 C CA  . THR A 1 298 ? 50.839 25.552 113.798 1.00 9.06  ? 298  THR A CA  1 
ATOM   2427 C C   . THR A 1 298 ? 49.537 25.029 113.164 1.00 8.69  ? 298  THR A C   1 
ATOM   2428 O O   . THR A 1 298 ? 49.581 24.381 112.123 1.00 8.61  ? 298  THR A O   1 
ATOM   2429 C CB  . THR A 1 298 ? 51.807 24.371 114.017 1.00 9.62  ? 298  THR A CB  1 
ATOM   2430 O OG1 . THR A 1 298 ? 51.265 23.480 115.001 1.00 9.47  ? 298  THR A OG1 1 
ATOM   2431 C CG2 . THR A 1 298 ? 53.185 24.877 114.474 1.00 10.73 ? 298  THR A CG2 1 
ATOM   2432 N N   . VAL A 1 299 ? 48.393 25.268 113.801 1.00 8.89  ? 299  VAL A N   1 
ATOM   2433 C CA  . VAL A 1 299 ? 47.111 24.814 113.258 1.00 9.02  ? 299  VAL A CA  1 
ATOM   2434 C C   . VAL A 1 299 ? 46.497 25.907 112.379 1.00 8.35  ? 299  VAL A C   1 
ATOM   2435 O O   . VAL A 1 299 ? 46.019 26.932 112.870 1.00 8.65  ? 299  VAL A O   1 
ATOM   2436 C CB  . VAL A 1 299 ? 46.141 24.396 114.377 1.00 9.32  ? 299  VAL A CB  1 
ATOM   2437 C CG1 . VAL A 1 299 ? 44.815 23.926 113.789 1.00 9.81  ? 299  VAL A CG1 1 
ATOM   2438 C CG2 . VAL A 1 299 ? 46.767 23.273 115.200 1.00 9.97  ? 299  VAL A CG2 1 
ATOM   2439 N N   . PHE A 1 300 ? 46.522 25.660 111.076 1.00 7.94  ? 300  PHE A N   1 
ATOM   2440 C CA  . PHE A 1 300 ? 46.028 26.593 110.073 1.00 7.33  ? 300  PHE A CA  1 
ATOM   2441 C C   . PHE A 1 300 ? 44.654 26.249 109.528 1.00 7.90  ? 300  PHE A C   1 
ATOM   2442 O O   . PHE A 1 300 ? 44.418 25.127 109.079 1.00 8.80  ? 300  PHE A O   1 
ATOM   2443 C CB  . PHE A 1 300 ? 47.032 26.679 108.919 1.00 7.93  ? 300  PHE A CB  1 
ATOM   2444 C CG  . PHE A 1 300 ? 48.177 27.596 109.190 1.00 7.00  ? 300  PHE A CG  1 
ATOM   2445 C CD1 . PHE A 1 300 ? 49.099 27.306 110.187 1.00 7.24  ? 300  PHE A CD1 1 
ATOM   2446 C CD2 . PHE A 1 300 ? 48.297 28.793 108.490 1.00 7.98  ? 300  PHE A CD2 1 
ATOM   2447 C CE1 . PHE A 1 300 ? 50.125 28.204 110.485 1.00 8.26  ? 300  PHE A CE1 1 
ATOM   2448 C CE2 . PHE A 1 300 ? 49.319 29.693 108.782 1.00 8.56  ? 300  PHE A CE2 1 
ATOM   2449 C CZ  . PHE A 1 300 ? 50.233 29.401 109.784 1.00 8.45  ? 300  PHE A CZ  1 
ATOM   2450 N N   . THR A 1 301 ? 43.756 27.224 109.564 1.00 7.58  ? 301  THR A N   1 
ATOM   2451 C CA  . THR A 1 301 ? 42.406 27.055 109.066 1.00 7.64  ? 301  THR A CA  1 
ATOM   2452 C C   . THR A 1 301 ? 42.333 27.612 107.642 1.00 7.60  ? 301  THR A C   1 
ATOM   2453 O O   . THR A 1 301 ? 42.689 28.773 107.420 1.00 7.77  ? 301  THR A O   1 
ATOM   2454 C CB  . THR A 1 301 ? 41.410 27.810 109.952 1.00 6.70  ? 301  THR A CB  1 
ATOM   2455 O OG1 . THR A 1 301 ? 41.530 27.354 111.304 1.00 7.57  ? 301  THR A OG1 1 
ATOM   2456 C CG2 . THR A 1 301 ? 39.988 27.578 109.477 1.00 6.76  ? 301  THR A CG2 1 
ATOM   2457 N N   . PHE A 1 302 ? 41.898 26.777 106.698 1.00 6.48  ? 302  PHE A N   1 
ATOM   2458 C CA  . PHE A 1 302 ? 41.776 27.171 105.300 1.00 7.28  ? 302  PHE A CA  1 
ATOM   2459 C C   . PHE A 1 302 ? 40.390 26.881 104.749 1.00 7.44  ? 302  PHE A C   1 
ATOM   2460 O O   . PHE A 1 302 ? 39.747 25.906 105.146 1.00 7.89  ? 302  PHE A O   1 
ATOM   2461 C CB  . PHE A 1 302 ? 42.724 26.342 104.409 1.00 7.35  ? 302  PHE A CB  1 
ATOM   2462 C CG  . PHE A 1 302 ? 44.185 26.594 104.633 1.00 7.18  ? 302  PHE A CG  1 
ATOM   2463 C CD1 . PHE A 1 302 ? 44.938 25.734 105.423 1.00 7.15  ? 302  PHE A CD1 1 
ATOM   2464 C CD2 . PHE A 1 302 ? 44.818 27.666 104.012 1.00 6.71  ? 302  PHE A CD2 1 
ATOM   2465 C CE1 . PHE A 1 302 ? 46.310 25.939 105.583 1.00 8.15  ? 302  PHE A CE1 1 
ATOM   2466 C CE2 . PHE A 1 302 ? 46.188 27.876 104.168 1.00 7.33  ? 302  PHE A CE2 1 
ATOM   2467 C CZ  . PHE A 1 302 ? 46.932 27.013 104.953 1.00 8.26  ? 302  PHE A CZ  1 
ATOM   2468 N N   . LYS A 1 303 ? 39.940 27.744 103.846 1.00 7.95  ? 303  LYS A N   1 
ATOM   2469 C CA  . LYS A 1 303 ? 38.703 27.488 103.129 1.00 7.77  ? 303  LYS A CA  1 
ATOM   2470 C C   . LYS A 1 303 ? 39.250 26.710 101.922 1.00 7.89  ? 303  LYS A C   1 
ATOM   2471 O O   . LYS A 1 303 ? 40.240 27.126 101.305 1.00 8.00  ? 303  LYS A O   1 
ATOM   2472 C CB  . LYS A 1 303 ? 38.025 28.771 102.661 1.00 9.43  ? 303  LYS A CB  1 
ATOM   2473 C CG  . LYS A 1 303 ? 36.779 28.473 101.828 1.00 10.73 ? 303  LYS A CG  1 
ATOM   2474 C CD  . LYS A 1 303 ? 36.012 29.716 101.440 1.00 12.76 ? 303  LYS A CD  1 
ATOM   2475 C CE  . LYS A 1 303 ? 36.753 30.577 100.453 1.00 15.03 ? 303  LYS A CE  1 
ATOM   2476 N NZ  . LYS A 1 303 ? 36.736 30.014 99.086  1.00 16.02 ? 303  LYS A NZ  1 
ATOM   2477 N N   . THR A 1 304 ? 38.627 25.584 101.592 1.00 6.57  ? 304  THR A N   1 
ATOM   2478 C CA  . THR A 1 304 ? 39.121 24.759 100.497 1.00 7.12  ? 304  THR A CA  1 
ATOM   2479 C C   . THR A 1 304 ? 37.989 24.152 99.695  1.00 6.99  ? 304  THR A C   1 
ATOM   2480 O O   . THR A 1 304 ? 36.846 24.111 100.144 1.00 7.61  ? 304  THR A O   1 
ATOM   2481 C CB  . THR A 1 304 ? 39.960 23.569 101.059 1.00 7.19  ? 304  THR A CB  1 
ATOM   2482 O OG1 . THR A 1 304 ? 40.542 22.821 99.986  1.00 7.57  ? 304  THR A OG1 1 
ATOM   2483 C CG2 . THR A 1 304 ? 39.077 22.610 101.870 1.00 7.51  ? 304  THR A CG2 1 
ATOM   2484 N N   . ASN A 1 305 ? 38.308 23.729 98.477  1.00 6.67  ? 305  ASN A N   1 
ATOM   2485 C CA  . ASN A 1 305 ? 37.343 23.023 97.645  1.00 7.59  ? 305  ASN A CA  1 
ATOM   2486 C C   . ASN A 1 305 ? 37.907 21.627 97.356  1.00 8.31  ? 305  ASN A C   1 
ATOM   2487 O O   . ASN A 1 305 ? 37.380 20.905 96.526  1.00 8.14  ? 305  ASN A O   1 
ATOM   2488 C CB  . ASN A 1 305 ? 37.015 23.769 96.344  1.00 7.15  ? 305  ASN A CB  1 
ATOM   2489 C CG  . ASN A 1 305 ? 38.245 24.074 95.503  1.00 7.16  ? 305  ASN A CG  1 
ATOM   2490 O OD1 . ASN A 1 305 ? 39.308 23.503 95.709  1.00 8.58  ? 305  ASN A OD1 1 
ATOM   2491 N ND2 . ASN A 1 305 ? 38.110 25.018 94.577  1.00 8.17  ? 305  ASN A ND2 1 
ATOM   2492 N N   . ARG A 1 306 ? 38.956 21.242 98.082  1.00 8.15  ? 306  ARG A N   1 
ATOM   2493 C CA  . ARG A 1 306 ? 39.564 19.923 97.900  1.00 9.66  ? 306  ARG A CA  1 
ATOM   2494 C C   . ARG A 1 306 ? 38.489 18.879 98.205  1.00 9.59  ? 306  ARG A C   1 
ATOM   2495 O O   . ARG A 1 306 ? 38.078 18.720 99.347  1.00 9.29  ? 306  ARG A O   1 
ATOM   2496 C CB  . ARG A 1 306 ? 40.754 19.777 98.852  1.00 10.71 ? 306  ARG A CB  1 
ATOM   2497 C CG  . ARG A 1 306 ? 41.363 18.386 98.951  1.00 11.94 ? 306  ARG A CG  1 
ATOM   2498 C CD  . ARG A 1 306 ? 42.095 18.004 97.696  1.00 14.16 ? 306  ARG A CD  1 
ATOM   2499 N NE  . ARG A 1 306 ? 43.029 16.913 97.961  1.00 16.03 ? 306  ARG A NE  1 
ATOM   2500 C CZ  . ARG A 1 306 ? 43.751 16.291 97.038  1.00 17.29 ? 306  ARG A CZ  1 
ATOM   2501 N NH1 . ARG A 1 306 ? 43.650 16.636 95.766  1.00 16.82 ? 306  ARG A NH1 1 
ATOM   2502 N NH2 . ARG A 1 306 ? 44.589 15.329 97.397  1.00 18.33 ? 306  ARG A NH2 1 
ATOM   2503 N N   . HIS A 1 307 ? 38.059 18.170 97.170  1.00 10.27 ? 307  HIS A N   1 
ATOM   2504 C CA  . HIS A 1 307 ? 37.017 17.151 97.253  1.00 11.70 ? 307  HIS A CA  1 
ATOM   2505 C C   . HIS A 1 307 ? 35.749 17.694 97.910  1.00 11.38 ? 307  HIS A C   1 
ATOM   2506 O O   . HIS A 1 307 ? 34.962 16.949 98.494  1.00 12.53 ? 307  HIS A O   1 
ATOM   2507 C CB  . HIS A 1 307 ? 37.532 15.886 97.949  1.00 14.14 ? 307  HIS A CB  1 
ATOM   2508 C CG  . HIS A 1 307 ? 38.605 15.179 97.179  1.00 16.01 ? 307  HIS A CG  1 
ATOM   2509 N ND1 . HIS A 1 307 ? 38.402 14.705 95.897  1.00 17.38 ? 307  HIS A ND1 1 
ATOM   2510 C CD2 . HIS A 1 307 ? 39.891 14.904 97.490  1.00 17.54 ? 307  HIS A CD2 1 
ATOM   2511 C CE1 . HIS A 1 307 ? 39.523 14.174 95.452  1.00 17.90 ? 307  HIS A CE1 1 
ATOM   2512 N NE2 . HIS A 1 307 ? 40.441 14.284 96.397  1.00 17.66 ? 307  HIS A NE2 1 
ATOM   2513 N N   . SER A 1 308 ? 35.520 18.986 97.705  1.00 10.50 ? 308  SER A N   1 
ATOM   2514 C CA  . SER A 1 308 ? 34.363 19.681 98.250  1.00 9.97  ? 308  SER A CA  1 
ATOM   2515 C C   . SER A 1 308 ? 34.037 20.835 97.308  1.00 9.16  ? 308  SER A C   1 
ATOM   2516 O O   . SER A 1 308 ? 34.370 21.988 97.580  1.00 8.61  ? 308  SER A O   1 
ATOM   2517 C CB  . SER A 1 308 ? 34.660 20.198 99.664  1.00 11.07 ? 308  SER A CB  1 
ATOM   2518 O OG  . SER A 1 308 ? 35.966 20.724 99.762  1.00 14.18 ? 308  SER A OG  1 
ATOM   2519 N N   . PRO A 1 309 ? 33.291 20.542 96.228  1.00 9.09  ? 309  PRO A N   1 
ATOM   2520 C CA  . PRO A 1 309 ? 32.908 21.545 95.229  1.00 9.24  ? 309  PRO A CA  1 
ATOM   2521 C C   . PRO A 1 309 ? 32.161 22.769 95.767  1.00 8.73  ? 309  PRO A C   1 
ATOM   2522 O O   . PRO A 1 309 ? 32.172 23.827 95.140  1.00 8.09  ? 309  PRO A O   1 
ATOM   2523 C CB  . PRO A 1 309 ? 32.043 20.744 94.256  1.00 10.52 ? 309  PRO A CB  1 
ATOM   2524 C CG  . PRO A 1 309 ? 32.513 19.333 94.421  1.00 12.20 ? 309  PRO A CG  1 
ATOM   2525 C CD  . PRO A 1 309 ? 32.751 19.215 95.885  1.00 9.23  ? 309  PRO A CD  1 
ATOM   2526 N N   . ASN A 1 310 ? 31.459 22.617 96.888  1.00 8.03  ? 310  ASN A N   1 
ATOM   2527 C CA  . ASN A 1 310 ? 30.722 23.733 97.493  1.00 8.35  ? 310  ASN A CA  1 
ATOM   2528 C C   . ASN A 1 310 ? 31.517 24.443 98.585  1.00 7.63  ? 310  ASN A C   1 
ATOM   2529 O O   . ASN A 1 310 ? 31.006 25.354 99.236  1.00 7.55  ? 310  ASN A O   1 
ATOM   2530 C CB  . ASN A 1 310 ? 29.381 23.268 98.070  1.00 9.09  ? 310  ASN A CB  1 
ATOM   2531 C CG  . ASN A 1 310 ? 28.425 22.771 97.006  1.00 9.55  ? 310  ASN A CG  1 
ATOM   2532 O OD1 . ASN A 1 310 ? 27.583 21.913 97.261  1.00 11.51 ? 310  ASN A OD1 1 
ATOM   2533 N ND2 . ASN A 1 310 ? 28.531 23.322 95.816  1.00 8.80  ? 310  ASN A ND2 1 
ATOM   2534 N N   . TYR A 1 311 ? 32.761 24.005 98.765  1.00 7.78  ? 311  TYR A N   1 
ATOM   2535 C CA  . TYR A 1 311 ? 33.714 24.542 99.739  1.00 7.16  ? 311  TYR A CA  1 
ATOM   2536 C C   . TYR A 1 311 ? 33.424 24.175 101.191 1.00 7.62  ? 311  TYR A C   1 
ATOM   2537 O O   . TYR A 1 311 ? 32.284 23.899 101.556 1.00 8.18  ? 311  TYR A O   1 
ATOM   2538 C CB  . TYR A 1 311 ? 33.893 26.057 99.566  1.00 7.42  ? 311  TYR A CB  1 
ATOM   2539 C CG  . TYR A 1 311 ? 34.427 26.446 98.203  1.00 8.41  ? 311  TYR A CG  1 
ATOM   2540 C CD1 . TYR A 1 311 ? 33.595 26.462 97.082  1.00 8.01  ? 311  TYR A CD1 1 
ATOM   2541 C CD2 . TYR A 1 311 ? 35.769 26.782 98.031  1.00 8.57  ? 311  TYR A CD2 1 
ATOM   2542 C CE1 . TYR A 1 311 ? 34.089 26.798 95.820  1.00 8.23  ? 311  TYR A CE1 1 
ATOM   2543 C CE2 . TYR A 1 311 ? 36.272 27.124 96.775  1.00 9.55  ? 311  TYR A CE2 1 
ATOM   2544 C CZ  . TYR A 1 311 ? 35.433 27.127 95.682  1.00 9.47  ? 311  TYR A CZ  1 
ATOM   2545 O OH  . TYR A 1 311 ? 35.960 27.438 94.451  1.00 10.12 ? 311  TYR A OH  1 
ATOM   2546 N N   . ARG A 1 312 ? 34.483 24.153 101.995 1.00 7.67  ? 312  ARG A N   1 
ATOM   2547 C CA  . ARG A 1 312 ? 34.395 23.813 103.409 1.00 7.69  ? 312  ARG A CA  1 
ATOM   2548 C C   . ARG A 1 312 ? 35.627 24.351 104.127 1.00 8.16  ? 312  ARG A C   1 
ATOM   2549 O O   . ARG A 1 312 ? 36.547 24.859 103.493 1.00 8.14  ? 312  ARG A O   1 
ATOM   2550 C CB  . ARG A 1 312 ? 34.330 22.289 103.580 1.00 8.70  ? 312  ARG A CB  1 
ATOM   2551 C CG  . ARG A 1 312 ? 35.605 21.536 103.202 1.00 9.72  ? 312  ARG A CG  1 
ATOM   2552 C CD  . ARG A 1 312 ? 35.382 20.043 103.363 1.00 11.52 ? 312  ARG A CD  1 
ATOM   2553 N NE  . ARG A 1 312 ? 36.600 19.248 103.253 1.00 13.80 ? 312  ARG A NE  1 
ATOM   2554 C CZ  . ARG A 1 312 ? 36.655 17.942 103.504 1.00 14.97 ? 312  ARG A CZ  1 
ATOM   2555 N NH1 . ARG A 1 312 ? 35.562 17.287 103.870 1.00 15.90 ? 312  ARG A NH1 1 
ATOM   2556 N NH2 . ARG A 1 312 ? 37.809 17.293 103.441 1.00 15.86 ? 312  ARG A NH2 1 
ATOM   2557 N N   . LEU A 1 313 ? 35.621 24.276 105.451 1.00 7.74  ? 313  LEU A N   1 
ATOM   2558 C CA  . LEU A 1 313 ? 36.762 24.716 106.241 1.00 7.92  ? 313  LEU A CA  1 
ATOM   2559 C C   . LEU A 1 313 ? 37.504 23.528 106.826 1.00 7.93  ? 313  LEU A C   1 
ATOM   2560 O O   . LEU A 1 313 ? 36.903 22.642 107.447 1.00 8.66  ? 313  LEU A O   1 
ATOM   2561 C CB  . LEU A 1 313 ? 36.331 25.625 107.386 1.00 8.22  ? 313  LEU A CB  1 
ATOM   2562 C CG  . LEU A 1 313 ? 35.867 27.035 107.039 1.00 8.46  ? 313  LEU A CG  1 
ATOM   2563 C CD1 . LEU A 1 313 ? 35.413 27.739 108.297 1.00 9.97  ? 313  LEU A CD1 1 
ATOM   2564 C CD2 . LEU A 1 313 ? 37.003 27.802 106.373 1.00 11.10 ? 313  LEU A CD2 1 
ATOM   2565 N N   . ILE A 1 314 ? 38.816 23.522 106.628 1.00 7.89  ? 314  ILE A N   1 
ATOM   2566 C CA  . ILE A 1 314 ? 39.671 22.469 107.151 1.00 7.12  ? 314  ILE A CA  1 
ATOM   2567 C C   . ILE A 1 314 ? 40.793 23.082 107.978 1.00 7.33  ? 314  ILE A C   1 
ATOM   2568 O O   . ILE A 1 314 ? 41.128 24.256 107.821 1.00 7.40  ? 314  ILE A O   1 
ATOM   2569 C CB  . ILE A 1 314 ? 40.310 21.612 106.033 1.00 8.13  ? 314  ILE A CB  1 
ATOM   2570 C CG1 . ILE A 1 314 ? 41.109 22.503 105.086 1.00 8.12  ? 314  ILE A CG1 1 
ATOM   2571 C CG2 . ILE A 1 314 ? 39.256 20.783 105.310 1.00 9.29  ? 314  ILE A CG2 1 
ATOM   2572 C CD1 . ILE A 1 314 ? 41.985 21.739 104.133 1.00 9.92  ? 314  ILE A CD1 1 
ATOM   2573 N N   . ASN A 1 315 ? 41.321 22.289 108.896 1.00 7.50  ? 315  ASN A N   1 
ATOM   2574 C CA  . ASN A 1 315 ? 42.446 22.682 109.727 1.00 7.72  ? 315  ASN A CA  1 
ATOM   2575 C C   . ASN A 1 315 ? 43.610 21.769 109.359 1.00 7.70  ? 315  ASN A C   1 
ATOM   2576 O O   . ASN A 1 315 ? 43.489 20.545 109.407 1.00 7.97  ? 315  ASN A O   1 
ATOM   2577 C CB  . ASN A 1 315 ? 42.161 22.480 111.209 1.00 7.74  ? 315  ASN A CB  1 
ATOM   2578 C CG  . ASN A 1 315 ? 41.397 23.626 111.842 1.00 8.53  ? 315  ASN A CG  1 
ATOM   2579 O OD1 . ASN A 1 315 ? 41.068 23.558 113.020 1.00 10.91 ? 315  ASN A OD1 1 
ATOM   2580 N ND2 . ASN A 1 315 ? 41.132 24.683 111.091 1.00 7.61  ? 315  ASN A ND2 1 
ATOM   2581 N N   . ILE A 1 316 ? 44.711 22.371 108.932 1.00 7.58  ? 316  ILE A N   1 
ATOM   2582 C CA  . ILE A 1 316 ? 45.913 21.630 108.581 1.00 8.22  ? 316  ILE A CA  1 
ATOM   2583 C C   . ILE A 1 316 ? 46.960 22.025 109.623 1.00 8.28  ? 316  ILE A C   1 
ATOM   2584 O O   . ILE A 1 316 ? 47.231 23.211 109.823 1.00 8.45  ? 316  ILE A O   1 
ATOM   2585 C CB  . ILE A 1 316 ? 46.455 22.014 107.175 1.00 8.67  ? 316  ILE A CB  1 
ATOM   2586 C CG1 . ILE A 1 316 ? 45.433 21.686 106.086 1.00 8.39  ? 316  ILE A CG1 1 
ATOM   2587 C CG2 . ILE A 1 316 ? 47.770 21.272 106.910 1.00 8.87  ? 316  ILE A CG2 1 
ATOM   2588 C CD1 . ILE A 1 316 ? 45.883 22.064 104.672 1.00 9.27  ? 316  ILE A CD1 1 
ATOM   2589 N N   . ASP A 1 317 ? 47.501 21.045 110.335 1.00 8.79  ? 317  ASP A N   1 
ATOM   2590 C CA  . ASP A 1 317 ? 48.524 21.304 111.336 1.00 9.85  ? 317  ASP A CA  1 
ATOM   2591 C C   . ASP A 1 317 ? 49.879 21.155 110.641 1.00 9.42  ? 317  ASP A C   1 
ATOM   2592 O O   . ASP A 1 317 ? 50.205 20.077 110.148 1.00 8.45  ? 317  ASP A O   1 
ATOM   2593 C CB  . ASP A 1 317 ? 48.394 20.289 112.477 1.00 10.92 ? 317  ASP A CB  1 
ATOM   2594 C CG  . ASP A 1 317 ? 49.250 20.639 113.683 1.00 11.69 ? 317  ASP A CG  1 
ATOM   2595 O OD1 . ASP A 1 317 ? 50.298 21.299 113.527 1.00 10.27 ? 317  ASP A OD1 1 
ATOM   2596 O OD2 . ASP A 1 317 ? 48.872 20.239 114.801 1.00 12.54 ? 317  ASP A OD2 1 
ATOM   2597 N N   . PHE A 1 318 ? 50.661 22.228 110.590 1.00 9.23  ? 318  PHE A N   1 
ATOM   2598 C CA  . PHE A 1 318 ? 51.968 22.176 109.945 1.00 9.56  ? 318  PHE A CA  1 
ATOM   2599 C C   . PHE A 1 318 ? 52.886 21.105 110.544 1.00 9.89  ? 318  PHE A C   1 
ATOM   2600 O O   . PHE A 1 318 ? 53.824 20.662 109.886 1.00 10.33 ? 318  PHE A O   1 
ATOM   2601 C CB  . PHE A 1 318 ? 52.677 23.534 110.015 1.00 9.13  ? 318  PHE A CB  1 
ATOM   2602 C CG  . PHE A 1 318 ? 52.093 24.599 109.116 1.00 8.69  ? 318  PHE A CG  1 
ATOM   2603 C CD1 . PHE A 1 318 ? 52.679 25.860 109.084 1.00 9.08  ? 318  PHE A CD1 1 
ATOM   2604 C CD2 . PHE A 1 318 ? 50.990 24.353 108.299 1.00 8.60  ? 318  PHE A CD2 1 
ATOM   2605 C CE1 . PHE A 1 318 ? 52.183 26.856 108.258 1.00 9.36  ? 318  PHE A CE1 1 
ATOM   2606 C CE2 . PHE A 1 318 ? 50.485 25.348 107.466 1.00 9.71  ? 318  PHE A CE2 1 
ATOM   2607 C CZ  . PHE A 1 318 ? 51.085 26.602 107.445 1.00 8.97  ? 318  PHE A CZ  1 
ATOM   2608 N N   . THR A 1 319 ? 52.629 20.693 111.782 1.00 10.77 ? 319  THR A N   1 
ATOM   2609 C CA  . THR A 1 319 ? 53.460 19.668 112.413 1.00 11.94 ? 319  THR A CA  1 
ATOM   2610 C C   . THR A 1 319 ? 53.015 18.239 112.094 1.00 12.10 ? 319  THR A C   1 
ATOM   2611 O O   . THR A 1 319 ? 53.706 17.287 112.445 1.00 12.68 ? 319  THR A O   1 
ATOM   2612 C CB  . THR A 1 319 ? 53.499 19.816 113.945 1.00 12.96 ? 319  THR A CB  1 
ATOM   2613 O OG1 . THR A 1 319 ? 52.195 19.587 114.486 1.00 14.09 ? 319  THR A OG1 1 
ATOM   2614 C CG2 . THR A 1 319 ? 53.953 21.203 114.333 1.00 13.75 ? 319  THR A CG2 1 
ATOM   2615 N N   . ASP A 1 320 ? 51.862 18.095 111.450 1.00 11.29 ? 320  ASP A N   1 
ATOM   2616 C CA  . ASP A 1 320 ? 51.319 16.782 111.082 1.00 11.72 ? 320  ASP A CA  1 
ATOM   2617 C C   . ASP A 1 320 ? 50.481 17.103 109.843 1.00 11.86 ? 320  ASP A C   1 
ATOM   2618 O O   . ASP A 1 320 ? 49.262 16.890 109.814 1.00 11.06 ? 320  ASP A O   1 
ATOM   2619 C CB  . ASP A 1 320 ? 50.439 16.268 112.229 1.00 13.08 ? 320  ASP A CB  1 
ATOM   2620 C CG  . ASP A 1 320 ? 50.112 14.791 112.116 1.00 14.65 ? 320  ASP A CG  1 
ATOM   2621 O OD1 . ASP A 1 320 ? 49.094 14.379 112.704 1.00 16.59 ? 320  ASP A OD1 1 
ATOM   2622 O OD2 . ASP A 1 320 ? 50.863 14.046 111.457 1.00 15.32 ? 320  ASP A OD2 1 
ATOM   2623 N N   . PRO A 1 321 ? 51.156 17.537 108.767 1.00 12.32 ? 321  PRO A N   1 
ATOM   2624 C CA  . PRO A 1 321 ? 50.580 17.942 107.484 1.00 12.73 ? 321  PRO A CA  1 
ATOM   2625 C C   . PRO A 1 321 ? 49.896 16.982 106.517 1.00 13.31 ? 321  PRO A C   1 
ATOM   2626 O O   . PRO A 1 321 ? 49.254 17.450 105.579 1.00 12.93 ? 321  PRO A O   1 
ATOM   2627 C CB  . PRO A 1 321 ? 51.754 18.640 106.818 1.00 12.93 ? 321  PRO A CB  1 
ATOM   2628 C CG  . PRO A 1 321 ? 52.884 17.754 107.195 1.00 13.00 ? 321  PRO A CG  1 
ATOM   2629 C CD  . PRO A 1 321 ? 52.631 17.508 108.673 1.00 12.11 ? 321  PRO A CD  1 
ATOM   2630 N N   . GLU A 1 322 ? 50.067 15.674 106.683 1.00 13.59 ? 322  GLU A N   1 
ATOM   2631 C CA  . GLU A 1 322 ? 49.442 14.720 105.766 1.00 14.22 ? 322  GLU A CA  1 
ATOM   2632 C C   . GLU A 1 322 ? 47.935 14.922 105.678 1.00 13.25 ? 322  GLU A C   1 
ATOM   2633 O O   . GLU A 1 322 ? 47.274 15.135 106.687 1.00 11.90 ? 322  GLU A O   1 
ATOM   2634 C CB  . GLU A 1 322 ? 49.745 13.279 106.174 1.00 16.62 ? 322  GLU A CB  1 
ATOM   2635 C CG  . GLU A 1 322 ? 51.181 12.849 105.948 1.00 20.21 ? 322  GLU A CG  1 
ATOM   2636 C CD  . GLU A 1 322 ? 51.445 11.449 106.467 1.00 22.71 ? 322  GLU A CD  1 
ATOM   2637 O OE1 . GLU A 1 322 ? 51.460 11.266 107.701 1.00 23.71 ? 322  GLU A OE1 1 
ATOM   2638 O OE2 . GLU A 1 322 ? 51.613 10.535 105.636 1.00 24.88 ? 322  GLU A OE2 1 
ATOM   2639 N N   . GLU A 1 323 ? 47.395 14.785 104.473 1.00 12.69 ? 323  GLU A N   1 
ATOM   2640 C CA  . GLU A 1 323 ? 45.969 14.975 104.240 1.00 13.19 ? 323  GLU A CA  1 
ATOM   2641 C C   . GLU A 1 323 ? 45.070 14.111 105.124 1.00 12.97 ? 323  GLU A C   1 
ATOM   2642 O O   . GLU A 1 323 ? 44.012 14.554 105.558 1.00 12.93 ? 323  GLU A O   1 
ATOM   2643 C CB  . GLU A 1 323 ? 45.627 14.752 102.767 1.00 13.38 ? 323  GLU A CB  1 
ATOM   2644 C CG  . GLU A 1 323 ? 44.173 15.063 102.429 1.00 13.82 ? 323  GLU A CG  1 
ATOM   2645 C CD  . GLU A 1 323 ? 43.877 15.010 100.947 1.00 14.63 ? 323  GLU A CD  1 
ATOM   2646 O OE1 . GLU A 1 323 ? 44.746 14.572 100.171 1.00 14.81 ? 323  GLU A OE1 1 
ATOM   2647 O OE2 . GLU A 1 323 ? 42.762 15.410 100.554 1.00 14.57 ? 323  GLU A OE2 1 
ATOM   2648 N N   . SER A 1 324 ? 45.508 12.892 105.415 1.00 12.80 ? 324  SER A N   1 
ATOM   2649 C CA  . SER A 1 324 ? 44.729 11.996 106.261 1.00 13.68 ? 324  SER A CA  1 
ATOM   2650 C C   . SER A 1 324 ? 44.552 12.559 107.678 1.00 13.83 ? 324  SER A C   1 
ATOM   2651 O O   . SER A 1 324 ? 43.681 12.115 108.417 1.00 14.26 ? 324  SER A O   1 
ATOM   2652 C CB  . SER A 1 324 ? 45.406 10.625 106.336 1.00 14.58 ? 324  SER A CB  1 
ATOM   2653 O OG  . SER A 1 324 ? 46.739 10.748 106.812 1.00 16.47 ? 324  SER A OG  1 
ATOM   2654 N N   . LYS A 1 325 ? 45.398 13.519 108.044 1.00 13.66 ? 325  LYS A N   1 
ATOM   2655 C CA  . LYS A 1 325 ? 45.348 14.116 109.372 1.00 13.56 ? 325  LYS A CA  1 
ATOM   2656 C C   . LYS A 1 325 ? 44.542 15.409 109.454 1.00 12.53 ? 325  LYS A C   1 
ATOM   2657 O O   . LYS A 1 325 ? 44.214 15.865 110.541 1.00 12.15 ? 325  LYS A O   1 
ATOM   2658 C CB  . LYS A 1 325 ? 46.768 14.376 109.880 1.00 15.60 ? 325  LYS A CB  1 
ATOM   2659 C CG  . LYS A 1 325 ? 47.667 13.146 109.893 1.00 18.29 ? 325  LYS A CG  1 
ATOM   2660 C CD  . LYS A 1 325 ? 47.087 12.050 110.767 1.00 21.76 ? 325  LYS A CD  1 
ATOM   2661 C CE  . LYS A 1 325 ? 48.058 10.897 110.905 1.00 23.72 ? 325  LYS A CE  1 
ATOM   2662 N NZ  . LYS A 1 325 ? 47.507 9.822  111.773 1.00 25.87 ? 325  LYS A NZ  1 
ATOM   2663 N N   . TRP A 1 326 ? 44.210 16.001 108.318 1.00 11.94 ? 326  TRP A N   1 
ATOM   2664 C CA  . TRP A 1 326 ? 43.456 17.251 108.351 1.00 11.83 ? 326  TRP A CA  1 
ATOM   2665 C C   . TRP A 1 326 ? 42.126 17.107 109.085 1.00 11.75 ? 326  TRP A C   1 
ATOM   2666 O O   . TRP A 1 326 ? 41.455 16.074 108.990 1.00 12.17 ? 326  TRP A O   1 
ATOM   2667 C CB  . TRP A 1 326 ? 43.177 17.736 106.934 1.00 11.17 ? 326  TRP A CB  1 
ATOM   2668 C CG  . TRP A 1 326 ? 44.384 17.998 106.081 1.00 11.04 ? 326  TRP A CG  1 
ATOM   2669 C CD1 . TRP A 1 326 ? 45.696 17.979 106.468 1.00 10.90 ? 326  TRP A CD1 1 
ATOM   2670 C CD2 . TRP A 1 326 ? 44.382 18.306 104.688 1.00 11.50 ? 326  TRP A CD2 1 
ATOM   2671 N NE1 . TRP A 1 326 ? 46.510 18.253 105.393 1.00 11.85 ? 326  TRP A NE1 1 
ATOM   2672 C CE2 . TRP A 1 326 ? 45.727 18.459 104.284 1.00 11.14 ? 326  TRP A CE2 1 
ATOM   2673 C CE3 . TRP A 1 326 ? 43.367 18.470 103.731 1.00 11.20 ? 326  TRP A CE3 1 
ATOM   2674 C CZ2 . TRP A 1 326 ? 46.087 18.765 102.967 1.00 11.37 ? 326  TRP A CZ2 1 
ATOM   2675 C CZ3 . TRP A 1 326 ? 43.725 18.777 102.423 1.00 11.36 ? 326  TRP A CZ3 1 
ATOM   2676 C CH2 . TRP A 1 326 ? 45.072 18.920 102.053 1.00 11.20 ? 326  TRP A CH2 1 
ATOM   2677 N N   . LYS A 1 327 ? 41.735 18.142 109.815 1.00 11.79 ? 327  LYS A N   1 
ATOM   2678 C CA  . LYS A 1 327 ? 40.460 18.109 110.512 1.00 12.02 ? 327  LYS A CA  1 
ATOM   2679 C C   . LYS A 1 327 ? 39.463 18.936 109.711 1.00 11.73 ? 327  LYS A C   1 
ATOM   2680 O O   . LYS A 1 327 ? 39.812 19.989 109.176 1.00 11.74 ? 327  LYS A O   1 
ATOM   2681 C CB  . LYS A 1 327 ? 40.578 18.709 111.918 1.00 12.83 ? 327  LYS A CB  1 
ATOM   2682 C CG  . LYS A 1 327 ? 39.216 18.985 112.568 1.00 16.01 ? 327  LYS A CG  1 
ATOM   2683 C CD  . LYS A 1 327 ? 39.304 19.756 113.870 1.00 17.80 ? 327  LYS A CD  1 
ATOM   2684 C CE  . LYS A 1 327 ? 37.910 20.067 114.397 1.00 18.65 ? 327  LYS A CE  1 
ATOM   2685 N NZ  . LYS A 1 327 ? 37.946 20.747 115.722 1.00 20.69 ? 327  LYS A NZ  1 
ATOM   2686 N N   . VAL A 1 328 ? 38.240 18.443 109.584 1.00 11.65 ? 328  VAL A N   1 
ATOM   2687 C CA  . VAL A 1 328 ? 37.195 19.178 108.879 1.00 11.84 ? 328  VAL A CA  1 
ATOM   2688 C C   . VAL A 1 328 ? 36.461 20.000 109.944 1.00 11.43 ? 328  VAL A C   1 
ATOM   2689 O O   . VAL A 1 328 ? 35.720 19.455 110.759 1.00 12.68 ? 328  VAL A O   1 
ATOM   2690 C CB  . VAL A 1 328 ? 36.211 18.231 108.143 1.00 11.96 ? 328  VAL A CB  1 
ATOM   2691 C CG1 . VAL A 1 328 ? 35.175 19.048 107.380 1.00 12.91 ? 328  VAL A CG1 1 
ATOM   2692 C CG2 . VAL A 1 328 ? 36.979 17.313 107.190 1.00 12.24 ? 328  VAL A CG2 1 
ATOM   2693 N N   . LEU A 1 329 ? 36.747 21.296 109.979 1.00 10.38 ? 329  LEU A N   1 
ATOM   2694 C CA  . LEU A 1 329 ? 36.148 22.204 110.952 1.00 9.96  ? 329  LEU A CA  1 
ATOM   2695 C C   . LEU A 1 329 ? 34.676 22.528 110.653 1.00 9.12  ? 329  LEU A C   1 
ATOM   2696 O O   . LEU A 1 329 ? 33.829 22.505 111.544 1.00 9.49  ? 329  LEU A O   1 
ATOM   2697 C CB  . LEU A 1 329 ? 36.975 23.484 111.020 1.00 10.08 ? 329  LEU A CB  1 
ATOM   2698 C CG  . LEU A 1 329 ? 36.676 24.447 112.162 1.00 9.58  ? 329  LEU A CG  1 
ATOM   2699 C CD1 . LEU A 1 329 ? 36.960 23.809 113.524 1.00 9.88  ? 329  LEU A CD1 1 
ATOM   2700 C CD2 . LEU A 1 329 ? 37.510 25.701 111.967 1.00 9.12  ? 329  LEU A CD2 1 
ATOM   2701 N N   . VAL A 1 330 ? 34.393 22.903 109.406 1.00 8.77  ? 330  VAL A N   1 
ATOM   2702 C CA  . VAL A 1 330 ? 33.026 23.198 108.973 1.00 8.32  ? 330  VAL A CA  1 
ATOM   2703 C C   . VAL A 1 330 ? 32.836 22.411 107.684 1.00 7.63  ? 330  VAL A C   1 
ATOM   2704 O O   . VAL A 1 330 ? 33.389 22.769 106.641 1.00 7.58  ? 330  VAL A O   1 
ATOM   2705 C CB  . VAL A 1 330 ? 32.783 24.713 108.715 1.00 8.04  ? 330  VAL A CB  1 
ATOM   2706 C CG1 . VAL A 1 330 ? 31.367 24.931 108.186 1.00 8.61  ? 330  VAL A CG1 1 
ATOM   2707 C CG2 . VAL A 1 330 ? 32.985 25.519 109.990 1.00 8.15  ? 330  VAL A CG2 1 
ATOM   2708 N N   . PRO A 1 331 ? 32.129 21.268 107.759 1.00 7.98  ? 331  PRO A N   1 
ATOM   2709 C CA  . PRO A 1 331 ? 31.900 20.447 106.571 1.00 8.66  ? 331  PRO A CA  1 
ATOM   2710 C C   . PRO A 1 331 ? 31.178 21.163 105.446 1.00 8.54  ? 331  PRO A C   1 
ATOM   2711 O O   . PRO A 1 331 ? 30.487 22.162 105.644 1.00 9.25  ? 331  PRO A O   1 
ATOM   2712 C CB  . PRO A 1 331 ? 31.055 19.289 107.111 1.00 8.47  ? 331  PRO A CB  1 
ATOM   2713 C CG  . PRO A 1 331 ? 31.529 19.144 108.516 1.00 8.95  ? 331  PRO A CG  1 
ATOM   2714 C CD  . PRO A 1 331 ? 31.666 20.580 108.980 1.00 8.32  ? 331  PRO A CD  1 
ATOM   2715 N N   . GLU A 1 332 ? 31.337 20.606 104.259 1.00 8.74  ? 332  GLU A N   1 
ATOM   2716 C CA  . GLU A 1 332 ? 30.718 21.117 103.052 1.00 9.41  ? 332  GLU A CA  1 
ATOM   2717 C C   . GLU A 1 332 ? 29.202 20.961 103.134 1.00 10.41 ? 332  GLU A C   1 
ATOM   2718 O O   . GLU A 1 332 ? 28.697 20.009 103.743 1.00 10.79 ? 332  GLU A O   1 
ATOM   2719 C CB  . GLU A 1 332 ? 31.236 20.313 101.857 1.00 9.02  ? 332  GLU A CB  1 
ATOM   2720 C CG  . GLU A 1 332 ? 30.650 20.742 100.530 1.00 9.57  ? 332  GLU A CG  1 
ATOM   2721 C CD  . GLU A 1 332 ? 30.970 19.778 99.401  1.00 9.06  ? 332  GLU A CD  1 
ATOM   2722 O OE1 . GLU A 1 332 ? 30.833 20.177 98.235  1.00 8.95  ? 332  GLU A OE1 1 
ATOM   2723 O OE2 . GLU A 1 332 ? 31.359 18.625 99.658  1.00 10.33 ? 332  GLU A OE2 1 
ATOM   2724 N N   . HIS A 1 333 ? 28.484 21.915 102.558 1.00 11.35 ? 333  HIS A N   1 
ATOM   2725 C CA  . HIS A 1 333 ? 27.036 21.831 102.520 1.00 12.39 ? 333  HIS A CA  1 
ATOM   2726 C C   . HIS A 1 333 ? 26.667 21.157 101.196 1.00 12.85 ? 333  HIS A C   1 
ATOM   2727 O O   . HIS A 1 333 ? 27.374 21.272 100.211 1.00 11.40 ? 333  HIS A O   1 
ATOM   2728 C CB  . HIS A 1 333 ? 26.393 23.218 102.652 1.00 14.76 ? 333  HIS A CB  1 
ATOM   2729 C CG  . HIS A 1 333 ? 26.195 23.641 104.071 1.00 18.22 ? 333  HIS A CG  1 
ATOM   2730 N ND1 . HIS A 1 333 ? 25.144 23.183 104.841 1.00 19.85 ? 333  HIS A ND1 1 
ATOM   2731 C CD2 . HIS A 1 333 ? 26.942 24.430 104.879 1.00 19.71 ? 333  HIS A CD2 1 
ATOM   2732 C CE1 . HIS A 1 333 ? 25.260 23.664 106.061 1.00 20.54 ? 333  HIS A CE1 1 
ATOM   2733 N NE2 . HIS A 1 333 ? 26.340 24.425 106.113 1.00 20.43 ? 333  HIS A NE2 1 
ATOM   2734 N N   . GLU A 1 334 ? 25.536 20.477 101.193 1.00 13.25 ? 334  GLU A N   1 
ATOM   2735 C CA  . GLU A 1 334 ? 25.037 19.749 100.044 1.00 14.64 ? 334  GLU A CA  1 
ATOM   2736 C C   . GLU A 1 334 ? 24.804 20.624 98.823  1.00 13.64 ? 334  GLU A C   1 
ATOM   2737 O O   . GLU A 1 334 ? 25.019 20.179 97.701  1.00 13.47 ? 334  GLU A O   1 
ATOM   2738 C CB  . GLU A 1 334 ? 23.737 19.030 100.430 1.00 16.96 ? 334  GLU A CB  1 
ATOM   2739 C CG  . GLU A 1 334 ? 23.229 17.991 99.444  1.00 21.15 ? 334  GLU A CG  1 
ATOM   2740 C CD  . GLU A 1 334 ? 22.055 17.204 100.002 1.00 23.31 ? 334  GLU A CD  1 
ATOM   2741 O OE1 . GLU A 1 334 ? 22.247 16.482 101.004 1.00 24.52 ? 334  GLU A OE1 1 
ATOM   2742 O OE2 . GLU A 1 334 ? 20.943 17.319 99.446  1.00 24.68 ? 334  GLU A OE2 1 
ATOM   2743 N N   . LYS A 1 335 ? 24.376 21.863 99.043  1.00 13.06 ? 335  LYS A N   1 
ATOM   2744 C CA  . LYS A 1 335 ? 24.098 22.761 97.927  1.00 13.63 ? 335  LYS A CA  1 
ATOM   2745 C C   . LYS A 1 335 ? 24.647 24.179 98.082  1.00 12.79 ? 335  LYS A C   1 
ATOM   2746 O O   . LYS A 1 335 ? 25.106 24.774 97.108  1.00 12.95 ? 335  LYS A O   1 
ATOM   2747 C CB  . LYS A 1 335 ? 22.590 22.806 97.673  1.00 15.24 ? 335  LYS A CB  1 
ATOM   2748 C CG  . LYS A 1 335 ? 22.181 23.493 96.381  1.00 17.73 ? 335  LYS A CG  1 
ATOM   2749 C CD  . LYS A 1 335 ? 20.709 23.262 96.071  1.00 18.55 ? 335  LYS A CD  1 
ATOM   2750 C CE  . LYS A 1 335 ? 19.789 23.866 97.120  1.00 19.77 ? 335  LYS A CE  1 
ATOM   2751 N NZ  . LYS A 1 335 ? 19.863 25.350 97.150  1.00 19.96 ? 335  LYS A NZ  1 
ATOM   2752 N N   . ASP A 1 336 ? 24.608 24.717 99.296  1.00 11.52 ? 336  ASP A N   1 
ATOM   2753 C CA  . ASP A 1 336 ? 25.093 26.075 99.535  1.00 11.40 ? 336  ASP A CA  1 
ATOM   2754 C C   . ASP A 1 336 ? 26.600 26.223 99.451  1.00 10.55 ? 336  ASP A C   1 
ATOM   2755 O O   . ASP A 1 336 ? 27.347 25.467 100.068 1.00 10.39 ? 336  ASP A O   1 
ATOM   2756 C CB  . ASP A 1 336 ? 24.580 26.593 100.881 1.00 12.57 ? 336  ASP A CB  1 
ATOM   2757 C CG  . ASP A 1 336 ? 23.064 26.712 100.919 1.00 13.75 ? 336  ASP A CG  1 
ATOM   2758 O OD1 . ASP A 1 336 ? 22.426 26.566 99.857  1.00 13.92 ? 336  ASP A OD1 1 
ATOM   2759 O OD2 . ASP A 1 336 ? 22.516 26.962 102.012 1.00 15.58 ? 336  ASP A OD2 1 
ATOM   2760 N N   . VAL A 1 337 ? 27.032 27.245 98.724  1.00 9.37  ? 337  VAL A N   1 
ATOM   2761 C CA  . VAL A 1 337 ? 28.443 27.515 98.539  1.00 8.96  ? 337  VAL A CA  1 
ATOM   2762 C C   . VAL A 1 337 ? 29.003 28.420 99.627  1.00 7.95  ? 337  VAL A C   1 
ATOM   2763 O O   . VAL A 1 337 ? 28.443 29.478 99.921  1.00 8.64  ? 337  VAL A O   1 
ATOM   2764 C CB  . VAL A 1 337 ? 28.704 28.184 97.163  1.00 9.20  ? 337  VAL A CB  1 
ATOM   2765 C CG1 . VAL A 1 337 ? 30.183 28.532 97.011  1.00 9.69  ? 337  VAL A CG1 1 
ATOM   2766 C CG2 . VAL A 1 337 ? 28.258 27.263 96.035  1.00 11.13 ? 337  VAL A CG2 1 
ATOM   2767 N N   . LEU A 1 338 ? 30.092 27.984 100.252 1.00 8.09  ? 338  LEU A N   1 
ATOM   2768 C CA  . LEU A 1 338 ? 30.755 28.796 101.261 1.00 8.69  ? 338  LEU A CA  1 
ATOM   2769 C C   . LEU A 1 338 ? 31.625 29.734 100.421 1.00 8.91  ? 338  LEU A C   1 
ATOM   2770 O O   . LEU A 1 338 ? 32.639 29.306 99.872  1.00 9.35  ? 338  LEU A O   1 
ATOM   2771 C CB  . LEU A 1 338 ? 31.626 27.933 102.182 1.00 8.55  ? 338  LEU A CB  1 
ATOM   2772 C CG  . LEU A 1 338 ? 32.446 28.641 103.271 1.00 7.65  ? 338  LEU A CG  1 
ATOM   2773 C CD1 . LEU A 1 338 ? 31.575 29.568 104.114 1.00 7.85  ? 338  LEU A CD1 1 
ATOM   2774 C CD2 . LEU A 1 338 ? 33.132 27.599 104.138 1.00 7.47  ? 338  LEU A CD2 1 
ATOM   2775 N N   . GLU A 1 339 ? 31.210 30.994 100.307 1.00 8.94  ? 339  GLU A N   1 
ATOM   2776 C CA  . GLU A 1 339 ? 31.922 31.984 99.494  1.00 10.21 ? 339  GLU A CA  1 
ATOM   2777 C C   . GLU A 1 339 ? 33.217 32.493 100.094 1.00 9.94  ? 339  GLU A C   1 
ATOM   2778 O O   . GLU A 1 339 ? 34.237 32.583 99.418  1.00 9.80  ? 339  GLU A O   1 
ATOM   2779 C CB  . GLU A 1 339 ? 31.023 33.179 99.181  1.00 11.23 ? 339  GLU A CB  1 
ATOM   2780 C CG  . GLU A 1 339 ? 29.775 32.838 98.395  1.00 14.78 ? 339  GLU A CG  1 
ATOM   2781 C CD  . GLU A 1 339 ? 29.258 34.024 97.609  1.00 16.71 ? 339  GLU A CD  1 
ATOM   2782 O OE1 . GLU A 1 339 ? 29.082 35.100 98.215  1.00 17.99 ? 339  GLU A OE1 1 
ATOM   2783 O OE2 . GLU A 1 339 ? 29.048 33.881 96.384  1.00 18.91 ? 339  GLU A OE2 1 
ATOM   2784 N N   . TRP A 1 340 ? 33.155 32.915 101.349 1.00 9.18  ? 340  TRP A N   1 
ATOM   2785 C CA  . TRP A 1 340 ? 34.339 33.418 102.030 1.00 9.23  ? 340  TRP A CA  1 
ATOM   2786 C C   . TRP A 1 340 ? 34.169 33.296 103.531 1.00 8.97  ? 340  TRP A C   1 
ATOM   2787 O O   . TRP A 1 340 ? 33.052 33.126 104.035 1.00 8.65  ? 340  TRP A O   1 
ATOM   2788 C CB  . TRP A 1 340 ? 34.672 34.862 101.610 1.00 10.04 ? 340  TRP A CB  1 
ATOM   2789 C CG  . TRP A 1 340 ? 33.564 35.862 101.787 1.00 10.37 ? 340  TRP A CG  1 
ATOM   2790 C CD1 . TRP A 1 340 ? 32.699 36.296 100.825 1.00 10.73 ? 340  TRP A CD1 1 
ATOM   2791 C CD2 . TRP A 1 340 ? 33.224 36.571 102.984 1.00 10.46 ? 340  TRP A CD2 1 
ATOM   2792 N NE1 . TRP A 1 340 ? 31.844 37.236 101.349 1.00 10.42 ? 340  TRP A NE1 1 
ATOM   2793 C CE2 . TRP A 1 340 ? 32.142 37.425 102.673 1.00 10.52 ? 340  TRP A CE2 1 
ATOM   2794 C CE3 . TRP A 1 340 ? 33.723 36.571 104.292 1.00 10.98 ? 340  TRP A CE3 1 
ATOM   2795 C CZ2 . TRP A 1 340 ? 31.551 38.268 103.615 1.00 10.63 ? 340  TRP A CZ2 1 
ATOM   2796 C CZ3 . TRP A 1 340 ? 33.129 37.419 105.239 1.00 9.81  ? 340  TRP A CZ3 1 
ATOM   2797 C CH2 . TRP A 1 340 ? 32.051 38.253 104.888 1.00 10.22 ? 340  TRP A CH2 1 
ATOM   2798 N N   . VAL A 1 341 ? 35.298 33.335 104.225 1.00 8.21  ? 341  VAL A N   1 
ATOM   2799 C CA  . VAL A 1 341 ? 35.323 33.213 105.674 1.00 8.78  ? 341  VAL A CA  1 
ATOM   2800 C C   . VAL A 1 341 ? 36.356 34.177 106.253 1.00 9.05  ? 341  VAL A C   1 
ATOM   2801 O O   . VAL A 1 341 ? 37.452 34.318 105.719 1.00 10.49 ? 341  VAL A O   1 
ATOM   2802 C CB  . VAL A 1 341 ? 35.723 31.780 106.096 1.00 9.48  ? 341  VAL A CB  1 
ATOM   2803 C CG1 . VAL A 1 341 ? 35.651 31.632 107.610 1.00 10.76 ? 341  VAL A CG1 1 
ATOM   2804 C CG2 . VAL A 1 341 ? 34.824 30.747 105.409 1.00 10.24 ? 341  VAL A CG2 1 
ATOM   2805 N N   . ALA A 1 342 ? 35.999 34.826 107.352 1.00 7.93  ? 342  ALA A N   1 
ATOM   2806 C CA  . ALA A 1 342 ? 36.916 35.746 108.013 1.00 8.74  ? 342  ALA A CA  1 
ATOM   2807 C C   . ALA A 1 342 ? 37.012 35.374 109.484 1.00 8.31  ? 342  ALA A C   1 
ATOM   2808 O O   . ALA A 1 342 ? 36.082 34.786 110.046 1.00 10.79 ? 342  ALA A O   1 
ATOM   2809 C CB  . ALA A 1 342 ? 36.408 37.168 107.884 1.00 8.51  ? 342  ALA A CB  1 
ATOM   2810 N N   . CYS A 1 343 ? 38.164 35.637 110.086 1.00 8.43  ? 343  CYS A N   1 
ATOM   2811 C CA  . CYS A 1 343 ? 38.356 35.390 111.509 1.00 7.59  ? 343  CYS A CA  1 
ATOM   2812 C C   . CYS A 1 343 ? 38.379 36.755 112.202 1.00 7.92  ? 343  CYS A C   1 
ATOM   2813 O O   . CYS A 1 343 ? 39.107 37.660 111.792 1.00 9.94  ? 343  CYS A O   1 
ATOM   2814 C CB  . CYS A 1 343 ? 39.658 34.639 111.777 1.00 8.66  ? 343  CYS A CB  1 
ATOM   2815 S SG  . CYS A 1 343 ? 39.937 34.344 113.529 1.00 9.48  ? 343  CYS A SG  1 
ATOM   2816 N N   . VAL A 1 344 ? 37.543 36.908 113.221 1.00 8.15  ? 344  VAL A N   1 
ATOM   2817 C CA  . VAL A 1 344 ? 37.451 38.167 113.947 1.00 8.59  ? 344  VAL A CA  1 
ATOM   2818 C C   . VAL A 1 344 ? 37.329 37.930 115.453 1.00 8.56  ? 344  VAL A C   1 
ATOM   2819 O O   . VAL A 1 344 ? 36.844 36.882 115.891 1.00 9.08  ? 344  VAL A O   1 
ATOM   2820 C CB  . VAL A 1 344 ? 36.262 39.010 113.412 1.00 8.91  ? 344  VAL A CB  1 
ATOM   2821 C CG1 . VAL A 1 344 ? 34.943 38.295 113.661 1.00 9.25  ? 344  VAL A CG1 1 
ATOM   2822 C CG2 . VAL A 1 344 ? 36.273 40.404 114.009 1.00 8.93  ? 344  VAL A CG2 1 
ATOM   2823 N N   . ARG A 1 345 ? 37.786 38.909 116.236 1.00 8.99  ? 345  ARG A N   1 
ATOM   2824 C CA  . ARG A 1 345 ? 37.767 38.842 117.696 1.00 9.29  ? 345  ARG A CA  1 
ATOM   2825 C C   . ARG A 1 345 ? 38.397 37.560 118.232 1.00 9.74  ? 345  ARG A C   1 
ATOM   2826 O O   . ARG A 1 345 ? 37.823 36.867 119.082 1.00 9.60  ? 345  ARG A O   1 
ATOM   2827 C CB  . ARG A 1 345 ? 36.354 39.001 118.245 1.00 10.19 ? 345  ARG A CB  1 
ATOM   2828 C CG  . ARG A 1 345 ? 36.357 39.554 119.658 1.00 11.75 ? 345  ARG A CG  1 
ATOM   2829 C CD  . ARG A 1 345 ? 35.209 39.007 120.448 1.00 12.53 ? 345  ARG A CD  1 
ATOM   2830 N NE  . ARG A 1 345 ? 35.377 37.588 120.745 1.00 12.18 ? 345  ARG A NE  1 
ATOM   2831 C CZ  . ARG A 1 345 ? 34.598 36.905 121.576 1.00 12.27 ? 345  ARG A CZ  1 
ATOM   2832 N NH1 . ARG A 1 345 ? 33.594 37.503 122.196 1.00 13.93 ? 345  ARG A NH1 1 
ATOM   2833 N NH2 . ARG A 1 345 ? 34.820 35.624 121.790 1.00 13.03 ? 345  ARG A NH2 1 
ATOM   2834 N N   . SER A 1 346 ? 39.561 37.236 117.683 1.00 10.30 ? 346  SER A N   1 
ATOM   2835 C CA  . SER A 1 346 ? 40.346 36.062 118.055 1.00 10.57 ? 346  SER A CA  1 
ATOM   2836 C C   . SER A 1 346 ? 39.768 34.690 117.717 1.00 10.32 ? 346  SER A C   1 
ATOM   2837 O O   . SER A 1 346 ? 40.324 33.963 116.892 1.00 10.46 ? 346  SER A O   1 
ATOM   2838 C CB  . SER A 1 346 ? 40.715 36.111 119.540 1.00 11.41 ? 346  SER A CB  1 
ATOM   2839 O OG  . SER A 1 346 ? 41.578 37.205 119.818 1.00 13.93 ? 346  SER A OG  1 
ATOM   2840 N N   . ASN A 1 347 ? 38.619 34.362 118.294 1.00 10.87 ? 347  ASN A N   1 
ATOM   2841 C CA  . ASN A 1 347 ? 38.032 33.044 118.077 1.00 10.30 ? 347  ASN A CA  1 
ATOM   2842 C C   . ASN A 1 347 ? 36.662 32.960 117.409 1.00 9.25  ? 347  ASN A C   1 
ATOM   2843 O O   . ASN A 1 347 ? 35.937 31.968 117.597 1.00 9.02  ? 347  ASN A O   1 
ATOM   2844 C CB  . ASN A 1 347 ? 38.032 32.245 119.386 1.00 11.08 ? 347  ASN A CB  1 
ATOM   2845 C CG  . ASN A 1 347 ? 37.129 32.843 120.448 1.00 12.65 ? 347  ASN A CG  1 
ATOM   2846 O OD1 . ASN A 1 347 ? 36.755 32.178 121.416 1.00 15.55 ? 347  ASN A OD1 1 
ATOM   2847 N ND2 . ASN A 1 347 ? 36.798 34.102 120.292 1.00 11.76 ? 347  ASN A ND2 1 
ATOM   2848 N N   . PHE A 1 348 ? 36.295 33.987 116.650 1.00 8.85  ? 348  PHE A N   1 
ATOM   2849 C CA  . PHE A 1 348 ? 35.031 33.949 115.919 1.00 8.50  ? 348  PHE A CA  1 
ATOM   2850 C C   . PHE A 1 348 ? 35.350 33.825 114.438 1.00 8.26  ? 348  PHE A C   1 
ATOM   2851 O O   . PHE A 1 348 ? 36.394 34.284 113.980 1.00 8.62  ? 348  PHE A O   1 
ATOM   2852 C CB  . PHE A 1 348 ? 34.220 35.240 116.087 1.00 8.69  ? 348  PHE A CB  1 
ATOM   2853 C CG  . PHE A 1 348 ? 33.419 35.329 117.359 1.00 9.12  ? 348  PHE A CG  1 
ATOM   2854 C CD1 . PHE A 1 348 ? 33.107 36.582 117.874 1.00 10.07 ? 348  PHE A CD1 1 
ATOM   2855 C CD2 . PHE A 1 348 ? 32.936 34.198 118.014 1.00 10.40 ? 348  PHE A CD2 1 
ATOM   2856 C CE1 . PHE A 1 348 ? 32.328 36.719 119.019 1.00 10.15 ? 348  PHE A CE1 1 
ATOM   2857 C CE2 . PHE A 1 348 ? 32.146 34.322 119.180 1.00 10.84 ? 348  PHE A CE2 1 
ATOM   2858 C CZ  . PHE A 1 348 ? 31.844 35.592 119.675 1.00 10.75 ? 348  PHE A CZ  1 
ATOM   2859 N N   . LEU A 1 349 ? 34.438 33.204 113.701 1.00 7.97  ? 349  LEU A N   1 
ATOM   2860 C CA  . LEU A 1 349 ? 34.564 33.063 112.257 1.00 7.85  ? 349  LEU A CA  1 
ATOM   2861 C C   . LEU A 1 349 ? 33.282 33.593 111.640 1.00 7.50  ? 349  LEU A C   1 
ATOM   2862 O O   . LEU A 1 349 ? 32.191 33.278 112.104 1.00 8.94  ? 349  LEU A O   1 
ATOM   2863 C CB  . LEU A 1 349 ? 34.719 31.599 111.839 1.00 8.72  ? 349  LEU A CB  1 
ATOM   2864 C CG  . LEU A 1 349 ? 35.989 30.852 112.223 1.00 8.75  ? 349  LEU A CG  1 
ATOM   2865 C CD1 . LEU A 1 349 ? 35.873 29.399 111.783 1.00 9.93  ? 349  LEU A CD1 1 
ATOM   2866 C CD2 . LEU A 1 349 ? 37.181 31.523 111.572 1.00 9.19  ? 349  LEU A CD2 1 
ATOM   2867 N N   . VAL A 1 350 ? 33.415 34.434 110.624 1.00 8.29  ? 350  VAL A N   1 
ATOM   2868 C CA  . VAL A 1 350 ? 32.261 34.968 109.903 1.00 8.04  ? 350  VAL A CA  1 
ATOM   2869 C C   . VAL A 1 350 ? 32.219 34.193 108.581 1.00 7.74  ? 350  VAL A C   1 
ATOM   2870 O O   . VAL A 1 350 ? 33.178 34.220 107.811 1.00 8.03  ? 350  VAL A O   1 
ATOM   2871 C CB  . VAL A 1 350 ? 32.395 36.492 109.639 1.00 7.46  ? 350  VAL A CB  1 
ATOM   2872 C CG1 . VAL A 1 350 ? 31.252 36.982 108.753 1.00 9.10  ? 350  VAL A CG1 1 
ATOM   2873 C CG2 . VAL A 1 350 ? 32.417 37.259 110.965 1.00 9.07  ? 350  VAL A CG2 1 
ATOM   2874 N N   . LEU A 1 351 ? 31.144 33.442 108.362 1.00 8.03  ? 351  LEU A N   1 
ATOM   2875 C CA  . LEU A 1 351 ? 30.999 32.640 107.150 1.00 8.73  ? 351  LEU A CA  1 
ATOM   2876 C C   . LEU A 1 351 ? 29.913 33.245 106.277 1.00 7.90  ? 351  LEU A C   1 
ATOM   2877 O O   . LEU A 1 351 ? 28.806 33.513 106.740 1.00 8.65  ? 351  LEU A O   1 
ATOM   2878 C CB  . LEU A 1 351 ? 30.583 31.196 107.478 1.00 9.34  ? 351  LEU A CB  1 
ATOM   2879 C CG  . LEU A 1 351 ? 31.119 30.266 108.574 1.00 13.89 ? 351  LEU A CG  1 
ATOM   2880 C CD1 . LEU A 1 351 ? 31.271 28.871 107.996 1.00 11.78 ? 351  LEU A CD1 1 
ATOM   2881 C CD2 . LEU A 1 351 ? 32.399 30.731 109.257 1.00 10.52 ? 351  LEU A CD2 1 
ATOM   2882 N N   . CYS A 1 352 ? 30.228 33.427 105.002 1.00 7.81  ? 352  CYS A N   1 
ATOM   2883 C CA  . CYS A 1 352 ? 29.261 33.955 104.052 1.00 7.96  ? 352  CYS A CA  1 
ATOM   2884 C C   . CYS A 1 352 ? 28.923 32.856 103.049 1.00 7.31  ? 352  CYS A C   1 
ATOM   2885 O O   . CYS A 1 352 ? 29.807 32.350 102.344 1.00 7.53  ? 352  CYS A O   1 
ATOM   2886 C CB  . CYS A 1 352 ? 29.835 35.169 103.336 1.00 8.25  ? 352  CYS A CB  1 
ATOM   2887 S SG  . CYS A 1 352 ? 28.714 35.918 102.140 1.00 10.27 ? 352  CYS A SG  1 
ATOM   2888 N N   . TYR A 1 353 ? 27.658 32.451 103.034 1.00 7.33  ? 353  TYR A N   1 
ATOM   2889 C CA  . TYR A 1 353 ? 27.185 31.416 102.129 1.00 8.45  ? 353  TYR A CA  1 
ATOM   2890 C C   . TYR A 1 353 ? 26.364 32.009 101.004 1.00 7.99  ? 353  TYR A C   1 
ATOM   2891 O O   . TYR A 1 353 ? 25.861 33.138 101.099 1.00 9.26  ? 353  TYR A O   1 
ATOM   2892 C CB  . TYR A 1 353 ? 26.304 30.411 102.874 1.00 8.41  ? 353  TYR A CB  1 
ATOM   2893 C CG  . TYR A 1 353 ? 27.050 29.399 103.697 1.00 7.79  ? 353  TYR A CG  1 
ATOM   2894 C CD1 . TYR A 1 353 ? 27.234 29.580 105.061 1.00 7.91  ? 353  TYR A CD1 1 
ATOM   2895 C CD2 . TYR A 1 353 ? 27.577 28.258 103.104 1.00 8.05  ? 353  TYR A CD2 1 
ATOM   2896 C CE1 . TYR A 1 353 ? 27.935 28.645 105.820 1.00 7.09  ? 353  TYR A CE1 1 
ATOM   2897 C CE2 . TYR A 1 353 ? 28.282 27.316 103.847 1.00 8.28  ? 353  TYR A CE2 1 
ATOM   2898 C CZ  . TYR A 1 353 ? 28.459 27.518 105.209 1.00 8.85  ? 353  TYR A CZ  1 
ATOM   2899 O OH  . TYR A 1 353 ? 29.165 26.600 105.954 1.00 9.72  ? 353  TYR A OH  1 
ATOM   2900 N N   . LEU A 1 354 ? 26.238 31.231 99.936  1.00 7.95  ? 354  LEU A N   1 
ATOM   2901 C CA  . LEU A 1 354 ? 25.426 31.602 98.790  1.00 8.66  ? 354  LEU A CA  1 
ATOM   2902 C C   . LEU A 1 354 ? 24.360 30.514 98.695  1.00 8.76  ? 354  LEU A C   1 
ATOM   2903 O O   . LEU A 1 354 ? 24.667 29.343 98.459  1.00 8.97  ? 354  LEU A O   1 
ATOM   2904 C CB  . LEU A 1 354 ? 26.248 31.652 97.498  1.00 9.62  ? 354  LEU A CB  1 
ATOM   2905 C CG  . LEU A 1 354 ? 25.531 32.328 96.332  1.00 11.35 ? 354  LEU A CG  1 
ATOM   2906 C CD1 . LEU A 1 354 ? 25.356 33.817 96.612  1.00 11.78 ? 354  LEU A CD1 1 
ATOM   2907 C CD2 . LEU A 1 354 ? 26.325 32.130 95.057  1.00 12.22 ? 354  LEU A CD2 1 
ATOM   2908 N N   . HIS A 1 355 ? 23.120 30.896 98.977  1.00 8.86  ? 355  HIS A N   1 
ATOM   2909 C CA  . HIS A 1 355 ? 21.979 29.992 98.937  1.00 9.68  ? 355  HIS A CA  1 
ATOM   2910 C C   . HIS A 1 355 ? 21.085 30.451 97.799  1.00 10.02 ? 355  HIS A C   1 
ATOM   2911 O O   . HIS A 1 355 ? 20.500 31.529 97.867  1.00 10.50 ? 355  HIS A O   1 
ATOM   2912 C CB  . HIS A 1 355 ? 21.211 30.061 100.260 1.00 10.82 ? 355  HIS A CB  1 
ATOM   2913 C CG  . HIS A 1 355 ? 19.952 29.255 100.264 1.00 13.01 ? 355  HIS A CG  1 
ATOM   2914 N ND1 . HIS A 1 355 ? 19.956 27.876 100.326 1.00 13.94 ? 355  HIS A ND1 1 
ATOM   2915 C CD2 . HIS A 1 355 ? 18.650 29.624 100.201 1.00 13.44 ? 355  HIS A CD2 1 
ATOM   2916 C CE1 . HIS A 1 355 ? 18.714 27.435 100.300 1.00 14.73 ? 355  HIS A CE1 1 
ATOM   2917 N NE2 . HIS A 1 355 ? 17.901 28.476 100.227 1.00 14.55 ? 355  HIS A NE2 1 
ATOM   2918 N N   . ASP A 1 356 ? 20.990 29.629 96.763  1.00 10.57 ? 356  ASP A N   1 
ATOM   2919 C CA  . ASP A 1 356 ? 20.192 29.950 95.585  1.00 10.60 ? 356  ASP A CA  1 
ATOM   2920 C C   . ASP A 1 356 ? 20.426 31.384 95.124  1.00 9.84  ? 356  ASP A C   1 
ATOM   2921 O O   . ASP A 1 356 ? 19.494 32.160 94.918  1.00 9.26  ? 356  ASP A O   1 
ATOM   2922 C CB  . ASP A 1 356 ? 18.699 29.677 95.806  1.00 11.25 ? 356  ASP A CB  1 
ATOM   2923 C CG  . ASP A 1 356 ? 18.366 28.189 95.817  1.00 12.85 ? 356  ASP A CG  1 
ATOM   2924 O OD1 . ASP A 1 356 ? 19.052 27.393 95.139  1.00 12.39 ? 356  ASP A OD1 1 
ATOM   2925 O OD2 . ASP A 1 356 ? 17.391 27.812 96.493  1.00 14.98 ? 356  ASP A OD2 1 
ATOM   2926 N N   . VAL A 1 357 ? 21.703 31.718 94.994  1.00 9.89  ? 357  VAL A N   1 
ATOM   2927 C CA  . VAL A 1 357 ? 22.174 33.009 94.509  1.00 9.48  ? 357  VAL A CA  1 
ATOM   2928 C C   . VAL A 1 357 ? 21.894 34.227 95.394  1.00 10.10 ? 357  VAL A C   1 
ATOM   2929 O O   . VAL A 1 357 ? 21.896 35.355 94.920  1.00 9.98  ? 357  VAL A O   1 
ATOM   2930 C CB  . VAL A 1 357 ? 21.706 33.271 93.042  1.00 9.51  ? 357  VAL A CB  1 
ATOM   2931 C CG1 . VAL A 1 357 ? 22.674 34.201 92.341  1.00 10.61 ? 357  VAL A CG1 1 
ATOM   2932 C CG2 . VAL A 1 357 ? 21.596 31.958 92.262  1.00 9.75  ? 357  VAL A CG2 1 
ATOM   2933 N N   . LYS A 1 358 ? 21.749 33.985 96.689  1.00 10.25 ? 358  LYS A N   1 
ATOM   2934 C CA  . LYS A 1 358 ? 21.508 35.043 97.669  1.00 11.09 ? 358  LYS A CA  1 
ATOM   2935 C C   . LYS A 1 358 ? 22.453 34.795 98.843  1.00 10.39 ? 358  LYS A C   1 
ATOM   2936 O O   . LYS A 1 358 ? 22.692 33.647 99.214  1.00 10.16 ? 358  LYS A O   1 
ATOM   2937 C CB  . LYS A 1 358 ? 20.047 34.999 98.137  1.00 12.90 ? 358  LYS A CB  1 
ATOM   2938 C CG  . LYS A 1 358 ? 19.033 35.182 97.008  1.00 15.54 ? 358  LYS A CG  1 
ATOM   2939 C CD  . LYS A 1 358 ? 17.657 34.678 97.396  1.00 16.93 ? 358  LYS A CD  1 
ATOM   2940 C CE  . LYS A 1 358 ? 17.597 33.160 97.444  1.00 18.39 ? 358  LYS A CE  1 
ATOM   2941 N NZ  . LYS A 1 358 ? 16.236 32.675 97.813  1.00 20.39 ? 358  LYS A NZ  1 
ATOM   2942 N N   . ASN A 1 359 ? 23.020 35.854 99.409  1.00 10.27 ? 359  ASN A N   1 
ATOM   2943 C CA  . ASN A 1 359 ? 23.950 35.690 100.519 1.00 11.24 ? 359  ASN A CA  1 
ATOM   2944 C C   . ASN A 1 359 ? 23.329 35.569 101.903 1.00 11.40 ? 359  ASN A C   1 
ATOM   2945 O O   . ASN A 1 359 ? 22.271 36.139 102.182 1.00 11.04 ? 359  ASN A O   1 
ATOM   2946 C CB  . ASN A 1 359 ? 24.957 36.837 100.567 1.00 11.22 ? 359  ASN A CB  1 
ATOM   2947 C CG  . ASN A 1 359 ? 26.033 36.714 99.526  1.00 11.60 ? 359  ASN A CG  1 
ATOM   2948 O OD1 . ASN A 1 359 ? 26.384 37.686 98.870  1.00 11.22 ? 359  ASN A OD1 1 
ATOM   2949 N ND2 . ASN A 1 359 ? 26.574 35.514 99.370  1.00 11.14 ? 359  ASN A ND2 1 
ATOM   2950 N N   . THR A 1 360 ? 23.996 34.795 102.751 1.00 12.03 ? 360  THR A N   1 
ATOM   2951 C CA  . THR A 1 360 ? 23.611 34.624 104.148 1.00 12.10 ? 360  THR A CA  1 
ATOM   2952 C C   . THR A 1 360 ? 24.923 34.826 104.914 1.00 12.07 ? 360  THR A C   1 
ATOM   2953 O O   . THR A 1 360 ? 26.008 34.601 104.378 1.00 11.64 ? 360  THR A O   1 
ATOM   2954 C CB  . THR A 1 360 ? 23.043 33.227 104.454 1.00 12.68 ? 360  THR A CB  1 
ATOM   2955 O OG1 . THR A 1 360 ? 24.044 32.239 104.203 1.00 14.73 ? 360  THR A OG1 1 
ATOM   2956 C CG2 . THR A 1 360 ? 21.807 32.934 103.595 1.00 14.25 ? 360  THR A CG2 1 
ATOM   2957 N N   . LEU A 1 361 ? 24.822 35.294 106.150 1.00 11.12 ? 361  LEU A N   1 
ATOM   2958 C CA  . LEU A 1 361 ? 25.983 35.565 106.994 1.00 11.82 ? 361  LEU A CA  1 
ATOM   2959 C C   . LEU A 1 361 ? 25.795 34.889 108.340 1.00 11.03 ? 361  LEU A C   1 
ATOM   2960 O O   . LEU A 1 361 ? 24.765 35.073 109.000 1.00 11.21 ? 361  LEU A O   1 
ATOM   2961 C CB  . LEU A 1 361 ? 26.161 37.068 107.215 1.00 13.20 ? 361  LEU A CB  1 
ATOM   2962 C CG  . LEU A 1 361 ? 27.144 37.889 106.386 1.00 15.16 ? 361  LEU A CG  1 
ATOM   2963 C CD1 . LEU A 1 361 ? 27.340 39.222 107.097 1.00 14.74 ? 361  LEU A CD1 1 
ATOM   2964 C CD2 . LEU A 1 361 ? 28.488 37.170 106.249 1.00 13.91 ? 361  LEU A CD2 1 
ATOM   2965 N N   . GLN A 1 362 ? 26.815 34.151 108.767 1.00 10.75 ? 362  GLN A N   1 
ATOM   2966 C CA  . GLN A 1 362 ? 26.763 33.412 110.021 1.00 11.05 ? 362  GLN A CA  1 
ATOM   2967 C C   . GLN A 1 362 ? 28.043 33.572 110.831 1.00 10.68 ? 362  GLN A C   1 
ATOM   2968 O O   . GLN A 1 362 ? 29.129 33.708 110.275 1.00 11.42 ? 362  GLN A O   1 
ATOM   2969 C CB  . GLN A 1 362 ? 26.596 31.918 109.729 1.00 12.70 ? 362  GLN A CB  1 
ATOM   2970 C CG  . GLN A 1 362 ? 25.482 31.544 108.772 1.00 14.55 ? 362  GLN A CG  1 
ATOM   2971 C CD  . GLN A 1 362 ? 25.382 30.052 108.563 1.00 15.66 ? 362  GLN A CD  1 
ATOM   2972 O OE1 . GLN A 1 362 ? 26.300 29.298 108.877 1.00 15.25 ? 362  GLN A OE1 1 
ATOM   2973 N NE2 . GLN A 1 362 ? 24.258 29.616 108.053 1.00 16.45 ? 362  GLN A NE2 1 
ATOM   2974 N N   . LEU A 1 363 ? 27.900 33.540 112.148 1.00 9.05  ? 363  LEU A N   1 
ATOM   2975 C CA  . LEU A 1 363 ? 29.032 33.611 113.073 1.00 8.75  ? 363  LEU A CA  1 
ATOM   2976 C C   . LEU A 1 363 ? 29.221 32.207 113.639 1.00 8.00  ? 363  LEU A C   1 
ATOM   2977 O O   . LEU A 1 363 ? 28.256 31.566 114.076 1.00 8.62  ? 363  LEU A O   1 
ATOM   2978 C CB  . LEU A 1 363 ? 28.749 34.576 114.230 1.00 9.42  ? 363  LEU A CB  1 
ATOM   2979 C CG  . LEU A 1 363 ? 29.965 34.927 115.096 1.00 10.01 ? 363  LEU A CG  1 
ATOM   2980 C CD1 . LEU A 1 363 ? 30.847 35.900 114.345 1.00 10.47 ? 363  LEU A CD1 1 
ATOM   2981 C CD2 . LEU A 1 363 ? 29.530 35.546 116.427 1.00 10.96 ? 363  LEU A CD2 1 
ATOM   2982 N N   . HIS A 1 364 ? 30.452 31.721 113.593 1.00 8.22  ? 364  HIS A N   1 
ATOM   2983 C CA  . HIS A 1 364 ? 30.793 30.398 114.091 1.00 8.79  ? 364  HIS A CA  1 
ATOM   2984 C C   . HIS A 1 364 ? 31.941 30.465 115.088 1.00 9.14  ? 364  HIS A C   1 
ATOM   2985 O O   . HIS A 1 364 ? 32.700 31.432 115.119 1.00 8.64  ? 364  HIS A O   1 
ATOM   2986 C CB  . HIS A 1 364 ? 31.197 29.457 112.939 1.00 9.11  ? 364  HIS A CB  1 
ATOM   2987 C CG  . HIS A 1 364 ? 30.063 29.075 112.041 1.00 8.36  ? 364  HIS A CG  1 
ATOM   2988 N ND1 . HIS A 1 364 ? 29.684 27.763 111.838 1.00 9.21  ? 364  HIS A ND1 1 
ATOM   2989 C CD2 . HIS A 1 364 ? 29.245 29.825 111.263 1.00 8.89  ? 364  HIS A CD2 1 
ATOM   2990 C CE1 . HIS A 1 364 ? 28.686 27.725 110.979 1.00 9.14  ? 364  HIS A CE1 1 
ATOM   2991 N NE2 . HIS A 1 364 ? 28.399 28.964 110.614 1.00 9.27  ? 364  HIS A NE2 1 
ATOM   2992 N N   . ASP A 1 365 ? 32.047 29.432 115.915 1.00 9.50  ? 365  ASP A N   1 
ATOM   2993 C CA  . ASP A 1 365 ? 33.129 29.339 116.889 1.00 10.04 ? 365  ASP A CA  1 
ATOM   2994 C C   . ASP A 1 365 ? 34.353 28.778 116.163 1.00 9.66  ? 365  ASP A C   1 
ATOM   2995 O O   . ASP A 1 365 ? 34.238 27.796 115.433 1.00 10.64 ? 365  ASP A O   1 
ATOM   2996 C CB  . ASP A 1 365 ? 32.723 28.391 118.020 1.00 11.04 ? 365  ASP A CB  1 
ATOM   2997 C CG  . ASP A 1 365 ? 33.878 28.035 118.935 1.00 13.17 ? 365  ASP A CG  1 
ATOM   2998 O OD1 . ASP A 1 365 ? 34.142 26.831 119.100 1.00 15.87 ? 365  ASP A OD1 1 
ATOM   2999 O OD2 . ASP A 1 365 ? 34.525 28.951 119.475 1.00 15.61 ? 365  ASP A OD2 1 
ATOM   3000 N N   . LEU A 1 366 ? 35.523 29.365 116.394 1.00 9.02  ? 366  LEU A N   1 
ATOM   3001 C CA  . LEU A 1 366 ? 36.733 28.881 115.735 1.00 9.23  ? 366  LEU A CA  1 
ATOM   3002 C C   . LEU A 1 366 ? 37.173 27.491 116.172 1.00 10.06 ? 366  LEU A C   1 
ATOM   3003 O O   . LEU A 1 366 ? 37.578 26.688 115.346 1.00 9.87  ? 366  LEU A O   1 
ATOM   3004 C CB  . LEU A 1 366 ? 37.893 29.864 115.913 1.00 9.40  ? 366  LEU A CB  1 
ATOM   3005 C CG  . LEU A 1 366 ? 39.304 29.412 115.501 1.00 9.38  ? 366  LEU A CG  1 
ATOM   3006 C CD1 . LEU A 1 366 ? 39.369 29.101 114.010 1.00 9.02  ? 366  LEU A CD1 1 
ATOM   3007 C CD2 . LEU A 1 366 ? 40.306 30.503 115.847 1.00 9.47  ? 366  LEU A CD2 1 
ATOM   3008 N N   . ALA A 1 367 ? 37.069 27.201 117.462 1.00 10.67 ? 367  ALA A N   1 
ATOM   3009 C CA  . ALA A 1 367 ? 37.500 25.910 117.989 1.00 11.15 ? 367  ALA A CA  1 
ATOM   3010 C C   . ALA A 1 367 ? 36.698 24.698 117.525 1.00 11.74 ? 367  ALA A C   1 
ATOM   3011 O O   . ALA A 1 367 ? 37.258 23.637 117.277 1.00 12.35 ? 367  ALA A O   1 
ATOM   3012 C CB  . ALA A 1 367 ? 37.518 25.956 119.512 1.00 11.26 ? 367  ALA A CB  1 
ATOM   3013 N N   . THR A 1 368 ? 35.386 24.844 117.423 1.00 11.69 ? 368  THR A N   1 
ATOM   3014 C CA  . THR A 1 368 ? 34.547 23.720 117.036 1.00 12.52 ? 368  THR A CA  1 
ATOM   3015 C C   . THR A 1 368 ? 33.875 23.864 115.680 1.00 11.50 ? 368  THR A C   1 
ATOM   3016 O O   . THR A 1 368 ? 33.416 22.878 115.105 1.00 11.54 ? 368  THR A O   1 
ATOM   3017 C CB  . THR A 1 368 ? 33.430 23.511 118.075 1.00 12.48 ? 368  THR A CB  1 
ATOM   3018 O OG1 . THR A 1 368 ? 32.577 24.669 118.092 1.00 14.33 ? 368  THR A OG1 1 
ATOM   3019 C CG2 . THR A 1 368 ? 34.021 23.301 119.476 1.00 13.70 ? 368  THR A CG2 1 
ATOM   3020 N N   . GLY A 1 369 ? 33.777 25.099 115.200 1.00 10.84 ? 369  GLY A N   1 
ATOM   3021 C CA  . GLY A 1 369 ? 33.106 25.342 113.940 1.00 10.27 ? 369  GLY A CA  1 
ATOM   3022 C C   . GLY A 1 369 ? 31.602 25.449 114.124 1.00 9.80  ? 369  GLY A C   1 
ATOM   3023 O O   . GLY A 1 369 ? 30.875 25.650 113.161 1.00 10.40 ? 369  GLY A O   1 
ATOM   3024 N N   . ALA A 1 370 ? 31.125 25.346 115.362 1.00 10.44 ? 370  ALA A N   1 
ATOM   3025 C CA  . ALA A 1 370 ? 29.691 25.427 115.625 1.00 10.04 ? 370  ALA A CA  1 
ATOM   3026 C C   . ALA A 1 370 ? 29.087 26.784 115.279 1.00 9.96  ? 370  ALA A C   1 
ATOM   3027 O O   . ALA A 1 370 ? 29.730 27.815 115.437 1.00 9.27  ? 370  ALA A O   1 
ATOM   3028 C CB  . ALA A 1 370 ? 29.403 25.095 117.088 1.00 10.07 ? 370  ALA A CB  1 
ATOM   3029 N N   . LEU A 1 371 ? 27.854 26.750 114.785 1.00 10.03 ? 371  LEU A N   1 
ATOM   3030 C CA  . LEU A 1 371 ? 27.089 27.944 114.440 1.00 10.03 ? 371  LEU A CA  1 
ATOM   3031 C C   . LEU A 1 371 ? 26.689 28.621 115.756 1.00 10.48 ? 371  LEU A C   1 
ATOM   3032 O O   . LEU A 1 371 ? 26.169 27.961 116.662 1.00 10.12 ? 371  LEU A O   1 
ATOM   3033 C CB  . LEU A 1 371 ? 25.821 27.551 113.674 1.00 10.18 ? 371  LEU A CB  1 
ATOM   3034 C CG  . LEU A 1 371 ? 24.778 28.657 113.493 1.00 10.77 ? 371  LEU A CG  1 
ATOM   3035 C CD1 . LEU A 1 371 ? 25.329 29.798 112.655 1.00 10.89 ? 371  LEU A CD1 1 
ATOM   3036 C CD2 . LEU A 1 371 ? 23.532 28.093 112.841 1.00 11.56 ? 371  LEU A CD2 1 
ATOM   3037 N N   . LEU A 1 372 ? 26.945 29.922 115.844 1.00 10.62 ? 372  LEU A N   1 
ATOM   3038 C CA  . LEU A 1 372 ? 26.627 30.707 117.032 1.00 11.07 ? 372  LEU A CA  1 
ATOM   3039 C C   . LEU A 1 372 ? 25.525 31.722 116.790 1.00 11.58 ? 372  LEU A C   1 
ATOM   3040 O O   . LEU A 1 372 ? 24.665 31.931 117.640 1.00 12.56 ? 372  LEU A O   1 
ATOM   3041 C CB  . LEU A 1 372 ? 27.866 31.460 117.514 1.00 11.04 ? 372  LEU A CB  1 
ATOM   3042 C CG  . LEU A 1 372 ? 29.095 30.644 117.909 1.00 11.16 ? 372  LEU A CG  1 
ATOM   3043 C CD1 . LEU A 1 372 ? 30.228 31.587 118.245 1.00 12.11 ? 372  LEU A CD1 1 
ATOM   3044 C CD2 . LEU A 1 372 ? 28.776 29.739 119.102 1.00 11.87 ? 372  LEU A CD2 1 
ATOM   3045 N N   . LYS A 1 373 ? 25.564 32.379 115.639 1.00 11.96 ? 373  LYS A N   1 
ATOM   3046 C CA  . LYS A 1 373 ? 24.582 33.413 115.344 1.00 12.70 ? 373  LYS A CA  1 
ATOM   3047 C C   . LYS A 1 373 ? 24.394 33.615 113.853 1.00 12.68 ? 373  LYS A C   1 
ATOM   3048 O O   . LYS A 1 373 ? 25.326 33.482 113.073 1.00 12.45 ? 373  LYS A O   1 
ATOM   3049 C CB  . LYS A 1 373 ? 25.046 34.735 115.972 1.00 13.50 ? 373  LYS A CB  1 
ATOM   3050 C CG  . LYS A 1 373 ? 24.155 35.957 115.734 1.00 15.78 ? 373  LYS A CG  1 
ATOM   3051 C CD  . LYS A 1 373 ? 22.877 35.884 116.554 1.00 17.10 ? 373  LYS A CD  1 
ATOM   3052 C CE  . LYS A 1 373 ? 22.109 37.205 116.547 1.00 18.42 ? 373  LYS A CE  1 
ATOM   3053 N NZ  . LYS A 1 373 ? 21.741 37.652 115.176 1.00 20.47 ? 373  LYS A NZ  1 
ATOM   3054 N N   . ILE A 1 374 ? 23.171 33.940 113.473 1.00 11.90 ? 374  ILE A N   1 
ATOM   3055 C CA  . ILE A 1 374 ? 22.834 34.213 112.093 1.00 12.64 ? 374  ILE A CA  1 
ATOM   3056 C C   . ILE A 1 374 ? 22.562 35.708 112.018 1.00 12.36 ? 374  ILE A C   1 
ATOM   3057 O O   . ILE A 1 374 ? 21.819 36.247 112.839 1.00 11.43 ? 374  ILE A O   1 
ATOM   3058 C CB  . ILE A 1 374 ? 21.566 33.451 111.683 1.00 13.42 ? 374  ILE A CB  1 
ATOM   3059 C CG1 . ILE A 1 374 ? 21.869 31.957 111.617 1.00 14.95 ? 374  ILE A CG1 1 
ATOM   3060 C CG2 . ILE A 1 374 ? 21.027 33.984 110.353 1.00 14.84 ? 374  ILE A CG2 1 
ATOM   3061 C CD1 . ILE A 1 374 ? 20.669 31.117 111.358 1.00 16.47 ? 374  ILE A CD1 1 
ATOM   3062 N N   . PHE A 1 375 ? 23.246 36.391 111.110 1.00 11.74 ? 375  PHE A N   1 
ATOM   3063 C CA  . PHE A 1 375 ? 23.031 37.821 110.924 1.00 13.27 ? 375  PHE A CA  1 
ATOM   3064 C C   . PHE A 1 375 ? 21.945 37.937 109.858 1.00 14.75 ? 375  PHE A C   1 
ATOM   3065 O O   . PHE A 1 375 ? 22.157 37.585 108.699 1.00 14.89 ? 375  PHE A O   1 
ATOM   3066 C CB  . PHE A 1 375 ? 24.323 38.513 110.481 1.00 12.52 ? 375  PHE A CB  1 
ATOM   3067 C CG  . PHE A 1 375 ? 25.423 38.458 111.504 1.00 12.65 ? 375  PHE A CG  1 
ATOM   3068 C CD1 . PHE A 1 375 ? 26.556 37.676 111.290 1.00 12.42 ? 375  PHE A CD1 1 
ATOM   3069 C CD2 . PHE A 1 375 ? 25.316 39.172 112.689 1.00 13.34 ? 375  PHE A CD2 1 
ATOM   3070 C CE1 . PHE A 1 375 ? 27.571 37.614 112.246 1.00 12.93 ? 375  PHE A CE1 1 
ATOM   3071 C CE2 . PHE A 1 375 ? 26.322 39.118 113.650 1.00 13.05 ? 375  PHE A CE2 1 
ATOM   3072 C CZ  . PHE A 1 375 ? 27.453 38.335 113.428 1.00 12.75 ? 375  PHE A CZ  1 
ATOM   3073 N N   . PRO A 1 376 ? 20.756 38.422 110.247 1.00 16.30 ? 376  PRO A N   1 
ATOM   3074 C CA  . PRO A 1 376 ? 19.632 38.571 109.320 1.00 17.22 ? 376  PRO A CA  1 
ATOM   3075 C C   . PRO A 1 376 ? 19.871 39.524 108.151 1.00 17.56 ? 376  PRO A C   1 
ATOM   3076 O O   . PRO A 1 376 ? 20.415 40.619 108.313 1.00 17.72 ? 376  PRO A O   1 
ATOM   3077 C CB  . PRO A 1 376 ? 18.509 39.060 110.228 1.00 18.06 ? 376  PRO A CB  1 
ATOM   3078 C CG  . PRO A 1 376 ? 19.238 39.895 111.226 1.00 17.94 ? 376  PRO A CG  1 
ATOM   3079 C CD  . PRO A 1 376 ? 20.434 39.025 111.553 1.00 16.81 ? 376  PRO A CD  1 
ATOM   3080 N N   . LEU A 1 377 ? 19.445 39.096 106.969 1.00 18.62 ? 377  LEU A N   1 
ATOM   3081 C CA  . LEU A 1 377 ? 19.598 39.891 105.758 1.00 19.50 ? 377  LEU A CA  1 
ATOM   3082 C C   . LEU A 1 377 ? 18.416 39.647 104.840 1.00 20.17 ? 377  LEU A C   1 
ATOM   3083 O O   . LEU A 1 377 ? 17.836 38.563 104.843 1.00 20.39 ? 377  LEU A O   1 
ATOM   3084 C CB  . LEU A 1 377 ? 20.865 39.480 105.006 1.00 18.95 ? 377  LEU A CB  1 
ATOM   3085 C CG  . LEU A 1 377 ? 22.248 39.676 105.614 1.00 18.74 ? 377  LEU A CG  1 
ATOM   3086 C CD1 . LEU A 1 377 ? 23.269 38.972 104.737 1.00 17.96 ? 377  LEU A CD1 1 
ATOM   3087 C CD2 . LEU A 1 377 ? 22.563 41.157 105.725 1.00 18.64 ? 377  LEU A CD2 1 
ATOM   3088 N N   . GLU A 1 378 ? 18.041 40.671 104.083 1.00 20.72 ? 378  GLU A N   1 
ATOM   3089 C CA  . GLU A 1 378 ? 16.966 40.537 103.112 1.00 21.09 ? 378  GLU A CA  1 
ATOM   3090 C C   . GLU A 1 378 ? 17.596 39.849 101.900 1.00 20.30 ? 378  GLU A C   1 
ATOM   3091 O O   . GLU A 1 378 ? 18.791 39.556 101.908 1.00 19.93 ? 378  GLU A O   1 
ATOM   3092 C CB  . GLU A 1 378 ? 16.415 41.915 102.726 1.00 23.31 ? 378  GLU A CB  1 
ATOM   3093 C CG  . GLU A 1 378 ? 15.673 42.637 103.854 1.00 26.19 ? 378  GLU A CG  1 
ATOM   3094 C CD  . GLU A 1 378 ? 14.479 41.850 104.385 1.00 28.11 ? 378  GLU A CD  1 
ATOM   3095 O OE1 . GLU A 1 378 ? 13.524 41.624 103.614 1.00 29.33 ? 378  GLU A OE1 1 
ATOM   3096 O OE2 . GLU A 1 378 ? 14.500 41.457 105.572 1.00 29.16 ? 378  GLU A OE2 1 
ATOM   3097 N N   . VAL A 1 379 ? 16.801 39.582 100.873 1.00 19.38 ? 379  VAL A N   1 
ATOM   3098 C CA  . VAL A 1 379 ? 17.302 38.936 99.666  1.00 18.60 ? 379  VAL A CA  1 
ATOM   3099 C C   . VAL A 1 379 ? 18.275 39.859 98.943  1.00 17.19 ? 379  VAL A C   1 
ATOM   3100 O O   . VAL A 1 379 ? 17.909 40.954 98.521  1.00 16.65 ? 379  VAL A O   1 
ATOM   3101 C CB  . VAL A 1 379 ? 16.141 38.545 98.718  1.00 19.38 ? 379  VAL A CB  1 
ATOM   3102 C CG1 . VAL A 1 379 ? 16.682 38.054 97.378  1.00 20.15 ? 379  VAL A CG1 1 
ATOM   3103 C CG2 . VAL A 1 379 ? 15.283 37.471 99.365  1.00 19.94 ? 379  VAL A CG2 1 
ATOM   3104 N N   . GLY A 1 380 ? 19.520 39.416 98.818  1.00 14.60 ? 380  GLY A N   1 
ATOM   3105 C CA  . GLY A 1 380 ? 20.518 40.224 98.146  1.00 12.89 ? 380  GLY A CA  1 
ATOM   3106 C C   . GLY A 1 380 ? 21.932 39.700 98.279  1.00 12.18 ? 380  GLY A C   1 
ATOM   3107 O O   . GLY A 1 380 ? 22.153 38.496 98.454  1.00 12.25 ? 380  GLY A O   1 
ATOM   3108 N N   . SER A 1 381 ? 22.886 40.624 98.260  1.00 11.29 ? 381  SER A N   1 
ATOM   3109 C CA  . SER A 1 381 ? 24.298 40.282 98.335  1.00 11.40 ? 381  SER A CA  1 
ATOM   3110 C C   . SER A 1 381 ? 25.072 41.039 99.392  1.00 11.19 ? 381  SER A C   1 
ATOM   3111 O O   . SER A 1 381 ? 24.739 42.177 99.728  1.00 11.38 ? 381  SER A O   1 
ATOM   3112 C CB  . SER A 1 381 ? 24.967 40.586 96.994  1.00 11.95 ? 381  SER A CB  1 
ATOM   3113 O OG  . SER A 1 381 ? 24.308 39.929 95.931  1.00 12.67 ? 381  SER A OG  1 
ATOM   3114 N N   . VAL A 1 382 ? 26.102 40.387 99.919  1.00 10.96 ? 382  VAL A N   1 
ATOM   3115 C CA  . VAL A 1 382 ? 27.008 41.022 100.865 1.00 11.45 ? 382  VAL A CA  1 
ATOM   3116 C C   . VAL A 1 382 ? 28.161 41.463 99.954  1.00 12.07 ? 382  VAL A C   1 
ATOM   3117 O O   . VAL A 1 382 ? 28.814 40.634 99.312  1.00 12.83 ? 382  VAL A O   1 
ATOM   3118 C CB  . VAL A 1 382 ? 27.507 40.044 101.953 1.00 11.11 ? 382  VAL A CB  1 
ATOM   3119 C CG1 . VAL A 1 382 ? 28.520 40.737 102.851 1.00 11.80 ? 382  VAL A CG1 1 
ATOM   3120 C CG2 . VAL A 1 382 ? 26.331 39.559 102.777 1.00 11.93 ? 382  VAL A CG2 1 
ATOM   3121 N N   . VAL A 1 383 ? 28.354 42.770 99.848  1.00 12.46 ? 383  VAL A N   1 
ATOM   3122 C CA  . VAL A 1 383 ? 29.383 43.313 98.974  1.00 12.86 ? 383  VAL A CA  1 
ATOM   3123 C C   . VAL A 1 383 ? 30.545 43.989 99.705  1.00 12.48 ? 383  VAL A C   1 
ATOM   3124 O O   . VAL A 1 383 ? 31.481 44.469 99.075  1.00 13.37 ? 383  VAL A O   1 
ATOM   3125 C CB  . VAL A 1 383 ? 28.742 44.298 97.946  1.00 13.59 ? 383  VAL A CB  1 
ATOM   3126 C CG1 . VAL A 1 383 ? 28.121 45.490 98.656  1.00 14.19 ? 383  VAL A CG1 1 
ATOM   3127 C CG2 . VAL A 1 383 ? 29.746 44.747 96.897  1.00 16.15 ? 383  VAL A CG2 1 
ATOM   3128 N N   . GLY A 1 384 ? 30.493 43.996 101.031 1.00 12.16 ? 384  GLY A N   1 
ATOM   3129 C CA  . GLY A 1 384 ? 31.557 44.608 101.808 1.00 11.44 ? 384  GLY A CA  1 
ATOM   3130 C C   . GLY A 1 384 ? 31.585 43.995 103.191 1.00 10.94 ? 384  GLY A C   1 
ATOM   3131 O O   . GLY A 1 384 ? 30.552 43.594 103.716 1.00 10.88 ? 384  GLY A O   1 
ATOM   3132 N N   . TYR A 1 385 ? 32.773 43.925 103.776 1.00 10.43 ? 385  TYR A N   1 
ATOM   3133 C CA  . TYR A 1 385 ? 32.958 43.363 105.106 1.00 10.26 ? 385  TYR A CA  1 
ATOM   3134 C C   . TYR A 1 385 ? 34.283 43.787 105.718 1.00 9.57  ? 385  TYR A C   1 
ATOM   3135 O O   . TYR A 1 385 ? 35.309 43.888 105.032 1.00 9.67  ? 385  TYR A O   1 
ATOM   3136 C CB  . TYR A 1 385 ? 32.926 41.827 105.064 1.00 10.04 ? 385  TYR A CB  1 
ATOM   3137 C CG  . TYR A 1 385 ? 33.451 41.174 106.336 1.00 9.68  ? 385  TYR A CG  1 
ATOM   3138 C CD1 . TYR A 1 385 ? 32.607 40.933 107.417 1.00 9.77  ? 385  TYR A CD1 1 
ATOM   3139 C CD2 . TYR A 1 385 ? 34.813 40.886 106.492 1.00 10.07 ? 385  TYR A CD2 1 
ATOM   3140 C CE1 . TYR A 1 385 ? 33.100 40.438 108.627 1.00 10.30 ? 385  TYR A CE1 1 
ATOM   3141 C CE2 . TYR A 1 385 ? 35.317 40.393 107.702 1.00 10.35 ? 385  TYR A CE2 1 
ATOM   3142 C CZ  . TYR A 1 385 ? 34.451 40.173 108.767 1.00 9.45  ? 385  TYR A CZ  1 
ATOM   3143 O OH  . TYR A 1 385 ? 34.935 39.726 109.975 1.00 9.75  ? 385  TYR A OH  1 
ATOM   3144 N N   . SER A 1 386 ? 34.271 43.986 107.027 1.00 8.96  ? 386  SER A N   1 
ATOM   3145 C CA  . SER A 1 386 ? 35.498 44.317 107.740 1.00 9.04  ? 386  SER A CA  1 
ATOM   3146 C C   . SER A 1 386 ? 35.487 43.646 109.107 1.00 8.68  ? 386  SER A C   1 
ATOM   3147 O O   . SER A 1 386 ? 34.437 43.479 109.719 1.00 8.29  ? 386  SER A O   1 
ATOM   3148 C CB  . SER A 1 386 ? 35.678 45.831 107.893 1.00 9.10  ? 386  SER A CB  1 
ATOM   3149 O OG  . SER A 1 386 ? 34.820 46.350 108.884 1.00 8.99  ? 386  SER A OG  1 
ATOM   3150 N N   . GLY A 1 387 ? 36.668 43.228 109.542 1.00 8.59  ? 387  GLY A N   1 
ATOM   3151 C CA  . GLY A 1 387 ? 36.813 42.591 110.836 1.00 9.18  ? 387  GLY A CA  1 
ATOM   3152 C C   . GLY A 1 387 ? 37.895 41.530 110.787 1.00 9.60  ? 387  GLY A C   1 
ATOM   3153 O O   . GLY A 1 387 ? 37.652 40.428 110.307 1.00 10.72 ? 387  GLY A O   1 
ATOM   3154 N N   . GLN A 1 388 ? 39.105 41.897 111.208 1.00 10.62 ? 388  GLN A N   1 
ATOM   3155 C CA  . GLN A 1 388 ? 40.230 40.966 111.231 1.00 11.38 ? 388  GLN A CA  1 
ATOM   3156 C C   . GLN A 1 388 ? 40.358 40.339 112.613 1.00 11.50 ? 388  GLN A C   1 
ATOM   3157 O O   . GLN A 1 388 ? 39.648 40.729 113.542 1.00 10.83 ? 388  GLN A O   1 
ATOM   3158 C CB  . GLN A 1 388 ? 41.535 41.652 110.775 1.00 13.56 ? 388  GLN A CB  1 
ATOM   3159 C CG  . GLN A 1 388 ? 42.038 42.811 111.624 1.00 17.58 ? 388  GLN A CG  1 
ATOM   3160 C CD  . GLN A 1 388 ? 43.263 43.495 111.018 1.00 19.84 ? 388  GLN A CD  1 
ATOM   3161 O OE1 . GLN A 1 388 ? 43.144 44.315 110.113 1.00 21.42 ? 388  GLN A OE1 1 
ATOM   3162 N NE2 . GLN A 1 388 ? 44.437 43.163 111.522 1.00 22.04 ? 388  GLN A NE2 1 
ATOM   3163 N N   . LYS A 1 389 ? 41.328 39.444 112.768 1.00 10.06 ? 389  LYS A N   1 
ATOM   3164 C CA  . LYS A 1 389 ? 41.500 38.727 114.021 1.00 10.14 ? 389  LYS A CA  1 
ATOM   3165 C C   . LYS A 1 389 ? 41.583 39.593 115.267 1.00 10.85 ? 389  LYS A C   1 
ATOM   3166 O O   . LYS A 1 389 ? 41.003 39.249 116.288 1.00 11.33 ? 389  LYS A O   1 
ATOM   3167 C CB  . LYS A 1 389 ? 42.688 37.759 113.960 1.00 10.33 ? 389  LYS A CB  1 
ATOM   3168 C CG  . LYS A 1 389 ? 42.682 36.691 115.058 1.00 10.96 ? 389  LYS A CG  1 
ATOM   3169 C CD  . LYS A 1 389 ? 43.881 35.770 114.934 1.00 11.16 ? 389  LYS A CD  1 
ATOM   3170 C CE  . LYS A 1 389 ? 43.827 34.578 115.872 1.00 11.70 ? 389  LYS A CE  1 
ATOM   3171 N NZ  . LYS A 1 389 ? 42.751 33.622 115.515 1.00 11.89 ? 389  LYS A NZ  1 
ATOM   3172 N N   . LYS A 1 390 ? 42.312 40.702 115.195 1.00 11.16 ? 390  LYS A N   1 
ATOM   3173 C CA  . LYS A 1 390 ? 42.431 41.563 116.371 1.00 12.01 ? 390  LYS A CA  1 
ATOM   3174 C C   . LYS A 1 390 ? 41.274 42.537 116.588 1.00 11.82 ? 390  LYS A C   1 
ATOM   3175 O O   . LYS A 1 390 ? 41.208 43.187 117.631 1.00 12.73 ? 390  LYS A O   1 
ATOM   3176 C CB  . LYS A 1 390 ? 43.767 42.316 116.382 1.00 14.17 ? 390  LYS A CB  1 
ATOM   3177 C CG  . LYS A 1 390 ? 43.945 43.383 115.340 1.00 17.31 ? 390  LYS A CG  1 
ATOM   3178 C CD  . LYS A 1 390 ? 45.342 43.964 115.455 1.00 19.78 ? 390  LYS A CD  1 
ATOM   3179 C CE  . LYS A 1 390 ? 45.609 44.978 114.377 1.00 21.13 ? 390  LYS A CE  1 
ATOM   3180 N NZ  . LYS A 1 390 ? 46.972 45.571 114.494 1.00 21.53 ? 390  LYS A NZ  1 
ATOM   3181 N N   . ASP A 1 391 ? 40.377 42.645 115.613 1.00 10.94 ? 391  ASP A N   1 
ATOM   3182 C CA  . ASP A 1 391 ? 39.225 43.527 115.748 1.00 10.69 ? 391  ASP A CA  1 
ATOM   3183 C C   . ASP A 1 391 ? 38.191 42.895 116.678 1.00 10.31 ? 391  ASP A C   1 
ATOM   3184 O O   . ASP A 1 391 ? 38.133 41.679 116.811 1.00 10.23 ? 391  ASP A O   1 
ATOM   3185 C CB  . ASP A 1 391 ? 38.598 43.800 114.373 1.00 11.12 ? 391  ASP A CB  1 
ATOM   3186 C CG  . ASP A 1 391 ? 39.456 44.716 113.509 1.00 12.46 ? 391  ASP A CG  1 
ATOM   3187 O OD1 . ASP A 1 391 ? 40.065 45.657 114.051 1.00 14.38 ? 391  ASP A OD1 1 
ATOM   3188 O OD2 . ASP A 1 391 ? 39.513 44.499 112.287 1.00 12.82 ? 391  ASP A OD2 1 
ATOM   3189 N N   . THR A 1 392 ? 37.352 43.725 117.283 1.00 11.01 ? 392  THR A N   1 
ATOM   3190 C CA  . THR A 1 392 ? 36.322 43.228 118.191 1.00 11.06 ? 392  THR A CA  1 
ATOM   3191 C C   . THR A 1 392 ? 34.935 43.618 117.692 1.00 10.87 ? 392  THR A C   1 
ATOM   3192 O O   . THR A 1 392 ? 33.953 43.633 118.451 1.00 11.68 ? 392  THR A O   1 
ATOM   3193 C CB  . THR A 1 392 ? 36.523 43.799 119.597 1.00 12.24 ? 392  THR A CB  1 
ATOM   3194 O OG1 . THR A 1 392 ? 36.448 45.225 119.548 1.00 13.64 ? 392  THR A OG1 1 
ATOM   3195 C CG2 . THR A 1 392 ? 37.889 43.404 120.146 1.00 12.93 ? 392  THR A CG2 1 
ATOM   3196 N N   . GLU A 1 393 ? 34.863 43.928 116.406 1.00 9.85  ? 393  GLU A N   1 
ATOM   3197 C CA  . GLU A 1 393 ? 33.616 44.338 115.785 1.00 9.46  ? 393  GLU A CA  1 
ATOM   3198 C C   . GLU A 1 393 ? 33.682 44.057 114.294 1.00 9.15  ? 393  GLU A C   1 
ATOM   3199 O O   . GLU A 1 393 ? 34.768 43.898 113.733 1.00 9.06  ? 393  GLU A O   1 
ATOM   3200 C CB  . GLU A 1 393 ? 33.413 45.839 115.987 1.00 10.21 ? 393  GLU A CB  1 
ATOM   3201 C CG  . GLU A 1 393 ? 34.331 46.667 115.126 1.00 11.22 ? 393  GLU A CG  1 
ATOM   3202 C CD  . GLU A 1 393 ? 34.548 48.055 115.649 1.00 11.34 ? 393  GLU A CD  1 
ATOM   3203 O OE1 . GLU A 1 393 ? 33.568 48.768 115.953 1.00 12.63 ? 393  GLU A OE1 1 
ATOM   3204 O OE2 . GLU A 1 393 ? 35.728 48.435 115.765 1.00 12.78 ? 393  GLU A OE2 1 
ATOM   3205 N N   . ILE A 1 394 ? 32.507 43.993 113.678 1.00 8.64  ? 394  ILE A N   1 
ATOM   3206 C CA  . ILE A 1 394 ? 32.402 43.791 112.242 1.00 8.76  ? 394  ILE A CA  1 
ATOM   3207 C C   . ILE A 1 394 ? 31.458 44.815 111.631 1.00 8.62  ? 394  ILE A C   1 
ATOM   3208 O O   . ILE A 1 394 ? 30.578 45.365 112.307 1.00 8.20  ? 394  ILE A O   1 
ATOM   3209 C CB  . ILE A 1 394 ? 31.861 42.373 111.835 1.00 8.68  ? 394  ILE A CB  1 
ATOM   3210 C CG1 . ILE A 1 394 ? 30.503 42.077 112.480 1.00 9.15  ? 394  ILE A CG1 1 
ATOM   3211 C CG2 . ILE A 1 394 ? 32.895 41.301 112.116 1.00 8.15  ? 394  ILE A CG2 1 
ATOM   3212 C CD1 . ILE A 1 394 ? 29.820 40.836 111.901 1.00 10.69 ? 394  ILE A CD1 1 
ATOM   3213 N N   . PHE A 1 395 ? 31.720 45.110 110.367 1.00 9.18  ? 395  PHE A N   1 
ATOM   3214 C CA  . PHE A 1 395 ? 30.883 45.974 109.554 1.00 8.77  ? 395  PHE A CA  1 
ATOM   3215 C C   . PHE A 1 395 ? 30.630 45.128 108.302 1.00 8.71  ? 395  PHE A C   1 
ATOM   3216 O O   . PHE A 1 395 ? 31.491 44.352 107.896 1.00 9.50  ? 395  PHE A O   1 
ATOM   3217 C CB  . PHE A 1 395 ? 31.616 47.251 109.128 1.00 9.62  ? 395  PHE A CB  1 
ATOM   3218 C CG  . PHE A 1 395 ? 31.780 48.266 110.222 1.00 9.65  ? 395  PHE A CG  1 
ATOM   3219 C CD1 . PHE A 1 395 ? 32.910 48.261 111.029 1.00 10.60 ? 395  PHE A CD1 1 
ATOM   3220 C CD2 . PHE A 1 395 ? 30.821 49.259 110.409 1.00 9.64  ? 395  PHE A CD2 1 
ATOM   3221 C CE1 . PHE A 1 395 ? 33.090 49.239 112.010 1.00 10.78 ? 395  PHE A CE1 1 
ATOM   3222 C CE2 . PHE A 1 395 ? 30.989 50.241 111.382 1.00 10.64 ? 395  PHE A CE2 1 
ATOM   3223 C CZ  . PHE A 1 395 ? 32.129 50.229 112.183 1.00 11.11 ? 395  PHE A CZ  1 
ATOM   3224 N N   . TYR A 1 396 ? 29.436 45.209 107.737 1.00 9.41  ? 396  TYR A N   1 
ATOM   3225 C CA  . TYR A 1 396 ? 29.158 44.469 106.512 1.00 10.31 ? 396  TYR A CA  1 
ATOM   3226 C C   . TYR A 1 396 ? 28.133 45.226 105.695 1.00 10.49 ? 396  TYR A C   1 
ATOM   3227 O O   . TYR A 1 396 ? 27.246 45.884 106.241 1.00 10.86 ? 396  TYR A O   1 
ATOM   3228 C CB  . TYR A 1 396 ? 28.755 43.008 106.757 1.00 10.77 ? 396  TYR A CB  1 
ATOM   3229 C CG  . TYR A 1 396 ? 27.637 42.766 107.744 1.00 11.20 ? 396  TYR A CG  1 
ATOM   3230 C CD1 . TYR A 1 396 ? 26.331 42.532 107.308 1.00 11.66 ? 396  TYR A CD1 1 
ATOM   3231 C CD2 . TYR A 1 396 ? 27.893 42.726 109.113 1.00 12.34 ? 396  TYR A CD2 1 
ATOM   3232 C CE1 . TYR A 1 396 ? 25.310 42.261 108.220 1.00 12.11 ? 396  TYR A CE1 1 
ATOM   3233 C CE2 . TYR A 1 396 ? 26.887 42.458 110.024 1.00 12.71 ? 396  TYR A CE2 1 
ATOM   3234 C CZ  . TYR A 1 396 ? 25.605 42.230 109.581 1.00 12.78 ? 396  TYR A CZ  1 
ATOM   3235 O OH  . TYR A 1 396 ? 24.640 42.000 110.522 1.00 13.38 ? 396  TYR A OH  1 
ATOM   3236 N N   . GLN A 1 397 ? 28.300 45.168 104.384 1.00 11.09 ? 397  GLN A N   1 
ATOM   3237 C CA  . GLN A 1 397 ? 27.440 45.897 103.481 1.00 11.72 ? 397  GLN A CA  1 
ATOM   3238 C C   . GLN A 1 397 ? 26.576 44.995 102.627 1.00 11.67 ? 397  GLN A C   1 
ATOM   3239 O O   . GLN A 1 397 ? 27.059 44.058 101.986 1.00 11.84 ? 397  GLN A O   1 
ATOM   3240 C CB  . GLN A 1 397 ? 28.300 46.804 102.611 1.00 13.75 ? 397  GLN A CB  1 
ATOM   3241 C CG  . GLN A 1 397 ? 27.543 47.824 101.807 1.00 16.06 ? 397  GLN A CG  1 
ATOM   3242 C CD  . GLN A 1 397 ? 28.432 48.952 101.318 1.00 17.98 ? 397  GLN A CD  1 
ATOM   3243 O OE1 . GLN A 1 397 ? 27.949 49.916 100.742 1.00 19.38 ? 397  GLN A OE1 1 
ATOM   3244 N NE2 . GLN A 1 397 ? 29.736 48.844 101.562 1.00 18.85 ? 397  GLN A NE2 1 
ATOM   3245 N N   . PHE A 1 398 ? 25.297 45.331 102.597 1.00 11.30 ? 398  PHE A N   1 
ATOM   3246 C CA  . PHE A 1 398 ? 24.296 44.597 101.846 1.00 11.91 ? 398  PHE A CA  1 
ATOM   3247 C C   . PHE A 1 398 ? 23.771 45.444 100.702 1.00 11.76 ? 398  PHE A C   1 
ATOM   3248 O O   . PHE A 1 398 ? 23.649 46.657 100.833 1.00 11.77 ? 398  PHE A O   1 
ATOM   3249 C CB  . PHE A 1 398 ? 23.132 44.255 102.782 1.00 12.36 ? 398  PHE A CB  1 
ATOM   3250 C CG  . PHE A 1 398 ? 21.941 43.673 102.083 1.00 13.29 ? 398  PHE A CG  1 
ATOM   3251 C CD1 . PHE A 1 398 ? 21.858 42.307 101.855 1.00 13.28 ? 398  PHE A CD1 1 
ATOM   3252 C CD2 . PHE A 1 398 ? 20.897 44.495 101.656 1.00 13.49 ? 398  PHE A CD2 1 
ATOM   3253 C CE1 . PHE A 1 398 ? 20.757 41.764 101.203 1.00 14.12 ? 398  PHE A CE1 1 
ATOM   3254 C CE2 . PHE A 1 398 ? 19.791 43.964 101.001 1.00 14.13 ? 398  PHE A CE2 1 
ATOM   3255 C CZ  . PHE A 1 398 ? 19.720 42.597 100.779 1.00 14.59 ? 398  PHE A CZ  1 
ATOM   3256 N N   . THR A 1 399 ? 23.443 44.794 99.594  1.00 11.85 ? 399  THR A N   1 
ATOM   3257 C CA  . THR A 1 399 ? 22.884 45.475 98.434  1.00 11.85 ? 399  THR A CA  1 
ATOM   3258 C C   . THR A 1 399 ? 21.941 44.516 97.703  1.00 11.81 ? 399  THR A C   1 
ATOM   3259 O O   . THR A 1 399 ? 21.954 43.312 97.951  1.00 10.97 ? 399  THR A O   1 
ATOM   3260 C CB  . THR A 1 399 ? 23.989 45.969 97.477  1.00 12.79 ? 399  THR A CB  1 
ATOM   3261 O OG1 . THR A 1 399 ? 23.418 46.853 96.508  1.00 14.39 ? 399  THR A OG1 1 
ATOM   3262 C CG2 . THR A 1 399 ? 24.648 44.808 96.755  1.00 13.28 ? 399  THR A CG2 1 
ATOM   3263 N N   . SER A 1 400 ? 21.083 45.062 96.852  1.00 11.46 ? 400  SER A N   1 
ATOM   3264 C CA  . SER A 1 400 ? 20.152 44.244 96.082  1.00 12.64 ? 400  SER A CA  1 
ATOM   3265 C C   . SER A 1 400 ? 19.776 45.017 94.820  1.00 11.65 ? 400  SER A C   1 
ATOM   3266 O O   . SER A 1 400 ? 20.273 46.119 94.585  1.00 12.35 ? 400  SER A O   1 
ATOM   3267 C CB  . SER A 1 400 ? 18.898 43.910 96.897  1.00 13.57 ? 400  SER A CB  1 
ATOM   3268 O OG  . SER A 1 400 ? 18.030 45.018 97.017  1.00 15.79 ? 400  SER A OG  1 
ATOM   3269 N N   . PHE A 1 401 ? 18.916 44.430 93.997  1.00 11.90 ? 401  PHE A N   1 
ATOM   3270 C CA  . PHE A 1 401 ? 18.492 45.082 92.768  1.00 12.03 ? 401  PHE A CA  1 
ATOM   3271 C C   . PHE A 1 401 ? 17.725 46.376 92.998  1.00 12.64 ? 401  PHE A C   1 
ATOM   3272 O O   . PHE A 1 401 ? 17.816 47.298 92.201  1.00 12.14 ? 401  PHE A O   1 
ATOM   3273 C CB  . PHE A 1 401 ? 17.597 44.151 91.941  1.00 11.77 ? 401  PHE A CB  1 
ATOM   3274 C CG  . PHE A 1 401 ? 18.305 42.954 91.382  1.00 11.70 ? 401  PHE A CG  1 
ATOM   3275 C CD1 . PHE A 1 401 ? 17.947 41.670 91.775  1.00 12.16 ? 401  PHE A CD1 1 
ATOM   3276 C CD2 . PHE A 1 401 ? 19.313 43.111 90.444  1.00 12.08 ? 401  PHE A CD2 1 
ATOM   3277 C CE1 . PHE A 1 401 ? 18.587 40.552 91.228  1.00 11.62 ? 401  PHE A CE1 1 
ATOM   3278 C CE2 . PHE A 1 401 ? 19.960 42.007 89.895  1.00 11.95 ? 401  PHE A CE2 1 
ATOM   3279 C CZ  . PHE A 1 401 ? 19.596 40.728 90.288  1.00 12.60 ? 401  PHE A CZ  1 
ATOM   3280 N N   . LEU A 1 402 ? 16.970 46.436 94.086  1.00 13.66 ? 402  LEU A N   1 
ATOM   3281 C CA  . LEU A 1 402 ? 16.147 47.609 94.357  1.00 16.23 ? 402  LEU A CA  1 
ATOM   3282 C C   . LEU A 1 402 ? 16.651 48.606 95.392  1.00 17.66 ? 402  LEU A C   1 
ATOM   3283 O O   . LEU A 1 402 ? 16.195 49.752 95.414  1.00 18.91 ? 402  LEU A O   1 
ATOM   3284 C CB  . LEU A 1 402 ? 14.718 47.165 94.703  1.00 15.82 ? 402  LEU A CB  1 
ATOM   3285 C CG  . LEU A 1 402 ? 14.041 46.276 93.656  1.00 17.05 ? 402  LEU A CG  1 
ATOM   3286 C CD1 . LEU A 1 402 ? 12.673 45.794 94.135  1.00 17.64 ? 402  LEU A CD1 1 
ATOM   3287 C CD2 . LEU A 1 402 ? 13.913 47.043 92.349  1.00 17.40 ? 402  LEU A CD2 1 
ATOM   3288 N N   . SER A 1 403 ? 17.569 48.183 96.254  1.00 19.39 ? 403  SER A N   1 
ATOM   3289 C CA  . SER A 1 403 ? 18.078 49.097 97.268  1.00 20.74 ? 403  SER A CA  1 
ATOM   3290 C C   . SER A 1 403 ? 19.570 49.387 97.146  1.00 20.38 ? 403  SER A C   1 
ATOM   3291 O O   . SER A 1 403 ? 20.379 48.492 96.897  1.00 19.56 ? 403  SER A O   1 
ATOM   3292 C CB  . SER A 1 403 ? 17.744 48.598 98.674  1.00 22.02 ? 403  SER A CB  1 
ATOM   3293 O OG  . SER A 1 403 ? 18.350 47.349 98.925  1.00 23.98 ? 403  SER A OG  1 
ATOM   3294 N N   . PRO A 1 404 ? 19.949 50.663 97.340  1.00 20.36 ? 404  PRO A N   1 
ATOM   3295 C CA  . PRO A 1 404 ? 21.328 51.155 97.272  1.00 20.27 ? 404  PRO A CA  1 
ATOM   3296 C C   . PRO A 1 404 ? 22.193 50.456 98.305  1.00 20.07 ? 404  PRO A C   1 
ATOM   3297 O O   . PRO A 1 404 ? 23.417 50.486 98.222  1.00 21.42 ? 404  PRO A O   1 
ATOM   3298 C CB  . PRO A 1 404 ? 21.173 52.642 97.597  1.00 20.40 ? 404  PRO A CB  1 
ATOM   3299 C CG  . PRO A 1 404 ? 19.804 52.947 97.118  1.00 20.96 ? 404  PRO A CG  1 
ATOM   3300 C CD  . PRO A 1 404 ? 19.022 51.774 97.598  1.00 20.92 ? 404  PRO A CD  1 
ATOM   3301 N N   . GLY A 1 405 ? 21.543 49.877 99.308  1.00 18.70 ? 405  GLY A N   1 
ATOM   3302 C CA  . GLY A 1 405 ? 22.275 49.153 100.325 1.00 17.51 ? 405  GLY A CA  1 
ATOM   3303 C C   . GLY A 1 405 ? 22.207 49.657 101.752 1.00 16.43 ? 405  GLY A C   1 
ATOM   3304 O O   . GLY A 1 405 ? 21.750 50.764 102.037 1.00 15.97 ? 405  GLY A O   1 
ATOM   3305 N N   . ILE A 1 406 ? 22.604 48.768 102.653 1.00 15.26 ? 406  ILE A N   1 
ATOM   3306 C CA  . ILE A 1 406 ? 22.633 49.055 104.076 1.00 14.13 ? 406  ILE A CA  1 
ATOM   3307 C C   . ILE A 1 406 ? 23.955 48.543 104.624 1.00 12.75 ? 406  ILE A C   1 
ATOM   3308 O O   . ILE A 1 406 ? 24.416 47.452 104.266 1.00 12.02 ? 406  ILE A O   1 
ATOM   3309 C CB  . ILE A 1 406 ? 21.511 48.304 104.840 1.00 15.36 ? 406  ILE A CB  1 
ATOM   3310 C CG1 . ILE A 1 406 ? 20.133 48.743 104.355 1.00 16.07 ? 406  ILE A CG1 1 
ATOM   3311 C CG2 . ILE A 1 406 ? 21.632 48.550 106.338 1.00 15.93 ? 406  ILE A CG2 1 
ATOM   3312 C CD1 . ILE A 1 406 ? 18.984 48.010 105.052 1.00 17.40 ? 406  ILE A CD1 1 
ATOM   3313 N N   . ILE A 1 407 ? 24.580 49.357 105.463 1.00 11.57 ? 407  ILE A N   1 
ATOM   3314 C CA  . ILE A 1 407 ? 25.821 48.981 106.111 1.00 10.37 ? 407  ILE A CA  1 
ATOM   3315 C C   . ILE A 1 407 ? 25.450 48.696 107.559 1.00 10.36 ? 407  ILE A C   1 
ATOM   3316 O O   . ILE A 1 407 ? 24.837 49.539 108.214 1.00 10.50 ? 407  ILE A O   1 
ATOM   3317 C CB  . ILE A 1 407 ? 26.861 50.118 106.073 1.00 9.96  ? 407  ILE A CB  1 
ATOM   3318 C CG1 . ILE A 1 407 ? 27.338 50.333 104.638 1.00 10.33 ? 407  ILE A CG1 1 
ATOM   3319 C CG2 . ILE A 1 407 ? 28.045 49.785 106.984 1.00 10.93 ? 407  ILE A CG2 1 
ATOM   3320 C CD1 . ILE A 1 407 ? 28.072 51.635 104.419 1.00 11.90 ? 407  ILE A CD1 1 
ATOM   3321 N N   . TYR A 1 408 ? 25.767 47.490 108.022 1.00 9.88  ? 408  TYR A N   1 
ATOM   3322 C CA  . TYR A 1 408 ? 25.489 47.067 109.388 1.00 10.76 ? 408  TYR A CA  1 
ATOM   3323 C C   . TYR A 1 408 ? 26.768 47.053 110.202 1.00 10.74 ? 408  TYR A C   1 
ATOM   3324 O O   . TYR A 1 408 ? 27.860 46.986 109.659 1.00 10.83 ? 408  TYR A O   1 
ATOM   3325 C CB  . TYR A 1 408 ? 24.908 45.653 109.406 1.00 11.65 ? 408  TYR A CB  1 
ATOM   3326 C CG  . TYR A 1 408 ? 23.605 45.479 108.667 1.00 12.59 ? 408  TYR A CG  1 
ATOM   3327 C CD1 . TYR A 1 408 ? 23.590 45.121 107.319 1.00 12.74 ? 408  TYR A CD1 1 
ATOM   3328 C CD2 . TYR A 1 408 ? 22.389 45.620 109.327 1.00 13.93 ? 408  TYR A CD2 1 
ATOM   3329 C CE1 . TYR A 1 408 ? 22.397 44.904 106.646 1.00 14.09 ? 408  TYR A CE1 1 
ATOM   3330 C CE2 . TYR A 1 408 ? 21.186 45.406 108.664 1.00 14.01 ? 408  TYR A CE2 1 
ATOM   3331 C CZ  . TYR A 1 408 ? 21.200 45.044 107.322 1.00 14.12 ? 408  TYR A CZ  1 
ATOM   3332 O OH  . TYR A 1 408 ? 20.019 44.801 106.656 1.00 15.46 ? 408  TYR A OH  1 
ATOM   3333 N N   . HIS A 1 409 ? 26.608 47.074 111.519 1.00 10.71 ? 409  HIS A N   1 
ATOM   3334 C CA  . HIS A 1 409 ? 27.733 47.047 112.451 1.00 11.01 ? 409  HIS A CA  1 
ATOM   3335 C C   . HIS A 1 409 ? 27.348 46.159 113.626 1.00 10.77 ? 409  HIS A C   1 
ATOM   3336 O O   . HIS A 1 409 ? 26.185 46.136 114.034 1.00 11.28 ? 409  HIS A O   1 
ATOM   3337 C CB  . HIS A 1 409 ? 28.035 48.469 112.948 1.00 12.33 ? 409  HIS A CB  1 
ATOM   3338 C CG  . HIS A 1 409 ? 29.108 48.535 113.992 1.00 13.11 ? 409  HIS A CG  1 
ATOM   3339 N ND1 . HIS A 1 409 ? 28.912 49.154 115.211 1.00 15.10 ? 409  HIS A ND1 1 
ATOM   3340 C CD2 . HIS A 1 409 ? 30.387 48.097 113.986 1.00 13.57 ? 409  HIS A CD2 1 
ATOM   3341 C CE1 . HIS A 1 409 ? 30.028 49.094 115.909 1.00 14.79 ? 409  HIS A CE1 1 
ATOM   3342 N NE2 . HIS A 1 409 ? 30.936 48.457 115.192 1.00 13.75 ? 409  HIS A NE2 1 
ATOM   3343 N N   . CYS A 1 410 ? 28.311 45.411 114.148 1.00 10.61 ? 410  CYS A N   1 
ATOM   3344 C CA  . CYS A 1 410 ? 28.044 44.566 115.302 1.00 10.28 ? 410  CYS A CA  1 
ATOM   3345 C C   . CYS A 1 410 ? 29.252 44.534 116.209 1.00 10.43 ? 410  CYS A C   1 
ATOM   3346 O O   . CYS A 1 410 ? 30.367 44.227 115.781 1.00 10.26 ? 410  CYS A O   1 
ATOM   3347 C CB  . CYS A 1 410 ? 27.655 43.141 114.898 1.00 10.76 ? 410  CYS A CB  1 
ATOM   3348 S SG  . CYS A 1 410 ? 27.158 42.126 116.322 1.00 11.18 ? 410  CYS A SG  1 
ATOM   3349 N N   . ASP A 1 411 ? 29.036 44.957 117.447 1.00 10.12 ? 411  ASP A N   1 
ATOM   3350 C CA  . ASP A 1 411 ? 30.076 44.966 118.458 1.00 10.39 ? 411  ASP A CA  1 
ATOM   3351 C C   . ASP A 1 411 ? 30.126 43.537 119.007 1.00 10.80 ? 411  ASP A C   1 
ATOM   3352 O O   . ASP A 1 411 ? 29.219 43.091 119.716 1.00 10.81 ? 411  ASP A O   1 
ATOM   3353 C CB  . ASP A 1 411 ? 29.705 45.976 119.553 1.00 10.76 ? 411  ASP A CB  1 
ATOM   3354 C CG  . ASP A 1 411 ? 30.728 46.044 120.677 1.00 12.84 ? 411  ASP A CG  1 
ATOM   3355 O OD1 . ASP A 1 411 ? 31.712 45.279 120.673 1.00 13.63 ? 411  ASP A OD1 1 
ATOM   3356 O OD2 . ASP A 1 411 ? 30.533 46.873 121.586 1.00 14.71 ? 411  ASP A OD2 1 
ATOM   3357 N N   . LEU A 1 412 ? 31.207 42.833 118.702 1.00 10.57 ? 412  LEU A N   1 
ATOM   3358 C CA  . LEU A 1 412 ? 31.333 41.449 119.133 1.00 11.56 ? 412  LEU A CA  1 
ATOM   3359 C C   . LEU A 1 412 ? 31.834 41.242 120.556 1.00 11.94 ? 412  LEU A C   1 
ATOM   3360 O O   . LEU A 1 412 ? 32.042 40.105 120.969 1.00 12.39 ? 412  LEU A O   1 
ATOM   3361 C CB  . LEU A 1 412 ? 32.182 40.662 118.131 1.00 11.03 ? 412  LEU A CB  1 
ATOM   3362 C CG  . LEU A 1 412 ? 31.583 40.623 116.717 1.00 11.40 ? 412  LEU A CG  1 
ATOM   3363 C CD1 . LEU A 1 412 ? 32.574 39.988 115.750 1.00 12.07 ? 412  LEU A CD1 1 
ATOM   3364 C CD2 . LEU A 1 412 ? 30.254 39.875 116.682 1.00 11.45 ? 412  LEU A CD2 1 
ATOM   3365 N N   . THR A 1 413 ? 32.036 42.326 121.299 1.00 12.70 ? 413  THR A N   1 
ATOM   3366 C CA  . THR A 1 413 ? 32.486 42.205 122.687 1.00 14.18 ? 413  THR A CA  1 
ATOM   3367 C C   . THR A 1 413 ? 31.293 41.953 123.604 1.00 15.41 ? 413  THR A C   1 
ATOM   3368 O O   . THR A 1 413 ? 31.453 41.491 124.726 1.00 15.67 ? 413  THR A O   1 
ATOM   3369 C CB  . THR A 1 413 ? 33.207 43.483 123.187 1.00 14.22 ? 413  THR A CB  1 
ATOM   3370 O OG1 . THR A 1 413 ? 32.307 44.598 123.157 1.00 14.45 ? 413  THR A OG1 1 
ATOM   3371 C CG2 . THR A 1 413 ? 34.421 43.797 122.325 1.00 14.49 ? 413  THR A CG2 1 
ATOM   3372 N N   . LYS A 1 414 ? 30.104 42.281 123.113 1.00 15.85 ? 414  LYS A N   1 
ATOM   3373 C CA  . LYS A 1 414 ? 28.870 42.123 123.874 1.00 17.17 ? 414  LYS A CA  1 
ATOM   3374 C C   . LYS A 1 414 ? 28.476 40.663 124.053 1.00 18.31 ? 414  LYS A C   1 
ATOM   3375 O O   . LYS A 1 414 ? 28.610 39.862 123.135 1.00 18.81 ? 414  LYS A O   1 
ATOM   3376 C CB  . LYS A 1 414 ? 27.735 42.874 123.179 1.00 16.93 ? 414  LYS A CB  1 
ATOM   3377 C CG  . LYS A 1 414 ? 27.978 44.368 123.048 1.00 16.94 ? 414  LYS A CG  1 
ATOM   3378 C CD  . LYS A 1 414 ? 27.900 45.057 124.397 1.00 17.47 ? 414  LYS A CD  1 
ATOM   3379 C CE  . LYS A 1 414 ? 28.210 46.534 124.271 1.00 17.51 ? 414  LYS A CE  1 
ATOM   3380 N NZ  . LYS A 1 414 ? 28.063 47.243 125.566 1.00 18.49 ? 414  LYS A NZ  1 
ATOM   3381 N N   . GLU A 1 415 ? 27.964 40.333 125.237 1.00 19.76 ? 415  GLU A N   1 
ATOM   3382 C CA  . GLU A 1 415 ? 27.538 38.969 125.530 1.00 21.04 ? 415  GLU A CA  1 
ATOM   3383 C C   . GLU A 1 415 ? 26.338 38.599 124.671 1.00 21.62 ? 415  GLU A C   1 
ATOM   3384 O O   . GLU A 1 415 ? 26.213 37.464 124.217 1.00 22.00 ? 415  GLU A O   1 
ATOM   3385 C CB  . GLU A 1 415 ? 27.195 38.824 127.014 1.00 22.18 ? 415  GLU A CB  1 
ATOM   3386 C CG  . GLU A 1 415 ? 28.393 39.023 127.935 1.00 24.00 ? 415  GLU A CG  1 
ATOM   3387 C CD  . GLU A 1 415 ? 29.549 38.096 127.597 1.00 24.60 ? 415  GLU A CD  1 
ATOM   3388 O OE1 . GLU A 1 415 ? 30.689 38.595 127.463 1.00 25.21 ? 415  GLU A OE1 1 
ATOM   3389 O OE2 . GLU A 1 415 ? 29.318 36.873 127.454 1.00 25.62 ? 415  GLU A OE2 1 
ATOM   3390 N N   . GLU A 1 416 ? 25.446 39.562 124.480 1.00 21.48 ? 416  GLU A N   1 
ATOM   3391 C CA  . GLU A 1 416 ? 24.257 39.362 123.667 1.00 22.03 ? 416  GLU A CA  1 
ATOM   3392 C C   . GLU A 1 416 ? 24.442 40.215 122.427 1.00 22.34 ? 416  GLU A C   1 
ATOM   3393 O O   . GLU A 1 416 ? 24.332 41.450 122.477 1.00 22.28 ? 416  GLU A O   1 
ATOM   3394 C CB  . GLU A 1 416 ? 23.003 39.742 124.459 1.00 21.84 ? 416  GLU A CB  1 
ATOM   3395 C CG  . GLU A 1 416 ? 22.783 38.831 125.674 1.00 21.58 ? 416  GLU A CG  1 
ATOM   3396 C CD  . GLU A 1 416 ? 21.636 39.256 126.578 1.00 21.85 ? 416  GLU A CD  1 
ATOM   3397 O OE1 . GLU A 1 416 ? 20.615 39.768 126.078 1.00 20.06 ? 416  GLU A OE1 1 
ATOM   3398 O OE2 . GLU A 1 416 ? 21.757 39.058 127.806 1.00 21.42 ? 416  GLU A OE2 1 
ATOM   3399 N N   . LEU A 1 417 ? 24.832 39.572 121.330 1.00 22.02 ? 417  LEU A N   1 
ATOM   3400 C CA  . LEU A 1 417 ? 25.116 40.247 120.069 1.00 22.34 ? 417  LEU A CA  1 
ATOM   3401 C C   . LEU A 1 417 ? 23.875 40.848 119.457 1.00 22.62 ? 417  LEU A C   1 
ATOM   3402 O O   . LEU A 1 417 ? 22.855 40.242 119.310 1.00 21.88 ? 417  LEU A O   1 
ATOM   3403 C CB  . LEU A 1 417 ? 25.721 39.265 119.060 1.00 21.95 ? 417  LEU A CB  1 
ATOM   3404 C CG  . LEU A 1 417 ? 27.017 38.602 119.513 1.00 21.39 ? 417  LEU A CG  1 
ATOM   3405 C CD1 . LEU A 1 417 ? 27.494 37.657 118.427 1.00 21.87 ? 417  LEU A CD1 1 
ATOM   3406 C CD2 . LEU A 1 417 ? 28.059 39.662 119.822 1.00 21.63 ? 417  LEU A CD2 1 
ATOM   3407 N N   . GLU A 1 418 ? 24.025 42.127 119.096 1.00 22.96 ? 418  GLU A N   1 
ATOM   3408 C CA  . GLU A 1 418 ? 22.927 42.878 118.465 1.00 23.75 ? 418  GLU A CA  1 
ATOM   3409 C C   . GLU A 1 418 ? 23.396 43.726 117.306 1.00 22.83 ? 418  GLU A C   1 
ATOM   3410 O O   . GLU A 1 418 ? 23.930 44.834 117.533 1.00 22.63 ? 418  GLU A O   1 
ATOM   3411 C CB  . GLU A 1 418 ? 22.234 43.743 119.518 1.00 25.67 ? 418  GLU A CB  1 
ATOM   3412 C CG  . GLU A 1 418 ? 21.526 42.921 120.557 1.00 28.03 ? 418  GLU A CG  1 
ATOM   3413 C CD  . GLU A 1 418 ? 20.917 43.770 121.625 1.00 29.69 ? 418  GLU A CD  1 
ATOM   3414 O OE1 . GLU A 1 418 ? 20.182 43.221 122.461 1.00 30.29 ? 418  GLU A OE1 1 
ATOM   3415 O OE2 . GLU A 1 418 ? 21.172 44.994 121.627 1.00 29.68 ? 418  GLU A OE2 1 
ATOM   3416 N N   . PRO A 1 419 ? 23.320 43.204 116.119 1.00 21.88 ? 419  PRO A N   1 
ATOM   3417 C CA  . PRO A 1 419 ? 23.697 43.909 114.881 1.00 21.25 ? 419  PRO A CA  1 
ATOM   3418 C C   . PRO A 1 419 ? 22.757 45.111 114.715 1.00 20.02 ? 419  PRO A C   1 
ATOM   3419 O O   . PRO A 1 419 ? 21.565 45.032 115.032 1.00 19.94 ? 419  PRO A O   1 
ATOM   3420 C CB  . PRO A 1 419 ? 23.531 42.866 113.778 1.00 21.99 ? 419  PRO A CB  1 
ATOM   3421 C CG  . PRO A 1 419 ? 22.454 41.946 114.330 1.00 22.51 ? 419  PRO A CG  1 
ATOM   3422 C CD  . PRO A 1 419 ? 22.830 41.830 115.776 1.00 22.36 ? 419  PRO A CD  1 
ATOM   3423 N N   . ARG A 1 420 ? 23.301 46.219 114.217 1.00 18.47 ? 420  ARG A N   1 
ATOM   3424 C CA  . ARG A 1 420 ? 22.510 47.430 114.031 1.00 17.34 ? 420  ARG A CA  1 
ATOM   3425 C C   . ARG A 1 420 ? 22.832 48.104 112.706 1.00 16.14 ? 420  ARG A C   1 
ATOM   3426 O O   . ARG A 1 420 ? 23.923 47.928 112.151 1.00 14.57 ? 420  ARG A O   1 
ATOM   3427 C CB  . ARG A 1 420 ? 22.835 48.405 115.185 1.00 18.65 ? 420  ARG A CB  1 
ATOM   3428 C CG  . ARG A 1 420 ? 21.650 49.204 115.705 1.00 21.81 ? 420  ARG A CG  1 
ATOM   3429 C CD  . ARG A 1 420 ? 20.776 48.378 116.646 1.00 23.05 ? 420  ARG A CD  1 
ATOM   3430 N NE  . ARG A 1 420 ? 19.584 49.113 117.065 1.00 25.02 ? 420  ARG A NE  1 
ATOM   3431 C CZ  . ARG A 1 420 ? 19.508 49.881 118.148 1.00 24.72 ? 420  ARG A CZ  1 
ATOM   3432 N NH1 . ARG A 1 420 ? 20.553 50.026 118.940 1.00 25.01 ? 420  ARG A NH1 1 
ATOM   3433 N NH2 . ARG A 1 420 ? 18.377 50.515 118.433 1.00 25.59 ? 420  ARG A NH2 1 
ATOM   3434 N N   . VAL A 1 421 ? 21.859 48.840 112.177 1.00 15.13 ? 421  VAL A N   1 
ATOM   3435 C CA  . VAL A 1 421 ? 22.043 49.574 110.931 1.00 14.88 ? 421  VAL A CA  1 
ATOM   3436 C C   . VAL A 1 421 ? 22.995 50.722 111.247 1.00 15.04 ? 421  VAL A C   1 
ATOM   3437 O O   . VAL A 1 421 ? 22.763 51.493 112.177 1.00 15.50 ? 421  VAL A O   1 
ATOM   3438 C CB  . VAL A 1 421 ? 20.711 50.152 110.396 1.00 14.80 ? 421  VAL A CB  1 
ATOM   3439 C CG1 . VAL A 1 421 ? 20.973 51.080 109.221 1.00 14.90 ? 421  VAL A CG1 1 
ATOM   3440 C CG2 . VAL A 1 421 ? 19.783 49.020 109.983 1.00 14.88 ? 421  VAL A CG2 1 
ATOM   3441 N N   . PHE A 1 422 ? 24.084 50.796 110.496 1.00 14.72 ? 422  PHE A N   1 
ATOM   3442 C CA  . PHE A 1 422 ? 25.087 51.830 110.687 1.00 14.97 ? 422  PHE A CA  1 
ATOM   3443 C C   . PHE A 1 422 ? 24.940 52.971 109.685 1.00 15.55 ? 422  PHE A C   1 
ATOM   3444 O O   . PHE A 1 422 ? 25.098 54.139 110.035 1.00 15.46 ? 422  PHE A O   1 
ATOM   3445 C CB  . PHE A 1 422 ? 26.484 51.212 110.581 1.00 14.36 ? 422  PHE A CB  1 
ATOM   3446 C CG  . PHE A 1 422 ? 27.590 52.147 110.970 1.00 14.84 ? 422  PHE A CG  1 
ATOM   3447 C CD1 . PHE A 1 422 ? 27.850 52.416 112.310 1.00 14.81 ? 422  PHE A CD1 1 
ATOM   3448 C CD2 . PHE A 1 422 ? 28.372 52.759 109.995 1.00 15.22 ? 422  PHE A CD2 1 
ATOM   3449 C CE1 . PHE A 1 422 ? 28.873 53.281 112.675 1.00 15.20 ? 422  PHE A CE1 1 
ATOM   3450 C CE2 . PHE A 1 422 ? 29.397 53.626 110.346 1.00 15.57 ? 422  PHE A CE2 1 
ATOM   3451 C CZ  . PHE A 1 422 ? 29.651 53.890 111.689 1.00 15.11 ? 422  PHE A CZ  1 
ATOM   3452 N N   . ARG A 1 423 ? 24.659 52.626 108.434 1.00 16.63 ? 423  ARG A N   1 
ATOM   3453 C CA  . ARG A 1 423 ? 24.502 53.626 107.382 1.00 18.16 ? 423  ARG A CA  1 
ATOM   3454 C C   . ARG A 1 423 ? 23.532 53.096 106.334 1.00 18.97 ? 423  ARG A C   1 
ATOM   3455 O O   . ARG A 1 423 ? 23.621 51.946 105.929 1.00 17.69 ? 423  ARG A O   1 
ATOM   3456 C CB  . ARG A 1 423 ? 25.861 53.930 106.735 1.00 19.13 ? 423  ARG A CB  1 
ATOM   3457 C CG  . ARG A 1 423 ? 25.796 54.801 105.483 1.00 21.25 ? 423  ARG A CG  1 
ATOM   3458 C CD  . ARG A 1 423 ? 25.425 56.234 105.814 1.00 22.29 ? 423  ARG A CD  1 
ATOM   3459 N NE  . ARG A 1 423 ? 26.487 56.905 106.555 1.00 23.53 ? 423  ARG A NE  1 
ATOM   3460 C CZ  . ARG A 1 423 ? 26.441 58.169 106.960 1.00 24.48 ? 423  ARG A CZ  1 
ATOM   3461 N NH1 . ARG A 1 423 ? 25.380 58.918 106.704 1.00 24.62 ? 423  ARG A NH1 1 
ATOM   3462 N NH2 . ARG A 1 423 ? 27.475 58.686 107.608 1.00 24.72 ? 423  ARG A NH2 1 
ATOM   3463 N N   . GLU A 1 424 ? 22.589 53.933 105.922 1.00 20.30 ? 424  GLU A N   1 
ATOM   3464 C CA  . GLU A 1 424 ? 21.601 53.562 104.920 1.00 22.92 ? 424  GLU A CA  1 
ATOM   3465 C C   . GLU A 1 424 ? 21.209 54.815 104.148 1.00 24.85 ? 424  GLU A C   1 
ATOM   3466 O O   . GLU A 1 424 ? 20.745 55.795 104.733 1.00 25.10 ? 424  GLU A O   1 
ATOM   3467 C CB  . GLU A 1 424 ? 20.368 52.946 105.581 1.00 22.75 ? 424  GLU A CB  1 
ATOM   3468 C CG  . GLU A 1 424 ? 19.290 52.499 104.599 1.00 23.11 ? 424  GLU A CG  1 
ATOM   3469 C CD  . GLU A 1 424 ? 18.154 51.725 105.254 1.00 23.70 ? 424  GLU A CD  1 
ATOM   3470 O OE1 . GLU A 1 424 ? 18.085 51.696 106.499 1.00 23.54 ? 424  GLU A OE1 1 
ATOM   3471 O OE2 . GLU A 1 424 ? 17.333 51.142 104.515 1.00 23.63 ? 424  GLU A OE2 1 
ATOM   3472 N N   . VAL A 1 425 ? 21.454 54.795 102.844 1.00 27.25 ? 425  VAL A N   1 
ATOM   3473 C CA  . VAL A 1 425 ? 21.130 55.928 101.984 1.00 29.90 ? 425  VAL A CA  1 
ATOM   3474 C C   . VAL A 1 425 ? 19.943 55.618 101.084 1.00 31.02 ? 425  VAL A C   1 
ATOM   3475 O O   . VAL A 1 425 ? 19.813 54.508 100.564 1.00 31.30 ? 425  VAL A O   1 
ATOM   3476 C CB  . VAL A 1 425 ? 22.340 56.356 101.117 1.00 30.52 ? 425  VAL A CB  1 
ATOM   3477 C CG1 . VAL A 1 425 ? 23.513 56.747 102.008 1.00 30.80 ? 425  VAL A CG1 1 
ATOM   3478 C CG2 . VAL A 1 425 ? 22.737 55.232 100.158 1.00 31.53 ? 425  VAL A CG2 1 
ATOM   3479 N N   . THR A 1 426 ? 19.084 56.612 100.896 1.00 32.25 ? 426  THR A N   1 
ATOM   3480 C CA  . THR A 1 426 ? 17.907 56.445 100.058 1.00 33.11 ? 426  THR A CA  1 
ATOM   3481 C C   . THR A 1 426 ? 18.070 57.218 98.746  1.00 33.45 ? 426  THR A C   1 
ATOM   3482 O O   . THR A 1 426 ? 18.573 58.340 98.740  1.00 33.56 ? 426  THR A O   1 
ATOM   3483 C CB  . THR A 1 426 ? 16.632 56.910 100.806 1.00 33.76 ? 426  THR A CB  1 
ATOM   3484 O OG1 . THR A 1 426 ? 15.467 56.531 100.062 1.00 33.90 ? 426  THR A OG1 1 
ATOM   3485 C CG2 . THR A 1 426 ? 16.631 58.422 101.030 1.00 34.01 ? 426  THR A CG2 1 
ATOM   3486 N N   . VAL A 1 427 ? 17.701 56.588 97.635  1.00 33.60 ? 427  VAL A N   1 
ATOM   3487 C CA  . VAL A 1 427 ? 17.793 57.229 96.325  1.00 33.69 ? 427  VAL A CA  1 
ATOM   3488 C C   . VAL A 1 427 ? 16.432 57.788 95.928  1.00 34.25 ? 427  VAL A C   1 
ATOM   3489 O O   . VAL A 1 427 ? 15.496 57.035 95.658  1.00 34.13 ? 427  VAL A O   1 
ATOM   3490 C CB  . VAL A 1 427 ? 18.285 56.239 95.238  1.00 33.26 ? 427  VAL A CB  1 
ATOM   3491 C CG1 . VAL A 1 427 ? 18.199 56.875 93.853  1.00 33.31 ? 427  VAL A CG1 1 
ATOM   3492 C CG2 . VAL A 1 427 ? 19.712 55.825 95.519  1.00 32.95 ? 427  VAL A CG2 1 
ATOM   3493 N N   . LYS A 1 428 ? 16.323 59.112 95.921  1.00 34.93 ? 428  LYS A N   1 
ATOM   3494 C CA  . LYS A 1 428 ? 15.081 59.778 95.551  1.00 35.35 ? 428  LYS A CA  1 
ATOM   3495 C C   . LYS A 1 428 ? 14.821 59.639 94.055  1.00 35.33 ? 428  LYS A C   1 
ATOM   3496 O O   . LYS A 1 428 ? 15.749 59.675 93.253  1.00 35.41 ? 428  LYS A O   1 
ATOM   3497 C CB  . LYS A 1 428 ? 15.138 61.258 95.923  1.00 36.08 ? 428  LYS A CB  1 
ATOM   3498 C CG  . LYS A 1 428 ? 15.245 61.533 97.405  1.00 36.71 ? 428  LYS A CG  1 
ATOM   3499 C CD  . LYS A 1 428 ? 15.236 63.025 97.670  1.00 37.86 ? 428  LYS A CD  1 
ATOM   3500 C CE  . LYS A 1 428 ? 15.204 63.326 99.156  1.00 38.00 ? 428  LYS A CE  1 
ATOM   3501 N NZ  . LYS A 1 428 ? 15.148 64.793 99.415  1.00 38.65 ? 428  LYS A NZ  1 
ATOM   3502 N N   . GLY A 1 429 ? 13.549 59.510 93.693  1.00 35.23 ? 429  GLY A N   1 
ATOM   3503 C CA  . GLY A 1 429 ? 13.197 59.367 92.291  1.00 35.10 ? 429  GLY A CA  1 
ATOM   3504 C C   . GLY A 1 429 ? 12.854 57.936 91.933  1.00 34.82 ? 429  GLY A C   1 
ATOM   3505 O O   . GLY A 1 429 ? 12.132 57.684 90.969  1.00 35.26 ? 429  GLY A O   1 
ATOM   3506 N N   . ILE A 1 430 ? 13.380 56.993 92.706  1.00 34.16 ? 430  ILE A N   1 
ATOM   3507 C CA  . ILE A 1 430 ? 13.116 55.580 92.479  1.00 33.33 ? 430  ILE A CA  1 
ATOM   3508 C C   . ILE A 1 430 ? 12.430 54.985 93.704  1.00 32.73 ? 430  ILE A C   1 
ATOM   3509 O O   . ILE A 1 430 ? 13.006 54.930 94.784  1.00 32.74 ? 430  ILE A O   1 
ATOM   3510 C CB  . ILE A 1 430 ? 14.416 54.788 92.196  1.00 33.45 ? 430  ILE A CB  1 
ATOM   3511 C CG1 . ILE A 1 430 ? 15.126 55.352 90.967  1.00 33.55 ? 430  ILE A CG1 1 
ATOM   3512 C CG2 . ILE A 1 430 ? 14.095 53.308 91.985  1.00 33.89 ? 430  ILE A CG2 1 
ATOM   3513 C CD1 . ILE A 1 430 ? 16.442 54.669 90.647  1.00 33.12 ? 430  ILE A CD1 1 
ATOM   3514 N N   . ASP A 1 431 ? 11.176 54.587 93.535  1.00 31.78 ? 431  ASP A N   1 
ATOM   3515 C CA  . ASP A 1 431 ? 10.419 53.988 94.624  1.00 30.88 ? 431  ASP A CA  1 
ATOM   3516 C C   . ASP A 1 431 ? 10.531 52.468 94.505  1.00 30.04 ? 431  ASP A C   1 
ATOM   3517 O O   . ASP A 1 431 ? 9.920  51.862 93.625  1.00 29.87 ? 431  ASP A O   1 
ATOM   3518 C CB  . ASP A 1 431 ? 8.951  54.437 94.551  1.00 31.36 ? 431  ASP A CB  1 
ATOM   3519 C CG  . ASP A 1 431 ? 8.127  53.998 95.759  1.00 31.45 ? 431  ASP A CG  1 
ATOM   3520 O OD1 . ASP A 1 431 ? 8.647  53.278 96.637  1.00 32.13 ? 431  ASP A OD1 1 
ATOM   3521 O OD2 . ASP A 1 431 ? 6.940  54.385 95.821  1.00 32.09 ? 431  ASP A OD2 1 
ATOM   3522 N N   . ALA A 1 432 ? 11.288 51.860 95.413  1.00 28.74 ? 432  ALA A N   1 
ATOM   3523 C CA  . ALA A 1 432 ? 11.496 50.411 95.420  1.00 27.70 ? 432  ALA A CA  1 
ATOM   3524 C C   . ALA A 1 432 ? 10.191 49.617 95.497  1.00 27.01 ? 432  ALA A C   1 
ATOM   3525 O O   . ALA A 1 432 ? 10.085 48.535 94.924  1.00 26.42 ? 432  ALA A O   1 
ATOM   3526 C CB  . ALA A 1 432 ? 12.424 50.016 96.560  1.00 27.84 ? 432  ALA A CB  1 
ATOM   3527 N N   . SER A 1 433 ? 9.198  50.179 96.180  1.00 26.16 ? 433  SER A N   1 
ATOM   3528 C CA  . SER A 1 433 ? 7.897  49.534 96.336  1.00 25.56 ? 433  SER A CA  1 
ATOM   3529 C C   . SER A 1 433 ? 7.144  49.362 95.018  1.00 24.59 ? 433  SER A C   1 
ATOM   3530 O O   . SER A 1 433 ? 6.210  48.572 94.937  1.00 24.32 ? 433  SER A O   1 
ATOM   3531 C CB  . SER A 1 433 ? 7.024  50.321 97.316  1.00 26.03 ? 433  SER A CB  1 
ATOM   3532 O OG  . SER A 1 433 ? 7.629  50.390 98.590  1.00 27.93 ? 433  SER A OG  1 
ATOM   3533 N N   . ASP A 1 434 ? 7.530  50.129 94.005  1.00 23.80 ? 434  ASP A N   1 
ATOM   3534 C CA  . ASP A 1 434 ? 6.881  50.048 92.700  1.00 23.18 ? 434  ASP A CA  1 
ATOM   3535 C C   . ASP A 1 434 ? 7.361  48.845 91.890  1.00 22.48 ? 434  ASP A C   1 
ATOM   3536 O O   . ASP A 1 434 ? 6.743  48.464 90.891  1.00 22.05 ? 434  ASP A O   1 
ATOM   3537 C CB  . ASP A 1 434 ? 7.168  51.318 91.885  1.00 23.92 ? 434  ASP A CB  1 
ATOM   3538 C CG  . ASP A 1 434 ? 6.629  52.585 92.531  1.00 25.06 ? 434  ASP A CG  1 
ATOM   3539 O OD1 . ASP A 1 434 ? 6.988  53.678 92.036  1.00 25.51 ? 434  ASP A OD1 1 
ATOM   3540 O OD2 . ASP A 1 434 ? 5.862  52.500 93.512  1.00 25.63 ? 434  ASP A OD2 1 
ATOM   3541 N N   . TYR A 1 435 ? 8.468  48.254 92.321  1.00 21.54 ? 435  TYR A N   1 
ATOM   3542 C CA  . TYR A 1 435 ? 9.046  47.128 91.605  1.00 21.35 ? 435  TYR A CA  1 
ATOM   3543 C C   . TYR A 1 435 ? 9.017  45.803 92.324  1.00 20.75 ? 435  TYR A C   1 
ATOM   3544 O O   . TYR A 1 435 ? 8.810  45.737 93.541  1.00 20.03 ? 435  TYR A O   1 
ATOM   3545 C CB  . TYR A 1 435 ? 10.477 47.471 91.189  1.00 21.87 ? 435  TYR A CB  1 
ATOM   3546 C CG  . TYR A 1 435 ? 10.580 48.842 90.579  1.00 23.36 ? 435  TYR A CG  1 
ATOM   3547 C CD1 . TYR A 1 435 ? 10.162 49.071 89.271  1.00 23.78 ? 435  TYR A CD1 1 
ATOM   3548 C CD2 . TYR A 1 435 ? 11.026 49.924 91.334  1.00 24.13 ? 435  TYR A CD2 1 
ATOM   3549 C CE1 . TYR A 1 435 ? 10.175 50.354 88.728  1.00 24.88 ? 435  TYR A CE1 1 
ATOM   3550 C CE2 . TYR A 1 435 ? 11.046 51.208 90.801  1.00 24.61 ? 435  TYR A CE2 1 
ATOM   3551 C CZ  . TYR A 1 435 ? 10.617 51.415 89.501  1.00 25.03 ? 435  TYR A CZ  1 
ATOM   3552 O OH  . TYR A 1 435 ? 10.618 52.687 88.981  1.00 26.08 ? 435  TYR A OH  1 
ATOM   3553 N N   . GLN A 1 436 ? 9.311  44.748 91.578  1.00 20.30 ? 436  GLN A N   1 
ATOM   3554 C CA  . GLN A 1 436 ? 9.300  43.402 92.098  1.00 20.17 ? 436  GLN A CA  1 
ATOM   3555 C C   . GLN A 1 436 ? 10.462 42.591 91.537  1.00 18.83 ? 436  GLN A C   1 
ATOM   3556 O O   . GLN A 1 436 ? 10.807 42.722 90.360  1.00 18.10 ? 436  GLN A O   1 
ATOM   3557 C CB  . GLN A 1 436 ? 7.978  42.748 91.696  1.00 22.03 ? 436  GLN A CB  1 
ATOM   3558 C CG  . GLN A 1 436 ? 7.809  41.304 92.072  1.00 24.50 ? 436  GLN A CG  1 
ATOM   3559 C CD  . GLN A 1 436 ? 6.449  40.782 91.664  1.00 25.57 ? 436  GLN A CD  1 
ATOM   3560 O OE1 . GLN A 1 436 ? 5.463  40.992 92.362  1.00 26.65 ? 436  GLN A OE1 1 
ATOM   3561 N NE2 . GLN A 1 436 ? 6.385  40.121 90.513  1.00 26.66 ? 436  GLN A NE2 1 
ATOM   3562 N N   . THR A 1 437 ? 11.074 41.781 92.396  1.00 17.96 ? 437  THR A N   1 
ATOM   3563 C CA  . THR A 1 437 ? 12.172 40.907 92.004  1.00 16.79 ? 437  THR A CA  1 
ATOM   3564 C C   . THR A 1 437 ? 11.732 39.478 92.280  1.00 15.70 ? 437  THR A C   1 
ATOM   3565 O O   . THR A 1 437 ? 11.353 39.148 93.402  1.00 15.87 ? 437  THR A O   1 
ATOM   3566 C CB  . THR A 1 437 ? 13.452 41.162 92.817  1.00 17.61 ? 437  THR A CB  1 
ATOM   3567 O OG1 . THR A 1 437 ? 13.914 42.497 92.583  1.00 19.08 ? 437  THR A OG1 1 
ATOM   3568 C CG2 . THR A 1 437 ? 14.542 40.167 92.422  1.00 18.00 ? 437  THR A CG2 1 
ATOM   3569 N N   . VAL A 1 438 ? 11.710 38.656 91.238  1.00 14.08 ? 438  VAL A N   1 
ATOM   3570 C CA  . VAL A 1 438 ? 11.344 37.256 91.390  1.00 13.82 ? 438  VAL A CA  1 
ATOM   3571 C C   . VAL A 1 438 ? 12.472 36.386 90.856  1.00 12.48 ? 438  VAL A C   1 
ATOM   3572 O O   . VAL A 1 438 ? 13.227 36.799 89.983  1.00 12.31 ? 438  VAL A O   1 
ATOM   3573 C CB  . VAL A 1 438 ? 10.036 36.897 90.633  1.00 14.88 ? 438  VAL A CB  1 
ATOM   3574 C CG1 . VAL A 1 438 ? 8.857  37.690 91.182  1.00 15.65 ? 438  VAL A CG1 1 
ATOM   3575 C CG2 . VAL A 1 438 ? 10.195 37.122 89.133  1.00 15.73 ? 438  VAL A CG2 1 
ATOM   3576 N N   . GLN A 1 439 ? 12.624 35.216 91.453  1.00 11.35 ? 439  GLN A N   1 
ATOM   3577 C CA  . GLN A 1 439 ? 13.619 34.255 91.021  1.00 10.67 ? 439  GLN A CA  1 
ATOM   3578 C C   . GLN A 1 439 ? 12.873 33.038 90.510  1.00 10.93 ? 439  GLN A C   1 
ATOM   3579 O O   . GLN A 1 439 ? 11.952 32.542 91.161  1.00 10.61 ? 439  GLN A O   1 
ATOM   3580 C CB  . GLN A 1 439 ? 14.529 33.825 92.174  1.00 10.30 ? 439  GLN A CB  1 
ATOM   3581 C CG  . GLN A 1 439 ? 15.554 32.772 91.769  1.00 10.68 ? 439  GLN A CG  1 
ATOM   3582 C CD  . GLN A 1 439 ? 16.501 32.421 92.893  1.00 11.08 ? 439  GLN A CD  1 
ATOM   3583 O OE1 . GLN A 1 439 ? 16.080 31.994 93.971  1.00 12.11 ? 439  GLN A OE1 1 
ATOM   3584 N NE2 . GLN A 1 439 ? 17.790 32.600 92.652  1.00 10.20 ? 439  GLN A NE2 1 
ATOM   3585 N N   . ILE A 1 440 ? 13.226 32.601 89.311  1.00 9.76  ? 440  ILE A N   1 
ATOM   3586 C CA  . ILE A 1 440 ? 12.609 31.421 88.724  1.00 10.31 ? 440  ILE A CA  1 
ATOM   3587 C C   . ILE A 1 440 ? 13.732 30.499 88.290  1.00 10.08 ? 440  ILE A C   1 
ATOM   3588 O O   . ILE A 1 440 ? 14.899 30.896 88.289  1.00 9.86  ? 440  ILE A O   1 
ATOM   3589 C CB  . ILE A 1 440 ? 11.691 31.785 87.514  1.00 10.43 ? 440  ILE A CB  1 
ATOM   3590 C CG1 . ILE A 1 440 ? 12.477 32.498 86.404  1.00 10.53 ? 440  ILE A CG1 1 
ATOM   3591 C CG2 . ILE A 1 440 ? 10.534 32.654 87.984  1.00 11.62 ? 440  ILE A CG2 1 
ATOM   3592 C CD1 . ILE A 1 440 ? 13.159 31.570 85.408  1.00 11.33 ? 440  ILE A CD1 1 
ATOM   3593 N N   . PHE A 1 441 ? 13.383 29.260 87.971  1.00 10.54 ? 441  PHE A N   1 
ATOM   3594 C CA  . PHE A 1 441 ? 14.345 28.270 87.513  1.00 10.78 ? 441  PHE A CA  1 
ATOM   3595 C C   . PHE A 1 441 ? 13.803 27.725 86.206  1.00 11.69 ? 441  PHE A C   1 
ATOM   3596 O O   . PHE A 1 441 ? 12.694 27.195 86.159  1.00 13.13 ? 441  PHE A O   1 
ATOM   3597 C CB  . PHE A 1 441 ? 14.520 27.160 88.551  1.00 10.65 ? 441  PHE A CB  1 
ATOM   3598 C CG  . PHE A 1 441 ? 15.026 27.664 89.866  1.00 12.30 ? 441  PHE A CG  1 
ATOM   3599 C CD1 . PHE A 1 441 ? 14.139 28.147 90.821  1.00 12.45 ? 441  PHE A CD1 1 
ATOM   3600 C CD2 . PHE A 1 441 ? 16.393 27.701 90.140  1.00 12.00 ? 441  PHE A CD2 1 
ATOM   3601 C CE1 . PHE A 1 441 ? 14.598 28.670 92.028  1.00 13.38 ? 441  PHE A CE1 1 
ATOM   3602 C CE2 . PHE A 1 441 ? 16.864 28.221 91.344  1.00 12.59 ? 441  PHE A CE2 1 
ATOM   3603 C CZ  . PHE A 1 441 ? 15.965 28.704 92.291  1.00 13.11 ? 441  PHE A CZ  1 
ATOM   3604 N N   . TYR A 1 442 ? 14.545 27.949 85.130  1.00 11.11 ? 442  TYR A N   1 
ATOM   3605 C CA  . TYR A 1 442 ? 14.110 27.493 83.819  1.00 12.02 ? 442  TYR A CA  1 
ATOM   3606 C C   . TYR A 1 442 ? 14.967 26.338 83.316  1.00 12.57 ? 442  TYR A C   1 
ATOM   3607 O O   . TYR A 1 442 ? 16.149 26.236 83.635  1.00 12.08 ? 442  TYR A O   1 
ATOM   3608 C CB  . TYR A 1 442 ? 14.145 28.654 82.820  1.00 11.11 ? 442  TYR A CB  1 
ATOM   3609 C CG  . TYR A 1 442 ? 15.531 29.156 82.496  1.00 9.03  ? 442  TYR A CG  1 
ATOM   3610 C CD1 . TYR A 1 442 ? 16.252 28.611 81.432  1.00 8.96  ? 442  TYR A CD1 1 
ATOM   3611 C CD2 . TYR A 1 442 ? 16.131 30.153 83.261  1.00 8.71  ? 442  TYR A CD2 1 
ATOM   3612 C CE1 . TYR A 1 442 ? 17.540 29.038 81.143  1.00 7.89  ? 442  TYR A CE1 1 
ATOM   3613 C CE2 . TYR A 1 442 ? 17.421 30.600 82.980  1.00 7.92  ? 442  TYR A CE2 1 
ATOM   3614 C CZ  . TYR A 1 442 ? 18.126 30.034 81.917  1.00 7.78  ? 442  TYR A CZ  1 
ATOM   3615 O OH  . TYR A 1 442 ? 19.409 30.461 81.638  1.00 8.70  ? 442  TYR A OH  1 
ATOM   3616 N N   . PRO A 1 443 ? 14.370 25.424 82.547  1.00 14.27 ? 443  PRO A N   1 
ATOM   3617 C CA  . PRO A 1 443 ? 15.139 24.296 82.029  1.00 14.30 ? 443  PRO A CA  1 
ATOM   3618 C C   . PRO A 1 443 ? 15.949 24.671 80.793  1.00 13.58 ? 443  PRO A C   1 
ATOM   3619 O O   . PRO A 1 443 ? 15.475 25.390 79.916  1.00 14.36 ? 443  PRO A O   1 
ATOM   3620 C CB  . PRO A 1 443 ? 14.051 23.278 81.694  1.00 15.48 ? 443  PRO A CB  1 
ATOM   3621 C CG  . PRO A 1 443 ? 12.928 24.159 81.231  1.00 16.32 ? 443  PRO A CG  1 
ATOM   3622 C CD  . PRO A 1 443 ? 12.932 25.259 82.271  1.00 15.35 ? 443  PRO A CD  1 
ATOM   3623 N N   . SER A 1 444 ? 17.198 24.226 80.765  1.00 12.21 ? 444  SER A N   1 
ATOM   3624 C CA  . SER A 1 444 ? 18.054 24.468 79.619  1.00 11.53 ? 444  SER A CA  1 
ATOM   3625 C C   . SER A 1 444 ? 17.827 23.294 78.660  1.00 11.56 ? 444  SER A C   1 
ATOM   3626 O O   . SER A 1 444 ? 17.042 22.393 78.952  1.00 11.54 ? 444  SER A O   1 
ATOM   3627 C CB  . SER A 1 444 ? 19.520 24.543 80.048  1.00 11.93 ? 444  SER A CB  1 
ATOM   3628 O OG  . SER A 1 444 ? 20.337 24.900 78.949  1.00 9.44  ? 444  SER A OG  1 
ATOM   3629 N N   . LYS A 1 445 ? 18.577 23.275 77.564  1.00 11.13 ? 445  LYS A N   1 
ATOM   3630 C CA  . LYS A 1 445 ? 18.472 22.238 76.535  1.00 12.64 ? 445  LYS A CA  1 
ATOM   3631 C C   . LYS A 1 445 ? 18.575 20.820 77.098  1.00 12.83 ? 445  LYS A C   1 
ATOM   3632 O O   . LYS A 1 445 ? 17.764 19.952 76.763  1.00 13.61 ? 445  LYS A O   1 
ATOM   3633 C CB  . LYS A 1 445 ? 19.556 22.469 75.473  1.00 13.90 ? 445  LYS A CB  1 
ATOM   3634 C CG  . LYS A 1 445 ? 19.509 21.541 74.279  1.00 16.70 ? 445  LYS A CG  1 
ATOM   3635 C CD  . LYS A 1 445 ? 20.605 21.917 73.294  1.00 18.36 ? 445  LYS A CD  1 
ATOM   3636 C CE  . LYS A 1 445 ? 20.579 21.031 72.063  1.00 20.04 ? 445  LYS A CE  1 
ATOM   3637 N NZ  . LYS A 1 445 ? 21.611 21.445 71.074  1.00 21.49 ? 445  LYS A NZ  1 
ATOM   3638 N N   . ASP A 1 446 ? 19.543 20.597 77.983  1.00 12.16 ? 446  ASP A N   1 
ATOM   3639 C CA  . ASP A 1 446 ? 19.743 19.275 78.567  1.00 11.60 ? 446  ASP A CA  1 
ATOM   3640 C C   . ASP A 1 446 ? 18.886 18.983 79.799  1.00 12.08 ? 446  ASP A C   1 
ATOM   3641 O O   . ASP A 1 446 ? 19.077 17.959 80.457  1.00 12.21 ? 446  ASP A O   1 
ATOM   3642 C CB  . ASP A 1 446 ? 21.240 19.019 78.850  1.00 11.83 ? 446  ASP A CB  1 
ATOM   3643 C CG  . ASP A 1 446 ? 21.819 19.907 79.960  1.00 11.07 ? 446  ASP A CG  1 
ATOM   3644 O OD1 . ASP A 1 446 ? 23.063 19.977 80.064  1.00 11.39 ? 446  ASP A OD1 1 
ATOM   3645 O OD2 . ASP A 1 446 ? 21.061 20.513 80.736  1.00 11.79 ? 446  ASP A OD2 1 
ATOM   3646 N N   . GLY A 1 447 ? 17.972 19.902 80.108  1.00 12.22 ? 447  GLY A N   1 
ATOM   3647 C CA  . GLY A 1 447 ? 17.092 19.737 81.253  1.00 12.16 ? 447  GLY A CA  1 
ATOM   3648 C C   . GLY A 1 447 ? 17.558 20.367 82.560  1.00 12.12 ? 447  GLY A C   1 
ATOM   3649 O O   . GLY A 1 447 ? 16.780 20.485 83.507  1.00 12.79 ? 447  GLY A O   1 
ATOM   3650 N N   . THR A 1 448 ? 18.816 20.787 82.629  1.00 11.02 ? 448  THR A N   1 
ATOM   3651 C CA  . THR A 1 448 ? 19.328 21.407 83.848  1.00 10.90 ? 448  THR A CA  1 
ATOM   3652 C C   . THR A 1 448 ? 18.531 22.665 84.161  1.00 10.69 ? 448  THR A C   1 
ATOM   3653 O O   . THR A 1 448 ? 18.270 23.469 83.273  1.00 10.64 ? 448  THR A O   1 
ATOM   3654 C CB  . THR A 1 448 ? 20.809 21.803 83.687  1.00 11.14 ? 448  THR A CB  1 
ATOM   3655 O OG1 . THR A 1 448 ? 21.569 20.665 83.282  1.00 12.19 ? 448  THR A OG1 1 
ATOM   3656 C CG2 . THR A 1 448 ? 21.371 22.331 85.000  1.00 10.54 ? 448  THR A CG2 1 
ATOM   3657 N N   . LYS A 1 449 ? 18.136 22.821 85.418  1.00 10.74 ? 449  LYS A N   1 
ATOM   3658 C CA  . LYS A 1 449 ? 17.382 23.989 85.865  1.00 10.92 ? 449  LYS A CA  1 
ATOM   3659 C C   . LYS A 1 449 ? 18.356 25.123 86.174  1.00 9.38  ? 449  LYS A C   1 
ATOM   3660 O O   . LYS A 1 449 ? 19.293 24.963 86.959  1.00 9.98  ? 449  LYS A O   1 
ATOM   3661 C CB  . LYS A 1 449 ? 16.533 23.641 87.091  1.00 12.46 ? 449  LYS A CB  1 
ATOM   3662 C CG  . LYS A 1 449 ? 15.405 22.654 86.788  1.00 15.24 ? 449  LYS A CG  1 
ATOM   3663 C CD  . LYS A 1 449 ? 14.428 23.242 85.773  1.00 18.64 ? 449  LYS A CD  1 
ATOM   3664 C CE  . LYS A 1 449 ? 13.293 22.286 85.439  1.00 20.56 ? 449  LYS A CE  1 
ATOM   3665 N NZ  . LYS A 1 449 ? 12.568 21.839 86.661  1.00 22.09 ? 449  LYS A NZ  1 
ATOM   3666 N N   . ILE A 1 450 ? 18.138 26.256 85.514  1.00 8.66  ? 450  ILE A N   1 
ATOM   3667 C CA  . ILE A 1 450 ? 18.999 27.427 85.666  1.00 7.92  ? 450  ILE A CA  1 
ATOM   3668 C C   . ILE A 1 450 ? 18.271 28.552 86.391  1.00 8.36  ? 450  ILE A C   1 
ATOM   3669 O O   . ILE A 1 450 ? 17.112 28.831 86.088  1.00 8.02  ? 450  ILE A O   1 
ATOM   3670 C CB  . ILE A 1 450 ? 19.401 27.983 84.272  1.00 7.54  ? 450  ILE A CB  1 
ATOM   3671 C CG1 . ILE A 1 450 ? 19.861 26.864 83.336  1.00 7.80  ? 450  ILE A CG1 1 
ATOM   3672 C CG2 . ILE A 1 450 ? 20.487 29.043 84.402  1.00 7.31  ? 450  ILE A CG2 1 
ATOM   3673 C CD1 . ILE A 1 450 ? 21.088 26.106 83.807  1.00 8.64  ? 450  ILE A CD1 1 
ATOM   3674 N N   . PRO A 1 451 ? 18.914 29.170 87.392  1.00 7.92  ? 451  PRO A N   1 
ATOM   3675 C CA  . PRO A 1 451 ? 18.233 30.268 88.085  1.00 8.24  ? 451  PRO A CA  1 
ATOM   3676 C C   . PRO A 1 451 ? 18.284 31.538 87.241  1.00 8.62  ? 451  PRO A C   1 
ATOM   3677 O O   . PRO A 1 451 ? 19.231 31.765 86.475  1.00 8.09  ? 451  PRO A O   1 
ATOM   3678 C CB  . PRO A 1 451 ? 19.092 30.493 89.337  1.00 7.69  ? 451  PRO A CB  1 
ATOM   3679 C CG  . PRO A 1 451 ? 19.928 29.271 89.471  1.00 7.90  ? 451  PRO A CG  1 
ATOM   3680 C CD  . PRO A 1 451 ? 20.189 28.842 88.054  1.00 8.15  ? 451  PRO A CD  1 
ATOM   3681 N N   . MET A 1 452 ? 17.263 32.365 87.401  1.00 8.88  ? 452  MET A N   1 
ATOM   3682 C CA  . MET A 1 452 ? 17.197 33.651 86.739  1.00 8.59  ? 452  MET A CA  1 
ATOM   3683 C C   . MET A 1 452 ? 16.396 34.621 87.590  1.00 8.71  ? 452  MET A C   1 
ATOM   3684 O O   . MET A 1 452 ? 15.360 34.251 88.143  1.00 9.24  ? 452  MET A O   1 
ATOM   3685 C CB  . MET A 1 452 ? 16.593 33.554 85.335  1.00 8.86  ? 452  MET A CB  1 
ATOM   3686 C CG  . MET A 1 452 ? 16.369 34.937 84.694  1.00 9.37  ? 452  MET A CG  1 
ATOM   3687 S SD  . MET A 1 452 ? 16.275 34.948 82.895  1.00 8.81  ? 452  MET A SD  1 
ATOM   3688 C CE  . MET A 1 452 ? 14.856 33.882 82.624  1.00 10.44 ? 452  MET A CE  1 
ATOM   3689 N N   . PHE A 1 453 ? 16.961 35.804 87.808  1.00 8.85  ? 453  PHE A N   1 
ATOM   3690 C CA  . PHE A 1 453 ? 16.284 36.863 88.549  1.00 9.21  ? 453  PHE A CA  1 
ATOM   3691 C C   . PHE A 1 453 ? 15.601 37.735 87.499  1.00 9.30  ? 453  PHE A C   1 
ATOM   3692 O O   . PHE A 1 453 ? 16.172 38.008 86.442  1.00 9.10  ? 453  PHE A O   1 
ATOM   3693 C CB  . PHE A 1 453 ? 17.289 37.765 89.267  1.00 9.71  ? 453  PHE A CB  1 
ATOM   3694 C CG  . PHE A 1 453 ? 17.984 37.127 90.421  1.00 11.47 ? 453  PHE A CG  1 
ATOM   3695 C CD1 . PHE A 1 453 ? 19.355 36.907 90.376  1.00 11.64 ? 453  PHE A CD1 1 
ATOM   3696 C CD2 . PHE A 1 453 ? 17.291 36.804 91.572  1.00 11.71 ? 453  PHE A CD2 1 
ATOM   3697 C CE1 . PHE A 1 453 ? 20.029 36.378 91.463  1.00 12.71 ? 453  PHE A CE1 1 
ATOM   3698 C CE2 . PHE A 1 453 ? 17.956 36.269 92.681  1.00 12.29 ? 453  PHE A CE2 1 
ATOM   3699 C CZ  . PHE A 1 453 ? 19.326 36.056 92.622  1.00 12.85 ? 453  PHE A CZ  1 
ATOM   3700 N N   . ILE A 1 454 ? 14.381 38.166 87.782  1.00 9.49  ? 454  ILE A N   1 
ATOM   3701 C CA  . ILE A 1 454 ? 13.660 39.048 86.877  1.00 9.78  ? 454  ILE A CA  1 
ATOM   3702 C C   . ILE A 1 454 ? 13.166 40.220 87.723  1.00 9.77  ? 454  ILE A C   1 
ATOM   3703 O O   . ILE A 1 454 ? 12.543 40.017 88.762  1.00 9.67  ? 454  ILE A O   1 
ATOM   3704 C CB  . ILE A 1 454 ? 12.460 38.347 86.201  1.00 10.24 ? 454  ILE A CB  1 
ATOM   3705 C CG1 . ILE A 1 454 ? 12.913 37.068 85.488  1.00 11.59 ? 454  ILE A CG1 1 
ATOM   3706 C CG2 . ILE A 1 454 ? 11.803 39.302 85.207  1.00 11.73 ? 454  ILE A CG2 1 
ATOM   3707 C CD1 . ILE A 1 454 ? 11.771 36.257 84.889  1.00 12.19 ? 454  ILE A CD1 1 
ATOM   3708 N N   . VAL A 1 455 ? 13.466 41.437 87.293  1.00 9.56  ? 455  VAL A N   1 
ATOM   3709 C CA  . VAL A 1 455 ? 13.056 42.644 88.005  1.00 10.69 ? 455  VAL A CA  1 
ATOM   3710 C C   . VAL A 1 455 ? 12.152 43.445 87.080  1.00 10.82 ? 455  VAL A C   1 
ATOM   3711 O O   . VAL A 1 455 ? 12.519 43.736 85.945  1.00 10.42 ? 455  VAL A O   1 
ATOM   3712 C CB  . VAL A 1 455 ? 14.281 43.503 88.397  1.00 10.83 ? 455  VAL A CB  1 
ATOM   3713 C CG1 . VAL A 1 455 ? 13.837 44.770 89.113  1.00 12.07 ? 455  VAL A CG1 1 
ATOM   3714 C CG2 . VAL A 1 455 ? 15.237 42.708 89.272  1.00 11.15 ? 455  VAL A CG2 1 
ATOM   3715 N N   . HIS A 1 456 ? 10.970 43.805 87.565  1.00 12.13 ? 456  HIS A N   1 
ATOM   3716 C CA  . HIS A 1 456 ? 10.025 44.550 86.753  1.00 14.84 ? 456  HIS A CA  1 
ATOM   3717 C C   . HIS A 1 456 ? 9.026  45.321 87.602  1.00 15.81 ? 456  HIS A C   1 
ATOM   3718 O O   . HIS A 1 456 ? 8.899  45.083 88.806  1.00 15.65 ? 456  HIS A O   1 
ATOM   3719 C CB  . HIS A 1 456 ? 9.279  43.588 85.817  1.00 15.34 ? 456  HIS A CB  1 
ATOM   3720 C CG  . HIS A 1 456 ? 8.472  42.547 86.531  1.00 16.65 ? 456  HIS A CG  1 
ATOM   3721 N ND1 . HIS A 1 456 ? 7.210  42.801 87.033  1.00 17.37 ? 456  HIS A ND1 1 
ATOM   3722 C CD2 . HIS A 1 456 ? 8.743  41.255 86.827  1.00 17.18 ? 456  HIS A CD2 1 
ATOM   3723 C CE1 . HIS A 1 456 ? 6.744  41.712 87.610  1.00 17.36 ? 456  HIS A CE1 1 
ATOM   3724 N NE2 . HIS A 1 456 ? 7.653  40.758 87.501  1.00 18.22 ? 456  HIS A NE2 1 
ATOM   3725 N N   . LYS A 1 457 ? 8.283  46.205 86.947  1.00 17.44 ? 457  LYS A N   1 
ATOM   3726 C CA  . LYS A 1 457 ? 7.259  47.006 87.599  1.00 19.01 ? 457  LYS A CA  1 
ATOM   3727 C C   . LYS A 1 457 ? 6.120  46.083 88.006  1.00 19.28 ? 457  LYS A C   1 
ATOM   3728 O O   . LYS A 1 457 ? 5.781  45.142 87.284  1.00 19.08 ? 457  LYS A O   1 
ATOM   3729 C CB  . LYS A 1 457 ? 6.750  48.088 86.641  1.00 20.82 ? 457  LYS A CB  1 
ATOM   3730 C CG  . LYS A 1 457 ? 7.807  49.102 86.236  1.00 23.85 ? 457  LYS A CG  1 
ATOM   3731 C CD  . LYS A 1 457 ? 7.265  50.127 85.244  1.00 25.55 ? 457  LYS A CD  1 
ATOM   3732 C CE  . LYS A 1 457 ? 6.983  49.510 83.877  1.00 27.08 ? 457  LYS A CE  1 
ATOM   3733 N NZ  . LYS A 1 457 ? 6.399  50.503 82.927  1.00 27.56 ? 457  LYS A NZ  1 
ATOM   3734 N N   . LYS A 1 458 ? 5.577  46.310 89.196  1.00 19.77 ? 458  LYS A N   1 
ATOM   3735 C CA  . LYS A 1 458 ? 4.478  45.496 89.699  1.00 20.09 ? 458  LYS A CA  1 
ATOM   3736 C C   . LYS A 1 458 ? 3.230  45.635 88.830  1.00 20.58 ? 458  LYS A C   1 
ATOM   3737 O O   . LYS A 1 458 ? 2.953  46.707 88.297  1.00 20.99 ? 458  LYS A O   1 
ATOM   3738 C CB  . LYS A 1 458 ? 4.131  45.885 91.139  1.00 19.74 ? 458  LYS A CB  1 
ATOM   3739 C CG  . LYS A 1 458 ? 5.144  45.459 92.180  1.00 20.28 ? 458  LYS A CG  1 
ATOM   3740 C CD  . LYS A 1 458 ? 4.752  45.985 93.554  1.00 20.85 ? 458  LYS A CD  1 
ATOM   3741 C CE  . LYS A 1 458 ? 5.683  45.478 94.643  1.00 20.86 ? 458  LYS A CE  1 
ATOM   3742 N NZ  . LYS A 1 458 ? 5.363  46.095 95.965  1.00 20.56 ? 458  LYS A NZ  1 
ATOM   3743 N N   . GLY A 1 459 ? 2.525  44.522 88.652  1.00 21.16 ? 459  GLY A N   1 
ATOM   3744 C CA  . GLY A 1 459 ? 1.297  44.520 87.877  1.00 21.64 ? 459  GLY A CA  1 
ATOM   3745 C C   . GLY A 1 459 ? 1.353  44.504 86.361  1.00 21.70 ? 459  GLY A C   1 
ATOM   3746 O O   . GLY A 1 459 ? 0.305  44.566 85.721  1.00 22.06 ? 459  GLY A O   1 
ATOM   3747 N N   . ILE A 1 460 ? 2.543  44.423 85.771  1.00 21.35 ? 460  ILE A N   1 
ATOM   3748 C CA  . ILE A 1 460 ? 2.625  44.400 84.313  1.00 21.02 ? 460  ILE A CA  1 
ATOM   3749 C C   . ILE A 1 460 ? 1.952  43.149 83.756  1.00 20.96 ? 460  ILE A C   1 
ATOM   3750 O O   . ILE A 1 460 ? 1.892  42.117 84.418  1.00 20.71 ? 460  ILE A O   1 
ATOM   3751 C CB  . ILE A 1 460 ? 4.086  44.449 83.784  1.00 21.38 ? 460  ILE A CB  1 
ATOM   3752 C CG1 . ILE A 1 460 ? 4.892  43.241 84.265  1.00 21.41 ? 460  ILE A CG1 1 
ATOM   3753 C CG2 . ILE A 1 460 ? 4.741  45.761 84.178  1.00 21.18 ? 460  ILE A CG2 1 
ATOM   3754 C CD1 . ILE A 1 460 ? 6.249  43.099 83.584  1.00 21.78 ? 460  ILE A CD1 1 
ATOM   3755 N N   . LYS A 1 461 ? 1.424  43.263 82.546  1.00 20.82 ? 461  LYS A N   1 
ATOM   3756 C CA  . LYS A 1 461 ? 0.776  42.139 81.887  1.00 20.95 ? 461  LYS A CA  1 
ATOM   3757 C C   . LYS A 1 461 ? 1.828  41.383 81.095  1.00 20.09 ? 461  LYS A C   1 
ATOM   3758 O O   . LYS A 1 461 ? 2.657  41.996 80.421  1.00 19.39 ? 461  LYS A O   1 
ATOM   3759 C CB  . LYS A 1 461 ? -0.341 42.638 80.967  1.00 22.89 ? 461  LYS A CB  1 
ATOM   3760 C CG  . LYS A 1 461 ? -1.541 43.203 81.710  1.00 26.06 ? 461  LYS A CG  1 
ATOM   3761 C CD  . LYS A 1 461 ? -2.586 43.754 80.757  1.00 28.44 ? 461  LYS A CD  1 
ATOM   3762 C CE  . LYS A 1 461 ? -2.103 45.032 80.087  1.00 29.76 ? 461  LYS A CE  1 
ATOM   3763 N NZ  . LYS A 1 461 ? -3.140 45.617 79.193  1.00 31.09 ? 461  LYS A NZ  1 
ATOM   3764 N N   . LEU A 1 462 ? 1.832  40.064 81.202  1.00 18.49 ? 462  LEU A N   1 
ATOM   3765 C CA  . LEU A 1 462 ? 2.803  39.260 80.478  1.00 18.06 ? 462  LEU A CA  1 
ATOM   3766 C C   . LEU A 1 462 ? 2.275  38.976 79.069  1.00 17.31 ? 462  LEU A C   1 
ATOM   3767 O O   . LEU A 1 462 ? 1.920  37.846 78.731  1.00 16.67 ? 462  LEU A O   1 
ATOM   3768 C CB  . LEU A 1 462 ? 3.104  37.974 81.248  1.00 18.63 ? 462  LEU A CB  1 
ATOM   3769 C CG  . LEU A 1 462 ? 3.671  38.210 82.650  1.00 19.06 ? 462  LEU A CG  1 
ATOM   3770 C CD1 . LEU A 1 462 ? 3.998  36.881 83.303  1.00 19.34 ? 462  LEU A CD1 1 
ATOM   3771 C CD2 . LEU A 1 462 ? 4.915  39.090 82.581  1.00 19.01 ? 462  LEU A CD2 1 
ATOM   3772 N N   . ASP A 1 463 ? 2.214  40.036 78.268  1.00 16.82 ? 463  ASP A N   1 
ATOM   3773 C CA  . ASP A 1 463 ? 1.717  39.970 76.899  1.00 16.21 ? 463  ASP A CA  1 
ATOM   3774 C C   . ASP A 1 463 ? 2.814  40.084 75.838  1.00 16.03 ? 463  ASP A C   1 
ATOM   3775 O O   . ASP A 1 463 ? 2.524  40.306 74.666  1.00 15.43 ? 463  ASP A O   1 
ATOM   3776 C CB  . ASP A 1 463 ? 0.656  41.066 76.678  1.00 16.93 ? 463  ASP A CB  1 
ATOM   3777 C CG  . ASP A 1 463 ? 1.181  42.482 76.946  1.00 17.23 ? 463  ASP A CG  1 
ATOM   3778 O OD1 . ASP A 1 463 ? 2.394  42.663 77.197  1.00 17.25 ? 463  ASP A OD1 1 
ATOM   3779 O OD2 . ASP A 1 463 ? 0.367  43.429 76.893  1.00 18.27 ? 463  ASP A OD2 1 
ATOM   3780 N N   . GLY A 1 464 ? 4.064  40.029 76.288  1.00 15.23 ? 464  GLY A N   1 
ATOM   3781 C CA  . GLY A 1 464 ? 5.209  40.117 75.395  1.00 14.81 ? 464  GLY A CA  1 
ATOM   3782 C C   . GLY A 1 464 ? 5.492  41.479 74.782  1.00 14.32 ? 464  GLY A C   1 
ATOM   3783 O O   . GLY A 1 464 ? 6.341  41.596 73.908  1.00 14.88 ? 464  GLY A O   1 
ATOM   3784 N N   . SER A 1 465 ? 4.869  42.523 75.318  1.00 14.27 ? 465  SER A N   1 
ATOM   3785 C CA  . SER A 1 465 ? 5.031  43.878 74.785  1.00 14.26 ? 465  SER A CA  1 
ATOM   3786 C C   . SER A 1 465 ? 6.175  44.704 75.377  1.00 13.72 ? 465  SER A C   1 
ATOM   3787 O O   . SER A 1 465 ? 6.461  45.809 74.910  1.00 13.86 ? 465  SER A O   1 
ATOM   3788 C CB  . SER A 1 465 ? 3.734  44.664 74.996  1.00 14.78 ? 465  SER A CB  1 
ATOM   3789 O OG  . SER A 1 465 ? 3.533  44.954 76.368  1.00 15.52 ? 465  SER A OG  1 
ATOM   3790 N N   . HIS A 1 466 ? 6.816  44.185 76.414  1.00 13.18 ? 466  HIS A N   1 
ATOM   3791 C CA  . HIS A 1 466 ? 7.867  44.930 77.096  1.00 12.59 ? 466  HIS A CA  1 
ATOM   3792 C C   . HIS A 1 466 ? 9.284  44.700 76.628  1.00 12.09 ? 466  HIS A C   1 
ATOM   3793 O O   . HIS A 1 466 ? 9.654  43.591 76.266  1.00 11.90 ? 466  HIS A O   1 
ATOM   3794 C CB  . HIS A 1 466 ? 7.829  44.627 78.592  1.00 12.73 ? 466  HIS A CB  1 
ATOM   3795 C CG  . HIS A 1 466 ? 6.450  44.459 79.134  1.00 13.62 ? 466  HIS A CG  1 
ATOM   3796 N ND1 . HIS A 1 466 ? 5.626  45.529 79.410  1.00 14.42 ? 466  HIS A ND1 1 
ATOM   3797 C CD2 . HIS A 1 466 ? 5.738  43.347 79.423  1.00 14.82 ? 466  HIS A CD2 1 
ATOM   3798 C CE1 . HIS A 1 466 ? 4.464  45.081 79.842  1.00 13.92 ? 466  HIS A CE1 1 
ATOM   3799 N NE2 . HIS A 1 466 ? 4.507  43.762 79.857  1.00 14.58 ? 466  HIS A NE2 1 
ATOM   3800 N N   . PRO A 1 467 ? 10.070 45.780 76.527  1.00 11.49 ? 467  PRO A N   1 
ATOM   3801 C CA  . PRO A 1 467 ? 11.455 45.585 76.108  1.00 11.34 ? 467  PRO A CA  1 
ATOM   3802 C C   . PRO A 1 467 ? 12.138 44.962 77.327  1.00 10.18 ? 467  PRO A C   1 
ATOM   3803 O O   . PRO A 1 467 ? 11.758 45.223 78.478  1.00 10.05 ? 467  PRO A O   1 
ATOM   3804 C CB  . PRO A 1 467 ? 11.941 47.006 75.822  1.00 12.09 ? 467  PRO A CB  1 
ATOM   3805 C CG  . PRO A 1 467 ? 11.057 47.868 76.664  1.00 13.21 ? 467  PRO A CG  1 
ATOM   3806 C CD  . PRO A 1 467 ? 9.714  47.208 76.571  1.00 11.61 ? 467  PRO A CD  1 
ATOM   3807 N N   . ALA A 1 468 ? 13.106 44.097 77.071  1.00 9.20  ? 468  ALA A N   1 
ATOM   3808 C CA  . ALA A 1 468 ? 13.812 43.427 78.155  1.00 8.63  ? 468  ALA A CA  1 
ATOM   3809 C C   . ALA A 1 468 ? 15.321 43.549 77.983  1.00 8.19  ? 468  ALA A C   1 
ATOM   3810 O O   . ALA A 1 468 ? 15.821 43.665 76.870  1.00 8.17  ? 468  ALA A O   1 
ATOM   3811 C CB  . ALA A 1 468 ? 13.400 41.962 78.221  1.00 9.19  ? 468  ALA A CB  1 
ATOM   3812 N N   . PHE A 1 469 ? 16.026 43.521 79.107  1.00 7.81  ? 469  PHE A N   1 
ATOM   3813 C CA  . PHE A 1 469 ? 17.487 43.606 79.142  1.00 7.21  ? 469  PHE A CA  1 
ATOM   3814 C C   . PHE A 1 469 ? 17.939 42.371 79.919  1.00 7.10  ? 469  PHE A C   1 
ATOM   3815 O O   . PHE A 1 469 ? 17.741 42.288 81.122  1.00 7.27  ? 469  PHE A O   1 
ATOM   3816 C CB  . PHE A 1 469 ? 17.904 44.899 79.852  1.00 7.20  ? 469  PHE A CB  1 
ATOM   3817 C CG  . PHE A 1 469 ? 19.389 45.184 79.828  1.00 6.97  ? 469  PHE A CG  1 
ATOM   3818 C CD1 . PHE A 1 469 ? 19.943 45.971 78.822  1.00 7.33  ? 469  PHE A CD1 1 
ATOM   3819 C CD2 . PHE A 1 469 ? 20.216 44.717 80.844  1.00 7.79  ? 469  PHE A CD2 1 
ATOM   3820 C CE1 . PHE A 1 469 ? 21.300 46.303 78.836  1.00 7.79  ? 469  PHE A CE1 1 
ATOM   3821 C CE2 . PHE A 1 469 ? 21.572 45.045 80.870  1.00 8.02  ? 469  PHE A CE2 1 
ATOM   3822 C CZ  . PHE A 1 469 ? 22.115 45.837 79.862  1.00 8.13  ? 469  PHE A CZ  1 
ATOM   3823 N N   . LEU A 1 470 ? 18.493 41.402 79.196  1.00 6.48  ? 470  LEU A N   1 
ATOM   3824 C CA  . LEU A 1 470 ? 18.958 40.129 79.758  1.00 6.41  ? 470  LEU A CA  1 
ATOM   3825 C C   . LEU A 1 470 ? 20.481 40.111 79.841  1.00 6.50  ? 470  LEU A C   1 
ATOM   3826 O O   . LEU A 1 470 ? 21.175 40.176 78.824  1.00 6.94  ? 470  LEU A O   1 
ATOM   3827 C CB  . LEU A 1 470 ? 18.446 38.959 78.900  1.00 6.72  ? 470  LEU A CB  1 
ATOM   3828 C CG  . LEU A 1 470 ? 18.935 37.536 79.200  1.00 6.58  ? 470  LEU A CG  1 
ATOM   3829 C CD1 . LEU A 1 470 ? 18.587 37.092 80.626  1.00 6.87  ? 470  LEU A CD1 1 
ATOM   3830 C CD2 . LEU A 1 470 ? 18.369 36.574 78.177  1.00 6.45  ? 470  LEU A CD2 1 
ATOM   3831 N N   . TYR A 1 471 ? 20.979 39.957 81.061  1.00 7.64  ? 471  TYR A N   1 
ATOM   3832 C CA  . TYR A 1 471 ? 22.400 39.957 81.356  1.00 6.75  ? 471  TYR A CA  1 
ATOM   3833 C C   . TYR A 1 471 ? 22.914 38.596 81.803  1.00 6.59  ? 471  TYR A C   1 
ATOM   3834 O O   . TYR A 1 471 ? 22.217 37.853 82.479  1.00 6.89  ? 471  TYR A O   1 
ATOM   3835 C CB  . TYR A 1 471 ? 22.666 40.979 82.462  1.00 7.64  ? 471  TYR A CB  1 
ATOM   3836 C CG  . TYR A 1 471 ? 24.113 41.095 82.877  1.00 7.21  ? 471  TYR A CG  1 
ATOM   3837 C CD1 . TYR A 1 471 ? 24.973 41.964 82.215  1.00 8.37  ? 471  TYR A CD1 1 
ATOM   3838 C CD2 . TYR A 1 471 ? 24.618 40.342 83.932  1.00 8.17  ? 471  TYR A CD2 1 
ATOM   3839 C CE1 . TYR A 1 471 ? 26.304 42.084 82.590  1.00 8.61  ? 471  TYR A CE1 1 
ATOM   3840 C CE2 . TYR A 1 471 ? 25.946 40.452 84.315  1.00 9.31  ? 471  TYR A CE2 1 
ATOM   3841 C CZ  . TYR A 1 471 ? 26.780 41.320 83.638  1.00 8.77  ? 471  TYR A CZ  1 
ATOM   3842 O OH  . TYR A 1 471 ? 28.111 41.418 83.973  1.00 10.19 ? 471  TYR A OH  1 
ATOM   3843 N N   . GLY A 1 472 ? 24.150 38.291 81.413  1.00 6.20  ? 472  GLY A N   1 
ATOM   3844 C CA  . GLY A 1 472 ? 24.792 37.051 81.796  1.00 5.88  ? 472  GLY A CA  1 
ATOM   3845 C C   . GLY A 1 472 ? 26.299 37.173 81.689  1.00 5.66  ? 472  GLY A C   1 
ATOM   3846 O O   . GLY A 1 472 ? 26.811 38.098 81.066  1.00 6.23  ? 472  GLY A O   1 
ATOM   3847 N N   . TYR A 1 473 ? 27.002 36.264 82.352  1.00 6.24  ? 473  TYR A N   1 
ATOM   3848 C CA  . TYR A 1 473 ? 28.462 36.214 82.310  1.00 6.12  ? 473  TYR A CA  1 
ATOM   3849 C C   . TYR A 1 473 ? 28.799 34.753 81.947  1.00 6.38  ? 473  TYR A C   1 
ATOM   3850 O O   . TYR A 1 473 ? 29.078 34.458 80.786  1.00 6.92  ? 473  TYR A O   1 
ATOM   3851 C CB  . TYR A 1 473 ? 29.052 36.646 83.661  1.00 6.55  ? 473  TYR A CB  1 
ATOM   3852 C CG  . TYR A 1 473 ? 30.560 36.695 83.704  1.00 7.22  ? 473  TYR A CG  1 
ATOM   3853 C CD1 . TYR A 1 473 ? 31.268 37.721 83.071  1.00 8.03  ? 473  TYR A CD1 1 
ATOM   3854 C CD2 . TYR A 1 473 ? 31.282 35.723 84.389  1.00 7.22  ? 473  TYR A CD2 1 
ATOM   3855 C CE1 . TYR A 1 473 ? 32.659 37.767 83.119  1.00 7.58  ? 473  TYR A CE1 1 
ATOM   3856 C CE2 . TYR A 1 473 ? 32.661 35.759 84.444  1.00 6.72  ? 473  TYR A CE2 1 
ATOM   3857 C CZ  . TYR A 1 473 ? 33.346 36.781 83.812  1.00 6.54  ? 473  TYR A CZ  1 
ATOM   3858 O OH  . TYR A 1 473 ? 34.718 36.799 83.885  1.00 8.52  ? 473  TYR A OH  1 
ATOM   3859 N N   . GLY A 1 474 ? 28.728 33.858 82.933  1.00 6.72  ? 474  GLY A N   1 
ATOM   3860 C CA  . GLY A 1 474 ? 28.956 32.446 82.668  1.00 6.57  ? 474  GLY A CA  1 
ATOM   3861 C C   . GLY A 1 474 ? 30.380 31.960 82.552  1.00 6.24  ? 474  GLY A C   1 
ATOM   3862 O O   . GLY A 1 474 ? 30.799 31.509 81.502  1.00 6.69  ? 474  GLY A O   1 
ATOM   3863 N N   . GLY A 1 475 ? 31.130 32.051 83.640  1.00 6.60  ? 475  GLY A N   1 
ATOM   3864 C CA  . GLY A 1 475 ? 32.492 31.572 83.601  1.00 6.75  ? 475  GLY A CA  1 
ATOM   3865 C C   . GLY A 1 475 ? 33.296 31.941 84.823  1.00 7.11  ? 475  GLY A C   1 
ATOM   3866 O O   . GLY A 1 475 ? 32.839 32.665 85.709  1.00 6.87  ? 475  GLY A O   1 
ATOM   3867 N N   . PHE A 1 476 ? 34.460 31.313 84.910  1.00 7.32  ? 476  PHE A N   1 
ATOM   3868 C CA  . PHE A 1 476 ? 35.439 31.579 85.940  1.00 7.35  ? 476  PHE A CA  1 
ATOM   3869 C C   . PHE A 1 476 ? 34.982 31.491 87.384  1.00 7.88  ? 476  PHE A C   1 
ATOM   3870 O O   . PHE A 1 476 ? 35.549 32.148 88.254  1.00 8.74  ? 476  PHE A O   1 
ATOM   3871 C CB  . PHE A 1 476 ? 36.089 32.932 85.640  1.00 8.69  ? 476  PHE A CB  1 
ATOM   3872 C CG  . PHE A 1 476 ? 36.761 32.976 84.295  1.00 9.61  ? 476  PHE A CG  1 
ATOM   3873 C CD1 . PHE A 1 476 ? 36.144 33.567 83.196  1.00 9.35  ? 476  PHE A CD1 1 
ATOM   3874 C CD2 . PHE A 1 476 ? 38.000 32.372 84.118  1.00 9.10  ? 476  PHE A CD2 1 
ATOM   3875 C CE1 . PHE A 1 476 ? 36.752 33.557 81.941  1.00 9.73  ? 476  PHE A CE1 1 
ATOM   3876 C CE2 . PHE A 1 476 ? 38.619 32.357 82.871  1.00 10.61 ? 476  PHE A CE2 1 
ATOM   3877 C CZ  . PHE A 1 476 ? 37.993 32.946 81.783  1.00 9.97  ? 476  PHE A CZ  1 
ATOM   3878 N N   . ASN A 1 477 ? 33.965 30.670 87.630  1.00 7.67  ? 477  ASN A N   1 
ATOM   3879 C CA  . ASN A 1 477 ? 33.454 30.471 88.980  1.00 8.71  ? 477  ASN A CA  1 
ATOM   3880 C C   . ASN A 1 477 ? 32.897 31.756 89.593  1.00 9.21  ? 477  ASN A C   1 
ATOM   3881 O O   . ASN A 1 477 ? 32.785 31.882 90.818  1.00 10.17 ? 477  ASN A O   1 
ATOM   3882 C CB  . ASN A 1 477 ? 34.561 29.891 89.866  1.00 10.33 ? 477  ASN A CB  1 
ATOM   3883 C CG  . ASN A 1 477 ? 34.033 29.335 91.164  1.00 12.16 ? 477  ASN A CG  1 
ATOM   3884 O OD1 . ASN A 1 477 ? 33.079 28.559 91.176  1.00 12.80 ? 477  ASN A OD1 1 
ATOM   3885 N ND2 . ASN A 1 477 ? 34.676 29.689 92.260  1.00 13.85 ? 477  ASN A ND2 1 
ATOM   3886 N N   . ILE A 1 478 ? 32.558 32.721 88.746  1.00 8.94  ? 478  ILE A N   1 
ATOM   3887 C CA  . ILE A 1 478 ? 32.000 33.981 89.227  1.00 10.13 ? 478  ILE A CA  1 
ATOM   3888 C C   . ILE A 1 478 ? 30.477 33.867 89.355  1.00 9.23  ? 478  ILE A C   1 
ATOM   3889 O O   . ILE A 1 478 ? 29.806 33.408 88.447  1.00 8.57  ? 478  ILE A O   1 
ATOM   3890 C CB  . ILE A 1 478 ? 32.379 35.163 88.288  1.00 11.00 ? 478  ILE A CB  1 
ATOM   3891 C CG1 . ILE A 1 478 ? 33.902 35.332 88.262  1.00 12.00 ? 478  ILE A CG1 1 
ATOM   3892 C CG2 . ILE A 1 478 ? 31.703 36.463 88.749  1.00 11.16 ? 478  ILE A CG2 1 
ATOM   3893 C CD1 . ILE A 1 478 ? 34.402 36.537 87.508  1.00 13.26 ? 478  ILE A CD1 1 
ATOM   3894 N N   . SER A 1 479 ? 29.949 34.204 90.521  1.00 10.12 ? 479  SER A N   1 
ATOM   3895 C CA  . SER A 1 479 ? 28.515 34.163 90.756  1.00 10.07 ? 479  SER A CA  1 
ATOM   3896 C C   . SER A 1 479 ? 27.938 35.546 90.523  1.00 10.31 ? 479  SER A C   1 
ATOM   3897 O O   . SER A 1 479 ? 28.436 36.532 91.066  1.00 10.81 ? 479  SER A O   1 
ATOM   3898 C CB  . SER A 1 479 ? 28.217 33.721 92.182  1.00 10.09 ? 479  SER A CB  1 
ATOM   3899 O OG  . SER A 1 479 ? 28.563 32.364 92.340  1.00 10.17 ? 479  SER A OG  1 
ATOM   3900 N N   . ILE A 1 480 ? 26.892 35.623 89.713  1.00 10.23 ? 480  ILE A N   1 
ATOM   3901 C CA  . ILE A 1 480 ? 26.258 36.903 89.413  1.00 10.18 ? 480  ILE A CA  1 
ATOM   3902 C C   . ILE A 1 480 ? 25.089 37.086 90.376  1.00 10.03 ? 480  ILE A C   1 
ATOM   3903 O O   . ILE A 1 480 ? 23.992 36.591 90.155  1.00 10.59 ? 480  ILE A O   1 
ATOM   3904 C CB  . ILE A 1 480 ? 25.794 36.948 87.954  1.00 11.34 ? 480  ILE A CB  1 
ATOM   3905 C CG1 . ILE A 1 480 ? 26.955 36.554 87.032  1.00 11.29 ? 480  ILE A CG1 1 
ATOM   3906 C CG2 . ILE A 1 480 ? 25.304 38.342 87.625  1.00 10.16 ? 480  ILE A CG2 1 
ATOM   3907 C CD1 . ILE A 1 480 ? 28.194 37.450 87.148  1.00 11.58 ? 480  ILE A CD1 1 
ATOM   3908 N N   . THR A 1 481 ? 25.360 37.776 91.474  1.00 9.83  ? 481  THR A N   1 
ATOM   3909 C CA  . THR A 1 481 ? 24.378 37.987 92.529  1.00 10.65 ? 481  THR A CA  1 
ATOM   3910 C C   . THR A 1 481 ? 23.714 39.360 92.453  1.00 10.41 ? 481  THR A C   1 
ATOM   3911 O O   . THR A 1 481 ? 24.179 40.236 91.720  1.00 11.37 ? 481  THR A O   1 
ATOM   3912 C CB  . THR A 1 481 ? 25.049 37.758 93.895  1.00 10.50 ? 481  THR A CB  1 
ATOM   3913 O OG1 . THR A 1 481 ? 26.079 38.735 94.087  1.00 12.49 ? 481  THR A OG1 1 
ATOM   3914 C CG2 . THR A 1 481 ? 25.670 36.353 93.943  1.00 11.61 ? 481  THR A CG2 1 
ATOM   3915 N N   . PRO A 1 482 ? 22.606 39.562 93.194  1.00 10.31 ? 482  PRO A N   1 
ATOM   3916 C CA  . PRO A 1 482 ? 21.900 40.847 93.171  1.00 11.23 ? 482  PRO A CA  1 
ATOM   3917 C C   . PRO A 1 482 ? 22.802 42.036 93.456  1.00 11.75 ? 482  PRO A C   1 
ATOM   3918 O O   . PRO A 1 482 ? 23.579 42.022 94.406  1.00 11.70 ? 482  PRO A O   1 
ATOM   3919 C CB  . PRO A 1 482 ? 20.848 40.677 94.257  1.00 11.41 ? 482  PRO A CB  1 
ATOM   3920 C CG  . PRO A 1 482 ? 20.531 39.226 94.177  1.00 11.60 ? 482  PRO A CG  1 
ATOM   3921 C CD  . PRO A 1 482 ? 21.903 38.603 94.065  1.00 10.40 ? 482  PRO A CD  1 
ATOM   3922 N N   . ASN A 1 483 ? 22.665 43.076 92.644  1.00 11.92 ? 483  ASN A N   1 
ATOM   3923 C CA  . ASN A 1 483 ? 23.470 44.283 92.791  1.00 13.07 ? 483  ASN A CA  1 
ATOM   3924 C C   . ASN A 1 483 ? 22.622 45.487 92.397  1.00 11.78 ? 483  ASN A C   1 
ATOM   3925 O O   . ASN A 1 483 ? 21.708 45.365 91.573  1.00 12.17 ? 483  ASN A O   1 
ATOM   3926 C CB  . ASN A 1 483 ? 24.714 44.194 91.901  1.00 15.71 ? 483  ASN A CB  1 
ATOM   3927 C CG  . ASN A 1 483 ? 25.737 45.268 92.219  1.00 18.60 ? 483  ASN A CG  1 
ATOM   3928 O OD1 . ASN A 1 483 ? 26.248 45.344 93.334  1.00 21.06 ? 483  ASN A OD1 1 
ATOM   3929 N ND2 . ASN A 1 483 ? 26.025 46.119 91.240  1.00 21.01 ? 483  ASN A ND2 1 
ATOM   3930 N N   . TYR A 1 484 ? 22.923 46.640 92.982  1.00 12.21 ? 484  TYR A N   1 
ATOM   3931 C CA  . TYR A 1 484 ? 22.167 47.847 92.691  1.00 11.41 ? 484  TYR A CA  1 
ATOM   3932 C C   . TYR A 1 484 ? 22.715 48.588 91.483  1.00 11.40 ? 484  TYR A C   1 
ATOM   3933 O O   . TYR A 1 484 ? 23.886 48.957 91.442  1.00 11.72 ? 484  TYR A O   1 
ATOM   3934 C CB  . TYR A 1 484 ? 22.157 48.783 93.894  1.00 11.61 ? 484  TYR A CB  1 
ATOM   3935 C CG  . TYR A 1 484 ? 21.197 49.932 93.740  1.00 11.68 ? 484  TYR A CG  1 
ATOM   3936 C CD1 . TYR A 1 484 ? 19.825 49.710 93.755  1.00 11.94 ? 484  TYR A CD1 1 
ATOM   3937 C CD2 . TYR A 1 484 ? 21.653 51.245 93.583  1.00 11.97 ? 484  TYR A CD2 1 
ATOM   3938 C CE1 . TYR A 1 484 ? 18.923 50.758 93.623  1.00 12.40 ? 484  TYR A CE1 1 
ATOM   3939 C CE2 . TYR A 1 484 ? 20.753 52.305 93.448  1.00 13.53 ? 484  TYR A CE2 1 
ATOM   3940 C CZ  . TYR A 1 484 ? 19.393 52.050 93.471  1.00 13.30 ? 484  TYR A CZ  1 
ATOM   3941 O OH  . TYR A 1 484 ? 18.499 53.088 93.357  1.00 14.57 ? 484  TYR A OH  1 
ATOM   3942 N N   . SER A 1 485 ? 21.846 48.818 90.507  1.00 10.91 ? 485  SER A N   1 
ATOM   3943 C CA  . SER A 1 485 ? 22.219 49.522 89.287  1.00 10.78 ? 485  SER A CA  1 
ATOM   3944 C C   . SER A 1 485 ? 21.183 50.575 88.942  1.00 10.83 ? 485  SER A C   1 
ATOM   3945 O O   . SER A 1 485 ? 20.063 50.250 88.546  1.00 9.99  ? 485  SER A O   1 
ATOM   3946 C CB  . SER A 1 485 ? 22.360 48.550 88.111  1.00 11.03 ? 485  SER A CB  1 
ATOM   3947 O OG  . SER A 1 485 ? 22.624 49.255 86.909  1.00 13.98 ? 485  SER A OG  1 
ATOM   3948 N N   . VAL A 1 486 ? 21.581 51.838 89.055  1.00 10.90 ? 486  VAL A N   1 
ATOM   3949 C CA  . VAL A 1 486 ? 20.706 52.955 88.726  1.00 11.19 ? 486  VAL A CA  1 
ATOM   3950 C C   . VAL A 1 486 ? 20.426 52.948 87.217  1.00 10.42 ? 486  VAL A C   1 
ATOM   3951 O O   . VAL A 1 486 ? 19.299 53.185 86.784  1.00 9.83  ? 486  VAL A O   1 
ATOM   3952 C CB  . VAL A 1 486 ? 21.361 54.307 89.136  1.00 12.47 ? 486  VAL A CB  1 
ATOM   3953 C CG1 . VAL A 1 486 ? 20.568 55.481 88.587  1.00 13.67 ? 486  VAL A CG1 1 
ATOM   3954 C CG2 . VAL A 1 486 ? 21.474 54.401 90.653  1.00 13.86 ? 486  VAL A CG2 1 
ATOM   3955 N N   . SER A 1 487 ? 21.449 52.634 86.431  1.00 10.38 ? 487  SER A N   1 
ATOM   3956 C CA  . SER A 1 487 ? 21.314 52.598 84.982  1.00 9.92  ? 487  SER A CA  1 
ATOM   3957 C C   . SER A 1 487 ? 20.250 51.607 84.521  1.00 9.80  ? 487  SER A C   1 
ATOM   3958 O O   . SER A 1 487 ? 19.415 51.920 83.672  1.00 10.20 ? 487  SER A O   1 
ATOM   3959 C CB  . SER A 1 487 ? 22.660 52.291 84.323  1.00 10.47 ? 487  SER A CB  1 
ATOM   3960 O OG  . SER A 1 487 ? 23.235 51.088 84.817  1.00 10.54 ? 487  SER A OG  1 
ATOM   3961 N N   . ARG A 1 488 ? 20.238 50.425 85.124  1.00 9.72  ? 488  ARG A N   1 
ATOM   3962 C CA  . ARG A 1 488 ? 19.248 49.423 84.760  1.00 10.05 ? 488  ARG A CA  1 
ATOM   3963 C C   . ARG A 1 488 ? 17.856 49.812 85.245  1.00 10.04 ? 488  ARG A C   1 
ATOM   3964 O O   . ARG A 1 488 ? 16.859 49.561 84.562  1.00 9.59  ? 488  ARG A O   1 
ATOM   3965 C CB  . ARG A 1 488 ? 19.642 48.057 85.312  1.00 10.54 ? 488  ARG A CB  1 
ATOM   3966 C CG  . ARG A 1 488 ? 20.848 47.435 84.646  1.00 12.79 ? 488  ARG A CG  1 
ATOM   3967 C CD  . ARG A 1 488 ? 21.228 46.161 85.383  1.00 14.76 ? 488  ARG A CD  1 
ATOM   3968 N NE  . ARG A 1 488 ? 22.403 45.504 84.824  1.00 16.30 ? 488  ARG A NE  1 
ATOM   3969 C CZ  . ARG A 1 488 ? 22.987 44.436 85.359  1.00 16.50 ? 488  ARG A CZ  1 
ATOM   3970 N NH1 . ARG A 1 488 ? 22.510 43.900 86.471  1.00 17.26 ? 488  ARG A NH1 1 
ATOM   3971 N NH2 . ARG A 1 488 ? 24.048 43.904 84.772  1.00 17.73 ? 488  ARG A NH2 1 
ATOM   3972 N N   . LEU A 1 489 ? 17.778 50.439 86.417  1.00 9.76  ? 489  LEU A N   1 
ATOM   3973 C CA  . LEU A 1 489 ? 16.478 50.858 86.934  1.00 9.83  ? 489  LEU A CA  1 
ATOM   3974 C C   . LEU A 1 489 ? 15.870 51.967 86.077  1.00 9.77  ? 489  LEU A C   1 
ATOM   3975 O O   . LEU A 1 489 ? 14.652 52.077 85.975  1.00 9.33  ? 489  LEU A O   1 
ATOM   3976 C CB  . LEU A 1 489 ? 16.559 51.229 88.417  1.00 10.94 ? 489  LEU A CB  1 
ATOM   3977 C CG  . LEU A 1 489 ? 16.826 50.026 89.328  1.00 12.13 ? 489  LEU A CG  1 
ATOM   3978 C CD1 . LEU A 1 489 ? 17.044 50.494 90.752  1.00 13.13 ? 489  LEU A CD1 1 
ATOM   3979 C CD2 . LEU A 1 489 ? 15.678 49.026 89.259  1.00 13.31 ? 489  LEU A CD2 1 
ATOM   3980 N N   . ILE A 1 490 ? 16.708 52.775 85.442  1.00 9.40  ? 490  ILE A N   1 
ATOM   3981 C CA  . ILE A 1 490 ? 16.201 53.817 84.558  1.00 9.26  ? 490  ILE A CA  1 
ATOM   3982 C C   . ILE A 1 490 ? 15.565 53.145 83.340  1.00 9.62  ? 490  ILE A C   1 
ATOM   3983 O O   . ILE A 1 490 ? 14.560 53.619 82.819  1.00 8.98  ? 490  ILE A O   1 
ATOM   3984 C CB  . ILE A 1 490 ? 17.310 54.797 84.125  1.00 9.44  ? 490  ILE A CB  1 
ATOM   3985 C CG1 . ILE A 1 490 ? 17.715 55.663 85.311  1.00 10.29 ? 490  ILE A CG1 1 
ATOM   3986 C CG2 . ILE A 1 490 ? 16.833 55.681 82.971  1.00 9.51  ? 490  ILE A CG2 1 
ATOM   3987 C CD1 . ILE A 1 490 ? 18.957 56.464 85.073  1.00 11.03 ? 490  ILE A CD1 1 
ATOM   3988 N N   . PHE A 1 491 ? 16.146 52.038 82.898  1.00 9.32  ? 491  PHE A N   1 
ATOM   3989 C CA  . PHE A 1 491 ? 15.601 51.281 81.780  1.00 9.29  ? 491  PHE A CA  1 
ATOM   3990 C C   . PHE A 1 491 ? 14.212 50.768 82.179  1.00 9.50  ? 491  PHE A C   1 
ATOM   3991 O O   . PHE A 1 491 ? 13.265 50.833 81.406  1.00 9.44  ? 491  PHE A O   1 
ATOM   3992 C CB  . PHE A 1 491 ? 16.542 50.119 81.427  1.00 9.15  ? 491  PHE A CB  1 
ATOM   3993 C CG  . PHE A 1 491 ? 15.989 49.167 80.395  1.00 8.24  ? 491  PHE A CG  1 
ATOM   3994 C CD1 . PHE A 1 491 ? 15.862 49.547 79.062  1.00 8.12  ? 491  PHE A CD1 1 
ATOM   3995 C CD2 . PHE A 1 491 ? 15.611 47.878 80.760  1.00 7.88  ? 491  PHE A CD2 1 
ATOM   3996 C CE1 . PHE A 1 491 ? 15.362 48.649 78.109  1.00 9.03  ? 491  PHE A CE1 1 
ATOM   3997 C CE2 . PHE A 1 491 ? 15.119 46.981 79.814  1.00 7.54  ? 491  PHE A CE2 1 
ATOM   3998 C CZ  . PHE A 1 491 ? 14.994 47.368 78.491  1.00 8.29  ? 491  PHE A CZ  1 
ATOM   3999 N N   . VAL A 1 492 ? 14.082 50.305 83.414  1.00 9.87  ? 492  VAL A N   1 
ATOM   4000 C CA  . VAL A 1 492 ? 12.802 49.803 83.897  1.00 10.19 ? 492  VAL A CA  1 
ATOM   4001 C C   . VAL A 1 492 ? 11.747 50.914 84.022  1.00 10.62 ? 492  VAL A C   1 
ATOM   4002 O O   . VAL A 1 492 ? 10.691 50.854 83.397  1.00 11.28 ? 492  VAL A O   1 
ATOM   4003 C CB  . VAL A 1 492 ? 12.955 49.073 85.261  1.00 10.66 ? 492  VAL A CB  1 
ATOM   4004 C CG1 . VAL A 1 492 ? 11.580 48.698 85.821  1.00 9.89  ? 492  VAL A CG1 1 
ATOM   4005 C CG2 . VAL A 1 492 ? 13.826 47.820 85.104  1.00 10.43 ? 492  VAL A CG2 1 
ATOM   4006 N N   . ARG A 1 493 ? 12.082 51.960 84.769  1.00 10.80 ? 493  ARG A N   1 
ATOM   4007 C CA  . ARG A 1 493 ? 11.180 53.077 85.020  1.00 11.54 ? 493  ARG A CA  1 
ATOM   4008 C C   . ARG A 1 493 ? 10.919 54.014 83.839  1.00 12.14 ? 493  ARG A C   1 
ATOM   4009 O O   . ARG A 1 493 ? 9.777  54.361 83.541  1.00 12.49 ? 493  ARG A O   1 
ATOM   4010 C CB  . ARG A 1 493 ? 11.726 53.886 86.202  1.00 12.37 ? 493  ARG A CB  1 
ATOM   4011 C CG  . ARG A 1 493 ? 11.071 55.247 86.419  1.00 13.52 ? 493  ARG A CG  1 
ATOM   4012 C CD  . ARG A 1 493 ? 9.587  55.139 86.741  1.00 13.82 ? 493  ARG A CD  1 
ATOM   4013 N NE  . ARG A 1 493 ? 8.995  56.463 86.924  1.00 14.64 ? 493  ARG A NE  1 
ATOM   4014 C CZ  . ARG A 1 493 ? 8.594  57.251 85.932  1.00 14.76 ? 493  ARG A CZ  1 
ATOM   4015 N NH1 . ARG A 1 493 ? 8.703  56.851 84.675  1.00 15.67 ? 493  ARG A NH1 1 
ATOM   4016 N NH2 . ARG A 1 493 ? 8.133  58.465 86.202  1.00 16.15 ? 493  ARG A NH2 1 
ATOM   4017 N N   . HIS A 1 494 ? 11.982 54.428 83.171  1.00 11.30 ? 494  HIS A N   1 
ATOM   4018 C CA  . HIS A 1 494 ? 11.852 55.368 82.079  1.00 10.94 ? 494  HIS A CA  1 
ATOM   4019 C C   . HIS A 1 494 ? 11.782 54.797 80.663  1.00 10.95 ? 494  HIS A C   1 
ATOM   4020 O O   . HIS A 1 494 ? 11.563 55.543 79.707  1.00 10.37 ? 494  HIS A O   1 
ATOM   4021 C CB  . HIS A 1 494 ? 12.936 56.440 82.212  1.00 10.91 ? 494  HIS A CB  1 
ATOM   4022 C CG  . HIS A 1 494 ? 12.823 57.243 83.469  1.00 10.70 ? 494  HIS A CG  1 
ATOM   4023 N ND1 . HIS A 1 494 ? 11.833 58.183 83.667  1.00 11.57 ? 494  HIS A ND1 1 
ATOM   4024 C CD2 . HIS A 1 494 ? 13.567 57.235 84.603  1.00 12.22 ? 494  HIS A CD2 1 
ATOM   4025 C CE1 . HIS A 1 494 ? 11.971 58.715 84.864  1.00 12.12 ? 494  HIS A CE1 1 
ATOM   4026 N NE2 . HIS A 1 494 ? 13.018 58.158 85.452  1.00 12.25 ? 494  HIS A NE2 1 
ATOM   4027 N N   . MET A 1 495 ? 12.022 53.499 80.520  1.00 10.70 ? 495  MET A N   1 
ATOM   4028 C CA  . MET A 1 495 ? 11.924 52.873 79.213  1.00 10.51 ? 495  MET A CA  1 
ATOM   4029 C C   . MET A 1 495 ? 10.946 51.695 79.250  1.00 10.29 ? 495  MET A C   1 
ATOM   4030 O O   . MET A 1 495 ? 10.803 50.968 78.269  1.00 10.67 ? 495  MET A O   1 
ATOM   4031 C CB  . MET A 1 495 ? 13.303 52.458 78.689  1.00 9.93  ? 495  MET A CB  1 
ATOM   4032 C CG  . MET A 1 495 ? 14.185 53.652 78.330  1.00 10.85 ? 495  MET A CG  1 
ATOM   4033 S SD  . MET A 1 495 ? 15.879 53.260 77.864  1.00 11.90 ? 495  MET A SD  1 
ATOM   4034 C CE  . MET A 1 495 ? 15.644 52.339 76.371  1.00 13.09 ? 495  MET A CE  1 
ATOM   4035 N N   . GLY A 1 496 ? 10.258 51.551 80.385  1.00 10.13 ? 496  GLY A N   1 
ATOM   4036 C CA  . GLY A 1 496 ? 9.269  50.496 80.578  1.00 10.38 ? 496  GLY A CA  1 
ATOM   4037 C C   . GLY A 1 496 ? 9.801  49.084 80.419  1.00 10.04 ? 496  GLY A C   1 
ATOM   4038 O O   . GLY A 1 496 ? 9.061  48.165 80.054  1.00 10.77 ? 496  GLY A O   1 
ATOM   4039 N N   . GLY A 1 497 ? 11.074 48.901 80.734  1.00 9.70  ? 497  GLY A N   1 
ATOM   4040 C CA  . GLY A 1 497 ? 11.689 47.602 80.569  1.00 9.79  ? 497  GLY A CA  1 
ATOM   4041 C C   . GLY A 1 497 ? 11.647 46.607 81.706  1.00 9.59  ? 497  GLY A C   1 
ATOM   4042 O O   . GLY A 1 497 ? 11.282 46.926 82.839  1.00 10.44 ? 497  GLY A O   1 
ATOM   4043 N N   . VAL A 1 498 ? 12.035 45.385 81.350  1.00 9.52  ? 498  VAL A N   1 
ATOM   4044 C CA  . VAL A 1 498 ? 12.130 44.256 82.272  1.00 9.32  ? 498  VAL A CA  1 
ATOM   4045 C C   . VAL A 1 498 ? 13.609 43.871 82.323  1.00 9.37  ? 498  VAL A C   1 
ATOM   4046 O O   . VAL A 1 498 ? 14.256 43.755 81.289  1.00 8.83  ? 498  VAL A O   1 
ATOM   4047 C CB  . VAL A 1 498 ? 11.310 43.043 81.761  1.00 9.75  ? 498  VAL A CB  1 
ATOM   4048 C CG1 . VAL A 1 498 ? 11.572 41.812 82.632  1.00 9.78  ? 498  VAL A CG1 1 
ATOM   4049 C CG2 . VAL A 1 498 ? 9.823  43.378 81.759  1.00 9.75  ? 498  VAL A CG2 1 
ATOM   4050 N N   . LEU A 1 499 ? 14.147 43.736 83.524  1.00 8.73  ? 499  LEU A N   1 
ATOM   4051 C CA  . LEU A 1 499 ? 15.541 43.344 83.706  1.00 8.78  ? 499  LEU A CA  1 
ATOM   4052 C C   . LEU A 1 499 ? 15.594 41.856 84.046  1.00 8.18  ? 499  LEU A C   1 
ATOM   4053 O O   . LEU A 1 499 ? 14.768 41.358 84.800  1.00 8.77  ? 499  LEU A O   1 
ATOM   4054 C CB  . LEU A 1 499 ? 16.158 44.150 84.854  1.00 9.85  ? 499  LEU A CB  1 
ATOM   4055 C CG  . LEU A 1 499 ? 17.539 43.741 85.369  1.00 12.03 ? 499  LEU A CG  1 
ATOM   4056 C CD1 . LEU A 1 499 ? 18.590 44.007 84.304  1.00 12.31 ? 499  LEU A CD1 1 
ATOM   4057 C CD2 . LEU A 1 499 ? 17.872 44.512 86.638  1.00 13.19 ? 499  LEU A CD2 1 
ATOM   4058 N N   . ALA A 1 500 ? 16.579 41.153 83.504  1.00 7.41  ? 500  ALA A N   1 
ATOM   4059 C CA  . ALA A 1 500 ? 16.732 39.733 83.801  1.00 7.25  ? 500  ALA A CA  1 
ATOM   4060 C C   . ALA A 1 500 ? 18.218 39.392 83.874  1.00 7.47  ? 500  ALA A C   1 
ATOM   4061 O O   . ALA A 1 500 ? 19.018 39.926 83.102  1.00 8.46  ? 500  ALA A O   1 
ATOM   4062 C CB  . ALA A 1 500 ? 16.032 38.874 82.741  1.00 8.11  ? 500  ALA A CB  1 
ATOM   4063 N N   . VAL A 1 501 ? 18.579 38.549 84.841  1.00 7.41  ? 501  VAL A N   1 
ATOM   4064 C CA  . VAL A 1 501 ? 19.959 38.098 85.029  1.00 7.60  ? 501  VAL A CA  1 
ATOM   4065 C C   . VAL A 1 501 ? 19.887 36.579 85.117  1.00 7.59  ? 501  VAL A C   1 
ATOM   4066 O O   . VAL A 1 501 ? 19.247 36.046 86.008  1.00 8.21  ? 501  VAL A O   1 
ATOM   4067 C CB  . VAL A 1 501 ? 20.580 38.657 86.337  1.00 7.77  ? 501  VAL A CB  1 
ATOM   4068 C CG1 . VAL A 1 501 ? 21.961 38.056 86.566  1.00 10.07 ? 501  VAL A CG1 1 
ATOM   4069 C CG2 . VAL A 1 501 ? 20.665 40.175 86.284  1.00 9.70  ? 501  VAL A CG2 1 
ATOM   4070 N N   . ALA A 1 502 ? 20.540 35.889 84.186  1.00 7.08  ? 502  ALA A N   1 
ATOM   4071 C CA  . ALA A 1 502 ? 20.531 34.430 84.152  1.00 6.87  ? 502  ALA A CA  1 
ATOM   4072 C C   . ALA A 1 502 ? 21.818 33.863 84.736  1.00 6.71  ? 502  ALA A C   1 
ATOM   4073 O O   . ALA A 1 502 ? 22.920 34.188 84.266  1.00 6.84  ? 502  ALA A O   1 
ATOM   4074 C CB  . ALA A 1 502 ? 20.332 33.940 82.728  1.00 7.95  ? 502  ALA A CB  1 
ATOM   4075 N N   . ASN A 1 503 ? 21.676 32.994 85.732  1.00 6.45  ? 503  ASN A N   1 
ATOM   4076 C CA  . ASN A 1 503 ? 22.812 32.377 86.408  1.00 6.47  ? 503  ASN A CA  1 
ATOM   4077 C C   . ASN A 1 503 ? 23.267 31.098 85.713  1.00 6.91  ? 503  ASN A C   1 
ATOM   4078 O O   . ASN A 1 503 ? 23.313 30.010 86.296  1.00 7.64  ? 503  ASN A O   1 
ATOM   4079 C CB  . ASN A 1 503 ? 22.460 32.140 87.867  1.00 6.57  ? 503  ASN A CB  1 
ATOM   4080 C CG  . ASN A 1 503 ? 22.188 33.441 88.599  1.00 6.67  ? 503  ASN A CG  1 
ATOM   4081 O OD1 . ASN A 1 503 ? 21.039 33.789 88.877  1.00 8.81  ? 503  ASN A OD1 1 
ATOM   4082 N ND2 . ASN A 1 503 ? 23.240 34.217 88.819  1.00 7.45  ? 503  ASN A ND2 1 
ATOM   4083 N N   . ILE A 1 504 ? 23.668 31.273 84.463  1.00 6.07  ? 504  ILE A N   1 
ATOM   4084 C CA  . ILE A 1 504 ? 24.104 30.180 83.619  1.00 6.30  ? 504  ILE A CA  1 
ATOM   4085 C C   . ILE A 1 504 ? 25.356 29.459 84.116  1.00 6.38  ? 504  ILE A C   1 
ATOM   4086 O O   . ILE A 1 504 ? 26.130 29.985 84.913  1.00 6.10  ? 504  ILE A O   1 
ATOM   4087 C CB  . ILE A 1 504 ? 24.305 30.681 82.167  1.00 6.37  ? 504  ILE A CB  1 
ATOM   4088 C CG1 . ILE A 1 504 ? 25.503 31.629 82.083  1.00 7.22  ? 504  ILE A CG1 1 
ATOM   4089 C CG2 . ILE A 1 504 ? 23.031 31.402 81.683  1.00 6.27  ? 504  ILE A CG2 1 
ATOM   4090 C CD1 . ILE A 1 504 ? 25.736 32.210 80.705  1.00 6.64  ? 504  ILE A CD1 1 
ATOM   4091 N N   . ARG A 1 505 ? 25.546 28.242 83.625  1.00 5.83  ? 505  ARG A N   1 
ATOM   4092 C CA  . ARG A 1 505 ? 26.702 27.447 84.009  1.00 6.36  ? 505  ARG A CA  1 
ATOM   4093 C C   . ARG A 1 505 ? 27.992 28.147 83.623  1.00 6.51  ? 505  ARG A C   1 
ATOM   4094 O O   . ARG A 1 505 ? 28.011 29.015 82.736  1.00 7.07  ? 505  ARG A O   1 
ATOM   4095 C CB  . ARG A 1 505 ? 26.614 26.038 83.433  1.00 6.55  ? 505  ARG A CB  1 
ATOM   4096 C CG  . ARG A 1 505 ? 25.636 25.176 84.227  1.00 6.59  ? 505  ARG A CG  1 
ATOM   4097 C CD  . ARG A 1 505 ? 25.377 23.841 83.578  1.00 7.62  ? 505  ARG A CD  1 
ATOM   4098 N NE  . ARG A 1 505 ? 24.540 23.991 82.398  1.00 8.18  ? 505  ARG A NE  1 
ATOM   4099 C CZ  . ARG A 1 505 ? 24.078 22.974 81.679  1.00 8.90  ? 505  ARG A CZ  1 
ATOM   4100 N NH1 . ARG A 1 505 ? 24.388 21.730 82.012  1.00 8.70  ? 505  ARG A NH1 1 
ATOM   4101 N NH2 . ARG A 1 505 ? 23.272 23.196 80.650  1.00 8.78  ? 505  ARG A NH2 1 
ATOM   4102 N N   . GLY A 1 506 ? 29.072 27.728 84.271  1.00 6.80  ? 506  GLY A N   1 
ATOM   4103 C CA  . GLY A 1 506 ? 30.363 28.365 84.091  1.00 5.84  ? 506  GLY A CA  1 
ATOM   4104 C C   . GLY A 1 506 ? 30.609 29.255 85.302  1.00 7.31  ? 506  GLY A C   1 
ATOM   4105 O O   . GLY A 1 506 ? 31.754 29.507 85.682  1.00 6.52  ? 506  GLY A O   1 
ATOM   4106 N N   . GLY A 1 507 ? 29.525 29.742 85.904  1.00 6.85  ? 507  GLY A N   1 
ATOM   4107 C CA  . GLY A 1 507 ? 29.618 30.569 87.092  1.00 6.64  ? 507  GLY A CA  1 
ATOM   4108 C C   . GLY A 1 507 ? 29.867 29.714 88.324  1.00 7.30  ? 507  GLY A C   1 
ATOM   4109 O O   . GLY A 1 507 ? 30.035 28.499 88.221  1.00 8.13  ? 507  GLY A O   1 
ATOM   4110 N N   . GLY A 1 508 ? 29.850 30.348 89.495  1.00 7.57  ? 508  GLY A N   1 
ATOM   4111 C CA  . GLY A 1 508 ? 30.076 29.612 90.728  1.00 7.73  ? 508  GLY A CA  1 
ATOM   4112 C C   . GLY A 1 508 ? 28.852 29.471 91.610  1.00 7.67  ? 508  GLY A C   1 
ATOM   4113 O O   . GLY A 1 508 ? 28.963 29.038 92.760  1.00 7.87  ? 508  GLY A O   1 
ATOM   4114 N N   . GLU A 1 509 ? 27.681 29.755 91.050  1.00 7.68  ? 509  GLU A N   1 
ATOM   4115 C CA  . GLU A 1 509 ? 26.424 29.733 91.797  1.00 7.69  ? 509  GLU A CA  1 
ATOM   4116 C C   . GLU A 1 509 ? 26.145 28.436 92.537  1.00 7.73  ? 509  GLU A C   1 
ATOM   4117 O O   . GLU A 1 509 ? 25.595 28.458 93.639  1.00 7.47  ? 509  GLU A O   1 
ATOM   4118 C CB  . GLU A 1 509 ? 25.244 30.111 90.901  1.00 8.00  ? 509  GLU A CB  1 
ATOM   4119 C CG  . GLU A 1 509 ? 25.269 31.572 90.446  1.00 7.80  ? 509  GLU A CG  1 
ATOM   4120 C CD  . GLU A 1 509 ? 26.039 31.812 89.157  1.00 7.43  ? 509  GLU A CD  1 
ATOM   4121 O OE1 . GLU A 1 509 ? 25.892 32.926 88.608  1.00 7.12  ? 509  GLU A OE1 1 
ATOM   4122 O OE2 . GLU A 1 509 ? 26.754 30.903 88.683  1.00 7.85  ? 509  GLU A OE2 1 
ATOM   4123 N N   . TYR A 1 510 ? 26.475 27.311 91.911  1.00 7.64  ? 510  TYR A N   1 
ATOM   4124 C CA  . TYR A 1 510 ? 26.296 26.023 92.565  1.00 7.90  ? 510  TYR A CA  1 
ATOM   4125 C C   . TYR A 1 510 ? 27.616 25.289 92.684  1.00 8.34  ? 510  TYR A C   1 
ATOM   4126 O O   . TYR A 1 510 ? 27.728 24.103 92.386  1.00 9.06  ? 510  TYR A O   1 
ATOM   4127 C CB  . TYR A 1 510 ? 25.214 25.184 91.886  1.00 7.60  ? 510  TYR A CB  1 
ATOM   4128 C CG  . TYR A 1 510 ? 23.841 25.793 92.073  1.00 8.23  ? 510  TYR A CG  1 
ATOM   4129 C CD1 . TYR A 1 510 ? 23.216 26.475 91.030  1.00 8.64  ? 510  TYR A CD1 1 
ATOM   4130 C CD2 . TYR A 1 510 ? 23.204 25.751 93.311  1.00 9.31  ? 510  TYR A CD2 1 
ATOM   4131 C CE1 . TYR A 1 510 ? 21.990 27.110 91.215  1.00 9.49  ? 510  TYR A CE1 1 
ATOM   4132 C CE2 . TYR A 1 510 ? 21.979 26.380 93.511  1.00 9.95  ? 510  TYR A CE2 1 
ATOM   4133 C CZ  . TYR A 1 510 ? 21.380 27.058 92.458  1.00 9.29  ? 510  TYR A CZ  1 
ATOM   4134 O OH  . TYR A 1 510 ? 20.179 27.694 92.632  1.00 11.00 ? 510  TYR A OH  1 
ATOM   4135 N N   . GLY A 1 511 ? 28.633 26.053 93.064  1.00 9.03  ? 511  GLY A N   1 
ATOM   4136 C CA  . GLY A 1 511 ? 29.954 25.499 93.276  1.00 9.76  ? 511  GLY A CA  1 
ATOM   4137 C C   . GLY A 1 511 ? 30.761 25.127 92.058  1.00 9.66  ? 511  GLY A C   1 
ATOM   4138 O O   . GLY A 1 511 ? 30.402 25.428 90.923  1.00 8.72  ? 511  GLY A O   1 
ATOM   4139 N N   . GLU A 1 512 ? 31.852 24.412 92.303  1.00 10.03 ? 512  GLU A N   1 
ATOM   4140 C CA  . GLU A 1 512 ? 32.748 24.014 91.239  1.00 11.03 ? 512  GLU A CA  1 
ATOM   4141 C C   . GLU A 1 512 ? 32.104 23.149 90.165  1.00 10.83 ? 512  GLU A C   1 
ATOM   4142 O O   . GLU A 1 512 ? 32.531 23.191 89.010  1.00 10.55 ? 512  GLU A O   1 
ATOM   4143 C CB  . GLU A 1 512 ? 34.005 23.366 91.825  1.00 11.49 ? 512  GLU A CB  1 
ATOM   4144 C CG  . GLU A 1 512 ? 35.078 22.979 90.809  1.00 13.24 ? 512  GLU A CG  1 
ATOM   4145 C CD  . GLU A 1 512 ? 35.610 24.142 89.966  1.00 15.11 ? 512  GLU A CD  1 
ATOM   4146 O OE1 . GLU A 1 512 ? 35.363 25.324 90.278  1.00 14.73 ? 512  GLU A OE1 1 
ATOM   4147 O OE2 . GLU A 1 512 ? 36.302 23.855 88.977  1.00 16.28 ? 512  GLU A OE2 1 
ATOM   4148 N N   . THR A 1 513 ? 31.074 22.381 90.512  1.00 10.25 ? 513  THR A N   1 
ATOM   4149 C CA  . THR A 1 513 ? 30.417 21.567 89.496  1.00 10.76 ? 513  THR A CA  1 
ATOM   4150 C C   . THR A 1 513 ? 29.650 22.488 88.533  1.00 10.05 ? 513  THR A C   1 
ATOM   4151 O O   . THR A 1 513 ? 29.520 22.191 87.356  1.00 9.15  ? 513  THR A O   1 
ATOM   4152 C CB  . THR A 1 513 ? 29.486 20.497 90.099  1.00 12.12 ? 513  THR A CB  1 
ATOM   4153 O OG1 . THR A 1 513 ? 28.506 21.127 90.916  1.00 14.65 ? 513  THR A OG1 1 
ATOM   4154 C CG2 . THR A 1 513 ? 30.270 19.513 90.956  1.00 12.99 ? 513  THR A CG2 1 
ATOM   4155 N N   . TRP A 1 514 ? 29.164 23.619 89.036  1.00 8.80  ? 514  TRP A N   1 
ATOM   4156 C CA  . TRP A 1 514 ? 28.457 24.577 88.180  1.00 8.37  ? 514  TRP A CA  1 
ATOM   4157 C C   . TRP A 1 514 ? 29.473 25.200 87.222  1.00 7.72  ? 514  TRP A C   1 
ATOM   4158 O O   . TRP A 1 514 ? 29.208 25.385 86.032  1.00 7.66  ? 514  TRP A O   1 
ATOM   4159 C CB  . TRP A 1 514 ? 27.784 25.658 89.033  1.00 8.04  ? 514  TRP A CB  1 
ATOM   4160 C CG  . TRP A 1 514 ? 26.659 26.381 88.341  1.00 7.18  ? 514  TRP A CG  1 
ATOM   4161 C CD1 . TRP A 1 514 ? 26.629 27.698 87.985  1.00 7.26  ? 514  TRP A CD1 1 
ATOM   4162 C CD2 . TRP A 1 514 ? 25.383 25.839 87.970  1.00 7.17  ? 514  TRP A CD2 1 
ATOM   4163 N NE1 . TRP A 1 514 ? 25.417 28.015 87.423  1.00 7.56  ? 514  TRP A NE1 1 
ATOM   4164 C CE2 . TRP A 1 514 ? 24.627 26.890 87.403  1.00 6.37  ? 514  TRP A CE2 1 
ATOM   4165 C CE3 . TRP A 1 514 ? 24.796 24.565 88.065  1.00 8.20  ? 514  TRP A CE3 1 
ATOM   4166 C CZ2 . TRP A 1 514 ? 23.325 26.713 86.934  1.00 6.59  ? 514  TRP A CZ2 1 
ATOM   4167 C CZ3 . TRP A 1 514 ? 23.496 24.386 87.595  1.00 8.85  ? 514  TRP A CZ3 1 
ATOM   4168 C CH2 . TRP A 1 514 ? 22.776 25.459 87.038  1.00 7.39  ? 514  TRP A CH2 1 
ATOM   4169 N N   . HIS A 1 515 ? 30.645 25.522 87.759  1.00 7.23  ? 515  HIS A N   1 
ATOM   4170 C CA  . HIS A 1 515 ? 31.725 26.096 86.966  1.00 8.13  ? 515  HIS A CA  1 
ATOM   4171 C C   . HIS A 1 515 ? 32.150 25.115 85.865  1.00 8.09  ? 515  HIS A C   1 
ATOM   4172 O O   . HIS A 1 515 ? 32.202 25.484 84.684  1.00 7.93  ? 515  HIS A O   1 
ATOM   4173 C CB  . HIS A 1 515 ? 32.895 26.442 87.894  1.00 7.84  ? 515  HIS A CB  1 
ATOM   4174 C CG  . HIS A 1 515 ? 34.122 26.908 87.175  1.00 8.13  ? 515  HIS A CG  1 
ATOM   4175 N ND1 . HIS A 1 515 ? 35.392 26.618 87.626  1.00 8.96  ? 515  HIS A ND1 1 
ATOM   4176 C CD2 . HIS A 1 515 ? 34.273 27.661 86.057  1.00 7.36  ? 515  HIS A CD2 1 
ATOM   4177 C CE1 . HIS A 1 515 ? 36.276 27.172 86.818  1.00 8.20  ? 515  HIS A CE1 1 
ATOM   4178 N NE2 . HIS A 1 515 ? 35.622 27.807 85.863  1.00 7.14  ? 515  HIS A NE2 1 
ATOM   4179 N N   . LYS A 1 516 ? 32.454 23.878 86.248  1.00 9.04  ? 516  LYS A N   1 
ATOM   4180 C CA  . LYS A 1 516 ? 32.867 22.863 85.282  1.00 8.89  ? 516  LYS A CA  1 
ATOM   4181 C C   . LYS A 1 516 ? 31.812 22.579 84.219  1.00 8.72  ? 516  LYS A C   1 
ATOM   4182 O O   . LYS A 1 516 ? 32.133 22.150 83.109  1.00 9.06  ? 516  LYS A O   1 
ATOM   4183 C CB  . LYS A 1 516 ? 33.260 21.571 85.992  1.00 10.31 ? 516  LYS A CB  1 
ATOM   4184 C CG  . LYS A 1 516 ? 34.615 21.643 86.656  1.00 12.44 ? 516  LYS A CG  1 
ATOM   4185 C CD  . LYS A 1 516 ? 35.086 20.256 87.039  1.00 14.74 ? 516  LYS A CD  1 
ATOM   4186 C CE  . LYS A 1 516 ? 36.480 20.278 87.633  1.00 15.59 ? 516  LYS A CE  1 
ATOM   4187 N NZ  . LYS A 1 516 ? 36.524 21.001 88.919  1.00 17.35 ? 516  LYS A NZ  1 
ATOM   4188 N N   . GLY A 1 517 ? 30.554 22.846 84.552  1.00 8.89  ? 517  GLY A N   1 
ATOM   4189 C CA  . GLY A 1 517 ? 29.474 22.641 83.608  1.00 9.53  ? 517  GLY A CA  1 
ATOM   4190 C C   . GLY A 1 517 ? 29.420 23.675 82.496  1.00 9.12  ? 517  GLY A C   1 
ATOM   4191 O O   . GLY A 1 517 ? 28.588 23.558 81.606  1.00 10.98 ? 517  GLY A O   1 
ATOM   4192 N N   . GLY A 1 518 ? 30.309 24.664 82.539  1.00 9.20  ? 518  GLY A N   1 
ATOM   4193 C CA  . GLY A 1 518 ? 30.329 25.710 81.525  1.00 9.73  ? 518  GLY A CA  1 
ATOM   4194 C C   . GLY A 1 518 ? 31.732 26.081 81.072  1.00 9.75  ? 518  GLY A C   1 
ATOM   4195 O O   . GLY A 1 518 ? 32.027 27.244 80.788  1.00 10.28 ? 518  GLY A O   1 
ATOM   4196 N N   . ILE A 1 519 ? 32.605 25.085 80.981  1.00 8.84  ? 519  ILE A N   1 
ATOM   4197 C CA  . ILE A 1 519 ? 33.974 25.332 80.552  1.00 9.02  ? 519  ILE A CA  1 
ATOM   4198 C C   . ILE A 1 519 ? 34.470 24.208 79.661  1.00 8.55  ? 519  ILE A C   1 
ATOM   4199 O O   . ILE A 1 519 ? 33.868 23.128 79.604  1.00 8.36  ? 519  ILE A O   1 
ATOM   4200 C CB  . ILE A 1 519 ? 34.956 25.440 81.757  1.00 10.21 ? 519  ILE A CB  1 
ATOM   4201 C CG1 . ILE A 1 519 ? 35.041 24.106 82.503  1.00 10.47 ? 519  ILE A CG1 1 
ATOM   4202 C CG2 . ILE A 1 519 ? 34.543 26.572 82.685  1.00 10.61 ? 519  ILE A CG2 1 
ATOM   4203 C CD1 . ILE A 1 519 ? 36.077 24.107 83.625  1.00 11.73 ? 519  ILE A CD1 1 
ATOM   4204 N N   . LEU A 1 520 ? 35.572 24.480 78.974  1.00 8.48  ? 520  LEU A N   1 
ATOM   4205 C CA  . LEU A 1 520 ? 36.245 23.515 78.117  1.00 8.90  ? 520  LEU A CA  1 
ATOM   4206 C C   . LEU A 1 520 ? 35.300 22.849 77.102  1.00 9.16  ? 520  LEU A C   1 
ATOM   4207 O O   . LEU A 1 520 ? 34.664 23.540 76.312  1.00 8.70  ? 520  LEU A O   1 
ATOM   4208 C CB  . LEU A 1 520 ? 36.988 22.504 79.015  1.00 9.51  ? 520  LEU A CB  1 
ATOM   4209 C CG  . LEU A 1 520 ? 37.957 23.163 80.016  1.00 9.48  ? 520  LEU A CG  1 
ATOM   4210 C CD1 . LEU A 1 520 ? 38.430 22.175 81.088  1.00 10.28 ? 520  LEU A CD1 1 
ATOM   4211 C CD2 . LEU A 1 520 ? 39.133 23.794 79.272  1.00 9.49  ? 520  LEU A CD2 1 
ATOM   4212 N N   . ALA A 1 521 ? 35.193 21.523 77.124  1.00 9.09  ? 521  ALA A N   1 
ATOM   4213 C CA  . ALA A 1 521 ? 34.308 20.834 76.190  1.00 9.23  ? 521  ALA A CA  1 
ATOM   4214 C C   . ALA A 1 521 ? 32.848 21.223 76.377  1.00 8.99  ? 521  ALA A C   1 
ATOM   4215 O O   . ALA A 1 521 ? 32.057 21.157 75.442  1.00 9.40  ? 521  ALA A O   1 
ATOM   4216 C CB  . ALA A 1 521 ? 34.464 19.319 76.314  1.00 9.29  ? 521  ALA A CB  1 
ATOM   4217 N N   . ASN A 1 522 ? 32.513 21.689 77.574  1.00 8.40  ? 522  ASN A N   1 
ATOM   4218 C CA  . ASN A 1 522 ? 31.138 22.070 77.886  1.00 8.40  ? 522  ASN A CA  1 
ATOM   4219 C C   . ASN A 1 522 ? 30.845 23.561 77.792  1.00 7.75  ? 522  ASN A C   1 
ATOM   4220 O O   . ASN A 1 522 ? 29.803 24.001 78.263  1.00 7.47  ? 522  ASN A O   1 
ATOM   4221 C CB  . ASN A 1 522 ? 30.758 21.577 79.289  1.00 10.49 ? 522  ASN A CB  1 
ATOM   4222 C CG  . ASN A 1 522 ? 30.738 20.070 79.399  1.00 11.24 ? 522  ASN A CG  1 
ATOM   4223 O OD1 . ASN A 1 522 ? 30.294 19.372 78.489  1.00 11.45 ? 522  ASN A OD1 1 
ATOM   4224 N ND2 . ASN A 1 522 ? 31.201 19.560 80.534  1.00 13.82 ? 522  ASN A ND2 1 
ATOM   4225 N N   . LYS A 1 523 ? 31.726 24.346 77.180  1.00 7.59  ? 523  LYS A N   1 
ATOM   4226 C CA  . LYS A 1 523 ? 31.462 25.781 77.073  1.00 7.23  ? 523  LYS A CA  1 
ATOM   4227 C C   . LYS A 1 523 ? 30.123 26.061 76.377  1.00 7.19  ? 523  LYS A C   1 
ATOM   4228 O O   . LYS A 1 523 ? 29.430 27.016 76.729  1.00 7.26  ? 523  LYS A O   1 
ATOM   4229 C CB  . LYS A 1 523 ? 32.616 26.506 76.379  1.00 7.25  ? 523  LYS A CB  1 
ATOM   4230 C CG  . LYS A 1 523 ? 32.473 28.030 76.324  1.00 6.75  ? 523  LYS A CG  1 
ATOM   4231 C CD  . LYS A 1 523 ? 32.432 28.669 77.710  1.00 6.86  ? 523  LYS A CD  1 
ATOM   4232 C CE  . LYS A 1 523 ? 32.195 30.174 77.630  1.00 6.51  ? 523  LYS A CE  1 
ATOM   4233 N NZ  . LYS A 1 523 ? 31.916 30.751 78.972  1.00 7.73  ? 523  LYS A NZ  1 
ATOM   4234 N N   . GLN A 1 524 ? 29.738 25.227 75.411  1.00 7.37  ? 524  GLN A N   1 
ATOM   4235 C CA  . GLN A 1 524 ? 28.468 25.439 74.720  1.00 7.68  ? 524  GLN A CA  1 
ATOM   4236 C C   . GLN A 1 524 ? 27.268 25.445 75.676  1.00 8.08  ? 524  GLN A C   1 
ATOM   4237 O O   . GLN A 1 524 ? 26.236 26.027 75.372  1.00 8.64  ? 524  GLN A O   1 
ATOM   4238 C CB  . GLN A 1 524 ? 28.287 24.427 73.579  1.00 7.24  ? 524  GLN A CB  1 
ATOM   4239 C CG  . GLN A 1 524 ? 27.009 24.592 72.751  1.00 8.43  ? 524  GLN A CG  1 
ATOM   4240 C CD  . GLN A 1 524 ? 26.936 25.918 72.025  1.00 7.76  ? 524  GLN A CD  1 
ATOM   4241 O OE1 . GLN A 1 524 ? 27.950 26.442 71.544  1.00 8.72  ? 524  GLN A OE1 1 
ATOM   4242 N NE2 . GLN A 1 524 ? 25.739 26.470 71.940  1.00 8.74  ? 524  GLN A NE2 1 
ATOM   4243 N N   . ASN A 1 525 ? 27.403 24.792 76.825  1.00 8.19  ? 525  ASN A N   1 
ATOM   4244 C CA  . ASN A 1 525 ? 26.324 24.783 77.816  1.00 8.48  ? 525  ASN A CA  1 
ATOM   4245 C C   . ASN A 1 525 ? 25.974 26.214 78.229  1.00 8.53  ? 525  ASN A C   1 
ATOM   4246 O O   . ASN A 1 525 ? 24.812 26.521 78.483  1.00 8.63  ? 525  ASN A O   1 
ATOM   4247 C CB  . ASN A 1 525 ? 26.723 24.007 79.078  1.00 8.11  ? 525  ASN A CB  1 
ATOM   4248 C CG  . ASN A 1 525 ? 26.658 22.494 78.903  1.00 9.16  ? 525  ASN A CG  1 
ATOM   4249 O OD1 . ASN A 1 525 ? 26.077 21.969 77.950  1.00 9.43  ? 525  ASN A OD1 1 
ATOM   4250 N ND2 . ASN A 1 525 ? 27.253 21.780 79.849  1.00 9.99  ? 525  ASN A ND2 1 
ATOM   4251 N N   . CYS A 1 526 ? 26.990 27.078 78.331  1.00 8.94  ? 526  CYS A N   1 
ATOM   4252 C CA  . CYS A 1 526 ? 26.778 28.479 78.705  1.00 8.82  ? 526  CYS A CA  1 
ATOM   4253 C C   . CYS A 1 526 ? 25.858 29.160 77.716  1.00 8.64  ? 526  CYS A C   1 
ATOM   4254 O O   . CYS A 1 526 ? 24.902 29.830 78.095  1.00 8.40  ? 526  CYS A O   1 
ATOM   4255 C CB  . CYS A 1 526 ? 28.088 29.268 78.685  1.00 10.04 ? 526  CYS A CB  1 
ATOM   4256 S SG  . CYS A 1 526 ? 29.362 28.688 79.775  1.00 10.27 ? 526  CYS A SG  1 
ATOM   4257 N N   . PHE A 1 527 ? 26.194 29.017 76.439  1.00 8.54  ? 527  PHE A N   1 
ATOM   4258 C CA  . PHE A 1 527 ? 25.433 29.637 75.370  1.00 8.17  ? 527  PHE A CA  1 
ATOM   4259 C C   . PHE A 1 527 ? 24.029 29.072 75.298  1.00 8.12  ? 527  PHE A C   1 
ATOM   4260 O O   . PHE A 1 527 ? 23.074 29.825 75.115  1.00 8.73  ? 527  PHE A O   1 
ATOM   4261 C CB  . PHE A 1 527 ? 26.160 29.472 74.033  1.00 7.98  ? 527  PHE A CB  1 
ATOM   4262 C CG  . PHE A 1 527 ? 27.613 29.858 74.086  1.00 7.53  ? 527  PHE A CG  1 
ATOM   4263 C CD1 . PHE A 1 527 ? 28.599 28.979 73.646  1.00 7.78  ? 527  PHE A CD1 1 
ATOM   4264 C CD2 . PHE A 1 527 ? 27.996 31.090 74.603  1.00 8.80  ? 527  PHE A CD2 1 
ATOM   4265 C CE1 . PHE A 1 527 ? 29.941 29.322 73.724  1.00 7.86  ? 527  PHE A CE1 1 
ATOM   4266 C CE2 . PHE A 1 527 ? 29.337 31.443 74.684  1.00 8.70  ? 527  PHE A CE2 1 
ATOM   4267 C CZ  . PHE A 1 527 ? 30.314 30.551 74.244  1.00 8.70  ? 527  PHE A CZ  1 
ATOM   4268 N N   . ASP A 1 528 ? 23.901 27.762 75.472  1.00 8.35  ? 528  ASP A N   1 
ATOM   4269 C CA  . ASP A 1 528 ? 22.594 27.126 75.451  1.00 7.88  ? 528  ASP A CA  1 
ATOM   4270 C C   . ASP A 1 528 ? 21.748 27.630 76.614  1.00 7.93  ? 528  ASP A C   1 
ATOM   4271 O O   . ASP A 1 528 ? 20.576 27.981 76.456  1.00 7.65  ? 528  ASP A O   1 
ATOM   4272 C CB  . ASP A 1 528 ? 22.739 25.604 75.547  1.00 8.05  ? 528  ASP A CB  1 
ATOM   4273 C CG  . ASP A 1 528 ? 23.298 24.975 74.284  1.00 8.73  ? 528  ASP A CG  1 
ATOM   4274 O OD1 . ASP A 1 528 ? 23.262 25.611 73.214  1.00 10.00 ? 528  ASP A OD1 1 
ATOM   4275 O OD2 . ASP A 1 528 ? 23.770 23.821 74.386  1.00 9.38  ? 528  ASP A OD2 1 
ATOM   4276 N N   . ASP A 1 529 ? 22.357 27.666 77.792  1.00 6.84  ? 529  ASP A N   1 
ATOM   4277 C CA  . ASP A 1 529 ? 21.666 28.155 78.977  1.00 7.40  ? 529  ASP A CA  1 
ATOM   4278 C C   . ASP A 1 529 ? 21.141 29.578 78.740  1.00 7.10  ? 529  ASP A C   1 
ATOM   4279 O O   . ASP A 1 529 ? 19.985 29.884 79.021  1.00 7.52  ? 529  ASP A O   1 
ATOM   4280 C CB  . ASP A 1 529 ? 22.624 28.212 80.176  1.00 7.55  ? 529  ASP A CB  1 
ATOM   4281 C CG  . ASP A 1 529 ? 22.955 26.848 80.764  1.00 8.45  ? 529  ASP A CG  1 
ATOM   4282 O OD1 . ASP A 1 529 ? 22.338 25.836 80.396  1.00 9.16  ? 529  ASP A OD1 1 
ATOM   4283 O OD2 . ASP A 1 529 ? 23.845 26.793 81.634  1.00 8.97  ? 529  ASP A OD2 1 
ATOM   4284 N N   . PHE A 1 530 ? 21.997 30.444 78.205  1.00 6.77  ? 530  PHE A N   1 
ATOM   4285 C CA  . PHE A 1 530 ? 21.612 31.831 77.978  1.00 6.94  ? 530  PHE A CA  1 
ATOM   4286 C C   . PHE A 1 530 ? 20.517 31.966 76.927  1.00 7.17  ? 530  PHE A C   1 
ATOM   4287 O O   . PHE A 1 530 ? 19.569 32.727 77.115  1.00 7.03  ? 530  PHE A O   1 
ATOM   4288 C CB  . PHE A 1 530 ? 22.849 32.668 77.652  1.00 7.27  ? 530  PHE A CB  1 
ATOM   4289 C CG  . PHE A 1 530 ? 22.669 34.133 77.897  1.00 6.23  ? 530  PHE A CG  1 
ATOM   4290 C CD1 . PHE A 1 530 ? 22.405 34.618 79.177  1.00 6.67  ? 530  PHE A CD1 1 
ATOM   4291 C CD2 . PHE A 1 530 ? 22.772 35.029 76.845  1.00 7.14  ? 530  PHE A CD2 1 
ATOM   4292 C CE1 . PHE A 1 530 ? 22.254 35.985 79.404  1.00 7.90  ? 530  PHE A CE1 1 
ATOM   4293 C CE2 . PHE A 1 530 ? 22.624 36.400 77.059  1.00 7.32  ? 530  PHE A CE2 1 
ATOM   4294 C CZ  . PHE A 1 530 ? 22.363 36.877 78.339  1.00 6.97  ? 530  PHE A CZ  1 
ATOM   4295 N N   . GLN A 1 531 ? 20.643 31.225 75.832  1.00 7.35  ? 531  GLN A N   1 
ATOM   4296 C CA  . GLN A 1 531 ? 19.622 31.234 74.789  1.00 7.89  ? 531  GLN A CA  1 
ATOM   4297 C C   . GLN A 1 531 ? 18.291 30.750 75.369  1.00 7.76  ? 531  GLN A C   1 
ATOM   4298 O O   . GLN A 1 531 ? 17.227 31.287 75.050  1.00 7.79  ? 531  GLN A O   1 
ATOM   4299 C CB  . GLN A 1 531 ? 20.068 30.365 73.612  1.00 8.36  ? 531  GLN A CB  1 
ATOM   4300 C CG  . GLN A 1 531 ? 21.197 31.023 72.832  1.00 8.71  ? 531  GLN A CG  1 
ATOM   4301 C CD  . GLN A 1 531 ? 21.998 30.046 71.992  1.00 8.94  ? 531  GLN A CD  1 
ATOM   4302 O OE1 . GLN A 1 531 ? 21.493 29.026 71.534  1.00 9.60  ? 531  GLN A OE1 1 
ATOM   4303 N NE2 . GLN A 1 531 ? 23.271 30.353 71.802  1.00 7.89  ? 531  GLN A NE2 1 
ATOM   4304 N N   . CYS A 1 532 ? 18.359 29.783 76.278  1.00 7.85  ? 532  CYS A N   1 
ATOM   4305 C CA  . CYS A 1 532 ? 17.154 29.268 76.908  1.00 8.09  ? 532  CYS A CA  1 
ATOM   4306 C C   . CYS A 1 532 ? 16.530 30.276 77.877  1.00 8.38  ? 532  CYS A C   1 
ATOM   4307 O O   . CYS A 1 532 ? 15.314 30.275 78.094  1.00 9.09  ? 532  CYS A O   1 
ATOM   4308 C CB  . CYS A 1 532 ? 17.430 27.916 77.565  1.00 8.14  ? 532  CYS A CB  1 
ATOM   4309 S SG  . CYS A 1 532 ? 17.646 26.581 76.326  1.00 9.56  ? 532  CYS A SG  1 
ATOM   4310 N N   . ALA A 1 533 ? 17.352 31.170 78.424  1.00 8.06  ? 533  ALA A N   1 
ATOM   4311 C CA  . ALA A 1 533 ? 16.836 32.212 79.315  1.00 8.22  ? 533  ALA A CA  1 
ATOM   4312 C C   . ALA A 1 533 ? 15.988 33.148 78.464  1.00 8.30  ? 533  ALA A C   1 
ATOM   4313 O O   . ALA A 1 533 ? 14.898 33.567 78.856  1.00 8.82  ? 533  ALA A O   1 
ATOM   4314 C CB  . ALA A 1 533 ? 17.980 32.987 79.959  1.00 8.10  ? 533  ALA A CB  1 
ATOM   4315 N N   . ALA A 1 534 ? 16.506 33.470 77.285  1.00 8.51  ? 534  ALA A N   1 
ATOM   4316 C CA  . ALA A 1 534 ? 15.795 34.326 76.343  1.00 9.31  ? 534  ALA A CA  1 
ATOM   4317 C C   . ALA A 1 534 ? 14.476 33.668 75.931  1.00 9.52  ? 534  ALA A C   1 
ATOM   4318 O O   . ALA A 1 534 ? 13.421 34.310 75.921  1.00 9.84  ? 534  ALA A O   1 
ATOM   4319 C CB  . ALA A 1 534 ? 16.661 34.591 75.124  1.00 9.56  ? 534  ALA A CB  1 
ATOM   4320 N N   . GLU A 1 535 ? 14.532 32.383 75.599  1.00 9.43  ? 535  GLU A N   1 
ATOM   4321 C CA  . GLU A 1 535 ? 13.325 31.664 75.208  1.00 10.23 ? 535  GLU A CA  1 
ATOM   4322 C C   . GLU A 1 535 ? 12.289 31.673 76.324  1.00 10.11 ? 535  GLU A C   1 
ATOM   4323 O O   . GLU A 1 535 ? 11.095 31.819 76.060  1.00 10.67 ? 535  GLU A O   1 
ATOM   4324 C CB  . GLU A 1 535 ? 13.644 30.229 74.787  1.00 10.85 ? 535  GLU A CB  1 
ATOM   4325 C CG  . GLU A 1 535 ? 14.333 30.120 73.435  1.00 13.28 ? 535  GLU A CG  1 
ATOM   4326 C CD  . GLU A 1 535 ? 14.363 28.708 72.879  1.00 15.58 ? 535  GLU A CD  1 
ATOM   4327 O OE1 . GLU A 1 535 ? 15.278 28.407 72.084  1.00 17.32 ? 535  GLU A OE1 1 
ATOM   4328 O OE2 . GLU A 1 535 ? 13.469 27.905 73.218  1.00 16.26 ? 535  GLU A OE2 1 
ATOM   4329 N N   . TYR A 1 536 ? 12.744 31.552 77.568  1.00 9.87  ? 536  TYR A N   1 
ATOM   4330 C CA  . TYR A 1 536 ? 11.837 31.579 78.710  1.00 10.10 ? 536  TYR A CA  1 
ATOM   4331 C C   . TYR A 1 536 ? 11.135 32.936 78.817  1.00 10.08 ? 536  TYR A C   1 
ATOM   4332 O O   . TYR A 1 536 ? 9.920  33.009 78.999  1.00 11.10 ? 536  TYR A O   1 
ATOM   4333 C CB  . TYR A 1 536 ? 12.589 31.287 80.013  1.00 10.06 ? 536  TYR A CB  1 
ATOM   4334 C CG  . TYR A 1 536 ? 11.726 31.405 81.257  1.00 9.98  ? 536  TYR A CG  1 
ATOM   4335 C CD1 . TYR A 1 536 ? 11.094 30.284 81.795  1.00 11.34 ? 536  TYR A CD1 1 
ATOM   4336 C CD2 . TYR A 1 536 ? 11.529 32.639 81.883  1.00 11.44 ? 536  TYR A CD2 1 
ATOM   4337 C CE1 . TYR A 1 536 ? 10.285 30.386 82.922  1.00 11.47 ? 536  TYR A CE1 1 
ATOM   4338 C CE2 . TYR A 1 536 ? 10.723 32.752 83.014  1.00 11.08 ? 536  TYR A CE2 1 
ATOM   4339 C CZ  . TYR A 1 536 ? 10.104 31.619 83.526  1.00 11.47 ? 536  TYR A CZ  1 
ATOM   4340 O OH  . TYR A 1 536 ? 9.308  31.714 84.648  1.00 12.73 ? 536  TYR A OH  1 
ATOM   4341 N N   . LEU A 1 537 ? 11.904 34.015 78.727  1.00 10.11 ? 537  LEU A N   1 
ATOM   4342 C CA  . LEU A 1 537 ? 11.342 35.361 78.822  1.00 10.50 ? 537  LEU A CA  1 
ATOM   4343 C C   . LEU A 1 537 ? 10.291 35.615 77.745  1.00 10.79 ? 537  LEU A C   1 
ATOM   4344 O O   . LEU A 1 537 ? 9.304  36.317 77.982  1.00 11.32 ? 537  LEU A O   1 
ATOM   4345 C CB  . LEU A 1 537 ? 12.445 36.416 78.726  1.00 10.04 ? 537  LEU A CB  1 
ATOM   4346 C CG  . LEU A 1 537 ? 13.452 36.464 79.873  1.00 10.42 ? 537  LEU A CG  1 
ATOM   4347 C CD1 . LEU A 1 537 ? 14.517 37.498 79.561  1.00 10.46 ? 537  LEU A CD1 1 
ATOM   4348 C CD2 . LEU A 1 537 ? 12.738 36.796 81.185  1.00 10.49 ? 537  LEU A CD2 1 
ATOM   4349 N N   . ILE A 1 538 ? 10.524 35.063 76.559  1.00 11.21 ? 538  ILE A N   1 
ATOM   4350 C CA  . ILE A 1 538 ? 9.612  35.211 75.436  1.00 11.81 ? 538  ILE A CA  1 
ATOM   4351 C C   . ILE A 1 538 ? 8.368  34.334 75.606  1.00 12.32 ? 538  ILE A C   1 
ATOM   4352 O O   . ILE A 1 538 ? 7.247  34.826 75.507  1.00 12.82 ? 538  ILE A O   1 
ATOM   4353 C CB  . ILE A 1 538 ? 10.323 34.869 74.099  1.00 11.27 ? 538  ILE A CB  1 
ATOM   4354 C CG1 . ILE A 1 538 ? 11.390 35.919 73.793  1.00 11.42 ? 538  ILE A CG1 1 
ATOM   4355 C CG2 . ILE A 1 538 ? 9.318  34.799 72.944  1.00 12.21 ? 538  ILE A CG2 1 
ATOM   4356 C CD1 . ILE A 1 538 ? 12.490 35.429 72.879  1.00 10.20 ? 538  ILE A CD1 1 
ATOM   4357 N N   . LYS A 1 539 ? 8.562  33.056 75.920  1.00 12.77 ? 539  LYS A N   1 
ATOM   4358 C CA  . LYS A 1 539 ? 7.429  32.148 76.079  1.00 13.96 ? 539  LYS A CA  1 
ATOM   4359 C C   . LYS A 1 539 ? 6.528  32.548 77.243  1.00 14.03 ? 539  LYS A C   1 
ATOM   4360 O O   . LYS A 1 539 ? 5.309  32.412 77.164  1.00 14.01 ? 539  LYS A O   1 
ATOM   4361 C CB  . LYS A 1 539 ? 7.887  30.693 76.240  1.00 15.52 ? 539  LYS A CB  1 
ATOM   4362 C CG  . LYS A 1 539 ? 8.474  30.352 77.598  1.00 18.14 ? 539  LYS A CG  1 
ATOM   4363 C CD  . LYS A 1 539 ? 8.790  28.865 77.686  1.00 19.83 ? 539  LYS A CD  1 
ATOM   4364 C CE  . LYS A 1 539 ? 9.568  28.502 78.944  1.00 21.39 ? 539  LYS A CE  1 
ATOM   4365 N NZ  . LYS A 1 539 ? 8.716  28.005 80.058  1.00 22.25 ? 539  LYS A NZ  1 
ATOM   4366 N N   . GLU A 1 540 ? 7.124  33.076 78.307  1.00 13.58 ? 540  GLU A N   1 
ATOM   4367 C CA  . GLU A 1 540 ? 6.345  33.485 79.466  1.00 13.96 ? 540  GLU A CA  1 
ATOM   4368 C C   . GLU A 1 540 ? 5.692  34.864 79.335  1.00 13.35 ? 540  GLU A C   1 
ATOM   4369 O O   . GLU A 1 540 ? 5.039  35.344 80.260  1.00 14.15 ? 540  GLU A O   1 
ATOM   4370 C CB  . GLU A 1 540 ? 7.172  33.373 80.752  1.00 14.88 ? 540  GLU A CB  1 
ATOM   4371 C CG  . GLU A 1 540 ? 7.622  31.940 81.081  1.00 16.46 ? 540  GLU A CG  1 
ATOM   4372 C CD  . GLU A 1 540 ? 6.464  30.950 81.229  1.00 17.37 ? 540  GLU A CD  1 
ATOM   4373 O OE1 . GLU A 1 540 ? 5.428  31.311 81.826  1.00 19.16 ? 540  GLU A OE1 1 
ATOM   4374 O OE2 . GLU A 1 540 ? 6.594  29.802 80.754  1.00 19.23 ? 540  GLU A OE2 1 
ATOM   4375 N N   . GLY A 1 541 ? 5.928  35.523 78.205  1.00 12.59 ? 541  GLY A N   1 
ATOM   4376 C CA  . GLY A 1 541 ? 5.302  36.815 77.963  1.00 12.32 ? 541  GLY A CA  1 
ATOM   4377 C C   . GLY A 1 541 ? 5.945  38.070 78.516  1.00 11.89 ? 541  GLY A C   1 
ATOM   4378 O O   . GLY A 1 541 ? 5.320  39.131 78.539  1.00 11.59 ? 541  GLY A O   1 
ATOM   4379 N N   . TYR A 1 542 ? 7.189  37.977 78.967  1.00 11.28 ? 542  TYR A N   1 
ATOM   4380 C CA  . TYR A 1 542 ? 7.867  39.160 79.481  1.00 11.88 ? 542  TYR A CA  1 
ATOM   4381 C C   . TYR A 1 542 ? 8.306  40.073 78.348  1.00 11.81 ? 542  TYR A C   1 
ATOM   4382 O O   . TYR A 1 542 ? 8.276  41.297 78.481  1.00 13.31 ? 542  TYR A O   1 
ATOM   4383 C CB  . TYR A 1 542 ? 9.098  38.780 80.308  1.00 11.89 ? 542  TYR A CB  1 
ATOM   4384 C CG  . TYR A 1 542 ? 8.783  38.179 81.644  1.00 12.15 ? 542  TYR A CG  1 
ATOM   4385 C CD1 . TYR A 1 542 ? 8.684  36.798 81.800  1.00 11.15 ? 542  TYR A CD1 1 
ATOM   4386 C CD2 . TYR A 1 542 ? 8.584  38.987 82.758  1.00 11.75 ? 542  TYR A CD2 1 
ATOM   4387 C CE1 . TYR A 1 542 ? 8.394  36.240 83.034  1.00 12.25 ? 542  TYR A CE1 1 
ATOM   4388 C CE2 . TYR A 1 542 ? 8.293  38.437 83.997  1.00 12.37 ? 542  TYR A CE2 1 
ATOM   4389 C CZ  . TYR A 1 542 ? 8.200  37.066 84.127  1.00 12.16 ? 542  TYR A CZ  1 
ATOM   4390 O OH  . TYR A 1 542 ? 7.920  36.509 85.352  1.00 13.22 ? 542  TYR A OH  1 
ATOM   4391 N N   . THR A 1 543 ? 8.645  39.475 77.212  1.00 11.38 ? 543  THR A N   1 
ATOM   4392 C CA  . THR A 1 543 ? 9.141  40.236 76.075  1.00 11.23 ? 543  THR A CA  1 
ATOM   4393 C C   . THR A 1 543 ? 8.927  39.444 74.780  1.00 11.50 ? 543  THR A C   1 
ATOM   4394 O O   . THR A 1 543 ? 8.245  38.412 74.781  1.00 12.25 ? 543  THR A O   1 
ATOM   4395 C CB  . THR A 1 543 ? 10.663 40.515 76.300  1.00 10.77 ? 543  THR A CB  1 
ATOM   4396 O OG1 . THR A 1 543 ? 11.145 41.486 75.361  1.00 9.88  ? 543  THR A OG1 1 
ATOM   4397 C CG2 . THR A 1 543 ? 11.488 39.220 76.186  1.00 10.20 ? 543  THR A CG2 1 
ATOM   4398 N N   . SER A 1 544 ? 9.515  39.932 73.691  1.00 12.26 ? 544  SER A N   1 
ATOM   4399 C CA  . SER A 1 544 ? 9.441  39.292 72.379  1.00 12.68 ? 544  SER A CA  1 
ATOM   4400 C C   . SER A 1 544 ? 10.830 39.481 71.781  1.00 12.33 ? 544  SER A C   1 
ATOM   4401 O O   . SER A 1 544 ? 11.522 40.435 72.133  1.00 12.19 ? 544  SER A O   1 
ATOM   4402 C CB  . SER A 1 544 ? 8.404  39.991 71.502  1.00 13.65 ? 544  SER A CB  1 
ATOM   4403 O OG  . SER A 1 544 ? 7.099  39.770 72.000  1.00 15.92 ? 544  SER A OG  1 
ATOM   4404 N N   . PRO A 1 545 ? 11.227 38.632 70.814  1.00 12.63 ? 545  PRO A N   1 
ATOM   4405 C CA  . PRO A 1 545 ? 12.550 38.727 70.182  1.00 13.22 ? 545  PRO A CA  1 
ATOM   4406 C C   . PRO A 1 545 ? 12.969 40.130 69.741  1.00 13.73 ? 545  PRO A C   1 
ATOM   4407 O O   . PRO A 1 545 ? 14.071 40.582 70.060  1.00 13.81 ? 545  PRO A O   1 
ATOM   4408 C CB  . PRO A 1 545 ? 12.420 37.784 68.988  1.00 13.05 ? 545  PRO A CB  1 
ATOM   4409 C CG  . PRO A 1 545 ? 11.498 36.738 69.484  1.00 12.85 ? 545  PRO A CG  1 
ATOM   4410 C CD  . PRO A 1 545 ? 10.439 37.537 70.214  1.00 12.98 ? 545  PRO A CD  1 
ATOM   4411 N N   . LYS A 1 546 ? 12.073 40.831 69.049  1.00 14.24 ? 546  LYS A N   1 
ATOM   4412 C CA  . LYS A 1 546 ? 12.358 42.171 68.544  1.00 14.87 ? 546  LYS A CA  1 
ATOM   4413 C C   . LYS A 1 546 ? 12.579 43.200 69.649  1.00 13.75 ? 546  LYS A C   1 
ATOM   4414 O O   . LYS A 1 546 ? 13.195 44.233 69.412  1.00 13.87 ? 546  LYS A O   1 
ATOM   4415 C CB  . LYS A 1 546 ? 11.234 42.666 67.628  1.00 17.09 ? 546  LYS A CB  1 
ATOM   4416 C CG  . LYS A 1 546 ? 10.009 43.171 68.384  1.00 19.62 ? 546  LYS A CG  1 
ATOM   4417 C CD  . LYS A 1 546 ? 9.007  43.857 67.473  1.00 22.01 ? 546  LYS A CD  1 
ATOM   4418 C CE  . LYS A 1 546 ? 8.093  42.859 66.793  1.00 23.72 ? 546  LYS A CE  1 
ATOM   4419 N NZ  . LYS A 1 546 ? 7.300  42.082 67.792  1.00 24.71 ? 546  LYS A NZ  1 
ATOM   4420 N N   . ARG A 1 547 ? 12.085 42.911 70.849  1.00 11.84 ? 547  ARG A N   1 
ATOM   4421 C CA  . ARG A 1 547 ? 12.207 43.831 71.983  1.00 11.85 ? 547  ARG A CA  1 
ATOM   4422 C C   . ARG A 1 547 ? 13.266 43.408 72.993  1.00 10.38 ? 547  ARG A C   1 
ATOM   4423 O O   . ARG A 1 547 ? 13.412 44.043 74.033  1.00 9.98  ? 547  ARG A O   1 
ATOM   4424 C CB  . ARG A 1 547 ? 10.871 43.922 72.725  1.00 13.37 ? 547  ARG A CB  1 
ATOM   4425 C CG  . ARG A 1 547 ? 9.667  44.224 71.871  1.00 15.35 ? 547  ARG A CG  1 
ATOM   4426 C CD  . ARG A 1 547 ? 8.400  44.180 72.704  1.00 17.26 ? 547  ARG A CD  1 
ATOM   4427 N NE  . ARG A 1 547 ? 7.196  44.262 71.880  1.00 19.01 ? 547  ARG A NE  1 
ATOM   4428 C CZ  . ARG A 1 547 ? 6.727  45.379 71.336  1.00 19.85 ? 547  ARG A CZ  1 
ATOM   4429 N NH1 . ARG A 1 547 ? 7.354  46.529 71.517  1.00 21.02 ? 547  ARG A NH1 1 
ATOM   4430 N NH2 . ARG A 1 547 ? 5.630  45.337 70.593  1.00 20.90 ? 547  ARG A NH2 1 
ATOM   4431 N N   . LEU A 1 548 ? 13.959 42.314 72.712  1.00 9.10  ? 548  LEU A N   1 
ATOM   4432 C CA  . LEU A 1 548 ? 14.969 41.800 73.622  1.00 8.35  ? 548  LEU A CA  1 
ATOM   4433 C C   . LEU A 1 548 ? 16.411 42.229 73.364  1.00 7.57  ? 548  LEU A C   1 
ATOM   4434 O O   . LEU A 1 548 ? 16.928 42.074 72.260  1.00 7.59  ? 548  LEU A O   1 
ATOM   4435 C CB  . LEU A 1 548 ? 14.895 40.270 73.643  1.00 8.11  ? 548  LEU A CB  1 
ATOM   4436 C CG  . LEU A 1 548 ? 15.914 39.497 74.491  1.00 8.62  ? 548  LEU A CG  1 
ATOM   4437 C CD1 . LEU A 1 548 ? 15.789 39.847 75.965  1.00 9.17  ? 548  LEU A CD1 1 
ATOM   4438 C CD2 . LEU A 1 548 ? 15.707 38.013 74.292  1.00 9.73  ? 548  LEU A CD2 1 
ATOM   4439 N N   . THR A 1 549 ? 17.044 42.762 74.409  1.00 7.34  ? 549  THR A N   1 
ATOM   4440 C CA  . THR A 1 549 ? 18.448 43.141 74.363  1.00 7.11  ? 549  THR A CA  1 
ATOM   4441 C C   . THR A 1 549 ? 19.231 42.220 75.300  1.00 6.48  ? 549  THR A C   1 
ATOM   4442 O O   . THR A 1 549 ? 18.756 41.901 76.393  1.00 6.87  ? 549  THR A O   1 
ATOM   4443 C CB  . THR A 1 549 ? 18.692 44.581 74.866  1.00 6.72  ? 549  THR A CB  1 
ATOM   4444 O OG1 . THR A 1 549 ? 18.060 45.510 73.981  1.00 7.63  ? 549  THR A OG1 1 
ATOM   4445 C CG2 . THR A 1 549 ? 20.185 44.895 74.899  1.00 7.46  ? 549  THR A CG2 1 
ATOM   4446 N N   . ILE A 1 550 ? 20.382 41.733 74.837  1.00 6.77  ? 550  ILE A N   1 
ATOM   4447 C CA  . ILE A 1 550 ? 21.255 40.930 75.684  1.00 6.95  ? 550  ILE A CA  1 
ATOM   4448 C C   . ILE A 1 550 ? 22.555 41.711 75.870  1.00 6.82  ? 550  ILE A C   1 
ATOM   4449 O O   . ILE A 1 550 ? 23.008 42.437 74.964  1.00 6.59  ? 550  ILE A O   1 
ATOM   4450 C CB  . ILE A 1 550 ? 21.517 39.497 75.164  1.00 6.88  ? 550  ILE A CB  1 
ATOM   4451 C CG1 . ILE A 1 550 ? 21.997 39.486 73.716  1.00 7.66  ? 550  ILE A CG1 1 
ATOM   4452 C CG2 . ILE A 1 550 ? 20.266 38.643 75.387  1.00 8.06  ? 550  ILE A CG2 1 
ATOM   4453 C CD1 . ILE A 1 550 ? 22.472 38.100 73.242  1.00 8.23  ? 550  ILE A CD1 1 
ATOM   4454 N N   . ASN A 1 551 ? 23.119 41.587 77.065  1.00 6.94  ? 551  ASN A N   1 
ATOM   4455 C CA  . ASN A 1 551 ? 24.341 42.287 77.430  1.00 6.89  ? 551  ASN A CA  1 
ATOM   4456 C C   . ASN A 1 551 ? 25.235 41.426 78.304  1.00 6.49  ? 551  ASN A C   1 
ATOM   4457 O O   . ASN A 1 551 ? 24.764 40.586 79.074  1.00 6.37  ? 551  ASN A O   1 
ATOM   4458 C CB  . ASN A 1 551 ? 23.962 43.569 78.179  1.00 6.25  ? 551  ASN A CB  1 
ATOM   4459 C CG  . ASN A 1 551 ? 25.153 44.288 78.799  1.00 6.82  ? 551  ASN A CG  1 
ATOM   4460 O OD1 . ASN A 1 551 ? 25.168 44.485 79.997  1.00 7.70  ? 551  ASN A OD1 1 
ATOM   4461 N ND2 . ASN A 1 551 ? 26.106 44.738 77.991  1.00 7.76  ? 551  ASN A ND2 1 
ATOM   4462 N N   . GLY A 1 552 ? 26.534 41.625 78.119  1.00 6.75  ? 552  GLY A N   1 
ATOM   4463 C CA  . GLY A 1 552 ? 27.533 40.929 78.905  1.00 6.48  ? 552  GLY A CA  1 
ATOM   4464 C C   . GLY A 1 552 ? 28.861 41.625 78.688  1.00 6.12  ? 552  GLY A C   1 
ATOM   4465 O O   . GLY A 1 552 ? 29.052 42.292 77.673  1.00 6.30  ? 552  GLY A O   1 
ATOM   4466 N N   . GLY A 1 553 ? 29.792 41.458 79.620  1.00 5.99  ? 553  GLY A N   1 
ATOM   4467 C CA  . GLY A 1 553 ? 31.104 42.062 79.483  1.00 6.55  ? 553  GLY A CA  1 
ATOM   4468 C C   . GLY A 1 553 ? 32.220 41.064 79.732  1.00 7.51  ? 553  GLY A C   1 
ATOM   4469 O O   . GLY A 1 553 ? 32.087 40.181 80.583  1.00 6.89  ? 553  GLY A O   1 
ATOM   4470 N N   . SER A 1 554 ? 33.305 41.191 78.976  1.00 7.52  ? 554  SER A N   1 
ATOM   4471 C CA  . SER A 1 554 ? 34.483 40.334 79.084  1.00 8.15  ? 554  SER A CA  1 
ATOM   4472 C C   . SER A 1 554 ? 34.069 38.922 78.665  1.00 7.74  ? 554  SER A C   1 
ATOM   4473 O O   . SER A 1 554 ? 33.717 38.704 77.503  1.00 8.35  ? 554  SER A O   1 
ATOM   4474 C CB  . SER A 1 554 ? 35.041 40.390 80.509  1.00 9.85  ? 554  SER A CB  1 
ATOM   4475 O OG  . SER A 1 554 ? 36.399 39.977 80.553  1.00 12.50 ? 554  SER A OG  1 
ATOM   4476 N N   . ASN A 1 555 ? 34.109 37.963 79.581  1.00 8.24  ? 555  ASN A N   1 
ATOM   4477 C CA  . ASN A 1 555 ? 33.660 36.606 79.269  1.00 7.14  ? 555  ASN A CA  1 
ATOM   4478 C C   . ASN A 1 555 ? 32.176 36.694 78.883  1.00 6.66  ? 555  ASN A C   1 
ATOM   4479 O O   . ASN A 1 555 ? 31.683 35.899 78.099  1.00 6.71  ? 555  ASN A O   1 
ATOM   4480 C CB  . ASN A 1 555 ? 33.874 35.691 80.488  1.00 7.73  ? 555  ASN A CB  1 
ATOM   4481 C CG  . ASN A 1 555 ? 33.164 34.337 80.363  1.00 7.61  ? 555  ASN A CG  1 
ATOM   4482 O OD1 . ASN A 1 555 ? 32.247 34.052 81.099  1.00 8.85  ? 555  ASN A OD1 1 
ATOM   4483 N ND2 . ASN A 1 555 ? 33.591 33.521 79.441  1.00 6.38  ? 555  ASN A ND2 1 
ATOM   4484 N N   . GLY A 1 556 ? 31.487 37.699 79.423  1.00 6.82  ? 556  GLY A N   1 
ATOM   4485 C CA  . GLY A 1 556 ? 30.083 37.931 79.093  1.00 6.59  ? 556  GLY A CA  1 
ATOM   4486 C C   . GLY A 1 556 ? 29.912 38.566 77.716  1.00 6.67  ? 556  GLY A C   1 
ATOM   4487 O O   . GLY A 1 556 ? 28.842 38.487 77.120  1.00 6.61  ? 556  GLY A O   1 
ATOM   4488 N N   . GLY A 1 557 ? 30.966 39.233 77.240  1.00 5.89  ? 557  GLY A N   1 
ATOM   4489 C CA  . GLY A 1 557 ? 30.970 39.833 75.911  1.00 6.86  ? 557  GLY A CA  1 
ATOM   4490 C C   . GLY A 1 557 ? 31.060 38.683 74.919  1.00 6.85  ? 557  GLY A C   1 
ATOM   4491 O O   . GLY A 1 557 ? 30.416 38.693 73.867  1.00 6.36  ? 557  GLY A O   1 
ATOM   4492 N N   . LEU A 1 558 ? 31.881 37.686 75.249  1.00 6.33  ? 558  LEU A N   1 
ATOM   4493 C CA  . LEU A 1 558 ? 31.996 36.477 74.435  1.00 6.69  ? 558  LEU A CA  1 
ATOM   4494 C C   . LEU A 1 558 ? 30.606 35.818 74.399  1.00 6.55  ? 558  LEU A C   1 
ATOM   4495 O O   . LEU A 1 558 ? 30.116 35.398 73.351  1.00 7.21  ? 558  LEU A O   1 
ATOM   4496 C CB  . LEU A 1 558 ? 33.017 35.514 75.067  1.00 7.23  ? 558  LEU A CB  1 
ATOM   4497 C CG  . LEU A 1 558 ? 32.901 34.025 74.722  1.00 6.66  ? 558  LEU A CG  1 
ATOM   4498 C CD1 . LEU A 1 558 ? 33.156 33.798 73.243  1.00 7.38  ? 558  LEU A CD1 1 
ATOM   4499 C CD2 . LEU A 1 558 ? 33.891 33.230 75.564  1.00 7.47  ? 558  LEU A CD2 1 
ATOM   4500 N N   . LEU A 1 559 ? 29.974 35.730 75.563  1.00 6.63  ? 559  LEU A N   1 
ATOM   4501 C CA  . LEU A 1 559 ? 28.651 35.125 75.679  1.00 6.55  ? 559  LEU A CA  1 
ATOM   4502 C C   . LEU A 1 559 ? 27.628 35.709 74.703  1.00 6.68  ? 559  LEU A C   1 
ATOM   4503 O O   . LEU A 1 559 ? 27.031 34.988 73.902  1.00 6.24  ? 559  LEU A O   1 
ATOM   4504 C CB  . LEU A 1 559 ? 28.136 35.295 77.118  1.00 6.78  ? 559  LEU A CB  1 
ATOM   4505 C CG  . LEU A 1 559 ? 26.698 34.842 77.378  1.00 7.30  ? 559  LEU A CG  1 
ATOM   4506 C CD1 . LEU A 1 559 ? 26.633 33.328 77.365  1.00 9.59  ? 559  LEU A CD1 1 
ATOM   4507 C CD2 . LEU A 1 559 ? 26.181 35.391 78.697  1.00 7.87  ? 559  LEU A CD2 1 
ATOM   4508 N N   . VAL A 1 560 ? 27.434 37.019 74.749  1.00 6.56  ? 560  VAL A N   1 
ATOM   4509 C CA  . VAL A 1 560 ? 26.446 37.624 73.881  1.00 6.74  ? 560  VAL A CA  1 
ATOM   4510 C C   . VAL A 1 560 ? 26.831 37.666 72.408  1.00 6.41  ? 560  VAL A C   1 
ATOM   4511 O O   . VAL A 1 560 ? 25.957 37.566 71.547  1.00 7.03  ? 560  VAL A O   1 
ATOM   4512 C CB  . VAL A 1 560 ? 25.975 38.996 74.424  1.00 6.27  ? 560  VAL A CB  1 
ATOM   4513 C CG1 . VAL A 1 560 ? 25.488 38.830 75.879  1.00 6.88  ? 560  VAL A CG1 1 
ATOM   4514 C CG2 . VAL A 1 560 ? 27.083 40.045 74.311  1.00 6.64  ? 560  VAL A CG2 1 
ATOM   4515 N N   . ALA A 1 561 ? 28.124 37.759 72.106  1.00 7.06  ? 561  ALA A N   1 
ATOM   4516 C CA  . ALA A 1 561 ? 28.567 37.768 70.711  1.00 7.80  ? 561  ALA A CA  1 
ATOM   4517 C C   . ALA A 1 561 ? 28.287 36.399 70.087  1.00 7.75  ? 561  ALA A C   1 
ATOM   4518 O O   . ALA A 1 561 ? 27.782 36.299 68.968  1.00 8.26  ? 561  ALA A O   1 
ATOM   4519 C CB  . ALA A 1 561 ? 30.048 38.101 70.634  1.00 7.69  ? 561  ALA A CB  1 
ATOM   4520 N N   . THR A 1 562 ? 28.589 35.342 70.836  1.00 7.51  ? 562  THR A N   1 
ATOM   4521 C CA  . THR A 1 562 ? 28.336 33.987 70.363  1.00 7.79  ? 562  THR A CA  1 
ATOM   4522 C C   . THR A 1 562 ? 26.842 33.767 70.171  1.00 7.33  ? 562  THR A C   1 
ATOM   4523 O O   . THR A 1 562 ? 26.424 33.166 69.181  1.00 7.29  ? 562  THR A O   1 
ATOM   4524 C CB  . THR A 1 562 ? 28.895 32.935 71.355  1.00 6.90  ? 562  THR A CB  1 
ATOM   4525 O OG1 . THR A 1 562 ? 30.319 33.038 71.387  1.00 7.32  ? 562  THR A OG1 1 
ATOM   4526 C CG2 . THR A 1 562 ? 28.476 31.511 70.971  1.00 5.90  ? 562  THR A CG2 1 
ATOM   4527 N N   . CYS A 1 563 ? 26.038 34.272 71.101  1.00 7.48  ? 563  CYS A N   1 
ATOM   4528 C CA  . CYS A 1 563 ? 24.596 34.094 70.998  1.00 7.95  ? 563  CYS A CA  1 
ATOM   4529 C C   . CYS A 1 563 ? 24.033 34.810 69.778  1.00 7.43  ? 563  CYS A C   1 
ATOM   4530 O O   . CYS A 1 563 ? 23.106 34.309 69.147  1.00 8.01  ? 563  CYS A O   1 
ATOM   4531 C CB  . CYS A 1 563 ? 23.889 34.510 72.294  1.00 8.03  ? 563  CYS A CB  1 
ATOM   4532 S SG  . CYS A 1 563 ? 24.147 33.343 73.669  1.00 8.09  ? 563  CYS A SG  1 
ATOM   4533 N N   . ALA A 1 564 ? 24.627 35.946 69.416  1.00 7.73  ? 564  ALA A N   1 
ATOM   4534 C CA  . ALA A 1 564 ? 24.194 36.696 68.240  1.00 7.96  ? 564  ALA A CA  1 
ATOM   4535 C C   . ALA A 1 564 ? 24.429 35.863 66.982  1.00 8.32  ? 564  ALA A C   1 
ATOM   4536 O O   . ALA A 1 564 ? 23.563 35.789 66.121  1.00 8.87  ? 564  ALA A O   1 
ATOM   4537 C CB  . ALA A 1 564 ? 24.924 38.023 68.162  1.00 8.12  ? 564  ALA A CB  1 
ATOM   4538 N N   . ASN A 1 565 ? 25.586 35.211 66.911  1.00 7.98  ? 565  ASN A N   1 
ATOM   4539 C CA  . ASN A 1 565 ? 25.918 34.360 65.766  1.00 8.53  ? 565  ASN A CA  1 
ATOM   4540 C C   . ASN A 1 565 ? 25.037 33.110 65.723  1.00 8.95  ? 565  ASN A C   1 
ATOM   4541 O O   . ASN A 1 565 ? 24.575 32.699 64.662  1.00 9.52  ? 565  ASN A O   1 
ATOM   4542 C CB  . ASN A 1 565 ? 27.365 33.855 65.840  1.00 8.53  ? 565  ASN A CB  1 
ATOM   4543 C CG  . ASN A 1 565 ? 28.400 34.892 65.447  1.00 7.90  ? 565  ASN A CG  1 
ATOM   4544 O OD1 . ASN A 1 565 ? 28.129 35.835 64.703  1.00 8.65  ? 565  ASN A OD1 1 
ATOM   4545 N ND2 . ASN A 1 565 ? 29.625 34.696 65.931  1.00 6.87  ? 565  ASN A ND2 1 
ATOM   4546 N N   . GLN A 1 566 ? 24.855 32.484 66.883  1.00 8.55  ? 566  GLN A N   1 
ATOM   4547 C CA  . GLN A 1 566 ? 24.077 31.243 66.976  1.00 8.44  ? 566  GLN A CA  1 
ATOM   4548 C C   . GLN A 1 566 ? 22.568 31.362 66.848  1.00 8.44  ? 566  GLN A C   1 
ATOM   4549 O O   . GLN A 1 566 ? 21.928 30.511 66.231  1.00 8.84  ? 566  GLN A O   1 
ATOM   4550 C CB  . GLN A 1 566 ? 24.440 30.489 68.262  1.00 8.26  ? 566  GLN A CB  1 
ATOM   4551 C CG  . GLN A 1 566 ? 25.874 30.011 68.269  1.00 8.09  ? 566  GLN A CG  1 
ATOM   4552 C CD  . GLN A 1 566 ? 26.223 29.141 69.445  1.00 7.81  ? 566  GLN A CD  1 
ATOM   4553 O OE1 . GLN A 1 566 ? 25.434 28.978 70.380  1.00 8.25  ? 566  GLN A OE1 1 
ATOM   4554 N NE2 . GLN A 1 566 ? 27.418 28.580 69.414  1.00 7.66  ? 566  GLN A NE2 1 
ATOM   4555 N N   . ARG A 1 567 ? 22.001 32.400 67.446  1.00 9.07  ? 567  ARG A N   1 
ATOM   4556 C CA  . ARG A 1 567 ? 20.567 32.618 67.401  1.00 9.82  ? 567  ARG A CA  1 
ATOM   4557 C C   . ARG A 1 567 ? 20.253 34.081 67.109  1.00 9.53  ? 567  ARG A C   1 
ATOM   4558 O O   . ARG A 1 567 ? 19.624 34.768 67.920  1.00 8.51  ? 567  ARG A O   1 
ATOM   4559 C CB  . ARG A 1 567 ? 19.925 32.208 68.734  1.00 9.91  ? 567  ARG A CB  1 
ATOM   4560 C CG  . ARG A 1 567 ? 19.927 30.708 69.026  1.00 12.33 ? 567  ARG A CG  1 
ATOM   4561 C CD  . ARG A 1 567 ? 19.062 29.917 68.042  1.00 12.55 ? 567  ARG A CD  1 
ATOM   4562 N NE  . ARG A 1 567 ? 17.693 30.424 67.966  1.00 14.15 ? 567  ARG A NE  1 
ATOM   4563 C CZ  . ARG A 1 567 ? 16.709 30.099 68.799  1.00 14.99 ? 567  ARG A CZ  1 
ATOM   4564 N NH1 . ARG A 1 567 ? 16.919 29.250 69.792  1.00 16.45 ? 567  ARG A NH1 1 
ATOM   4565 N NH2 . ARG A 1 567 ? 15.514 30.653 68.649  1.00 14.77 ? 567  ARG A NH2 1 
ATOM   4566 N N   . PRO A 1 568 ? 20.628 34.564 65.912  1.00 9.45  ? 568  PRO A N   1 
ATOM   4567 C CA  . PRO A 1 568 ? 20.343 35.969 65.599  1.00 10.58 ? 568  PRO A CA  1 
ATOM   4568 C C   . PRO A 1 568 ? 18.853 36.312 65.621  1.00 10.81 ? 568  PRO A C   1 
ATOM   4569 O O   . PRO A 1 568 ? 18.480 37.462 65.870  1.00 11.44 ? 568  PRO A O   1 
ATOM   4570 C CB  . PRO A 1 568 ? 20.963 36.146 64.214  1.00 10.32 ? 568  PRO A CB  1 
ATOM   4571 C CG  . PRO A 1 568 ? 20.885 34.760 63.610  1.00 10.06 ? 568  PRO A CG  1 
ATOM   4572 C CD  . PRO A 1 568 ? 21.276 33.885 64.776  1.00 9.66  ? 568  PRO A CD  1 
ATOM   4573 N N   . ASP A 1 569 ? 18.021 35.289 65.434  1.00 11.84 ? 569  ASP A N   1 
ATOM   4574 C CA  . ASP A 1 569 ? 16.563 35.419 65.411  1.00 12.06 ? 569  ASP A CA  1 
ATOM   4575 C C   . ASP A 1 569 ? 15.940 35.645 66.786  1.00 12.36 ? 569  ASP A C   1 
ATOM   4576 O O   . ASP A 1 569 ? 14.755 35.975 66.907  1.00 11.92 ? 569  ASP A O   1 
ATOM   4577 C CB  . ASP A 1 569 ? 15.958 34.123 64.845  1.00 13.38 ? 569  ASP A CB  1 
ATOM   4578 C CG  . ASP A 1 569 ? 16.188 32.918 65.761  1.00 14.73 ? 569  ASP A CG  1 
ATOM   4579 O OD1 . ASP A 1 569 ? 17.359 32.567 66.005  1.00 14.04 ? 569  ASP A OD1 1 
ATOM   4580 O OD2 . ASP A 1 569 ? 15.196 32.335 66.254  1.00 16.54 ? 569  ASP A OD2 1 
ATOM   4581 N N   . LEU A 1 570 ? 16.731 35.410 67.820  1.00 11.36 ? 570  LEU A N   1 
ATOM   4582 C CA  . LEU A 1 570 ? 16.255 35.501 69.192  1.00 11.10 ? 570  LEU A CA  1 
ATOM   4583 C C   . LEU A 1 570 ? 16.401 36.861 69.872  1.00 10.08 ? 570  LEU A C   1 
ATOM   4584 O O   . LEU A 1 570 ? 15.719 37.139 70.860  1.00 10.11 ? 570  LEU A O   1 
ATOM   4585 C CB  . LEU A 1 570 ? 16.994 34.429 70.004  1.00 12.28 ? 570  LEU A CB  1 
ATOM   4586 C CG  . LEU A 1 570 ? 16.468 33.882 71.322  1.00 13.09 ? 570  LEU A CG  1 
ATOM   4587 C CD1 . LEU A 1 570 ? 15.011 33.473 71.175  1.00 14.34 ? 570  LEU A CD1 1 
ATOM   4588 C CD2 . LEU A 1 570 ? 17.317 32.671 71.715  1.00 13.15 ? 570  LEU A CD2 1 
ATOM   4589 N N   . PHE A 1 571 ? 17.251 37.717 69.312  1.00 9.14  ? 571  PHE A N   1 
ATOM   4590 C CA  . PHE A 1 571 ? 17.539 39.007 69.924  1.00 9.08  ? 571  PHE A CA  1 
ATOM   4591 C C   . PHE A 1 571 ? 17.333 40.184 68.999  1.00 8.92  ? 571  PHE A C   1 
ATOM   4592 O O   . PHE A 1 571 ? 17.565 40.086 67.809  1.00 10.66 ? 571  PHE A O   1 
ATOM   4593 C CB  . PHE A 1 571 ? 19.003 39.008 70.391  1.00 8.38  ? 571  PHE A CB  1 
ATOM   4594 C CG  . PHE A 1 571 ? 19.417 37.727 71.057  1.00 8.23  ? 571  PHE A CG  1 
ATOM   4595 C CD1 . PHE A 1 571 ? 20.240 36.817 70.403  1.00 8.41  ? 571  PHE A CD1 1 
ATOM   4596 C CD2 . PHE A 1 571 ? 18.941 37.411 72.317  1.00 7.74  ? 571  PHE A CD2 1 
ATOM   4597 C CE1 . PHE A 1 571 ? 20.576 35.610 70.998  1.00 8.89  ? 571  PHE A CE1 1 
ATOM   4598 C CE2 . PHE A 1 571 ? 19.273 36.210 72.921  1.00 8.35  ? 571  PHE A CE2 1 
ATOM   4599 C CZ  . PHE A 1 571 ? 20.089 35.305 72.266  1.00 8.43  ? 571  PHE A CZ  1 
ATOM   4600 N N   . GLY A 1 572 ? 16.915 41.304 69.576  1.00 8.74  ? 572  GLY A N   1 
ATOM   4601 C CA  . GLY A 1 572 ? 16.732 42.508 68.784  1.00 8.12  ? 572  GLY A CA  1 
ATOM   4602 C C   . GLY A 1 572 ? 17.972 43.385 68.872  1.00 8.20  ? 572  GLY A C   1 
ATOM   4603 O O   . GLY A 1 572 ? 18.353 44.051 67.904  1.00 8.27  ? 572  GLY A O   1 
ATOM   4604 N N   . CYS A 1 573 ? 18.647 43.313 70.013  1.00 8.13  ? 573  CYS A N   1 
ATOM   4605 C CA  . CYS A 1 573 ? 19.817 44.134 70.243  1.00 8.00  ? 573  CYS A CA  1 
ATOM   4606 C C   . CYS A 1 573 ? 20.823 43.394 71.113  1.00 7.54  ? 573  CYS A C   1 
ATOM   4607 O O   . CYS A 1 573 ? 20.451 42.631 72.012  1.00 7.81  ? 573  CYS A O   1 
ATOM   4608 C CB  . CYS A 1 573 ? 19.355 45.421 70.913  1.00 8.15  ? 573  CYS A CB  1 
ATOM   4609 S SG  . CYS A 1 573 ? 20.568 46.687 71.143  1.00 9.89  ? 573  CYS A SG  1 
ATOM   4610 N N   . VAL A 1 574 ? 22.100 43.616 70.827  1.00 7.53  ? 574  VAL A N   1 
ATOM   4611 C CA  . VAL A 1 574 ? 23.198 42.980 71.549  1.00 6.91  ? 574  VAL A CA  1 
ATOM   4612 C C   . VAL A 1 574 ? 24.262 44.023 71.866  1.00 7.03  ? 574  VAL A C   1 
ATOM   4613 O O   . VAL A 1 574 ? 24.709 44.757 70.981  1.00 7.19  ? 574  VAL A O   1 
ATOM   4614 C CB  . VAL A 1 574 ? 23.875 41.868 70.691  1.00 7.44  ? 574  VAL A CB  1 
ATOM   4615 C CG1 . VAL A 1 574 ? 25.053 41.243 71.437  1.00 8.34  ? 574  VAL A CG1 1 
ATOM   4616 C CG2 . VAL A 1 574 ? 22.856 40.812 70.290  1.00 7.50  ? 574  VAL A CG2 1 
ATOM   4617 N N   . ILE A 1 575 ? 24.619 44.134 73.138  1.00 7.40  ? 575  ILE A N   1 
ATOM   4618 C CA  . ILE A 1 575 ? 25.669 45.050 73.549  1.00 7.85  ? 575  ILE A CA  1 
ATOM   4619 C C   . ILE A 1 575 ? 26.740 44.203 74.213  1.00 6.71  ? 575  ILE A C   1 
ATOM   4620 O O   . ILE A 1 575 ? 26.525 43.644 75.288  1.00 6.76  ? 575  ILE A O   1 
ATOM   4621 C CB  . ILE A 1 575 ? 25.160 46.129 74.527  1.00 7.99  ? 575  ILE A CB  1 
ATOM   4622 C CG1 . ILE A 1 575 ? 24.085 46.976 73.850  1.00 9.73  ? 575  ILE A CG1 1 
ATOM   4623 C CG2 . ILE A 1 575 ? 26.315 47.040 74.968  1.00 8.90  ? 575  ILE A CG2 1 
ATOM   4624 C CD1 . ILE A 1 575 ? 23.478 48.017 74.752  1.00 10.93 ? 575  ILE A CD1 1 
ATOM   4625 N N   . ALA A 1 576 ? 27.880 44.075 73.549  1.00 5.95  ? 576  ALA A N   1 
ATOM   4626 C CA  . ALA A 1 576 ? 28.994 43.293 74.069  1.00 6.60  ? 576  ALA A CA  1 
ATOM   4627 C C   . ALA A 1 576 ? 30.099 44.236 74.525  1.00 6.89  ? 576  ALA A C   1 
ATOM   4628 O O   . ALA A 1 576 ? 30.711 44.950 73.722  1.00 6.90  ? 576  ALA A O   1 
ATOM   4629 C CB  . ALA A 1 576 ? 29.522 42.348 73.000  1.00 6.79  ? 576  ALA A CB  1 
ATOM   4630 N N   . GLN A 1 577 ? 30.370 44.217 75.820  1.00 6.82  ? 577  GLN A N   1 
ATOM   4631 C CA  . GLN A 1 577 ? 31.396 45.069 76.396  1.00 7.25  ? 577  GLN A CA  1 
ATOM   4632 C C   . GLN A 1 577 ? 32.704 44.320 76.602  1.00 6.63  ? 577  GLN A C   1 
ATOM   4633 O O   . GLN A 1 577 ? 32.704 43.192 77.089  1.00 6.58  ? 577  GLN A O   1 
ATOM   4634 C CB  . GLN A 1 577 ? 30.910 45.633 77.733  1.00 7.49  ? 577  GLN A CB  1 
ATOM   4635 C CG  . GLN A 1 577 ? 29.726 46.574 77.594  1.00 8.57  ? 577  GLN A CG  1 
ATOM   4636 C CD  . GLN A 1 577 ? 29.118 46.951 78.920  1.00 9.30  ? 577  GLN A CD  1 
ATOM   4637 O OE1 . GLN A 1 577 ? 28.181 46.318 79.374  1.00 10.84 ? 577  GLN A OE1 1 
ATOM   4638 N NE2 . GLN A 1 577 ? 29.651 47.985 79.551  1.00 11.18 ? 577  GLN A NE2 1 
ATOM   4639 N N   . VAL A 1 578 ? 33.805 44.953 76.205  1.00 6.83  ? 578  VAL A N   1 
ATOM   4640 C CA  . VAL A 1 578 ? 35.160 44.423 76.355  1.00 6.96  ? 578  VAL A CA  1 
ATOM   4641 C C   . VAL A 1 578 ? 35.245 42.896 76.262  1.00 6.40  ? 578  VAL A C   1 
ATOM   4642 O O   . VAL A 1 578 ? 35.854 42.235 77.111  1.00 7.13  ? 578  VAL A O   1 
ATOM   4643 C CB  . VAL A 1 578 ? 35.784 44.945 77.692  1.00 6.91  ? 578  VAL A CB  1 
ATOM   4644 C CG1 . VAL A 1 578 ? 35.901 46.461 77.649  1.00 7.50  ? 578  VAL A CG1 1 
ATOM   4645 C CG2 . VAL A 1 578 ? 34.931 44.561 78.913  1.00 6.81  ? 578  VAL A CG2 1 
ATOM   4646 N N   . GLY A 1 579 ? 34.649 42.355 75.203  1.00 6.74  ? 579  GLY A N   1 
ATOM   4647 C CA  . GLY A 1 579 ? 34.582 40.917 75.018  1.00 6.60  ? 579  GLY A CA  1 
ATOM   4648 C C   . GLY A 1 579 ? 35.727 40.203 74.341  1.00 7.42  ? 579  GLY A C   1 
ATOM   4649 O O   . GLY A 1 579 ? 36.450 40.767 73.531  1.00 6.27  ? 579  GLY A O   1 
ATOM   4650 N N   . VAL A 1 580 ? 35.893 38.938 74.702  1.00 7.86  ? 580  VAL A N   1 
ATOM   4651 C CA  . VAL A 1 580 ? 36.923 38.088 74.112  1.00 7.59  ? 580  VAL A CA  1 
ATOM   4652 C C   . VAL A 1 580 ? 36.253 37.505 72.857  1.00 7.55  ? 580  VAL A C   1 
ATOM   4653 O O   . VAL A 1 580 ? 35.306 36.728 72.952  1.00 8.01  ? 580  VAL A O   1 
ATOM   4654 C CB  . VAL A 1 580 ? 37.321 36.957 75.072  1.00 8.60  ? 580  VAL A CB  1 
ATOM   4655 C CG1 . VAL A 1 580 ? 38.459 36.155 74.476  1.00 8.91  ? 580  VAL A CG1 1 
ATOM   4656 C CG2 . VAL A 1 580 ? 37.720 37.532 76.419  1.00 8.99  ? 580  VAL A CG2 1 
ATOM   4657 N N   . MET A 1 581 ? 36.740 37.912 71.687  1.00 7.09  ? 581  MET A N   1 
ATOM   4658 C CA  . MET A 1 581 ? 36.145 37.488 70.419  1.00 6.30  ? 581  MET A CA  1 
ATOM   4659 C C   . MET A 1 581 ? 36.971 36.518 69.595  1.00 6.87  ? 581  MET A C   1 
ATOM   4660 O O   . MET A 1 581 ? 36.426 35.746 68.821  1.00 6.33  ? 581  MET A O   1 
ATOM   4661 C CB  . MET A 1 581 ? 35.795 38.717 69.568  1.00 6.36  ? 581  MET A CB  1 
ATOM   4662 C CG  . MET A 1 581 ? 35.024 39.790 70.304  1.00 7.48  ? 581  MET A CG  1 
ATOM   4663 S SD  . MET A 1 581 ? 33.515 39.149 71.044  1.00 8.59  ? 581  MET A SD  1 
ATOM   4664 C CE  . MET A 1 581 ? 32.737 40.672 71.545  1.00 7.30  ? 581  MET A CE  1 
ATOM   4665 N N   . ASP A 1 582 ? 38.287 36.621 69.674  1.00 7.25  ? 582  ASP A N   1 
ATOM   4666 C CA  . ASP A 1 582 ? 39.155 35.714 68.943  1.00 7.76  ? 582  ASP A CA  1 
ATOM   4667 C C   . ASP A 1 582 ? 39.560 34.597 69.901  1.00 7.79  ? 582  ASP A C   1 
ATOM   4668 O O   . ASP A 1 582 ? 40.533 34.730 70.644  1.00 7.90  ? 582  ASP A O   1 
ATOM   4669 C CB  . ASP A 1 582 ? 40.385 36.460 68.413  1.00 7.72  ? 582  ASP A CB  1 
ATOM   4670 C CG  . ASP A 1 582 ? 41.236 35.600 67.495  1.00 8.75  ? 582  ASP A CG  1 
ATOM   4671 O OD1 . ASP A 1 582 ? 41.166 34.357 67.592  1.00 8.35  ? 582  ASP A OD1 1 
ATOM   4672 O OD2 . ASP A 1 582 ? 41.976 36.175 66.667  1.00 8.96  ? 582  ASP A OD2 1 
ATOM   4673 N N   . MET A 1 583 ? 38.838 33.487 69.851  1.00 7.74  ? 583  MET A N   1 
ATOM   4674 C CA  . MET A 1 583 ? 39.150 32.380 70.740  1.00 7.74  ? 583  MET A CA  1 
ATOM   4675 C C   . MET A 1 583 ? 40.353 31.551 70.314  1.00 8.61  ? 583  MET A C   1 
ATOM   4676 O O   . MET A 1 583 ? 40.776 30.668 71.050  1.00 8.36  ? 583  MET A O   1 
ATOM   4677 C CB  . MET A 1 583 ? 37.927 31.485 70.952  1.00 7.81  ? 583  MET A CB  1 
ATOM   4678 C CG  . MET A 1 583 ? 36.720 32.212 71.498  1.00 9.59  ? 583  MET A CG  1 
ATOM   4679 S SD  . MET A 1 583 ? 37.048 33.040 73.052  1.00 9.36  ? 583  MET A SD  1 
ATOM   4680 C CE  . MET A 1 583 ? 37.296 31.636 74.124  1.00 9.33  ? 583  MET A CE  1 
ATOM   4681 N N   . LEU A 1 584 ? 40.880 31.827 69.125  1.00 8.52  ? 584  LEU A N   1 
ATOM   4682 C CA  . LEU A 1 584 ? 42.058 31.104 68.640  1.00 8.52  ? 584  LEU A CA  1 
ATOM   4683 C C   . LEU A 1 584 ? 43.358 31.806 69.040  1.00 8.94  ? 584  LEU A C   1 
ATOM   4684 O O   . LEU A 1 584 ? 44.403 31.172 69.143  1.00 10.13 ? 584  LEU A O   1 
ATOM   4685 C CB  . LEU A 1 584 ? 42.014 30.923 67.112  1.00 9.05  ? 584  LEU A CB  1 
ATOM   4686 C CG  . LEU A 1 584 ? 40.788 30.217 66.536  1.00 8.82  ? 584  LEU A CG  1 
ATOM   4687 C CD1 . LEU A 1 584 ? 40.920 30.085 65.026  1.00 8.92  ? 584  LEU A CD1 1 
ATOM   4688 C CD2 . LEU A 1 584 ? 40.614 28.846 67.188  1.00 9.70  ? 584  LEU A CD2 1 
ATOM   4689 N N   . LYS A 1 585 ? 43.294 33.105 69.312  1.00 8.35  ? 585  LYS A N   1 
ATOM   4690 C CA  . LYS A 1 585 ? 44.488 33.862 69.665  1.00 8.24  ? 585  LYS A CA  1 
ATOM   4691 C C   . LYS A 1 585 ? 44.473 34.556 71.027  1.00 7.73  ? 585  LYS A C   1 
ATOM   4692 O O   . LYS A 1 585 ? 45.466 35.170 71.405  1.00 8.17  ? 585  LYS A O   1 
ATOM   4693 C CB  . LYS A 1 585 ? 44.778 34.916 68.587  1.00 8.57  ? 585  LYS A CB  1 
ATOM   4694 C CG  . LYS A 1 585 ? 45.092 34.357 67.211  1.00 9.27  ? 585  LYS A CG  1 
ATOM   4695 C CD  . LYS A 1 585 ? 45.490 35.467 66.251  1.00 11.57 ? 585  LYS A CD  1 
ATOM   4696 C CE  . LYS A 1 585 ? 45.854 34.912 64.892  1.00 12.67 ? 585  LYS A CE  1 
ATOM   4697 N NZ  . LYS A 1 585 ? 46.257 35.992 63.957  1.00 12.20 ? 585  LYS A NZ  1 
ATOM   4698 N N   . PHE A 1 586 ? 43.397 34.404 71.800  1.00 7.85  ? 586  PHE A N   1 
ATOM   4699 C CA  . PHE A 1 586 ? 43.319 35.106 73.089  1.00 7.75  ? 586  PHE A CA  1 
ATOM   4700 C C   . PHE A 1 586 ? 44.516 34.912 74.025  1.00 7.73  ? 586  PHE A C   1 
ATOM   4701 O O   . PHE A 1 586 ? 44.905 35.830 74.748  1.00 8.23  ? 586  PHE A O   1 
ATOM   4702 C CB  . PHE A 1 586 ? 42.034 34.745 73.849  1.00 6.65  ? 586  PHE A CB  1 
ATOM   4703 C CG  . PHE A 1 586 ? 42.053 33.365 74.470  1.00 7.12  ? 586  PHE A CG  1 
ATOM   4704 C CD1 . PHE A 1 586 ? 42.631 33.147 75.723  1.00 8.02  ? 586  PHE A CD1 1 
ATOM   4705 C CD2 . PHE A 1 586 ? 41.508 32.279 73.796  1.00 8.00  ? 586  PHE A CD2 1 
ATOM   4706 C CE1 . PHE A 1 586 ? 42.677 31.870 76.277  1.00 7.63  ? 586  PHE A CE1 1 
ATOM   4707 C CE2 . PHE A 1 586 ? 41.550 30.999 74.346  1.00 7.50  ? 586  PHE A CE2 1 
ATOM   4708 C CZ  . PHE A 1 586 ? 42.135 30.800 75.589  1.00 7.89  ? 586  PHE A CZ  1 
ATOM   4709 N N   . HIS A 1 587 ? 45.106 33.721 73.993  1.00 8.82  ? 587  HIS A N   1 
ATOM   4710 C CA  . HIS A 1 587 ? 46.216 33.383 74.878  1.00 8.98  ? 587  HIS A CA  1 
ATOM   4711 C C   . HIS A 1 587 ? 47.528 34.091 74.583  1.00 9.43  ? 587  HIS A C   1 
ATOM   4712 O O   . HIS A 1 587 ? 48.441 34.067 75.395  1.00 9.97  ? 587  HIS A O   1 
ATOM   4713 C CB  . HIS A 1 587 ? 46.455 31.874 74.847  1.00 9.08  ? 587  HIS A CB  1 
ATOM   4714 C CG  . HIS A 1 587 ? 46.840 31.365 73.497  1.00 8.96  ? 587  HIS A CG  1 
ATOM   4715 N ND1 . HIS A 1 587 ? 45.913 31.166 72.494  1.00 10.09 ? 587  HIS A ND1 1 
ATOM   4716 C CD2 . HIS A 1 587 ? 48.048 31.066 72.970  1.00 9.61  ? 587  HIS A CD2 1 
ATOM   4717 C CE1 . HIS A 1 587 ? 46.536 30.775 71.406  1.00 10.25 ? 587  HIS A CE1 1 
ATOM   4718 N NE2 . HIS A 1 587 ? 47.832 30.706 71.663  1.00 10.09 ? 587  HIS A NE2 1 
ATOM   4719 N N   . LYS A 1 588 ? 47.621 34.711 73.417  1.00 8.55  ? 588  LYS A N   1 
ATOM   4720 C CA  . LYS A 1 588 ? 48.857 35.371 73.006  1.00 8.91  ? 588  LYS A CA  1 
ATOM   4721 C C   . LYS A 1 588 ? 49.114 36.741 73.618  1.00 9.42  ? 588  LYS A C   1 
ATOM   4722 O O   . LYS A 1 588 ? 50.261 37.200 73.665  1.00 10.10 ? 588  LYS A O   1 
ATOM   4723 C CB  . LYS A 1 588 ? 48.872 35.542 71.486  1.00 9.74  ? 588  LYS A CB  1 
ATOM   4724 C CG  . LYS A 1 588 ? 48.796 34.239 70.711  1.00 12.29 ? 588  LYS A CG  1 
ATOM   4725 C CD  . LYS A 1 588 ? 48.925 34.458 69.212  1.00 16.75 ? 588  LYS A CD  1 
ATOM   4726 C CE  . LYS A 1 588 ? 49.117 33.132 68.500  1.00 18.46 ? 588  LYS A CE  1 
ATOM   4727 N NZ  . LYS A 1 588 ? 49.394 33.293 67.050  1.00 20.40 ? 588  LYS A NZ  1 
ATOM   4728 N N   . TYR A 1 589 ? 48.060 37.380 74.112  1.00 8.60  ? 589  TYR A N   1 
ATOM   4729 C CA  . TYR A 1 589 ? 48.180 38.737 74.626  1.00 8.88  ? 589  TYR A CA  1 
ATOM   4730 C C   . TYR A 1 589 ? 48.061 38.908 76.127  1.00 7.61  ? 589  TYR A C   1 
ATOM   4731 O O   . TYR A 1 589 ? 47.319 38.187 76.791  1.00 7.96  ? 589  TYR A O   1 
ATOM   4732 C CB  . TYR A 1 589 ? 47.155 39.610 73.898  1.00 8.04  ? 589  TYR A CB  1 
ATOM   4733 C CG  . TYR A 1 589 ? 47.098 39.326 72.412  1.00 8.54  ? 589  TYR A CG  1 
ATOM   4734 C CD1 . TYR A 1 589 ? 45.998 38.681 71.843  1.00 8.51  ? 589  TYR A CD1 1 
ATOM   4735 C CD2 . TYR A 1 589 ? 48.170 39.648 71.583  1.00 8.46  ? 589  TYR A CD2 1 
ATOM   4736 C CE1 . TYR A 1 589 ? 45.976 38.357 70.487  1.00 9.88  ? 589  TYR A CE1 1 
ATOM   4737 C CE2 . TYR A 1 589 ? 48.159 39.330 70.227  1.00 9.42  ? 589  TYR A CE2 1 
ATOM   4738 C CZ  . TYR A 1 589 ? 47.058 38.682 69.691  1.00 9.26  ? 589  TYR A CZ  1 
ATOM   4739 O OH  . TYR A 1 589 ? 47.028 38.331 68.359  1.00 11.73 ? 589  TYR A OH  1 
ATOM   4740 N N   . THR A 1 590 ? 48.775 39.908 76.634  1.00 7.58  ? 590  THR A N   1 
ATOM   4741 C CA  . THR A 1 590 ? 48.810 40.260 78.046  1.00 7.62  ? 590  THR A CA  1 
ATOM   4742 C C   . THR A 1 590 ? 48.608 39.081 79.018  1.00 7.85  ? 590  THR A C   1 
ATOM   4743 O O   . THR A 1 590 ? 49.458 38.184 79.095  1.00 7.88  ? 590  THR A O   1 
ATOM   4744 C CB  . THR A 1 590 ? 47.854 41.460 78.356  1.00 7.15  ? 590  THR A CB  1 
ATOM   4745 O OG1 . THR A 1 590 ? 46.486 41.088 78.136  1.00 6.99  ? 590  THR A OG1 1 
ATOM   4746 C CG2 . THR A 1 590 ? 48.187 42.654 77.472  1.00 7.81  ? 590  THR A CG2 1 
ATOM   4747 N N   . ILE A 1 591 ? 47.476 39.050 79.716  1.00 7.52  ? 591  ILE A N   1 
ATOM   4748 C CA  . ILE A 1 591 ? 47.186 38.000 80.693  1.00 7.68  ? 591  ILE A CA  1 
ATOM   4749 C C   . ILE A 1 591 ? 46.232 36.919 80.163  1.00 7.58  ? 591  ILE A C   1 
ATOM   4750 O O   . ILE A 1 591 ? 45.817 36.029 80.903  1.00 8.15  ? 591  ILE A O   1 
ATOM   4751 C CB  . ILE A 1 591 ? 46.627 38.651 81.990  1.00 7.61  ? 591  ILE A CB  1 
ATOM   4752 C CG1 . ILE A 1 591 ? 46.717 37.698 83.191  1.00 8.17  ? 591  ILE A CG1 1 
ATOM   4753 C CG2 . ILE A 1 591 ? 45.178 39.101 81.768  1.00 7.76  ? 591  ILE A CG2 1 
ATOM   4754 C CD1 . ILE A 1 591 ? 48.132 37.185 83.496  1.00 9.66  ? 591  ILE A CD1 1 
ATOM   4755 N N   . GLY A 1 592 ? 45.947 36.967 78.869  1.00 7.97  ? 592  GLY A N   1 
ATOM   4756 C CA  . GLY A 1 592 ? 45.047 36.002 78.257  1.00 8.36  ? 592  GLY A CA  1 
ATOM   4757 C C   . GLY A 1 592 ? 45.446 34.545 78.419  1.00 8.03  ? 592  GLY A C   1 
ATOM   4758 O O   . GLY A 1 592 ? 44.592 33.654 78.369  1.00 8.36  ? 592  GLY A O   1 
ATOM   4759 N N   . HIS A 1 593 ? 46.733 34.287 78.643  1.00 8.22  ? 593  HIS A N   1 
ATOM   4760 C CA  . HIS A 1 593 ? 47.197 32.917 78.829  1.00 8.84  ? 593  HIS A CA  1 
ATOM   4761 C C   . HIS A 1 593 ? 46.510 32.267 80.033  1.00 8.67  ? 593  HIS A C   1 
ATOM   4762 O O   . HIS A 1 593 ? 46.389 31.051 80.104  1.00 9.41  ? 593  HIS A O   1 
ATOM   4763 C CB  . HIS A 1 593 ? 48.732 32.862 78.970  1.00 9.31  ? 593  HIS A CB  1 
ATOM   4764 C CG  . HIS A 1 593 ? 49.262 33.493 80.222  1.00 8.98  ? 593  HIS A CG  1 
ATOM   4765 N ND1 . HIS A 1 593 ? 49.982 34.671 80.225  1.00 10.29 ? 593  HIS A ND1 1 
ATOM   4766 C CD2 . HIS A 1 593 ? 49.210 33.080 81.510  1.00 8.25  ? 593  HIS A CD2 1 
ATOM   4767 C CE1 . HIS A 1 593 ? 50.344 34.954 81.462  1.00 8.59  ? 593  HIS A CE1 1 
ATOM   4768 N NE2 . HIS A 1 593 ? 49.887 34.002 82.258  1.00 10.11 ? 593  HIS A NE2 1 
ATOM   4769 N N   . ALA A 1 594 ? 46.049 33.092 80.969  1.00 8.73  ? 594  ALA A N   1 
ATOM   4770 C CA  . ALA A 1 594 ? 45.403 32.595 82.176  1.00 8.44  ? 594  ALA A CA  1 
ATOM   4771 C C   . ALA A 1 594 ? 44.010 32.030 81.957  1.00 8.46  ? 594  ALA A C   1 
ATOM   4772 O O   . ALA A 1 594 ? 43.546 31.219 82.758  1.00 9.06  ? 594  ALA A O   1 
ATOM   4773 C CB  . ALA A 1 594 ? 45.361 33.699 83.235  1.00 8.65  ? 594  ALA A CB  1 
ATOM   4774 N N   . TRP A 1 595 ? 43.360 32.413 80.865  1.00 8.50  ? 595  TRP A N   1 
ATOM   4775 C CA  . TRP A 1 595 ? 41.995 31.963 80.609  1.00 8.13  ? 595  TRP A CA  1 
ATOM   4776 C C   . TRP A 1 595 ? 41.866 30.562 80.023  1.00 8.29  ? 595  TRP A C   1 
ATOM   4777 O O   . TRP A 1 595 ? 40.751 30.043 79.896  1.00 7.84  ? 595  TRP A O   1 
ATOM   4778 C CB  . TRP A 1 595 ? 41.254 32.964 79.701  1.00 7.62  ? 595  TRP A CB  1 
ATOM   4779 C CG  . TRP A 1 595 ? 41.422 34.414 80.103  1.00 7.93  ? 595  TRP A CG  1 
ATOM   4780 C CD1 . TRP A 1 595 ? 41.653 34.900 81.369  1.00 7.99  ? 595  TRP A CD1 1 
ATOM   4781 C CD2 . TRP A 1 595 ? 41.484 35.543 79.225  1.00 7.75  ? 595  TRP A CD2 1 
ATOM   4782 N NE1 . TRP A 1 595 ? 41.873 36.261 81.313  1.00 7.82  ? 595  TRP A NE1 1 
ATOM   4783 C CE2 . TRP A 1 595 ? 41.782 36.679 80.014  1.00 7.70  ? 595  TRP A CE2 1 
ATOM   4784 C CE3 . TRP A 1 595 ? 41.335 35.703 77.841  1.00 7.76  ? 595  TRP A CE3 1 
ATOM   4785 C CZ2 . TRP A 1 595 ? 41.927 37.952 79.470  1.00 6.89  ? 595  TRP A CZ2 1 
ATOM   4786 C CZ3 . TRP A 1 595 ? 41.481 36.977 77.301  1.00 7.72  ? 595  TRP A CZ3 1 
ATOM   4787 C CH2 . TRP A 1 595 ? 41.778 38.083 78.118  1.00 7.60  ? 595  TRP A CH2 1 
ATOM   4788 N N   . THR A 1 596 ? 42.983 29.927 79.688  1.00 8.44  ? 596  THR A N   1 
ATOM   4789 C CA  . THR A 1 596 ? 42.930 28.600 79.094  1.00 8.59  ? 596  THR A CA  1 
ATOM   4790 C C   . THR A 1 596 ? 42.287 27.551 79.994  1.00 8.62  ? 596  THR A C   1 
ATOM   4791 O O   . THR A 1 596 ? 41.819 26.531 79.511  1.00 8.03  ? 596  THR A O   1 
ATOM   4792 C CB  . THR A 1 596 ? 44.313 28.103 78.669  1.00 8.68  ? 596  THR A CB  1 
ATOM   4793 O OG1 . THR A 1 596 ? 45.171 28.071 79.804  1.00 9.76  ? 596  THR A OG1 1 
ATOM   4794 C CG2 . THR A 1 596 ? 44.911 29.013 77.621  1.00 8.99  ? 596  THR A CG2 1 
ATOM   4795 N N   . THR A 1 597 ? 42.214 27.827 81.293  1.00 8.44  ? 597  THR A N   1 
ATOM   4796 C CA  . THR A 1 597 ? 41.600 26.889 82.222  1.00 8.39  ? 597  THR A CA  1 
ATOM   4797 C C   . THR A 1 597 ? 40.085 26.823 82.021  1.00 7.64  ? 597  THR A C   1 
ATOM   4798 O O   . THR A 1 597 ? 39.453 25.831 82.377  1.00 8.74  ? 597  THR A O   1 
ATOM   4799 C CB  . THR A 1 597 ? 41.949 27.227 83.667  1.00 9.30  ? 597  THR A CB  1 
ATOM   4800 O OG1 . THR A 1 597 ? 41.683 28.612 83.910  1.00 9.31  ? 597  THR A OG1 1 
ATOM   4801 C CG2 . THR A 1 597 ? 43.413 26.935 83.943  1.00 9.79  ? 597  THR A CG2 1 
ATOM   4802 N N   . ASP A 1 598 ? 39.491 27.904 81.516  1.00 7.42  ? 598  ASP A N   1 
ATOM   4803 C CA  . ASP A 1 598 ? 38.055 27.915 81.226  1.00 7.00  ? 598  ASP A CA  1 
ATOM   4804 C C   . ASP A 1 598 ? 37.782 27.580 79.759  1.00 7.81  ? 598  ASP A C   1 
ATOM   4805 O O   . ASP A 1 598 ? 36.813 26.902 79.447  1.00 8.22  ? 598  ASP A O   1 
ATOM   4806 C CB  . ASP A 1 598 ? 37.433 29.295 81.497  1.00 7.44  ? 598  ASP A CB  1 
ATOM   4807 C CG  . ASP A 1 598 ? 36.598 29.335 82.772  1.00 6.17  ? 598  ASP A CG  1 
ATOM   4808 O OD1 . ASP A 1 598 ? 37.045 28.807 83.811  1.00 6.89  ? 598  ASP A OD1 1 
ATOM   4809 O OD2 . ASP A 1 598 ? 35.483 29.912 82.735  1.00 6.53  ? 598  ASP A OD2 1 
ATOM   4810 N N   . TYR A 1 599 ? 38.650 28.049 78.863  1.00 7.83  ? 599  TYR A N   1 
ATOM   4811 C CA  . TYR A 1 599 ? 38.429 27.871 77.429  1.00 7.59  ? 599  TYR A CA  1 
ATOM   4812 C C   . TYR A 1 599 ? 39.162 26.774 76.683  1.00 8.13  ? 599  TYR A C   1 
ATOM   4813 O O   . TYR A 1 599 ? 38.642 26.238 75.708  1.00 7.69  ? 599  TYR A O   1 
ATOM   4814 C CB  . TYR A 1 599 ? 38.764 29.173 76.693  1.00 7.50  ? 599  TYR A CB  1 
ATOM   4815 C CG  . TYR A 1 599 ? 38.099 30.420 77.224  1.00 8.16  ? 599  TYR A CG  1 
ATOM   4816 C CD1 . TYR A 1 599 ? 38.815 31.607 77.323  1.00 7.92  ? 599  TYR A CD1 1 
ATOM   4817 C CD2 . TYR A 1 599 ? 36.749 30.427 77.567  1.00 8.81  ? 599  TYR A CD2 1 
ATOM   4818 C CE1 . TYR A 1 599 ? 38.206 32.772 77.740  1.00 8.72  ? 599  TYR A CE1 1 
ATOM   4819 C CE2 . TYR A 1 599 ? 36.118 31.599 77.994  1.00 8.42  ? 599  TYR A CE2 1 
ATOM   4820 C CZ  . TYR A 1 599 ? 36.877 32.764 78.066  1.00 8.57  ? 599  TYR A CZ  1 
ATOM   4821 O OH  . TYR A 1 599 ? 36.359 33.971 78.439  1.00 8.33  ? 599  TYR A OH  1 
ATOM   4822 N N   . GLY A 1 600 ? 40.376 26.478 77.127  1.00 8.51  ? 600  GLY A N   1 
ATOM   4823 C CA  . GLY A 1 600 ? 41.241 25.538 76.436  1.00 9.67  ? 600  GLY A CA  1 
ATOM   4824 C C   . GLY A 1 600 ? 42.213 26.414 75.642  1.00 10.89 ? 600  GLY A C   1 
ATOM   4825 O O   . GLY A 1 600 ? 42.160 27.638 75.751  1.00 11.36 ? 600  GLY A O   1 
HETATM 4826 N N   . CSD A 1 601 ? 43.146 25.816 74.905  1.00 12.56 ? 601  CSD A N   1 
HETATM 4827 C CA  . CSD A 1 601 ? 44.092 26.589 74.087  1.00 14.00 ? 601  CSD A CA  1 
HETATM 4828 C CB  . CSD A 1 601 ? 45.513 26.635 74.699  1.00 17.01 ? 601  CSD A CB  1 
HETATM 4829 S SG  . CSD A 1 601 ? 46.638 27.948 74.049  1.00 19.74 ? 601  CSD A SG  1 
HETATM 4830 C C   . CSD A 1 601 ? 44.101 25.914 72.714  1.00 14.00 ? 601  CSD A C   1 
HETATM 4831 O O   . CSD A 1 601 ? 44.142 24.682 72.617  1.00 13.32 ? 601  CSD A O   1 
HETATM 4832 O OD1 . CSD A 1 601 ? 47.333 27.379 72.900  1.00 19.92 ? 601  CSD A OD1 1 
HETATM 4833 O OD2 . CSD A 1 601 ? 47.548 28.306 75.131  1.00 22.36 ? 601  CSD A OD2 1 
ATOM   4834 N N   . SER A 1 602 ? 44.047 26.726 71.663  1.00 13.24 ? 602  SER A N   1 
ATOM   4835 C CA  . SER A 1 602 ? 43.996 26.250 70.285  1.00 13.54 ? 602  SER A CA  1 
ATOM   4836 C C   . SER A 1 602 ? 45.176 25.417 69.792  1.00 14.10 ? 602  SER A C   1 
ATOM   4837 O O   . SER A 1 602 ? 45.113 24.857 68.699  1.00 14.42 ? 602  SER A O   1 
ATOM   4838 C CB  . SER A 1 602 ? 43.733 27.421 69.332  1.00 13.13 ? 602  SER A CB  1 
ATOM   4839 O OG  . SER A 1 602 ? 44.764 28.382 69.427  1.00 12.85 ? 602  SER A OG  1 
ATOM   4840 N N   . ASP A 1 603 ? 46.240 25.329 70.589  1.00 15.29 ? 603  ASP A N   1 
ATOM   4841 C CA  . ASP A 1 603 ? 47.401 24.521 70.213  1.00 16.57 ? 603  ASP A CA  1 
ATOM   4842 C C   . ASP A 1 603 ? 47.038 23.035 70.225  1.00 17.03 ? 603  ASP A C   1 
ATOM   4843 O O   . ASP A 1 603 ? 47.689 22.219 69.576  1.00 17.25 ? 603  ASP A O   1 
ATOM   4844 C CB  . ASP A 1 603 ? 48.579 24.762 71.162  1.00 18.25 ? 603  ASP A CB  1 
ATOM   4845 C CG  . ASP A 1 603 ? 49.297 26.077 70.902  1.00 19.42 ? 603  ASP A CG  1 
ATOM   4846 O OD1 . ASP A 1 603 ? 49.077 26.699 69.844  1.00 20.72 ? 603  ASP A OD1 1 
ATOM   4847 O OD2 . ASP A 1 603 ? 50.105 26.481 71.766  1.00 21.32 ? 603  ASP A OD2 1 
ATOM   4848 N N   . SER A 1 604 ? 46.006 22.693 70.987  1.00 17.28 ? 604  SER A N   1 
ATOM   4849 C CA  . SER A 1 604 ? 45.518 21.322 71.076  1.00 17.21 ? 604  SER A CA  1 
ATOM   4850 C C   . SER A 1 604 ? 44.427 21.125 70.029  1.00 17.53 ? 604  SER A C   1 
ATOM   4851 O O   . SER A 1 604 ? 43.547 21.973 69.888  1.00 16.65 ? 604  SER A O   1 
ATOM   4852 C CB  . SER A 1 604 ? 44.945 21.060 72.473  1.00 17.76 ? 604  SER A CB  1 
ATOM   4853 O OG  . SER A 1 604 ? 44.079 19.935 72.477  1.00 19.02 ? 604  SER A OG  1 
ATOM   4854 N N   . LYS A 1 605 ? 44.472 20.010 69.301  1.00 17.51 ? 605  LYS A N   1 
ATOM   4855 C CA  . LYS A 1 605 ? 43.465 19.736 68.286  1.00 18.19 ? 605  LYS A CA  1 
ATOM   4856 C C   . LYS A 1 605 ? 42.087 19.582 68.921  1.00 17.40 ? 605  LYS A C   1 
ATOM   4857 O O   . LYS A 1 605 ? 41.104 20.098 68.402  1.00 17.49 ? 605  LYS A O   1 
ATOM   4858 C CB  . LYS A 1 605 ? 43.818 18.486 67.477  1.00 20.25 ? 605  LYS A CB  1 
ATOM   4859 C CG  . LYS A 1 605 ? 42.916 18.292 66.278  1.00 22.10 ? 605  LYS A CG  1 
ATOM   4860 C CD  . LYS A 1 605 ? 43.405 17.200 65.354  1.00 24.09 ? 605  LYS A CD  1 
ATOM   4861 C CE  . LYS A 1 605 ? 42.680 17.290 64.028  1.00 25.41 ? 605  LYS A CE  1 
ATOM   4862 N NZ  . LYS A 1 605 ? 41.213 17.087 64.190  1.00 26.47 ? 605  LYS A NZ  1 
ATOM   4863 N N   . GLN A 1 606 ? 42.030 18.890 70.055  1.00 17.15 ? 606  GLN A N   1 
ATOM   4864 C CA  . GLN A 1 606 ? 40.772 18.684 70.764  1.00 15.64 ? 606  GLN A CA  1 
ATOM   4865 C C   . GLN A 1 606 ? 40.188 20.033 71.183  1.00 14.45 ? 606  GLN A C   1 
ATOM   4866 O O   . GLN A 1 606 ? 39.004 20.289 70.985  1.00 14.09 ? 606  GLN A O   1 
ATOM   4867 C CB  . GLN A 1 606 ? 40.979 17.813 72.005  1.00 15.91 ? 606  GLN A CB  1 
ATOM   4868 C CG  . GLN A 1 606 ? 39.691 17.495 72.751  1.00 16.41 ? 606  GLN A CG  1 
ATOM   4869 C CD  . GLN A 1 606 ? 39.915 16.964 74.155  1.00 16.92 ? 606  GLN A CD  1 
ATOM   4870 O OE1 . GLN A 1 606 ? 40.988 17.139 74.745  1.00 17.35 ? 606  GLN A OE1 1 
ATOM   4871 N NE2 . GLN A 1 606 ? 38.877 16.367 74.724  1.00 16.97 ? 606  GLN A NE2 1 
ATOM   4872 N N   . HIS A 1 607 ? 41.024 20.892 71.759  1.00 13.26 ? 607  HIS A N   1 
ATOM   4873 C CA  . HIS A 1 607 ? 40.557 22.207 72.194  1.00 12.60 ? 607  HIS A CA  1 
ATOM   4874 C C   . HIS A 1 607 ? 40.149 23.062 71.009  1.00 11.91 ? 607  HIS A C   1 
ATOM   4875 O O   . HIS A 1 607 ? 39.114 23.712 71.049  1.00 11.37 ? 607  HIS A O   1 
ATOM   4876 C CB  . HIS A 1 607 ? 41.625 22.921 73.016  1.00 12.58 ? 607  HIS A CB  1 
ATOM   4877 C CG  . HIS A 1 607 ? 41.975 22.203 74.280  1.00 12.22 ? 607  HIS A CG  1 
ATOM   4878 N ND1 . HIS A 1 607 ? 42.743 22.774 75.273  1.00 12.25 ? 607  HIS A ND1 1 
ATOM   4879 C CD2 . HIS A 1 607 ? 41.648 20.965 74.716  1.00 13.36 ? 607  HIS A CD2 1 
ATOM   4880 C CE1 . HIS A 1 607 ? 42.867 21.921 76.269  1.00 13.35 ? 607  HIS A CE1 1 
ATOM   4881 N NE2 . HIS A 1 607 ? 42.213 20.817 75.955  1.00 13.07 ? 607  HIS A NE2 1 
ATOM   4882 N N   . PHE A 1 608 ? 40.942 23.013 69.946  1.00 11.71 ? 608  PHE A N   1 
ATOM   4883 C CA  . PHE A 1 608 ? 40.646 23.776 68.747  1.00 11.49 ? 608  PHE A CA  1 
ATOM   4884 C C   . PHE A 1 608 ? 39.257 23.412 68.242  1.00 11.87 ? 608  PHE A C   1 
ATOM   4885 O O   . PHE A 1 608 ? 38.486 24.284 67.853  1.00 12.26 ? 608  PHE A O   1 
ATOM   4886 C CB  . PHE A 1 608 ? 41.671 23.490 67.642  1.00 11.76 ? 608  PHE A CB  1 
ATOM   4887 C CG  . PHE A 1 608 ? 41.295 24.086 66.320  1.00 11.57 ? 608  PHE A CG  1 
ATOM   4888 C CD1 . PHE A 1 608 ? 41.523 25.434 66.057  1.00 11.39 ? 608  PHE A CD1 1 
ATOM   4889 C CD2 . PHE A 1 608 ? 40.648 23.319 65.361  1.00 12.62 ? 608  PHE A CD2 1 
ATOM   4890 C CE1 . PHE A 1 608 ? 41.114 26.005 64.861  1.00 12.82 ? 608  PHE A CE1 1 
ATOM   4891 C CE2 . PHE A 1 608 ? 40.235 23.882 64.161  1.00 12.74 ? 608  PHE A CE2 1 
ATOM   4892 C CZ  . PHE A 1 608 ? 40.465 25.228 63.912  1.00 13.47 ? 608  PHE A CZ  1 
ATOM   4893 N N   . GLU A 1 609 ? 38.936 22.120 68.261  1.00 12.45 ? 609  GLU A N   1 
ATOM   4894 C CA  . GLU A 1 609 ? 37.637 21.671 67.786  1.00 12.70 ? 609  GLU A CA  1 
ATOM   4895 C C   . GLU A 1 609 ? 36.475 22.242 68.600  1.00 12.05 ? 609  GLU A C   1 
ATOM   4896 O O   . GLU A 1 609 ? 35.388 22.441 68.066  1.00 12.89 ? 609  GLU A O   1 
ATOM   4897 C CB  . GLU A 1 609 ? 37.574 20.144 67.707  1.00 14.36 ? 609  GLU A CB  1 
ATOM   4898 C CG  . GLU A 1 609 ? 38.636 19.521 66.793  1.00 17.47 ? 609  GLU A CG  1 
ATOM   4899 C CD  . GLU A 1 609 ? 38.631 20.070 65.370  1.00 19.19 ? 609  GLU A CD  1 
ATOM   4900 O OE1 . GLU A 1 609 ? 39.715 20.121 64.751  1.00 20.84 ? 609  GLU A OE1 1 
ATOM   4901 O OE2 . GLU A 1 609 ? 37.553 20.438 64.859  1.00 20.94 ? 609  GLU A OE2 1 
ATOM   4902 N N   . TRP A 1 610 ? 36.706 22.500 69.884  1.00 11.49 ? 610  TRP A N   1 
ATOM   4903 C CA  . TRP A 1 610 ? 35.664 23.110 70.721  1.00 10.75 ? 610  TRP A CA  1 
ATOM   4904 C C   . TRP A 1 610 ? 35.558 24.583 70.354  1.00 10.47 ? 610  TRP A C   1 
ATOM   4905 O O   . TRP A 1 610 ? 34.479 25.093 70.066  1.00 10.41 ? 610  TRP A O   1 
ATOM   4906 C CB  . TRP A 1 610 ? 36.034 23.123 72.210  1.00 11.67 ? 610  TRP A CB  1 
ATOM   4907 C CG  . TRP A 1 610 ? 36.371 21.853 72.870  1.00 12.07 ? 610  TRP A CG  1 
ATOM   4908 C CD1 . TRP A 1 610 ? 35.909 20.608 72.562  1.00 12.64 ? 610  TRP A CD1 1 
ATOM   4909 C CD2 . TRP A 1 610 ? 37.226 21.701 73.999  1.00 11.37 ? 610  TRP A CD2 1 
ATOM   4910 N NE1 . TRP A 1 610 ? 36.430 19.686 73.440  1.00 12.33 ? 610  TRP A NE1 1 
ATOM   4911 C CE2 . TRP A 1 610 ? 37.246 20.331 74.334  1.00 11.88 ? 610  TRP A CE2 1 
ATOM   4912 C CE3 . TRP A 1 610 ? 37.981 22.596 74.771  1.00 11.17 ? 610  TRP A CE3 1 
ATOM   4913 C CZ2 . TRP A 1 610 ? 37.988 19.828 75.405  1.00 12.30 ? 610  TRP A CZ2 1 
ATOM   4914 C CZ3 . TRP A 1 610 ? 38.719 22.101 75.836  1.00 11.46 ? 610  TRP A CZ3 1 
ATOM   4915 C CH2 . TRP A 1 610 ? 38.717 20.725 76.146  1.00 11.58 ? 610  TRP A CH2 1 
ATOM   4916 N N   . LEU A 1 611 ? 36.706 25.250 70.421  1.00 9.93  ? 611  LEU A N   1 
ATOM   4917 C CA  . LEU A 1 611 ? 36.827 26.679 70.168  1.00 9.48  ? 611  LEU A CA  1 
ATOM   4918 C C   . LEU A 1 611 ? 36.308 27.179 68.830  1.00 9.37  ? 611  LEU A C   1 
ATOM   4919 O O   . LEU A 1 611 ? 35.584 28.177 68.779  1.00 9.19  ? 611  LEU A O   1 
ATOM   4920 C CB  . LEU A 1 611 ? 38.285 27.101 70.342  1.00 9.47  ? 611  LEU A CB  1 
ATOM   4921 C CG  . LEU A 1 611 ? 38.853 26.928 71.749  1.00 10.08 ? 611  LEU A CG  1 
ATOM   4922 C CD1 . LEU A 1 611 ? 40.357 27.004 71.712  1.00 10.66 ? 611  LEU A CD1 1 
ATOM   4923 C CD2 . LEU A 1 611 ? 38.292 27.982 72.697  1.00 10.04 ? 611  LEU A CD2 1 
ATOM   4924 N N   . ILE A 1 612 ? 36.654 26.474 67.758  1.00 9.00  ? 612  ILE A N   1 
ATOM   4925 C CA  . ILE A 1 612 ? 36.250 26.891 66.425  1.00 9.51  ? 612  ILE A CA  1 
ATOM   4926 C C   . ILE A 1 612 ? 34.738 26.918 66.240  1.00 9.48  ? 612  ILE A C   1 
ATOM   4927 O O   . ILE A 1 612 ? 34.225 27.704 65.441  1.00 10.07 ? 612  ILE A O   1 
ATOM   4928 C CB  . ILE A 1 612 ? 36.940 26.032 65.323  1.00 9.77  ? 612  ILE A CB  1 
ATOM   4929 C CG1 . ILE A 1 612 ? 36.865 26.737 63.968  1.00 11.74 ? 612  ILE A CG1 1 
ATOM   4930 C CG2 . ILE A 1 612 ? 36.287 24.659 65.218  1.00 10.60 ? 612  ILE A CG2 1 
ATOM   4931 C CD1 . ILE A 1 612 ? 37.692 28.006 63.889  1.00 11.45 ? 612  ILE A CD1 1 
ATOM   4932 N N   . LYS A 1 613 ? 34.026 26.097 67.007  1.00 9.12  ? 613  LYS A N   1 
ATOM   4933 C CA  . LYS A 1 613 ? 32.571 26.038 66.893  1.00 8.95  ? 613  LYS A CA  1 
ATOM   4934 C C   . LYS A 1 613 ? 31.818 27.250 67.447  1.00 8.33  ? 613  LYS A C   1 
ATOM   4935 O O   . LYS A 1 613 ? 30.716 27.553 66.992  1.00 8.89  ? 613  LYS A O   1 
ATOM   4936 C CB  . LYS A 1 613 ? 32.021 24.769 67.551  1.00 9.50  ? 613  LYS A CB  1 
ATOM   4937 C CG  . LYS A 1 613 ? 32.380 23.481 66.843  1.00 11.57 ? 613  LYS A CG  1 
ATOM   4938 C CD  . LYS A 1 613 ? 31.733 22.293 67.530  1.00 14.05 ? 613  LYS A CD  1 
ATOM   4939 C CE  . LYS A 1 613 ? 31.977 21.012 66.759  1.00 15.79 ? 613  LYS A CE  1 
ATOM   4940 N NZ  . LYS A 1 613 ? 31.184 19.892 67.322  1.00 17.48 ? 613  LYS A NZ  1 
ATOM   4941 N N   . TYR A 1 614 ? 32.426 27.960 68.395  1.00 7.12  ? 614  TYR A N   1 
ATOM   4942 C CA  . TYR A 1 614 ? 31.759 29.099 69.000  1.00 7.55  ? 614  TYR A CA  1 
ATOM   4943 C C   . TYR A 1 614 ? 32.513 30.425 68.968  1.00 7.31  ? 614  TYR A C   1 
ATOM   4944 O O   . TYR A 1 614 ? 31.934 31.459 69.297  1.00 7.18  ? 614  TYR A O   1 
ATOM   4945 C CB  . TYR A 1 614 ? 31.344 28.768 70.438  1.00 7.59  ? 614  TYR A CB  1 
ATOM   4946 C CG  . TYR A 1 614 ? 32.475 28.675 71.451  1.00 6.80  ? 614  TYR A CG  1 
ATOM   4947 C CD1 . TYR A 1 614 ? 33.039 29.828 72.012  1.00 7.12  ? 614  TYR A CD1 1 
ATOM   4948 C CD2 . TYR A 1 614 ? 32.937 27.432 71.904  1.00 6.72  ? 614  TYR A CD2 1 
ATOM   4949 C CE1 . TYR A 1 614 ? 34.013 29.743 72.996  1.00 7.69  ? 614  TYR A CE1 1 
ATOM   4950 C CE2 . TYR A 1 614 ? 33.916 27.341 72.884  1.00 7.69  ? 614  TYR A CE2 1 
ATOM   4951 C CZ  . TYR A 1 614 ? 34.440 28.504 73.427  1.00 7.70  ? 614  TYR A CZ  1 
ATOM   4952 O OH  . TYR A 1 614 ? 35.357 28.494 74.447  1.00 8.19  ? 614  TYR A OH  1 
ATOM   4953 N N   . SER A 1 615 ? 33.795 30.403 68.617  1.00 7.00  ? 615  SER A N   1 
ATOM   4954 C CA  . SER A 1 615 ? 34.583 31.638 68.561  1.00 7.02  ? 615  SER A CA  1 
ATOM   4955 C C   . SER A 1 615 ? 33.811 32.694 67.778  1.00 7.19  ? 615  SER A C   1 
ATOM   4956 O O   . SER A 1 615 ? 33.582 32.522 66.588  1.00 7.50  ? 615  SER A O   1 
ATOM   4957 C CB  . SER A 1 615 ? 35.927 31.363 67.890  1.00 6.86  ? 615  SER A CB  1 
ATOM   4958 O OG  . SER A 1 615 ? 36.735 32.526 67.834  1.00 6.32  ? 615  SER A OG  1 
ATOM   4959 N N   . PRO A 1 616 ? 33.453 33.829 68.419  1.00 7.02  ? 616  PRO A N   1 
ATOM   4960 C CA  . PRO A 1 616 ? 32.698 34.871 67.712  1.00 7.16  ? 616  PRO A CA  1 
ATOM   4961 C C   . PRO A 1 616 ? 33.324 35.314 66.390  1.00 6.79  ? 616  PRO A C   1 
ATOM   4962 O O   . PRO A 1 616 ? 32.645 35.384 65.368  1.00 6.61  ? 616  PRO A O   1 
ATOM   4963 C CB  . PRO A 1 616 ? 32.668 36.015 68.736  1.00 6.65  ? 616  PRO A CB  1 
ATOM   4964 C CG  . PRO A 1 616 ? 32.630 35.298 70.046  1.00 7.34  ? 616  PRO A CG  1 
ATOM   4965 C CD  . PRO A 1 616 ? 33.661 34.196 69.829  1.00 6.33  ? 616  PRO A CD  1 
ATOM   4966 N N   . LEU A 1 617 ? 34.632 35.542 66.403  1.00 6.94  ? 617  LEU A N   1 
ATOM   4967 C CA  . LEU A 1 617 ? 35.346 35.988 65.212  1.00 6.85  ? 617  LEU A CA  1 
ATOM   4968 C C   . LEU A 1 617 ? 35.276 35.013 64.041  1.00 6.36  ? 617  LEU A C   1 
ATOM   4969 O O   . LEU A 1 617 ? 35.325 35.420 62.873  1.00 7.34  ? 617  LEU A O   1 
ATOM   4970 C CB  . LEU A 1 617 ? 36.818 36.273 65.540  1.00 7.48  ? 617  LEU A CB  1 
ATOM   4971 C CG  . LEU A 1 617 ? 37.672 36.816 64.393  1.00 6.43  ? 617  LEU A CG  1 
ATOM   4972 C CD1 . LEU A 1 617 ? 37.149 38.135 63.857  1.00 7.63  ? 617  LEU A CD1 1 
ATOM   4973 C CD2 . LEU A 1 617 ? 39.090 36.969 64.884  1.00 7.89  ? 617  LEU A CD2 1 
ATOM   4974 N N   . HIS A 1 618 ? 35.116 33.738 64.360  1.00 6.82  ? 618  HIS A N   1 
ATOM   4975 C CA  . HIS A 1 618 ? 35.102 32.688 63.357  1.00 7.48  ? 618  HIS A CA  1 
ATOM   4976 C C   . HIS A 1 618 ? 33.747 32.105 63.010  1.00 7.34  ? 618  HIS A C   1 
ATOM   4977 O O   . HIS A 1 618 ? 33.669 31.164 62.220  1.00 8.76  ? 618  HIS A O   1 
ATOM   4978 C CB  . HIS A 1 618 ? 36.072 31.596 63.792  1.00 7.76  ? 618  HIS A CB  1 
ATOM   4979 C CG  . HIS A 1 618 ? 37.442 32.130 64.075  1.00 8.45  ? 618  HIS A CG  1 
ATOM   4980 N ND1 . HIS A 1 618 ? 37.852 32.493 65.346  1.00 7.84  ? 618  HIS A ND1 1 
ATOM   4981 C CD2 . HIS A 1 618 ? 38.439 32.489 63.235  1.00 8.31  ? 618  HIS A CD2 1 
ATOM   4982 C CE1 . HIS A 1 618 ? 39.042 33.060 65.270  1.00 8.25  ? 618  HIS A CE1 1 
ATOM   4983 N NE2 . HIS A 1 618 ? 39.419 33.073 64.003  1.00 8.03  ? 618  HIS A NE2 1 
ATOM   4984 N N   . ASN A 1 619 ? 32.684 32.701 63.529  1.00 7.35  ? 619  ASN A N   1 
ATOM   4985 C CA  . ASN A 1 619 ? 31.347 32.193 63.247  1.00 7.72  ? 619  ASN A CA  1 
ATOM   4986 C C   . ASN A 1 619 ? 30.365 33.236 62.758  1.00 8.36  ? 619  ASN A C   1 
ATOM   4987 O O   . ASN A 1 619 ? 29.157 33.098 62.950  1.00 8.44  ? 619  ASN A O   1 
ATOM   4988 C CB  . ASN A 1 619 ? 30.787 31.432 64.448  1.00 8.47  ? 619  ASN A CB  1 
ATOM   4989 C CG  . ASN A 1 619 ? 31.461 30.090 64.624  1.00 9.08  ? 619  ASN A CG  1 
ATOM   4990 O OD1 . ASN A 1 619 ? 31.107 29.109 63.966  1.00 10.01 ? 619  ASN A OD1 1 
ATOM   4991 N ND2 . ASN A 1 619 ? 32.465 30.043 65.483  1.00 8.58  ? 619  ASN A ND2 1 
ATOM   4992 N N   . VAL A 1 620 ? 30.889 34.302 62.167  1.00 8.69  ? 620  VAL A N   1 
ATOM   4993 C CA  . VAL A 1 620 ? 30.033 35.333 61.605  1.00 9.03  ? 620  VAL A CA  1 
ATOM   4994 C C   . VAL A 1 620 ? 29.534 34.763 60.272  1.00 10.07 ? 620  VAL A C   1 
ATOM   4995 O O   . VAL A 1 620 ? 30.331 34.447 59.391  1.00 10.40 ? 620  VAL A O   1 
ATOM   4996 C CB  . VAL A 1 620 ? 30.798 36.647 61.394  1.00 8.73  ? 620  VAL A CB  1 
ATOM   4997 C CG1 . VAL A 1 620 ? 29.903 37.662 60.698  1.00 9.09  ? 620  VAL A CG1 1 
ATOM   4998 C CG2 . VAL A 1 620 ? 31.268 37.188 62.738  1.00 8.92  ? 620  VAL A CG2 1 
ATOM   4999 N N   . LYS A 1 621 ? 28.223 34.605 60.151  1.00 11.16 ? 621  LYS A N   1 
ATOM   5000 C CA  . LYS A 1 621 ? 27.642 34.024 58.950  1.00 13.20 ? 621  LYS A CA  1 
ATOM   5001 C C   . LYS A 1 621 ? 26.253 34.571 58.685  1.00 14.11 ? 621  LYS A C   1 
ATOM   5002 O O   . LYS A 1 621 ? 25.441 34.687 59.597  1.00 13.29 ? 621  LYS A O   1 
ATOM   5003 C CB  . LYS A 1 621 ? 27.560 32.504 59.120  1.00 15.04 ? 621  LYS A CB  1 
ATOM   5004 C CG  . LYS A 1 621 ? 27.051 31.750 57.909  1.00 17.58 ? 621  LYS A CG  1 
ATOM   5005 C CD  . LYS A 1 621 ? 27.055 30.250 58.166  1.00 20.11 ? 621  LYS A CD  1 
ATOM   5006 C CE  . LYS A 1 621 ? 26.625 29.465 56.936  1.00 21.85 ? 621  LYS A CE  1 
ATOM   5007 N NZ  . LYS A 1 621 ? 26.750 27.998 57.158  1.00 23.23 ? 621  LYS A NZ  1 
ATOM   5008 N N   . LEU A 1 622 ? 26.000 34.947 57.439  1.00 15.11 ? 622  LEU A N   1 
ATOM   5009 C CA  . LEU A 1 622 ? 24.690 35.459 57.058  1.00 16.95 ? 622  LEU A CA  1 
ATOM   5010 C C   . LEU A 1 622 ? 23.629 34.421 57.381  1.00 17.53 ? 622  LEU A C   1 
ATOM   5011 O O   . LEU A 1 622 ? 23.805 33.237 57.095  1.00 17.39 ? 622  LEU A O   1 
ATOM   5012 C CB  . LEU A 1 622 ? 24.642 35.740 55.556  1.00 17.51 ? 622  LEU A CB  1 
ATOM   5013 C CG  . LEU A 1 622 ? 25.352 36.987 55.047  1.00 18.22 ? 622  LEU A CG  1 
ATOM   5014 C CD1 . LEU A 1 622 ? 25.267 37.042 53.526  1.00 18.90 ? 622  LEU A CD1 1 
ATOM   5015 C CD2 . LEU A 1 622 ? 24.708 38.217 55.667  1.00 18.38 ? 622  LEU A CD2 1 
ATOM   5016 N N   . PRO A 1 623 ? 22.537 34.839 58.036  1.00 18.00 ? 623  PRO A N   1 
ATOM   5017 C CA  . PRO A 1 623 ? 21.486 33.872 58.357  1.00 19.27 ? 623  PRO A CA  1 
ATOM   5018 C C   . PRO A 1 623 ? 20.942 33.302 57.043  1.00 21.20 ? 623  PRO A C   1 
ATOM   5019 O O   . PRO A 1 623 ? 20.813 34.018 56.055  1.00 20.27 ? 623  PRO A O   1 
ATOM   5020 C CB  . PRO A 1 623 ? 20.450 34.731 59.071  1.00 18.84 ? 623  PRO A CB  1 
ATOM   5021 C CG  . PRO A 1 623 ? 21.296 35.764 59.755  1.00 18.13 ? 623  PRO A CG  1 
ATOM   5022 C CD  . PRO A 1 623 ? 22.265 36.142 58.666  1.00 17.69 ? 623  PRO A CD  1 
ATOM   5023 N N   . GLU A 1 624 ? 20.631 32.013 57.051  1.00 23.35 ? 624  GLU A N   1 
ATOM   5024 C CA  . GLU A 1 624 ? 20.119 31.321 55.875  1.00 25.91 ? 624  GLU A CA  1 
ATOM   5025 C C   . GLU A 1 624 ? 18.794 31.894 55.378  1.00 26.45 ? 624  GLU A C   1 
ATOM   5026 O O   . GLU A 1 624 ? 18.651 32.232 54.203  1.00 26.60 ? 624  GLU A O   1 
ATOM   5027 C CB  . GLU A 1 624 ? 19.967 29.824 56.179  1.00 27.32 ? 624  GLU A CB  1 
ATOM   5028 C CG  . GLU A 1 624 ? 21.268 29.101 56.563  1.00 29.78 ? 624  GLU A CG  1 
ATOM   5029 C CD  . GLU A 1 624 ? 21.895 29.602 57.869  1.00 31.26 ? 624  GLU A CD  1 
ATOM   5030 O OE1 . GLU A 1 624 ? 21.173 29.736 58.884  1.00 31.94 ? 624  GLU A OE1 1 
ATOM   5031 O OE2 . GLU A 1 624 ? 23.115 29.875 57.870  1.00 32.45 ? 624  GLU A OE2 1 
ATOM   5032 N N   . ALA A 1 625 ? 17.822 31.993 56.278  1.00 26.89 ? 625  ALA A N   1 
ATOM   5033 C CA  . ALA A 1 625 ? 16.500 32.510 55.940  1.00 27.39 ? 625  ALA A CA  1 
ATOM   5034 C C   . ALA A 1 625 ? 16.543 33.973 55.506  1.00 27.82 ? 625  ALA A C   1 
ATOM   5035 O O   . ALA A 1 625 ? 17.191 34.796 56.143  1.00 27.83 ? 625  ALA A O   1 
ATOM   5036 C CB  . ALA A 1 625 ? 15.549 32.336 57.118  1.00 27.47 ? 625  ALA A CB  1 
ATOM   5037 N N   . ASP A 1 626 ? 15.785 34.291 54.461  1.00 28.11 ? 626  ASP A N   1 
ATOM   5038 C CA  . ASP A 1 626 ? 15.729 35.647 53.917  1.00 28.31 ? 626  ASP A CA  1 
ATOM   5039 C C   . ASP A 1 626 ? 15.109 36.668 54.866  1.00 27.32 ? 626  ASP A C   1 
ATOM   5040 O O   . ASP A 1 626 ? 15.386 37.860 54.771  1.00 27.78 ? 626  ASP A O   1 
ATOM   5041 C CB  . ASP A 1 626 ? 14.955 35.654 52.595  1.00 30.33 ? 626  ASP A CB  1 
ATOM   5042 C CG  . ASP A 1 626 ? 15.557 34.727 51.561  1.00 31.84 ? 626  ASP A CG  1 
ATOM   5043 O OD1 . ASP A 1 626 ? 16.752 34.889 51.241  1.00 32.56 ? 626  ASP A OD1 1 
ATOM   5044 O OD2 . ASP A 1 626 ? 14.834 33.832 51.073  1.00 32.98 ? 626  ASP A OD2 1 
ATOM   5045 N N   . ASP A 1 627 ? 14.241 36.202 55.755  1.00 26.02 ? 627  ASP A N   1 
ATOM   5046 C CA  . ASP A 1 627 ? 13.580 37.089 56.708  1.00 24.32 ? 627  ASP A CA  1 
ATOM   5047 C C   . ASP A 1 627 ? 14.347 37.253 58.024  1.00 22.25 ? 627  ASP A C   1 
ATOM   5048 O O   . ASP A 1 627 ? 13.849 37.870 58.966  1.00 22.52 ? 627  ASP A O   1 
ATOM   5049 C CB  . ASP A 1 627 ? 12.150 36.598 56.981  1.00 26.14 ? 627  ASP A CB  1 
ATOM   5050 C CG  . ASP A 1 627 ? 12.108 35.258 57.709  1.00 27.70 ? 627  ASP A CG  1 
ATOM   5051 O OD1 . ASP A 1 627 ? 11.230 35.092 58.580  1.00 29.13 ? 627  ASP A OD1 1 
ATOM   5052 O OD2 . ASP A 1 627 ? 12.940 34.373 57.411  1.00 29.02 ? 627  ASP A OD2 1 
ATOM   5053 N N   . ILE A 1 628 ? 15.547 36.686 58.090  1.00 19.10 ? 628  ILE A N   1 
ATOM   5054 C CA  . ILE A 1 628 ? 16.362 36.777 59.293  1.00 16.60 ? 628  ILE A CA  1 
ATOM   5055 C C   . ILE A 1 628 ? 17.667 37.519 59.019  1.00 14.55 ? 628  ILE A C   1 
ATOM   5056 O O   . ILE A 1 628 ? 18.375 37.214 58.071  1.00 13.93 ? 628  ILE A O   1 
ATOM   5057 C CB  . ILE A 1 628 ? 16.697 35.369 59.859  1.00 16.48 ? 628  ILE A CB  1 
ATOM   5058 C CG1 . ILE A 1 628 ? 15.410 34.630 60.226  1.00 16.44 ? 628  ILE A CG1 1 
ATOM   5059 C CG2 . ILE A 1 628 ? 17.600 35.486 61.092  1.00 15.63 ? 628  ILE A CG2 1 
ATOM   5060 C CD1 . ILE A 1 628 ? 15.627 33.216 60.714  1.00 17.89 ? 628  ILE A CD1 1 
ATOM   5061 N N   . GLN A 1 629 ? 17.951 38.516 59.846  1.00 12.56 ? 629  GLN A N   1 
ATOM   5062 C CA  . GLN A 1 629 ? 19.172 39.300 59.750  1.00 11.44 ? 629  GLN A CA  1 
ATOM   5063 C C   . GLN A 1 629 ? 19.794 39.294 61.144  1.00 10.21 ? 629  GLN A C   1 
ATOM   5064 O O   . GLN A 1 629 ? 19.251 38.699 62.073  1.00 10.83 ? 629  GLN A O   1 
ATOM   5065 C CB  . GLN A 1 629 ? 18.865 40.737 59.317  1.00 11.53 ? 629  GLN A CB  1 
ATOM   5066 C CG  . GLN A 1 629 ? 18.076 41.570 60.323  1.00 11.49 ? 629  GLN A CG  1 
ATOM   5067 C CD  . GLN A 1 629 ? 17.844 42.999 59.853  1.00 12.72 ? 629  GLN A CD  1 
ATOM   5068 O OE1 . GLN A 1 629 ? 18.787 43.777 59.674  1.00 12.71 ? 629  GLN A OE1 1 
ATOM   5069 N NE2 . GLN A 1 629 ? 16.581 43.345 59.637  1.00 14.62 ? 629  GLN A NE2 1 
ATOM   5070 N N   . TYR A 1 630 ? 20.966 39.892 61.274  1.00 9.58  ? 630  TYR A N   1 
ATOM   5071 C CA  . TYR A 1 630 ? 21.601 39.957 62.580  1.00 9.06  ? 630  TYR A CA  1 
ATOM   5072 C C   . TYR A 1 630 ? 20.954 41.037 63.428  1.00 9.23  ? 630  TYR A C   1 
ATOM   5073 O O   . TYR A 1 630 ? 20.380 42.002 62.901  1.00 9.46  ? 630  TYR A O   1 
ATOM   5074 C CB  . TYR A 1 630 ? 23.085 40.276 62.449  1.00 9.02  ? 630  TYR A CB  1 
ATOM   5075 C CG  . TYR A 1 630 ? 23.984 39.076 62.499  1.00 9.07  ? 630  TYR A CG  1 
ATOM   5076 C CD1 . TYR A 1 630 ? 23.794 37.997 61.636  1.00 9.91  ? 630  TYR A CD1 1 
ATOM   5077 C CD2 . TYR A 1 630 ? 25.047 39.028 63.397  1.00 8.85  ? 630  TYR A CD2 1 
ATOM   5078 C CE1 . TYR A 1 630 ? 24.643 36.906 61.666  1.00 9.29  ? 630  TYR A CE1 1 
ATOM   5079 C CE2 . TYR A 1 630 ? 25.902 37.945 63.431  1.00 8.93  ? 630  TYR A CE2 1 
ATOM   5080 C CZ  . TYR A 1 630 ? 25.698 36.888 62.560  1.00 8.42  ? 630  TYR A CZ  1 
ATOM   5081 O OH  . TYR A 1 630 ? 26.578 35.837 62.552  1.00 8.47  ? 630  TYR A OH  1 
ATOM   5082 N N   . PRO A 1 631 ? 20.992 40.866 64.760  1.00 8.75  ? 631  PRO A N   1 
ATOM   5083 C CA  . PRO A 1 631 ? 20.401 41.896 65.610  1.00 8.12  ? 631  PRO A CA  1 
ATOM   5084 C C   . PRO A 1 631 ? 21.289 43.139 65.550  1.00 7.63  ? 631  PRO A C   1 
ATOM   5085 O O   . PRO A 1 631 ? 22.388 43.112 64.967  1.00 7.60  ? 631  PRO A O   1 
ATOM   5086 C CB  . PRO A 1 631 ? 20.448 41.251 67.004  1.00 9.07  ? 631  PRO A CB  1 
ATOM   5087 C CG  . PRO A 1 631 ? 21.589 40.285 66.924  1.00 9.33  ? 631  PRO A CG  1 
ATOM   5088 C CD  . PRO A 1 631 ? 21.427 39.700 65.546  1.00 8.86  ? 631  PRO A CD  1 
ATOM   5089 N N   . SER A 1 632 ? 20.764 44.255 66.052  1.00 7.98  ? 632  SER A N   1 
ATOM   5090 C CA  . SER A 1 632 ? 21.541 45.487 66.132  1.00 8.08  ? 632  SER A CA  1 
ATOM   5091 C C   . SER A 1 632 ? 22.621 45.148 67.157  1.00 8.11  ? 632  SER A C   1 
ATOM   5092 O O   . SER A 1 632 ? 22.330 44.559 68.201  1.00 8.47  ? 632  SER A O   1 
ATOM   5093 C CB  . SER A 1 632 ? 20.677 46.639 66.641  1.00 8.28  ? 632  SER A CB  1 
ATOM   5094 O OG  . SER A 1 632 ? 19.685 46.992 65.687  1.00 8.68  ? 632  SER A OG  1 
ATOM   5095 N N   . MET A 1 633 ? 23.865 45.469 66.836  1.00 7.85  ? 633  MET A N   1 
ATOM   5096 C CA  . MET A 1 633 ? 24.973 45.155 67.724  1.00 7.86  ? 633  MET A CA  1 
ATOM   5097 C C   . MET A 1 633 ? 25.869 46.342 68.002  1.00 7.11  ? 633  MET A C   1 
ATOM   5098 O O   . MET A 1 633 ? 26.170 47.134 67.111  1.00 7.22  ? 633  MET A O   1 
ATOM   5099 C CB  . MET A 1 633 ? 25.840 44.037 67.134  1.00 7.48  ? 633  MET A CB  1 
ATOM   5100 C CG  . MET A 1 633 ? 25.106 42.723 66.900  1.00 8.15  ? 633  MET A CG  1 
ATOM   5101 S SD  . MET A 1 633 ? 26.147 41.403 66.289  1.00 8.68  ? 633  MET A SD  1 
ATOM   5102 C CE  . MET A 1 633 ? 27.086 41.019 67.786  1.00 9.73  ? 633  MET A CE  1 
ATOM   5103 N N   . LEU A 1 634 ? 26.238 46.491 69.265  1.00 7.13  ? 634  LEU A N   1 
ATOM   5104 C CA  . LEU A 1 634 ? 27.153 47.544 69.676  1.00 7.05  ? 634  LEU A CA  1 
ATOM   5105 C C   . LEU A 1 634 ? 28.239 46.901 70.517  1.00 6.98  ? 634  LEU A C   1 
ATOM   5106 O O   . LEU A 1 634 ? 27.954 46.207 71.494  1.00 6.87  ? 634  LEU A O   1 
ATOM   5107 C CB  . LEU A 1 634 ? 26.448 48.612 70.512  1.00 7.21  ? 634  LEU A CB  1 
ATOM   5108 C CG  . LEU A 1 634 ? 27.353 49.695 71.116  1.00 7.21  ? 634  LEU A CG  1 
ATOM   5109 C CD1 . LEU A 1 634 ? 28.018 50.525 70.014  1.00 8.08  ? 634  LEU A CD1 1 
ATOM   5110 C CD2 . LEU A 1 634 ? 26.532 50.598 72.041  1.00 7.77  ? 634  LEU A CD2 1 
ATOM   5111 N N   . LEU A 1 635 ? 29.481 47.068 70.091  1.00 6.70  ? 635  LEU A N   1 
ATOM   5112 C CA  . LEU A 1 635 ? 30.640 46.568 70.823  1.00 6.05  ? 635  LEU A CA  1 
ATOM   5113 C C   . LEU A 1 635 ? 31.285 47.785 71.499  1.00 6.58  ? 635  LEU A C   1 
ATOM   5114 O O   . LEU A 1 635 ? 31.446 48.837 70.870  1.00 6.49  ? 635  LEU A O   1 
ATOM   5115 C CB  . LEU A 1 635 ? 31.666 45.928 69.887  1.00 7.22  ? 635  LEU A CB  1 
ATOM   5116 C CG  . LEU A 1 635 ? 31.195 44.881 68.878  1.00 7.62  ? 635  LEU A CG  1 
ATOM   5117 C CD1 . LEU A 1 635 ? 32.416 44.324 68.148  1.00 8.83  ? 635  LEU A CD1 1 
ATOM   5118 C CD2 . LEU A 1 635 ? 30.401 43.766 69.555  1.00 7.52  ? 635  LEU A CD2 1 
ATOM   5119 N N   . LEU A 1 636 ? 31.585 47.663 72.787  1.00 6.54  ? 636  LEU A N   1 
ATOM   5120 C CA  . LEU A 1 636 ? 32.221 48.744 73.529  1.00 7.85  ? 636  LEU A CA  1 
ATOM   5121 C C   . LEU A 1 636 ? 33.562 48.268 74.040  1.00 7.50  ? 636  LEU A C   1 
ATOM   5122 O O   . LEU A 1 636 ? 33.675 47.179 74.596  1.00 7.63  ? 636  LEU A O   1 
ATOM   5123 C CB  . LEU A 1 636 ? 31.352 49.177 74.717  1.00 8.12  ? 636  LEU A CB  1 
ATOM   5124 C CG  . LEU A 1 636 ? 29.937 49.679 74.409  1.00 7.71  ? 636  LEU A CG  1 
ATOM   5125 C CD1 . LEU A 1 636 ? 29.197 50.001 75.699  1.00 9.90  ? 636  LEU A CD1 1 
ATOM   5126 C CD2 . LEU A 1 636 ? 30.011 50.916 73.509  1.00 7.99  ? 636  LEU A CD2 1 
ATOM   5127 N N   . THR A 1 637 ? 34.602 49.030 73.760  1.00 6.95  ? 637  THR A N   1 
ATOM   5128 C CA  . THR A 1 637 ? 35.930 48.715 74.262  1.00 7.93  ? 637  THR A CA  1 
ATOM   5129 C C   . THR A 1 637 ? 36.673 50.031 74.476  1.00 7.46  ? 637  THR A C   1 
ATOM   5130 O O   . THR A 1 637 ? 36.099 51.109 74.279  1.00 7.67  ? 637  THR A O   1 
ATOM   5131 C CB  . THR A 1 637 ? 36.705 47.714 73.361  1.00 7.95  ? 637  THR A CB  1 
ATOM   5132 O OG1 . THR A 1 637 ? 37.954 47.370 73.973  1.00 8.36  ? 637  THR A OG1 1 
ATOM   5133 C CG2 . THR A 1 637 ? 36.960 48.293 71.979  1.00 8.86  ? 637  THR A CG2 1 
ATOM   5134 N N   . ALA A 1 638 ? 37.922 49.955 74.909  1.00 8.13  ? 638  ALA A N   1 
ATOM   5135 C CA  . ALA A 1 638 ? 38.716 51.154 75.174  1.00 7.64  ? 638  ALA A CA  1 
ATOM   5136 C C   . ALA A 1 638 ? 40.170 50.888 74.853  1.00 7.76  ? 638  ALA A C   1 
ATOM   5137 O O   . ALA A 1 638 ? 40.647 49.762 74.986  1.00 7.91  ? 638  ALA A O   1 
ATOM   5138 C CB  . ALA A 1 638 ? 38.557 51.586 76.621  1.00 9.02  ? 638  ALA A CB  1 
ATOM   5139 N N   . ASP A 1 639 ? 40.902 51.939 74.507  1.00 7.44  ? 639  ASP A N   1 
ATOM   5140 C CA  . ASP A 1 639 ? 42.283 51.778 74.105  1.00 7.73  ? 639  ASP A CA  1 
ATOM   5141 C C   . ASP A 1 639 ? 43.300 51.351 75.151  1.00 7.69  ? 639  ASP A C   1 
ATOM   5142 O O   . ASP A 1 639 ? 44.431 51.047 74.800  1.00 8.04  ? 639  ASP A O   1 
ATOM   5143 C CB  . ASP A 1 639 ? 42.774 52.981 73.291  1.00 8.13  ? 639  ASP A CB  1 
ATOM   5144 C CG  . ASP A 1 639 ? 42.781 54.272 74.076  1.00 9.02  ? 639  ASP A CG  1 
ATOM   5145 O OD1 . ASP A 1 639 ? 42.523 54.266 75.298  1.00 9.11  ? 639  ASP A OD1 1 
ATOM   5146 O OD2 . ASP A 1 639 ? 43.059 55.310 73.442  1.00 10.73 ? 639  ASP A OD2 1 
ATOM   5147 N N   . HIS A 1 640 ? 42.937 51.398 76.427  1.00 7.06  ? 640  HIS A N   1 
ATOM   5148 C CA  . HIS A 1 640 ? 43.849 50.943 77.472  1.00 7.24  ? 640  HIS A CA  1 
ATOM   5149 C C   . HIS A 1 640 ? 43.317 49.658 78.127  1.00 6.51  ? 640  HIS A C   1 
ATOM   5150 O O   . HIS A 1 640 ? 43.653 49.349 79.276  1.00 6.24  ? 640  HIS A O   1 
ATOM   5151 C CB  . HIS A 1 640 ? 44.120 52.028 78.527  1.00 6.92  ? 640  HIS A CB  1 
ATOM   5152 C CG  . HIS A 1 640 ? 44.982 53.146 78.041  1.00 7.39  ? 640  HIS A CG  1 
ATOM   5153 N ND1 . HIS A 1 640 ? 44.549 54.090 77.137  1.00 7.80  ? 640  HIS A ND1 1 
ATOM   5154 C CD2 . HIS A 1 640 ? 46.263 53.507 78.363  1.00 8.03  ? 640  HIS A CD2 1 
ATOM   5155 C CE1 . HIS A 1 640 ? 45.501 54.976 76.915  1.00 9.18  ? 640  HIS A CE1 1 
ATOM   5156 N NE2 . HIS A 1 640 ? 46.548 54.633 77.658  1.00 8.25  ? 640  HIS A NE2 1 
ATOM   5157 N N   . ASP A 1 641 ? 42.438 48.935 77.441  1.00 6.76  ? 641  ASP A N   1 
ATOM   5158 C CA  . ASP A 1 641 ? 41.972 47.688 78.008  1.00 6.97  ? 641  ASP A CA  1 
ATOM   5159 C C   . ASP A 1 641 ? 43.039 46.633 77.785  1.00 6.04  ? 641  ASP A C   1 
ATOM   5160 O O   . ASP A 1 641 ? 43.026 45.905 76.782  1.00 6.84  ? 641  ASP A O   1 
ATOM   5161 C CB  . ASP A 1 641 ? 40.640 47.217 77.427  1.00 7.10  ? 641  ASP A CB  1 
ATOM   5162 C CG  . ASP A 1 641 ? 40.108 45.977 78.144  1.00 6.35  ? 641  ASP A CG  1 
ATOM   5163 O OD1 . ASP A 1 641 ? 40.877 45.360 78.920  1.00 6.95  ? 641  ASP A OD1 1 
ATOM   5164 O OD2 . ASP A 1 641 ? 38.929 45.610 77.948  1.00 6.66  ? 641  ASP A OD2 1 
ATOM   5165 N N   . ASP A 1 642 ? 43.951 46.547 78.744  1.00 6.06  ? 642  ASP A N   1 
ATOM   5166 C CA  . ASP A 1 642 ? 44.997 45.557 78.671  1.00 6.40  ? 642  ASP A CA  1 
ATOM   5167 C C   . ASP A 1 642 ? 44.590 44.223 79.293  1.00 6.54  ? 642  ASP A C   1 
ATOM   5168 O O   . ASP A 1 642 ? 45.384 43.300 79.320  1.00 6.71  ? 642  ASP A O   1 
ATOM   5169 C CB  . ASP A 1 642 ? 46.336 46.102 79.197  1.00 6.72  ? 642  ASP A CB  1 
ATOM   5170 C CG  . ASP A 1 642 ? 46.247 46.714 80.592  1.00 7.59  ? 642  ASP A CG  1 
ATOM   5171 O OD1 . ASP A 1 642 ? 47.310 47.188 81.063  1.00 7.81  ? 642  ASP A OD1 1 
ATOM   5172 O OD2 . ASP A 1 642 ? 45.154 46.728 81.204  1.00 7.03  ? 642  ASP A OD2 1 
ATOM   5173 N N   . ARG A 1 643 ? 43.347 44.119 79.775  1.00 6.07  ? 643  ARG A N   1 
ATOM   5174 C CA  . ARG A 1 643 ? 42.850 42.844 80.308  1.00 6.09  ? 643  ARG A CA  1 
ATOM   5175 C C   . ARG A 1 643 ? 42.415 42.040 79.084  1.00 6.07  ? 643  ARG A C   1 
ATOM   5176 O O   . ARG A 1 643 ? 42.894 40.940 78.863  1.00 6.33  ? 643  ARG A O   1 
ATOM   5177 C CB  . ARG A 1 643 ? 41.669 43.037 81.265  1.00 6.66  ? 643  ARG A CB  1 
ATOM   5178 C CG  . ARG A 1 643 ? 41.216 41.731 81.927  1.00 7.06  ? 643  ARG A CG  1 
ATOM   5179 C CD  . ARG A 1 643 ? 42.237 41.248 82.957  1.00 7.85  ? 643  ARG A CD  1 
ATOM   5180 N NE  . ARG A 1 643 ? 42.373 42.222 84.036  1.00 10.03 ? 643  ARG A NE  1 
ATOM   5181 C CZ  . ARG A 1 643 ? 41.503 42.385 85.026  1.00 11.41 ? 643  ARG A CZ  1 
ATOM   5182 N NH1 . ARG A 1 643 ? 40.424 41.627 85.103  1.00 11.94 ? 643  ARG A NH1 1 
ATOM   5183 N NH2 . ARG A 1 643 ? 41.676 43.362 85.909  1.00 12.64 ? 643  ARG A NH2 1 
ATOM   5184 N N   . VAL A 1 644 ? 41.505 42.605 78.297  1.00 6.00  ? 644  VAL A N   1 
ATOM   5185 C CA  . VAL A 1 644 ? 41.054 41.975 77.054  1.00 6.21  ? 644  VAL A CA  1 
ATOM   5186 C C   . VAL A 1 644 ? 41.426 42.983 75.976  1.00 6.27  ? 644  VAL A C   1 
ATOM   5187 O O   . VAL A 1 644 ? 40.711 43.957 75.739  1.00 6.30  ? 644  VAL A O   1 
ATOM   5188 C CB  . VAL A 1 644 ? 39.522 41.706 77.027  1.00 6.41  ? 644  VAL A CB  1 
ATOM   5189 C CG1 . VAL A 1 644 ? 39.115 41.129 75.679  1.00 6.96  ? 644  VAL A CG1 1 
ATOM   5190 C CG2 . VAL A 1 644 ? 39.139 40.724 78.128  1.00 6.10  ? 644  VAL A CG2 1 
ATOM   5191 N N   . VAL A 1 645 ? 42.587 42.771 75.368  1.00 6.18  ? 645  VAL A N   1 
ATOM   5192 C CA  . VAL A 1 645 ? 43.088 43.698 74.361  1.00 6.49  ? 645  VAL A CA  1 
ATOM   5193 C C   . VAL A 1 645 ? 42.002 44.028 73.351  1.00 6.58  ? 645  VAL A C   1 
ATOM   5194 O O   . VAL A 1 645 ? 41.326 43.135 72.836  1.00 6.44  ? 645  VAL A O   1 
ATOM   5195 C CB  . VAL A 1 645 ? 44.387 43.185 73.725  1.00 7.46  ? 645  VAL A CB  1 
ATOM   5196 C CG1 . VAL A 1 645 ? 45.514 43.268 74.762  1.00 7.55  ? 645  VAL A CG1 1 
ATOM   5197 C CG2 . VAL A 1 645 ? 44.207 41.753 73.217  1.00 7.64  ? 645  VAL A CG2 1 
ATOM   5198 N N   . PRO A 1 646 ? 41.841 45.329 73.025  1.00 6.96  ? 646  PRO A N   1 
ATOM   5199 C CA  . PRO A 1 646 ? 40.807 45.757 72.083  1.00 6.82  ? 646  PRO A CA  1 
ATOM   5200 C C   . PRO A 1 646 ? 40.777 45.143 70.696  1.00 6.94  ? 646  PRO A C   1 
ATOM   5201 O O   . PRO A 1 646 ? 39.740 45.168 70.039  1.00 6.62  ? 646  PRO A O   1 
ATOM   5202 C CB  . PRO A 1 646 ? 40.944 47.289 72.084  1.00 7.44  ? 646  PRO A CB  1 
ATOM   5203 C CG  . PRO A 1 646 ? 42.371 47.520 72.449  1.00 7.13  ? 646  PRO A CG  1 
ATOM   5204 C CD  . PRO A 1 646 ? 42.635 46.471 73.506  1.00 7.10  ? 646  PRO A CD  1 
ATOM   5205 N N   . LEU A 1 647 ? 41.895 44.574 70.258  1.00 6.34  ? 647  LEU A N   1 
ATOM   5206 C CA  . LEU A 1 647 ? 41.951 43.931 68.947  1.00 6.77  ? 647  LEU A CA  1 
ATOM   5207 C C   . LEU A 1 647 ? 40.818 42.910 68.817  1.00 6.87  ? 647  LEU A C   1 
ATOM   5208 O O   . LEU A 1 647 ? 40.345 42.644 67.726  1.00 6.61  ? 647  LEU A O   1 
ATOM   5209 C CB  . LEU A 1 647 ? 43.324 43.284 68.703  1.00 7.13  ? 647  LEU A CB  1 
ATOM   5210 C CG  . LEU A 1 647 ? 43.757 42.175 69.665  1.00 5.96  ? 647  LEU A CG  1 
ATOM   5211 C CD1 . LEU A 1 647 ? 43.233 40.813 69.190  1.00 7.03  ? 647  LEU A CD1 1 
ATOM   5212 C CD2 . LEU A 1 647 ? 45.280 42.148 69.758  1.00 7.53  ? 647  LEU A CD2 1 
ATOM   5213 N N   . HIS A 1 648 ? 40.375 42.336 69.933  1.00 5.96  ? 648  HIS A N   1 
ATOM   5214 C CA  . HIS A 1 648 ? 39.272 41.372 69.874  1.00 6.27  ? 648  HIS A CA  1 
ATOM   5215 C C   . HIS A 1 648 ? 38.031 42.005 69.245  1.00 6.71  ? 648  HIS A C   1 
ATOM   5216 O O   . HIS A 1 648 ? 37.429 41.448 68.320  1.00 6.85  ? 648  HIS A O   1 
ATOM   5217 C CB  . HIS A 1 648 ? 38.920 40.846 71.270  1.00 6.42  ? 648  HIS A CB  1 
ATOM   5218 C CG  . HIS A 1 648 ? 39.903 39.834 71.797  1.00 5.72  ? 648  HIS A CG  1 
ATOM   5219 N ND1 . HIS A 1 648 ? 39.899 38.520 71.390  1.00 5.96  ? 648  HIS A ND1 1 
ATOM   5220 C CD2 . HIS A 1 648 ? 40.921 39.965 72.678  1.00 6.27  ? 648  HIS A CD2 1 
ATOM   5221 C CE1 . HIS A 1 648 ? 40.884 37.877 71.997  1.00 5.83  ? 648  HIS A CE1 1 
ATOM   5222 N NE2 . HIS A 1 648 ? 41.514 38.722 72.781  1.00 6.00  ? 648  HIS A NE2 1 
ATOM   5223 N N   . SER A 1 649 ? 37.643 43.161 69.775  1.00 7.05  ? 649  SER A N   1 
ATOM   5224 C CA  . SER A 1 649 ? 36.486 43.878 69.262  1.00 6.80  ? 649  SER A CA  1 
ATOM   5225 C C   . SER A 1 649 ? 36.750 44.486 67.892  1.00 7.11  ? 649  SER A C   1 
ATOM   5226 O O   . SER A 1 649 ? 35.863 44.515 67.053  1.00 6.87  ? 649  SER A O   1 
ATOM   5227 C CB  . SER A 1 649 ? 36.042 44.958 70.250  1.00 6.93  ? 649  SER A CB  1 
ATOM   5228 O OG  . SER A 1 649 ? 35.481 44.375 71.417  1.00 7.00  ? 649  SER A OG  1 
ATOM   5229 N N   . LEU A 1 650 ? 37.969 44.959 67.661  1.00 6.55  ? 650  LEU A N   1 
ATOM   5230 C CA  . LEU A 1 650 ? 38.288 45.545 66.357  1.00 6.93  ? 650  LEU A CA  1 
ATOM   5231 C C   . LEU A 1 650 ? 38.130 44.526 65.229  1.00 6.90  ? 650  LEU A C   1 
ATOM   5232 O O   . LEU A 1 650 ? 37.488 44.801 64.222  1.00 7.09  ? 650  LEU A O   1 
ATOM   5233 C CB  . LEU A 1 650 ? 39.705 46.115 66.340  1.00 7.37  ? 650  LEU A CB  1 
ATOM   5234 C CG  . LEU A 1 650 ? 40.117 47.146 67.387  1.00 7.41  ? 650  LEU A CG  1 
ATOM   5235 C CD1 . LEU A 1 650 ? 41.489 47.702 67.012  1.00 8.35  ? 650  LEU A CD1 1 
ATOM   5236 C CD2 . LEU A 1 650 ? 39.100 48.276 67.482  1.00 8.29  ? 650  LEU A CD2 1 
ATOM   5237 N N   . LYS A 1 651 ? 38.730 43.352 65.405  1.00 6.71  ? 651  LYS A N   1 
ATOM   5238 C CA  . LYS A 1 651 ? 38.637 42.312 64.391  1.00 7.43  ? 651  LYS A CA  1 
ATOM   5239 C C   . LYS A 1 651 ? 37.208 41.820 64.216  1.00 7.36  ? 651  LYS A C   1 
ATOM   5240 O O   . LYS A 1 651 ? 36.768 41.553 63.098  1.00 7.67  ? 651  LYS A O   1 
ATOM   5241 C CB  . LYS A 1 651 ? 39.571 41.145 64.735  1.00 8.35  ? 651  LYS A CB  1 
ATOM   5242 C CG  . LYS A 1 651 ? 41.045 41.518 64.634  1.00 9.91  ? 651  LYS A CG  1 
ATOM   5243 C CD  . LYS A 1 651 ? 41.975 40.459 65.205  1.00 12.06 ? 651  LYS A CD  1 
ATOM   5244 C CE  . LYS A 1 651 ? 42.063 39.238 64.336  1.00 12.27 ? 651  LYS A CE  1 
ATOM   5245 N NZ  . LYS A 1 651 ? 42.970 38.263 65.000  1.00 8.95  ? 651  LYS A NZ  1 
ATOM   5246 N N   . PHE A 1 652 ? 36.482 41.706 65.323  1.00 7.00  ? 652  PHE A N   1 
ATOM   5247 C CA  . PHE A 1 652 ? 35.116 41.236 65.259  1.00 6.68  ? 652  PHE A CA  1 
ATOM   5248 C C   . PHE A 1 652 ? 34.204 42.208 64.506  1.00 6.86  ? 652  PHE A C   1 
ATOM   5249 O O   . PHE A 1 652 ? 33.448 41.791 63.638  1.00 7.16  ? 652  PHE A O   1 
ATOM   5250 C CB  . PHE A 1 652 ? 34.600 40.972 66.673  1.00 6.83  ? 652  PHE A CB  1 
ATOM   5251 C CG  . PHE A 1 652 ? 33.272 40.270 66.722  1.00 6.61  ? 652  PHE A CG  1 
ATOM   5252 C CD1 . PHE A 1 652 ? 33.009 39.167 65.920  1.00 7.25  ? 652  PHE A CD1 1 
ATOM   5253 C CD2 . PHE A 1 652 ? 32.297 40.690 67.624  1.00 6.25  ? 652  PHE A CD2 1 
ATOM   5254 C CE1 . PHE A 1 652 ? 31.784 38.502 66.011  1.00 7.99  ? 652  PHE A CE1 1 
ATOM   5255 C CE2 . PHE A 1 652 ? 31.079 40.038 67.727  1.00 6.97  ? 652  PHE A CE2 1 
ATOM   5256 C CZ  . PHE A 1 652 ? 30.819 38.930 66.921  1.00 8.04  ? 652  PHE A CZ  1 
ATOM   5257 N N   . ILE A 1 653 ? 34.291 43.501 64.799  1.00 7.40  ? 653  ILE A N   1 
ATOM   5258 C CA  . ILE A 1 653 ? 33.436 44.452 64.101  1.00 7.25  ? 653  ILE A CA  1 
ATOM   5259 C C   . ILE A 1 653 ? 33.769 44.543 62.610  1.00 7.28  ? 653  ILE A C   1 
ATOM   5260 O O   . ILE A 1 653 ? 32.868 44.670 61.784  1.00 7.57  ? 653  ILE A O   1 
ATOM   5261 C CB  . ILE A 1 653 ? 33.438 45.840 64.776  1.00 7.46  ? 653  ILE A CB  1 
ATOM   5262 C CG1 . ILE A 1 653 ? 32.193 46.620 64.365  1.00 8.14  ? 653  ILE A CG1 1 
ATOM   5263 C CG2 . ILE A 1 653 ? 34.685 46.626 64.445  1.00 7.69  ? 653  ILE A CG2 1 
ATOM   5264 C CD1 . ILE A 1 653 ? 30.895 46.005 64.841  1.00 8.94  ? 653  ILE A CD1 1 
ATOM   5265 N N   . ALA A 1 654 ? 35.051 44.438 62.273  1.00 6.79  ? 654  ALA A N   1 
ATOM   5266 C CA  . ALA A 1 654 ? 35.458 44.470 60.871  1.00 6.32  ? 654  ALA A CA  1 
ATOM   5267 C C   . ALA A 1 654 ? 34.795 43.293 60.135  1.00 7.39  ? 654  ALA A C   1 
ATOM   5268 O O   . ALA A 1 654 ? 34.271 43.434 59.027  1.00 7.50  ? 654  ALA A O   1 
ATOM   5269 C CB  . ALA A 1 654 ? 36.978 44.382 60.760  1.00 6.66  ? 654  ALA A CB  1 
ATOM   5270 N N   . THR A 1 655 ? 34.799 42.134 60.785  1.00 7.39  ? 655  THR A N   1 
ATOM   5271 C CA  . THR A 1 655 ? 34.214 40.925 60.222  1.00 7.64  ? 655  THR A CA  1 
ATOM   5272 C C   . THR A 1 655 ? 32.690 41.020 60.111  1.00 7.92  ? 655  THR A C   1 
ATOM   5273 O O   . THR A 1 655 ? 32.102 40.639 59.095  1.00 7.60  ? 655  THR A O   1 
ATOM   5274 C CB  . THR A 1 655 ? 34.640 39.711 61.071  1.00 7.47  ? 655  THR A CB  1 
ATOM   5275 O OG1 . THR A 1 655 ? 36.071 39.672 61.157  1.00 8.41  ? 655  THR A OG1 1 
ATOM   5276 C CG2 . THR A 1 655 ? 34.127 38.400 60.470  1.00 8.64  ? 655  THR A CG2 1 
ATOM   5277 N N   . LEU A 1 656 ? 32.044 41.534 61.150  1.00 7.31  ? 656  LEU A N   1 
ATOM   5278 C CA  . LEU A 1 656 ? 30.591 41.700 61.135  1.00 7.22  ? 656  LEU A CA  1 
ATOM   5279 C C   . LEU A 1 656 ? 30.171 42.627 60.001  1.00 7.64  ? 656  LEU A C   1 
ATOM   5280 O O   . LEU A 1 656 ? 29.240 42.323 59.249  1.00 7.56  ? 656  LEU A O   1 
ATOM   5281 C CB  . LEU A 1 656 ? 30.097 42.270 62.471  1.00 7.27  ? 656  LEU A CB  1 
ATOM   5282 C CG  . LEU A 1 656 ? 30.073 41.328 63.672  1.00 7.62  ? 656  LEU A CG  1 
ATOM   5283 C CD1 . LEU A 1 656 ? 29.921 42.128 64.944  1.00 7.14  ? 656  LEU A CD1 1 
ATOM   5284 C CD2 . LEU A 1 656 ? 28.934 40.349 63.531  1.00 8.28  ? 656  LEU A CD2 1 
ATOM   5285 N N   . GLN A 1 657 ? 30.859 43.761 59.886  1.00 8.16  ? 657  GLN A N   1 
ATOM   5286 C CA  . GLN A 1 657 ? 30.540 44.730 58.848  1.00 8.43  ? 657  GLN A CA  1 
ATOM   5287 C C   . GLN A 1 657 ? 30.758 44.204 57.437  1.00 9.22  ? 657  GLN A C   1 
ATOM   5288 O O   . GLN A 1 657 ? 29.948 44.466 56.550  1.00 10.65 ? 657  GLN A O   1 
ATOM   5289 C CB  . GLN A 1 657 ? 31.308 46.032 59.070  1.00 8.15  ? 657  GLN A CB  1 
ATOM   5290 C CG  . GLN A 1 657 ? 30.811 46.796 60.286  1.00 8.08  ? 657  GLN A CG  1 
ATOM   5291 C CD  . GLN A 1 657 ? 31.613 48.040 60.601  1.00 8.42  ? 657  GLN A CD  1 
ATOM   5292 O OE1 . GLN A 1 657 ? 32.598 48.360 59.935  1.00 9.22  ? 657  GLN A OE1 1 
ATOM   5293 N NE2 . GLN A 1 657 ? 31.195 48.747 61.644  1.00 8.19  ? 657  GLN A NE2 1 
ATOM   5294 N N   . TYR A 1 658 ? 31.812 43.419 57.253  1.00 9.25  ? 658  TYR A N   1 
ATOM   5295 C CA  . TYR A 1 658 ? 32.112 42.875 55.936  1.00 9.65  ? 658  TYR A CA  1 
ATOM   5296 C C   . TYR A 1 658 ? 31.188 41.726 55.532  1.00 9.95  ? 658  TYR A C   1 
ATOM   5297 O O   . TYR A 1 658 ? 30.574 41.755 54.468  1.00 9.94  ? 658  TYR A O   1 
ATOM   5298 C CB  . TYR A 1 658 ? 33.570 42.421 55.864  1.00 9.97  ? 658  TYR A CB  1 
ATOM   5299 C CG  . TYR A 1 658 ? 33.955 41.887 54.504  1.00 11.58 ? 658  TYR A CG  1 
ATOM   5300 C CD1 . TYR A 1 658 ? 34.159 42.750 53.426  1.00 12.47 ? 658  TYR A CD1 1 
ATOM   5301 C CD2 . TYR A 1 658 ? 34.091 40.518 54.288  1.00 12.49 ? 658  TYR A CD2 1 
ATOM   5302 C CE1 . TYR A 1 658 ? 34.489 42.258 52.160  1.00 13.85 ? 658  TYR A CE1 1 
ATOM   5303 C CE2 . TYR A 1 658 ? 34.419 40.016 53.030  1.00 13.29 ? 658  TYR A CE2 1 
ATOM   5304 C CZ  . TYR A 1 658 ? 34.618 40.892 51.975  1.00 13.33 ? 658  TYR A CZ  1 
ATOM   5305 O OH  . TYR A 1 658 ? 34.959 40.395 50.738  1.00 15.48 ? 658  TYR A OH  1 
ATOM   5306 N N   . ILE A 1 659 ? 31.086 40.719 56.386  1.00 10.37 ? 659  ILE A N   1 
ATOM   5307 C CA  . ILE A 1 659 ? 30.261 39.556 56.093  1.00 11.20 ? 659  ILE A CA  1 
ATOM   5308 C C   . ILE A 1 659 ? 28.755 39.812 56.171  1.00 11.16 ? 659  ILE A C   1 
ATOM   5309 O O   . ILE A 1 659 ? 28.006 39.411 55.286  1.00 12.08 ? 659  ILE A O   1 
ATOM   5310 C CB  . ILE A 1 659 ? 30.628 38.386 57.041  1.00 11.50 ? 659  ILE A CB  1 
ATOM   5311 C CG1 . ILE A 1 659 ? 32.089 37.957 56.837  1.00 11.74 ? 659  ILE A CG1 1 
ATOM   5312 C CG2 . ILE A 1 659 ? 29.679 37.206 56.831  1.00 11.75 ? 659  ILE A CG2 1 
ATOM   5313 C CD1 . ILE A 1 659 ? 32.366 37.257 55.509  1.00 12.73 ? 659  ILE A CD1 1 
ATOM   5314 N N   . VAL A 1 660 ? 28.313 40.472 57.236  1.00 10.64 ? 660  VAL A N   1 
ATOM   5315 C CA  . VAL A 1 660 ? 26.894 40.731 57.449  1.00 11.25 ? 660  VAL A CA  1 
ATOM   5316 C C   . VAL A 1 660 ? 26.453 42.139 57.047  1.00 11.57 ? 660  VAL A C   1 
ATOM   5317 O O   . VAL A 1 660 ? 25.444 42.303 56.377  1.00 11.05 ? 660  VAL A O   1 
ATOM   5318 C CB  . VAL A 1 660 ? 26.508 40.467 58.942  1.00 10.84 ? 660  VAL A CB  1 
ATOM   5319 C CG1 . VAL A 1 660 ? 25.020 40.701 59.170  1.00 10.34 ? 660  VAL A CG1 1 
ATOM   5320 C CG2 . VAL A 1 660 ? 26.883 39.038 59.349  1.00 11.16 ? 660  VAL A CG2 1 
ATOM   5321 N N   . GLY A 1 661 ? 27.235 43.141 57.438  1.00 11.74 ? 661  GLY A N   1 
ATOM   5322 C CA  . GLY A 1 661 ? 26.907 44.526 57.135  1.00 13.30 ? 661  GLY A CA  1 
ATOM   5323 C C   . GLY A 1 661 ? 26.697 44.864 55.668  1.00 14.38 ? 661  GLY A C   1 
ATOM   5324 O O   . GLY A 1 661 ? 25.884 45.728 55.343  1.00 15.02 ? 661  GLY A O   1 
ATOM   5325 N N   . ARG A 1 662 ? 27.430 44.198 54.783  1.00 15.20 ? 662  ARG A N   1 
ATOM   5326 C CA  . ARG A 1 662 ? 27.301 44.451 53.347  1.00 17.14 ? 662  ARG A CA  1 
ATOM   5327 C C   . ARG A 1 662 ? 26.056 43.844 52.707  1.00 16.86 ? 662  ARG A C   1 
ATOM   5328 O O   . ARG A 1 662 ? 25.689 44.213 51.589  1.00 17.64 ? 662  ARG A O   1 
ATOM   5329 C CB  . ARG A 1 662 ? 28.541 43.956 52.597  1.00 19.06 ? 662  ARG A CB  1 
ATOM   5330 C CG  . ARG A 1 662 ? 29.832 44.662 52.973  1.00 22.53 ? 662  ARG A CG  1 
ATOM   5331 C CD  . ARG A 1 662 ? 30.905 44.431 51.924  1.00 25.55 ? 662  ARG A CD  1 
ATOM   5332 N NE  . ARG A 1 662 ? 31.026 43.021 51.553  1.00 28.30 ? 662  ARG A NE  1 
ATOM   5333 C CZ  . ARG A 1 662 ? 31.493 42.585 50.387  1.00 29.98 ? 662  ARG A CZ  1 
ATOM   5334 N NH1 . ARG A 1 662 ? 31.893 43.447 49.465  1.00 31.18 ? 662  ARG A NH1 1 
ATOM   5335 N NH2 . ARG A 1 662 ? 31.561 41.285 50.144  1.00 31.01 ? 662  ARG A NH2 1 
ATOM   5336 N N   . SER A 1 663 ? 25.431 42.883 53.378  1.00 16.68 ? 663  SER A N   1 
ATOM   5337 C CA  . SER A 1 663 ? 24.243 42.251 52.819  1.00 16.79 ? 663  SER A CA  1 
ATOM   5338 C C   . SER A 1 663 ? 23.074 43.232 52.764  1.00 17.19 ? 663  SER A C   1 
ATOM   5339 O O   . SER A 1 663 ? 22.864 44.017 53.685  1.00 16.44 ? 663  SER A O   1 
ATOM   5340 C CB  . SER A 1 663 ? 23.869 40.979 53.592  1.00 16.83 ? 663  SER A CB  1 
ATOM   5341 O OG  . SER A 1 663 ? 23.438 41.253 54.908  1.00 16.43 ? 663  SER A OG  1 
ATOM   5342 N N   . ARG A 1 664 ? 22.304 43.158 51.685  1.00 17.87 ? 664  ARG A N   1 
ATOM   5343 C CA  . ARG A 1 664 ? 21.167 44.047 51.490  1.00 18.96 ? 664  ARG A CA  1 
ATOM   5344 C C   . ARG A 1 664 ? 20.089 43.897 52.557  1.00 17.69 ? 664  ARG A C   1 
ATOM   5345 O O   . ARG A 1 664 ? 19.479 44.882 52.960  1.00 17.95 ? 664  ARG A O   1 
ATOM   5346 C CB  . ARG A 1 664 ? 20.559 43.844 50.101  1.00 21.57 ? 664  ARG A CB  1 
ATOM   5347 C CG  . ARG A 1 664 ? 19.329 44.700 49.838  1.00 25.23 ? 664  ARG A CG  1 
ATOM   5348 C CD  . ARG A 1 664 ? 18.908 44.645 48.385  1.00 28.53 ? 664  ARG A CD  1 
ATOM   5349 N NE  . ARG A 1 664 ? 19.867 45.318 47.510  1.00 31.51 ? 664  ARG A NE  1 
ATOM   5350 C CZ  . ARG A 1 664 ? 19.537 45.992 46.413  1.00 33.00 ? 664  ARG A CZ  1 
ATOM   5351 N NH1 . ARG A 1 664 ? 18.269 46.089 46.043  1.00 33.67 ? 664  ARG A NH1 1 
ATOM   5352 N NH2 . ARG A 1 664 ? 20.478 46.579 45.688  1.00 33.79 ? 664  ARG A NH2 1 
ATOM   5353 N N   . LYS A 1 665 ? 19.891 42.680 53.053  1.00 16.74 ? 665  LYS A N   1 
ATOM   5354 C CA  . LYS A 1 665 ? 18.866 42.458 54.070  1.00 14.90 ? 665  LYS A CA  1 
ATOM   5355 C C   . LYS A 1 665 ? 19.239 42.989 55.456  1.00 13.97 ? 665  LYS A C   1 
ATOM   5356 O O   . LYS A 1 665 ? 18.380 43.121 56.332  1.00 14.04 ? 665  LYS A O   1 
ATOM   5357 C CB  . LYS A 1 665 ? 18.497 40.973 54.146  1.00 15.27 ? 665  LYS A CB  1 
ATOM   5358 C CG  . LYS A 1 665 ? 19.568 40.066 54.740  1.00 14.52 ? 665  LYS A CG  1 
ATOM   5359 C CD  . LYS A 1 665 ? 19.013 38.670 54.970  1.00 14.99 ? 665  LYS A CD  1 
ATOM   5360 C CE  . LYS A 1 665 ? 20.107 37.704 55.378  1.00 14.97 ? 665  LYS A CE  1 
ATOM   5361 N NZ  . LYS A 1 665 ? 19.562 36.363 55.700  1.00 16.33 ? 665  LYS A NZ  1 
ATOM   5362 N N   . GLN A 1 666 ? 20.520 43.272 55.660  1.00 13.20 ? 666  GLN A N   1 
ATOM   5363 C CA  . GLN A 1 666 ? 20.974 43.779 56.947  1.00 12.52 ? 666  GLN A CA  1 
ATOM   5364 C C   . GLN A 1 666 ? 20.723 45.281 57.094  1.00 12.60 ? 666  GLN A C   1 
ATOM   5365 O O   . GLN A 1 666 ? 21.398 46.105 56.482  1.00 13.79 ? 666  GLN A O   1 
ATOM   5366 C CB  . GLN A 1 666 ? 22.461 43.483 57.154  1.00 11.14 ? 666  GLN A CB  1 
ATOM   5367 C CG  . GLN A 1 666 ? 22.960 43.817 58.564  1.00 9.99  ? 666  GLN A CG  1 
ATOM   5368 C CD  . GLN A 1 666 ? 22.337 42.925 59.636  1.00 10.14 ? 666  GLN A CD  1 
ATOM   5369 O OE1 . GLN A 1 666 ? 22.049 41.753 59.402  1.00 9.60  ? 666  GLN A OE1 1 
ATOM   5370 N NE2 . GLN A 1 666 ? 22.157 43.478 60.830  1.00 10.34 ? 666  GLN A NE2 1 
ATOM   5371 N N   . ASN A 1 667 ? 19.716 45.622 57.885  1.00 12.84 ? 667  ASN A N   1 
ATOM   5372 C CA  . ASN A 1 667 ? 19.383 47.015 58.133  1.00 13.52 ? 667  ASN A CA  1 
ATOM   5373 C C   . ASN A 1 667 ? 19.719 47.418 59.569  1.00 12.62 ? 667  ASN A C   1 
ATOM   5374 O O   . ASN A 1 667 ? 19.811 48.601 59.883  1.00 13.55 ? 667  ASN A O   1 
ATOM   5375 C CB  . ASN A 1 667 ? 17.905 47.278 57.825  1.00 15.51 ? 667  ASN A CB  1 
ATOM   5376 C CG  . ASN A 1 667 ? 17.571 47.078 56.360  1.00 17.06 ? 667  ASN A CG  1 
ATOM   5377 O OD1 . ASN A 1 667 ? 18.265 47.584 55.481  1.00 19.41 ? 667  ASN A OD1 1 
ATOM   5378 N ND2 . ASN A 1 667 ? 16.507 46.336 56.092  1.00 17.50 ? 667  ASN A ND2 1 
ATOM   5379 N N   . ASN A 1 668 ? 19.907 46.427 60.436  1.00 10.91 ? 668  ASN A N   1 
ATOM   5380 C CA  . ASN A 1 668 ? 20.258 46.702 61.831  1.00 10.02 ? 668  ASN A CA  1 
ATOM   5381 C C   . ASN A 1 668 ? 21.732 47.088 61.868  1.00 8.97  ? 668  ASN A C   1 
ATOM   5382 O O   . ASN A 1 668 ? 22.562 46.410 61.263  1.00 9.30  ? 668  ASN A O   1 
ATOM   5383 C CB  . ASN A 1 668 ? 20.004 45.474 62.710  1.00 10.34 ? 668  ASN A CB  1 
ATOM   5384 C CG  . ASN A 1 668 ? 18.530 45.170 62.870  1.00 9.91  ? 668  ASN A CG  1 
ATOM   5385 O OD1 . ASN A 1 668 ? 17.682 46.055 62.696  1.00 11.74 ? 668  ASN A OD1 1 
ATOM   5386 N ND2 . ASN A 1 668 ? 18.208 43.925 63.201  1.00 10.07 ? 668  ASN A ND2 1 
ATOM   5387 N N   . PRO A 1 669 ? 22.083 48.168 62.591  1.00 8.59  ? 669  PRO A N   1 
ATOM   5388 C CA  . PRO A 1 669 ? 23.475 48.623 62.679  1.00 8.24  ? 669  PRO A CA  1 
ATOM   5389 C C   . PRO A 1 669 ? 24.389 47.671 63.448  1.00 7.82  ? 669  PRO A C   1 
ATOM   5390 O O   . PRO A 1 669 ? 23.944 46.993 64.378  1.00 8.25  ? 669  PRO A O   1 
ATOM   5391 C CB  . PRO A 1 669 ? 23.344 49.970 63.397  1.00 8.32  ? 669  PRO A CB  1 
ATOM   5392 C CG  . PRO A 1 669 ? 22.213 49.727 64.337  1.00 9.14  ? 669  PRO A CG  1 
ATOM   5393 C CD  . PRO A 1 669 ? 21.213 48.984 63.453  1.00 8.37  ? 669  PRO A CD  1 
ATOM   5394 N N   . LEU A 1 670 ? 25.657 47.624 63.040  1.00 7.75  ? 670  LEU A N   1 
ATOM   5395 C CA  . LEU A 1 670 ? 26.694 46.785 63.654  1.00 7.51  ? 670  LEU A CA  1 
ATOM   5396 C C   . LEU A 1 670 ? 27.812 47.790 63.907  1.00 8.02  ? 670  LEU A C   1 
ATOM   5397 O O   . LEU A 1 670 ? 28.593 48.097 63.013  1.00 8.10  ? 670  LEU A O   1 
ATOM   5398 C CB  . LEU A 1 670 ? 27.139 45.686 62.678  1.00 8.54  ? 670  LEU A CB  1 
ATOM   5399 C CG  . LEU A 1 670 ? 26.003 44.792 62.173  1.00 8.54  ? 670  LEU A CG  1 
ATOM   5400 C CD1 . LEU A 1 670 ? 26.460 43.997 60.966  1.00 9.08  ? 670  LEU A CD1 1 
ATOM   5401 C CD2 . LEU A 1 670 ? 25.518 43.869 63.287  1.00 9.41  ? 670  LEU A CD2 1 
ATOM   5402 N N   . LEU A 1 671 ? 27.913 48.260 65.145  1.00 7.28  ? 671  LEU A N   1 
ATOM   5403 C CA  . LEU A 1 671 ? 28.860 49.318 65.488  1.00 7.09  ? 671  LEU A CA  1 
ATOM   5404 C C   . LEU A 1 671 ? 29.797 49.043 66.641  1.00 6.81  ? 671  LEU A C   1 
ATOM   5405 O O   . LEU A 1 671 ? 29.539 48.177 67.467  1.00 7.03  ? 671  LEU A O   1 
ATOM   5406 C CB  . LEU A 1 671 ? 28.060 50.569 65.849  1.00 7.94  ? 671  LEU A CB  1 
ATOM   5407 C CG  . LEU A 1 671 ? 26.995 51.059 64.865  1.00 8.31  ? 671  LEU A CG  1 
ATOM   5408 C CD1 . LEU A 1 671 ? 26.164 52.172 65.478  1.00 8.04  ? 671  LEU A CD1 1 
ATOM   5409 C CD2 . LEU A 1 671 ? 27.650 51.544 63.595  1.00 10.25 ? 671  LEU A CD2 1 
ATOM   5410 N N   . ILE A 1 672 ? 30.862 49.833 66.706  1.00 6.72  ? 672  ILE A N   1 
ATOM   5411 C CA  . ILE A 1 672 ? 31.833 49.757 67.792  1.00 7.23  ? 672  ILE A CA  1 
ATOM   5412 C C   . ILE A 1 672 ? 32.172 51.161 68.282  1.00 7.49  ? 672  ILE A C   1 
ATOM   5413 O O   . ILE A 1 672 ? 32.148 52.117 67.515  1.00 6.95  ? 672  ILE A O   1 
ATOM   5414 C CB  . ILE A 1 672 ? 33.151 49.063 67.355  1.00 6.30  ? 672  ILE A CB  1 
ATOM   5415 C CG1 . ILE A 1 672 ? 34.072 48.865 68.565  1.00 6.88  ? 672  ILE A CG1 1 
ATOM   5416 C CG2 . ILE A 1 672 ? 33.865 49.904 66.294  1.00 6.88  ? 672  ILE A CG2 1 
ATOM   5417 C CD1 . ILE A 1 672 ? 35.336 48.064 68.270  1.00 7.74  ? 672  ILE A CD1 1 
ATOM   5418 N N   . HIS A 1 673 ? 32.400 51.296 69.578  1.00 8.20  ? 673  HIS A N   1 
ATOM   5419 C CA  . HIS A 1 673 ? 32.819 52.574 70.127  1.00 8.82  ? 673  HIS A CA  1 
ATOM   5420 C C   . HIS A 1 673 ? 34.053 52.256 70.945  1.00 8.65  ? 673  HIS A C   1 
ATOM   5421 O O   . HIS A 1 673 ? 34.019 51.384 71.811  1.00 9.07  ? 673  HIS A O   1 
ATOM   5422 C CB  . HIS A 1 673 ? 31.749 53.214 71.015  1.00 10.08 ? 673  HIS A CB  1 
ATOM   5423 C CG  . HIS A 1 673 ? 32.176 54.524 71.608  1.00 12.54 ? 673  HIS A CG  1 
ATOM   5424 N ND1 . HIS A 1 673 ? 32.599 55.588 70.835  1.00 14.73 ? 673  HIS A ND1 1 
ATOM   5425 C CD2 . HIS A 1 673 ? 32.257 54.936 72.900  1.00 14.36 ? 673  HIS A CD2 1 
ATOM   5426 C CE1 . HIS A 1 673 ? 32.918 56.596 71.624  1.00 15.08 ? 673  HIS A CE1 1 
ATOM   5427 N NE2 . HIS A 1 673 ? 32.723 56.225 72.879  1.00 15.45 ? 673  HIS A NE2 1 
ATOM   5428 N N   . VAL A 1 674 ? 35.161 52.904 70.614  1.00 7.80  ? 674  VAL A N   1 
ATOM   5429 C CA  . VAL A 1 674 ? 36.413 52.698 71.326  1.00 8.21  ? 674  VAL A CA  1 
ATOM   5430 C C   . VAL A 1 674 ? 36.690 53.973 72.114  1.00 7.95  ? 674  VAL A C   1 
ATOM   5431 O O   . VAL A 1 674 ? 36.883 55.043 71.530  1.00 8.45  ? 674  VAL A O   1 
ATOM   5432 C CB  . VAL A 1 674 ? 37.591 52.447 70.353  1.00 8.13  ? 674  VAL A CB  1 
ATOM   5433 C CG1 . VAL A 1 674 ? 38.864 52.145 71.132  1.00 9.38  ? 674  VAL A CG1 1 
ATOM   5434 C CG2 . VAL A 1 674 ? 37.277 51.309 69.398  1.00 8.06  ? 674  VAL A CG2 1 
ATOM   5435 N N   . ASP A 1 675 ? 36.667 53.869 73.437  1.00 8.00  ? 675  ASP A N   1 
ATOM   5436 C CA  . ASP A 1 675 ? 36.914 55.015 74.303  1.00 8.42  ? 675  ASP A CA  1 
ATOM   5437 C C   . ASP A 1 675 ? 38.403 55.238 74.509  1.00 8.29  ? 675  ASP A C   1 
ATOM   5438 O O   . ASP A 1 675 ? 39.226 54.365 74.217  1.00 8.10  ? 675  ASP A O   1 
ATOM   5439 C CB  . ASP A 1 675 ? 36.234 54.808 75.664  1.00 10.37 ? 675  ASP A CB  1 
ATOM   5440 C CG  . ASP A 1 675 ? 36.086 56.109 76.462  1.00 11.25 ? 675  ASP A CG  1 
ATOM   5441 O OD1 . ASP A 1 675 ? 36.129 57.206 75.859  1.00 13.04 ? 675  ASP A OD1 1 
ATOM   5442 O OD2 . ASP A 1 675 ? 35.922 56.017 77.694  1.00 13.69 ? 675  ASP A OD2 1 
ATOM   5443 N N   . THR A 1 676 ? 38.748 56.443 74.948  1.00 8.43  ? 676  THR A N   1 
ATOM   5444 C CA  . THR A 1 676 ? 40.130 56.798 75.233  1.00 9.61  ? 676  THR A CA  1 
ATOM   5445 C C   . THR A 1 676 ? 40.299 56.940 76.748  1.00 9.51  ? 676  THR A C   1 
ATOM   5446 O O   . THR A 1 676 ? 39.332 57.186 77.467  1.00 10.54 ? 676  THR A O   1 
ATOM   5447 C CB  . THR A 1 676 ? 40.513 58.128 74.569  1.00 10.25 ? 676  THR A CB  1 
ATOM   5448 O OG1 . THR A 1 676 ? 39.558 59.137 74.924  1.00 11.41 ? 676  THR A OG1 1 
ATOM   5449 C CG2 . THR A 1 676 ? 40.576 57.988 73.048  1.00 11.81 ? 676  THR A CG2 1 
ATOM   5450 N N   . LYS A 1 677 ? 41.540 56.797 77.200  1.00 9.01  ? 677  LYS A N   1 
ATOM   5451 C CA  . LYS A 1 677 ? 41.881 56.905 78.618  1.00 8.81  ? 677  LYS A CA  1 
ATOM   5452 C C   . LYS A 1 677 ? 40.992 56.037 79.511  1.00 8.10  ? 677  LYS A C   1 
ATOM   5453 O O   . LYS A 1 677 ? 40.623 56.415 80.627  1.00 8.71  ? 677  LYS A O   1 
ATOM   5454 C CB  . LYS A 1 677 ? 41.872 58.371 79.062  1.00 9.42  ? 677  LYS A CB  1 
ATOM   5455 C CG  . LYS A 1 677 ? 42.749 59.259 78.178  1.00 10.64 ? 677  LYS A CG  1 
ATOM   5456 C CD  . LYS A 1 677 ? 42.925 60.657 78.741  1.00 12.34 ? 677  LYS A CD  1 
ATOM   5457 C CE  . LYS A 1 677 ? 43.649 60.637 80.076  1.00 12.93 ? 677  LYS A CE  1 
ATOM   5458 N NZ  . LYS A 1 677 ? 43.769 62.013 80.616  1.00 14.39 ? 677  LYS A NZ  1 
ATOM   5459 N N   . ALA A 1 678 ? 40.703 54.841 79.015  1.00 8.19  ? 678  ALA A N   1 
ATOM   5460 C CA  . ALA A 1 678 ? 39.882 53.883 79.736  1.00 8.52  ? 678  ALA A CA  1 
ATOM   5461 C C   . ALA A 1 678 ? 40.369 52.479 79.424  1.00 7.98  ? 678  ALA A C   1 
ATOM   5462 O O   . ALA A 1 678 ? 41.038 52.249 78.413  1.00 6.83  ? 678  ALA A O   1 
ATOM   5463 C CB  . ALA A 1 678 ? 38.416 54.040 79.361  1.00 9.56  ? 678  ALA A CB  1 
ATOM   5464 N N   . GLY A 1 679 ? 40.020 51.551 80.306  1.00 7.31  ? 679  GLY A N   1 
ATOM   5465 C CA  . GLY A 1 679 ? 40.430 50.173 80.146  1.00 7.24  ? 679  GLY A CA  1 
ATOM   5466 C C   . GLY A 1 679 ? 39.312 49.169 80.311  1.00 6.94  ? 679  GLY A C   1 
ATOM   5467 O O   . GLY A 1 679 ? 38.185 49.413 79.922  1.00 7.74  ? 679  GLY A O   1 
ATOM   5468 N N   . HIS A 1 680 ? 39.611 48.049 80.957  1.00 6.14  ? 680  HIS A N   1 
ATOM   5469 C CA  . HIS A 1 680 ? 38.615 47.000 81.114  1.00 6.72  ? 680  HIS A CA  1 
ATOM   5470 C C   . HIS A 1 680 ? 37.363 47.422 81.870  1.00 7.59  ? 680  HIS A C   1 
ATOM   5471 O O   . HIS A 1 680 ? 36.290 46.849 81.660  1.00 8.54  ? 680  HIS A O   1 
ATOM   5472 C CB  . HIS A 1 680 ? 39.246 45.777 81.757  1.00 6.84  ? 680  HIS A CB  1 
ATOM   5473 C CG  . HIS A 1 680 ? 38.534 44.501 81.453  1.00 5.84  ? 680  HIS A CG  1 
ATOM   5474 N ND1 . HIS A 1 680 ? 38.263 44.074 80.163  1.00 6.85  ? 680  HIS A ND1 1 
ATOM   5475 C CD2 . HIS A 1 680 ? 38.067 43.527 82.272  1.00 6.88  ? 680  HIS A CD2 1 
ATOM   5476 C CE1 . HIS A 1 680 ? 37.665 42.907 80.204  1.00 7.08  ? 680  HIS A CE1 1 
ATOM   5477 N NE2 . HIS A 1 680 ? 37.535 42.554 81.477  1.00 7.51  ? 680  HIS A NE2 1 
ATOM   5478 N N   . GLY A 1 681 ? 37.515 48.378 82.779  1.00 7.83  ? 681  GLY A N   1 
ATOM   5479 C CA  . GLY A 1 681 ? 36.378 48.869 83.534  1.00 7.98  ? 681  GLY A CA  1 
ATOM   5480 C C   . GLY A 1 681 ? 36.671 49.288 84.965  1.00 7.47  ? 681  GLY A C   1 
ATOM   5481 O O   . GLY A 1 681 ? 36.102 50.267 85.443  1.00 8.09  ? 681  GLY A O   1 
ATOM   5482 N N   . ALA A 1 682 ? 37.525 48.543 85.659  1.00 7.33  ? 682  ALA A N   1 
ATOM   5483 C CA  . ALA A 1 682 ? 37.847 48.891 87.044  1.00 8.03  ? 682  ALA A CA  1 
ATOM   5484 C C   . ALA A 1 682 ? 38.434 50.300 87.127  1.00 8.71  ? 682  ALA A C   1 
ATOM   5485 O O   . ALA A 1 682 ? 39.303 50.663 86.346  1.00 8.84  ? 682  ALA A O   1 
ATOM   5486 C CB  . ALA A 1 682 ? 38.832 47.883 87.642  1.00 8.29  ? 682  ALA A CB  1 
ATOM   5487 N N   . GLY A 1 683 ? 37.956 51.078 88.087  1.00 8.65  ? 683  GLY A N   1 
ATOM   5488 C CA  . GLY A 1 683 ? 38.463 52.425 88.270  1.00 8.29  ? 683  GLY A CA  1 
ATOM   5489 C C   . GLY A 1 683 ? 37.994 53.473 87.281  1.00 8.03  ? 683  GLY A C   1 
ATOM   5490 O O   . GLY A 1 683 ? 38.491 54.602 87.299  1.00 7.99  ? 683  GLY A O   1 
ATOM   5491 N N   . LYS A 1 684 ? 37.063 53.108 86.404  1.00 8.07  ? 684  LYS A N   1 
ATOM   5492 C CA  . LYS A 1 684 ? 36.545 54.058 85.424  1.00 8.79  ? 684  LYS A CA  1 
ATOM   5493 C C   . LYS A 1 684 ? 35.862 55.197 86.175  1.00 8.43  ? 684  LYS A C   1 
ATOM   5494 O O   . LYS A 1 684 ? 35.044 54.963 87.064  1.00 8.68  ? 684  LYS A O   1 
ATOM   5495 C CB  . LYS A 1 684 ? 35.554 53.370 84.476  1.00 9.51  ? 684  LYS A CB  1 
ATOM   5496 C CG  . LYS A 1 684 ? 35.034 54.272 83.368  1.00 10.47 ? 684  LYS A CG  1 
ATOM   5497 C CD  . LYS A 1 684 ? 34.173 53.512 82.372  1.00 12.17 ? 684  LYS A CD  1 
ATOM   5498 C CE  . LYS A 1 684 ? 35.014 52.580 81.509  1.00 12.95 ? 684  LYS A CE  1 
ATOM   5499 N NZ  . LYS A 1 684 ? 34.190 51.935 80.453  1.00 14.24 ? 684  LYS A NZ  1 
ATOM   5500 N N   . PRO A 1 685 ? 36.198 56.445 85.831  1.00 8.48  ? 685  PRO A N   1 
ATOM   5501 C CA  . PRO A 1 685 ? 35.569 57.568 86.525  1.00 7.96  ? 685  PRO A CA  1 
ATOM   5502 C C   . PRO A 1 685 ? 34.070 57.666 86.267  1.00 8.33  ? 685  PRO A C   1 
ATOM   5503 O O   . PRO A 1 685 ? 33.582 57.300 85.191  1.00 8.81  ? 685  PRO A O   1 
ATOM   5504 C CB  . PRO A 1 685 ? 36.309 58.780 85.962  1.00 8.26  ? 685  PRO A CB  1 
ATOM   5505 C CG  . PRO A 1 685 ? 36.725 58.331 84.597  1.00 8.42  ? 685  PRO A CG  1 
ATOM   5506 C CD  . PRO A 1 685 ? 37.202 56.925 84.863  1.00 8.08  ? 685  PRO A CD  1 
ATOM   5507 N N   . THR A 1 686 ? 33.360 58.235 87.233  1.00 7.98  ? 686  THR A N   1 
ATOM   5508 C CA  . THR A 1 686 ? 31.917 58.427 87.157  1.00 7.87  ? 686  THR A CA  1 
ATOM   5509 C C   . THR A 1 686 ? 31.476 59.078 85.841  1.00 8.34  ? 686  THR A C   1 
ATOM   5510 O O   . THR A 1 686 ? 30.499 58.634 85.220  1.00 8.44  ? 686  THR A O   1 
ATOM   5511 C CB  . THR A 1 686 ? 31.431 59.282 88.345  1.00 8.72  ? 686  THR A CB  1 
ATOM   5512 O OG1 . THR A 1 686 ? 31.763 58.610 89.564  1.00 9.40  ? 686  THR A OG1 1 
ATOM   5513 C CG2 . THR A 1 686 ? 29.923 59.506 88.269  1.00 9.88  ? 686  THR A CG2 1 
ATOM   5514 N N   . ALA A 1 687 ? 32.205 60.103 85.397  1.00 8.43  ? 687  ALA A N   1 
ATOM   5515 C CA  . ALA A 1 687 ? 31.838 60.774 84.156  1.00 9.04  ? 687  ALA A CA  1 
ATOM   5516 C C   . ALA A 1 687 ? 31.799 59.791 82.989  1.00 9.19  ? 687  ALA A C   1 
ATOM   5517 O O   . ALA A 1 687 ? 30.861 59.807 82.197  1.00 9.25  ? 687  ALA A O   1 
ATOM   5518 C CB  . ALA A 1 687 ? 32.786 61.920 83.864  1.00 10.02 ? 687  ALA A CB  1 
ATOM   5519 N N   . LYS A 1 688 ? 32.788 58.901 82.923  1.00 8.52  ? 688  LYS A N   1 
ATOM   5520 C CA  . LYS A 1 688 ? 32.836 57.920 81.840  1.00 9.09  ? 688  LYS A CA  1 
ATOM   5521 C C   . LYS A 1 688 ? 31.760 56.849 81.997  1.00 8.71  ? 688  LYS A C   1 
ATOM   5522 O O   . LYS A 1 688 ? 31.191 56.379 81.012  1.00 9.20  ? 688  LYS A O   1 
ATOM   5523 C CB  . LYS A 1 688 ? 34.224 57.288 81.728  1.00 10.22 ? 688  LYS A CB  1 
ATOM   5524 C CG  . LYS A 1 688 ? 35.268 58.182 81.094  1.00 10.25 ? 688  LYS A CG  1 
ATOM   5525 C CD  . LYS A 1 688 ? 36.568 57.428 80.888  1.00 11.29 ? 688  LYS A CD  1 
ATOM   5526 C CE  . LYS A 1 688 ? 37.562 58.245 80.095  1.00 11.94 ? 688  LYS A CE  1 
ATOM   5527 N NZ  . LYS A 1 688 ? 37.141 58.461 78.680  1.00 12.62 ? 688  LYS A NZ  1 
ATOM   5528 N N   . VAL A 1 689 ? 31.479 56.462 83.236  1.00 8.65  ? 689  VAL A N   1 
ATOM   5529 C CA  . VAL A 1 689 ? 30.432 55.473 83.501  1.00 9.05  ? 689  VAL A CA  1 
ATOM   5530 C C   . VAL A 1 689 ? 29.093 56.022 82.978  1.00 10.01 ? 689  VAL A C   1 
ATOM   5531 O O   . VAL A 1 689 ? 28.359 55.334 82.266  1.00 10.19 ? 689  VAL A O   1 
ATOM   5532 C CB  . VAL A 1 689 ? 30.329 55.153 85.011  1.00 10.09 ? 689  VAL A CB  1 
ATOM   5533 C CG1 . VAL A 1 689 ? 29.078 54.322 85.300  1.00 10.82 ? 689  VAL A CG1 1 
ATOM   5534 C CG2 . VAL A 1 689 ? 31.577 54.412 85.466  1.00 10.47 ? 689  VAL A CG2 1 
ATOM   5535 N N   . ILE A 1 690 ? 28.809 57.283 83.282  1.00 9.51  ? 690  ILE A N   1 
ATOM   5536 C CA  . ILE A 1 690 ? 27.580 57.918 82.829  1.00 9.59  ? 690  ILE A CA  1 
ATOM   5537 C C   . ILE A 1 690 ? 27.490 57.984 81.305  1.00 9.76  ? 690  ILE A C   1 
ATOM   5538 O O   . ILE A 1 690 ? 26.445 57.686 80.732  1.00 9.79  ? 690  ILE A O   1 
ATOM   5539 C CB  . ILE A 1 690 ? 27.426 59.316 83.453  1.00 9.51  ? 690  ILE A CB  1 
ATOM   5540 C CG1 . ILE A 1 690 ? 27.190 59.185 84.957  1.00 9.69  ? 690  ILE A CG1 1 
ATOM   5541 C CG2 . ILE A 1 690 ? 26.281 60.077 82.788  1.00 9.71  ? 690  ILE A CG2 1 
ATOM   5542 C CD1 . ILE A 1 690 ? 27.128 60.501 85.690  1.00 10.69 ? 690  ILE A CD1 1 
ATOM   5543 N N   . GLU A 1 691 ? 28.588 58.346 80.648  1.00 9.61  ? 691  GLU A N   1 
ATOM   5544 C CA  . GLU A 1 691 ? 28.581 58.402 79.189  1.00 10.00 ? 691  GLU A CA  1 
ATOM   5545 C C   . GLU A 1 691 ? 28.330 57.018 78.597  1.00 9.79  ? 691  GLU A C   1 
ATOM   5546 O O   . GLU A 1 691 ? 27.583 56.869 77.629  1.00 9.63  ? 691  GLU A O   1 
ATOM   5547 C CB  . GLU A 1 691 ? 29.907 58.947 78.645  1.00 10.44 ? 691  GLU A CB  1 
ATOM   5548 C CG  . GLU A 1 691 ? 30.227 60.392 79.011  1.00 13.38 ? 691  GLU A CG  1 
ATOM   5549 C CD  . GLU A 1 691 ? 29.226 61.393 78.472  1.00 14.96 ? 691  GLU A CD  1 
ATOM   5550 O OE1 . GLU A 1 691 ? 28.898 61.337 77.268  1.00 17.09 ? 691  GLU A OE1 1 
ATOM   5551 O OE2 . GLU A 1 691 ? 28.794 62.259 79.253  1.00 17.17 ? 691  GLU A OE2 1 
ATOM   5552 N N   . GLU A 1 692 ? 28.935 56.002 79.203  1.00 8.34  ? 692  GLU A N   1 
ATOM   5553 C CA  . GLU A 1 692 ? 28.793 54.635 78.721  1.00 9.06  ? 692  GLU A CA  1 
ATOM   5554 C C   . GLU A 1 692 ? 27.375 54.087 78.811  1.00 8.38  ? 692  GLU A C   1 
ATOM   5555 O O   . GLU A 1 692 ? 26.874 53.521 77.835  1.00 7.64  ? 692  GLU A O   1 
ATOM   5556 C CB  . GLU A 1 692 ? 29.768 53.709 79.446  1.00 11.10 ? 692  GLU A CB  1 
ATOM   5557 C CG  . GLU A 1 692 ? 29.664 52.257 79.020  1.00 13.38 ? 692  GLU A CG  1 
ATOM   5558 C CD  . GLU A 1 692 ? 30.746 51.413 79.632  1.00 15.29 ? 692  GLU A CD  1 
ATOM   5559 O OE1 . GLU A 1 692 ? 30.536 50.905 80.752  1.00 17.34 ? 692  GLU A OE1 1 
ATOM   5560 O OE2 . GLU A 1 692 ? 31.808 51.285 78.996  1.00 16.94 ? 692  GLU A OE2 1 
ATOM   5561 N N   . VAL A 1 693 ? 26.731 54.225 79.964  1.00 8.39  ? 693  VAL A N   1 
ATOM   5562 C CA  . VAL A 1 693 ? 25.371 53.725 80.071  1.00 8.82  ? 693  VAL A CA  1 
ATOM   5563 C C   . VAL A 1 693 ? 24.430 54.530 79.174  1.00 8.65  ? 693  VAL A C   1 
ATOM   5564 O O   . VAL A 1 693 ? 23.478 53.976 78.628  1.00 8.24  ? 693  VAL A O   1 
ATOM   5565 C CB  . VAL A 1 693 ? 24.882 53.648 81.541  1.00 8.30  ? 693  VAL A CB  1 
ATOM   5566 C CG1 . VAL A 1 693 ? 25.737 52.637 82.312  1.00 10.84 ? 693  VAL A CG1 1 
ATOM   5567 C CG2 . VAL A 1 693 ? 24.930 55.025 82.218  1.00 9.94  ? 693  VAL A CG2 1 
ATOM   5568 N N   . SER A 1 694 ? 24.739 55.812 78.979  1.00 8.40  ? 694  SER A N   1 
ATOM   5569 C CA  . SER A 1 694 ? 23.934 56.667 78.118  1.00 8.65  ? 694  SER A CA  1 
ATOM   5570 C C   . SER A 1 694 ? 24.025 56.151 76.686  1.00 8.53  ? 694  SER A C   1 
ATOM   5571 O O   . SER A 1 694 ? 23.015 56.107 75.980  1.00 9.14  ? 694  SER A O   1 
ATOM   5572 C CB  . SER A 1 694 ? 24.410 58.113 78.212  1.00 9.07  ? 694  SER A CB  1 
ATOM   5573 O OG  . SER A 1 694 ? 24.106 58.647 79.489  1.00 10.09 ? 694  SER A OG  1 
ATOM   5574 N N   . ASP A 1 695 ? 25.222 55.728 76.281  1.00 8.25  ? 695  ASP A N   1 
ATOM   5575 C CA  . ASP A 1 695 ? 25.438 55.176 74.943  1.00 8.41  ? 695  ASP A CA  1 
ATOM   5576 C C   . ASP A 1 695 ? 24.674 53.868 74.791  1.00 8.25  ? 695  ASP A C   1 
ATOM   5577 O O   . ASP A 1 695 ? 23.993 53.646 73.792  1.00 8.43  ? 695  ASP A O   1 
ATOM   5578 C CB  . ASP A 1 695 ? 26.925 54.896 74.693  1.00 9.42  ? 695  ASP A CB  1 
ATOM   5579 C CG  . ASP A 1 695 ? 27.738 56.161 74.487  1.00 11.52 ? 695  ASP A CG  1 
ATOM   5580 O OD1 . ASP A 1 695 ? 27.161 57.197 74.123  1.00 11.44 ? 695  ASP A OD1 1 
ATOM   5581 O OD2 . ASP A 1 695 ? 28.965 56.112 74.687  1.00 12.57 ? 695  ASP A OD2 1 
ATOM   5582 N N   . MET A 1 696 ? 24.798 53.004 75.791  1.00 7.71  ? 696  MET A N   1 
ATOM   5583 C CA  . MET A 1 696 ? 24.133 51.709 75.775  1.00 7.80  ? 696  MET A CA  1 
ATOM   5584 C C   . MET A 1 696 ? 22.625 51.823 75.621  1.00 7.15  ? 696  MET A C   1 
ATOM   5585 O O   . MET A 1 696 ? 22.036 51.227 74.711  1.00 7.98  ? 696  MET A O   1 
ATOM   5586 C CB  . MET A 1 696 ? 24.451 50.934 77.058  1.00 9.04  ? 696  MET A CB  1 
ATOM   5587 C CG  . MET A 1 696 ? 25.898 50.494 77.171  1.00 9.93  ? 696  MET A CG  1 
ATOM   5588 S SD  . MET A 1 696 ? 26.261 49.768 78.776  1.00 12.66 ? 696  MET A SD  1 
ATOM   5589 C CE  . MET A 1 696 ? 25.119 48.391 78.783  1.00 12.31 ? 696  MET A CE  1 
ATOM   5590 N N   . PHE A 1 697 ? 22.006 52.615 76.485  1.00 8.07  ? 697  PHE A N   1 
ATOM   5591 C CA  . PHE A 1 697 ? 20.573 52.765 76.448  1.00 8.23  ? 697  PHE A CA  1 
ATOM   5592 C C   . PHE A 1 697 ? 20.010 53.588 75.306  1.00 8.34  ? 697  PHE A C   1 
ATOM   5593 O O   . PHE A 1 697 ? 18.874 53.365 74.887  1.00 9.00  ? 697  PHE A O   1 
ATOM   5594 C CB  . PHE A 1 697 ? 20.065 53.142 77.831  1.00 7.84  ? 697  PHE A CB  1 
ATOM   5595 C CG  . PHE A 1 697 ? 20.198 52.007 78.803  1.00 7.66  ? 697  PHE A CG  1 
ATOM   5596 C CD1 . PHE A 1 697 ? 21.249 51.968 79.709  1.00 8.90  ? 697  PHE A CD1 1 
ATOM   5597 C CD2 . PHE A 1 697 ? 19.348 50.908 78.720  1.00 8.16  ? 697  PHE A CD2 1 
ATOM   5598 C CE1 . PHE A 1 697 ? 21.471 50.848 80.500  1.00 9.39  ? 697  PHE A CE1 1 
ATOM   5599 C CE2 . PHE A 1 697 ? 19.558 49.781 79.504  1.00 8.55  ? 697  PHE A CE2 1 
ATOM   5600 C CZ  . PHE A 1 697 ? 20.623 49.752 80.400  1.00 8.26  ? 697  PHE A CZ  1 
ATOM   5601 N N   . ALA A 1 698 ? 20.822 54.487 74.758  1.00 8.30  ? 698  ALA A N   1 
ATOM   5602 C CA  . ALA A 1 698 ? 20.403 55.274 73.609  1.00 7.49  ? 698  ALA A CA  1 
ATOM   5603 C C   . ALA A 1 698 ? 20.392 54.312 72.412  1.00 7.73  ? 698  ALA A C   1 
ATOM   5604 O O   . ALA A 1 698 ? 19.490 54.363 71.577  1.00 8.04  ? 698  ALA A O   1 
ATOM   5605 C CB  . ALA A 1 698 ? 21.376 56.407 73.371  1.00 8.70  ? 698  ALA A CB  1 
ATOM   5606 N N   . PHE A 1 699 ? 21.391 53.430 72.340  1.00 7.51  ? 699  PHE A N   1 
ATOM   5607 C CA  . PHE A 1 699 ? 21.471 52.449 71.254  1.00 7.79  ? 699  PHE A CA  1 
ATOM   5608 C C   . PHE A 1 699 ? 20.238 51.562 71.296  1.00 8.40  ? 699  PHE A C   1 
ATOM   5609 O O   . PHE A 1 699 ? 19.583 51.352 70.284  1.00 8.48  ? 699  PHE A O   1 
ATOM   5610 C CB  . PHE A 1 699 ? 22.739 51.593 71.391  1.00 8.81  ? 699  PHE A CB  1 
ATOM   5611 C CG  . PHE A 1 699 ? 22.985 50.664 70.225  1.00 8.09  ? 699  PHE A CG  1 
ATOM   5612 C CD1 . PHE A 1 699 ? 23.403 51.164 68.996  1.00 8.50  ? 699  PHE A CD1 1 
ATOM   5613 C CD2 . PHE A 1 699 ? 22.819 49.284 70.370  1.00 8.06  ? 699  PHE A CD2 1 
ATOM   5614 C CE1 . PHE A 1 699 ? 23.658 50.297 67.921  1.00 7.93  ? 699  PHE A CE1 1 
ATOM   5615 C CE2 . PHE A 1 699 ? 23.070 48.416 69.305  1.00 9.23  ? 699  PHE A CE2 1 
ATOM   5616 C CZ  . PHE A 1 699 ? 23.489 48.919 68.078  1.00 8.41  ? 699  PHE A CZ  1 
ATOM   5617 N N   . ILE A 1 700 ? 19.926 51.045 72.478  1.00 7.54  ? 700  ILE A N   1 
ATOM   5618 C CA  . ILE A 1 700 ? 18.748 50.202 72.641  1.00 8.38  ? 700  ILE A CA  1 
ATOM   5619 C C   . ILE A 1 700 ? 17.478 50.957 72.233  1.00 8.83  ? 700  ILE A C   1 
ATOM   5620 O O   . ILE A 1 700 ? 16.698 50.477 71.402  1.00 8.47  ? 700  ILE A O   1 
ATOM   5621 C CB  . ILE A 1 700 ? 18.612 49.706 74.109  1.00 8.36  ? 700  ILE A CB  1 
ATOM   5622 C CG1 . ILE A 1 700 ? 19.749 48.734 74.444  1.00 7.41  ? 700  ILE A CG1 1 
ATOM   5623 C CG2 . ILE A 1 700 ? 17.238 49.054 74.343  1.00 8.73  ? 700  ILE A CG2 1 
ATOM   5624 C CD1 . ILE A 1 700 ? 19.926 48.497 75.922  1.00 8.91  ? 700  ILE A CD1 1 
ATOM   5625 N N   . ALA A 1 701 ? 17.304 52.153 72.787  1.00 8.89  ? 701  ALA A N   1 
ATOM   5626 C CA  . ALA A 1 701 ? 16.133 52.984 72.509  1.00 8.68  ? 701  ALA A CA  1 
ATOM   5627 C C   . ALA A 1 701 ? 15.942 53.295 71.043  1.00 9.55  ? 701  ALA A C   1 
ATOM   5628 O O   . ALA A 1 701 ? 14.823 53.217 70.534  1.00 9.67  ? 701  ALA A O   1 
ATOM   5629 C CB  . ALA A 1 701 ? 16.204 54.272 73.298  1.00 10.02 ? 701  ALA A CB  1 
ATOM   5630 N N   . ARG A 1 702 ? 17.019 53.677 70.369  1.00 9.18  ? 702  ARG A N   1 
ATOM   5631 C CA  . ARG A 1 702 ? 16.917 54.000 68.954  1.00 10.45 ? 702  ARG A CA  1 
ATOM   5632 C C   . ARG A 1 702 ? 16.636 52.770 68.092  1.00 11.11 ? 702  ARG A C   1 
ATOM   5633 O O   . ARG A 1 702 ? 15.735 52.773 67.250  1.00 11.01 ? 702  ARG A O   1 
ATOM   5634 C CB  . ARG A 1 702 ? 18.172 54.709 68.462  1.00 11.91 ? 702  ARG A CB  1 
ATOM   5635 C CG  . ARG A 1 702 ? 18.070 55.081 67.013  1.00 13.91 ? 702  ARG A CG  1 
ATOM   5636 C CD  . ARG A 1 702 ? 19.133 56.054 66.578  1.00 15.47 ? 702  ARG A CD  1 
ATOM   5637 N NE  . ARG A 1 702 ? 18.884 56.448 65.197  1.00 16.52 ? 702  ARG A NE  1 
ATOM   5638 C CZ  . ARG A 1 702 ? 19.698 57.194 64.462  1.00 17.30 ? 702  ARG A CZ  1 
ATOM   5639 N NH1 . ARG A 1 702 ? 20.832 57.645 64.967  1.00 15.46 ? 702  ARG A NH1 1 
ATOM   5640 N NH2 . ARG A 1 702 ? 19.372 57.476 63.206  1.00 18.36 ? 702  ARG A NH2 1 
ATOM   5641 N N   . CYS A 1 703 ? 17.394 51.708 68.316  1.00 10.06 ? 703  CYS A N   1 
ATOM   5642 C CA  . CYS A 1 703 ? 17.206 50.488 67.547  1.00 10.03 ? 703  CYS A CA  1 
ATOM   5643 C C   . CYS A 1 703 ? 15.813 49.878 67.704  1.00 10.67 ? 703  CYS A C   1 
ATOM   5644 O O   . CYS A 1 703 ? 15.222 49.417 66.725  1.00 11.05 ? 703  CYS A O   1 
ATOM   5645 C CB  . CYS A 1 703 ? 18.288 49.470 67.904  1.00 10.77 ? 703  CYS A CB  1 
ATOM   5646 S SG  . CYS A 1 703 ? 19.926 49.960 67.298  1.00 11.22 ? 703  CYS A SG  1 
ATOM   5647 N N   . LEU A 1 704 ? 15.279 49.903 68.920  1.00 10.89 ? 704  LEU A N   1 
ATOM   5648 C CA  . LEU A 1 704 ? 13.956 49.337 69.163  1.00 11.80 ? 704  LEU A CA  1 
ATOM   5649 C C   . LEU A 1 704 ? 12.848 50.397 69.153  1.00 12.22 ? 704  LEU A C   1 
ATOM   5650 O O   . LEU A 1 704 ? 11.689 50.067 69.353  1.00 12.55 ? 704  LEU A O   1 
ATOM   5651 C CB  . LEU A 1 704 ? 13.931 48.559 70.488  1.00 13.30 ? 704  LEU A CB  1 
ATOM   5652 C CG  . LEU A 1 704 ? 15.063 47.574 70.817  1.00 15.05 ? 704  LEU A CG  1 
ATOM   5653 C CD1 . LEU A 1 704 ? 14.650 46.723 72.006  1.00 14.29 ? 704  LEU A CD1 1 
ATOM   5654 C CD2 . LEU A 1 704 ? 15.437 46.695 69.639  1.00 16.13 ? 704  LEU A CD2 1 
ATOM   5655 N N   . ASN A 1 705 ? 13.221 51.654 68.910  1.00 11.60 ? 705  ASN A N   1 
ATOM   5656 C CA  . ASN A 1 705 ? 12.289 52.795 68.876  1.00 12.44 ? 705  ASN A CA  1 
ATOM   5657 C C   . ASN A 1 705 ? 11.394 52.854 70.118  1.00 12.36 ? 705  ASN A C   1 
ATOM   5658 O O   . ASN A 1 705 ? 10.168 52.909 70.034  1.00 12.20 ? 705  ASN A O   1 
ATOM   5659 C CB  . ASN A 1 705 ? 11.449 52.777 67.591  1.00 13.32 ? 705  ASN A CB  1 
ATOM   5660 C CG  . ASN A 1 705 ? 10.869 54.151 67.233  1.00 13.96 ? 705  ASN A CG  1 
ATOM   5661 O OD1 . ASN A 1 705 ? 11.133 55.156 67.889  1.00 15.22 ? 705  ASN A OD1 1 
ATOM   5662 N ND2 . ASN A 1 705 ? 10.104 54.193 66.160  1.00 14.08 ? 705  ASN A ND2 1 
ATOM   5663 N N   . ILE A 1 706 ? 12.029 52.840 71.282  1.00 12.47 ? 706  ILE A N   1 
ATOM   5664 C CA  . ILE A 1 706 ? 11.325 52.888 72.553  1.00 12.90 ? 706  ILE A CA  1 
ATOM   5665 C C   . ILE A 1 706 ? 11.069 54.325 72.978  1.00 12.96 ? 706  ILE A C   1 
ATOM   5666 O O   . ILE A 1 706 ? 11.966 55.165 72.914  1.00 13.16 ? 706  ILE A O   1 
ATOM   5667 C CB  . ILE A 1 706 ? 12.153 52.185 73.663  1.00 12.42 ? 706  ILE A CB  1 
ATOM   5668 C CG1 . ILE A 1 706 ? 12.406 50.724 73.292  1.00 13.51 ? 706  ILE A CG1 1 
ATOM   5669 C CG2 . ILE A 1 706 ? 11.441 52.286 75.008  1.00 13.78 ? 706  ILE A CG2 1 
ATOM   5670 C CD1 . ILE A 1 706 ? 13.389 50.006 74.208  1.00 12.79 ? 706  ILE A CD1 1 
ATOM   5671 N N   . ASP A 1 707 ? 9.840  54.603 73.403  1.00 13.04 ? 707  ASP A N   1 
ATOM   5672 C CA  . ASP A 1 707 ? 9.461  55.929 73.883  1.00 13.16 ? 707  ASP A CA  1 
ATOM   5673 C C   . ASP A 1 707 ? 9.960  56.126 75.307  1.00 13.01 ? 707  ASP A C   1 
ATOM   5674 O O   . ASP A 1 707 ? 9.788  55.255 76.159  1.00 13.10 ? 707  ASP A O   1 
ATOM   5675 C CB  . ASP A 1 707 ? 7.932  56.094 73.934  1.00 14.53 ? 707  ASP A CB  1 
ATOM   5676 C CG  . ASP A 1 707 ? 7.311  56.429 72.592  1.00 16.53 ? 707  ASP A CG  1 
ATOM   5677 O OD1 . ASP A 1 707 ? 6.098  56.159 72.442  1.00 18.53 ? 707  ASP A OD1 1 
ATOM   5678 O OD2 . ASP A 1 707 ? 7.999  56.986 71.715  1.00 16.73 ? 707  ASP A OD2 1 
ATOM   5679 N N   . TRP A 1 708 ? 10.548 57.285 75.558  1.00 12.88 ? 708  TRP A N   1 
ATOM   5680 C CA  . TRP A 1 708 ? 11.013 57.638 76.887  1.00 12.98 ? 708  TRP A CA  1 
ATOM   5681 C C   . TRP A 1 708 ? 9.760  57.944 77.710  1.00 13.70 ? 708  TRP A C   1 
ATOM   5682 O O   . TRP A 1 708 ? 8.845  58.623 77.237  1.00 14.55 ? 708  TRP A O   1 
ATOM   5683 C CB  . TRP A 1 708 ? 11.899 58.889 76.809  1.00 13.49 ? 708  TRP A CB  1 
ATOM   5684 C CG  . TRP A 1 708 ? 12.356 59.423 78.149  1.00 14.10 ? 708  TRP A CG  1 
ATOM   5685 C CD1 . TRP A 1 708 ? 11.863 60.513 78.806  1.00 14.27 ? 708  TRP A CD1 1 
ATOM   5686 C CD2 . TRP A 1 708 ? 13.436 58.930 78.949  1.00 14.14 ? 708  TRP A CD2 1 
ATOM   5687 N NE1 . TRP A 1 708 ? 12.573 60.738 79.957  1.00 14.78 ? 708  TRP A NE1 1 
ATOM   5688 C CE2 . TRP A 1 708 ? 13.547 59.779 80.074  1.00 14.57 ? 708  TRP A CE2 1 
ATOM   5689 C CE3 . TRP A 1 708 ? 14.332 57.858 78.823  1.00 14.68 ? 708  TRP A CE3 1 
ATOM   5690 C CZ2 . TRP A 1 708 ? 14.514 59.594 81.067  1.00 15.05 ? 708  TRP A CZ2 1 
ATOM   5691 C CZ3 . TRP A 1 708 ? 15.298 57.673 79.810  1.00 15.09 ? 708  TRP A CZ3 1 
ATOM   5692 C CH2 . TRP A 1 708 ? 15.380 58.537 80.917  1.00 15.43 ? 708  TRP A CH2 1 
ATOM   5693 N N   . ILE A 1 709 ? 9.705  57.402 78.917  1.00 13.30 ? 709  ILE A N   1 
ATOM   5694 C CA  . ILE A 1 709 ? 8.594  57.632 79.830  1.00 14.46 ? 709  ILE A CA  1 
ATOM   5695 C C   . ILE A 1 709 ? 9.184  58.503 80.937  1.00 15.34 ? 709  ILE A C   1 
ATOM   5696 O O   . ILE A 1 709 ? 9.998  58.035 81.731  1.00 15.29 ? 709  ILE A O   1 
ATOM   5697 C CB  . ILE A 1 709 ? 8.078  56.312 80.436  1.00 14.24 ? 709  ILE A CB  1 
ATOM   5698 C CG1 . ILE A 1 709 ? 7.725  55.321 79.327  1.00 14.51 ? 709  ILE A CG1 1 
ATOM   5699 C CG2 . ILE A 1 709 ? 6.867  56.580 81.332  1.00 14.85 ? 709  ILE A CG2 1 
ATOM   5700 C CD1 . ILE A 1 709 ? 7.408  53.924 79.818  1.00 15.65 ? 709  ILE A CD1 1 
ATOM   5701 N N   . PRO A 1 710 ? 8.826  59.799 80.967  1.00 15.95 ? 710  PRO A N   1 
ATOM   5702 C CA  . PRO A 1 710 ? 9.331  60.736 81.979  1.00 16.52 ? 710  PRO A CA  1 
ATOM   5703 C C   . PRO A 1 710 ? 8.945  60.439 83.428  1.00 16.55 ? 710  PRO A C   1 
ATOM   5704 O O   . PRO A 1 710 ? 7.937  59.741 83.650  1.00 16.66 ? 710  PRO A O   1 
ATOM   5705 C CB  . PRO A 1 710 ? 8.788  62.084 81.493  1.00 16.91 ? 710  PRO A CB  1 
ATOM   5706 C CG  . PRO A 1 710 ? 7.513  61.711 80.818  1.00 17.53 ? 710  PRO A CG  1 
ATOM   5707 C CD  . PRO A 1 710 ? 7.917  60.481 80.033  1.00 16.33 ? 710  PRO A CD  1 
ATOM   5708 O OXT . PRO A 1 710 ? 9.681  60.883 84.340  1.00 17.25 ? 710  PRO A OXT 1 
HETATM 5709 C C1  . SGL B 2 .   ? 37.026 39.894 82.609  1.00 19.52 ? 781  SGL A C1  1 
HETATM 5710 S S1  . SGL B 2 .   ? 35.947 39.232 83.910  1.00 25.61 ? 781  SGL A S1  1 
HETATM 5711 C C2  . SGL B 2 .   ? 36.944 38.968 81.419  1.00 16.65 ? 781  SGL A C2  1 
HETATM 5712 O O2  . SGL B 2 .   ? 35.984 37.936 81.685  1.00 15.07 ? 781  SGL A O2  1 
HETATM 5713 C C3  . SGL B 2 .   ? 38.301 38.342 81.123  1.00 17.76 ? 781  SGL A C3  1 
HETATM 5714 O O3  . SGL B 2 .   ? 38.211 37.427 80.050  1.00 21.98 ? 781  SGL A O3  1 
HETATM 5715 O O4  . SGL B 2 .   ? 36.020 40.208 84.999  1.00 23.42 ? 781  SGL A O4  1 
HETATM 5716 C C1  . SGL C 2 .   ? 44.352 37.513 87.041  1.00 24.39 ? 782  SGL A C1  1 
HETATM 5717 S S1  . SGL C 2 .   ? 45.659 36.417 86.373  1.00 24.65 ? 782  SGL A S1  1 
HETATM 5718 C C2  . SGL C 2 .   ? 43.552 38.181 85.911  1.00 23.38 ? 782  SGL A C2  1 
HETATM 5719 O O2  . SGL C 2 .   ? 42.259 38.562 86.404  1.00 24.67 ? 782  SGL A O2  1 
HETATM 5720 C C3  . SGL C 2 .   ? 43.378 37.268 84.695  1.00 22.59 ? 782  SGL A C3  1 
HETATM 5721 O O3  . SGL C 2 .   ? 42.306 37.715 83.871  1.00 18.74 ? 782  SGL A O3  1 
HETATM 5722 O O4  . SGL C 2 .   ? 45.338 35.067 86.850  1.00 24.48 ? 782  SGL A O4  1 
HETATM 5723 C C1  . SGM D 3 .   ? 35.251 48.148 104.431 1.00 23.26 ? 783  SGM A C1  1 
HETATM 5724 C C2  . SGM D 3 .   ? 35.241 48.155 102.896 1.00 22.94 ? 783  SGM A C2  1 
HETATM 5725 O O2  . SGM D 3 .   ? 35.264 46.809 102.449 1.00 24.45 ? 783  SGM A O2  1 
HETATM 5726 C C3  . SGM D 3 .   ? 36.419 48.949 102.274 1.00 23.27 ? 783  SGM A C3  1 
HETATM 5727 O O3  . SGM D 3 .   ? 36.243 49.022 100.888 1.00 23.96 ? 783  SGM A O3  1 
HETATM 5728 S S1  . SGM D 3 .   ? 33.771 47.059 105.109 1.00 21.82 ? 783  SGM A S1  1 
HETATM 5729 C C1  . SGM E 3 .   ? 14.580 25.752 76.514  1.00 18.27 ? 784  SGM A C1  1 
HETATM 5730 C C2  . SGM E 3 .   ? 14.721 24.218 76.460  1.00 18.65 ? 784  SGM A C2  1 
HETATM 5731 O O2  . SGM E 3 .   ? 14.849 23.875 75.084  1.00 20.27 ? 784  SGM A O2  1 
HETATM 5732 C C3  . SGM E 3 .   ? 13.523 23.458 77.080  1.00 20.44 ? 784  SGM A C3  1 
HETATM 5733 O O3  . SGM E 3 .   ? 12.345 24.077 76.694  1.00 22.14 ? 784  SGM A O3  1 
HETATM 5734 S S1  . SGM E 3 .   ? 15.858 26.487 75.389  1.00 14.91 ? 784  SGM A S1  1 
HETATM 5735 C C1  . GOL F 4 .   ? 26.859 18.139 77.179  1.00 17.48 ? 790  GOL A C1  1 
HETATM 5736 O O1  . GOL F 4 .   ? 27.618 19.328 77.027  1.00 16.49 ? 790  GOL A O1  1 
HETATM 5737 C C2  . GOL F 4 .   ? 25.382 18.466 77.371  1.00 16.73 ? 790  GOL A C2  1 
HETATM 5738 O O2  . GOL F 4 .   ? 25.222 19.339 78.494  1.00 17.26 ? 790  GOL A O2  1 
HETATM 5739 C C3  . GOL F 4 .   ? 24.548 17.201 77.571  1.00 17.51 ? 790  GOL A C3  1 
HETATM 5740 O O3  . GOL F 4 .   ? 24.764 16.664 78.863  1.00 19.23 ? 790  GOL A O3  1 
HETATM 5741 C C1  . GOL G 4 .   ? 61.724 29.838 95.119  1.00 12.58 ? 791  GOL A C1  1 
HETATM 5742 O O1  . GOL G 4 .   ? 62.011 30.984 94.339  1.00 10.93 ? 791  GOL A O1  1 
HETATM 5743 C C2  . GOL G 4 .   ? 61.664 28.589 94.243  1.00 12.87 ? 791  GOL A C2  1 
HETATM 5744 O O2  . GOL G 4 .   ? 60.574 28.702 93.321  1.00 13.42 ? 791  GOL A O2  1 
HETATM 5745 C C3  . GOL G 4 .   ? 61.505 27.321 95.088  1.00 12.48 ? 791  GOL A C3  1 
HETATM 5746 O O3  . GOL G 4 .   ? 61.530 26.163 94.274  1.00 14.68 ? 791  GOL A O3  1 
HETATM 5747 C C1  . GOL H 4 .   ? 54.734 49.997 83.989  1.00 23.25 ? 792  GOL A C1  1 
HETATM 5748 O O1  . GOL H 4 .   ? 55.616 48.905 84.224  1.00 24.54 ? 792  GOL A O1  1 
HETATM 5749 C C2  . GOL H 4 .   ? 54.818 51.031 85.114  1.00 23.25 ? 792  GOL A C2  1 
HETATM 5750 O O2  . GOL H 4 .   ? 56.060 50.904 85.817  1.00 23.28 ? 792  GOL A O2  1 
HETATM 5751 C C3  . GOL H 4 .   ? 53.656 50.888 86.092  1.00 22.39 ? 792  GOL A C3  1 
HETATM 5752 O O3  . GOL H 4 .   ? 53.676 49.611 86.703  1.00 20.97 ? 792  GOL A O3  1 
HETATM 5753 C C1  . GOL I 4 .   ? 39.701 52.190 58.489  1.00 24.95 ? 793  GOL A C1  1 
HETATM 5754 O O1  . GOL I 4 .   ? 38.471 52.112 57.788  1.00 25.55 ? 793  GOL A O1  1 
HETATM 5755 C C2  . GOL I 4 .   ? 40.757 51.307 57.837  1.00 25.03 ? 793  GOL A C2  1 
HETATM 5756 O O2  . GOL I 4 .   ? 40.233 49.998 57.650  1.00 25.66 ? 793  GOL A O2  1 
HETATM 5757 C C3  . GOL I 4 .   ? 42.032 51.230 58.669  1.00 24.22 ? 793  GOL A C3  1 
HETATM 5758 O O3  . GOL I 4 .   ? 42.955 52.223 58.288  1.00 23.31 ? 793  GOL A O3  1 
HETATM 5759 O O   . HOH J 5 .   ? 49.188 40.009 105.110 1.00 11.24 ? 801  HOH A O   1 
HETATM 5760 O O   . HOH J 5 .   ? 21.678 22.546 78.256  1.00 10.10 ? 802  HOH A O   1 
HETATM 5761 O O   . HOH J 5 .   ? 23.783 29.721 95.242  1.00 13.65 ? 803  HOH A O   1 
HETATM 5762 O O   . HOH J 5 .   ? 54.815 35.790 91.185  1.00 8.75  ? 804  HOH A O   1 
HETATM 5763 O O   . HOH J 5 .   ? 43.697 32.575 63.480  1.00 12.77 ? 805  HOH A O   1 
HETATM 5764 O O   . HOH J 5 .   ? 46.177 46.758 75.435  1.00 9.12  ? 806  HOH A O   1 
HETATM 5765 O O   . HOH J 5 .   ? 28.898 29.651 66.958  1.00 10.17 ? 807  HOH A O   1 
HETATM 5766 O O   . HOH J 5 .   ? 29.856 38.829 90.633  1.00 31.16 ? 808  HOH A O   1 
HETATM 5767 O O   . HOH J 5 .   ? 54.137 28.083 83.567  1.00 11.64 ? 809  HOH A O   1 
HETATM 5768 O O   . HOH J 5 .   ? 50.702 37.035 92.317  1.00 12.97 ? 810  HOH A O   1 
HETATM 5769 O O   . HOH J 5 .   ? 26.443 43.517 119.676 1.00 13.12 ? 811  HOH A O   1 
HETATM 5770 O O   . HOH J 5 .   ? 45.796 54.107 111.481 1.00 12.41 ? 812  HOH A O   1 
HETATM 5771 O O   . HOH J 5 .   ? 60.078 50.790 108.526 1.00 9.04  ? 813  HOH A O   1 
HETATM 5772 O O   . HOH J 5 .   ? 39.971 34.709 61.550  1.00 10.81 ? 814  HOH A O   1 
HETATM 5773 O O   . HOH J 5 .   ? 48.819 33.647 100.065 1.00 12.93 ? 815  HOH A O   1 
HETATM 5774 O O   . HOH J 5 .   ? 41.874 34.512 64.432  1.00 8.82  ? 816  HOH A O   1 
HETATM 5775 O O   . HOH J 5 .   ? 43.551 38.285 74.754  1.00 8.89  ? 817  HOH A O   1 
HETATM 5776 O O   . HOH J 5 .   ? 37.336 43.427 73.145  1.00 6.67  ? 818  HOH A O   1 
HETATM 5777 O O   . HOH J 5 .   ? 44.278 40.306 76.579  1.00 6.85  ? 819  HOH A O   1 
HETATM 5778 O O   . HOH J 5 .   ? 47.526 41.375 58.214  1.00 12.42 ? 820  HOH A O   1 
HETATM 5779 O O   . HOH J 5 .   ? 14.815 44.697 67.076  1.00 19.24 ? 821  HOH A O   1 
HETATM 5780 O O   . HOH J 5 .   ? 35.897 16.501 73.073  1.00 9.90  ? 822  HOH A O   1 
HETATM 5781 O O   . HOH J 5 .   ? 38.439 52.395 82.637  1.00 8.71  ? 823  HOH A O   1 
HETATM 5782 O O   . HOH J 5 .   ? 49.080 55.733 77.876  1.00 14.23 ? 824  HOH A O   1 
HETATM 5783 O O   . HOH J 5 .   ? 24.297 51.970 87.185  1.00 21.01 ? 825  HOH A O   1 
HETATM 5784 O O   . HOH J 5 .   ? 43.861 57.139 75.435  1.00 13.92 ? 826  HOH A O   1 
HETATM 5785 O O   . HOH J 5 .   ? 55.233 57.335 97.561  1.00 9.84  ? 827  HOH A O   1 
HETATM 5786 O O   . HOH J 5 .   ? 52.509 39.081 96.582  1.00 12.13 ? 828  HOH A O   1 
HETATM 5787 O O   . HOH J 5 .   ? 29.516 24.501 101.657 1.00 7.54  ? 829  HOH A O   1 
HETATM 5788 O O   . HOH J 5 .   ? 49.761 44.483 105.097 1.00 11.14 ? 830  HOH A O   1 
HETATM 5789 O O   . HOH J 5 .   ? 43.629 30.857 89.810  1.00 14.75 ? 831  HOH A O   1 
HETATM 5790 O O   . HOH J 5 .   ? 44.344 40.937 113.126 1.00 16.48 ? 832  HOH A O   1 
HETATM 5791 O O   . HOH J 5 .   ? 18.543 33.748 90.105  1.00 8.43  ? 833  HOH A O   1 
HETATM 5792 O O   . HOH J 5 .   ? 26.526 32.587 85.939  1.00 7.15  ? 834  HOH A O   1 
HETATM 5793 O O   . HOH J 5 .   ? 26.270 20.666 83.830  1.00 14.80 ? 835  HOH A O   1 
HETATM 5794 O O   . HOH J 5 .   ? 19.449 47.547 89.907  1.00 13.24 ? 836  HOH A O   1 
HETATM 5795 O O   . HOH J 5 .   ? 54.610 21.321 107.307 1.00 11.51 ? 837  HOH A O   1 
HETATM 5796 O O   . HOH J 5 .   ? 39.680 39.155 84.008  1.00 14.84 ? 838  HOH A O   1 
HETATM 5797 O O   . HOH J 5 .   ? 62.186 50.132 106.754 1.00 9.15  ? 839  HOH A O   1 
HETATM 5798 O O   . HOH J 5 .   ? 40.197 55.679 92.813  1.00 11.15 ? 840  HOH A O   1 
HETATM 5799 O O   . HOH J 5 .   ? 29.104 18.625 96.712  1.00 14.54 ? 841  HOH A O   1 
HETATM 5800 O O   . HOH J 5 .   ? 31.194 51.311 64.262  1.00 7.95  ? 842  HOH A O   1 
HETATM 5801 O O   . HOH J 5 .   ? 37.742 23.930 86.678  1.00 16.07 ? 843  HOH A O   1 
HETATM 5802 O O   . HOH J 5 .   ? 51.560 36.076 84.623  1.00 12.03 ? 844  HOH A O   1 
HETATM 5803 O O   . HOH J 5 .   ? 64.185 47.480 99.456  1.00 9.46  ? 845  HOH A O   1 
HETATM 5804 O O   . HOH J 5 .   ? 39.378 55.613 95.490  1.00 10.59 ? 846  HOH A O   1 
HETATM 5805 O O   . HOH J 5 .   ? 45.560 19.857 96.771  1.00 10.93 ? 847  HOH A O   1 
HETATM 5806 O O   . HOH J 5 .   ? 36.530 37.812 57.399  1.00 16.06 ? 848  HOH A O   1 
HETATM 5807 O O   . HOH J 5 .   ? 51.274 46.798 62.035  1.00 10.43 ? 849  HOH A O   1 
HETATM 5808 O O   . HOH J 5 .   ? 35.110 45.494 57.262  1.00 10.17 ? 850  HOH A O   1 
HETATM 5809 O O   . HOH J 5 .   ? 37.836 37.876 59.937  1.00 9.24  ? 851  HOH A O   1 
HETATM 5810 O O   . HOH J 5 .   ? 55.793 39.405 109.749 1.00 9.62  ? 852  HOH A O   1 
HETATM 5811 O O   . HOH J 5 .   ? 40.378 38.706 60.895  1.00 7.67  ? 853  HOH A O   1 
HETATM 5812 O O   . HOH J 5 .   ? 58.580 33.800 88.065  1.00 9.76  ? 854  HOH A O   1 
HETATM 5813 O O   . HOH J 5 .   ? 48.295 30.898 82.917  1.00 10.78 ? 855  HOH A O   1 
HETATM 5814 O O   . HOH J 5 .   ? 9.363  39.869 68.053  1.00 14.95 ? 856  HOH A O   1 
HETATM 5815 O O   . HOH J 5 .   ? 15.526 45.834 75.079  1.00 8.39  ? 857  HOH A O   1 
HETATM 5816 O O   . HOH J 5 .   ? 50.460 41.952 106.649 1.00 12.27 ? 858  HOH A O   1 
HETATM 5817 O O   . HOH J 5 .   ? 19.151 48.923 113.676 1.00 15.77 ? 859  HOH A O   1 
HETATM 5818 O O   . HOH J 5 .   ? 29.160 33.455 85.716  1.00 8.02  ? 860  HOH A O   1 
HETATM 5819 O O   . HOH J 5 .   ? 15.988 42.944 94.786  1.00 16.50 ? 861  HOH A O   1 
HETATM 5820 O O   . HOH J 5 .   ? 53.066 50.118 64.772  1.00 16.14 ? 862  HOH A O   1 
HETATM 5821 O O   . HOH J 5 .   ? 15.685 63.273 81.548  1.00 15.19 ? 863  HOH A O   1 
HETATM 5822 O O   . HOH J 5 .   ? 38.496 52.899 95.582  1.00 18.99 ? 864  HOH A O   1 
HETATM 5823 O O   . HOH J 5 .   ? 8.589  50.726 76.723  1.00 14.08 ? 865  HOH A O   1 
HETATM 5824 O O   . HOH J 5 .   ? 20.426 42.406 125.053 1.00 17.09 ? 866  HOH A O   1 
HETATM 5825 O O   . HOH J 5 .   ? 46.678 28.873 82.236  1.00 16.03 ? 867  HOH A O   1 
HETATM 5826 O O   . HOH J 5 .   ? 39.383 55.065 82.900  1.00 10.48 ? 868  HOH A O   1 
HETATM 5827 O O   . HOH J 5 .   ? 35.955 25.896 75.336  1.00 13.70 ? 869  HOH A O   1 
HETATM 5828 O O   . HOH J 5 .   ? 43.317 27.880 113.343 1.00 9.61  ? 870  HOH A O   1 
HETATM 5829 O O   . HOH J 5 .   ? 37.342 35.268 60.950  1.00 11.78 ? 871  HOH A O   1 
HETATM 5830 O O   . HOH J 5 .   ? 48.975 13.952 102.218 1.00 25.28 ? 872  HOH A O   1 
HETATM 5831 O O   . HOH J 5 .   ? 52.158 41.213 71.666  1.00 15.83 ? 873  HOH A O   1 
HETATM 5832 O O   . HOH J 5 .   ? 45.687 28.359 89.669  1.00 9.07  ? 874  HOH A O   1 
HETATM 5833 O O   . HOH J 5 .   ? 54.995 52.683 112.969 1.00 10.87 ? 875  HOH A O   1 
HETATM 5834 O O   . HOH J 5 .   ? 48.583 47.435 58.878  1.00 11.05 ? 876  HOH A O   1 
HETATM 5835 O O   . HOH J 5 .   ? 41.898 51.722 87.140  1.00 11.65 ? 877  HOH A O   1 
HETATM 5836 O O   . HOH J 5 .   ? 30.340 24.760 104.486 1.00 11.85 ? 878  HOH A O   1 
HETATM 5837 O O   . HOH J 5 .   ? 32.165 23.965 71.249  1.00 10.16 ? 879  HOH A O   1 
HETATM 5838 O O   . HOH J 5 .   ? 36.156 35.861 55.486  1.00 26.57 ? 880  HOH A O   1 
HETATM 5839 O O   . HOH J 5 .   ? 48.574 47.300 61.562  1.00 8.69  ? 881  HOH A O   1 
HETATM 5840 O O   . HOH J 5 .   ? 45.432 46.576 104.758 1.00 13.09 ? 882  HOH A O   1 
HETATM 5841 O O   . HOH J 5 .   ? 38.267 45.038 75.334  1.00 6.89  ? 883  HOH A O   1 
HETATM 5842 O O   . HOH J 5 .   ? 44.793 32.774 101.197 1.00 13.06 ? 884  HOH A O   1 
HETATM 5843 O O   . HOH J 5 .   ? 49.111 35.877 77.317  1.00 9.63  ? 885  HOH A O   1 
HETATM 5844 O O   . HOH J 5 .   ? 17.201 41.299 65.422  1.00 15.01 ? 886  HOH A O   1 
HETATM 5845 O O   . HOH J 5 .   ? 26.570 57.927 61.820  1.00 13.45 ? 887  HOH A O   1 
HETATM 5846 O O   . HOH J 5 .   ? 40.385 23.762 83.872  1.00 11.32 ? 888  HOH A O   1 
HETATM 5847 O O   . HOH J 5 .   ? 48.704 50.641 116.226 1.00 15.64 ? 889  HOH A O   1 
HETATM 5848 O O   . HOH J 5 .   ? 45.121 58.799 82.880  1.00 13.83 ? 890  HOH A O   1 
HETATM 5849 O O   . HOH J 5 .   ? 53.918 34.805 85.716  1.00 7.75  ? 891  HOH A O   1 
HETATM 5850 O O   . HOH J 5 .   ? 27.229 31.251 62.553  1.00 15.79 ? 892  HOH A O   1 
HETATM 5851 O O   . HOH J 5 .   ? 37.016 18.288 70.723  1.00 15.78 ? 893  HOH A O   1 
HETATM 5852 O O   . HOH J 5 .   ? 53.372 47.484 111.576 1.00 9.95  ? 894  HOH A O   1 
HETATM 5853 O O   . HOH J 5 .   ? 44.751 45.525 70.985  1.00 8.08  ? 895  HOH A O   1 
HETATM 5854 O O   . HOH J 5 .   ? 62.573 53.339 93.702  1.00 23.63 ? 896  HOH A O   1 
HETATM 5855 O O   . HOH J 5 .   ? 30.552 33.235 78.594  1.00 8.27  ? 897  HOH A O   1 
HETATM 5856 O O   . HOH J 5 .   ? 38.867 31.187 57.860  1.00 21.96 ? 898  HOH A O   1 
HETATM 5857 O O   . HOH J 5 .   ? 28.279 19.634 94.392  1.00 20.22 ? 899  HOH A O   1 
HETATM 5858 O O   . HOH J 5 .   ? 32.777 18.048 104.094 1.00 11.21 ? 900  HOH A O   1 
HETATM 5859 O O   . HOH J 5 .   ? 48.095 29.217 79.039  1.00 12.88 ? 901  HOH A O   1 
HETATM 5860 O O   . HOH J 5 .   ? 25.629 34.618 84.275  1.00 8.75  ? 902  HOH A O   1 
HETATM 5861 O O   . HOH J 5 .   ? 29.351 21.884 93.202  1.00 14.87 ? 903  HOH A O   1 
HETATM 5862 O O   . HOH J 5 .   ? 6.850  61.847 86.231  1.00 38.10 ? 904  HOH A O   1 
HETATM 5863 O O   . HOH J 5 .   ? 57.058 24.230 110.091 1.00 15.99 ? 905  HOH A O   1 
HETATM 5864 O O   . HOH J 5 .   ? 31.744 23.716 74.038  1.00 11.70 ? 906  HOH A O   1 
HETATM 5865 O O   . HOH J 5 .   ? 48.804 62.581 89.128  1.00 21.28 ? 907  HOH A O   1 
HETATM 5866 O O   . HOH J 5 .   ? 21.006 47.284 53.928  1.00 30.81 ? 908  HOH A O   1 
HETATM 5867 O O   . HOH J 5 .   ? 46.015 47.400 72.737  1.00 10.20 ? 909  HOH A O   1 
HETATM 5868 O O   . HOH J 5 .   ? 47.256 46.411 93.061  1.00 14.21 ? 910  HOH A O   1 
HETATM 5869 O O   . HOH J 5 .   ? 22.228 27.090 97.041  1.00 13.35 ? 911  HOH A O   1 
HETATM 5870 O O   . HOH J 5 .   ? 23.424 61.322 62.295  1.00 20.02 ? 912  HOH A O   1 
HETATM 5871 O O   . HOH J 5 .   ? 56.423 32.733 86.686  1.00 9.13  ? 913  HOH A O   1 
HETATM 5872 O O   . HOH J 5 .   ? 28.935 39.793 81.811  1.00 7.52  ? 914  HOH A O   1 
HETATM 5873 O O   . HOH J 5 .   ? 43.634 45.960 98.160  1.00 20.74 ? 915  HOH A O   1 
HETATM 5874 O O   . HOH J 5 .   ? 24.151 27.399 104.449 1.00 27.90 ? 916  HOH A O   1 
HETATM 5875 O O   . HOH J 5 .   ? 47.409 43.411 103.813 1.00 32.09 ? 917  HOH A O   1 
HETATM 5876 O O   . HOH J 5 .   ? 20.531 63.157 72.818  1.00 15.73 ? 918  HOH A O   1 
HETATM 5877 O O   . HOH J 5 .   ? 8.540  29.647 85.949  1.00 23.58 ? 919  HOH A O   1 
HETATM 5878 O O   . HOH J 5 .   ? 33.553 52.375 74.342  1.00 18.84 ? 920  HOH A O   1 
HETATM 5879 O O   . HOH J 5 .   ? 31.536 62.951 87.282  1.00 20.61 ? 921  HOH A O   1 
HETATM 5880 O O   . HOH J 5 .   ? 41.913 37.595 110.588 1.00 16.66 ? 922  HOH A O   1 
HETATM 5881 O O   . HOH J 5 .   ? 68.362 45.918 106.587 1.00 42.08 ? 923  HOH A O   1 
HETATM 5882 O O   . HOH J 5 .   ? 50.671 52.614 116.712 1.00 14.17 ? 924  HOH A O   1 
HETATM 5883 O O   . HOH J 5 .   ? 40.701 44.649 50.989  1.00 12.89 ? 925  HOH A O   1 
HETATM 5884 O O   . HOH J 5 .   ? 24.086 48.700 82.749  1.00 18.54 ? 926  HOH A O   1 
HETATM 5885 O O   . HOH J 5 .   ? 53.008 64.974 102.176 1.00 27.69 ? 927  HOH A O   1 
HETATM 5886 O O   . HOH J 5 .   ? 42.367 47.277 81.920  1.00 7.98  ? 928  HOH A O   1 
HETATM 5887 O O   . HOH J 5 .   ? 61.118 47.381 111.294 1.00 16.31 ? 929  HOH A O   1 
HETATM 5888 O O   . HOH J 5 .   ? 53.524 46.049 109.242 1.00 10.08 ? 930  HOH A O   1 
HETATM 5889 O O   . HOH J 5 .   ? 58.462 52.743 109.599 1.00 15.87 ? 931  HOH A O   1 
HETATM 5890 O O   . HOH J 5 .   ? 59.297 21.697 101.166 1.00 13.36 ? 932  HOH A O   1 
HETATM 5891 O O   . HOH J 5 .   ? 48.225 44.862 90.970  1.00 14.41 ? 933  HOH A O   1 
HETATM 5892 O O   . HOH J 5 .   ? 41.256 52.944 118.789 1.00 40.28 ? 934  HOH A O   1 
HETATM 5893 O O   . HOH J 5 .   ? 48.721 39.663 108.383 1.00 17.19 ? 935  HOH A O   1 
HETATM 5894 O O   . HOH J 5 .   ? 23.000 23.165 101.628 1.00 21.15 ? 936  HOH A O   1 
HETATM 5895 O O   . HOH J 5 .   ? 44.851 51.990 68.629  1.00 13.02 ? 937  HOH A O   1 
HETATM 5896 O O   . HOH J 5 .   ? 51.449 57.114 111.197 1.00 10.50 ? 938  HOH A O   1 
HETATM 5897 O O   . HOH J 5 .   ? 37.856 46.559 110.874 1.00 16.01 ? 939  HOH A O   1 
HETATM 5898 O O   . HOH J 5 .   ? 40.385 55.460 85.499  1.00 10.09 ? 940  HOH A O   1 
HETATM 5899 O O   . HOH J 5 .   ? 42.066 42.532 50.004  1.00 14.65 ? 941  HOH A O   1 
HETATM 5900 O O   . HOH J 5 .   ? 31.654 28.423 93.491  1.00 11.83 ? 942  HOH A O   1 
HETATM 5901 O O   . HOH J 5 .   ? 44.951 49.944 72.277  1.00 9.65  ? 943  HOH A O   1 
HETATM 5902 O O   . HOH J 5 .   ? 47.121 16.023 113.742 1.00 23.37 ? 944  HOH A O   1 
HETATM 5903 O O   . HOH J 5 .   ? 50.388 60.351 92.633  1.00 25.47 ? 945  HOH A O   1 
HETATM 5904 O O   . HOH J 5 .   ? 52.318 43.931 78.910  1.00 9.92  ? 946  HOH A O   1 
HETATM 5905 O O   . HOH J 5 .   ? 34.765 55.766 89.969  1.00 25.41 ? 947  HOH A O   1 
HETATM 5906 O O   . HOH J 5 .   ? 38.443 63.679 89.192  1.00 20.03 ? 948  HOH A O   1 
HETATM 5907 O O   . HOH J 5 .   ? 28.555 59.049 72.507  1.00 22.36 ? 949  HOH A O   1 
HETATM 5908 O O   . HOH J 5 .   ? 24.185 41.661 87.025  1.00 28.19 ? 950  HOH A O   1 
HETATM 5909 O O   . HOH J 5 .   ? 3.925  33.779 82.105  1.00 27.47 ? 951  HOH A O   1 
HETATM 5910 O O   . HOH J 5 .   ? 49.271 48.930 54.902  1.00 13.10 ? 952  HOH A O   1 
HETATM 5911 O O   . HOH J 5 .   ? 51.997 40.491 114.784 1.00 18.66 ? 953  HOH A O   1 
HETATM 5912 O O   . HOH J 5 .   ? 24.064 52.466 90.752  1.00 35.53 ? 954  HOH A O   1 
HETATM 5913 O O   . HOH J 5 .   ? 6.722  38.122 87.240  1.00 21.20 ? 955  HOH A O   1 
HETATM 5914 O O   . HOH J 5 .   ? 27.005 29.850 65.071  1.00 13.54 ? 956  HOH A O   1 
HETATM 5915 O O   . HOH J 5 .   ? 36.466 28.341 60.553  1.00 27.61 ? 957  HOH A O   1 
HETATM 5916 O O   . HOH J 5 .   ? 28.030 34.285 55.483  1.00 14.80 ? 958  HOH A O   1 
HETATM 5917 O O   . HOH J 5 .   ? 42.096 49.584 55.756  1.00 14.08 ? 959  HOH A O   1 
HETATM 5918 O O   . HOH J 5 .   ? 41.246 66.762 98.432  1.00 18.88 ? 960  HOH A O   1 
HETATM 5919 O O   . HOH J 5 .   ? 62.443 30.237 107.280 1.00 11.48 ? 961  HOH A O   1 
HETATM 5920 O O   . HOH J 5 .   ? 30.087 19.606 86.529  1.00 15.53 ? 962  HOH A O   1 
HETATM 5921 O O   . HOH J 5 .   ? 22.565 27.374 69.634  1.00 25.44 ? 963  HOH A O   1 
HETATM 5922 O O   . HOH J 5 .   ? 26.627 61.493 107.774 1.00 30.77 ? 964  HOH A O   1 
HETATM 5923 O O   . HOH J 5 .   ? 45.846 43.499 48.222  1.00 10.79 ? 965  HOH A O   1 
HETATM 5924 O O   . HOH J 5 .   ? 23.652 52.776 102.132 1.00 25.44 ? 966  HOH A O   1 
HETATM 5925 O O   . HOH J 5 .   ? 34.429 49.847 76.925  1.00 16.50 ? 967  HOH A O   1 
HETATM 5926 O O   . HOH J 5 .   ? 32.434 56.357 78.553  1.00 23.44 ? 968  HOH A O   1 
HETATM 5927 O O   . HOH J 5 .   ? 47.263 26.189 78.132  1.00 25.47 ? 969  HOH A O   1 
HETATM 5928 O O   . HOH J 5 .   ? 33.524 34.595 61.053  1.00 11.54 ? 970  HOH A O   1 
HETATM 5929 O O   . HOH J 5 .   ? 46.978 31.248 66.785  1.00 30.10 ? 971  HOH A O   1 
HETATM 5930 O O   . HOH J 5 .   ? 57.918 48.920 79.074  1.00 17.44 ? 972  HOH A O   1 
HETATM 5931 O O   . HOH J 5 .   ? 56.646 66.631 107.716 1.00 21.19 ? 973  HOH A O   1 
HETATM 5932 O O   . HOH J 5 .   ? 53.272 57.435 113.214 1.00 16.03 ? 974  HOH A O   1 
HETATM 5933 O O   . HOH J 5 .   ? 33.843 52.731 88.088  1.00 17.43 ? 975  HOH A O   1 
HETATM 5934 O O   . HOH J 5 .   ? 44.772 46.848 68.556  1.00 9.00  ? 976  HOH A O   1 
HETATM 5935 O O   . HOH J 5 .   ? 16.071 39.149 61.911  1.00 19.61 ? 977  HOH A O   1 
HETATM 5936 O O   . HOH J 5 .   ? 46.690 57.756 79.035  1.00 19.12 ? 978  HOH A O   1 
HETATM 5937 O O   . HOH J 5 .   ? 19.055 27.978 71.104  1.00 17.34 ? 979  HOH A O   1 
HETATM 5938 O O   . HOH J 5 .   ? 47.055 44.852 95.283  1.00 12.63 ? 980  HOH A O   1 
HETATM 5939 O O   . HOH J 5 .   ? 45.016 65.387 84.179  1.00 28.55 ? 981  HOH A O   1 
HETATM 5940 O O   . HOH J 5 .   ? 53.451 28.537 114.950 1.00 15.24 ? 982  HOH A O   1 
HETATM 5941 O O   . HOH J 5 .   ? 35.381 45.887 111.656 1.00 11.54 ? 983  HOH A O   1 
HETATM 5942 O O   . HOH J 5 .   ? 46.367 22.465 95.338  1.00 8.35  ? 984  HOH A O   1 
HETATM 5943 O O   . HOH J 5 .   ? 39.381 52.472 92.663  1.00 27.64 ? 985  HOH A O   1 
HETATM 5944 O O   . HOH J 5 .   ? 46.240 56.947 61.505  1.00 19.02 ? 986  HOH A O   1 
HETATM 5945 O O   . HOH J 5 .   ? 47.032 44.905 88.497  1.00 6.44  ? 987  HOH A O   1 
HETATM 5946 O O   . HOH J 5 .   ? 33.819 20.797 81.556  1.00 24.29 ? 988  HOH A O   1 
HETATM 5947 O O   . HOH J 5 .   ? 44.722 63.274 98.964  1.00 16.21 ? 989  HOH A O   1 
HETATM 5948 O O   . HOH J 5 .   ? 41.225 50.739 89.781  1.00 12.67 ? 990  HOH A O   1 
HETATM 5949 O O   . HOH J 5 .   ? 39.126 60.359 77.327  1.00 19.68 ? 991  HOH A O   1 
HETATM 5950 O O   . HOH J 5 .   ? 8.881  46.514 84.061  1.00 15.88 ? 992  HOH A O   1 
HETATM 5951 O O   . HOH J 5 .   ? 32.204 61.706 105.098 1.00 22.35 ? 993  HOH A O   1 
HETATM 5952 O O   . HOH J 5 .   ? 32.489 21.070 70.849  1.00 23.74 ? 994  HOH A O   1 
HETATM 5953 O O   . HOH J 5 .   ? 33.732 47.879 57.467  1.00 10.76 ? 995  HOH A O   1 
HETATM 5954 O O   . HOH J 5 .   ? 9.832  59.838 88.950  1.00 35.08 ? 996  HOH A O   1 
HETATM 5955 O O   . HOH J 5 .   ? 37.980 46.553 116.446 1.00 16.01 ? 997  HOH A O   1 
HETATM 5956 O O   . HOH J 5 .   ? 43.140 24.099 79.112  1.00 19.56 ? 998  HOH A O   1 
HETATM 5957 O O   . HOH J 5 .   ? 49.437 59.948 95.140  1.00 17.18 ? 999  HOH A O   1 
HETATM 5958 O O   . HOH J 5 .   ? 27.686 37.678 96.542  1.00 30.95 ? 1000 HOH A O   1 
HETATM 5959 O O   . HOH J 5 .   ? 33.939 29.559 80.570  1.00 14.37 ? 1001 HOH A O   1 
HETATM 5960 O O   . HOH J 5 .   ? 41.460 49.050 95.699  1.00 19.21 ? 1002 HOH A O   1 
HETATM 5961 O O   . HOH J 5 .   ? 55.275 41.775 80.991  1.00 13.80 ? 1003 HOH A O   1 
HETATM 5962 O O   . HOH J 5 .   ? 34.995 21.301 65.636  1.00 30.35 ? 1004 HOH A O   1 
HETATM 5963 O O   . HOH J 5 .   ? 50.110 34.130 57.145  1.00 28.56 ? 1005 HOH A O   1 
HETATM 5964 O O   . HOH J 5 .   ? 10.162 31.039 73.660  1.00 22.25 ? 1006 HOH A O   1 
HETATM 5965 O O   . HOH J 5 .   ? 37.751 67.906 83.061  1.00 34.36 ? 1007 HOH A O   1 
HETATM 5966 O O   . HOH J 5 .   ? 35.150 55.308 92.764  1.00 18.53 ? 1008 HOH A O   1 
HETATM 5967 O O   . HOH J 5 .   ? 64.099 41.236 107.447 1.00 17.41 ? 1009 HOH A O   1 
HETATM 5968 O O   . HOH J 5 .   ? 65.145 52.421 105.158 1.00 15.66 ? 1010 HOH A O   1 
HETATM 5969 O O   . HOH J 5 .   ? 47.287 33.759 114.158 1.00 29.76 ? 1011 HOH A O   1 
HETATM 5970 O O   . HOH J 5 .   ? 47.181 45.615 107.962 1.00 15.58 ? 1012 HOH A O   1 
HETATM 5971 O O   . HOH J 5 .   ? 52.413 18.735 98.501  1.00 32.33 ? 1013 HOH A O   1 
HETATM 5972 O O   . HOH J 5 .   ? 46.984 17.606 97.310  1.00 28.72 ? 1014 HOH A O   1 
HETATM 5973 O O   . HOH J 5 .   ? 40.453 35.750 108.125 1.00 23.01 ? 1015 HOH A O   1 
HETATM 5974 O O   . HOH J 5 .   ? 32.952 46.853 54.629  1.00 32.74 ? 1016 HOH A O   1 
HETATM 5975 O O   . HOH J 5 .   ? 33.825 60.408 66.700  1.00 35.39 ? 1017 HOH A O   1 
HETATM 5976 O O   . HOH J 5 .   ? 65.402 52.054 92.252  1.00 28.54 ? 1018 HOH A O   1 
HETATM 5977 O O   . HOH J 5 .   ? 49.181 31.857 116.564 1.00 11.35 ? 1019 HOH A O   1 
HETATM 5978 O O   . HOH J 5 .   ? 56.165 25.957 112.411 1.00 24.68 ? 1020 HOH A O   1 
HETATM 5979 O O   . HOH J 5 .   ? 57.016 46.879 82.402  1.00 19.96 ? 1021 HOH A O   1 
HETATM 5980 O O   . HOH J 5 .   ? 38.906 45.992 84.966  1.00 13.76 ? 1022 HOH A O   1 
HETATM 5981 O O   . HOH J 5 .   ? 33.089 17.441 101.450 1.00 18.52 ? 1023 HOH A O   1 
HETATM 5982 O O   . HOH J 5 .   ? 29.915 25.088 70.235  1.00 11.24 ? 1024 HOH A O   1 
HETATM 5983 O O   . HOH J 5 .   ? 38.614 21.877 84.931  1.00 13.30 ? 1025 HOH A O   1 
HETATM 5984 O O   . HOH J 5 .   ? 64.796 47.758 86.237  1.00 35.73 ? 1026 HOH A O   1 
HETATM 5985 O O   . HOH J 5 .   ? 58.208 40.498 110.539 1.00 12.45 ? 1027 HOH A O   1 
HETATM 5986 O O   . HOH J 5 .   ? 56.091 39.827 76.541  1.00 24.03 ? 1028 HOH A O   1 
HETATM 5987 O O   . HOH J 5 .   ? 42.578 56.204 66.596  1.00 14.39 ? 1029 HOH A O   1 
HETATM 5988 O O   . HOH J 5 .   ? 25.924 23.558 94.824  1.00 12.27 ? 1030 HOH A O   1 
HETATM 5989 O O   . HOH J 5 .   ? 44.117 27.409 87.447  1.00 10.21 ? 1031 HOH A O   1 
HETATM 5990 O O   . HOH J 5 .   ? 58.529 62.235 99.183  1.00 35.97 ? 1032 HOH A O   1 
HETATM 5991 O O   . HOH J 5 .   ? 61.598 51.740 89.883  1.00 25.82 ? 1033 HOH A O   1 
HETATM 5992 O O   . HOH J 5 .   ? 52.360 59.099 98.569  1.00 14.30 ? 1034 HOH A O   1 
HETATM 5993 O O   . HOH J 5 .   ? 41.521 46.713 84.629  1.00 15.76 ? 1035 HOH A O   1 
HETATM 5994 O O   . HOH J 5 .   ? 53.397 39.039 73.429  1.00 29.67 ? 1036 HOH A O   1 
HETATM 5995 O O   . HOH J 5 .   ? 42.846 54.066 86.031  1.00 8.54  ? 1037 HOH A O   1 
HETATM 5996 O O   . HOH J 5 .   ? 27.048 21.919 86.123  1.00 23.67 ? 1038 HOH A O   1 
HETATM 5997 O O   . HOH J 5 .   ? 38.780 32.496 90.011  1.00 39.19 ? 1039 HOH A O   1 
HETATM 5998 O O   . HOH J 5 .   ? 16.034 38.648 65.469  1.00 18.76 ? 1040 HOH A O   1 
HETATM 5999 O O   . HOH J 5 .   ? 45.449 40.277 50.580  1.00 16.77 ? 1041 HOH A O   1 
HETATM 6000 O O   . HOH J 5 .   ? 36.113 59.437 65.417  1.00 38.79 ? 1042 HOH A O   1 
HETATM 6001 O O   . HOH J 5 .   ? 55.334 52.679 78.720  1.00 28.79 ? 1043 HOH A O   1 
HETATM 6002 O O   . HOH J 5 .   ? 42.571 44.888 90.138  1.00 28.72 ? 1044 HOH A O   1 
HETATM 6003 O O   . HOH J 5 .   ? 34.595 15.237 100.693 1.00 35.16 ? 1045 HOH A O   1 
HETATM 6004 O O   . HOH J 5 .   ? 56.252 39.284 80.061  1.00 19.38 ? 1046 HOH A O   1 
HETATM 6005 O O   . HOH J 5 .   ? 48.203 39.478 100.491 1.00 14.44 ? 1047 HOH A O   1 
HETATM 6006 O O   . HOH J 5 .   ? 36.216 61.673 82.944  1.00 19.66 ? 1048 HOH A O   1 
HETATM 6007 O O   . HOH J 5 .   ? 21.126 33.112 115.382 1.00 18.45 ? 1049 HOH A O   1 
HETATM 6008 O O   . HOH J 5 .   ? 63.140 28.278 98.575  1.00 16.54 ? 1050 HOH A O   1 
HETATM 6009 O O   . HOH J 5 .   ? 29.526 29.403 61.688  1.00 20.19 ? 1051 HOH A O   1 
HETATM 6010 O O   . HOH J 5 .   ? 36.480 31.785 92.441  1.00 36.29 ? 1052 HOH A O   1 
HETATM 6011 O O   . HOH J 5 .   ? 36.576 44.671 55.082  1.00 9.14  ? 1053 HOH A O   1 
HETATM 6012 O O   . HOH J 5 .   ? 43.494 35.165 103.311 1.00 17.63 ? 1054 HOH A O   1 
HETATM 6013 O O   . HOH J 5 .   ? 5.030  33.266 84.648  1.00 28.60 ? 1055 HOH A O   1 
HETATM 6014 O O   . HOH J 5 .   ? 6.308  36.787 73.858  1.00 20.02 ? 1056 HOH A O   1 
HETATM 6015 O O   . HOH J 5 .   ? 55.811 17.005 114.127 1.00 20.50 ? 1057 HOH A O   1 
HETATM 6016 O O   . HOH J 5 .   ? 23.778 22.376 76.625  1.00 10.44 ? 1058 HOH A O   1 
HETATM 6017 O O   . HOH J 5 .   ? 20.253 23.266 88.913  1.00 25.62 ? 1059 HOH A O   1 
HETATM 6018 O O   . HOH J 5 .   ? 52.891 18.764 103.321 1.00 21.81 ? 1060 HOH A O   1 
HETATM 6019 O O   . HOH J 5 .   ? 31.856 45.377 81.270  1.00 23.03 ? 1061 HOH A O   1 
HETATM 6020 O O   . HOH J 5 .   ? 63.666 56.878 100.876 1.00 22.70 ? 1062 HOH A O   1 
HETATM 6021 O O   . HOH J 5 .   ? 40.008 25.309 115.038 1.00 9.10  ? 1063 HOH A O   1 
HETATM 6022 O O   . HOH J 5 .   ? 64.994 33.754 114.654 1.00 31.17 ? 1064 HOH A O   1 
HETATM 6023 O O   . HOH J 5 .   ? 50.286 28.502 74.262  1.00 38.66 ? 1065 HOH A O   1 
HETATM 6024 O O   . HOH J 5 .   ? 48.974 34.682 92.873  1.00 37.50 ? 1066 HOH A O   1 
HETATM 6025 O O   . HOH J 5 .   ? 32.115 34.704 123.072 1.00 30.54 ? 1067 HOH A O   1 
HETATM 6026 O O   . HOH J 5 .   ? 34.235 29.874 97.655  1.00 12.55 ? 1068 HOH A O   1 
HETATM 6027 O O   . HOH J 5 .   ? 48.704 52.381 85.187  1.00 11.93 ? 1069 HOH A O   1 
HETATM 6028 O O   . HOH J 5 .   ? 61.947 48.472 88.356  1.00 29.97 ? 1070 HOH A O   1 
HETATM 6029 O O   . HOH J 5 .   ? 66.232 45.858 100.421 1.00 13.97 ? 1071 HOH A O   1 
HETATM 6030 O O   . HOH J 5 .   ? 55.636 63.459 110.466 1.00 19.39 ? 1072 HOH A O   1 
HETATM 6031 O O   . HOH J 5 .   ? 60.813 33.874 86.453  1.00 13.75 ? 1073 HOH A O   1 
HETATM 6032 O O   . HOH J 5 .   ? 28.827 66.207 80.817  1.00 32.38 ? 1074 HOH A O   1 
HETATM 6033 O O   . HOH J 5 .   ? 20.529 15.347 79.187  1.00 34.88 ? 1075 HOH A O   1 
HETATM 6034 O O   . HOH J 5 .   ? 18.556 57.646 105.419 1.00 37.29 ? 1076 HOH A O   1 
HETATM 6035 O O   . HOH J 5 .   ? 51.760 49.660 55.182  1.00 14.25 ? 1077 HOH A O   1 
HETATM 6036 O O   . HOH J 5 .   ? 34.664 33.099 59.204  1.00 30.74 ? 1078 HOH A O   1 
HETATM 6037 O O   . HOH J 5 .   ? 52.212 31.338 57.416  1.00 42.24 ? 1079 HOH A O   1 
HETATM 6038 O O   . HOH J 5 .   ? 14.940 59.697 62.651  1.00 33.43 ? 1080 HOH A O   1 
HETATM 6039 O O   . HOH J 5 .   ? 54.119 17.744 94.211  1.00 26.50 ? 1081 HOH A O   1 
HETATM 6040 O O   . HOH J 5 .   ? 42.350 46.575 112.816 1.00 18.01 ? 1082 HOH A O   1 
HETATM 6041 O O   . HOH J 5 .   ? 18.908 35.814 113.500 1.00 26.81 ? 1083 HOH A O   1 
HETATM 6042 O O   . HOH J 5 .   ? 30.714 19.175 83.895  1.00 22.92 ? 1084 HOH A O   1 
HETATM 6043 O O   . HOH J 5 .   ? 12.928 62.962 81.626  1.00 17.12 ? 1085 HOH A O   1 
HETATM 6044 O O   . HOH J 5 .   ? 61.349 45.229 91.680  1.00 29.06 ? 1086 HOH A O   1 
HETATM 6045 O O   . HOH J 5 .   ? 8.964  52.053 64.872  1.00 20.84 ? 1087 HOH A O   1 
HETATM 6046 O O   . HOH J 5 .   ? 41.946 60.844 89.198  1.00 10.06 ? 1088 HOH A O   1 
HETATM 6047 O O   . HOH J 5 .   ? 37.137 19.868 83.741  1.00 23.07 ? 1089 HOH A O   1 
HETATM 6048 O O   . HOH J 5 .   ? 17.742 42.925 108.017 1.00 29.32 ? 1090 HOH A O   1 
HETATM 6049 O O   . HOH J 5 .   ? 13.851 27.928 79.088  1.00 18.95 ? 1091 HOH A O   1 
HETATM 6050 O O   . HOH J 5 .   ? 39.973 33.785 103.978 1.00 23.86 ? 1092 HOH A O   1 
HETATM 6051 O O   . HOH J 5 .   ? 37.462 15.756 110.635 1.00 15.97 ? 1093 HOH A O   1 
HETATM 6052 O O   . HOH J 5 .   ? 24.499 26.932 107.185 1.00 34.30 ? 1094 HOH A O   1 
HETATM 6053 O O   . HOH J 5 .   ? 27.177 63.666 76.177  1.00 25.18 ? 1095 HOH A O   1 
HETATM 6054 O O   . HOH J 5 .   ? 48.243 53.958 81.758  1.00 11.34 ? 1096 HOH A O   1 
HETATM 6055 O O   . HOH J 5 .   ? 33.734 47.693 80.792  1.00 18.00 ? 1097 HOH A O   1 
HETATM 6056 O O   . HOH J 5 .   ? 37.573 29.841 87.978  1.00 29.55 ? 1098 HOH A O   1 
HETATM 6057 O O   . HOH J 5 .   ? 41.456 17.745 94.157  1.00 22.23 ? 1099 HOH A O   1 
HETATM 6058 O O   . HOH J 5 .   ? 22.695 29.838 104.466 1.00 33.93 ? 1100 HOH A O   1 
HETATM 6059 O O   . HOH J 5 .   ? 56.908 44.088 82.273  1.00 23.24 ? 1101 HOH A O   1 
HETATM 6060 O O   . HOH J 5 .   ? 48.719 32.346 85.346  1.00 11.80 ? 1102 HOH A O   1 
HETATM 6061 O O   . HOH J 5 .   ? 40.104 39.443 120.157 1.00 29.08 ? 1103 HOH A O   1 
HETATM 6062 O O   . HOH J 5 .   ? 66.278 35.317 103.361 1.00 16.57 ? 1104 HOH A O   1 
HETATM 6063 O O   . HOH J 5 .   ? 35.372 64.539 90.294  1.00 15.76 ? 1105 HOH A O   1 
HETATM 6064 O O   . HOH J 5 .   ? 68.847 33.662 97.714  1.00 21.66 ? 1106 HOH A O   1 
HETATM 6065 O O   . HOH J 5 .   ? 26.408 41.322 93.930  1.00 40.30 ? 1107 HOH A O   1 
HETATM 6066 O O   . HOH J 5 .   ? 45.088 31.431 98.789  1.00 14.66 ? 1108 HOH A O   1 
HETATM 6067 O O   . HOH J 5 .   ? 50.013 29.737 70.204  1.00 31.99 ? 1109 HOH A O   1 
HETATM 6068 O O   . HOH J 5 .   ? 53.096 47.897 68.308  1.00 22.36 ? 1110 HOH A O   1 
HETATM 6069 O O   . HOH J 5 .   ? 55.091 46.139 72.455  1.00 37.71 ? 1111 HOH A O   1 
HETATM 6070 O O   . HOH J 5 .   ? 37.781 58.577 67.625  1.00 23.05 ? 1112 HOH A O   1 
HETATM 6071 O O   . HOH J 5 .   ? 46.503 25.373 117.903 1.00 17.92 ? 1113 HOH A O   1 
HETATM 6072 O O   . HOH J 5 .   ? 6.787  47.913 78.790  1.00 16.73 ? 1114 HOH A O   1 
HETATM 6073 O O   . HOH J 5 .   ? 50.618 53.789 87.481  1.00 26.98 ? 1115 HOH A O   1 
HETATM 6074 O O   . HOH J 5 .   ? 36.168 50.776 78.927  1.00 17.65 ? 1116 HOH A O   1 
HETATM 6075 O O   . HOH J 5 .   ? 36.611 66.389 86.544  1.00 38.10 ? 1117 HOH A O   1 
HETATM 6076 O O   . HOH J 5 .   ? 22.301 37.451 119.928 1.00 32.16 ? 1118 HOH A O   1 
HETATM 6077 O O   . HOH J 5 .   ? 54.816 48.975 72.618  1.00 28.55 ? 1119 HOH A O   1 
HETATM 6078 O O   . HOH J 5 .   ? 33.161 50.360 84.775  1.00 29.77 ? 1120 HOH A O   1 
HETATM 6079 O O   . HOH J 5 .   ? 20.143 60.471 98.790  1.00 34.84 ? 1121 HOH A O   1 
HETATM 6080 O O   . HOH J 5 .   ? 31.438 58.142 110.037 1.00 34.24 ? 1122 HOH A O   1 
HETATM 6081 O O   . HOH J 5 .   ? 66.731 29.603 100.890 1.00 31.59 ? 1123 HOH A O   1 
HETATM 6082 O O   . HOH J 5 .   ? 10.905 34.738 93.706  1.00 20.13 ? 1124 HOH A O   1 
HETATM 6083 O O   . HOH J 5 .   ? 60.369 27.154 88.463  1.00 15.66 ? 1125 HOH A O   1 
HETATM 6084 O O   . HOH J 5 .   ? 31.244 25.652 120.066 1.00 33.87 ? 1126 HOH A O   1 
HETATM 6085 O O   . HOH J 5 .   ? 37.988 36.677 85.195  1.00 30.40 ? 1127 HOH A O   1 
HETATM 6086 O O   . HOH J 5 .   ? 32.323 56.102 93.245  1.00 16.05 ? 1128 HOH A O   1 
HETATM 6087 O O   . HOH J 5 .   ? 32.938 30.268 95.066  1.00 17.51 ? 1129 HOH A O   1 
HETATM 6088 O O   . HOH J 5 .   ? 67.662 33.617 101.620 1.00 28.36 ? 1130 HOH A O   1 
HETATM 6089 O O   . HOH J 5 .   ? 42.477 13.279 98.605  1.00 25.81 ? 1131 HOH A O   1 
HETATM 6090 O O   . HOH J 5 .   ? 28.044 25.639 108.311 1.00 18.82 ? 1132 HOH A O   1 
HETATM 6091 O O   . HOH J 5 .   ? 60.576 28.273 106.659 1.00 15.23 ? 1133 HOH A O   1 
HETATM 6092 O O   . HOH J 5 .   ? 26.038 64.685 83.230  1.00 40.97 ? 1134 HOH A O   1 
HETATM 6093 O O   . HOH J 5 .   ? 28.803 64.695 94.295  1.00 17.65 ? 1135 HOH A O   1 
HETATM 6094 O O   . HOH J 5 .   ? 31.668 35.239 92.647  1.00 17.57 ? 1136 HOH A O   1 
HETATM 6095 O O   . HOH J 5 .   ? 20.513 58.442 68.650  1.00 26.75 ? 1137 HOH A O   1 
HETATM 6096 O O   . HOH J 5 .   ? 46.499 62.292 100.797 1.00 20.28 ? 1138 HOH A O   1 
HETATM 6097 O O   . HOH J 5 .   ? 32.416 52.821 76.785  1.00 26.60 ? 1139 HOH A O   1 
HETATM 6098 O O   . HOH J 5 .   ? 40.865 23.638 56.075  1.00 36.53 ? 1140 HOH A O   1 
HETATM 6099 O O   . HOH J 5 .   ? 62.350 55.380 98.854  1.00 16.98 ? 1141 HOH A O   1 
HETATM 6100 O O   . HOH J 5 .   ? 26.756 56.321 110.251 1.00 35.15 ? 1142 HOH A O   1 
HETATM 6101 O O   . HOH J 5 .   ? 30.446 53.216 106.585 1.00 17.91 ? 1143 HOH A O   1 
HETATM 6102 O O   . HOH J 5 .   ? 41.850 41.589 120.085 1.00 25.25 ? 1144 HOH A O   1 
HETATM 6103 O O   . HOH J 5 .   ? 13.827 30.943 94.715  1.00 18.41 ? 1145 HOH A O   1 
HETATM 6104 O O   . HOH J 5 .   ? 23.855 58.404 62.285  1.00 19.75 ? 1146 HOH A O   1 
HETATM 6105 O O   . HOH J 5 .   ? 39.947 23.004 116.426 1.00 20.11 ? 1147 HOH A O   1 
HETATM 6106 O O   . HOH J 5 .   ? 44.344 44.421 87.881  1.00 15.89 ? 1148 HOH A O   1 
HETATM 6107 O O   . HOH J 5 .   ? 11.330 46.291 69.257  1.00 35.07 ? 1149 HOH A O   1 
HETATM 6108 O O   . HOH J 5 .   ? 51.776 52.249 60.631  1.00 12.90 ? 1150 HOH A O   1 
HETATM 6109 O O   . HOH J 5 .   ? 52.213 48.649 72.109  1.00 26.54 ? 1151 HOH A O   1 
HETATM 6110 O O   . HOH J 5 .   ? 27.385 48.532 81.892  1.00 33.02 ? 1152 HOH A O   1 
HETATM 6111 O O   . HOH J 5 .   ? 33.832 56.593 58.874  1.00 17.03 ? 1153 HOH A O   1 
HETATM 6112 O O   . HOH J 5 .   ? 72.122 36.914 105.253 1.00 36.42 ? 1154 HOH A O   1 
HETATM 6113 O O   . HOH J 5 .   ? 69.412 44.612 98.361  1.00 24.98 ? 1155 HOH A O   1 
HETATM 6114 O O   . HOH J 5 .   ? 50.894 20.366 90.014  1.00 37.64 ? 1156 HOH A O   1 
HETATM 6115 O O   . HOH J 5 .   ? 39.204 50.330 96.880  1.00 18.66 ? 1157 HOH A O   1 
HETATM 6116 O O   . HOH J 5 .   ? 37.506 59.420 73.194  1.00 36.03 ? 1158 HOH A O   1 
HETATM 6117 O O   . HOH J 5 .   ? 34.386 46.570 85.480  1.00 29.19 ? 1159 HOH A O   1 
HETATM 6118 O O   . HOH J 5 .   ? 65.001 40.213 90.177  1.00 25.61 ? 1160 HOH A O   1 
HETATM 6119 O O   . HOH J 5 .   ? 47.189 65.087 111.813 1.00 37.74 ? 1161 HOH A O   1 
HETATM 6120 O O   . HOH J 5 .   ? 67.997 47.849 101.527 1.00 20.20 ? 1162 HOH A O   1 
HETATM 6121 O O   . HOH J 5 .   ? 23.204 19.802 76.005  1.00 24.14 ? 1163 HOH A O   1 
HETATM 6122 O O   . HOH J 5 .   ? 13.152 37.449 65.170  1.00 33.89 ? 1164 HOH A O   1 
HETATM 6123 O O   . HOH J 5 .   ? 44.427 39.657 110.559 1.00 25.85 ? 1165 HOH A O   1 
HETATM 6124 O O   . HOH J 5 .   ? 23.701 62.650 65.240  1.00 38.70 ? 1166 HOH A O   1 
HETATM 6125 O O   . HOH J 5 .   ? 48.844 43.414 108.472 1.00 21.96 ? 1167 HOH A O   1 
HETATM 6126 O O   . HOH J 5 .   ? 53.113 55.841 77.220  1.00 37.57 ? 1168 HOH A O   1 
HETATM 6127 O O   . HOH J 5 .   ? 48.620 63.726 101.590 1.00 23.97 ? 1169 HOH A O   1 
HETATM 6128 O O   . HOH J 5 .   ? 20.059 37.381 101.055 1.00 19.86 ? 1170 HOH A O   1 
HETATM 6129 O O   . HOH J 5 .   ? 21.040 45.401 88.822  1.00 21.66 ? 1171 HOH A O   1 
HETATM 6130 O O   . HOH J 5 .   ? 46.802 34.161 94.804  1.00 31.66 ? 1172 HOH A O   1 
HETATM 6131 O O   . HOH J 5 .   ? 34.572 58.596 73.642  1.00 32.96 ? 1173 HOH A O   1 
HETATM 6132 O O   . HOH J 5 .   ? 38.538 61.837 114.137 1.00 21.79 ? 1174 HOH A O   1 
HETATM 6133 O O   . HOH J 5 .   ? 10.683 28.584 89.000  1.00 19.86 ? 1175 HOH A O   1 
HETATM 6134 O O   . HOH J 5 .   ? 46.415 49.842 117.582 1.00 30.60 ? 1176 HOH A O   1 
HETATM 6135 O O   . HOH J 5 .   ? 53.539 62.782 114.858 1.00 38.28 ? 1177 HOH A O   1 
HETATM 6136 O O   . HOH J 5 .   ? 52.163 33.694 76.907  1.00 23.81 ? 1178 HOH A O   1 
HETATM 6137 O O   . HOH J 5 .   ? 34.408 26.504 92.485  1.00 15.45 ? 1179 HOH A O   1 
HETATM 6138 O O   . HOH J 5 .   ? 26.615 45.974 81.430  1.00 39.29 ? 1180 HOH A O   1 
HETATM 6139 O O   . HOH J 5 .   ? 30.658 57.421 107.549 1.00 37.52 ? 1181 HOH A O   1 
HETATM 6140 O O   . HOH J 5 .   ? 34.939 64.731 84.835  1.00 25.79 ? 1182 HOH A O   1 
HETATM 6141 O O   . HOH J 5 .   ? 51.681 16.714 94.996  1.00 21.89 ? 1183 HOH A O   1 
HETATM 6142 O O   . HOH J 5 .   ? 42.659 57.278 117.496 1.00 31.29 ? 1184 HOH A O   1 
HETATM 6143 O O   . HOH J 5 .   ? 39.247 66.847 105.130 1.00 26.28 ? 1185 HOH A O   1 
HETATM 6144 O O   . HOH J 5 .   ? 13.005 38.535 95.628  1.00 29.27 ? 1186 HOH A O   1 
HETATM 6145 O O   . HOH J 5 .   ? 44.470 20.249 112.511 1.00 33.10 ? 1187 HOH A O   1 
HETATM 6146 O O   . HOH J 5 .   ? 43.480 29.630 71.917  1.00 11.90 ? 1188 HOH A O   1 
HETATM 6147 O O   . HOH J 5 .   ? 45.488 62.600 96.466  1.00 23.19 ? 1189 HOH A O   1 
HETATM 6148 O O   . HOH J 5 .   ? 16.060 17.366 78.769  1.00 35.69 ? 1190 HOH A O   1 
HETATM 6149 O O   . HOH J 5 .   ? 43.912 22.128 88.421  1.00 28.34 ? 1191 HOH A O   1 
HETATM 6150 O O   . HOH J 5 .   ? 45.752 60.997 108.889 1.00 28.73 ? 1192 HOH A O   1 
HETATM 6151 O O   . HOH J 5 .   ? 9.321  46.621 64.375  1.00 28.00 ? 1193 HOH A O   1 
HETATM 6152 O O   . HOH J 5 .   ? 47.012 62.888 85.722  1.00 24.21 ? 1194 HOH A O   1 
HETATM 6153 O O   . HOH J 5 .   ? 57.993 57.868 107.769 1.00 13.94 ? 1195 HOH A O   1 
HETATM 6154 O O   . HOH J 5 .   ? 52.859 63.677 110.716 1.00 24.45 ? 1196 HOH A O   1 
HETATM 6155 O O   . HOH J 5 .   ? 51.943 22.002 87.982  1.00 29.52 ? 1197 HOH A O   1 
HETATM 6156 O O   . HOH J 5 .   ? 14.474 40.194 67.033  1.00 29.57 ? 1198 HOH A O   1 
HETATM 6157 O O   . HOH J 5 .   ? 47.084 41.762 98.957  1.00 21.30 ? 1199 HOH A O   1 
HETATM 6158 O O   . HOH J 5 .   ? 33.950 31.620 119.606 1.00 18.29 ? 1200 HOH A O   1 
HETATM 6159 O O   . HOH J 5 .   ? 33.667 46.150 99.608  1.00 34.13 ? 1201 HOH A O   1 
HETATM 6160 O O   . HOH J 5 .   ? 27.360 40.023 91.407  1.00 37.69 ? 1202 HOH A O   1 
HETATM 6161 O O   . HOH J 5 .   ? 40.011 44.619 87.921  1.00 24.30 ? 1203 HOH A O   1 
HETATM 6162 O O   . HOH J 5 .   ? 5.815  47.580 98.993  1.00 35.98 ? 1204 HOH A O   1 
HETATM 6163 O O   . HOH J 5 .   ? 21.984 42.080 110.152 1.00 20.76 ? 1205 HOH A O   1 
HETATM 6164 O O   . HOH J 5 .   ? 45.978 52.224 71.299  1.00 14.99 ? 1206 HOH A O   1 
HETATM 6165 O O   . HOH J 5 .   ? 57.191 56.043 112.358 1.00 16.46 ? 1207 HOH A O   1 
HETATM 6166 O O   . HOH J 5 .   ? 62.828 23.736 97.965  1.00 32.50 ? 1208 HOH A O   1 
HETATM 6167 O O   . HOH J 5 .   ? 43.724 18.213 74.495  1.00 20.55 ? 1209 HOH A O   1 
HETATM 6168 O O   . HOH J 5 .   ? 46.510 43.072 81.944  1.00 7.46  ? 1210 HOH A O   1 
HETATM 6169 O O   . HOH J 5 .   ? 53.006 51.241 116.149 1.00 9.88  ? 1211 HOH A O   1 
HETATM 6170 O O   . HOH J 5 .   ? 34.898 44.339 101.695 1.00 28.08 ? 1212 HOH A O   1 
HETATM 6171 O O   . HOH J 5 .   ? 46.435 37.326 105.735 1.00 18.27 ? 1213 HOH A O   1 
HETATM 6172 O O   . HOH J 5 .   ? 17.817 25.325 93.277  1.00 39.21 ? 1214 HOH A O   1 
HETATM 6173 O O   . HOH J 5 .   ? 28.058 50.624 54.212  1.00 39.74 ? 1215 HOH A O   1 
HETATM 6174 O O   . HOH J 5 .   ? 44.484 36.391 118.823 1.00 37.44 ? 1216 HOH A O   1 
HETATM 6175 O O   . HOH J 5 .   ? 23.499 36.775 128.518 1.00 33.47 ? 1217 HOH A O   1 
HETATM 6176 O O   . HOH J 5 .   ? 40.168 57.311 59.732  1.00 16.98 ? 1218 HOH A O   1 
HETATM 6177 O O   . HOH J 5 .   ? 33.567 65.473 102.135 1.00 30.83 ? 1219 HOH A O   1 
HETATM 6178 O O   . HOH J 5 .   ? 14.068 40.485 100.757 1.00 33.74 ? 1220 HOH A O   1 
HETATM 6179 O O   . HOH J 5 .   ? 32.034 55.224 98.134  1.00 21.03 ? 1221 HOH A O   1 
HETATM 6180 O O   . HOH J 5 .   ? 1.643  45.801 81.070  1.00 21.45 ? 1222 HOH A O   1 
HETATM 6181 O O   . HOH J 5 .   ? 33.256 43.708 72.988  1.00 7.19  ? 1223 HOH A O   1 
HETATM 6182 O O   . HOH J 5 .   ? 42.273 26.816 115.675 1.00 9.69  ? 1224 HOH A O   1 
HETATM 6183 O O   . HOH J 5 .   ? 29.879 32.241 67.616  1.00 8.08  ? 1225 HOH A O   1 
HETATM 6184 O O   . HOH J 5 .   ? 39.402 28.660 85.022  1.00 9.63  ? 1226 HOH A O   1 
HETATM 6185 O O   . HOH J 5 .   ? 43.771 49.394 69.476  1.00 12.28 ? 1227 HOH A O   1 
HETATM 6186 O O   . HOH J 5 .   ? 24.427 46.642 59.305  1.00 13.24 ? 1228 HOH A O   1 
HETATM 6187 O O   . HOH J 5 .   ? 52.675 31.051 115.487 1.00 16.14 ? 1229 HOH A O   1 
HETATM 6188 O O   . HOH J 5 .   ? 49.275 45.457 80.031  1.00 10.48 ? 1230 HOH A O   1 
HETATM 6189 O O   . HOH J 5 .   ? 55.502 46.059 75.529  1.00 14.40 ? 1231 HOH A O   1 
HETATM 6190 O O   . HOH J 5 .   ? 40.841 16.533 102.197 1.00 12.68 ? 1232 HOH A O   1 
HETATM 6191 O O   . HOH J 5 .   ? 46.947 18.299 109.778 1.00 8.64  ? 1233 HOH A O   1 
HETATM 6192 O O   . HOH J 5 .   ? 66.620 50.557 106.286 1.00 21.51 ? 1234 HOH A O   1 
HETATM 6193 O O   . HOH J 5 .   ? 24.257 40.537 128.575 1.00 22.65 ? 1235 HOH A O   1 
HETATM 6194 O O   . HOH J 5 .   ? 52.619 53.776 58.420  1.00 13.41 ? 1236 HOH A O   1 
HETATM 6195 O O   . HOH J 5 .   ? 32.619 48.599 78.463  1.00 14.65 ? 1237 HOH A O   1 
HETATM 6196 O O   . HOH J 5 .   ? 64.475 30.573 93.197  1.00 12.75 ? 1238 HOH A O   1 
HETATM 6197 O O   . HOH J 5 .   ? 43.870 25.023 117.085 1.00 14.09 ? 1239 HOH A O   1 
HETATM 6198 O O   . HOH J 5 .   ? 49.882 56.555 87.803  1.00 26.22 ? 1240 HOH A O   1 
HETATM 6199 O O   . HOH J 5 .   ? 30.480 38.207 122.241 1.00 23.87 ? 1241 HOH A O   1 
HETATM 6200 O O   . HOH J 5 .   ? 53.385 50.700 62.225  1.00 11.97 ? 1242 HOH A O   1 
HETATM 6201 O O   . HOH J 5 .   ? 43.833 24.565 86.934  1.00 16.64 ? 1243 HOH A O   1 
HETATM 6202 O O   . HOH J 5 .   ? 37.736 32.763 102.790 1.00 19.17 ? 1244 HOH A O   1 
HETATM 6203 O O   . HOH J 5 .   ? 48.954 17.112 90.682  1.00 17.82 ? 1245 HOH A O   1 
HETATM 6204 O O   . HOH J 5 .   ? 34.028 46.484 119.646 1.00 16.71 ? 1246 HOH A O   1 
HETATM 6205 O O   . HOH J 5 .   ? 40.087 48.518 91.029  1.00 21.25 ? 1247 HOH A O   1 
HETATM 6206 O O   . HOH J 5 .   ? 61.403 42.057 107.619 1.00 10.82 ? 1248 HOH A O   1 
HETATM 6207 O O   . HOH J 5 .   ? 64.641 49.549 107.967 1.00 16.15 ? 1249 HOH A O   1 
HETATM 6208 O O   . HOH J 5 .   ? 43.309 47.991 115.286 1.00 18.60 ? 1250 HOH A O   1 
HETATM 6209 O O   . HOH J 5 .   ? 17.343 46.219 66.599  1.00 13.06 ? 1251 HOH A O   1 
HETATM 6210 O O   . HOH J 5 .   ? 39.701 49.941 83.724  1.00 9.25  ? 1252 HOH A O   1 
HETATM 6211 O O   . HOH J 5 .   ? 44.881 49.419 55.724  1.00 13.67 ? 1253 HOH A O   1 
HETATM 6212 O O   . HOH J 5 .   ? 44.120 37.197 107.437 1.00 20.78 ? 1254 HOH A O   1 
HETATM 6213 O O   . HOH J 5 .   ? 7.642  33.844 85.374  1.00 18.05 ? 1255 HOH A O   1 
HETATM 6214 O O   . HOH J 5 .   ? 43.128 22.346 116.749 1.00 21.29 ? 1256 HOH A O   1 
HETATM 6215 O O   . HOH J 5 .   ? 26.288 46.143 117.848 1.00 16.70 ? 1257 HOH A O   1 
HETATM 6216 O O   . HOH J 5 .   ? 26.249 26.816 119.088 1.00 12.46 ? 1258 HOH A O   1 
HETATM 6217 O O   . HOH J 5 .   ? 36.396 45.212 52.359  1.00 22.23 ? 1259 HOH A O   1 
HETATM 6218 O O   . HOH J 5 .   ? 16.213 52.526 94.646  1.00 28.24 ? 1260 HOH A O   1 
HETATM 6219 O O   . HOH J 5 .   ? 38.891 44.190 107.900 1.00 29.47 ? 1261 HOH A O   1 
HETATM 6220 O O   . HOH J 5 .   ? 43.570 54.485 68.369  1.00 15.78 ? 1262 HOH A O   1 
HETATM 6221 O O   . HOH J 5 .   ? 37.333 53.710 91.033  1.00 15.41 ? 1263 HOH A O   1 
HETATM 6222 O O   . HOH J 5 .   ? 64.994 42.854 104.217 1.00 15.59 ? 1264 HOH A O   1 
HETATM 6223 O O   . HOH J 5 .   ? 57.301 14.164 114.390 1.00 12.46 ? 1265 HOH A O   1 
HETATM 6224 O O   . HOH J 5 .   ? 66.903 44.363 102.785 1.00 18.73 ? 1266 HOH A O   1 
HETATM 6225 O O   . HOH J 5 .   ? 29.868 38.031 99.248  1.00 15.94 ? 1267 HOH A O   1 
HETATM 6226 O O   . HOH J 5 .   ? 63.391 36.672 110.799 1.00 27.59 ? 1268 HOH A O   1 
HETATM 6227 O O   . HOH J 5 .   ? 30.396 33.404 56.776  1.00 18.49 ? 1269 HOH A O   1 
HETATM 6228 O O   . HOH J 5 .   ? 49.992 42.929 68.912  1.00 17.38 ? 1270 HOH A O   1 
HETATM 6229 O O   . HOH J 5 .   ? 67.057 36.481 95.878  1.00 15.98 ? 1271 HOH A O   1 
HETATM 6230 O O   . HOH J 5 .   ? 47.694 40.632 103.019 1.00 17.51 ? 1272 HOH A O   1 
HETATM 6231 O O   . HOH J 5 .   ? 22.325 56.347 107.630 1.00 23.81 ? 1273 HOH A O   1 
HETATM 6232 O O   . HOH J 5 .   ? 38.053 44.090 50.536  1.00 19.07 ? 1274 HOH A O   1 
HETATM 6233 O O   . HOH J 5 .   ? 67.456 39.589 95.889  1.00 18.94 ? 1275 HOH A O   1 
HETATM 6234 O O   . HOH J 5 .   ? 47.771 35.309 98.117  1.00 26.37 ? 1276 HOH A O   1 
HETATM 6235 O O   . HOH J 5 .   ? 47.245 28.313 68.629  1.00 21.25 ? 1277 HOH A O   1 
HETATM 6236 O O   . HOH J 5 .   ? 37.815 58.595 59.668  1.00 24.71 ? 1278 HOH A O   1 
HETATM 6237 O O   . HOH J 5 .   ? 24.095 22.348 72.119  1.00 17.80 ? 1279 HOH A O   1 
HETATM 6238 O O   . HOH J 5 .   ? 30.008 23.053 119.890 1.00 26.22 ? 1280 HOH A O   1 
HETATM 6239 O O   . HOH J 5 .   ? 12.611 46.112 66.301  1.00 27.50 ? 1281 HOH A O   1 
HETATM 6240 O O   . HOH J 5 .   ? 24.331 21.659 93.567  1.00 22.72 ? 1282 HOH A O   1 
HETATM 6241 O O   . HOH J 5 .   ? 28.639 59.554 60.916  1.00 17.47 ? 1283 HOH A O   1 
HETATM 6242 O O   . HOH J 5 .   ? 65.195 27.627 96.898  1.00 26.14 ? 1284 HOH A O   1 
HETATM 6243 O O   . HOH J 5 .   ? 49.985 48.162 117.111 1.00 19.62 ? 1285 HOH A O   1 
HETATM 6244 O O   . HOH J 5 .   ? 13.843 66.863 80.088  1.00 22.12 ? 1286 HOH A O   1 
HETATM 6245 O O   . HOH J 5 .   ? 21.723 65.396 79.099  1.00 18.32 ? 1287 HOH A O   1 
HETATM 6246 O O   . HOH J 5 .   ? 36.097 21.051 94.137  1.00 20.13 ? 1288 HOH A O   1 
HETATM 6247 O O   . HOH J 5 .   ? 32.256 66.392 96.785  1.00 16.45 ? 1289 HOH A O   1 
HETATM 6248 O O   . HOH J 5 .   ? 49.176 60.072 90.261  1.00 17.31 ? 1290 HOH A O   1 
HETATM 6249 O O   . HOH J 5 .   ? 49.368 40.561 60.177  1.00 23.68 ? 1291 HOH A O   1 
HETATM 6250 O O   . HOH J 5 .   ? 65.399 26.554 109.575 1.00 23.35 ? 1292 HOH A O   1 
HETATM 6251 O O   . HOH J 5 .   ? 6.795  50.843 65.894  1.00 21.54 ? 1293 HOH A O   1 
HETATM 6252 O O   . HOH J 5 .   ? 7.882  53.334 76.181  1.00 17.52 ? 1294 HOH A O   1 
HETATM 6253 O O   . HOH J 5 .   ? 54.703 27.240 116.979 1.00 22.02 ? 1295 HOH A O   1 
HETATM 6254 O O   . HOH J 5 .   ? 42.811 34.657 100.687 1.00 26.31 ? 1296 HOH A O   1 
HETATM 6255 O O   . HOH J 5 .   ? 33.284 39.717 89.800  1.00 36.80 ? 1297 HOH A O   1 
HETATM 6256 O O   . HOH J 5 .   ? 51.678 14.174 108.771 1.00 19.25 ? 1298 HOH A O   1 
HETATM 6257 O O   . HOH J 5 .   ? 28.284 23.497 68.793  1.00 24.25 ? 1299 HOH A O   1 
HETATM 6258 O O   . HOH J 5 .   ? 52.174 22.818 117.401 1.00 25.75 ? 1300 HOH A O   1 
HETATM 6259 O O   . HOH J 5 .   ? 27.571 47.090 128.702 1.00 17.54 ? 1301 HOH A O   1 
HETATM 6260 O O   . HOH J 5 .   ? 63.882 43.621 84.836  1.00 26.81 ? 1302 HOH A O   1 
HETATM 6261 O O   . HOH J 5 .   ? 7.759  31.178 72.349  1.00 29.47 ? 1303 HOH A O   1 
HETATM 6262 O O   . HOH J 5 .   ? 48.628 52.980 71.076  1.00 23.52 ? 1304 HOH A O   1 
HETATM 6263 O O   . HOH J 5 .   ? 24.956 19.752 71.648  1.00 31.21 ? 1305 HOH A O   1 
HETATM 6264 O O   . HOH J 5 .   ? 54.334 27.784 80.698  1.00 28.29 ? 1306 HOH A O   1 
HETATM 6265 O O   . HOH J 5 .   ? 18.745 31.542 63.691  1.00 21.10 ? 1307 HOH A O   1 
HETATM 6266 O O   . HOH J 5 .   ? 49.025 56.264 80.620  1.00 26.18 ? 1308 HOH A O   1 
HETATM 6267 O O   . HOH J 5 .   ? 36.574 16.798 66.968  1.00 27.02 ? 1309 HOH A O   1 
HETATM 6268 O O   . HOH J 5 .   ? 54.888 55.347 113.692 1.00 15.83 ? 1310 HOH A O   1 
HETATM 6269 O O   . HOH J 5 .   ? 32.025 18.441 88.012  1.00 20.56 ? 1311 HOH A O   1 
HETATM 6270 O O   . HOH J 5 .   ? 60.272 39.732 108.809 1.00 19.21 ? 1312 HOH A O   1 
HETATM 6271 O O   . HOH J 5 .   ? 62.429 25.917 99.629  1.00 21.96 ? 1313 HOH A O   1 
HETATM 6272 O O   . HOH J 5 .   ? 61.787 25.723 107.723 1.00 25.70 ? 1314 HOH A O   1 
HETATM 6273 O O   . HOH J 5 .   ? 42.527 45.607 93.549  1.00 30.19 ? 1315 HOH A O   1 
HETATM 6274 O O   . HOH J 5 .   ? 29.509 61.873 105.609 1.00 22.16 ? 1316 HOH A O   1 
HETATM 6275 O O   . HOH J 5 .   ? 10.474 57.728 70.828  1.00 20.35 ? 1317 HOH A O   1 
HETATM 6276 O O   . HOH J 5 .   ? 66.367 32.508 92.485  1.00 23.77 ? 1318 HOH A O   1 
HETATM 6277 O O   . HOH J 5 .   ? 58.558 39.759 113.125 1.00 25.58 ? 1319 HOH A O   1 
HETATM 6278 O O   . HOH J 5 .   ? 35.895 14.564 104.814 1.00 25.37 ? 1320 HOH A O   1 
HETATM 6279 O O   . HOH J 5 .   ? 43.533 65.717 99.422  1.00 18.63 ? 1321 HOH A O   1 
HETATM 6280 O O   . HOH J 5 .   ? 26.738 32.317 54.191  1.00 30.32 ? 1322 HOH A O   1 
HETATM 6281 O O   . HOH J 5 .   ? 15.773 42.584 55.940  1.00 19.22 ? 1323 HOH A O   1 
HETATM 6282 O O   . HOH J 5 .   ? 45.109 47.020 112.384 1.00 18.37 ? 1324 HOH A O   1 
HETATM 6283 O O   . HOH J 5 .   ? 45.790 54.872 72.340  1.00 20.40 ? 1325 HOH A O   1 
HETATM 6284 O O   . HOH J 5 .   ? 54.944 20.033 104.786 1.00 20.91 ? 1326 HOH A O   1 
HETATM 6285 O O   . HOH J 5 .   ? 18.489 31.254 59.060  1.00 25.61 ? 1327 HOH A O   1 
HETATM 6286 O O   . HOH J 5 .   ? 60.073 59.631 94.954  1.00 25.70 ? 1328 HOH A O   1 
HETATM 6287 O O   . HOH J 5 .   ? 34.165 62.118 99.169  1.00 15.94 ? 1329 HOH A O   1 
HETATM 6288 O O   . HOH J 5 .   ? 50.084 18.483 100.445 1.00 27.86 ? 1330 HOH A O   1 
HETATM 6289 O O   . HOH J 5 .   ? -0.225 38.660 82.674  1.00 25.99 ? 1331 HOH A O   1 
HETATM 6290 O O   . HOH J 5 .   ? 64.939 32.418 117.195 1.00 31.18 ? 1332 HOH A O   1 
HETATM 6291 O O   . HOH J 5 .   ? 39.248 18.597 82.135  1.00 27.99 ? 1333 HOH A O   1 
HETATM 6292 O O   . HOH J 5 .   ? 32.406 25.518 122.605 1.00 28.33 ? 1334 HOH A O   1 
HETATM 6293 O O   . HOH J 5 .   ? 47.603 59.743 83.301  1.00 27.53 ? 1335 HOH A O   1 
HETATM 6294 O O   . HOH J 5 .   ? 36.093 57.398 57.580  1.00 29.93 ? 1336 HOH A O   1 
HETATM 6295 O O   . HOH J 5 .   ? 47.520 53.136 114.230 1.00 18.90 ? 1337 HOH A O   1 
HETATM 6296 O O   . HOH J 5 .   ? 22.073 39.783 57.316  1.00 22.38 ? 1338 HOH A O   1 
HETATM 6297 O O   . HOH J 5 .   ? 57.971 22.705 93.474  1.00 26.35 ? 1339 HOH A O   1 
HETATM 6298 O O   . HOH J 5 .   ? 62.757 26.947 90.275  1.00 30.74 ? 1340 HOH A O   1 
HETATM 6299 O O   . HOH J 5 .   ? 28.322 53.090 92.393  1.00 26.88 ? 1341 HOH A O   1 
HETATM 6300 O O   . HOH J 5 .   ? 36.161 49.857 89.978  1.00 23.15 ? 1342 HOH A O   1 
HETATM 6301 O O   . HOH J 5 .   ? 36.939 65.121 97.592  1.00 19.44 ? 1343 HOH A O   1 
HETATM 6302 O O   . HOH J 5 .   ? 0.769  45.730 78.418  1.00 26.02 ? 1344 HOH A O   1 
HETATM 6303 O O   . HOH J 5 .   ? 19.476 43.253 104.529 1.00 24.05 ? 1345 HOH A O   1 
HETATM 6304 O O   . HOH J 5 .   ? 8.515  49.715 74.001  1.00 18.75 ? 1346 HOH A O   1 
HETATM 6305 O O   . HOH J 5 .   ? 28.474 38.381 52.955  1.00 23.14 ? 1347 HOH A O   1 
HETATM 6306 O O   . HOH J 5 .   ? 45.104 25.469 80.731  1.00 17.98 ? 1348 HOH A O   1 
HETATM 6307 O O   . HOH J 5 .   ? 45.411 39.155 103.750 1.00 32.39 ? 1349 HOH A O   1 
HETATM 6308 O O   . HOH J 5 .   ? 48.062 61.939 96.398  1.00 26.99 ? 1350 HOH A O   1 
HETATM 6309 O O   . HOH J 5 .   ? 34.302 28.439 62.466  1.00 24.50 ? 1351 HOH A O   1 
HETATM 6310 O O   . HOH J 5 .   ? 26.402 48.406 116.275 1.00 30.53 ? 1352 HOH A O   1 
HETATM 6311 O O   . HOH J 5 .   ? 48.598 23.189 64.133  1.00 30.51 ? 1353 HOH A O   1 
HETATM 6312 O O   . HOH J 5 .   ? 41.963 9.902  107.665 1.00 28.11 ? 1354 HOH A O   1 
HETATM 6313 O O   . HOH J 5 .   ? 30.329 58.574 74.961  1.00 25.14 ? 1355 HOH A O   1 
HETATM 6314 O O   . HOH J 5 .   ? 34.026 34.787 53.896  1.00 26.59 ? 1356 HOH A O   1 
HETATM 6315 O O   . HOH J 5 .   ? 25.608 49.674 93.553  1.00 27.20 ? 1357 HOH A O   1 
HETATM 6316 O O   . HOH J 5 .   ? 33.509 65.978 88.572  1.00 26.65 ? 1358 HOH A O   1 
HETATM 6317 O O   . HOH J 5 .   ? 56.720 22.017 111.753 1.00 25.77 ? 1359 HOH A O   1 
HETATM 6318 O O   . HOH J 5 .   ? 46.810 26.243 82.959  1.00 26.59 ? 1360 HOH A O   1 
HETATM 6319 O O   . HOH J 5 .   ? 25.490 61.453 103.494 1.00 26.73 ? 1361 HOH A O   1 
HETATM 6320 O O   . HOH J 5 .   ? 42.125 55.450 70.747  1.00 20.33 ? 1362 HOH A O   1 
HETATM 6321 O O   . HOH J 5 .   ? 35.281 54.571 118.350 1.00 26.50 ? 1363 HOH A O   1 
HETATM 6322 O O   . HOH J 5 .   ? 33.076 49.180 118.829 1.00 30.57 ? 1364 HOH A O   1 
HETATM 6323 O O   . HOH J 5 .   ? 11.621 30.747 93.091  1.00 24.76 ? 1365 HOH A O   1 
HETATM 6324 O O   . HOH J 5 .   ? 46.602 37.553 99.308  1.00 28.03 ? 1366 HOH A O   1 
HETATM 6325 O O   . HOH J 5 .   ? 48.815 26.715 64.132  1.00 29.70 ? 1367 HOH A O   1 
HETATM 6326 O O   . HOH J 5 .   ? 38.850 46.125 100.476 1.00 27.88 ? 1368 HOH A O   1 
HETATM 6327 O O   . HOH J 5 .   ? 18.159 37.919 51.634  1.00 31.57 ? 1369 HOH A O   1 
HETATM 6328 O O   . HOH J 5 .   ? 40.295 45.841 109.842 1.00 23.49 ? 1370 HOH A O   1 
HETATM 6329 O O   . HOH J 5 .   ? 38.633 59.076 70.570  1.00 27.69 ? 1371 HOH A O   1 
HETATM 6330 O O   . HOH J 5 .   ? 40.553 29.687 55.303  1.00 29.76 ? 1372 HOH A O   1 
HETATM 6331 O O   . HOH J 5 .   ? 30.656 53.924 94.045  1.00 31.69 ? 1373 HOH A O   1 
HETATM 6332 O O   . HOH J 5 .   ? 7.888  29.660 88.615  1.00 36.08 ? 1374 HOH A O   1 
HETATM 6333 O O   . HOH J 5 .   ? 59.791 25.421 109.997 1.00 24.26 ? 1375 HOH A O   1 
HETATM 6334 O O   . HOH J 5 .   ? 18.700 20.711 87.350  1.00 21.74 ? 1376 HOH A O   1 
HETATM 6335 O O   . HOH J 5 .   ? 32.166 16.434 98.193  1.00 17.52 ? 1377 HOH A O   1 
HETATM 6336 O O   . HOH J 5 .   ? 68.301 35.423 105.736 1.00 23.22 ? 1378 HOH A O   1 
HETATM 6337 O O   . HOH J 5 .   ? 23.090 65.551 81.488  1.00 22.76 ? 1379 HOH A O   1 
HETATM 6338 O O   . HOH J 5 .   ? 67.903 48.722 104.283 1.00 19.93 ? 1380 HOH A O   1 
HETATM 6339 O O   . HOH J 5 .   ? 23.880 46.968 56.703  1.00 17.25 ? 1381 HOH A O   1 
HETATM 6340 O O   . HOH J 5 .   ? 52.532 16.123 103.821 1.00 19.45 ? 1382 HOH A O   1 
HETATM 6341 O O   . HOH J 5 .   ? 46.576 47.331 110.005 1.00 23.61 ? 1383 HOH A O   1 
HETATM 6342 O O   . HOH J 5 .   ? 10.734 42.302 95.315  1.00 24.78 ? 1384 HOH A O   1 
HETATM 6343 O O   . HOH J 5 .   ? 51.104 44.122 61.149  1.00 25.96 ? 1385 HOH A O   1 
HETATM 6344 O O   . HOH J 5 .   ? 63.107 42.858 111.891 1.00 30.99 ? 1386 HOH A O   1 
HETATM 6345 O O   . HOH J 5 .   ? 18.102 35.449 101.502 1.00 28.02 ? 1387 HOH A O   1 
HETATM 6346 O O   . HOH J 5 .   ? 19.513 26.647 103.637 1.00 24.75 ? 1388 HOH A O   1 
HETATM 6347 O O   . HOH J 5 .   ? 49.249 29.876 76.657  1.00 26.62 ? 1389 HOH A O   1 
HETATM 6348 O O   . HOH J 5 .   ? 28.722 21.292 70.454  1.00 28.96 ? 1390 HOH A O   1 
HETATM 6349 O O   . HOH J 5 .   ? 52.196 45.795 71.864  1.00 19.13 ? 1391 HOH A O   1 
HETATM 6350 O O   . HOH J 5 .   ? 47.279 40.475 110.612 1.00 23.28 ? 1392 HOH A O   1 
HETATM 6351 O O   . HOH J 5 .   ? 63.149 56.433 96.466  1.00 29.32 ? 1393 HOH A O   1 
HETATM 6352 O O   . HOH J 5 .   ? 22.085 57.065 60.712  1.00 22.49 ? 1394 HOH A O   1 
HETATM 6353 O O   . HOH J 5 .   ? 29.399 37.842 132.495 1.00 35.90 ? 1395 HOH A O   1 
HETATM 6354 O O   . HOH J 5 .   ? 24.962 33.202 62.028  1.00 14.56 ? 1396 HOH A O   1 
HETATM 6355 O O   . HOH J 5 .   ? 31.501 53.088 96.590  1.00 27.85 ? 1397 HOH A O   1 
HETATM 6356 O O   . HOH J 5 .   ? 37.446 21.701 119.297 1.00 29.58 ? 1398 HOH A O   1 
HETATM 6357 O O   . HOH J 5 .   ? 46.859 18.261 69.402  1.00 29.44 ? 1399 HOH A O   1 
HETATM 6358 O O   . HOH J 5 .   ? 19.804 60.207 93.609  1.00 27.30 ? 1400 HOH A O   1 
HETATM 6359 O O   . HOH J 5 .   ? 29.656 43.322 83.467  1.00 33.92 ? 1401 HOH A O   1 
HETATM 6360 O O   . HOH J 5 .   ? 24.839 27.204 96.092  1.00 12.60 ? 1402 HOH A O   1 
HETATM 6361 O O   . HOH J 5 .   ? 28.671 26.811 120.722 1.00 21.90 ? 1403 HOH A O   1 
HETATM 6362 O O   . HOH J 5 .   ? 34.583 58.702 70.382  1.00 23.09 ? 1404 HOH A O   1 
HETATM 6363 O O   . HOH J 5 .   ? 15.829 47.757 45.559  1.00 29.02 ? 1405 HOH A O   1 
HETATM 6364 O O   . HOH J 5 .   ? 46.534 59.507 76.753  1.00 27.16 ? 1406 HOH A O   1 
HETATM 6365 O O   . HOH J 5 .   ? 34.682 18.412 69.296  1.00 29.01 ? 1407 HOH A O   1 
HETATM 6366 O O   . HOH J 5 .   ? 24.247 31.792 54.959  1.00 25.06 ? 1408 HOH A O   1 
HETATM 6367 O O   . HOH J 5 .   ? 42.746 44.493 105.365 1.00 29.16 ? 1409 HOH A O   1 
HETATM 6368 O O   . HOH J 5 .   ? 11.760 65.052 80.387  1.00 23.53 ? 1410 HOH A O   1 
HETATM 6369 O O   . HOH J 5 .   ? 40.479 57.751 67.558  1.00 28.93 ? 1411 HOH A O   1 
HETATM 6370 O O   . HOH J 5 .   ? 37.141 51.636 60.314  1.00 29.11 ? 1412 HOH A O   1 
HETATM 6371 O O   . HOH J 5 .   ? 36.499 64.699 116.463 1.00 24.25 ? 1413 HOH A O   1 
HETATM 6372 O O   . HOH J 5 .   ? 32.889 50.008 82.096  1.00 21.02 ? 1414 HOH A O   1 
HETATM 6373 O O   . HOH J 5 .   ? 15.230 25.580 94.121  1.00 33.26 ? 1415 HOH A O   1 
HETATM 6374 O O   . HOH J 5 .   ? 29.880 60.628 108.057 1.00 32.88 ? 1416 HOH A O   1 
HETATM 6375 O O   . HOH J 5 .   ? 26.854 51.516 86.221  1.00 29.21 ? 1417 HOH A O   1 
HETATM 6376 O O   . HOH J 5 .   ? 28.653 20.236 74.329  1.00 33.35 ? 1418 HOH A O   1 
HETATM 6377 O O   . HOH J 5 .   ? 37.414 17.775 85.657  1.00 23.89 ? 1419 HOH A O   1 
HETATM 6378 O O   . HOH J 5 .   ? 43.164 42.293 89.120  1.00 28.82 ? 1420 HOH A O   1 
HETATM 6379 O O   . HOH J 5 .   ? 19.216 34.882 115.974 1.00 26.45 ? 1421 HOH A O   1 
HETATM 6380 O O   . HOH J 5 .   ? 39.337 55.985 70.438  1.00 21.16 ? 1422 HOH A O   1 
HETATM 6381 O O   . HOH J 5 .   ? 29.487 40.002 96.189  1.00 34.02 ? 1423 HOH A O   1 
HETATM 6382 O O   . HOH J 5 .   ? 44.669 35.932 94.117  1.00 28.98 ? 1424 HOH A O   1 
HETATM 6383 O O   . HOH J 5 .   ? 31.908 65.581 83.981  1.00 32.10 ? 1425 HOH A O   1 
HETATM 6384 O O   . HOH J 5 .   ? 6.123  57.810 76.877  1.00 27.99 ? 1426 HOH A O   1 
HETATM 6385 O O   . HOH J 5 .   ? 26.509 17.840 97.389  1.00 22.97 ? 1427 HOH A O   1 
HETATM 6386 O O   . HOH J 5 .   ? 22.550 57.958 105.429 1.00 25.52 ? 1428 HOH A O   1 
HETATM 6387 O O   . HOH J 5 .   ? 47.950 37.013 91.086  1.00 29.86 ? 1429 HOH A O   1 
HETATM 6388 O O   . HOH J 5 .   ? 41.983 13.432 110.071 1.00 24.27 ? 1430 HOH A O   1 
HETATM 6389 O O   . HOH J 5 .   ? 55.546 54.752 76.764  1.00 31.27 ? 1431 HOH A O   1 
HETATM 6390 O O   . HOH J 5 .   ? 27.142 65.987 74.568  1.00 28.76 ? 1432 HOH A O   1 
HETATM 6391 O O   . HOH J 5 .   ? 45.962 42.586 92.538  1.00 24.10 ? 1433 HOH A O   1 
HETATM 6392 O O   . HOH J 5 .   ? 3.983  38.788 86.888  1.00 32.14 ? 1434 HOH A O   1 
HETATM 6393 O O   . HOH J 5 .   ? 51.411 25.402 117.746 1.00 19.99 ? 1435 HOH A O   1 
HETATM 6394 O O   . HOH J 5 .   ? 67.957 44.279 94.665  1.00 25.63 ? 1436 HOH A O   1 
HETATM 6395 O O   . HOH J 5 .   ? 47.036 40.394 113.700 1.00 27.22 ? 1437 HOH A O   1 
HETATM 6396 O O   . HOH J 5 .   ? 13.169 35.753 95.064  1.00 33.00 ? 1438 HOH A O   1 
HETATM 6397 O O   . HOH J 5 .   ? 20.659 51.471 113.906 1.00 28.21 ? 1439 HOH A O   1 
HETATM 6398 O O   . HOH J 5 .   ? 41.640 15.611 104.777 1.00 19.59 ? 1440 HOH A O   1 
HETATM 6399 O O   . HOH J 5 .   ? 43.194 39.199 47.601  1.00 27.10 ? 1441 HOH A O   1 
HETATM 6400 O O   . HOH J 5 .   ? 58.629 62.242 102.088 1.00 26.84 ? 1442 HOH A O   1 
HETATM 6401 O O   . HOH J 5 .   ? 38.624 33.999 53.355  1.00 28.14 ? 1443 HOH A O   1 
HETATM 6402 O O   . HOH J 5 .   ? 59.777 24.267 88.329  1.00 32.58 ? 1444 HOH A O   1 
HETATM 6403 O O   . HOH J 5 .   ? 29.261 39.060 50.352  1.00 39.12 ? 1445 HOH A O   1 
HETATM 6404 O O   . HOH J 5 .   ? 14.721 42.516 65.521  1.00 27.92 ? 1446 HOH A O   1 
HETATM 6405 O O   . HOH J 5 .   ? 39.674 41.239 49.108  1.00 27.93 ? 1447 HOH A O   1 
HETATM 6406 O O   . HOH J 5 .   ? 25.818 20.790 88.194  1.00 26.40 ? 1448 HOH A O   1 
HETATM 6407 O O   . HOH J 5 .   ? 49.785 43.139 63.296  1.00 30.01 ? 1449 HOH A O   1 
HETATM 6408 O O   . HOH J 5 .   ? 29.560 36.211 94.714  1.00 30.42 ? 1450 HOH A O   1 
HETATM 6409 O O   . HOH J 5 .   ? 16.900 45.905 53.223  1.00 21.10 ? 1451 HOH A O   1 
HETATM 6410 O O   . HOH J 5 .   ? 64.642 24.993 96.294  1.00 26.03 ? 1452 HOH A O   1 
HETATM 6411 O O   . HOH J 5 .   ? 9.925  47.464 72.888  1.00 19.76 ? 1453 HOH A O   1 
HETATM 6412 O O   . HOH J 5 .   ? 49.057 40.646 62.873  1.00 23.59 ? 1454 HOH A O   1 
HETATM 6413 O O   . HOH J 5 .   ? 28.604 64.442 103.345 1.00 32.58 ? 1455 HOH A O   1 
HETATM 6414 O O   . HOH J 5 .   ? 32.462 16.153 106.251 1.00 27.85 ? 1456 HOH A O   1 
HETATM 6415 O O   . HOH J 5 .   ? 46.493 25.084 87.338  1.00 28.38 ? 1457 HOH A O   1 
HETATM 6416 O O   . HOH J 5 .   ? 61.683 22.696 82.885  1.00 28.11 ? 1458 HOH A O   1 
HETATM 6417 O O   . HOH J 5 .   ? 14.653 62.656 90.760  1.00 34.95 ? 1459 HOH A O   1 
HETATM 6418 O O   . HOH J 5 .   ? 38.451 48.663 99.385  1.00 28.06 ? 1460 HOH A O   1 
HETATM 6419 O O   . HOH J 5 .   ? 41.026 22.102 88.536  1.00 28.19 ? 1461 HOH A O   1 
HETATM 6420 O O   . HOH J 5 .   ? 2.822  35.940 75.806  1.00 37.03 ? 1462 HOH A O   1 
HETATM 6421 O O   . HOH J 5 .   ? 44.295 63.006 106.672 1.00 28.25 ? 1463 HOH A O   1 
HETATM 6422 O O   . HOH J 5 .   ? 28.591 40.743 86.542  1.00 26.51 ? 1464 HOH A O   1 
HETATM 6423 O O   . HOH J 5 .   ? 44.211 9.843  110.278 1.00 29.84 ? 1465 HOH A O   1 
HETATM 6424 O O   . HOH J 5 .   ? 46.448 39.947 106.051 1.00 27.87 ? 1466 HOH A O   1 
HETATM 6425 O O   . HOH J 5 .   ? 46.351 19.253 115.492 1.00 21.56 ? 1467 HOH A O   1 
HETATM 6426 O O   . HOH J 5 .   ? 14.344 19.572 84.004  1.00 28.82 ? 1468 HOH A O   1 
HETATM 6427 O O   . HOH J 5 .   ? 41.196 61.435 75.097  1.00 27.49 ? 1469 HOH A O   1 
HETATM 6428 O O   . HOH J 5 .   ? 45.739 34.250 49.815  1.00 32.03 ? 1470 HOH A O   1 
HETATM 6429 O O   . HOH J 5 .   ? 26.580 63.444 99.814  1.00 27.47 ? 1471 HOH A O   1 
HETATM 6430 O O   . HOH J 5 .   ? 21.403 37.523 122.570 1.00 28.88 ? 1472 HOH A O   1 
HETATM 6431 O O   . HOH J 5 .   ? 46.828 32.871 87.164  1.00 21.06 ? 1473 HOH A O   1 
HETATM 6432 O O   . HOH J 5 .   ? 52.451 26.886 78.778  1.00 26.44 ? 1474 HOH A O   1 
HETATM 6433 O O   . HOH J 5 .   ? 29.134 44.864 81.405  1.00 30.60 ? 1475 HOH A O   1 
HETATM 6434 O O   . HOH J 5 .   ? 43.679 41.920 47.835  1.00 14.45 ? 1476 HOH A O   1 
HETATM 6435 O O   . HOH J 5 .   ? 40.943 27.408 117.977 1.00 16.66 ? 1477 HOH A O   1 
HETATM 6436 O O   . HOH J 5 .   ? 39.363 19.008 101.959 1.00 16.55 ? 1478 HOH A O   1 
HETATM 6437 O O   . HOH J 5 .   ? 47.423 15.338 89.101  1.00 20.51 ? 1479 HOH A O   1 
HETATM 6438 O O   . HOH J 5 .   ? 28.999 55.500 107.061 1.00 19.52 ? 1480 HOH A O   1 
HETATM 6439 O O   . HOH J 5 .   ? 7.295  53.263 83.940  1.00 25.40 ? 1481 HOH A O   1 
HETATM 6440 O O   . HOH J 5 .   ? 22.001 67.144 83.505  1.00 24.95 ? 1482 HOH A O   1 
HETATM 6441 O O   . HOH J 5 .   ? 5.456  54.422 76.588  1.00 24.52 ? 1483 HOH A O   1 
HETATM 6442 O O   . HOH J 5 .   ? 44.667 32.665 60.965  1.00 17.78 ? 1484 HOH A O   1 
HETATM 6443 O O   . HOH J 5 .   ? 66.216 29.103 94.876  1.00 19.09 ? 1485 HOH A O   1 
HETATM 6444 O O   . HOH J 5 .   ? 55.752 64.226 103.188 1.00 24.72 ? 1486 HOH A O   1 
HETATM 6445 O O   . HOH J 5 .   ? 29.328 62.119 81.966  1.00 20.10 ? 1487 HOH A O   1 
HETATM 6446 O O   . HOH J 5 .   ? 22.411 31.777 61.386  1.00 23.00 ? 1488 HOH A O   1 
HETATM 6447 O O   . HOH J 5 .   ? 67.672 34.732 93.741  1.00 27.09 ? 1489 HOH A O   1 
HETATM 6448 O O   . HOH J 5 .   ? 22.879 40.813 89.266  1.00 23.31 ? 1490 HOH A O   1 
HETATM 6449 O O   . HOH J 5 .   ? 25.671 26.162 109.556 1.00 27.42 ? 1491 HOH A O   1 
HETATM 6450 O O   . HOH J 5 .   ? 20.297 59.426 71.196  1.00 20.44 ? 1492 HOH A O   1 
HETATM 6451 O O   . HOH J 5 .   ? 45.587 23.603 84.940  1.00 32.21 ? 1493 HOH A O   1 
HETATM 6452 O O   . HOH J 5 .   ? 39.740 67.665 100.478 1.00 22.71 ? 1494 HOH A O   1 
HETATM 6453 O O   . HOH J 5 .   ? 20.812 18.850 86.992  1.00 26.28 ? 1495 HOH A O   1 
HETATM 6454 O O   . HOH J 5 .   ? 54.740 59.385 95.786  1.00 28.13 ? 1496 HOH A O   1 
HETATM 6455 O O   . HOH J 5 .   ? 39.648 19.207 79.258  1.00 26.79 ? 1497 HOH A O   1 
HETATM 6456 O O   . HOH J 5 .   ? 27.951 47.923 53.798  1.00 25.18 ? 1498 HOH A O   1 
HETATM 6457 O O   . HOH J 5 .   ? 69.668 42.611 93.377  1.00 26.49 ? 1499 HOH A O   1 
HETATM 6458 O O   . HOH J 5 .   ? 28.365 20.421 65.481  1.00 27.31 ? 1500 HOH A O   1 
HETATM 6459 O O   . HOH J 5 .   ? 69.261 51.334 103.294 1.00 28.04 ? 1501 HOH A O   1 
HETATM 6460 O O   . HOH J 5 .   ? 32.668 17.292 73.317  1.00 22.76 ? 1502 HOH A O   1 
HETATM 6461 O O   . HOH J 5 .   ? 5.944  36.193 89.117  1.00 24.24 ? 1503 HOH A O   1 
HETATM 6462 O O   . HOH J 5 .   ? 32.280 17.001 70.668  1.00 22.36 ? 1504 HOH A O   1 
HETATM 6463 O O   . HOH J 5 .   ? 25.434 27.625 64.939  1.00 25.90 ? 1505 HOH A O   1 
HETATM 6464 O O   . HOH J 5 .   ? 63.602 36.041 114.649 1.00 27.03 ? 1506 HOH A O   1 
HETATM 6465 O O   . HOH J 5 .   ? 39.308 54.633 56.655  1.00 29.61 ? 1507 HOH A O   1 
HETATM 6466 O O   . HOH J 5 .   ? 38.868 38.637 122.541 1.00 22.78 ? 1508 HOH A O   1 
HETATM 6467 O O   . HOH J 5 .   ? 6.658  33.760 87.950  1.00 28.07 ? 1509 HOH A O   1 
HETATM 6468 O O   . HOH J 5 .   ? 29.128 25.717 65.646  1.00 29.68 ? 1510 HOH A O   1 
HETATM 6469 O O   . HOH J 5 .   ? 4.332  49.887 90.558  1.00 28.69 ? 1511 HOH A O   1 
HETATM 6470 O O   . HOH J 5 .   ? 5.325  59.434 82.866  1.00 23.86 ? 1512 HOH A O   1 
HETATM 6471 O O   . HOH J 5 .   ? 59.339 47.454 80.960  1.00 27.47 ? 1513 HOH A O   1 
HETATM 6472 O O   . HOH J 5 .   ? 40.676 68.146 103.021 1.00 28.79 ? 1514 HOH A O   1 
HETATM 6473 O O   . HOH J 5 .   ? 62.537 36.740 83.921  1.00 31.80 ? 1515 HOH A O   1 
HETATM 6474 O O   . HOH J 5 .   ? 54.933 30.171 79.233  1.00 22.30 ? 1516 HOH A O   1 
HETATM 6475 O O   . HOH J 5 .   ? 41.836 19.510 83.007  1.00 30.44 ? 1517 HOH A O   1 
HETATM 6476 O O   . HOH J 5 .   ? 14.974 41.066 59.213  1.00 28.77 ? 1518 HOH A O   1 
HETATM 6477 O O   . HOH J 5 .   ? 41.409 31.990 119.282 1.00 20.45 ? 1519 HOH A O   1 
HETATM 6478 O O   . HOH J 5 .   ? 46.432 67.761 83.972  1.00 28.14 ? 1520 HOH A O   1 
HETATM 6479 O O   . HOH J 5 .   ? 36.404 61.512 80.211  1.00 26.02 ? 1521 HOH A O   1 
HETATM 6480 O O   . HOH J 5 .   ? 56.329 50.421 70.981  1.00 26.43 ? 1522 HOH A O   1 
HETATM 6481 O O   . HOH J 5 .   ? 23.327 35.924 123.893 1.00 28.72 ? 1523 HOH A O   1 
HETATM 6482 O O   . HOH J 5 .   ? 44.831 62.964 114.314 1.00 31.54 ? 1524 HOH A O   1 
HETATM 6483 O O   . HOH J 5 .   ? 41.074 60.074 69.838  1.00 30.37 ? 1525 HOH A O   1 
HETATM 6484 O O   . HOH J 5 .   ? 25.444 46.642 86.894  1.00 28.43 ? 1526 HOH A O   1 
HETATM 6485 O O   . HOH J 5 .   ? 32.834 63.782 110.090 1.00 30.18 ? 1527 HOH A O   1 
HETATM 6486 O O   . HOH J 5 .   ? 21.938 30.525 107.124 1.00 26.09 ? 1528 HOH A O   1 
HETATM 6487 O O   . HOH J 5 .   ? 59.693 26.826 91.498  1.00 23.21 ? 1529 HOH A O   1 
HETATM 6488 O O   . HOH J 5 .   ? 14.011 51.715 65.087  1.00 26.85 ? 1530 HOH A O   1 
HETATM 6489 O O   . HOH J 5 .   ? 56.594 29.563 118.861 1.00 23.60 ? 1531 HOH A O   1 
HETATM 6490 O O   . HOH J 5 .   ? 64.427 28.972 91.002  1.00 24.90 ? 1532 HOH A O   1 
HETATM 6491 O O   . HOH J 5 .   ? 30.977 26.487 63.784  1.00 28.87 ? 1533 HOH A O   1 
HETATM 6492 O O   . HOH J 5 .   ? -1.221 40.777 84.600  1.00 29.51 ? 1534 HOH A O   1 
HETATM 6493 O O   . HOH J 5 .   ? 66.700 56.090 99.082  1.00 27.31 ? 1535 HOH A O   1 
HETATM 6494 O O   . HOH J 5 .   ? 20.179 26.582 67.827  1.00 27.64 ? 1536 HOH A O   1 
HETATM 6495 O O   . HOH J 5 .   ? 15.580 43.394 53.191  1.00 27.70 ? 1537 HOH A O   1 
HETATM 6496 O O   . HOH J 5 .   ? 42.212 22.307 82.524  1.00 24.37 ? 1538 HOH A O   1 
HETATM 6497 O O   . HOH J 5 .   ? 20.855 65.675 85.449  1.00 29.73 ? 1539 HOH A O   1 
HETATM 6498 O O   . HOH J 5 .   ? 35.655 18.311 93.336  1.00 25.07 ? 1540 HOH A O   1 
HETATM 6499 O O   . HOH J 5 .   ? 68.418 30.038 103.056 1.00 22.29 ? 1541 HOH A O   1 
HETATM 6500 O O   . HOH J 5 .   ? 7.165  32.010 89.983  1.00 24.80 ? 1542 HOH A O   1 
HETATM 6501 O O   . HOH J 5 .   ? 50.968 58.872 88.537  1.00 31.18 ? 1543 HOH A O   1 
HETATM 6502 O O   . HOH J 5 .   ? 48.004 22.482 85.994  1.00 25.32 ? 1544 HOH A O   1 
HETATM 6503 O O   . HOH J 5 .   ? 38.737 29.306 121.549 1.00 25.08 ? 1545 HOH A O   1 
HETATM 6504 O O   . HOH J 5 .   ? 64.226 50.798 89.975  1.00 27.49 ? 1546 HOH A O   1 
HETATM 6505 O O   . HOH J 5 .   ? 50.352 55.185 74.527  1.00 23.64 ? 1547 HOH A O   1 
HETATM 6506 O O   . HOH J 5 .   ? 30.445 14.155 98.652  1.00 27.75 ? 1548 HOH A O   1 
HETATM 6507 O O   . HOH J 5 .   ? 34.215 36.162 92.672  1.00 31.84 ? 1549 HOH A O   1 
HETATM 6508 O O   . HOH J 5 .   ? 9.811  38.834 65.642  1.00 22.55 ? 1550 HOH A O   1 
HETATM 6509 O O   . HOH J 5 .   ? 60.931 62.574 97.832  1.00 29.67 ? 1551 HOH A O   1 
HETATM 6510 O O   . HOH J 5 .   ? 42.344 25.641 119.437 1.00 26.14 ? 1552 HOH A O   1 
HETATM 6511 O O   . HOH J 5 .   ? 31.447 32.165 93.373  1.00 23.85 ? 1553 HOH A O   1 
HETATM 6512 O O   . HOH J 5 .   ? 51.819 59.674 62.618  1.00 24.75 ? 1554 HOH A O   1 
HETATM 6513 O O   . HOH J 5 .   ? 42.549 21.111 114.325 1.00 22.54 ? 1555 HOH A O   1 
HETATM 6514 O O   . HOH J 5 .   ? 36.545 47.687 97.065  1.00 27.44 ? 1556 HOH A O   1 
HETATM 6515 O O   . HOH J 5 .   ? 32.304 48.086 123.352 1.00 21.43 ? 1557 HOH A O   1 
HETATM 6516 O O   . HOH J 5 .   ? 40.360 20.379 86.461  1.00 24.23 ? 1558 HOH A O   1 
HETATM 6517 O O   . HOH J 5 .   ? 15.863 42.551 99.097  1.00 21.59 ? 1559 HOH A O   1 
HETATM 6518 O O   . HOH J 5 .   ? 26.351 39.763 130.120 1.00 27.70 ? 1560 HOH A O   1 
HETATM 6519 O O   . HOH J 5 .   ? 5.034  49.438 63.706  1.00 24.75 ? 1561 HOH A O   1 
HETATM 6520 O O   . HOH J 5 .   ? 30.523 53.890 75.184  1.00 22.70 ? 1562 HOH A O   1 
HETATM 6521 O O   . HOH J 5 .   ? 39.889 12.825 99.757  1.00 21.25 ? 1563 HOH A O   1 
HETATM 6522 O O   . HOH J 5 .   ? 25.875 19.589 69.047  1.00 28.56 ? 1564 HOH A O   1 
HETATM 6523 O O   . HOH J 5 .   ? 43.493 14.031 112.577 1.00 25.53 ? 1565 HOH A O   1 
HETATM 6524 O O   . HOH J 5 .   ? 46.270 26.744 120.251 1.00 27.86 ? 1566 HOH A O   1 
HETATM 6525 O O   . HOH J 5 .   ? 20.653 18.284 84.228  1.00 27.99 ? 1567 HOH A O   1 
HETATM 6526 O O   . HOH J 5 .   ? 50.123 27.661 59.102  1.00 32.79 ? 1568 HOH A O   1 
HETATM 6527 O O   . HOH J 5 .   ? 24.048 63.674 105.565 1.00 27.84 ? 1569 HOH A O   1 
HETATM 6528 O O   . HOH J 5 .   ? 20.069 35.748 104.766 1.00 29.65 ? 1570 HOH A O   1 
HETATM 6529 O O   . HOH J 5 .   ? 20.477 40.061 51.355  1.00 27.05 ? 1571 HOH A O   1 
HETATM 6530 O O   . HOH J 5 .   ? 43.096 58.147 70.384  1.00 22.61 ? 1572 HOH A O   1 
HETATM 6531 O O   . HOH J 5 .   ? 29.073 64.116 86.280  1.00 30.63 ? 1573 HOH A O   1 
HETATM 6532 O O   . HOH J 5 .   ? 56.659 52.878 81.093  1.00 26.20 ? 1574 HOH A O   1 
HETATM 6533 O O   . HOH J 5 .   ? 33.361 59.135 78.018  1.00 27.18 ? 1575 HOH A O   1 
HETATM 6534 O O   . HOH J 5 .   ? 48.519 27.468 56.221  1.00 33.69 ? 1576 HOH A O   1 
HETATM 6535 O O   . HOH J 5 .   ? 38.576 62.827 116.691 1.00 25.46 ? 1577 HOH A O   1 
HETATM 6536 O O   . HOH J 5 .   ? 39.529 47.657 118.415 1.00 28.01 ? 1578 HOH A O   1 
HETATM 6537 O O   . HOH J 5 .   ? 60.908 58.301 92.407  1.00 30.99 ? 1579 HOH A O   1 
HETATM 6538 O O   . HOH J 5 .   ? 45.625 17.571 112.079 1.00 15.32 ? 1580 HOH A O   1 
HETATM 6539 O O   . HOH J 5 .   ? 38.802 18.302 94.492  1.00 23.47 ? 1581 HOH A O   1 
HETATM 6540 O O   . HOH J 5 .   ? 33.449 43.454 82.114  1.00 21.98 ? 1582 HOH A O   1 
HETATM 6541 O O   . HOH J 5 .   ? 32.589 39.707 87.140  1.00 27.86 ? 1583 HOH A O   1 
HETATM 6542 O O   . HOH J 5 .   ? 22.810 43.614 125.564 1.00 17.55 ? 1584 HOH A O   1 
HETATM 6543 O O   . HOH J 5 .   ? 48.248 19.679 90.113  1.00 15.89 ? 1585 HOH A O   1 
HETATM 6544 O O   . HOH J 5 .   ? 45.761 35.046 89.473  1.00 24.25 ? 1586 HOH A O   1 
HETATM 6545 O O   . HOH J 5 .   ? 64.063 45.373 91.989  1.00 26.87 ? 1587 HOH A O   1 
HETATM 6546 O O   . HOH J 5 .   ? 19.349 45.271 112.248 1.00 21.75 ? 1588 HOH A O   1 
HETATM 6547 O O   . HOH J 5 .   ? 21.284 18.294 74.937  1.00 23.94 ? 1589 HOH A O   1 
HETATM 6548 O O   . HOH J 5 .   ? 7.341  46.716 81.715  1.00 19.21 ? 1590 HOH A O   1 
HETATM 6549 O O   . HOH J 5 .   ? 54.489 59.950 113.799 1.00 26.72 ? 1591 HOH A O   1 
HETATM 6550 O O   . HOH J 5 .   ? 51.586 58.224 115.217 1.00 23.68 ? 1592 HOH A O   1 
HETATM 6551 O O   . HOH J 5 .   ? 59.036 39.219 80.268  1.00 28.60 ? 1593 HOH A O   1 
HETATM 6552 O O   . HOH J 5 .   ? 42.158 59.016 60.450  1.00 24.27 ? 1594 HOH A O   1 
HETATM 6553 O O   . HOH J 5 .   ? 55.470 60.060 93.155  1.00 23.17 ? 1595 HOH A O   1 
HETATM 6554 O O   . HOH J 5 .   ? 35.287 45.047 83.393  1.00 28.84 ? 1596 HOH A O   1 
HETATM 6555 O O   . HOH J 5 .   ? 61.467 37.618 81.449  1.00 24.84 ? 1597 HOH A O   1 
HETATM 6556 O O   . HOH J 5 .   ? 12.186 62.192 84.201  1.00 24.23 ? 1598 HOH A O   1 
HETATM 6557 O O   . HOH J 5 .   ? 51.180 23.784 73.686  1.00 26.94 ? 1599 HOH A O   1 
HETATM 6558 O O   . HOH J 5 .   ? 37.184 29.927 94.776  1.00 19.90 ? 1600 HOH A O   1 
HETATM 6559 O O   . HOH J 5 .   ? 28.842 35.604 53.211  1.00 20.69 ? 1601 HOH A O   1 
HETATM 6560 O O   . HOH J 5 .   ? 31.510 61.747 63.425  1.00 18.02 ? 1602 HOH A O   1 
HETATM 6561 O O   . HOH J 5 .   ? 33.533 61.312 79.886  1.00 21.59 ? 1603 HOH A O   1 
HETATM 6562 O O   . HOH J 5 .   ? 26.646 41.898 88.013  1.00 24.92 ? 1604 HOH A O   1 
HETATM 6563 O O   . HOH J 5 .   ? 39.088 26.210 122.435 1.00 28.81 ? 1605 HOH A O   1 
HETATM 6564 O O   . HOH J 5 .   ? 36.467 53.022 93.595  1.00 24.91 ? 1606 HOH A O   1 
HETATM 6565 O O   . HOH J 5 .   ? 52.285 40.411 98.812  1.00 16.54 ? 1607 HOH A O   1 
HETATM 6566 O O   . HOH J 5 .   ? 18.499 47.324 101.666 1.00 27.65 ? 1608 HOH A O   1 
HETATM 6567 O O   . HOH J 5 .   ? 22.109 38.105 52.417  1.00 26.71 ? 1609 HOH A O   1 
HETATM 6568 O O   . HOH J 5 .   ? 18.803 33.252 104.727 1.00 23.05 ? 1610 HOH A O   1 
HETATM 6569 O O   . HOH J 5 .   ? 50.406 66.819 107.197 1.00 29.48 ? 1611 HOH A O   1 
HETATM 6570 O O   . HOH J 5 .   ? 31.698 63.442 80.322  1.00 23.04 ? 1612 HOH A O   1 
HETATM 6571 O O   . HOH J 5 .   ? 50.401 28.726 119.659 1.00 24.29 ? 1613 HOH A O   1 
HETATM 6572 O O   . HOH J 5 .   ? 66.021 35.828 110.946 1.00 27.63 ? 1614 HOH A O   1 
HETATM 6573 O O   . HOH J 5 .   ? 24.551 62.981 96.406  1.00 22.91 ? 1615 HOH A O   1 
HETATM 6574 O O   . HOH J 5 .   ? 56.577 25.410 115.412 1.00 23.48 ? 1616 HOH A O   1 
HETATM 6575 O O   . HOH J 5 .   ? 3.172  34.264 86.521  1.00 29.23 ? 1617 HOH A O   1 
HETATM 6576 O O   . HOH J 5 .   ? 31.241 56.148 90.590  1.00 24.76 ? 1618 HOH A O   1 
HETATM 6577 O O   . HOH J 5 .   ? 28.379 35.701 124.597 1.00 32.66 ? 1619 HOH A O   1 
HETATM 6578 O O   . HOH J 5 .   ? 26.224 22.224 90.560  1.00 22.31 ? 1620 HOH A O   1 
HETATM 6579 O O   . HOH J 5 .   ? 28.594 19.354 68.421  1.00 21.52 ? 1621 HOH A O   1 
HETATM 6580 O O   . HOH J 5 .   ? 25.874 54.620 100.723 1.00 19.41 ? 1622 HOH A O   1 
HETATM 6581 O O   . HOH J 5 .   ? 47.332 15.332 95.951  1.00 19.09 ? 1623 HOH A O   1 
HETATM 6582 O O   . HOH J 5 .   ? 38.778 27.906 98.849  1.00 21.92 ? 1624 HOH A O   1 
HETATM 6583 O O   . HOH J 5 .   ? 35.448 19.581 79.636  1.00 21.38 ? 1625 HOH A O   1 
HETATM 6584 O O   . HOH J 5 .   ? 67.673 32.692 105.629 1.00 20.84 ? 1626 HOH A O   1 
HETATM 6585 O O   . HOH J 5 .   ? 33.754 22.396 63.481  1.00 26.04 ? 1627 HOH A O   1 
HETATM 6586 O O   . HOH J 5 .   ? 15.979 29.808 97.662  1.00 25.88 ? 1628 HOH A O   1 
HETATM 6587 O O   . HOH J 5 .   ? 34.878 26.634 121.868 1.00 27.15 ? 1629 HOH A O   1 
HETATM 6588 O O   . HOH J 5 .   ? 46.367 47.457 57.147  1.00 22.36 ? 1630 HOH A O   1 
HETATM 6589 O O   . HOH J 5 .   ? 39.050 15.212 100.682 1.00 22.21 ? 1631 HOH A O   1 
HETATM 6590 O O   . HOH J 5 .   ? 48.420 34.153 49.577  1.00 22.00 ? 1632 HOH A O   1 
HETATM 6591 O O   . HOH J 5 .   ? 17.707 65.284 74.955  1.00 24.06 ? 1633 HOH A O   1 
HETATM 6592 O O   . HOH J 5 .   ? 57.784 19.889 103.093 1.00 23.41 ? 1634 HOH A O   1 
HETATM 6593 O O   . HOH J 5 .   ? 37.246 47.814 52.456  1.00 20.90 ? 1635 HOH A O   1 
HETATM 6594 O O   . HOH J 5 .   ? 23.594 30.113 63.263  1.00 24.69 ? 1636 HOH A O   1 
HETATM 6595 O O   . HOH J 5 .   ? 54.461 42.845 72.075  1.00 24.54 ? 1637 HOH A O   1 
HETATM 6596 O O   . HOH J 5 .   ? 30.670 18.102 75.175  1.00 27.49 ? 1638 HOH A O   1 
HETATM 6597 O O   . HOH J 5 .   ? 61.881 29.385 115.331 1.00 25.91 ? 1639 HOH A O   1 
HETATM 6598 O O   . HOH J 5 .   ? 17.433 45.301 103.133 1.00 25.64 ? 1640 HOH A O   1 
HETATM 6599 O O   . HOH J 5 .   ? 22.662 65.622 89.777  1.00 23.12 ? 1641 HOH A O   1 
HETATM 6600 O O   . HOH J 5 .   ? 23.582 63.231 73.266  1.00 25.99 ? 1642 HOH A O   1 
HETATM 6601 O O   . HOH J 5 .   ? 3.670  41.728 89.283  1.00 27.45 ? 1643 HOH A O   1 
HETATM 6602 O O   . HOH J 5 .   ? 70.093 40.891 101.007 1.00 22.91 ? 1644 HOH A O   1 
HETATM 6603 O O   . HOH J 5 .   ? 41.327 18.232 77.198  1.00 21.76 ? 1645 HOH A O   1 
HETATM 6604 O O   . HOH J 5 .   ? 5.646  42.054 70.737  1.00 24.21 ? 1646 HOH A O   1 
HETATM 6605 O O   . HOH J 5 .   ? 23.152 41.219 49.609  1.00 23.02 ? 1647 HOH A O   1 
HETATM 6606 O O   . HOH J 5 .   ? 31.775 41.500 83.072  1.00 23.20 ? 1648 HOH A O   1 
HETATM 6607 O O   . HOH J 5 .   ? 37.711 45.638 105.099 1.00 24.80 ? 1649 HOH A O   1 
HETATM 6608 O O   . HOH J 5 .   ? 34.945 52.305 90.648  1.00 25.92 ? 1650 HOH A O   1 
HETATM 6609 O O   . HOH J 5 .   ? 45.842 55.702 69.514  1.00 23.16 ? 1651 HOH A O   1 
HETATM 6610 O O   . HOH J 5 .   ? 46.015 38.597 115.915 1.00 22.11 ? 1652 HOH A O   1 
HETATM 6611 O O   . HOH J 5 .   ? 22.938 24.716 70.592  1.00 25.80 ? 1653 HOH A O   1 
HETATM 6612 O O   . HOH J 5 .   ? 37.974 33.230 100.103 1.00 24.12 ? 1654 HOH A O   1 
HETATM 6613 O O   . HOH J 5 .   ? 39.239 39.634 108.041 1.00 23.24 ? 1655 HOH A O   1 
HETATM 6614 O O   . HOH J 5 .   ? 63.325 32.237 119.851 1.00 26.27 ? 1656 HOH A O   1 
HETATM 6615 O O   . HOH J 5 .   ? 47.329 67.042 92.835  1.00 24.69 ? 1657 HOH A O   1 
HETATM 6616 O O   . HOH J 5 .   ? 49.557 39.325 67.181  1.00 21.51 ? 1658 HOH A O   1 
HETATM 6617 O O   . HOH J 5 .   ? 24.202 38.960 50.697  1.00 23.57 ? 1659 HOH A O   1 
HETATM 6618 O O   . HOH J 5 .   ? 18.990 35.299 53.073  1.00 20.62 ? 1660 HOH A O   1 
HETATM 6619 O O   . HOH J 5 .   ? 1.195  35.287 79.596  1.00 26.22 ? 1661 HOH A O   1 
HETATM 6620 O O   . HOH J 5 .   ? 34.784 19.453 90.935  1.00 28.61 ? 1662 HOH A O   1 
HETATM 6621 O O   . HOH J 5 .   ? 47.246 36.125 115.738 1.00 22.80 ? 1663 HOH A O   1 
HETATM 6622 O O   . HOH J 5 .   ? 50.444 32.209 75.741  1.00 20.79 ? 1664 HOH A O   1 
HETATM 6623 O O   . HOH J 5 .   ? 49.535 57.127 115.875 1.00 22.68 ? 1665 HOH A O   1 
HETATM 6624 O O   . HOH J 5 .   ? 23.781 20.153 103.261 1.00 20.62 ? 1666 HOH A O   1 
HETATM 6625 O O   . HOH J 5 .   ? 38.186 39.617 105.155 1.00 25.45 ? 1667 HOH A O   1 
HETATM 6626 O O   . HOH J 5 .   ? 23.479 19.533 84.499  1.00 20.72 ? 1668 HOH A O   1 
HETATM 6627 O O   . HOH J 5 .   ? 14.968 45.760 62.462  1.00 24.15 ? 1669 HOH A O   1 
HETATM 6628 O O   . HOH J 5 .   ? 43.995 17.388 78.505  1.00 22.96 ? 1670 HOH A O   1 
HETATM 6629 O O   . HOH J 5 .   ? 20.331 29.498 103.660 1.00 22.60 ? 1671 HOH A O   1 
HETATM 6630 O O   . HOH J 5 .   ? 52.074 25.059 82.325  1.00 24.32 ? 1672 HOH A O   1 
HETATM 6631 O O   . HOH J 5 .   ? 51.565 17.031 115.561 1.00 21.05 ? 1673 HOH A O   1 
HETATM 6632 O O   . HOH J 5 .   ? 60.556 61.569 103.582 1.00 22.78 ? 1674 HOH A O   1 
HETATM 6633 O O   . HOH J 5 .   ? 48.837 61.116 98.953  1.00 21.40 ? 1675 HOH A O   1 
HETATM 6634 O O   . HOH J 5 .   ? 10.961 50.073 64.659  1.00 23.51 ? 1676 HOH A O   1 
HETATM 6635 O O   . HOH J 5 .   ? 70.068 49.333 94.366  1.00 24.09 ? 1677 HOH A O   1 
HETATM 6636 O O   . HOH J 5 .   ? 47.635 22.991 118.681 1.00 22.94 ? 1678 HOH A O   1 
HETATM 6637 O O   . HOH J 5 .   ? 42.863 40.491 108.120 1.00 24.23 ? 1679 HOH A O   1 
HETATM 6638 O O   . HOH J 5 .   ? 14.682 43.941 97.213  1.00 23.44 ? 1680 HOH A O   1 
HETATM 6639 O O   . HOH J 5 .   ? 22.054 33.895 129.363 1.00 23.31 ? 1681 HOH A O   1 
HETATM 6640 O O   . HOH J 5 .   ? 52.138 44.920 68.964  1.00 23.73 ? 1682 HOH A O   1 
HETATM 6641 O O   . HOH J 5 .   ? 49.786 20.325 87.551  1.00 23.18 ? 1683 HOH A O   1 
HETATM 6642 O O   . HOH J 5 .   ? 37.479 51.253 118.610 1.00 23.62 ? 1684 HOH A O   1 
HETATM 6643 O O   . HOH J 5 .   ? 43.340 44.491 95.940  1.00 23.78 ? 1685 HOH A O   1 
HETATM 6644 O O   . HOH J 5 .   ? 54.891 32.722 75.290  1.00 22.98 ? 1686 HOH A O   1 
HETATM 6645 O O   . HOH J 5 .   ? 39.792 29.583 118.956 1.00 24.25 ? 1687 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   LEU 2   2   2   LEU LEU A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   PHE 4   4   4   PHE PHE A . n 
A 1 5   GLN 5   5   5   GLN GLN A . n 
A 1 6   TYR 6   6   6   TYR TYR A . n 
A 1 7   PRO 7   7   7   PRO PRO A . n 
A 1 8   ASP 8   8   8   ASP ASP A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  TYR 10  10  10  TYR TYR A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  THR 14  14  14  THR THR A . n 
A 1 15  ALA 15  15  15  ALA ALA A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  GLN 17  17  17  GLN GLN A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  TYR 19  19  19  TYR TYR A . n 
A 1 20  HIS 20  20  20  HIS HIS A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  HIS 22  22  22  HIS HIS A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  CSX 25  25  25  CSX CSX A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  PRO 27  27  27  PRO PRO A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  TRP 30  30  30  TRP TRP A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  GLN 38  38  38  GLN GLN A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  LYS 40  40  40  LYS LYS A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  PHE 42  42  42  PHE PHE A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  GLN 46  46  46  GLN GLN A . n 
A 1 47  ASN 47  47  47  ASN ASN A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  GLN 56  56  56  GLN GLN A . n 
A 1 57  CSX 57  57  57  CSX CSX A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  ILE 59  59  59  ILE ILE A . n 
A 1 60  ARG 60  60  60  ARG ARG A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  LYS 64  64  64  LYS LYS A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  ARG 66  66  66  ARG ARG A . n 
A 1 67  MET 67  67  67  MET MET A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  TYR 73  73  73  TYR TYR A . n 
A 1 74  PRO 74  74  74  PRO PRO A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  CYS 78  78  78  CYS CYS A . n 
A 1 79  HIS 79  79  79  HIS HIS A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  TYR 86  86  86  TYR TYR A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  ASN 91  91  91  ASN ASN A . n 
A 1 92  THR 92  92  92  THR THR A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  ASN 96  96  96  ASN ASN A . n 
A 1 97  GLN 97  97  97  GLN GLN A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 TYR 101 101 101 TYR TYR A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 GLN 103 103 103 GLN GLN A . n 
A 1 104 ASP 104 104 104 ASP ASP A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 PHE 113 113 113 PHE PHE A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 ASP 115 115 115 ASP ASP A . n 
A 1 116 PRO 116 116 116 PRO PRO A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 SER 120 120 120 SER SER A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ARG 128 128 128 ARG ARG A . n 
A 1 129 GLY 129 129 129 GLY GLY A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ALA 131 131 131 ALA ALA A . n 
A 1 132 PHE 132 132 132 PHE PHE A . n 
A 1 133 SER 133 133 133 SER SER A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 ASP 135 135 135 ASP ASP A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
A 1 138 TYR 138 138 138 TYR TYR A . n 
A 1 139 PHE 139 139 139 PHE PHE A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 TYR 141 141 141 TYR TYR A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 SER 144 144 144 SER SER A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 GLY 147 147 147 GLY GLY A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 TRP 150 150 150 TRP TRP A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 MET 156 156 156 MET MET A . n 
A 1 157 LYS 157 157 157 LYS LYS A . n 
A 1 158 VAL 158 158 158 VAL VAL A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 ALA 161 161 161 ALA ALA A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 VAL 167 167 167 VAL VAL A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 LYS 172 172 172 LYS LYS A . n 
A 1 173 PHE 173 173 173 PHE PHE A . n 
A 1 174 SER 174 174 174 SER SER A . n 
A 1 175 CSD 175 175 175 CSD CSD A . n 
A 1 176 MET 176 176 176 MET MET A . n 
A 1 177 ALA 177 177 177 ALA ALA A . n 
A 1 178 TRP 178 178 178 TRP TRP A . n 
A 1 179 THR 179 179 179 THR THR A . n 
A 1 180 HIS 180 180 180 HIS HIS A . n 
A 1 181 ASP 181 181 181 ASP ASP A . n 
A 1 182 GLY 182 182 182 GLY GLY A . n 
A 1 183 LYS 183 183 183 LYS LYS A . n 
A 1 184 GLY 184 184 184 GLY GLY A . n 
A 1 185 MET 185 185 185 MET MET A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 TYR 187 187 187 TYR TYR A . n 
A 1 188 ASN 188 188 188 ASN ASN A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 TYR 190 190 190 TYR TYR A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 GLN 192 192 192 GLN GLN A . n 
A 1 193 GLN 193 193 193 GLN GLN A . n 
A 1 194 ASP 194 194 194 ASP ASP A . n 
A 1 195 GLY 195 195 195 GLY GLY A . n 
A 1 196 LYS 196 196 196 LYS LYS A . n 
A 1 197 SER 197 197 197 SER SER A . n 
A 1 198 ASP 198 198 198 ASP ASP A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 THR 200 200 200 THR THR A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 THR 202 202 202 THR THR A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 THR 204 204 204 THR THR A . n 
A 1 205 ASN 205 205 205 ASN ASN A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 HIS 207 207 207 HIS HIS A . n 
A 1 208 GLN 208 208 208 GLN GLN A . n 
A 1 209 LYS 209 209 209 LYS LYS A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 TYR 211 211 211 TYR TYR A . n 
A 1 212 TYR 212 212 212 TYR TYR A . n 
A 1 213 HIS 213 213 213 HIS HIS A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 GLY 216 216 216 GLY GLY A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 ASP 218 218 218 ASP ASP A . n 
A 1 219 GLN 219 219 219 GLN GLN A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 GLU 221 221 221 GLU GLU A . n 
A 1 222 ASP 222 222 222 ASP ASP A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 CYS 225 225 225 CYS CYS A . n 
A 1 226 ALA 226 226 226 ALA ALA A . n 
A 1 227 GLU 227 227 227 GLU GLU A . n 
A 1 228 PHE 228 228 228 PHE PHE A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASP 230 230 230 ASP ASP A . n 
A 1 231 GLU 231 231 231 GLU GLU A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 TRP 234 234 234 TRP TRP A . n 
A 1 235 MET 235 235 235 MET MET A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 GLY 237 237 237 GLY GLY A . n 
A 1 238 ALA 238 238 238 ALA ALA A . n 
A 1 239 GLU 239 239 239 GLU GLU A . n 
A 1 240 LEU 240 240 240 LEU LEU A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 ASP 242 242 242 ASP ASP A . n 
A 1 243 ASP 243 243 243 ASP ASP A . n 
A 1 244 GLY 244 244 244 GLY GLY A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 TYR 246 246 246 TYR TYR A . n 
A 1 247 VAL 247 247 247 VAL VAL A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 LEU 249 249 249 LEU LEU A . n 
A 1 250 SER 250 250 250 SER SER A . n 
A 1 251 ILE 251 251 251 ILE ILE A . n 
A 1 252 ARG 252 252 252 ARG ARG A . n 
A 1 253 GLU 253 253 253 GLU GLU A . n 
A 1 254 GLY 254 254 254 GLY GLY A . n 
A 1 255 CSX 255 255 255 CSX CSX A . n 
A 1 256 ASP 256 256 256 ASP ASP A . n 
A 1 257 PRO 257 257 257 PRO PRO A . n 
A 1 258 VAL 258 258 258 VAL VAL A . n 
A 1 259 ASN 259 259 259 ASN ASN A . n 
A 1 260 ARG 260 260 260 ARG ARG A . n 
A 1 261 LEU 261 261 261 LEU LEU A . n 
A 1 262 TRP 262 262 262 TRP TRP A . n 
A 1 263 TYR 263 263 263 TYR TYR A . n 
A 1 264 CYS 264 264 264 CYS CYS A . n 
A 1 265 ASP 265 265 265 ASP ASP A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 GLN 267 267 267 GLN GLN A . n 
A 1 268 GLN 268 268 268 GLN GLN A . n 
A 1 269 GLU 269 269 269 GLU GLU A . n 
A 1 270 SER 270 270 270 SER SER A . n 
A 1 271 ASN 271 271 271 ASN ASN A . n 
A 1 272 GLY 272 272 272 GLY GLY A . n 
A 1 273 ILE 273 273 273 ILE ILE A . n 
A 1 274 THR 274 274 274 THR THR A . n 
A 1 275 GLY 275 275 275 GLY GLY A . n 
A 1 276 ILE 276 276 276 ILE ILE A . n 
A 1 277 LEU 277 277 277 LEU LEU A . n 
A 1 278 LYS 278 278 278 LYS LYS A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 VAL 280 280 280 VAL VAL A . n 
A 1 281 LYS 281 281 281 LYS LYS A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 ILE 283 283 283 ILE ILE A . n 
A 1 284 ASP 284 284 284 ASP ASP A . n 
A 1 285 ASN 285 285 285 ASN ASN A . n 
A 1 286 PHE 286 286 286 PHE PHE A . n 
A 1 287 GLU 287 287 287 GLU GLU A . n 
A 1 288 GLY 288 288 288 GLY GLY A . n 
A 1 289 GLU 289 289 289 GLU GLU A . n 
A 1 290 TYR 290 290 290 TYR TYR A . n 
A 1 291 ASP 291 291 291 ASP ASP A . n 
A 1 292 TYR 292 292 292 TYR TYR A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 THR 294 294 294 THR THR A . n 
A 1 295 ASN 295 295 295 ASN ASN A . n 
A 1 296 GLU 296 296 296 GLU GLU A . n 
A 1 297 GLY 297 297 297 GLY GLY A . n 
A 1 298 THR 298 298 298 THR THR A . n 
A 1 299 VAL 299 299 299 VAL VAL A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 THR 301 301 301 THR THR A . n 
A 1 302 PHE 302 302 302 PHE PHE A . n 
A 1 303 LYS 303 303 303 LYS LYS A . n 
A 1 304 THR 304 304 304 THR THR A . n 
A 1 305 ASN 305 305 305 ASN ASN A . n 
A 1 306 ARG 306 306 306 ARG ARG A . n 
A 1 307 HIS 307 307 307 HIS HIS A . n 
A 1 308 SER 308 308 308 SER SER A . n 
A 1 309 PRO 309 309 309 PRO PRO A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 TYR 311 311 311 TYR TYR A . n 
A 1 312 ARG 312 312 312 ARG ARG A . n 
A 1 313 LEU 313 313 313 LEU LEU A . n 
A 1 314 ILE 314 314 314 ILE ILE A . n 
A 1 315 ASN 315 315 315 ASN ASN A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 ASP 317 317 317 ASP ASP A . n 
A 1 318 PHE 318 318 318 PHE PHE A . n 
A 1 319 THR 319 319 319 THR THR A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PRO 321 321 321 PRO PRO A . n 
A 1 322 GLU 322 322 322 GLU GLU A . n 
A 1 323 GLU 323 323 323 GLU GLU A . n 
A 1 324 SER 324 324 324 SER SER A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 TRP 326 326 326 TRP TRP A . n 
A 1 327 LYS 327 327 327 LYS LYS A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 LEU 329 329 329 LEU LEU A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 PRO 331 331 331 PRO PRO A . n 
A 1 332 GLU 332 332 332 GLU GLU A . n 
A 1 333 HIS 333 333 333 HIS HIS A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 LYS 335 335 335 LYS LYS A . n 
A 1 336 ASP 336 336 336 ASP ASP A . n 
A 1 337 VAL 337 337 337 VAL VAL A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 GLU 339 339 339 GLU GLU A . n 
A 1 340 TRP 340 340 340 TRP TRP A . n 
A 1 341 VAL 341 341 341 VAL VAL A . n 
A 1 342 ALA 342 342 342 ALA ALA A . n 
A 1 343 CYS 343 343 343 CYS CYS A . n 
A 1 344 VAL 344 344 344 VAL VAL A . n 
A 1 345 ARG 345 345 345 ARG ARG A . n 
A 1 346 SER 346 346 346 SER SER A . n 
A 1 347 ASN 347 347 347 ASN ASN A . n 
A 1 348 PHE 348 348 348 PHE PHE A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 VAL 350 350 350 VAL VAL A . n 
A 1 351 LEU 351 351 351 LEU LEU A . n 
A 1 352 CYS 352 352 352 CYS CYS A . n 
A 1 353 TYR 353 353 353 TYR TYR A . n 
A 1 354 LEU 354 354 354 LEU LEU A . n 
A 1 355 HIS 355 355 355 HIS HIS A . n 
A 1 356 ASP 356 356 356 ASP ASP A . n 
A 1 357 VAL 357 357 357 VAL VAL A . n 
A 1 358 LYS 358 358 358 LYS LYS A . n 
A 1 359 ASN 359 359 359 ASN ASN A . n 
A 1 360 THR 360 360 360 THR THR A . n 
A 1 361 LEU 361 361 361 LEU LEU A . n 
A 1 362 GLN 362 362 362 GLN GLN A . n 
A 1 363 LEU 363 363 363 LEU LEU A . n 
A 1 364 HIS 364 364 364 HIS HIS A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 ALA 367 367 367 ALA ALA A . n 
A 1 368 THR 368 368 368 THR THR A . n 
A 1 369 GLY 369 369 369 GLY GLY A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 LEU 371 371 371 LEU LEU A . n 
A 1 372 LEU 372 372 372 LEU LEU A . n 
A 1 373 LYS 373 373 373 LYS LYS A . n 
A 1 374 ILE 374 374 374 ILE ILE A . n 
A 1 375 PHE 375 375 375 PHE PHE A . n 
A 1 376 PRO 376 376 376 PRO PRO A . n 
A 1 377 LEU 377 377 377 LEU LEU A . n 
A 1 378 GLU 378 378 378 GLU GLU A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 GLY 380 380 380 GLY GLY A . n 
A 1 381 SER 381 381 381 SER SER A . n 
A 1 382 VAL 382 382 382 VAL VAL A . n 
A 1 383 VAL 383 383 383 VAL VAL A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 TYR 385 385 385 TYR TYR A . n 
A 1 386 SER 386 386 386 SER SER A . n 
A 1 387 GLY 387 387 387 GLY GLY A . n 
A 1 388 GLN 388 388 388 GLN GLN A . n 
A 1 389 LYS 389 389 389 LYS LYS A . n 
A 1 390 LYS 390 390 390 LYS LYS A . n 
A 1 391 ASP 391 391 391 ASP ASP A . n 
A 1 392 THR 392 392 392 THR THR A . n 
A 1 393 GLU 393 393 393 GLU GLU A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 PHE 395 395 395 PHE PHE A . n 
A 1 396 TYR 396 396 396 TYR TYR A . n 
A 1 397 GLN 397 397 397 GLN GLN A . n 
A 1 398 PHE 398 398 398 PHE PHE A . n 
A 1 399 THR 399 399 399 THR THR A . n 
A 1 400 SER 400 400 400 SER SER A . n 
A 1 401 PHE 401 401 401 PHE PHE A . n 
A 1 402 LEU 402 402 402 LEU LEU A . n 
A 1 403 SER 403 403 403 SER SER A . n 
A 1 404 PRO 404 404 404 PRO PRO A . n 
A 1 405 GLY 405 405 405 GLY GLY A . n 
A 1 406 ILE 406 406 406 ILE ILE A . n 
A 1 407 ILE 407 407 407 ILE ILE A . n 
A 1 408 TYR 408 408 408 TYR TYR A . n 
A 1 409 HIS 409 409 409 HIS HIS A . n 
A 1 410 CYS 410 410 410 CYS CYS A . n 
A 1 411 ASP 411 411 411 ASP ASP A . n 
A 1 412 LEU 412 412 412 LEU LEU A . n 
A 1 413 THR 413 413 413 THR THR A . n 
A 1 414 LYS 414 414 414 LYS LYS A . n 
A 1 415 GLU 415 415 415 GLU GLU A . n 
A 1 416 GLU 416 416 416 GLU GLU A . n 
A 1 417 LEU 417 417 417 LEU LEU A . n 
A 1 418 GLU 418 418 418 GLU GLU A . n 
A 1 419 PRO 419 419 419 PRO PRO A . n 
A 1 420 ARG 420 420 420 ARG ARG A . n 
A 1 421 VAL 421 421 421 VAL VAL A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 ARG 423 423 423 ARG ARG A . n 
A 1 424 GLU 424 424 424 GLU GLU A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 THR 426 426 426 THR THR A . n 
A 1 427 VAL 427 427 427 VAL VAL A . n 
A 1 428 LYS 428 428 428 LYS LYS A . n 
A 1 429 GLY 429 429 429 GLY GLY A . n 
A 1 430 ILE 430 430 430 ILE ILE A . n 
A 1 431 ASP 431 431 431 ASP ASP A . n 
A 1 432 ALA 432 432 432 ALA ALA A . n 
A 1 433 SER 433 433 433 SER SER A . n 
A 1 434 ASP 434 434 434 ASP ASP A . n 
A 1 435 TYR 435 435 435 TYR TYR A . n 
A 1 436 GLN 436 436 436 GLN GLN A . n 
A 1 437 THR 437 437 437 THR THR A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 GLN 439 439 439 GLN GLN A . n 
A 1 440 ILE 440 440 440 ILE ILE A . n 
A 1 441 PHE 441 441 441 PHE PHE A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 PRO 443 443 443 PRO PRO A . n 
A 1 444 SER 444 444 444 SER SER A . n 
A 1 445 LYS 445 445 445 LYS LYS A . n 
A 1 446 ASP 446 446 446 ASP ASP A . n 
A 1 447 GLY 447 447 447 GLY GLY A . n 
A 1 448 THR 448 448 448 THR THR A . n 
A 1 449 LYS 449 449 449 LYS LYS A . n 
A 1 450 ILE 450 450 450 ILE ILE A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 MET 452 452 452 MET MET A . n 
A 1 453 PHE 453 453 453 PHE PHE A . n 
A 1 454 ILE 454 454 454 ILE ILE A . n 
A 1 455 VAL 455 455 455 VAL VAL A . n 
A 1 456 HIS 456 456 456 HIS HIS A . n 
A 1 457 LYS 457 457 457 LYS LYS A . n 
A 1 458 LYS 458 458 458 LYS LYS A . n 
A 1 459 GLY 459 459 459 GLY GLY A . n 
A 1 460 ILE 460 460 460 ILE ILE A . n 
A 1 461 LYS 461 461 461 LYS LYS A . n 
A 1 462 LEU 462 462 462 LEU LEU A . n 
A 1 463 ASP 463 463 463 ASP ASP A . n 
A 1 464 GLY 464 464 464 GLY GLY A . n 
A 1 465 SER 465 465 465 SER SER A . n 
A 1 466 HIS 466 466 466 HIS HIS A . n 
A 1 467 PRO 467 467 467 PRO PRO A . n 
A 1 468 ALA 468 468 468 ALA ALA A . n 
A 1 469 PHE 469 469 469 PHE PHE A . n 
A 1 470 LEU 470 470 470 LEU LEU A . n 
A 1 471 TYR 471 471 471 TYR TYR A . n 
A 1 472 GLY 472 472 472 GLY GLY A . n 
A 1 473 TYR 473 473 473 TYR TYR A . n 
A 1 474 GLY 474 474 474 GLY GLY A . n 
A 1 475 GLY 475 475 475 GLY GLY A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ASN 477 477 477 ASN ASN A . n 
A 1 478 ILE 478 478 478 ILE ILE A . n 
A 1 479 SER 479 479 479 SER SER A . n 
A 1 480 ILE 480 480 480 ILE ILE A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 TYR 484 484 484 TYR TYR A . n 
A 1 485 SER 485 485 485 SER SER A . n 
A 1 486 VAL 486 486 486 VAL VAL A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 ARG 488 488 488 ARG ARG A . n 
A 1 489 LEU 489 489 489 LEU LEU A . n 
A 1 490 ILE 490 490 490 ILE ILE A . n 
A 1 491 PHE 491 491 491 PHE PHE A . n 
A 1 492 VAL 492 492 492 VAL VAL A . n 
A 1 493 ARG 493 493 493 ARG ARG A . n 
A 1 494 HIS 494 494 494 HIS HIS A . n 
A 1 495 MET 495 495 495 MET MET A . n 
A 1 496 GLY 496 496 496 GLY GLY A . n 
A 1 497 GLY 497 497 497 GLY GLY A . n 
A 1 498 VAL 498 498 498 VAL VAL A . n 
A 1 499 LEU 499 499 499 LEU LEU A . n 
A 1 500 ALA 500 500 500 ALA ALA A . n 
A 1 501 VAL 501 501 501 VAL VAL A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 ASN 503 503 503 ASN ASN A . n 
A 1 504 ILE 504 504 504 ILE ILE A . n 
A 1 505 ARG 505 505 505 ARG ARG A . n 
A 1 506 GLY 506 506 506 GLY GLY A . n 
A 1 507 GLY 507 507 507 GLY GLY A . n 
A 1 508 GLY 508 508 508 GLY GLY A . n 
A 1 509 GLU 509 509 509 GLU GLU A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 GLY 511 511 511 GLY GLY A . n 
A 1 512 GLU 512 512 512 GLU GLU A . n 
A 1 513 THR 513 513 513 THR THR A . n 
A 1 514 TRP 514 514 514 TRP TRP A . n 
A 1 515 HIS 515 515 515 HIS HIS A . n 
A 1 516 LYS 516 516 516 LYS LYS A . n 
A 1 517 GLY 517 517 517 GLY GLY A . n 
A 1 518 GLY 518 518 518 GLY GLY A . n 
A 1 519 ILE 519 519 519 ILE ILE A . n 
A 1 520 LEU 520 520 520 LEU LEU A . n 
A 1 521 ALA 521 521 521 ALA ALA A . n 
A 1 522 ASN 522 522 522 ASN ASN A . n 
A 1 523 LYS 523 523 523 LYS LYS A . n 
A 1 524 GLN 524 524 524 GLN GLN A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 CYS 526 526 526 CYS CYS A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 ASP 528 528 528 ASP ASP A . n 
A 1 529 ASP 529 529 529 ASP ASP A . n 
A 1 530 PHE 530 530 530 PHE PHE A . n 
A 1 531 GLN 531 531 531 GLN GLN A . n 
A 1 532 CYS 532 532 532 CYS CYS A . n 
A 1 533 ALA 533 533 533 ALA ALA A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 GLU 535 535 535 GLU GLU A . n 
A 1 536 TYR 536 536 536 TYR TYR A . n 
A 1 537 LEU 537 537 537 LEU LEU A . n 
A 1 538 ILE 538 538 538 ILE ILE A . n 
A 1 539 LYS 539 539 539 LYS LYS A . n 
A 1 540 GLU 540 540 540 GLU GLU A . n 
A 1 541 GLY 541 541 541 GLY GLY A . n 
A 1 542 TYR 542 542 542 TYR TYR A . n 
A 1 543 THR 543 543 543 THR THR A . n 
A 1 544 SER 544 544 544 SER SER A . n 
A 1 545 PRO 545 545 545 PRO PRO A . n 
A 1 546 LYS 546 546 546 LYS LYS A . n 
A 1 547 ARG 547 547 547 ARG ARG A . n 
A 1 548 LEU 548 548 548 LEU LEU A . n 
A 1 549 THR 549 549 549 THR THR A . n 
A 1 550 ILE 550 550 550 ILE ILE A . n 
A 1 551 ASN 551 551 551 ASN ASN A . n 
A 1 552 GLY 552 552 552 GLY GLY A . n 
A 1 553 GLY 553 553 553 GLY GLY A . n 
A 1 554 SER 554 554 554 SER SER A . n 
A 1 555 ASN 555 555 555 ASN ASN A . n 
A 1 556 GLY 556 556 556 GLY GLY A . n 
A 1 557 GLY 557 557 557 GLY GLY A . n 
A 1 558 LEU 558 558 558 LEU LEU A . n 
A 1 559 LEU 559 559 559 LEU LEU A . n 
A 1 560 VAL 560 560 560 VAL VAL A . n 
A 1 561 ALA 561 561 561 ALA ALA A . n 
A 1 562 THR 562 562 562 THR THR A . n 
A 1 563 CYS 563 563 563 CYS CYS A . n 
A 1 564 ALA 564 564 564 ALA ALA A . n 
A 1 565 ASN 565 565 565 ASN ASN A . n 
A 1 566 GLN 566 566 566 GLN GLN A . n 
A 1 567 ARG 567 567 567 ARG ARG A . n 
A 1 568 PRO 568 568 568 PRO PRO A . n 
A 1 569 ASP 569 569 569 ASP ASP A . n 
A 1 570 LEU 570 570 570 LEU LEU A . n 
A 1 571 PHE 571 571 571 PHE PHE A . n 
A 1 572 GLY 572 572 572 GLY GLY A . n 
A 1 573 CYS 573 573 573 CYS CYS A . n 
A 1 574 VAL 574 574 574 VAL VAL A . n 
A 1 575 ILE 575 575 575 ILE ILE A . n 
A 1 576 ALA 576 576 576 ALA ALA A . n 
A 1 577 GLN 577 577 577 GLN GLN A . n 
A 1 578 VAL 578 578 578 VAL VAL A . n 
A 1 579 GLY 579 579 579 GLY GLY A . n 
A 1 580 VAL 580 580 580 VAL VAL A . n 
A 1 581 MET 581 581 581 MET MET A . n 
A 1 582 ASP 582 582 582 ASP ASP A . n 
A 1 583 MET 583 583 583 MET MET A . n 
A 1 584 LEU 584 584 584 LEU LEU A . n 
A 1 585 LYS 585 585 585 LYS LYS A . n 
A 1 586 PHE 586 586 586 PHE PHE A . n 
A 1 587 HIS 587 587 587 HIS HIS A . n 
A 1 588 LYS 588 588 588 LYS LYS A . n 
A 1 589 TYR 589 589 589 TYR TYR A . n 
A 1 590 THR 590 590 590 THR THR A . n 
A 1 591 ILE 591 591 591 ILE ILE A . n 
A 1 592 GLY 592 592 592 GLY GLY A . n 
A 1 593 HIS 593 593 593 HIS HIS A . n 
A 1 594 ALA 594 594 594 ALA ALA A . n 
A 1 595 TRP 595 595 595 TRP TRP A . n 
A 1 596 THR 596 596 596 THR THR A . n 
A 1 597 THR 597 597 597 THR THR A . n 
A 1 598 ASP 598 598 598 ASP ASP A . n 
A 1 599 TYR 599 599 599 TYR TYR A . n 
A 1 600 GLY 600 600 600 GLY GLY A . n 
A 1 601 CSD 601 601 601 CSD CSD A . n 
A 1 602 SER 602 602 602 SER SER A . n 
A 1 603 ASP 603 603 603 ASP ASP A . n 
A 1 604 SER 604 604 604 SER SER A . n 
A 1 605 LYS 605 605 605 LYS LYS A . n 
A 1 606 GLN 606 606 606 GLN GLN A . n 
A 1 607 HIS 607 607 607 HIS HIS A . n 
A 1 608 PHE 608 608 608 PHE PHE A . n 
A 1 609 GLU 609 609 609 GLU GLU A . n 
A 1 610 TRP 610 610 610 TRP TRP A . n 
A 1 611 LEU 611 611 611 LEU LEU A . n 
A 1 612 ILE 612 612 612 ILE ILE A . n 
A 1 613 LYS 613 613 613 LYS LYS A . n 
A 1 614 TYR 614 614 614 TYR TYR A . n 
A 1 615 SER 615 615 615 SER SER A . n 
A 1 616 PRO 616 616 616 PRO PRO A . n 
A 1 617 LEU 617 617 617 LEU LEU A . n 
A 1 618 HIS 618 618 618 HIS HIS A . n 
A 1 619 ASN 619 619 619 ASN ASN A . n 
A 1 620 VAL 620 620 620 VAL VAL A . n 
A 1 621 LYS 621 621 621 LYS LYS A . n 
A 1 622 LEU 622 622 622 LEU LEU A . n 
A 1 623 PRO 623 623 623 PRO PRO A . n 
A 1 624 GLU 624 624 624 GLU GLU A . n 
A 1 625 ALA 625 625 625 ALA ALA A . n 
A 1 626 ASP 626 626 626 ASP ASP A . n 
A 1 627 ASP 627 627 627 ASP ASP A . n 
A 1 628 ILE 628 628 628 ILE ILE A . n 
A 1 629 GLN 629 629 629 GLN GLN A . n 
A 1 630 TYR 630 630 630 TYR TYR A . n 
A 1 631 PRO 631 631 631 PRO PRO A . n 
A 1 632 SER 632 632 632 SER SER A . n 
A 1 633 MET 633 633 633 MET MET A . n 
A 1 634 LEU 634 634 634 LEU LEU A . n 
A 1 635 LEU 635 635 635 LEU LEU A . n 
A 1 636 LEU 636 636 636 LEU LEU A . n 
A 1 637 THR 637 637 637 THR THR A . n 
A 1 638 ALA 638 638 638 ALA ALA A . n 
A 1 639 ASP 639 639 639 ASP ASP A . n 
A 1 640 HIS 640 640 640 HIS HIS A . n 
A 1 641 ASP 641 641 641 ASP ASP A . n 
A 1 642 ASP 642 642 642 ASP ASP A . n 
A 1 643 ARG 643 643 643 ARG ARG A . n 
A 1 644 VAL 644 644 644 VAL VAL A . n 
A 1 645 VAL 645 645 645 VAL VAL A . n 
A 1 646 PRO 646 646 646 PRO PRO A . n 
A 1 647 LEU 647 647 647 LEU LEU A . n 
A 1 648 HIS 648 648 648 HIS HIS A . n 
A 1 649 SER 649 649 649 SER SER A . n 
A 1 650 LEU 650 650 650 LEU LEU A . n 
A 1 651 LYS 651 651 651 LYS LYS A . n 
A 1 652 PHE 652 652 652 PHE PHE A . n 
A 1 653 ILE 653 653 653 ILE ILE A . n 
A 1 654 ALA 654 654 654 ALA ALA A . n 
A 1 655 THR 655 655 655 THR THR A . n 
A 1 656 LEU 656 656 656 LEU LEU A . n 
A 1 657 GLN 657 657 657 GLN GLN A . n 
A 1 658 TYR 658 658 658 TYR TYR A . n 
A 1 659 ILE 659 659 659 ILE ILE A . n 
A 1 660 VAL 660 660 660 VAL VAL A . n 
A 1 661 GLY 661 661 661 GLY GLY A . n 
A 1 662 ARG 662 662 662 ARG ARG A . n 
A 1 663 SER 663 663 663 SER SER A . n 
A 1 664 ARG 664 664 664 ARG ARG A . n 
A 1 665 LYS 665 665 665 LYS LYS A . n 
A 1 666 GLN 666 666 666 GLN GLN A . n 
A 1 667 ASN 667 667 667 ASN ASN A . n 
A 1 668 ASN 668 668 668 ASN ASN A . n 
A 1 669 PRO 669 669 669 PRO PRO A . n 
A 1 670 LEU 670 670 670 LEU LEU A . n 
A 1 671 LEU 671 671 671 LEU LEU A . n 
A 1 672 ILE 672 672 672 ILE ILE A . n 
A 1 673 HIS 673 673 673 HIS HIS A . n 
A 1 674 VAL 674 674 674 VAL VAL A . n 
A 1 675 ASP 675 675 675 ASP ASP A . n 
A 1 676 THR 676 676 676 THR THR A . n 
A 1 677 LYS 677 677 677 LYS LYS A . n 
A 1 678 ALA 678 678 678 ALA ALA A . n 
A 1 679 GLY 679 679 679 GLY GLY A . n 
A 1 680 HIS 680 680 680 HIS HIS A . n 
A 1 681 GLY 681 681 681 GLY GLY A . n 
A 1 682 ALA 682 682 682 ALA ALA A . n 
A 1 683 GLY 683 683 683 GLY GLY A . n 
A 1 684 LYS 684 684 684 LYS LYS A . n 
A 1 685 PRO 685 685 685 PRO PRO A . n 
A 1 686 THR 686 686 686 THR THR A . n 
A 1 687 ALA 687 687 687 ALA ALA A . n 
A 1 688 LYS 688 688 688 LYS LYS A . n 
A 1 689 VAL 689 689 689 VAL VAL A . n 
A 1 690 ILE 690 690 690 ILE ILE A . n 
A 1 691 GLU 691 691 691 GLU GLU A . n 
A 1 692 GLU 692 692 692 GLU GLU A . n 
A 1 693 VAL 693 693 693 VAL VAL A . n 
A 1 694 SER 694 694 694 SER SER A . n 
A 1 695 ASP 695 695 695 ASP ASP A . n 
A 1 696 MET 696 696 696 MET MET A . n 
A 1 697 PHE 697 697 697 PHE PHE A . n 
A 1 698 ALA 698 698 698 ALA ALA A . n 
A 1 699 PHE 699 699 699 PHE PHE A . n 
A 1 700 ILE 700 700 700 ILE ILE A . n 
A 1 701 ALA 701 701 701 ALA ALA A . n 
A 1 702 ARG 702 702 702 ARG ARG A . n 
A 1 703 CYS 703 703 703 CYS CYS A . n 
A 1 704 LEU 704 704 704 LEU LEU A . n 
A 1 705 ASN 705 705 705 ASN ASN A . n 
A 1 706 ILE 706 706 706 ILE ILE A . n 
A 1 707 ASP 707 707 707 ASP ASP A . n 
A 1 708 TRP 708 708 708 TRP TRP A . n 
A 1 709 ILE 709 709 709 ILE ILE A . n 
A 1 710 PRO 710 710 710 PRO PRO A . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A CSX 25  A CSX 25  ? CYS 'S-OXY CYSTEINE' 
2 A CSX 57  A CSX 57  ? CYS 'S-OXY CYSTEINE' 
3 A CSD 175 A CSD 175 ? CYS 3-SULFINOALANINE 
4 A CSX 255 A CSX 255 ? CYS 'S-OXY CYSTEINE' 
5 A CSD 601 A CSD 601 ? CYS 3-SULFINOALANINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-05-13 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-09-14 
5 'Structure model' 1 4 2014-11-12 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' Other                       
5 5 'Structure model' 'Non-polymer description'   
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .     ? 1 
SCALEPACK 'data scaling'   .     ? 2 
CCP4      'model building' .     ? 3 
SHARP     phasing          .     ? 4 
X-PLOR    refinement       3.851 ? 5 
CCP4      phasing          .     ? 6 
# 
_pdbx_entry_details.entry_id             1QFM 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   
;1-THIOXY-GLYCEROL (SGL781) IS COVALENTLY BOUND TO SER554

MONOTHIOGLYCEROL IS COVALENTLY BOUND TO CYS78 AND CYS532
;
_pdbx_entry_details.sequence_details     
;CYS25, CYS57 AND CYS255 ARE OXIDIZED WITH ONE OXYGEN ATOM.
CYS175 AND CYS601 ARE OXIDIZED WITH TWO OXYGEN ATOMS.
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OG 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   SER 
_pdbx_validate_close_contact.auth_seq_id_1    554 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   C1 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   SGL 
_pdbx_validate_close_contact.auth_seq_id_2    781 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.15 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 197 ? ? -141.32 57.75   
2  1 ASN A 271 ? ? -157.73 56.28   
3  1 ASP A 284 ? ? -109.51 52.85   
4  1 SER A 308 ? ? -151.76 83.35   
5  1 TYR A 311 ? ? 73.29   153.55  
6  1 ASP A 320 ? ? -152.32 64.96   
7  1 LYS A 335 ? ? -134.86 -37.48  
8  1 SER A 346 ? ? 67.45   -62.42  
9  1 TYR A 473 ? ? -128.64 -78.82  
10 1 LEU A 520 ? ? 51.83   -121.95 
11 1 SER A 554 ? ? 65.83   -115.11 
12 1 VAL A 578 ? ? 32.15   50.63   
13 1 THR A 590 ? ? 30.42   -110.98 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 1-HYDROXY-1-THIO-GLYCEROL SGL 
3 MONOTHIOGLYCEROL          SGM 
4 GLYCEROL                  GOL 
5 water                     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SGL 1   781  781  SGL SGL A . 
C 2 SGL 1   782  782  SGL SGL A . 
D 3 SGM 1   783  783  SGM SGM A . 
E 3 SGM 1   784  784  SGM SGM A . 
F 4 GOL 1   790  790  GOL GOL A . 
G 4 GOL 1   791  791  GOL GOL A . 
H 4 GOL 1   792  792  GOL GOL A . 
I 4 GOL 1   793  793  GOL GOL A . 
J 5 HOH 1   801  801  HOH HOH A . 
J 5 HOH 2   802  802  HOH HOH A . 
J 5 HOH 3   803  803  HOH HOH A . 
J 5 HOH 4   804  804  HOH HOH A . 
J 5 HOH 5   805  805  HOH HOH A . 
J 5 HOH 6   806  806  HOH HOH A . 
J 5 HOH 7   807  807  HOH HOH A . 
J 5 HOH 8   808  808  HOH HOH A . 
J 5 HOH 9   809  809  HOH HOH A . 
J 5 HOH 10  810  810  HOH HOH A . 
J 5 HOH 11  811  811  HOH HOH A . 
J 5 HOH 12  812  812  HOH HOH A . 
J 5 HOH 13  813  813  HOH HOH A . 
J 5 HOH 14  814  814  HOH HOH A . 
J 5 HOH 15  815  815  HOH HOH A . 
J 5 HOH 16  816  816  HOH HOH A . 
J 5 HOH 17  817  817  HOH HOH A . 
J 5 HOH 18  818  818  HOH HOH A . 
J 5 HOH 19  819  819  HOH HOH A . 
J 5 HOH 20  820  820  HOH HOH A . 
J 5 HOH 21  821  821  HOH HOH A . 
J 5 HOH 22  822  822  HOH HOH A . 
J 5 HOH 23  823  823  HOH HOH A . 
J 5 HOH 24  824  824  HOH HOH A . 
J 5 HOH 25  825  825  HOH HOH A . 
J 5 HOH 26  826  826  HOH HOH A . 
J 5 HOH 27  827  827  HOH HOH A . 
J 5 HOH 28  828  828  HOH HOH A . 
J 5 HOH 29  829  829  HOH HOH A . 
J 5 HOH 30  830  830  HOH HOH A . 
J 5 HOH 31  831  831  HOH HOH A . 
J 5 HOH 32  832  832  HOH HOH A . 
J 5 HOH 33  833  833  HOH HOH A . 
J 5 HOH 34  834  834  HOH HOH A . 
J 5 HOH 35  835  835  HOH HOH A . 
J 5 HOH 36  836  836  HOH HOH A . 
J 5 HOH 37  837  837  HOH HOH A . 
J 5 HOH 38  838  838  HOH HOH A . 
J 5 HOH 39  839  839  HOH HOH A . 
J 5 HOH 40  840  840  HOH HOH A . 
J 5 HOH 41  841  841  HOH HOH A . 
J 5 HOH 42  842  842  HOH HOH A . 
J 5 HOH 43  843  843  HOH HOH A . 
J 5 HOH 44  844  844  HOH HOH A . 
J 5 HOH 45  845  845  HOH HOH A . 
J 5 HOH 46  846  846  HOH HOH A . 
J 5 HOH 47  847  847  HOH HOH A . 
J 5 HOH 48  848  848  HOH HOH A . 
J 5 HOH 49  849  849  HOH HOH A . 
J 5 HOH 50  850  850  HOH HOH A . 
J 5 HOH 51  851  851  HOH HOH A . 
J 5 HOH 52  852  852  HOH HOH A . 
J 5 HOH 53  853  853  HOH HOH A . 
J 5 HOH 54  854  854  HOH HOH A . 
J 5 HOH 55  855  855  HOH HOH A . 
J 5 HOH 56  856  856  HOH HOH A . 
J 5 HOH 57  857  857  HOH HOH A . 
J 5 HOH 58  858  858  HOH HOH A . 
J 5 HOH 59  859  859  HOH HOH A . 
J 5 HOH 60  860  860  HOH HOH A . 
J 5 HOH 61  861  861  HOH HOH A . 
J 5 HOH 62  862  862  HOH HOH A . 
J 5 HOH 63  863  863  HOH HOH A . 
J 5 HOH 64  864  864  HOH HOH A . 
J 5 HOH 65  865  865  HOH HOH A . 
J 5 HOH 66  866  866  HOH HOH A . 
J 5 HOH 67  867  867  HOH HOH A . 
J 5 HOH 68  868  868  HOH HOH A . 
J 5 HOH 69  869  869  HOH HOH A . 
J 5 HOH 70  870  870  HOH HOH A . 
J 5 HOH 71  871  871  HOH HOH A . 
J 5 HOH 72  872  872  HOH HOH A . 
J 5 HOH 73  873  873  HOH HOH A . 
J 5 HOH 74  874  874  HOH HOH A . 
J 5 HOH 75  875  875  HOH HOH A . 
J 5 HOH 76  876  876  HOH HOH A . 
J 5 HOH 77  877  877  HOH HOH A . 
J 5 HOH 78  878  878  HOH HOH A . 
J 5 HOH 79  879  879  HOH HOH A . 
J 5 HOH 80  880  880  HOH HOH A . 
J 5 HOH 81  881  881  HOH HOH A . 
J 5 HOH 82  882  882  HOH HOH A . 
J 5 HOH 83  883  883  HOH HOH A . 
J 5 HOH 84  884  884  HOH HOH A . 
J 5 HOH 85  885  885  HOH HOH A . 
J 5 HOH 86  886  886  HOH HOH A . 
J 5 HOH 87  887  887  HOH HOH A . 
J 5 HOH 88  888  888  HOH HOH A . 
J 5 HOH 89  889  889  HOH HOH A . 
J 5 HOH 90  890  890  HOH HOH A . 
J 5 HOH 91  891  891  HOH HOH A . 
J 5 HOH 92  892  892  HOH HOH A . 
J 5 HOH 93  893  893  HOH HOH A . 
J 5 HOH 94  894  894  HOH HOH A . 
J 5 HOH 95  895  895  HOH HOH A . 
J 5 HOH 96  896  896  HOH HOH A . 
J 5 HOH 97  897  897  HOH HOH A . 
J 5 HOH 98  898  898  HOH HOH A . 
J 5 HOH 99  899  899  HOH HOH A . 
J 5 HOH 100 900  900  HOH HOH A . 
J 5 HOH 101 901  901  HOH HOH A . 
J 5 HOH 102 902  902  HOH HOH A . 
J 5 HOH 103 903  903  HOH HOH A . 
J 5 HOH 104 904  904  HOH HOH A . 
J 5 HOH 105 905  905  HOH HOH A . 
J 5 HOH 106 906  906  HOH HOH A . 
J 5 HOH 107 907  907  HOH HOH A . 
J 5 HOH 108 908  908  HOH HOH A . 
J 5 HOH 109 909  909  HOH HOH A . 
J 5 HOH 110 910  910  HOH HOH A . 
J 5 HOH 111 911  911  HOH HOH A . 
J 5 HOH 112 912  912  HOH HOH A . 
J 5 HOH 113 913  913  HOH HOH A . 
J 5 HOH 114 914  914  HOH HOH A . 
J 5 HOH 115 915  915  HOH HOH A . 
J 5 HOH 116 916  916  HOH HOH A . 
J 5 HOH 117 917  917  HOH HOH A . 
J 5 HOH 118 918  918  HOH HOH A . 
J 5 HOH 119 919  919  HOH HOH A . 
J 5 HOH 120 920  920  HOH HOH A . 
J 5 HOH 121 921  921  HOH HOH A . 
J 5 HOH 122 922  922  HOH HOH A . 
J 5 HOH 123 923  923  HOH HOH A . 
J 5 HOH 124 924  924  HOH HOH A . 
J 5 HOH 125 925  925  HOH HOH A . 
J 5 HOH 126 926  926  HOH HOH A . 
J 5 HOH 127 927  927  HOH HOH A . 
J 5 HOH 128 928  928  HOH HOH A . 
J 5 HOH 129 929  929  HOH HOH A . 
J 5 HOH 130 930  930  HOH HOH A . 
J 5 HOH 131 931  931  HOH HOH A . 
J 5 HOH 132 932  932  HOH HOH A . 
J 5 HOH 133 933  933  HOH HOH A . 
J 5 HOH 134 934  934  HOH HOH A . 
J 5 HOH 135 935  935  HOH HOH A . 
J 5 HOH 136 936  936  HOH HOH A . 
J 5 HOH 137 937  937  HOH HOH A . 
J 5 HOH 138 938  938  HOH HOH A . 
J 5 HOH 139 939  939  HOH HOH A . 
J 5 HOH 140 940  940  HOH HOH A . 
J 5 HOH 141 941  941  HOH HOH A . 
J 5 HOH 142 942  942  HOH HOH A . 
J 5 HOH 143 943  943  HOH HOH A . 
J 5 HOH 144 944  944  HOH HOH A . 
J 5 HOH 145 945  945  HOH HOH A . 
J 5 HOH 146 946  946  HOH HOH A . 
J 5 HOH 147 947  947  HOH HOH A . 
J 5 HOH 148 948  948  HOH HOH A . 
J 5 HOH 149 949  949  HOH HOH A . 
J 5 HOH 150 950  950  HOH HOH A . 
J 5 HOH 151 951  951  HOH HOH A . 
J 5 HOH 152 952  952  HOH HOH A . 
J 5 HOH 153 953  953  HOH HOH A . 
J 5 HOH 154 954  954  HOH HOH A . 
J 5 HOH 155 955  955  HOH HOH A . 
J 5 HOH 156 956  956  HOH HOH A . 
J 5 HOH 157 957  957  HOH HOH A . 
J 5 HOH 158 958  958  HOH HOH A . 
J 5 HOH 159 959  959  HOH HOH A . 
J 5 HOH 160 960  960  HOH HOH A . 
J 5 HOH 161 961  961  HOH HOH A . 
J 5 HOH 162 962  962  HOH HOH A . 
J 5 HOH 163 963  963  HOH HOH A . 
J 5 HOH 164 964  964  HOH HOH A . 
J 5 HOH 165 965  965  HOH HOH A . 
J 5 HOH 166 966  966  HOH HOH A . 
J 5 HOH 167 967  967  HOH HOH A . 
J 5 HOH 168 968  968  HOH HOH A . 
J 5 HOH 169 969  969  HOH HOH A . 
J 5 HOH 170 970  970  HOH HOH A . 
J 5 HOH 171 971  971  HOH HOH A . 
J 5 HOH 172 972  972  HOH HOH A . 
J 5 HOH 173 973  973  HOH HOH A . 
J 5 HOH 174 974  974  HOH HOH A . 
J 5 HOH 175 975  975  HOH HOH A . 
J 5 HOH 176 976  976  HOH HOH A . 
J 5 HOH 177 977  977  HOH HOH A . 
J 5 HOH 178 978  978  HOH HOH A . 
J 5 HOH 179 979  979  HOH HOH A . 
J 5 HOH 180 980  980  HOH HOH A . 
J 5 HOH 181 981  981  HOH HOH A . 
J 5 HOH 182 982  982  HOH HOH A . 
J 5 HOH 183 983  983  HOH HOH A . 
J 5 HOH 184 984  984  HOH HOH A . 
J 5 HOH 185 985  985  HOH HOH A . 
J 5 HOH 186 986  986  HOH HOH A . 
J 5 HOH 187 987  987  HOH HOH A . 
J 5 HOH 188 988  988  HOH HOH A . 
J 5 HOH 189 989  989  HOH HOH A . 
J 5 HOH 190 990  990  HOH HOH A . 
J 5 HOH 191 991  991  HOH HOH A . 
J 5 HOH 192 992  992  HOH HOH A . 
J 5 HOH 193 993  993  HOH HOH A . 
J 5 HOH 194 994  994  HOH HOH A . 
J 5 HOH 195 995  995  HOH HOH A . 
J 5 HOH 196 996  996  HOH HOH A . 
J 5 HOH 197 997  997  HOH HOH A . 
J 5 HOH 198 998  998  HOH HOH A . 
J 5 HOH 199 999  999  HOH HOH A . 
J 5 HOH 200 1000 1000 HOH HOH A . 
J 5 HOH 201 1001 1001 HOH HOH A . 
J 5 HOH 202 1002 1002 HOH HOH A . 
J 5 HOH 203 1003 1003 HOH HOH A . 
J 5 HOH 204 1004 1004 HOH HOH A . 
J 5 HOH 205 1005 1005 HOH HOH A . 
J 5 HOH 206 1006 1006 HOH HOH A . 
J 5 HOH 207 1007 1007 HOH HOH A . 
J 5 HOH 208 1008 1008 HOH HOH A . 
J 5 HOH 209 1009 1009 HOH HOH A . 
J 5 HOH 210 1010 1010 HOH HOH A . 
J 5 HOH 211 1011 1011 HOH HOH A . 
J 5 HOH 212 1012 1012 HOH HOH A . 
J 5 HOH 213 1013 1013 HOH HOH A . 
J 5 HOH 214 1014 1014 HOH HOH A . 
J 5 HOH 215 1015 1015 HOH HOH A . 
J 5 HOH 216 1016 1016 HOH HOH A . 
J 5 HOH 217 1017 1017 HOH HOH A . 
J 5 HOH 218 1018 1018 HOH HOH A . 
J 5 HOH 219 1019 1019 HOH HOH A . 
J 5 HOH 220 1020 1020 HOH HOH A . 
J 5 HOH 221 1021 1021 HOH HOH A . 
J 5 HOH 222 1022 1022 HOH HOH A . 
J 5 HOH 223 1023 1023 HOH HOH A . 
J 5 HOH 224 1024 1024 HOH HOH A . 
J 5 HOH 225 1025 1025 HOH HOH A . 
J 5 HOH 226 1026 1026 HOH HOH A . 
J 5 HOH 227 1027 1027 HOH HOH A . 
J 5 HOH 228 1028 1028 HOH HOH A . 
J 5 HOH 229 1029 1029 HOH HOH A . 
J 5 HOH 230 1030 1030 HOH HOH A . 
J 5 HOH 231 1031 1031 HOH HOH A . 
J 5 HOH 232 1032 1032 HOH HOH A . 
J 5 HOH 233 1033 1033 HOH HOH A . 
J 5 HOH 234 1034 1034 HOH HOH A . 
J 5 HOH 235 1035 1035 HOH HOH A . 
J 5 HOH 236 1036 1036 HOH HOH A . 
J 5 HOH 237 1037 1037 HOH HOH A . 
J 5 HOH 238 1038 1038 HOH HOH A . 
J 5 HOH 239 1039 1039 HOH HOH A . 
J 5 HOH 240 1040 1040 HOH HOH A . 
J 5 HOH 241 1041 1041 HOH HOH A . 
J 5 HOH 242 1042 1042 HOH HOH A . 
J 5 HOH 243 1043 1043 HOH HOH A . 
J 5 HOH 244 1044 1044 HOH HOH A . 
J 5 HOH 245 1045 1045 HOH HOH A . 
J 5 HOH 246 1046 1046 HOH HOH A . 
J 5 HOH 247 1047 1047 HOH HOH A . 
J 5 HOH 248 1048 1048 HOH HOH A . 
J 5 HOH 249 1049 1049 HOH HOH A . 
J 5 HOH 250 1050 1050 HOH HOH A . 
J 5 HOH 251 1051 1051 HOH HOH A . 
J 5 HOH 252 1052 1052 HOH HOH A . 
J 5 HOH 253 1053 1053 HOH HOH A . 
J 5 HOH 254 1054 1054 HOH HOH A . 
J 5 HOH 255 1055 1055 HOH HOH A . 
J 5 HOH 256 1056 1056 HOH HOH A . 
J 5 HOH 257 1057 1057 HOH HOH A . 
J 5 HOH 258 1058 1058 HOH HOH A . 
J 5 HOH 259 1059 1059 HOH HOH A . 
J 5 HOH 260 1060 1060 HOH HOH A . 
J 5 HOH 261 1061 1061 HOH HOH A . 
J 5 HOH 262 1062 1062 HOH HOH A . 
J 5 HOH 263 1063 1063 HOH HOH A . 
J 5 HOH 264 1064 1064 HOH HOH A . 
J 5 HOH 265 1065 1065 HOH HOH A . 
J 5 HOH 266 1066 1066 HOH HOH A . 
J 5 HOH 267 1067 1067 HOH HOH A . 
J 5 HOH 268 1068 1068 HOH HOH A . 
J 5 HOH 269 1069 1069 HOH HOH A . 
J 5 HOH 270 1070 1070 HOH HOH A . 
J 5 HOH 271 1071 1071 HOH HOH A . 
J 5 HOH 272 1072 1072 HOH HOH A . 
J 5 HOH 273 1073 1073 HOH HOH A . 
J 5 HOH 274 1074 1074 HOH HOH A . 
J 5 HOH 275 1075 1075 HOH HOH A . 
J 5 HOH 276 1076 1076 HOH HOH A . 
J 5 HOH 277 1077 1077 HOH HOH A . 
J 5 HOH 278 1078 1078 HOH HOH A . 
J 5 HOH 279 1079 1079 HOH HOH A . 
J 5 HOH 280 1080 1080 HOH HOH A . 
J 5 HOH 281 1081 1081 HOH HOH A . 
J 5 HOH 282 1082 1082 HOH HOH A . 
J 5 HOH 283 1083 1083 HOH HOH A . 
J 5 HOH 284 1084 1084 HOH HOH A . 
J 5 HOH 285 1085 1085 HOH HOH A . 
J 5 HOH 286 1086 1086 HOH HOH A . 
J 5 HOH 287 1087 1087 HOH HOH A . 
J 5 HOH 288 1088 1088 HOH HOH A . 
J 5 HOH 289 1089 1089 HOH HOH A . 
J 5 HOH 290 1090 1090 HOH HOH A . 
J 5 HOH 291 1091 1091 HOH HOH A . 
J 5 HOH 292 1092 1092 HOH HOH A . 
J 5 HOH 293 1093 1093 HOH HOH A . 
J 5 HOH 294 1094 1094 HOH HOH A . 
J 5 HOH 295 1095 1095 HOH HOH A . 
J 5 HOH 296 1096 1096 HOH HOH A . 
J 5 HOH 297 1097 1097 HOH HOH A . 
J 5 HOH 298 1098 1098 HOH HOH A . 
J 5 HOH 299 1099 1099 HOH HOH A . 
J 5 HOH 300 1100 1100 HOH HOH A . 
J 5 HOH 301 1101 1101 HOH HOH A . 
J 5 HOH 302 1102 1102 HOH HOH A . 
J 5 HOH 303 1103 1103 HOH HOH A . 
J 5 HOH 304 1104 1104 HOH HOH A . 
J 5 HOH 305 1105 1105 HOH HOH A . 
J 5 HOH 306 1106 1106 HOH HOH A . 
J 5 HOH 307 1107 1107 HOH HOH A . 
J 5 HOH 308 1108 1108 HOH HOH A . 
J 5 HOH 309 1109 1109 HOH HOH A . 
J 5 HOH 310 1110 1110 HOH HOH A . 
J 5 HOH 311 1111 1111 HOH HOH A . 
J 5 HOH 312 1112 1112 HOH HOH A . 
J 5 HOH 313 1113 1113 HOH HOH A . 
J 5 HOH 314 1114 1114 HOH HOH A . 
J 5 HOH 315 1115 1115 HOH HOH A . 
J 5 HOH 316 1116 1116 HOH HOH A . 
J 5 HOH 317 1117 1117 HOH HOH A . 
J 5 HOH 318 1118 1118 HOH HOH A . 
J 5 HOH 319 1119 1119 HOH HOH A . 
J 5 HOH 320 1120 1120 HOH HOH A . 
J 5 HOH 321 1121 1121 HOH HOH A . 
J 5 HOH 322 1122 1122 HOH HOH A . 
J 5 HOH 323 1123 1123 HOH HOH A . 
J 5 HOH 324 1124 1124 HOH HOH A . 
J 5 HOH 325 1125 1125 HOH HOH A . 
J 5 HOH 326 1126 1126 HOH HOH A . 
J 5 HOH 327 1127 1127 HOH HOH A . 
J 5 HOH 328 1128 1128 HOH HOH A . 
J 5 HOH 329 1129 1129 HOH HOH A . 
J 5 HOH 330 1130 1130 HOH HOH A . 
J 5 HOH 331 1131 1131 HOH HOH A . 
J 5 HOH 332 1132 1132 HOH HOH A . 
J 5 HOH 333 1133 1133 HOH HOH A . 
J 5 HOH 334 1134 1134 HOH HOH A . 
J 5 HOH 335 1135 1135 HOH HOH A . 
J 5 HOH 336 1136 1136 HOH HOH A . 
J 5 HOH 337 1137 1137 HOH HOH A . 
J 5 HOH 338 1138 1138 HOH HOH A . 
J 5 HOH 339 1139 1139 HOH HOH A . 
J 5 HOH 340 1140 1140 HOH HOH A . 
J 5 HOH 341 1141 1141 HOH HOH A . 
J 5 HOH 342 1142 1142 HOH HOH A . 
J 5 HOH 343 1143 1143 HOH HOH A . 
J 5 HOH 344 1144 1144 HOH HOH A . 
J 5 HOH 345 1145 1145 HOH HOH A . 
J 5 HOH 346 1146 1146 HOH HOH A . 
J 5 HOH 347 1147 1147 HOH HOH A . 
J 5 HOH 348 1148 1148 HOH HOH A . 
J 5 HOH 349 1149 1149 HOH HOH A . 
J 5 HOH 350 1150 1150 HOH HOH A . 
J 5 HOH 351 1151 1151 HOH HOH A . 
J 5 HOH 352 1152 1152 HOH HOH A . 
J 5 HOH 353 1153 1153 HOH HOH A . 
J 5 HOH 354 1154 1154 HOH HOH A . 
J 5 HOH 355 1155 1155 HOH HOH A . 
J 5 HOH 356 1156 1156 HOH HOH A . 
J 5 HOH 357 1157 1157 HOH HOH A . 
J 5 HOH 358 1158 1158 HOH HOH A . 
J 5 HOH 359 1159 1159 HOH HOH A . 
J 5 HOH 360 1160 1160 HOH HOH A . 
J 5 HOH 361 1161 1161 HOH HOH A . 
J 5 HOH 362 1162 1162 HOH HOH A . 
J 5 HOH 363 1163 1163 HOH HOH A . 
J 5 HOH 364 1164 1164 HOH HOH A . 
J 5 HOH 365 1165 1165 HOH HOH A . 
J 5 HOH 366 1166 1166 HOH HOH A . 
J 5 HOH 367 1167 1167 HOH HOH A . 
J 5 HOH 368 1168 1168 HOH HOH A . 
J 5 HOH 369 1169 1169 HOH HOH A . 
J 5 HOH 370 1170 1170 HOH HOH A . 
J 5 HOH 371 1171 1171 HOH HOH A . 
J 5 HOH 372 1172 1172 HOH HOH A . 
J 5 HOH 373 1173 1173 HOH HOH A . 
J 5 HOH 374 1174 1174 HOH HOH A . 
J 5 HOH 375 1175 1175 HOH HOH A . 
J 5 HOH 376 1176 1176 HOH HOH A . 
J 5 HOH 377 1177 1177 HOH HOH A . 
J 5 HOH 378 1178 1178 HOH HOH A . 
J 5 HOH 379 1179 1179 HOH HOH A . 
J 5 HOH 380 1180 1180 HOH HOH A . 
J 5 HOH 381 1181 1181 HOH HOH A . 
J 5 HOH 382 1182 1182 HOH HOH A . 
J 5 HOH 383 1183 1183 HOH HOH A . 
J 5 HOH 384 1184 1184 HOH HOH A . 
J 5 HOH 385 1185 1185 HOH HOH A . 
J 5 HOH 386 1186 1186 HOH HOH A . 
J 5 HOH 387 1187 1187 HOH HOH A . 
J 5 HOH 388 1188 1188 HOH HOH A . 
J 5 HOH 389 1189 1189 HOH HOH A . 
J 5 HOH 390 1190 1190 HOH HOH A . 
J 5 HOH 391 1191 1191 HOH HOH A . 
J 5 HOH 392 1192 1192 HOH HOH A . 
J 5 HOH 393 1193 1193 HOH HOH A . 
J 5 HOH 394 1194 1194 HOH HOH A . 
J 5 HOH 395 1195 1195 HOH HOH A . 
J 5 HOH 396 1196 1196 HOH HOH A . 
J 5 HOH 397 1197 1197 HOH HOH A . 
J 5 HOH 398 1198 1198 HOH HOH A . 
J 5 HOH 399 1199 1199 HOH HOH A . 
J 5 HOH 400 1200 1200 HOH HOH A . 
J 5 HOH 401 1201 1201 HOH HOH A . 
J 5 HOH 402 1202 1202 HOH HOH A . 
J 5 HOH 403 1203 1203 HOH HOH A . 
J 5 HOH 404 1204 1204 HOH HOH A . 
J 5 HOH 405 1205 1205 HOH HOH A . 
J 5 HOH 406 1206 1206 HOH HOH A . 
J 5 HOH 407 1207 1207 HOH HOH A . 
J 5 HOH 408 1208 1208 HOH HOH A . 
J 5 HOH 409 1209 1209 HOH HOH A . 
J 5 HOH 410 1210 1210 HOH HOH A . 
J 5 HOH 411 1211 1211 HOH HOH A . 
J 5 HOH 412 1212 1212 HOH HOH A . 
J 5 HOH 413 1213 1213 HOH HOH A . 
J 5 HOH 414 1214 1214 HOH HOH A . 
J 5 HOH 415 1215 1215 HOH HOH A . 
J 5 HOH 416 1216 1216 HOH HOH A . 
J 5 HOH 417 1217 1217 HOH HOH A . 
J 5 HOH 418 1218 1218 HOH HOH A . 
J 5 HOH 419 1219 1219 HOH HOH A . 
J 5 HOH 420 1220 1220 HOH HOH A . 
J 5 HOH 421 1221 1221 HOH HOH A . 
J 5 HOH 422 1222 1222 HOH HOH A . 
J 5 HOH 423 1223 1223 HOH HOH A . 
J 5 HOH 424 1224 1224 HOH HOH A . 
J 5 HOH 425 1225 1225 HOH HOH A . 
J 5 HOH 426 1226 1226 HOH HOH A . 
J 5 HOH 427 1227 1227 HOH HOH A . 
J 5 HOH 428 1228 1228 HOH HOH A . 
J 5 HOH 429 1229 1229 HOH HOH A . 
J 5 HOH 430 1230 1230 HOH HOH A . 
J 5 HOH 431 1231 1231 HOH HOH A . 
J 5 HOH 432 1232 1232 HOH HOH A . 
J 5 HOH 433 1233 1233 HOH HOH A . 
J 5 HOH 434 1234 1234 HOH HOH A . 
J 5 HOH 435 1235 1235 HOH HOH A . 
J 5 HOH 436 1236 1236 HOH HOH A . 
J 5 HOH 437 1237 1237 HOH HOH A . 
J 5 HOH 438 1238 1238 HOH HOH A . 
J 5 HOH 439 1239 1239 HOH HOH A . 
J 5 HOH 440 1240 1240 HOH HOH A . 
J 5 HOH 441 1241 1241 HOH HOH A . 
J 5 HOH 442 1242 1242 HOH HOH A . 
J 5 HOH 443 1243 1243 HOH HOH A . 
J 5 HOH 444 1244 1244 HOH HOH A . 
J 5 HOH 445 1245 1245 HOH HOH A . 
J 5 HOH 446 1246 1246 HOH HOH A . 
J 5 HOH 447 1247 1247 HOH HOH A . 
J 5 HOH 448 1248 1248 HOH HOH A . 
J 5 HOH 449 1249 1249 HOH HOH A . 
J 5 HOH 450 1250 1250 HOH HOH A . 
J 5 HOH 451 1251 1251 HOH HOH A . 
J 5 HOH 452 1252 1252 HOH HOH A . 
J 5 HOH 453 1253 1253 HOH HOH A . 
J 5 HOH 454 1254 1254 HOH HOH A . 
J 5 HOH 455 1255 1255 HOH HOH A . 
J 5 HOH 456 1256 1256 HOH HOH A . 
J 5 HOH 457 1257 1257 HOH HOH A . 
J 5 HOH 458 1258 1258 HOH HOH A . 
J 5 HOH 459 1259 1259 HOH HOH A . 
J 5 HOH 460 1260 1260 HOH HOH A . 
J 5 HOH 461 1261 1261 HOH HOH A . 
J 5 HOH 462 1262 1262 HOH HOH A . 
J 5 HOH 463 1263 1263 HOH HOH A . 
J 5 HOH 464 1264 1264 HOH HOH A . 
J 5 HOH 465 1265 1265 HOH HOH A . 
J 5 HOH 466 1266 1266 HOH HOH A . 
J 5 HOH 467 1267 1267 HOH HOH A . 
J 5 HOH 468 1268 1268 HOH HOH A . 
J 5 HOH 469 1269 1269 HOH HOH A . 
J 5 HOH 470 1270 1270 HOH HOH A . 
J 5 HOH 471 1271 1271 HOH HOH A . 
J 5 HOH 472 1272 1272 HOH HOH A . 
J 5 HOH 473 1273 1273 HOH HOH A . 
J 5 HOH 474 1274 1274 HOH HOH A . 
J 5 HOH 475 1275 1275 HOH HOH A . 
J 5 HOH 476 1276 1276 HOH HOH A . 
J 5 HOH 477 1277 1277 HOH HOH A . 
J 5 HOH 478 1278 1278 HOH HOH A . 
J 5 HOH 479 1279 1279 HOH HOH A . 
J 5 HOH 480 1280 1280 HOH HOH A . 
J 5 HOH 481 1281 1281 HOH HOH A . 
J 5 HOH 482 1282 1282 HOH HOH A . 
J 5 HOH 483 1283 1283 HOH HOH A . 
J 5 HOH 484 1284 1284 HOH HOH A . 
J 5 HOH 485 1285 1285 HOH HOH A . 
J 5 HOH 486 1286 1286 HOH HOH A . 
J 5 HOH 487 1287 1287 HOH HOH A . 
J 5 HOH 488 1288 1288 HOH HOH A . 
J 5 HOH 489 1289 1289 HOH HOH A . 
J 5 HOH 490 1290 1290 HOH HOH A . 
J 5 HOH 491 1291 1291 HOH HOH A . 
J 5 HOH 492 1292 1292 HOH HOH A . 
J 5 HOH 493 1293 1293 HOH HOH A . 
J 5 HOH 494 1294 1294 HOH HOH A . 
J 5 HOH 495 1295 1295 HOH HOH A . 
J 5 HOH 496 1296 1296 HOH HOH A . 
J 5 HOH 497 1297 1297 HOH HOH A . 
J 5 HOH 498 1298 1298 HOH HOH A . 
J 5 HOH 499 1299 1299 HOH HOH A . 
J 5 HOH 500 1300 1300 HOH HOH A . 
J 5 HOH 501 1301 1301 HOH HOH A . 
J 5 HOH 502 1302 1302 HOH HOH A . 
J 5 HOH 503 1303 1303 HOH HOH A . 
J 5 HOH 504 1304 1304 HOH HOH A . 
J 5 HOH 505 1305 1305 HOH HOH A . 
J 5 HOH 506 1306 1306 HOH HOH A . 
J 5 HOH 507 1307 1307 HOH HOH A . 
J 5 HOH 508 1308 1308 HOH HOH A . 
J 5 HOH 509 1309 1309 HOH HOH A . 
J 5 HOH 510 1310 1310 HOH HOH A . 
J 5 HOH 511 1311 1311 HOH HOH A . 
J 5 HOH 512 1312 1312 HOH HOH A . 
J 5 HOH 513 1313 1313 HOH HOH A . 
J 5 HOH 514 1314 1314 HOH HOH A . 
J 5 HOH 515 1315 1315 HOH HOH A . 
J 5 HOH 516 1316 1316 HOH HOH A . 
J 5 HOH 517 1317 1317 HOH HOH A . 
J 5 HOH 518 1318 1318 HOH HOH A . 
J 5 HOH 519 1319 1319 HOH HOH A . 
J 5 HOH 520 1320 1320 HOH HOH A . 
J 5 HOH 521 1321 1321 HOH HOH A . 
J 5 HOH 522 1322 1322 HOH HOH A . 
J 5 HOH 523 1323 1323 HOH HOH A . 
J 5 HOH 524 1324 1324 HOH HOH A . 
J 5 HOH 525 1325 1325 HOH HOH A . 
J 5 HOH 526 1326 1326 HOH HOH A . 
J 5 HOH 527 1327 1327 HOH HOH A . 
J 5 HOH 528 1328 1328 HOH HOH A . 
J 5 HOH 529 1329 1329 HOH HOH A . 
J 5 HOH 530 1330 1330 HOH HOH A . 
J 5 HOH 531 1331 1331 HOH HOH A . 
J 5 HOH 532 1332 1332 HOH HOH A . 
J 5 HOH 533 1333 1333 HOH HOH A . 
J 5 HOH 534 1334 1334 HOH HOH A . 
J 5 HOH 535 1335 1335 HOH HOH A . 
J 5 HOH 536 1336 1336 HOH HOH A . 
J 5 HOH 537 1337 1337 HOH HOH A . 
J 5 HOH 538 1338 1338 HOH HOH A . 
J 5 HOH 539 1339 1339 HOH HOH A . 
J 5 HOH 540 1340 1340 HOH HOH A . 
J 5 HOH 541 1341 1341 HOH HOH A . 
J 5 HOH 542 1342 1342 HOH HOH A . 
J 5 HOH 543 1343 1343 HOH HOH A . 
J 5 HOH 544 1344 1344 HOH HOH A . 
J 5 HOH 545 1345 1345 HOH HOH A . 
J 5 HOH 546 1346 1346 HOH HOH A . 
J 5 HOH 547 1347 1347 HOH HOH A . 
J 5 HOH 548 1348 1348 HOH HOH A . 
J 5 HOH 549 1349 1349 HOH HOH A . 
J 5 HOH 550 1350 1350 HOH HOH A . 
J 5 HOH 551 1351 1351 HOH HOH A . 
J 5 HOH 552 1352 1352 HOH HOH A . 
J 5 HOH 553 1353 1353 HOH HOH A . 
J 5 HOH 554 1354 1354 HOH HOH A . 
J 5 HOH 555 1355 1355 HOH HOH A . 
J 5 HOH 556 1356 1356 HOH HOH A . 
J 5 HOH 557 1357 1357 HOH HOH A . 
J 5 HOH 558 1358 1358 HOH HOH A . 
J 5 HOH 559 1359 1359 HOH HOH A . 
J 5 HOH 560 1360 1360 HOH HOH A . 
J 5 HOH 561 1361 1361 HOH HOH A . 
J 5 HOH 562 1362 1362 HOH HOH A . 
J 5 HOH 563 1363 1363 HOH HOH A . 
J 5 HOH 564 1364 1364 HOH HOH A . 
J 5 HOH 565 1365 1365 HOH HOH A . 
J 5 HOH 566 1366 1366 HOH HOH A . 
J 5 HOH 567 1367 1367 HOH HOH A . 
J 5 HOH 568 1368 1368 HOH HOH A . 
J 5 HOH 569 1369 1369 HOH HOH A . 
J 5 HOH 570 1370 1370 HOH HOH A . 
J 5 HOH 571 1371 1371 HOH HOH A . 
J 5 HOH 572 1372 1372 HOH HOH A . 
J 5 HOH 573 1373 1373 HOH HOH A . 
J 5 HOH 574 1374 1374 HOH HOH A . 
J 5 HOH 575 1375 1375 HOH HOH A . 
J 5 HOH 576 1376 1376 HOH HOH A . 
J 5 HOH 577 1377 1377 HOH HOH A . 
J 5 HOH 578 1378 1378 HOH HOH A . 
J 5 HOH 579 1379 1379 HOH HOH A . 
J 5 HOH 580 1380 1380 HOH HOH A . 
J 5 HOH 581 1381 1381 HOH HOH A . 
J 5 HOH 582 1382 1382 HOH HOH A . 
J 5 HOH 583 1383 1383 HOH HOH A . 
J 5 HOH 584 1384 1384 HOH HOH A . 
J 5 HOH 585 1385 1385 HOH HOH A . 
J 5 HOH 586 1386 1386 HOH HOH A . 
J 5 HOH 587 1387 1387 HOH HOH A . 
J 5 HOH 588 1388 1388 HOH HOH A . 
J 5 HOH 589 1389 1389 HOH HOH A . 
J 5 HOH 590 1390 1390 HOH HOH A . 
J 5 HOH 591 1391 1391 HOH HOH A . 
J 5 HOH 592 1392 1392 HOH HOH A . 
J 5 HOH 593 1393 1393 HOH HOH A . 
J 5 HOH 594 1394 1394 HOH HOH A . 
J 5 HOH 595 1395 1395 HOH HOH A . 
J 5 HOH 596 1396 1396 HOH HOH A . 
J 5 HOH 597 1397 1397 HOH HOH A . 
J 5 HOH 598 1398 1398 HOH HOH A . 
J 5 HOH 599 1399 1399 HOH HOH A . 
J 5 HOH 600 1400 1400 HOH HOH A . 
J 5 HOH 601 1401 1401 HOH HOH A . 
J 5 HOH 602 1402 1402 HOH HOH A . 
J 5 HOH 603 1403 1403 HOH HOH A . 
J 5 HOH 604 1404 1404 HOH HOH A . 
J 5 HOH 605 1405 1405 HOH HOH A . 
J 5 HOH 606 1406 1406 HOH HOH A . 
J 5 HOH 607 1407 1407 HOH HOH A . 
J 5 HOH 608 1408 1408 HOH HOH A . 
J 5 HOH 609 1409 1409 HOH HOH A . 
J 5 HOH 610 1410 1410 HOH HOH A . 
J 5 HOH 611 1411 1411 HOH HOH A . 
J 5 HOH 612 1412 1412 HOH HOH A . 
J 5 HOH 613 1413 1413 HOH HOH A . 
J 5 HOH 614 1414 1414 HOH HOH A . 
J 5 HOH 615 1415 1415 HOH HOH A . 
J 5 HOH 616 1416 1416 HOH HOH A . 
J 5 HOH 617 1417 1417 HOH HOH A . 
J 5 HOH 618 1418 1418 HOH HOH A . 
J 5 HOH 619 1419 1419 HOH HOH A . 
J 5 HOH 620 1420 1420 HOH HOH A . 
J 5 HOH 621 1421 1421 HOH HOH A . 
J 5 HOH 622 1422 1422 HOH HOH A . 
J 5 HOH 623 1423 1423 HOH HOH A . 
J 5 HOH 624 1424 1424 HOH HOH A . 
J 5 HOH 625 1425 1425 HOH HOH A . 
J 5 HOH 626 1426 1426 HOH HOH A . 
J 5 HOH 627 1427 1427 HOH HOH A . 
J 5 HOH 628 1428 1428 HOH HOH A . 
J 5 HOH 629 1429 1429 HOH HOH A . 
J 5 HOH 630 1430 1430 HOH HOH A . 
J 5 HOH 631 1431 1431 HOH HOH A . 
J 5 HOH 632 1432 1432 HOH HOH A . 
J 5 HOH 633 1433 1433 HOH HOH A . 
J 5 HOH 634 1434 1434 HOH HOH A . 
J 5 HOH 635 1435 1435 HOH HOH A . 
J 5 HOH 636 1436 1436 HOH HOH A . 
J 5 HOH 637 1437 1437 HOH HOH A . 
J 5 HOH 638 1438 1438 HOH HOH A . 
J 5 HOH 639 1439 1439 HOH HOH A . 
J 5 HOH 640 1440 1440 HOH HOH A . 
J 5 HOH 641 1441 1441 HOH HOH A . 
J 5 HOH 642 1442 1442 HOH HOH A . 
J 5 HOH 643 1443 1443 HOH HOH A . 
J 5 HOH 644 1444 1444 HOH HOH A . 
J 5 HOH 645 1445 1445 HOH HOH A . 
J 5 HOH 646 1446 1446 HOH HOH A . 
J 5 HOH 647 1447 1447 HOH HOH A . 
J 5 HOH 648 1448 1448 HOH HOH A . 
J 5 HOH 649 1449 1449 HOH HOH A . 
J 5 HOH 650 1450 1450 HOH HOH A . 
J 5 HOH 651 1451 1451 HOH HOH A . 
J 5 HOH 652 1452 1452 HOH HOH A . 
J 5 HOH 653 1453 1453 HOH HOH A . 
J 5 HOH 654 1454 1454 HOH HOH A . 
J 5 HOH 655 1455 1455 HOH HOH A . 
J 5 HOH 656 1456 1456 HOH HOH A . 
J 5 HOH 657 1457 1457 HOH HOH A . 
J 5 HOH 658 1458 1458 HOH HOH A . 
J 5 HOH 659 1459 1459 HOH HOH A . 
J 5 HOH 660 1460 1460 HOH HOH A . 
J 5 HOH 661 1461 1461 HOH HOH A . 
J 5 HOH 662 1462 1462 HOH HOH A . 
J 5 HOH 663 1463 1463 HOH HOH A . 
J 5 HOH 664 1464 1464 HOH HOH A . 
J 5 HOH 665 1465 1465 HOH HOH A . 
J 5 HOH 666 1466 1466 HOH HOH A . 
J 5 HOH 667 1467 1467 HOH HOH A . 
J 5 HOH 668 1468 1468 HOH HOH A . 
J 5 HOH 669 1469 1469 HOH HOH A . 
J 5 HOH 670 1470 1470 HOH HOH A . 
J 5 HOH 671 1471 1471 HOH HOH A . 
J 5 HOH 672 1472 1472 HOH HOH A . 
J 5 HOH 673 1473 1473 HOH HOH A . 
J 5 HOH 674 1474 1474 HOH HOH A . 
J 5 HOH 675 1475 1475 HOH HOH A . 
J 5 HOH 676 1476 1476 HOH HOH A . 
J 5 HOH 677 1477 1477 HOH HOH A . 
J 5 HOH 678 1478 1478 HOH HOH A . 
J 5 HOH 679 1479 1479 HOH HOH A . 
J 5 HOH 680 1480 1480 HOH HOH A . 
J 5 HOH 681 1481 1481 HOH HOH A . 
J 5 HOH 682 1482 1482 HOH HOH A . 
J 5 HOH 683 1483 1483 HOH HOH A . 
J 5 HOH 684 1484 1484 HOH HOH A . 
J 5 HOH 685 1485 1485 HOH HOH A . 
J 5 HOH 686 1486 1486 HOH HOH A . 
J 5 HOH 687 1487 1487 HOH HOH A . 
J 5 HOH 688 1488 1488 HOH HOH A . 
J 5 HOH 689 1489 1489 HOH HOH A . 
J 5 HOH 690 1490 1490 HOH HOH A . 
J 5 HOH 691 1491 1491 HOH HOH A . 
J 5 HOH 692 1492 1492 HOH HOH A . 
J 5 HOH 693 1493 1493 HOH HOH A . 
J 5 HOH 694 1494 1494 HOH HOH A . 
J 5 HOH 695 1495 1495 HOH HOH A . 
J 5 HOH 696 1496 1496 HOH HOH A . 
J 5 HOH 697 1497 1497 HOH HOH A . 
J 5 HOH 698 1498 1498 HOH HOH A . 
J 5 HOH 699 1499 1499 HOH HOH A . 
J 5 HOH 700 1500 1500 HOH HOH A . 
J 5 HOH 701 1501 1501 HOH HOH A . 
J 5 HOH 702 1502 1502 HOH HOH A . 
J 5 HOH 703 1503 1503 HOH HOH A . 
J 5 HOH 704 1504 1504 HOH HOH A . 
J 5 HOH 705 1505 1505 HOH HOH A . 
J 5 HOH 706 1506 1506 HOH HOH A . 
J 5 HOH 707 1507 1507 HOH HOH A . 
J 5 HOH 708 1508 1508 HOH HOH A . 
J 5 HOH 709 1509 1509 HOH HOH A . 
J 5 HOH 710 1510 1510 HOH HOH A . 
J 5 HOH 711 1511 1511 HOH HOH A . 
J 5 HOH 712 1512 1512 HOH HOH A . 
J 5 HOH 713 1513 1513 HOH HOH A . 
J 5 HOH 714 1514 1514 HOH HOH A . 
J 5 HOH 715 1515 1515 HOH HOH A . 
J 5 HOH 716 1516 1516 HOH HOH A . 
J 5 HOH 717 1517 1517 HOH HOH A . 
J 5 HOH 718 1518 1518 HOH HOH A . 
J 5 HOH 719 1519 1519 HOH HOH A . 
J 5 HOH 720 1520 1520 HOH HOH A . 
J 5 HOH 721 1521 1521 HOH HOH A . 
J 5 HOH 722 1522 1522 HOH HOH A . 
J 5 HOH 723 1523 1523 HOH HOH A . 
J 5 HOH 724 1524 1524 HOH HOH A . 
J 5 HOH 725 1525 1525 HOH HOH A . 
J 5 HOH 726 1526 1526 HOH HOH A . 
J 5 HOH 727 1527 1527 HOH HOH A . 
J 5 HOH 728 1528 1528 HOH HOH A . 
J 5 HOH 729 1529 1529 HOH HOH A . 
J 5 HOH 730 1530 1530 HOH HOH A . 
J 5 HOH 731 1531 1531 HOH HOH A . 
J 5 HOH 732 1532 1532 HOH HOH A . 
J 5 HOH 733 1533 1533 HOH HOH A . 
J 5 HOH 734 1534 1534 HOH HOH A . 
J 5 HOH 735 1535 1535 HOH HOH A . 
J 5 HOH 736 1536 1536 HOH HOH A . 
J 5 HOH 737 1537 1537 HOH HOH A . 
J 5 HOH 738 1538 1538 HOH HOH A . 
J 5 HOH 739 1539 1539 HOH HOH A . 
J 5 HOH 740 1540 1540 HOH HOH A . 
J 5 HOH 741 1541 1541 HOH HOH A . 
J 5 HOH 742 1542 1542 HOH HOH A . 
J 5 HOH 743 1543 1543 HOH HOH A . 
J 5 HOH 744 1544 1544 HOH HOH A . 
J 5 HOH 745 1545 1545 HOH HOH A . 
J 5 HOH 746 1546 1546 HOH HOH A . 
J 5 HOH 747 1547 1547 HOH HOH A . 
J 5 HOH 748 1548 1548 HOH HOH A . 
J 5 HOH 749 1549 1549 HOH HOH A . 
J 5 HOH 750 1550 1550 HOH HOH A . 
J 5 HOH 751 1551 1551 HOH HOH A . 
J 5 HOH 752 1552 1552 HOH HOH A . 
J 5 HOH 753 1553 1553 HOH HOH A . 
J 5 HOH 754 1554 1554 HOH HOH A . 
J 5 HOH 755 1555 1555 HOH HOH A . 
J 5 HOH 756 1556 1556 HOH HOH A . 
J 5 HOH 757 1557 1557 HOH HOH A . 
J 5 HOH 758 1558 1558 HOH HOH A . 
J 5 HOH 759 1559 1559 HOH HOH A . 
J 5 HOH 760 1560 1560 HOH HOH A . 
J 5 HOH 761 1561 1561 HOH HOH A . 
J 5 HOH 762 1562 1562 HOH HOH A . 
J 5 HOH 763 1563 1563 HOH HOH A . 
J 5 HOH 764 1564 1564 HOH HOH A . 
J 5 HOH 765 1565 1565 HOH HOH A . 
J 5 HOH 766 1566 1566 HOH HOH A . 
J 5 HOH 767 1567 1567 HOH HOH A . 
J 5 HOH 768 1568 1568 HOH HOH A . 
J 5 HOH 769 1569 1569 HOH HOH A . 
J 5 HOH 770 1570 1570 HOH HOH A . 
J 5 HOH 771 1571 1571 HOH HOH A . 
J 5 HOH 772 1572 1572 HOH HOH A . 
J 5 HOH 773 1573 1573 HOH HOH A . 
J 5 HOH 774 1574 1574 HOH HOH A . 
J 5 HOH 775 1575 1575 HOH HOH A . 
J 5 HOH 776 1576 1576 HOH HOH A . 
J 5 HOH 777 1577 1577 HOH HOH A . 
J 5 HOH 778 1578 1578 HOH HOH A . 
J 5 HOH 779 1579 1579 HOH HOH A . 
J 5 HOH 780 1580 1580 HOH HOH A . 
J 5 HOH 781 1581 1581 HOH HOH A . 
J 5 HOH 782 1582 1582 HOH HOH A . 
J 5 HOH 783 1583 1583 HOH HOH A . 
J 5 HOH 784 1584 1584 HOH HOH A . 
J 5 HOH 785 1585 1585 HOH HOH A . 
J 5 HOH 786 1586 1586 HOH HOH A . 
J 5 HOH 787 1587 1587 HOH HOH A . 
J 5 HOH 788 1588 1588 HOH HOH A . 
J 5 HOH 789 1589 1589 HOH HOH A . 
J 5 HOH 790 1590 1590 HOH HOH A . 
J 5 HOH 791 1591 1591 HOH HOH A . 
J 5 HOH 792 1592 1592 HOH HOH A . 
J 5 HOH 793 1593 1593 HOH HOH A . 
J 5 HOH 794 1594 1594 HOH HOH A . 
J 5 HOH 795 1595 1595 HOH HOH A . 
J 5 HOH 796 1596 1596 HOH HOH A . 
J 5 HOH 797 1597 1597 HOH HOH A . 
J 5 HOH 798 1598 1598 HOH HOH A . 
J 5 HOH 799 1599 1599 HOH HOH A . 
J 5 HOH 800 1600 1600 HOH HOH A . 
J 5 HOH 801 1601 1601 HOH HOH A . 
J 5 HOH 802 1602 1602 HOH HOH A . 
J 5 HOH 803 1603 1603 HOH HOH A . 
J 5 HOH 804 1604 1604 HOH HOH A . 
J 5 HOH 805 1605 1605 HOH HOH A . 
J 5 HOH 806 1606 1606 HOH HOH A . 
J 5 HOH 807 1607 1607 HOH HOH A . 
J 5 HOH 808 1608 1608 HOH HOH A . 
J 5 HOH 809 1609 1609 HOH HOH A . 
J 5 HOH 810 1610 1610 HOH HOH A . 
J 5 HOH 811 1611 1611 HOH HOH A . 
J 5 HOH 812 1612 1612 HOH HOH A . 
J 5 HOH 813 1613 1613 HOH HOH A . 
J 5 HOH 814 1614 1614 HOH HOH A . 
J 5 HOH 815 1615 1615 HOH HOH A . 
J 5 HOH 816 1616 1616 HOH HOH A . 
J 5 HOH 817 1617 1617 HOH HOH A . 
J 5 HOH 818 1618 1618 HOH HOH A . 
J 5 HOH 819 1619 1619 HOH HOH A . 
J 5 HOH 820 1620 1620 HOH HOH A . 
J 5 HOH 821 1621 1621 HOH HOH A . 
J 5 HOH 822 1622 1622 HOH HOH A . 
J 5 HOH 823 1623 1623 HOH HOH A . 
J 5 HOH 824 1624 1624 HOH HOH A . 
J 5 HOH 825 1625 1625 HOH HOH A . 
J 5 HOH 826 1626 1626 HOH HOH A . 
J 5 HOH 827 1627 1627 HOH HOH A . 
J 5 HOH 828 1628 1628 HOH HOH A . 
J 5 HOH 829 1629 1629 HOH HOH A . 
J 5 HOH 830 1630 1630 HOH HOH A . 
J 5 HOH 831 1631 1631 HOH HOH A . 
J 5 HOH 832 1632 1632 HOH HOH A . 
J 5 HOH 833 1633 1633 HOH HOH A . 
J 5 HOH 834 1634 1634 HOH HOH A . 
J 5 HOH 835 1635 1635 HOH HOH A . 
J 5 HOH 836 1636 1636 HOH HOH A . 
J 5 HOH 837 1637 1637 HOH HOH A . 
J 5 HOH 838 1638 1638 HOH HOH A . 
J 5 HOH 839 1639 1639 HOH HOH A . 
J 5 HOH 840 1640 1640 HOH HOH A . 
J 5 HOH 841 1641 1641 HOH HOH A . 
J 5 HOH 842 1642 1642 HOH HOH A . 
J 5 HOH 843 1643 1643 HOH HOH A . 
J 5 HOH 844 1644 1644 HOH HOH A . 
J 5 HOH 845 1645 1645 HOH HOH A . 
J 5 HOH 846 1646 1646 HOH HOH A . 
J 5 HOH 847 1647 1647 HOH HOH A . 
J 5 HOH 848 1648 1648 HOH HOH A . 
J 5 HOH 849 1649 1649 HOH HOH A . 
J 5 HOH 850 1650 1650 HOH HOH A . 
J 5 HOH 851 1651 1651 HOH HOH A . 
J 5 HOH 852 1652 1652 HOH HOH A . 
J 5 HOH 853 1653 1653 HOH HOH A . 
J 5 HOH 854 1654 1654 HOH HOH A . 
J 5 HOH 855 1655 1655 HOH HOH A . 
J 5 HOH 856 1656 1656 HOH HOH A . 
J 5 HOH 857 1657 1657 HOH HOH A . 
J 5 HOH 858 1658 1658 HOH HOH A . 
J 5 HOH 859 1659 1659 HOH HOH A . 
J 5 HOH 860 1660 1660 HOH HOH A . 
J 5 HOH 861 1661 1661 HOH HOH A . 
J 5 HOH 862 1662 1662 HOH HOH A . 
J 5 HOH 863 1663 1663 HOH HOH A . 
J 5 HOH 864 1664 1664 HOH HOH A . 
J 5 HOH 865 1665 1665 HOH HOH A . 
J 5 HOH 866 1666 1666 HOH HOH A . 
J 5 HOH 867 1667 1667 HOH HOH A . 
J 5 HOH 868 1668 1668 HOH HOH A . 
J 5 HOH 869 1669 1669 HOH HOH A . 
J 5 HOH 870 1670 1670 HOH HOH A . 
J 5 HOH 871 1671 1671 HOH HOH A . 
J 5 HOH 872 1672 1672 HOH HOH A . 
J 5 HOH 873 1673 1673 HOH HOH A . 
J 5 HOH 874 1674 1674 HOH HOH A . 
J 5 HOH 875 1675 1675 HOH HOH A . 
J 5 HOH 876 1676 1676 HOH HOH A . 
J 5 HOH 877 1677 1677 HOH HOH A . 
J 5 HOH 878 1678 1678 HOH HOH A . 
J 5 HOH 879 1679 1679 HOH HOH A . 
J 5 HOH 880 1680 1680 HOH HOH A . 
J 5 HOH 881 1681 1681 HOH HOH A . 
J 5 HOH 882 1682 1682 HOH HOH A . 
J 5 HOH 883 1683 1683 HOH HOH A . 
J 5 HOH 884 1684 1684 HOH HOH A . 
J 5 HOH 885 1685 1685 HOH HOH A . 
J 5 HOH 886 1686 1686 HOH HOH A . 
J 5 HOH 887 1687 1687 HOH HOH A . 
#