data_1QHA
# 
_entry.id   1QHA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QHA         
RCSB  RCSB001049   
WWPDB D_1000001049 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QHA 
_pdbx_database_status.recvd_initial_deposition_date   1999-05-11 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rosano, C.'    1 
'Sabini, E.'    2 
'Deriu, D.'     3 
'Magnani, M.'   4 
'Bolognesi, M.' 5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'Binding of non-catalytic ATP to human hexokinase I highlights the structural components for enzyme-membrane association control.' 
'Structure Fold.Des.' 7 1427 1437 1999 FODEFH UK 0969-2126 1263 ? 10574795 '10.1016/S0969-2126(00)80032-5' 
1       'Expression, Purification and Preliminary Crystallographic Studies of Human Hexokinase I' 'Protein Pept.Lett.'  5 237  242 
1998 PPELEN NE 0929-8665 2077 ? ?        ?                               
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rosano, C.'     1  ? 
primary 'Sabini, E.'     2  ? 
primary 'Rizzi, M.'      3  ? 
primary 'Deriu, D.'      4  ? 
primary 'Murshudov, G.'  5  ? 
primary 'Bianchi, M.'    6  ? 
primary 'Serafini, G.'   7  ? 
primary 'Magnani, M.'    8  ? 
primary 'Bolognesi, M.'  9  ? 
1       'Sabini, E.'     10 ? 
1       'Rosano, C.'     11 ? 
1       'Capasso, C.'    12 ? 
1       'Rizzi, M.'      13 ? 
1       'Bolognesi, M.'  14 ? 
1       'Bianchi, M.'    15 ? 
1       'Serafini, G.'   16 ? 
1       'Bartolucci, E.' 17 ? 
1       'Magnani, M.'    18 ? 
# 
_cell.entry_id           1QHA 
_cell.length_a           83.590 
_cell.length_b           176.170 
_cell.length_c           86.760 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.53 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QHA 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (HEXOKINASE)'                        102624.055 2   2.7.1.1 ? ? 'COMPLEXED WITH ATP ANALOGUE AMP-PNP' 
2 non-polymer nat alpha-D-glucopyranose                         180.156    4   ?       ? ? ?                                     
3 non-polymer nat 6-O-phosphono-alpha-D-glucopyranose           260.136    4   ?       ? ? ?                                     
4 non-polymer syn 'MAGNESIUM ION'                               24.305     6   ?       ? ? ?                                     
5 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196    2   ?       ? ? ?                                     
6 water       nat water                                         18.015     460 ?       ? ? ?                                     
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDF
IALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQ
SKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLF
EGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDN
KGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT
KDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIY
AIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDA
IKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDD
IRTHYDRLVNEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQV
RAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVK
ELSPKCNVSFLLSEDGSGKGAALITAVGVRLRTEASS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDF
IALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQ
SKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLF
EGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDN
KGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT
KDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIY
AIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDA
IKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDD
IRTHYDRLVNEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQV
RAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVK
ELSPKCNVSFLLSEDGSGKGAALITAVGVRLRTEASS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ILE n 
1 3   ALA n 
1 4   ALA n 
1 5   GLN n 
1 6   LEU n 
1 7   LEU n 
1 8   ALA n 
1 9   TYR n 
1 10  TYR n 
1 11  PHE n 
1 12  THR n 
1 13  GLU n 
1 14  LEU n 
1 15  LYS n 
1 16  ASP n 
1 17  ASP n 
1 18  GLN n 
1 19  VAL n 
1 20  LYS n 
1 21  LYS n 
1 22  ILE n 
1 23  ASP n 
1 24  LYS n 
1 25  TYR n 
1 26  LEU n 
1 27  TYR n 
1 28  ALA n 
1 29  MET n 
1 30  ARG n 
1 31  LEU n 
1 32  SER n 
1 33  ASP n 
1 34  GLU n 
1 35  THR n 
1 36  LEU n 
1 37  ILE n 
1 38  ASP n 
1 39  ILE n 
1 40  MET n 
1 41  THR n 
1 42  ARG n 
1 43  PHE n 
1 44  ARG n 
1 45  LYS n 
1 46  GLU n 
1 47  MET n 
1 48  LYS n 
1 49  ASN n 
1 50  GLY n 
1 51  LEU n 
1 52  SER n 
1 53  ARG n 
1 54  ASP n 
1 55  PHE n 
1 56  ASN n 
1 57  PRO n 
1 58  THR n 
1 59  ALA n 
1 60  THR n 
1 61  VAL n 
1 62  LYS n 
1 63  MET n 
1 64  LEU n 
1 65  PRO n 
1 66  THR n 
1 67  PHE n 
1 68  VAL n 
1 69  ARG n 
1 70  SER n 
1 71  ILE n 
1 72  PRO n 
1 73  ASP n 
1 74  GLY n 
1 75  SER n 
1 76  GLU n 
1 77  LYS n 
1 78  GLY n 
1 79  ASP n 
1 80  PHE n 
1 81  ILE n 
1 82  ALA n 
1 83  LEU n 
1 84  ASP n 
1 85  LEU n 
1 86  GLY n 
1 87  GLY n 
1 88  SER n 
1 89  SER n 
1 90  PHE n 
1 91  ARG n 
1 92  ILE n 
1 93  LEU n 
1 94  ARG n 
1 95  VAL n 
1 96  GLN n 
1 97  VAL n 
1 98  ASN n 
1 99  HIS n 
1 100 GLU n 
1 101 LYS n 
1 102 ASN n 
1 103 GLN n 
1 104 ASN n 
1 105 VAL n 
1 106 HIS n 
1 107 MET n 
1 108 GLU n 
1 109 SER n 
1 110 GLU n 
1 111 VAL n 
1 112 TYR n 
1 113 ASP n 
1 114 THR n 
1 115 PRO n 
1 116 GLU n 
1 117 ASN n 
1 118 ILE n 
1 119 VAL n 
1 120 HIS n 
1 121 GLY n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 GLN n 
1 126 LEU n 
1 127 PHE n 
1 128 ASP n 
1 129 HIS n 
1 130 VAL n 
1 131 ALA n 
1 132 GLU n 
1 133 CYS n 
1 134 LEU n 
1 135 GLY n 
1 136 ASP n 
1 137 PHE n 
1 138 MET n 
1 139 GLU n 
1 140 LYS n 
1 141 ARG n 
1 142 LYS n 
1 143 ILE n 
1 144 LYS n 
1 145 ASP n 
1 146 LYS n 
1 147 LYS n 
1 148 LEU n 
1 149 PRO n 
1 150 VAL n 
1 151 GLY n 
1 152 PHE n 
1 153 THR n 
1 154 PHE n 
1 155 SER n 
1 156 PHE n 
1 157 PRO n 
1 158 CYS n 
1 159 GLN n 
1 160 GLN n 
1 161 SER n 
1 162 LYS n 
1 163 ILE n 
1 164 ASP n 
1 165 GLU n 
1 166 ALA n 
1 167 ILE n 
1 168 LEU n 
1 169 ILE n 
1 170 THR n 
1 171 TRP n 
1 172 THR n 
1 173 LYS n 
1 174 ARG n 
1 175 PHE n 
1 176 LYS n 
1 177 ALA n 
1 178 SER n 
1 179 GLY n 
1 180 VAL n 
1 181 GLU n 
1 182 GLY n 
1 183 ALA n 
1 184 ASP n 
1 185 VAL n 
1 186 VAL n 
1 187 LYS n 
1 188 LEU n 
1 189 LEU n 
1 190 ASN n 
1 191 LYS n 
1 192 ALA n 
1 193 ILE n 
1 194 LYS n 
1 195 LYS n 
1 196 ARG n 
1 197 GLY n 
1 198 ASP n 
1 199 TYR n 
1 200 ASP n 
1 201 ALA n 
1 202 ASN n 
1 203 ILE n 
1 204 VAL n 
1 205 ALA n 
1 206 VAL n 
1 207 VAL n 
1 208 ASN n 
1 209 ASP n 
1 210 THR n 
1 211 VAL n 
1 212 GLY n 
1 213 THR n 
1 214 MET n 
1 215 MET n 
1 216 THR n 
1 217 CYS n 
1 218 GLY n 
1 219 TYR n 
1 220 ASP n 
1 221 ASP n 
1 222 GLN n 
1 223 HIS n 
1 224 CYS n 
1 225 GLU n 
1 226 VAL n 
1 227 GLY n 
1 228 LEU n 
1 229 ILE n 
1 230 ILE n 
1 231 GLY n 
1 232 THR n 
1 233 GLY n 
1 234 THR n 
1 235 ASN n 
1 236 ALA n 
1 237 CYS n 
1 238 TYR n 
1 239 MET n 
1 240 GLU n 
1 241 GLU n 
1 242 LEU n 
1 243 ARG n 
1 244 HIS n 
1 245 ILE n 
1 246 ASP n 
1 247 LEU n 
1 248 VAL n 
1 249 GLU n 
1 250 GLY n 
1 251 ASP n 
1 252 GLU n 
1 253 GLY n 
1 254 ARG n 
1 255 MET n 
1 256 CYS n 
1 257 ILE n 
1 258 ASN n 
1 259 THR n 
1 260 GLU n 
1 261 TRP n 
1 262 GLY n 
1 263 ALA n 
1 264 PHE n 
1 265 GLY n 
1 266 ASP n 
1 267 ASP n 
1 268 GLY n 
1 269 SER n 
1 270 LEU n 
1 271 GLU n 
1 272 ASP n 
1 273 ILE n 
1 274 ARG n 
1 275 THR n 
1 276 GLU n 
1 277 PHE n 
1 278 ASP n 
1 279 ARG n 
1 280 GLU n 
1 281 ILE n 
1 282 ASP n 
1 283 ARG n 
1 284 GLY n 
1 285 SER n 
1 286 LEU n 
1 287 ASN n 
1 288 PRO n 
1 289 GLY n 
1 290 LYS n 
1 291 GLN n 
1 292 LEU n 
1 293 PHE n 
1 294 GLU n 
1 295 LYS n 
1 296 MET n 
1 297 VAL n 
1 298 SER n 
1 299 GLY n 
1 300 MET n 
1 301 TYR n 
1 302 LEU n 
1 303 GLY n 
1 304 GLU n 
1 305 LEU n 
1 306 VAL n 
1 307 ARG n 
1 308 LEU n 
1 309 ILE n 
1 310 LEU n 
1 311 VAL n 
1 312 LYS n 
1 313 MET n 
1 314 ALA n 
1 315 LYS n 
1 316 GLU n 
1 317 GLY n 
1 318 LEU n 
1 319 LEU n 
1 320 PHE n 
1 321 GLU n 
1 322 GLY n 
1 323 ARG n 
1 324 ILE n 
1 325 THR n 
1 326 PRO n 
1 327 GLU n 
1 328 LEU n 
1 329 LEU n 
1 330 THR n 
1 331 ARG n 
1 332 GLY n 
1 333 LYS n 
1 334 PHE n 
1 335 ASN n 
1 336 THR n 
1 337 SER n 
1 338 ASP n 
1 339 VAL n 
1 340 SER n 
1 341 ALA n 
1 342 ILE n 
1 343 GLU n 
1 344 LYS n 
1 345 ASN n 
1 346 LYS n 
1 347 GLU n 
1 348 GLY n 
1 349 LEU n 
1 350 HIS n 
1 351 ASN n 
1 352 ALA n 
1 353 LYS n 
1 354 GLU n 
1 355 ILE n 
1 356 LEU n 
1 357 THR n 
1 358 ARG n 
1 359 LEU n 
1 360 GLY n 
1 361 VAL n 
1 362 GLU n 
1 363 PRO n 
1 364 SER n 
1 365 ASP n 
1 366 ASP n 
1 367 ASP n 
1 368 CYS n 
1 369 VAL n 
1 370 SER n 
1 371 VAL n 
1 372 GLN n 
1 373 HIS n 
1 374 VAL n 
1 375 CYS n 
1 376 THR n 
1 377 ILE n 
1 378 VAL n 
1 379 SER n 
1 380 PHE n 
1 381 ARG n 
1 382 SER n 
1 383 ALA n 
1 384 ASN n 
1 385 LEU n 
1 386 VAL n 
1 387 ALA n 
1 388 ALA n 
1 389 THR n 
1 390 LEU n 
1 391 GLY n 
1 392 ALA n 
1 393 ILE n 
1 394 LEU n 
1 395 ASN n 
1 396 ARG n 
1 397 LEU n 
1 398 ARG n 
1 399 ASP n 
1 400 ASN n 
1 401 LYS n 
1 402 GLY n 
1 403 THR n 
1 404 PRO n 
1 405 ARG n 
1 406 LEU n 
1 407 ARG n 
1 408 THR n 
1 409 THR n 
1 410 VAL n 
1 411 GLY n 
1 412 VAL n 
1 413 ASP n 
1 414 GLY n 
1 415 SER n 
1 416 LEU n 
1 417 TYR n 
1 418 LYS n 
1 419 THR n 
1 420 HIS n 
1 421 PRO n 
1 422 GLN n 
1 423 TYR n 
1 424 SER n 
1 425 ARG n 
1 426 ARG n 
1 427 PHE n 
1 428 HIS n 
1 429 LYS n 
1 430 THR n 
1 431 LEU n 
1 432 ARG n 
1 433 ARG n 
1 434 LEU n 
1 435 VAL n 
1 436 PRO n 
1 437 ASP n 
1 438 SER n 
1 439 ASP n 
1 440 VAL n 
1 441 ARG n 
1 442 PHE n 
1 443 LEU n 
1 444 LEU n 
1 445 SER n 
1 446 GLU n 
1 447 SER n 
1 448 GLY n 
1 449 SER n 
1 450 GLY n 
1 451 LYS n 
1 452 GLY n 
1 453 ALA n 
1 454 ALA n 
1 455 MET n 
1 456 VAL n 
1 457 THR n 
1 458 ALA n 
1 459 VAL n 
1 460 ALA n 
1 461 TYR n 
1 462 ARG n 
1 463 LEU n 
1 464 ALA n 
1 465 GLU n 
1 466 GLN n 
1 467 HIS n 
1 468 ARG n 
1 469 GLN n 
1 470 ILE n 
1 471 GLU n 
1 472 GLU n 
1 473 THR n 
1 474 LEU n 
1 475 ALA n 
1 476 HIS n 
1 477 PHE n 
1 478 HIS n 
1 479 LEU n 
1 480 THR n 
1 481 LYS n 
1 482 ASP n 
1 483 MET n 
1 484 LEU n 
1 485 LEU n 
1 486 GLU n 
1 487 VAL n 
1 488 LYS n 
1 489 LYS n 
1 490 ARG n 
1 491 MET n 
1 492 ARG n 
1 493 ALA n 
1 494 GLU n 
1 495 MET n 
1 496 GLU n 
1 497 LEU n 
1 498 GLY n 
1 499 LEU n 
1 500 ARG n 
1 501 LYS n 
1 502 GLN n 
1 503 THR n 
1 504 HIS n 
1 505 ASN n 
1 506 ASN n 
1 507 ALA n 
1 508 VAL n 
1 509 VAL n 
1 510 LYS n 
1 511 MET n 
1 512 LEU n 
1 513 PRO n 
1 514 SER n 
1 515 PHE n 
1 516 VAL n 
1 517 ARG n 
1 518 ARG n 
1 519 THR n 
1 520 PRO n 
1 521 ASP n 
1 522 GLY n 
1 523 THR n 
1 524 GLU n 
1 525 ASN n 
1 526 GLY n 
1 527 ASP n 
1 528 PHE n 
1 529 LEU n 
1 530 ALA n 
1 531 LEU n 
1 532 ASP n 
1 533 LEU n 
1 534 GLY n 
1 535 GLY n 
1 536 THR n 
1 537 ASN n 
1 538 PHE n 
1 539 ARG n 
1 540 VAL n 
1 541 LEU n 
1 542 LEU n 
1 543 VAL n 
1 544 LYS n 
1 545 ILE n 
1 546 ARG n 
1 547 SER n 
1 548 GLY n 
1 549 LYS n 
1 550 LYS n 
1 551 ARG n 
1 552 THR n 
1 553 VAL n 
1 554 GLU n 
1 555 MET n 
1 556 HIS n 
1 557 ASN n 
1 558 LYS n 
1 559 ILE n 
1 560 TYR n 
1 561 ALA n 
1 562 ILE n 
1 563 PRO n 
1 564 ILE n 
1 565 GLU n 
1 566 ILE n 
1 567 MET n 
1 568 GLN n 
1 569 GLY n 
1 570 THR n 
1 571 GLY n 
1 572 GLU n 
1 573 GLU n 
1 574 LEU n 
1 575 PHE n 
1 576 ASP n 
1 577 HIS n 
1 578 ILE n 
1 579 VAL n 
1 580 SER n 
1 581 CYS n 
1 582 ILE n 
1 583 SER n 
1 584 ASP n 
1 585 PHE n 
1 586 LEU n 
1 587 ASP n 
1 588 TYR n 
1 589 MET n 
1 590 GLY n 
1 591 ILE n 
1 592 LYS n 
1 593 GLY n 
1 594 PRO n 
1 595 ARG n 
1 596 MET n 
1 597 PRO n 
1 598 LEU n 
1 599 GLY n 
1 600 PHE n 
1 601 THR n 
1 602 PHE n 
1 603 SER n 
1 604 PHE n 
1 605 PRO n 
1 606 CYS n 
1 607 GLN n 
1 608 GLN n 
1 609 THR n 
1 610 SER n 
1 611 LEU n 
1 612 ASP n 
1 613 ALA n 
1 614 GLY n 
1 615 ILE n 
1 616 LEU n 
1 617 ILE n 
1 618 THR n 
1 619 TRP n 
1 620 THR n 
1 621 LYS n 
1 622 GLY n 
1 623 PHE n 
1 624 LYS n 
1 625 ALA n 
1 626 THR n 
1 627 ASP n 
1 628 CYS n 
1 629 VAL n 
1 630 GLY n 
1 631 HIS n 
1 632 ASP n 
1 633 VAL n 
1 634 VAL n 
1 635 THR n 
1 636 LEU n 
1 637 LEU n 
1 638 ARG n 
1 639 ASP n 
1 640 ALA n 
1 641 ILE n 
1 642 LYS n 
1 643 ARG n 
1 644 ARG n 
1 645 GLU n 
1 646 GLU n 
1 647 PHE n 
1 648 ASP n 
1 649 LEU n 
1 650 ASP n 
1 651 VAL n 
1 652 VAL n 
1 653 ALA n 
1 654 VAL n 
1 655 VAL n 
1 656 ASN n 
1 657 ASP n 
1 658 THR n 
1 659 VAL n 
1 660 GLY n 
1 661 THR n 
1 662 MET n 
1 663 MET n 
1 664 THR n 
1 665 CYS n 
1 666 ALA n 
1 667 TYR n 
1 668 GLU n 
1 669 GLU n 
1 670 PRO n 
1 671 THR n 
1 672 CYS n 
1 673 GLU n 
1 674 VAL n 
1 675 GLY n 
1 676 LEU n 
1 677 ILE n 
1 678 VAL n 
1 679 GLY n 
1 680 THR n 
1 681 GLY n 
1 682 SER n 
1 683 ASN n 
1 684 ALA n 
1 685 CYS n 
1 686 TYR n 
1 687 MET n 
1 688 GLU n 
1 689 GLU n 
1 690 MET n 
1 691 LYS n 
1 692 ASN n 
1 693 VAL n 
1 694 GLU n 
1 695 MET n 
1 696 VAL n 
1 697 GLU n 
1 698 GLY n 
1 699 ASP n 
1 700 GLN n 
1 701 GLY n 
1 702 GLN n 
1 703 MET n 
1 704 CYS n 
1 705 ILE n 
1 706 ASN n 
1 707 MET n 
1 708 GLU n 
1 709 TRP n 
1 710 GLY n 
1 711 ALA n 
1 712 PHE n 
1 713 GLY n 
1 714 ASP n 
1 715 ASN n 
1 716 GLY n 
1 717 CYS n 
1 718 LEU n 
1 719 ASP n 
1 720 ASP n 
1 721 ILE n 
1 722 ARG n 
1 723 THR n 
1 724 HIS n 
1 725 TYR n 
1 726 ASP n 
1 727 ARG n 
1 728 LEU n 
1 729 VAL n 
1 730 ASN n 
1 731 GLU n 
1 732 TYR n 
1 733 SER n 
1 734 LEU n 
1 735 ASN n 
1 736 ALA n 
1 737 GLY n 
1 738 LYS n 
1 739 GLN n 
1 740 ARG n 
1 741 TYR n 
1 742 GLU n 
1 743 LYS n 
1 744 MET n 
1 745 ILE n 
1 746 SER n 
1 747 GLY n 
1 748 MET n 
1 749 TYR n 
1 750 LEU n 
1 751 GLY n 
1 752 GLU n 
1 753 ILE n 
1 754 VAL n 
1 755 ARG n 
1 756 ASN n 
1 757 ILE n 
1 758 LEU n 
1 759 ILE n 
1 760 ASP n 
1 761 PHE n 
1 762 THR n 
1 763 LYS n 
1 764 LYS n 
1 765 GLY n 
1 766 PHE n 
1 767 LEU n 
1 768 PHE n 
1 769 ARG n 
1 770 GLY n 
1 771 GLN n 
1 772 ILE n 
1 773 SER n 
1 774 GLU n 
1 775 THR n 
1 776 LEU n 
1 777 LYS n 
1 778 THR n 
1 779 ARG n 
1 780 GLY n 
1 781 ILE n 
1 782 PHE n 
1 783 GLU n 
1 784 THR n 
1 785 LYS n 
1 786 PHE n 
1 787 LEU n 
1 788 SER n 
1 789 GLN n 
1 790 ILE n 
1 791 GLU n 
1 792 SER n 
1 793 ASP n 
1 794 ARG n 
1 795 LEU n 
1 796 ALA n 
1 797 LEU n 
1 798 LEU n 
1 799 GLN n 
1 800 VAL n 
1 801 ARG n 
1 802 ALA n 
1 803 ILE n 
1 804 LEU n 
1 805 GLN n 
1 806 GLN n 
1 807 LEU n 
1 808 GLY n 
1 809 LEU n 
1 810 ASN n 
1 811 SER n 
1 812 THR n 
1 813 CYS n 
1 814 ASP n 
1 815 ASP n 
1 816 SER n 
1 817 ILE n 
1 818 LEU n 
1 819 VAL n 
1 820 LYS n 
1 821 THR n 
1 822 VAL n 
1 823 CYS n 
1 824 GLY n 
1 825 VAL n 
1 826 VAL n 
1 827 SER n 
1 828 ARG n 
1 829 ARG n 
1 830 ALA n 
1 831 ALA n 
1 832 GLN n 
1 833 LEU n 
1 834 CYS n 
1 835 GLY n 
1 836 ALA n 
1 837 GLY n 
1 838 MET n 
1 839 ALA n 
1 840 ALA n 
1 841 VAL n 
1 842 VAL n 
1 843 ASP n 
1 844 LYS n 
1 845 ILE n 
1 846 ARG n 
1 847 GLU n 
1 848 ASN n 
1 849 ARG n 
1 850 GLY n 
1 851 LEU n 
1 852 ASP n 
1 853 ARG n 
1 854 LEU n 
1 855 ASN n 
1 856 VAL n 
1 857 THR n 
1 858 VAL n 
1 859 GLY n 
1 860 VAL n 
1 861 ASP n 
1 862 GLY n 
1 863 THR n 
1 864 LEU n 
1 865 TYR n 
1 866 LYS n 
1 867 LEU n 
1 868 HIS n 
1 869 PRO n 
1 870 HIS n 
1 871 PHE n 
1 872 SER n 
1 873 ARG n 
1 874 ILE n 
1 875 MET n 
1 876 HIS n 
1 877 GLN n 
1 878 THR n 
1 879 VAL n 
1 880 LYS n 
1 881 GLU n 
1 882 LEU n 
1 883 SER n 
1 884 PRO n 
1 885 LYS n 
1 886 CYS n 
1 887 ASN n 
1 888 VAL n 
1 889 SER n 
1 890 PHE n 
1 891 LEU n 
1 892 LEU n 
1 893 SER n 
1 894 GLU n 
1 895 ASP n 
1 896 GLY n 
1 897 SER n 
1 898 GLY n 
1 899 LYS n 
1 900 GLY n 
1 901 ALA n 
1 902 ALA n 
1 903 LEU n 
1 904 ILE n 
1 905 THR n 
1 906 ALA n 
1 907 VAL n 
1 908 GLY n 
1 909 VAL n 
1 910 ARG n 
1 911 LEU n 
1 912 ARG n 
1 913 THR n 
1 914 GLU n 
1 915 ALA n 
1 916 SER n 
1 917 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HXK1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P19367 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1QHA A 1 ? 917 ? P19367 1 ? 917 ? 1 917 
2 1 1QHA B 1 ? 917 ? P19367 1 ? 917 ? 1 917 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1QHA LEU A 776 ? UNP P19367 MET 776 conflict 776 1 
2 1QHA LEU B 776 ? UNP P19367 MET 776 conflict 776 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ANP non-polymer                   . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ? 'C10 H17 N6 O12 P3' 506.196 
ARG 'L-peptide linking'           y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking'           y CYSTEINE                                      ? 'C3 H7 N O2 S'      121.158 
G6P 'D-saccharide, alpha linking' n 6-O-phosphono-alpha-D-glucopyranose           ? 'C6 H13 O9 P'       260.136 
GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose                         ? 'C6 H12 O6'         180.156 
GLN 'L-peptide linking'           y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'             y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking'           y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer                   . WATER                                         ? 'H2 O'              18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking'           y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking'           y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking'           y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer                   . 'MAGNESIUM ION'                               ? 'Mg 2'              24.305  
PHE 'L-peptide linking'           y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking'           y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking'           y SERINE                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking'           y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking'           y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking'           y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1QHA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.11 
_exptl_crystal.density_percent_sol   60.47 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'pH 6.5' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1999-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.936 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        ESRF 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             0.936 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QHA 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             38.0 
_reflns.d_resolution_high            2.25 
_reflns.number_obs                   102729 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         86.6 
_reflns.pdbx_Rmerge_I_obs            0.050 
_reflns.pdbx_Rsym_value              0.097 
_reflns.pdbx_netI_over_sigmaI        8.0 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.0 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.25 
_reflns_shell.d_res_low              2.3 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    6.8 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1QHA 
_refine.ls_number_reflns_obs                     96872 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             12 
_refine.ls_d_res_high                            2.25 
_refine.ls_percent_reflns_obs                    85 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2080000 
_refine.ls_R_factor_R_free                       0.2790000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5 
_refine.ls_number_reflns_R_free                  5081 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1HKB 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        14097 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         180 
_refine_hist.number_atoms_solvent             460 
_refine_hist.number_atoms_total               14737 
_refine_hist.d_res_high                       2.25 
_refine_hist.d_res_low                        12 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.037 ? ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.039 ? ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1QHA 
_struct.title                     'HUMAN HEXOKINASE TYPE I COMPLEXED WITH ATP ANALOGUE AMP-PNP' 
_struct.pdbx_descriptor           'HEXOKINASE I (E.C.2.7.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QHA 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'KINASE, GLYCOLYSIS, PHOSPHOTRANSFERASE, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 5 ? 
K N N 2 ? 
L N N 3 ? 
M N N 2 ? 
N N N 3 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 5 ? 
S N N 6 ? 
T N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 18  ? TYR A 25  ? GLN A 18  TYR A 25  1 ? 8  
HELX_P HELX_P2  2  TYR A 27  ? MET A 29  ? TYR A 27  MET A 29  5 ? 3  
HELX_P HELX_P3  3  ASP A 33  ? LEU A 51  ? ASP A 33  LEU A 51  1 ? 19 
HELX_P HELX_P4  4  GLU A 116 ? VAL A 119 ? GLU A 116 VAL A 119 1 ? 4  
HELX_P HELX_P5  5  GLY A 123 ? LYS A 140 ? GLY A 123 LYS A 140 1 ? 18 
HELX_P HELX_P6  6  VAL A 185 ? ARG A 196 ? VAL A 185 ARG A 196 1 ? 12 
HELX_P HELX_P7  7  ASP A 209 ? ASP A 220 ? ASP A 209 ASP A 220 1 ? 12 
HELX_P HELX_P8  8  LEU A 242 ? HIS A 244 ? LEU A 242 HIS A 244 5 ? 3  
HELX_P HELX_P9  9  TRP A 261 ? ALA A 263 ? TRP A 261 ALA A 263 5 ? 3  
HELX_P HELX_P10 10 GLU A 276 ? GLY A 284 ? GLU A 276 GLY A 284 1 ? 9  
HELX_P HELX_P11 11 GLU A 294 ? VAL A 297 ? GLU A 294 VAL A 297 1 ? 4  
HELX_P HELX_P12 12 GLY A 299 ? GLU A 316 ? GLY A 299 GLU A 316 1 ? 18 
HELX_P HELX_P13 13 PHE A 320 ? GLY A 322 ? PHE A 320 GLY A 322 5 ? 3  
HELX_P HELX_P14 14 THR A 336 ? ILE A 342 ? THR A 336 ILE A 342 1 ? 7  
HELX_P HELX_P15 15 GLY A 348 ? LEU A 359 ? GLY A 348 LEU A 359 1 ? 12 
HELX_P HELX_P16 16 ASP A 365 ? LYS A 401 ? ASP A 365 LYS A 401 1 ? 37 
HELX_P HELX_P17 17 SER A 415 ? THR A 419 ? SER A 415 THR A 419 1 ? 5  
HELX_P HELX_P18 18 TYR A 423 ? LEU A 434 ? TYR A 423 LEU A 434 1 ? 12 
HELX_P HELX_P19 19 GLY A 450 ? PHE A 477 ? GLY A 450 PHE A 477 1 ? 28 
HELX_P HELX_P20 20 LYS A 481 ? LEU A 499 ? LYS A 481 LEU A 499 1 ? 19 
HELX_P HELX_P21 21 ILE A 564 ? MET A 567 ? ILE A 564 MET A 567 1 ? 4  
HELX_P HELX_P22 22 GLU A 572 ? TYR A 588 ? GLU A 572 TYR A 588 1 ? 17 
HELX_P HELX_P23 23 VAL A 633 ? ARG A 644 ? VAL A 633 ARG A 644 1 ? 12 
HELX_P HELX_P24 24 ASP A 657 ? TYR A 667 ? ASP A 657 TYR A 667 1 ? 11 
HELX_P HELX_P25 25 MET A 690 ? ASN A 692 ? MET A 690 ASN A 692 5 ? 3  
HELX_P HELX_P26 26 TRP A 709 ? ALA A 711 ? TRP A 709 ALA A 711 5 ? 3  
HELX_P HELX_P27 27 HIS A 724 ? GLU A 731 ? HIS A 724 GLU A 731 1 ? 8  
HELX_P HELX_P28 28 ARG A 740 ? MET A 744 ? ARG A 740 MET A 744 1 ? 5  
HELX_P HELX_P29 29 LEU A 750 ? LYS A 763 ? LEU A 750 LYS A 763 1 ? 14 
HELX_P HELX_P30 30 PHE A 768 ? GLY A 770 ? PHE A 768 GLY A 770 5 ? 3  
HELX_P HELX_P31 31 THR A 784 ? ILE A 790 ? THR A 784 ILE A 790 1 ? 7  
HELX_P HELX_P32 32 LEU A 797 ? LEU A 807 ? LEU A 797 LEU A 807 1 ? 11 
HELX_P HELX_P33 33 CYS A 813 ? ARG A 849 ? CYS A 813 ARG A 849 1 ? 37 
HELX_P HELX_P34 34 THR A 863 ? LEU A 867 ? THR A 863 LEU A 867 1 ? 5  
HELX_P HELX_P35 35 PHE A 871 ? LEU A 882 ? PHE A 871 LEU A 882 1 ? 12 
HELX_P HELX_P36 36 GLY A 898 ? ARG A 910 ? GLY A 898 ARG A 910 1 ? 13 
HELX_P HELX_P37 37 GLN B 18  ? TYR B 25  ? GLN B 18  TYR B 25  1 ? 8  
HELX_P HELX_P38 38 TYR B 27  ? MET B 29  ? TYR B 27  MET B 29  5 ? 3  
HELX_P HELX_P39 39 ASP B 33  ? LEU B 51  ? ASP B 33  LEU B 51  1 ? 19 
HELX_P HELX_P40 40 GLU B 116 ? VAL B 119 ? GLU B 116 VAL B 119 1 ? 4  
HELX_P HELX_P41 41 GLY B 123 ? LYS B 140 ? GLY B 123 LYS B 140 1 ? 18 
HELX_P HELX_P42 42 VAL B 185 ? LYS B 195 ? VAL B 185 LYS B 195 1 ? 11 
HELX_P HELX_P43 43 ASP B 209 ? ASP B 220 ? ASP B 209 ASP B 220 1 ? 12 
HELX_P HELX_P44 44 LEU B 242 ? HIS B 244 ? LEU B 242 HIS B 244 5 ? 3  
HELX_P HELX_P45 45 TRP B 261 ? ALA B 263 ? TRP B 261 ALA B 263 5 ? 3  
HELX_P HELX_P46 46 GLU B 276 ? GLY B 284 ? GLU B 276 GLY B 284 1 ? 9  
HELX_P HELX_P47 47 GLU B 294 ? MET B 296 ? GLU B 294 MET B 296 5 ? 3  
HELX_P HELX_P48 48 GLY B 299 ? LYS B 315 ? GLY B 299 LYS B 315 1 ? 17 
HELX_P HELX_P49 49 PHE B 320 ? GLY B 322 ? PHE B 320 GLY B 322 5 ? 3  
HELX_P HELX_P50 50 THR B 336 ? GLU B 343 ? THR B 336 GLU B 343 1 ? 8  
HELX_P HELX_P51 51 GLY B 348 ? ARG B 358 ? GLY B 348 ARG B 358 1 ? 11 
HELX_P HELX_P52 52 ASP B 365 ? LYS B 401 ? ASP B 365 LYS B 401 1 ? 37 
HELX_P HELX_P53 53 SER B 415 ? THR B 419 ? SER B 415 THR B 419 1 ? 5  
HELX_P HELX_P54 54 TYR B 423 ? LEU B 434 ? TYR B 423 LEU B 434 1 ? 12 
HELX_P HELX_P55 55 GLY B 450 ? PHE B 477 ? GLY B 450 PHE B 477 1 ? 28 
HELX_P HELX_P56 56 LYS B 481 ? LEU B 499 ? LYS B 481 LEU B 499 1 ? 19 
HELX_P HELX_P57 57 ILE B 564 ? MET B 567 ? ILE B 564 MET B 567 1 ? 4  
HELX_P HELX_P58 58 GLY B 571 ? TYR B 588 ? GLY B 571 TYR B 588 1 ? 18 
HELX_P HELX_P59 59 VAL B 633 ? ARG B 644 ? VAL B 633 ARG B 644 1 ? 12 
HELX_P HELX_P60 60 ASP B 657 ? ALA B 666 ? ASP B 657 ALA B 666 1 ? 10 
HELX_P HELX_P61 61 MET B 690 ? ASN B 692 ? MET B 690 ASN B 692 5 ? 3  
HELX_P HELX_P62 62 TRP B 709 ? ALA B 711 ? TRP B 709 ALA B 711 5 ? 3  
HELX_P HELX_P63 63 HIS B 724 ? GLU B 731 ? HIS B 724 GLU B 731 1 ? 8  
HELX_P HELX_P64 64 ARG B 740 ? MET B 744 ? ARG B 740 MET B 744 1 ? 5  
HELX_P HELX_P65 65 GLY B 747 ? LYS B 763 ? GLY B 747 LYS B 763 1 ? 17 
HELX_P HELX_P66 66 PHE B 768 ? GLY B 770 ? PHE B 768 GLY B 770 5 ? 3  
HELX_P HELX_P67 67 GLU B 774 ? LYS B 777 ? GLU B 774 LYS B 777 1 ? 4  
HELX_P HELX_P68 68 THR B 784 ? ILE B 790 ? THR B 784 ILE B 790 1 ? 7  
HELX_P HELX_P69 69 LEU B 797 ? LEU B 807 ? LEU B 797 LEU B 807 1 ? 11 
HELX_P HELX_P70 70 CYS B 813 ? ARG B 849 ? CYS B 813 ARG B 849 1 ? 37 
HELX_P HELX_P71 71 THR B 863 ? LEU B 867 ? THR B 863 LEU B 867 1 ? 5  
HELX_P HELX_P72 72 PHE B 871 ? LEU B 882 ? PHE B 871 LEU B 882 1 ? 12 
HELX_P HELX_P73 73 GLY B 898 ? ARG B 910 ? GLY B 898 ARG B 910 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A LEU 242 O  ? ? ? 1_555 G MG  . MG    ? ? A LEU 242  A MG  922  1_555 ? ? ? ? ? ? ? 3.059 ? ? 
metalc2  metalc ? ? A ILE 245 O  ? ? ? 1_555 G MG  . MG    ? ? A ILE 245  A MG  922  1_555 ? ? ? ? ? ? ? 2.594 ? ? 
metalc3  metalc ? ? A VAL 248 O  ? ? ? 1_555 G MG  . MG    ? ? A VAL 248  A MG  922  1_555 ? ? ? ? ? ? ? 2.415 ? ? 
metalc4  metalc ? ? A GLY 250 O  ? ? ? 1_555 G MG  . MG    ? ? A GLY 250  A MG  922  1_555 ? ? ? ? ? ? ? 2.637 ? ? 
metalc5  metalc ? ? A MET 690 O  ? ? ? 1_555 H MG  . MG    ? ? A MET 690  A MG  923  1_555 ? ? ? ? ? ? ? 2.886 ? ? 
metalc6  metalc ? ? A VAL 693 O  ? ? ? 1_555 H MG  . MG    ? ? A VAL 693  A MG  923  1_555 ? ? ? ? ? ? ? 2.874 ? ? 
metalc7  metalc ? ? A VAL 696 O  ? ? ? 1_555 H MG  . MG    ? ? A VAL 696  A MG  923  1_555 ? ? ? ? ? ? ? 2.498 ? ? 
metalc8  metalc ? ? A GLY 698 O  ? ? ? 1_555 H MG  . MG    ? ? A GLY 698  A MG  923  1_555 ? ? ? ? ? ? ? 2.800 ? ? 
metalc9  metalc ? ? B LEU 242 O  ? ? ? 1_555 P MG  . MG    ? ? B LEU 242  B MG  1920 1_555 ? ? ? ? ? ? ? 2.720 ? ? 
metalc10 metalc ? ? B ILE 245 O  ? ? ? 1_555 P MG  . MG    ? ? B ILE 245  B MG  1920 1_555 ? ? ? ? ? ? ? 2.768 ? ? 
metalc11 metalc ? ? B VAL 248 O  ? ? ? 1_555 P MG  . MG    ? ? B VAL 248  B MG  1920 1_555 ? ? ? ? ? ? ? 2.622 ? ? 
metalc12 metalc ? ? B GLY 250 O  ? ? ? 1_555 P MG  . MG    ? ? B GLY 250  B MG  1920 1_555 ? ? ? ? ? ? ? 2.633 ? ? 
metalc13 metalc ? ? B MET 690 O  ? ? ? 1_555 O MG  . MG    ? ? B MET 690  B MG  1919 1_555 ? ? ? ? ? ? ? 2.807 ? ? 
metalc14 metalc ? ? B VAL 693 O  ? ? ? 1_555 O MG  . MG    ? ? B VAL 693  B MG  1919 1_555 ? ? ? ? ? ? ? 2.744 ? ? 
metalc15 metalc ? ? B VAL 696 O  ? ? ? 1_555 O MG  . MG    ? ? B VAL 696  B MG  1919 1_555 ? ? ? ? ? ? ? 2.600 ? ? 
metalc16 metalc ? ? B GLY 698 O  ? ? ? 1_555 O MG  . MG    ? ? B GLY 698  B MG  1919 1_555 ? ? ? ? ? ? ? 2.713 ? ? 
metalc17 metalc ? ? P MG  .   MG ? ? ? 1_555 T HOH . O     ? ? B MG  1920 B HOH 2004 1_555 ? ? ? ? ? ? ? 3.071 ? ? 
metalc18 metalc ? ? Q MG  .   MG ? ? ? 1_555 R ANP . O3A   ? ? B MG  1921 B ANP 1999 1_555 ? ? ? ? ? ? ? 2.398 ? ? 
metalc19 metalc ? ? Q MG  .   MG ? ? ? 1_555 R ANP . "O5'" ? ? B MG  1921 B ANP 1999 1_555 ? ? ? ? ? ? ? 2.889 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 5 ? 
D ? 5 ? 
E ? 5 ? 
F ? 2 ? 
G ? 5 ? 
H ? 5 ? 
I ? 5 ? 
J ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? parallel      
F 1 2 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? parallel      
H 4 5 ? parallel      
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? parallel      
J 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 78  ? PHE A 80  ? GLY A 78  PHE A 80  
A 2 LEU A 93  ? VAL A 97  ? LEU A 93  VAL A 97  
A 3 HIS A 106 ? SER A 109 ? HIS A 106 SER A 109 
B 1 LEU A 83  ? LEU A 85  ? LEU A 83  LEU A 85  
B 2 PRO A 149 ? PHE A 154 ? PRO A 149 PHE A 154 
B 3 ASN A 202 ? VAL A 207 ? ASN A 202 VAL A 207 
C 1 ARG A 254 ? ASN A 258 ? ARG A 254 ASN A 258 
C 2 THR A 234 ? GLU A 241 ? THR A 234 GLU A 241 
C 3 CYS A 224 ? ILE A 230 ? CYS A 224 ILE A 230 
C 4 LEU A 406 ? ASP A 413 ? LEU A 406 ASP A 413 
C 5 SER A 438 ? LEU A 444 ? SER A 438 LEU A 444 
D 1 ASP A 650 ? VAL A 655 ? ASP A 650 VAL A 655 
D 2 PRO A 597 ? PHE A 602 ? PRO A 597 PHE A 602 
D 3 GLY A 526 ? LEU A 533 ? GLY A 526 LEU A 533 
D 4 PHE A 538 ? ARG A 546 ? PHE A 538 ARG A 546 
D 5 THR A 552 ? TYR A 560 ? THR A 552 TYR A 560 
E 1 GLN A 702 ? ASN A 706 ? GLN A 702 ASN A 706 
E 2 SER A 682 ? GLU A 689 ? SER A 682 GLU A 689 
E 3 CYS A 672 ? VAL A 678 ? CYS A 672 VAL A 678 
E 4 LEU A 854 ? ASP A 861 ? LEU A 854 ASP A 861 
E 5 CYS A 886 ? LEU A 892 ? CYS A 886 LEU A 892 
F 1 PRO A 157 ? GLN A 159 ? PRO A 157 GLN A 159 
F 2 ILE A 167 ? THR A 170 ? ILE A 167 THR A 170 
G 1 ASN B 202 ? VAL B 207 ? ASN B 202 VAL B 207 
G 2 PRO B 149 ? PHE B 154 ? PRO B 149 PHE B 154 
G 3 GLY B 78  ? LEU B 85  ? GLY B 78  LEU B 85  
G 4 PHE B 90  ? VAL B 97  ? PHE B 90  VAL B 97  
G 5 HIS B 106 ? TYR B 112 ? HIS B 106 TYR B 112 
H 1 ARG B 254 ? ASN B 258 ? ARG B 254 ASN B 258 
H 2 THR B 234 ? GLU B 241 ? THR B 234 GLU B 241 
H 3 CYS B 224 ? ILE B 230 ? CYS B 224 ILE B 230 
H 4 LEU B 406 ? ASP B 413 ? LEU B 406 ASP B 413 
H 5 SER B 438 ? LEU B 444 ? SER B 438 LEU B 444 
I 1 ASP B 650 ? VAL B 655 ? ASP B 650 VAL B 655 
I 2 PRO B 597 ? PHE B 602 ? PRO B 597 PHE B 602 
I 3 GLY B 526 ? LEU B 533 ? GLY B 526 LEU B 533 
I 4 PHE B 538 ? ARG B 546 ? PHE B 538 ARG B 546 
I 5 THR B 552 ? TYR B 560 ? THR B 552 TYR B 560 
J 1 GLN B 702 ? ASN B 706 ? GLN B 702 ASN B 706 
J 2 SER B 682 ? GLU B 689 ? SER B 682 GLU B 689 
J 3 CYS B 672 ? VAL B 678 ? CYS B 672 VAL B 678 
J 4 LEU B 854 ? ASP B 861 ? LEU B 854 ASP B 861 
J 5 CYS B 886 ? LEU B 892 ? CYS B 886 LEU B 892 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLY A 78  ? O GLY A 78  N VAL A 97  ? N VAL A 97  
A 2 3 O ARG A 94  ? O ARG A 94  N GLU A 108 ? N GLU A 108 
B 1 2 O LEU A 83  ? O LEU A 83  N THR A 153 ? N THR A 153 
B 2 3 O VAL A 150 ? O VAL A 150 N ASN A 202 ? N ASN A 202 
C 1 2 O MET A 255 ? O MET A 255 N GLU A 240 ? N GLU A 240 
C 2 3 O ASN A 235 ? O ASN A 235 N ILE A 229 ? N ILE A 229 
C 3 4 O GLU A 225 ? O GLU A 225 N THR A 409 ? N THR A 409 
C 4 5 O LEU A 406 ? O LEU A 406 N ASP A 439 ? N ASP A 439 
D 1 2 O ASP A 650 ? O ASP A 650 N LEU A 598 ? N LEU A 598 
D 2 3 O GLY A 599 ? O GLY A 599 N LEU A 529 ? N LEU A 529 
D 3 4 O GLY A 526 ? O GLY A 526 N ILE A 545 ? N ILE A 545 
D 4 5 O PHE A 538 ? O PHE A 538 N TYR A 560 ? N TYR A 560 
E 1 2 O MET A 703 ? O MET A 703 N GLU A 688 ? N GLU A 688 
E 2 3 O ASN A 683 ? O ASN A 683 N ILE A 677 ? N ILE A 677 
E 3 4 O GLU A 673 ? O GLU A 673 N THR A 857 ? N THR A 857 
E 4 5 O LEU A 854 ? O LEU A 854 N ASN A 887 ? N ASN A 887 
F 1 2 O PRO A 157 ? O PRO A 157 N THR A 170 ? N THR A 170 
G 1 2 O ASN B 202 ? O ASN B 202 N VAL B 150 ? N VAL B 150 
G 2 3 O GLY B 151 ? O GLY B 151 N ILE B 81  ? N ILE B 81  
G 3 4 O GLY B 78  ? O GLY B 78  N VAL B 97  ? N VAL B 97  
G 4 5 O PHE B 90  ? O PHE B 90  N TYR B 112 ? N TYR B 112 
H 1 2 O MET B 255 ? O MET B 255 N GLU B 240 ? N GLU B 240 
H 2 3 O ASN B 235 ? O ASN B 235 N ILE B 229 ? N ILE B 229 
H 3 4 O GLU B 225 ? O GLU B 225 N THR B 409 ? N THR B 409 
H 4 5 O LEU B 406 ? O LEU B 406 N ASP B 439 ? N ASP B 439 
I 1 2 O ASP B 650 ? O ASP B 650 N LEU B 598 ? N LEU B 598 
I 2 3 O GLY B 599 ? O GLY B 599 N LEU B 529 ? N LEU B 529 
I 3 4 O GLY B 526 ? O GLY B 526 N ILE B 545 ? N ILE B 545 
I 4 5 O PHE B 538 ? O PHE B 538 N TYR B 560 ? N TYR B 560 
J 1 2 O MET B 703 ? O MET B 703 N GLU B 688 ? N GLU B 688 
J 2 3 O ASN B 683 ? O ASN B 683 N ILE B 677 ? N ILE B 677 
J 3 4 O GLU B 673 ? O GLU B 673 N THR B 857 ? N THR B 857 
J 4 5 O LEU B 854 ? O LEU B 854 N ASN B 887 ? N ASN B 887 
# 
_database_PDB_matrix.entry_id          1QHA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QHA 
_atom_sites.fract_transf_matrix[1][1]   0.011963 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000111 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005676 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011526 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . THR A 1 12  ? 53.909  3.691   -43.637 1.00 58.64 ? 12   THR A N     1 
ATOM   2     C  CA    . THR A 1 12  ? 55.406  3.920   -43.648 1.00 58.27 ? 12   THR A CA    1 
ATOM   3     C  C     . THR A 1 12  ? 56.052  3.435   -42.348 1.00 60.81 ? 12   THR A C     1 
ATOM   4     O  O     . THR A 1 12  ? 55.982  2.353   -41.779 1.00 60.66 ? 12   THR A O     1 
ATOM   5     C  CB    . THR A 1 12  ? 55.400  5.459   -43.727 1.00 56.14 ? 12   THR A CB    1 
ATOM   6     O  OG1   . THR A 1 12  ? 54.054  5.861   -44.124 1.00 35.70 ? 12   THR A OG1   1 
ATOM   7     C  CG2   . THR A 1 12  ? 56.335  6.174   -44.671 1.00 60.76 ? 12   THR A CG2   1 
ATOM   8     N  N     . GLU A 1 13  ? 56.834  4.300   -41.732 1.00 62.51 ? 13   GLU A N     1 
ATOM   9     C  CA    . GLU A 1 13  ? 57.259  4.443   -40.369 1.00 62.84 ? 13   GLU A CA    1 
ATOM   10    C  C     . GLU A 1 13  ? 56.621  5.748   -39.827 1.00 63.15 ? 13   GLU A C     1 
ATOM   11    O  O     . GLU A 1 13  ? 57.041  6.846   -40.192 1.00 62.05 ? 13   GLU A O     1 
ATOM   12    C  CB    . GLU A 1 13  ? 58.774  4.657   -40.379 1.00 67.88 ? 13   GLU A CB    1 
ATOM   13    C  CG    . GLU A 1 13  ? 59.247  5.458   -39.169 1.00 73.40 ? 13   GLU A CG    1 
ATOM   14    C  CD    . GLU A 1 13  ? 59.714  4.480   -38.091 1.00 79.17 ? 13   GLU A CD    1 
ATOM   15    O  OE1   . GLU A 1 13  ? 59.921  3.298   -38.475 1.00 79.69 ? 13   GLU A OE1   1 
ATOM   16    O  OE2   . GLU A 1 13  ? 59.845  4.894   -36.912 1.00 79.99 ? 13   GLU A OE2   1 
ATOM   17    N  N     . LEU A 1 14  ? 55.480  5.661   -39.154 1.00 63.76 ? 14   LEU A N     1 
ATOM   18    C  CA    . LEU A 1 14  ? 54.793  6.831   -38.610 1.00 63.66 ? 14   LEU A CA    1 
ATOM   19    C  C     . LEU A 1 14  ? 55.591  7.526   -37.510 1.00 63.16 ? 14   LEU A C     1 
ATOM   20    O  O     . LEU A 1 14  ? 55.985  6.909   -36.517 1.00 62.63 ? 14   LEU A O     1 
ATOM   21    C  CB    . LEU A 1 14  ? 53.453  6.396   -38.008 1.00 61.65 ? 14   LEU A CB    1 
ATOM   22    C  CG    . LEU A 1 14  ? 52.276  6.263   -38.961 1.00 64.83 ? 14   LEU A CG    1 
ATOM   23    C  CD1   . LEU A 1 14  ? 52.734  5.942   -40.375 1.00 62.04 ? 14   LEU A CD1   1 
ATOM   24    C  CD2   . LEU A 1 14  ? 51.244  5.275   -38.439 1.00 64.55 ? 14   LEU A CD2   1 
ATOM   25    N  N     . LYS A 1 15  ? 55.769  8.838   -37.640 1.00 63.43 ? 15   LYS A N     1 
ATOM   26    C  CA    . LYS A 1 15  ? 56.477  9.555   -36.570 1.00 63.34 ? 15   LYS A CA    1 
ATOM   27    C  C     . LYS A 1 15  ? 55.529  10.336  -35.674 1.00 62.51 ? 15   LYS A C     1 
ATOM   28    O  O     . LYS A 1 15  ? 54.489  10.855  -36.097 1.00 61.43 ? 15   LYS A O     1 
ATOM   29    C  CB    . LYS A 1 15  ? 57.661  10.321  -37.137 1.00 66.45 ? 15   LYS A CB    1 
ATOM   30    C  CG    . LYS A 1 15  ? 58.829  9.384   -37.489 1.00 71.63 ? 15   LYS A CG    1 
ATOM   31    C  CD    . LYS A 1 15  ? 59.581  8.915   -36.248 1.00 73.05 ? 15   LYS A CD    1 
ATOM   32    C  CE    . LYS A 1 15  ? 60.032  7.466   -36.297 1.00 72.23 ? 15   LYS A CE    1 
ATOM   33    N  NZ    . LYS A 1 15  ? 60.941  7.210   -37.452 1.00 71.90 ? 15   LYS A NZ    1 
ATOM   34    N  N     . ASP A 1 16  ? 55.803  10.270  -34.363 1.00 61.70 ? 16   ASP A N     1 
ATOM   35    C  CA    . ASP A 1 16  ? 54.975  10.879  -33.349 1.00 60.93 ? 16   ASP A CA    1 
ATOM   36    C  C     . ASP A 1 16  ? 54.807  12.392  -33.534 1.00 59.10 ? 16   ASP A C     1 
ATOM   37    O  O     . ASP A 1 16  ? 55.812  13.073  -33.711 1.00 59.56 ? 16   ASP A O     1 
ATOM   38    C  CB    . ASP A 1 16  ? 55.535  10.722  -31.940 1.00 67.03 ? 16   ASP A CB    1 
ATOM   39    C  CG    . ASP A 1 16  ? 56.717  9.810   -31.715 1.00 72.68 ? 16   ASP A CG    1 
ATOM   40    O  OD1   . ASP A 1 16  ? 57.390  9.368   -32.681 1.00 71.52 ? 16   ASP A OD1   1 
ATOM   41    O  OD2   . ASP A 1 16  ? 56.943  9.538   -30.495 1.00 72.06 ? 16   ASP A OD2   1 
ATOM   42    N  N     . ASP A 1 17  ? 53.602  12.885  -33.352 1.00 56.93 ? 17   ASP A N     1 
ATOM   43    C  CA    . ASP A 1 17  ? 53.301  14.307  -33.246 1.00 55.07 ? 17   ASP A CA    1 
ATOM   44    C  C     . ASP A 1 17  ? 52.897  14.650  -31.807 1.00 52.79 ? 17   ASP A C     1 
ATOM   45    O  O     . ASP A 1 17  ? 53.047  13.771  -30.951 1.00 52.01 ? 17   ASP A O     1 
ATOM   46    C  CB    . ASP A 1 17  ? 52.182  14.672  -34.209 1.00 55.54 ? 17   ASP A CB    1 
ATOM   47    C  CG    . ASP A 1 17  ? 50.854  14.119  -33.750 1.00 55.40 ? 17   ASP A CG    1 
ATOM   48    O  OD1   . ASP A 1 17  ? 50.822  13.349  -32.771 1.00 56.87 ? 17   ASP A OD1   1 
ATOM   49    O  OD2   . ASP A 1 17  ? 49.840  14.484  -34.389 1.00 60.79 ? 17   ASP A OD2   1 
ATOM   50    N  N     . GLN A 1 18  ? 52.523  15.892  -31.510 1.00 51.15 ? 18   GLN A N     1 
ATOM   51    C  CA    . GLN A 1 18  ? 52.310  16.332  -30.129 1.00 48.92 ? 18   GLN A CA    1 
ATOM   52    C  C     . GLN A 1 18  ? 51.402  15.353  -29.374 1.00 46.18 ? 18   GLN A C     1 
ATOM   53    O  O     . GLN A 1 18  ? 51.674  14.810  -28.315 1.00 45.11 ? 18   GLN A O     1 
ATOM   54    C  CB    . GLN A 1 18  ? 51.740  17.740  -30.038 1.00 53.61 ? 18   GLN A CB    1 
ATOM   55    C  CG    . GLN A 1 18  ? 52.569  18.926  -30.408 1.00 62.47 ? 18   GLN A CG    1 
ATOM   56    C  CD    . GLN A 1 18  ? 53.881  19.147  -29.695 1.00 66.01 ? 18   GLN A CD    1 
ATOM   57    O  OE1   . GLN A 1 18  ? 54.776  18.293  -29.634 1.00 68.22 ? 18   GLN A OE1   1 
ATOM   58    N  NE2   . GLN A 1 18  ? 54.059  20.361  -29.146 1.00 66.71 ? 18   GLN A NE2   1 
ATOM   59    N  N     . VAL A 1 19  ? 50.241  15.120  -29.945 1.00 44.41 ? 19   VAL A N     1 
ATOM   60    C  CA    . VAL A 1 19  ? 49.204  14.230  -29.551 1.00 43.71 ? 19   VAL A CA    1 
ATOM   61    C  C     . VAL A 1 19  ? 49.690  12.832  -29.238 1.00 44.59 ? 19   VAL A C     1 
ATOM   62    O  O     . VAL A 1 19  ? 49.612  12.398  -28.075 1.00 45.79 ? 19   VAL A O     1 
ATOM   63    C  CB    . VAL A 1 19  ? 48.092  14.287  -30.613 1.00 38.88 ? 19   VAL A CB    1 
ATOM   64    C  CG1   . VAL A 1 19  ? 47.100  13.149  -30.386 1.00 40.95 ? 19   VAL A CG1   1 
ATOM   65    C  CG2   . VAL A 1 19  ? 47.379  15.614  -30.409 1.00 39.22 ? 19   VAL A CG2   1 
ATOM   66    N  N     . LYS A 1 20  ? 50.452  12.188  -30.113 1.00 44.99 ? 20   LYS A N     1 
ATOM   67    C  CA    . LYS A 1 20  ? 50.997  10.891  -29.748 1.00 45.10 ? 20   LYS A CA    1 
ATOM   68    C  C     . LYS A 1 20  ? 51.943  11.003  -28.567 1.00 44.27 ? 20   LYS A C     1 
ATOM   69    O  O     . LYS A 1 20  ? 51.997  10.042  -27.792 1.00 45.95 ? 20   LYS A O     1 
ATOM   70    C  CB    . LYS A 1 20  ? 51.575  10.096  -30.900 1.00 45.83 ? 20   LYS A CB    1 
ATOM   71    C  CG    . LYS A 1 20  ? 50.571  9.867   -32.024 1.00 52.29 ? 20   LYS A CG    1 
ATOM   72    C  CD    . LYS A 1 20  ? 51.296  9.511   -33.330 1.00 55.10 ? 20   LYS A CD    1 
ATOM   73    C  CE    . LYS A 1 20  ? 50.463  8.569   -34.176 1.00 55.89 ? 20   LYS A CE    1 
ATOM   74    N  NZ    . LYS A 1 20  ? 50.982  8.404   -35.571 1.00 61.16 ? 20   LYS A NZ    1 
ATOM   75    N  N     . LYS A 1 21  ? 52.763  12.022  -28.487 1.00 43.31 ? 21   LYS A N     1 
ATOM   76    C  CA    . LYS A 1 21  ? 53.734  12.225  -27.411 1.00 41.81 ? 21   LYS A CA    1 
ATOM   77    C  C     . LYS A 1 21  ? 53.036  12.435  -26.056 1.00 39.53 ? 21   LYS A C     1 
ATOM   78    O  O     . LYS A 1 21  ? 53.427  11.837  -25.070 1.00 38.10 ? 21   LYS A O     1 
ATOM   79    C  CB    . LYS A 1 21  ? 54.599  13.457  -27.681 1.00 39.12 ? 21   LYS A CB    1 
ATOM   80    C  CG    . LYS A 1 21  ? 56.019  13.183  -28.148 1.00 47.17 ? 21   LYS A CG    1 
ATOM   81    C  CD    . LYS A 1 21  ? 56.347  14.178  -29.278 1.00 53.85 ? 21   LYS A CD    1 
ATOM   82    C  CE    . LYS A 1 21  ? 57.798  14.608  -29.297 1.00 53.24 ? 21   LYS A CE    1 
ATOM   83    N  NZ    . LYS A 1 21  ? 58.522  14.129  -30.500 1.00 55.43 ? 21   LYS A NZ    1 
ATOM   84    N  N     . ILE A 1 22  ? 51.986  13.243  -26.058 1.00 38.69 ? 22   ILE A N     1 
ATOM   85    C  CA    . ILE A 1 22  ? 51.205  13.420  -24.830 1.00 40.87 ? 22   ILE A CA    1 
ATOM   86    C  C     . ILE A 1 22  ? 50.524  12.136  -24.373 1.00 41.46 ? 22   ILE A C     1 
ATOM   87    O  O     . ILE A 1 22  ? 50.604  11.779  -23.186 1.00 41.81 ? 22   ILE A O     1 
ATOM   88    C  CB    . ILE A 1 22  ? 50.211  14.563  -25.055 1.00 43.77 ? 22   ILE A CB    1 
ATOM   89    C  CG1   . ILE A 1 22  ? 50.987  15.877  -25.268 1.00 40.15 ? 22   ILE A CG1   1 
ATOM   90    C  CG2   . ILE A 1 22  ? 49.176  14.643  -23.956 1.00 40.61 ? 22   ILE A CG2   1 
ATOM   91    C  CD1   . ILE A 1 22  ? 50.105  17.100  -25.054 1.00 38.66 ? 22   ILE A CD1   1 
ATOM   92    N  N     . ASP A 1 23  ? 49.975  11.317  -25.286 1.00 40.78 ? 23   ASP A N     1 
ATOM   93    C  CA    . ASP A 1 23  ? 49.432  10.024  -24.862 1.00 40.33 ? 23   ASP A CA    1 
ATOM   94    C  C     . ASP A 1 23  ? 50.524  9.159   -24.210 1.00 40.20 ? 23   ASP A C     1 
ATOM   95    O  O     . ASP A 1 23  ? 50.192  8.263   -23.432 1.00 39.59 ? 23   ASP A O     1 
ATOM   96    C  CB    . ASP A 1 23  ? 48.795  9.245   -25.996 1.00 37.90 ? 23   ASP A CB    1 
ATOM   97    C  CG    . ASP A 1 23  ? 47.609  9.848   -26.667 1.00 42.18 ? 23   ASP A CG    1 
ATOM   98    O  OD1   . ASP A 1 23  ? 46.771  10.558  -26.055 1.00 42.26 ? 23   ASP A OD1   1 
ATOM   99    O  OD2   . ASP A 1 23  ? 47.462  9.582   -27.888 1.00 44.96 ? 23   ASP A OD2   1 
ATOM   100   N  N     . LYS A 1 24  ? 51.764  9.272   -24.663 1.00 39.32 ? 24   LYS A N     1 
ATOM   101   C  CA    . LYS A 1 24  ? 52.877  8.565   -24.075 1.00 39.42 ? 24   LYS A CA    1 
ATOM   102   C  C     . LYS A 1 24  ? 53.189  9.186   -22.712 1.00 38.14 ? 24   LYS A C     1 
ATOM   103   O  O     . LYS A 1 24  ? 53.331  8.480   -21.742 1.00 38.80 ? 24   LYS A O     1 
ATOM   104   C  CB    . LYS A 1 24  ? 54.161  8.691   -24.899 1.00 42.49 ? 24   LYS A CB    1 
ATOM   105   C  CG    . LYS A 1 24  ? 54.710  7.374   -25.429 1.00 46.20 ? 24   LYS A CG    1 
ATOM   106   C  CD    . LYS A 1 24  ? 54.499  7.234   -26.943 1.00 46.03 ? 24   LYS A CD    1 
ATOM   107   C  CE    . LYS A 1 24  ? 55.535  6.344   -27.579 1.00 45.20 ? 24   LYS A CE    1 
ATOM   108   N  NZ    . LYS A 1 24  ? 55.938  6.725   -28.965 1.00 51.97 ? 24   LYS A NZ    1 
ATOM   109   N  N     . TYR A 1 25  ? 53.387  10.480  -22.641 1.00 38.17 ? 25   TYR A N     1 
ATOM   110   C  CA    . TYR A 1 25  ? 53.627  11.179  -21.383 1.00 37.64 ? 25   TYR A CA    1 
ATOM   111   C  C     . TYR A 1 25  ? 52.576  10.802  -20.330 1.00 38.79 ? 25   TYR A C     1 
ATOM   112   O  O     . TYR A 1 25  ? 52.897  10.679  -19.144 1.00 38.39 ? 25   TYR A O     1 
ATOM   113   C  CB    . TYR A 1 25  ? 53.653  12.688  -21.633 1.00 35.92 ? 25   TYR A CB    1 
ATOM   114   C  CG    . TYR A 1 25  ? 54.289  13.553  -20.569 1.00 34.21 ? 25   TYR A CG    1 
ATOM   115   C  CD1   . TYR A 1 25  ? 55.643  13.833  -20.633 1.00 34.05 ? 25   TYR A CD1   1 
ATOM   116   C  CD2   . TYR A 1 25  ? 53.567  14.118  -19.532 1.00 33.97 ? 25   TYR A CD2   1 
ATOM   117   C  CE1   . TYR A 1 25  ? 56.272  14.579  -19.639 1.00 34.76 ? 25   TYR A CE1   1 
ATOM   118   C  CE2   . TYR A 1 25  ? 54.171  14.853  -18.532 1.00 34.67 ? 25   TYR A CE2   1 
ATOM   119   C  CZ    . TYR A 1 25  ? 55.533  15.088  -18.602 1.00 35.63 ? 25   TYR A CZ    1 
ATOM   120   O  OH    . TYR A 1 25  ? 56.176  15.841  -17.657 1.00 36.83 ? 25   TYR A OH    1 
ATOM   121   N  N     . LEU A 1 26  ? 51.296  10.812  -20.666 1.00 39.20 ? 26   LEU A N     1 
ATOM   122   C  CA    . LEU A 1 26  ? 50.202  10.622  -19.722 1.00 39.86 ? 26   LEU A CA    1 
ATOM   123   C  C     . LEU A 1 26  ? 49.599  9.223   -19.844 1.00 41.25 ? 26   LEU A C     1 
ATOM   124   O  O     . LEU A 1 26  ? 48.399  8.970   -19.719 1.00 39.84 ? 26   LEU A O     1 
ATOM   125   C  CB    . LEU A 1 26  ? 49.096  11.647  -20.037 1.00 36.38 ? 26   LEU A CB    1 
ATOM   126   C  CG    . LEU A 1 26  ? 49.481  13.110  -19.783 1.00 40.92 ? 26   LEU A CG    1 
ATOM   127   C  CD1   . LEU A 1 26  ? 48.292  13.991  -20.171 1.00 31.89 ? 26   LEU A CD1   1 
ATOM   128   C  CD2   . LEU A 1 26  ? 49.884  13.280  -18.309 1.00 30.56 ? 26   LEU A CD2   1 
ATOM   129   N  N     . TYR A 1 27  ? 50.458  8.291   -20.262 1.00 42.28 ? 27   TYR A N     1 
ATOM   130   C  CA    . TYR A 1 27  ? 49.984  6.920   -20.475 1.00 42.89 ? 27   TYR A CA    1 
ATOM   131   C  C     . TYR A 1 27  ? 49.135  6.397   -19.319 1.00 43.88 ? 27   TYR A C     1 
ATOM   132   O  O     . TYR A 1 27  ? 48.098  5.754   -19.472 1.00 44.46 ? 27   TYR A O     1 
ATOM   133   C  CB    . TYR A 1 27  ? 51.282  6.113   -20.535 1.00 43.79 ? 27   TYR A CB    1 
ATOM   134   C  CG    . TYR A 1 27  ? 51.033  4.651   -20.749 1.00 47.17 ? 27   TYR A CG    1 
ATOM   135   C  CD1   . TYR A 1 27  ? 50.543  4.153   -21.949 1.00 49.50 ? 27   TYR A CD1   1 
ATOM   136   C  CD2   . TYR A 1 27  ? 51.309  3.771   -19.707 1.00 48.62 ? 27   TYR A CD2   1 
ATOM   137   C  CE1   . TYR A 1 27  ? 50.361  2.778   -22.111 1.00 50.67 ? 27   TYR A CE1   1 
ATOM   138   C  CE2   . TYR A 1 27  ? 51.139  2.410   -19.885 1.00 49.50 ? 27   TYR A CE2   1 
ATOM   139   C  CZ    . TYR A 1 27  ? 50.672  1.926   -21.084 1.00 50.19 ? 27   TYR A CZ    1 
ATOM   140   O  OH    . TYR A 1 27  ? 50.511  0.562   -21.195 1.00 52.03 ? 27   TYR A OH    1 
ATOM   141   N  N     . ALA A 1 28  ? 49.604  6.633   -18.093 1.00 42.96 ? 28   ALA A N     1 
ATOM   142   C  CA    . ALA A 1 28  ? 49.042  6.128   -16.884 1.00 41.83 ? 28   ALA A CA    1 
ATOM   143   C  C     . ALA A 1 28  ? 47.630  6.608   -16.651 1.00 40.53 ? 28   ALA A C     1 
ATOM   144   O  O     . ALA A 1 28  ? 46.891  5.918   -15.936 1.00 42.02 ? 28   ALA A O     1 
ATOM   145   C  CB    . ALA A 1 28  ? 49.930  6.295   -15.659 1.00 40.21 ? 28   ALA A CB    1 
ATOM   146   N  N     . MET A 1 29  ? 47.197  7.636   -17.350 1.00 38.10 ? 29   MET A N     1 
ATOM   147   C  CA    . MET A 1 29  ? 45.828  8.080   -17.240 1.00 35.51 ? 29   MET A CA    1 
ATOM   148   C  C     . MET A 1 29  ? 44.969  7.516   -18.349 1.00 36.31 ? 29   MET A C     1 
ATOM   149   O  O     . MET A 1 29  ? 43.794  7.890   -18.384 1.00 37.06 ? 29   MET A O     1 
ATOM   150   C  CB    . MET A 1 29  ? 45.739  9.584   -17.226 1.00 31.56 ? 29   MET A CB    1 
ATOM   151   C  CG    . MET A 1 29  ? 46.530  10.204  -16.108 1.00 35.03 ? 29   MET A CG    1 
ATOM   152   S  SD    . MET A 1 29  ? 46.188  11.973  -15.905 1.00 41.64 ? 29   MET A SD    1 
ATOM   153   C  CE    . MET A 1 29  ? 47.893  12.500  -15.913 1.00 45.44 ? 29   MET A CE    1 
ATOM   154   N  N     . ARG A 1 30  ? 45.567  6.856   -19.325 1.00 36.07 ? 30   ARG A N     1 
ATOM   155   C  CA    . ARG A 1 30  ? 44.765  6.344   -20.445 1.00 35.79 ? 30   ARG A CA    1 
ATOM   156   C  C     . ARG A 1 30  ? 44.427  4.881   -20.101 1.00 34.65 ? 30   ARG A C     1 
ATOM   157   O  O     . ARG A 1 30  ? 45.308  4.034   -20.173 1.00 31.95 ? 30   ARG A O     1 
ATOM   158   C  CB    . ARG A 1 30  ? 45.497  6.537   -21.767 1.00 37.89 ? 30   ARG A CB    1 
ATOM   159   C  CG    . ARG A 1 30  ? 45.732  8.003   -22.154 1.00 41.62 ? 30   ARG A CG    1 
ATOM   160   C  CD    . ARG A 1 30  ? 46.389  8.189   -23.508 1.00 36.58 ? 30   ARG A CD    1 
ATOM   161   N  NE    . ARG A 1 30  ? 45.819  7.320   -24.510 1.00 46.71 ? 30   ARG A NE    1 
ATOM   162   C  CZ    . ARG A 1 30  ? 44.970  7.582   -25.503 1.00 47.41 ? 30   ARG A CZ    1 
ATOM   163   N  NH1   . ARG A 1 30  ? 44.522  8.777   -25.872 1.00 47.78 ? 30   ARG A NH1   1 
ATOM   164   N  NH2   . ARG A 1 30  ? 44.515  6.541   -26.193 1.00 48.33 ? 30   ARG A NH2   1 
ATOM   165   N  N     . LEU A 1 31  ? 43.227  4.668   -19.569 1.00 34.35 ? 31   LEU A N     1 
ATOM   166   C  CA    . LEU A 1 31  ? 42.827  3.375   -19.032 1.00 36.32 ? 31   LEU A CA    1 
ATOM   167   C  C     . LEU A 1 31  ? 41.979  2.560   -20.009 1.00 37.16 ? 31   LEU A C     1 
ATOM   168   O  O     . LEU A 1 31  ? 40.853  2.980   -20.303 1.00 39.04 ? 31   LEU A O     1 
ATOM   169   C  CB    . LEU A 1 31  ? 41.960  3.600   -17.765 1.00 36.38 ? 31   LEU A CB    1 
ATOM   170   C  CG    . LEU A 1 31  ? 42.593  4.543   -16.727 1.00 34.83 ? 31   LEU A CG    1 
ATOM   171   C  CD1   . LEU A 1 31  ? 41.680  4.645   -15.526 1.00 36.26 ? 31   LEU A CD1   1 
ATOM   172   C  CD2   . LEU A 1 31  ? 43.960  3.977   -16.347 1.00 35.67 ? 31   LEU A CD2   1 
ATOM   173   N  N     . SER A 1 32  ? 42.432  1.400   -20.413 1.00 36.37 ? 32   SER A N     1 
ATOM   174   C  CA    . SER A 1 32  ? 41.773  0.476   -21.293 1.00 37.90 ? 32   SER A CA    1 
ATOM   175   C  C     . SER A 1 32  ? 40.654  -0.370  -20.679 1.00 39.59 ? 32   SER A C     1 
ATOM   176   O  O     . SER A 1 32  ? 40.534  -0.475  -19.465 1.00 39.85 ? 32   SER A O     1 
ATOM   177   C  CB    . SER A 1 32  ? 42.846  -0.580  -21.679 1.00 33.79 ? 32   SER A CB    1 
ATOM   178   O  OG    . SER A 1 32  ? 43.186  -1.285  -20.499 1.00 36.14 ? 32   SER A OG    1 
ATOM   179   N  N     . ASP A 1 33  ? 39.832  -1.002  -21.536 1.00 40.82 ? 33   ASP A N     1 
ATOM   180   C  CA    . ASP A 1 33  ? 38.746  -1.862  -21.065 1.00 41.24 ? 33   ASP A CA    1 
ATOM   181   C  C     . ASP A 1 33  ? 39.208  -2.899  -20.053 1.00 41.23 ? 33   ASP A C     1 
ATOM   182   O  O     . ASP A 1 33  ? 38.643  -3.008  -18.951 1.00 42.17 ? 33   ASP A O     1 
ATOM   183   C  CB    . ASP A 1 33  ? 38.014  -2.460  -22.279 1.00 38.55 ? 33   ASP A CB    1 
ATOM   184   C  CG    . ASP A 1 33  ? 37.181  -1.350  -22.904 1.00 41.86 ? 33   ASP A CG    1 
ATOM   185   O  OD1   . ASP A 1 33  ? 37.400  -0.221  -22.420 1.00 41.74 ? 33   ASP A OD1   1 
ATOM   186   O  OD2   . ASP A 1 33  ? 36.308  -1.475  -23.783 1.00 40.77 ? 33   ASP A OD2   1 
ATOM   187   N  N     . GLU A 1 34  ? 40.346  -3.548  -20.240 1.00 40.85 ? 34   GLU A N     1 
ATOM   188   C  CA    . GLU A 1 34  ? 40.877  -4.429  -19.213 1.00 43.04 ? 34   GLU A CA    1 
ATOM   189   C  C     . GLU A 1 34  ? 41.126  -3.716  -17.893 1.00 42.68 ? 34   GLU A C     1 
ATOM   190   O  O     . GLU A 1 34  ? 40.893  -4.367  -16.861 1.00 44.88 ? 34   GLU A O     1 
ATOM   191   C  CB    . GLU A 1 34  ? 42.110  -5.259  -19.604 1.00 43.78 ? 34   GLU A CB    1 
ATOM   192   C  CG    . GLU A 1 34  ? 42.712  -4.828  -20.930 1.00 58.47 ? 34   GLU A CG    1 
ATOM   193   C  CD    . GLU A 1 34  ? 41.845  -4.926  -22.173 1.00 62.07 ? 34   GLU A CD    1 
ATOM   194   O  OE1   . GLU A 1 34  ? 41.361  -6.049  -22.513 1.00 65.59 ? 34   GLU A OE1   1 
ATOM   195   O  OE2   . GLU A 1 34  ? 41.646  -3.883  -22.845 1.00 58.16 ? 34   GLU A OE2   1 
ATOM   196   N  N     . THR A 1 35  ? 41.593  -2.473  -17.831 1.00 40.20 ? 35   THR A N     1 
ATOM   197   C  CA    . THR A 1 35  ? 41.896  -1.918  -16.529 1.00 37.61 ? 35   THR A CA    1 
ATOM   198   C  C     . THR A 1 35  ? 40.645  -1.483  -15.827 1.00 36.85 ? 35   THR A C     1 
ATOM   199   O  O     . THR A 1 35  ? 40.534  -1.557  -14.588 1.00 35.99 ? 35   THR A O     1 
ATOM   200   C  CB    . THR A 1 35  ? 43.196  -1.193  -16.287 1.00 35.88 ? 35   THR A CB    1 
ATOM   201   O  OG1   . THR A 1 35  ? 43.139  0.075   -15.681 1.00 31.44 ? 35   THR A OG1   1 
ATOM   202   C  CG2   . THR A 1 35  ? 44.268  -1.260  -17.341 1.00 30.74 ? 35   THR A CG2   1 
ATOM   203   N  N     . LEU A 1 36  ? 39.628  -1.153  -16.631 1.00 36.63 ? 36   LEU A N     1 
ATOM   204   C  CA    . LEU A 1 36  ? 38.378  -0.639  -16.023 1.00 35.57 ? 36   LEU A CA    1 
ATOM   205   C  C     . LEU A 1 36  ? 37.543  -1.802  -15.513 1.00 35.77 ? 36   LEU A C     1 
ATOM   206   O  O     . LEU A 1 36  ? 36.860  -1.694  -14.520 1.00 34.66 ? 36   LEU A O     1 
ATOM   207   C  CB    . LEU A 1 36  ? 37.584  0.130   -17.078 1.00 33.61 ? 36   LEU A CB    1 
ATOM   208   C  CG    . LEU A 1 36  ? 38.247  1.437   -17.563 1.00 36.86 ? 36   LEU A CG    1 
ATOM   209   C  CD1   . LEU A 1 36  ? 37.406  1.923   -18.743 1.00 27.40 ? 36   LEU A CD1   1 
ATOM   210   C  CD2   . LEU A 1 36  ? 38.345  2.480   -16.456 1.00 25.39 ? 36   LEU A CD2   1 
ATOM   211   N  N     . ILE A 1 37  ? 37.579  -2.934  -16.218 1.00 37.34 ? 37   ILE A N     1 
ATOM   212   C  CA    . ILE A 1 37  ? 36.957  -4.149  -15.726 1.00 37.84 ? 37   ILE A CA    1 
ATOM   213   C  C     . ILE A 1 37  ? 37.609  -4.582  -14.412 1.00 37.42 ? 37   ILE A C     1 
ATOM   214   O  O     . ILE A 1 37  ? 36.898  -5.129  -13.568 1.00 39.81 ? 37   ILE A O     1 
ATOM   215   C  CB    . ILE A 1 37  ? 37.090  -5.309  -16.749 1.00 41.92 ? 37   ILE A CB    1 
ATOM   216   C  CG1   . ILE A 1 37  ? 36.061  -5.086  -17.874 1.00 39.37 ? 37   ILE A CG1   1 
ATOM   217   C  CG2   . ILE A 1 37  ? 36.842  -6.656  -16.058 1.00 31.70 ? 37   ILE A CG2   1 
ATOM   218   C  CD1   . ILE A 1 37  ? 36.627  -5.555  -19.207 1.00 46.84 ? 37   ILE A CD1   1 
ATOM   219   N  N     . ASP A 1 38  ? 38.890  -4.414  -14.219 1.00 35.57 ? 38   ASP A N     1 
ATOM   220   C  CA    . ASP A 1 38  ? 39.557  -4.709  -12.947 1.00 35.25 ? 38   ASP A CA    1 
ATOM   221   C  C     . ASP A 1 38  ? 39.075  -3.800  -11.831 1.00 34.61 ? 38   ASP A C     1 
ATOM   222   O  O     . ASP A 1 38  ? 38.710  -4.270  -10.757 1.00 35.59 ? 38   ASP A O     1 
ATOM   223   C  CB    . ASP A 1 38  ? 41.058  -4.767  -13.166 1.00 32.11 ? 38   ASP A CB    1 
ATOM   224   C  CG    . ASP A 1 38  ? 42.033  -4.723  -12.043 1.00 37.13 ? 38   ASP A CG    1 
ATOM   225   O  OD1   . ASP A 1 38  ? 41.723  -5.059  -10.886 1.00 40.68 ? 38   ASP A OD1   1 
ATOM   226   O  OD2   . ASP A 1 38  ? 43.234  -4.346  -12.183 1.00 43.77 ? 38   ASP A OD2   1 
ATOM   227   N  N     . ILE A 1 39  ? 38.928  -2.506  -12.041 1.00 34.04 ? 39   ILE A N     1 
ATOM   228   C  CA    . ILE A 1 39  ? 38.437  -1.512  -11.110 1.00 33.37 ? 39   ILE A CA    1 
ATOM   229   C  C     . ILE A 1 39  ? 37.003  -1.790  -10.701 1.00 34.48 ? 39   ILE A C     1 
ATOM   230   O  O     . ILE A 1 39  ? 36.661  -1.791  -9.507  1.00 33.07 ? 39   ILE A O     1 
ATOM   231   C  CB    . ILE A 1 39  ? 38.585  -0.114  -11.732 1.00 32.56 ? 39   ILE A CB    1 
ATOM   232   C  CG1   . ILE A 1 39  ? 40.082  0.273   -11.721 1.00 32.09 ? 39   ILE A CG1   1 
ATOM   233   C  CG2   . ILE A 1 39  ? 37.795  1.002   -11.088 1.00 29.36 ? 39   ILE A CG2   1 
ATOM   234   C  CD1   . ILE A 1 39  ? 40.259  1.560   -12.525 1.00 33.92 ? 39   ILE A CD1   1 
ATOM   235   N  N     . MET A 1 40  ? 36.173  -2.061  -11.716 1.00 34.48 ? 40   MET A N     1 
ATOM   236   C  CA    . MET A 1 40  ? 34.774  -2.441  -11.487 1.00 34.71 ? 40   MET A CA    1 
ATOM   237   C  C     . MET A 1 40  ? 34.594  -3.603  -10.503 1.00 35.30 ? 40   MET A C     1 
ATOM   238   O  O     . MET A 1 40  ? 33.711  -3.622  -9.643  1.00 35.65 ? 40   MET A O     1 
ATOM   239   C  CB    . MET A 1 40  ? 34.150  -2.870  -12.830 1.00 32.78 ? 40   MET A CB    1 
ATOM   240   C  CG    . MET A 1 40  ? 32.633  -3.002  -12.777 1.00 31.60 ? 40   MET A CG    1 
ATOM   241   S  SD    . MET A 1 40  ? 31.986  -3.792  -14.245 1.00 40.54 ? 40   MET A SD    1 
ATOM   242   C  CE    . MET A 1 40  ? 31.626  -2.455  -15.330 1.00 35.48 ? 40   MET A CE    1 
ATOM   243   N  N     . THR A 1 41  ? 35.331  -4.666  -10.690 1.00 36.48 ? 41   THR A N     1 
ATOM   244   C  CA    . THR A 1 41  ? 35.394  -5.869  -9.877  1.00 37.38 ? 41   THR A CA    1 
ATOM   245   C  C     . THR A 1 41  ? 35.972  -5.507  -8.499  1.00 37.61 ? 41   THR A C     1 
ATOM   246   O  O     . THR A 1 41  ? 35.456  -5.990  -7.497  1.00 37.94 ? 41   THR A O     1 
ATOM   247   C  CB    . THR A 1 41  ? 36.346  -6.888  -10.536 1.00 39.74 ? 41   THR A CB    1 
ATOM   248   O  OG1   . THR A 1 41  ? 35.755  -7.296  -11.779 1.00 48.11 ? 41   THR A OG1   1 
ATOM   249   C  CG2   . THR A 1 41  ? 36.615  -8.124  -9.711  1.00 39.60 ? 41   THR A CG2   1 
ATOM   250   N  N     . ARG A 1 42  ? 37.008  -4.672  -8.455  1.00 35.99 ? 42   ARG A N     1 
ATOM   251   C  CA    . ARG A 1 42  ? 37.424  -4.196  -7.146  1.00 35.58 ? 42   ARG A CA    1 
ATOM   252   C  C     . ARG A 1 42  ? 36.256  -3.464  -6.493  1.00 34.68 ? 42   ARG A C     1 
ATOM   253   O  O     . ARG A 1 42  ? 36.130  -3.658  -5.276  1.00 36.73 ? 42   ARG A O     1 
ATOM   254   C  CB    . ARG A 1 42  ? 38.593  -3.254  -7.154  1.00 33.84 ? 42   ARG A CB    1 
ATOM   255   C  CG    . ARG A 1 42  ? 39.942  -3.850  -7.525  1.00 42.20 ? 42   ARG A CG    1 
ATOM   256   C  CD    . ARG A 1 42  ? 40.972  -2.713  -7.665  1.00 39.71 ? 42   ARG A CD    1 
ATOM   257   N  NE    . ARG A 1 42  ? 41.804  -3.024  -8.833  1.00 43.62 ? 42   ARG A NE    1 
ATOM   258   C  CZ    . ARG A 1 42  ? 43.013  -2.477  -8.965  1.00 47.53 ? 42   ARG A CZ    1 
ATOM   259   N  NH1   . ARG A 1 42  ? 43.456  -1.656  -8.017  1.00 47.95 ? 42   ARG A NH1   1 
ATOM   260   N  NH2   . ARG A 1 42  ? 43.756  -2.738  -10.031 1.00 49.01 ? 42   ARG A NH2   1 
ATOM   261   N  N     . PHE A 1 43  ? 35.524  -2.622  -7.224  1.00 31.29 ? 43   PHE A N     1 
ATOM   262   C  CA    . PHE A 1 43  ? 34.488  -1.852  -6.563  1.00 30.17 ? 43   PHE A CA    1 
ATOM   263   C  C     . PHE A 1 43  ? 33.402  -2.798  -6.065  1.00 32.02 ? 43   PHE A C     1 
ATOM   264   O  O     . PHE A 1 43  ? 32.791  -2.648  -5.013  1.00 31.92 ? 43   PHE A O     1 
ATOM   265   C  CB    . PHE A 1 43  ? 33.996  -0.669  -7.392  1.00 28.86 ? 43   PHE A CB    1 
ATOM   266   C  CG    . PHE A 1 43  ? 32.926  0.162   -6.696  1.00 28.13 ? 43   PHE A CG    1 
ATOM   267   C  CD1   . PHE A 1 43  ? 33.230  1.046   -5.688  1.00 23.89 ? 43   PHE A CD1   1 
ATOM   268   C  CD2   . PHE A 1 43  ? 31.593  0.026   -7.038  1.00 26.91 ? 43   PHE A CD2   1 
ATOM   269   C  CE1   . PHE A 1 43  ? 32.293  1.786   -5.034  1.00 24.43 ? 43   PHE A CE1   1 
ATOM   270   C  CE2   . PHE A 1 43  ? 30.618  0.730   -6.369  1.00 21.46 ? 43   PHE A CE2   1 
ATOM   271   C  CZ    . PHE A 1 43  ? 30.948  1.584   -5.338  1.00 24.94 ? 43   PHE A CZ    1 
ATOM   272   N  N     . ARG A 1 44  ? 33.118  -3.835  -6.838  1.00 32.85 ? 44   ARG A N     1 
ATOM   273   C  CA    . ARG A 1 44  ? 32.105  -4.824  -6.571  1.00 34.59 ? 44   ARG A CA    1 
ATOM   274   C  C     . ARG A 1 44  ? 32.362  -5.517  -5.233  1.00 35.44 ? 44   ARG A C     1 
ATOM   275   O  O     . ARG A 1 44  ? 31.397  -5.747  -4.552  1.00 35.80 ? 44   ARG A O     1 
ATOM   276   C  CB    . ARG A 1 44  ? 32.094  -5.906  -7.665  1.00 37.78 ? 44   ARG A CB    1 
ATOM   277   C  CG    . ARG A 1 44  ? 30.942  -6.892  -7.543  1.00 38.36 ? 44   ARG A CG    1 
ATOM   278   C  CD    . ARG A 1 44  ? 29.630  -6.131  -7.820  1.00 41.52 ? 44   ARG A CD    1 
ATOM   279   N  NE    . ARG A 1 44  ? 28.482  -6.965  -7.456  1.00 41.79 ? 44   ARG A NE    1 
ATOM   280   C  CZ    . ARG A 1 44  ? 28.049  -8.026  -8.130  1.00 36.86 ? 44   ARG A CZ    1 
ATOM   281   N  NH1   . ARG A 1 44  ? 28.576  -8.372  -9.292  1.00 40.52 ? 44   ARG A NH1   1 
ATOM   282   N  NH2   . ARG A 1 44  ? 27.018  -8.725  -7.657  1.00 44.26 ? 44   ARG A NH2   1 
ATOM   283   N  N     . LYS A 1 45  ? 33.617  -5.771  -4.882  1.00 34.81 ? 45   LYS A N     1 
ATOM   284   C  CA    . LYS A 1 45  ? 33.999  -6.486  -3.702  1.00 34.86 ? 45   LYS A CA    1 
ATOM   285   C  C     . LYS A 1 45  ? 33.983  -5.579  -2.496  1.00 37.81 ? 45   LYS A C     1 
ATOM   286   O  O     . LYS A 1 45  ? 33.590  -5.872  -1.364  1.00 38.64 ? 45   LYS A O     1 
ATOM   287   C  CB    . LYS A 1 45  ? 35.354  -7.116  -4.017  1.00 39.14 ? 45   LYS A CB    1 
ATOM   288   C  CG    . LYS A 1 45  ? 36.018  -7.784  -2.805  1.00 45.24 ? 45   LYS A CG    1 
ATOM   289   C  CD    . LYS A 1 45  ? 34.869  -8.412  -1.996  1.00 50.76 ? 45   LYS A CD    1 
ATOM   290   C  CE    . LYS A 1 45  ? 35.236  -9.744  -1.366  1.00 52.85 ? 45   LYS A CE    1 
ATOM   291   N  NZ    . LYS A 1 45  ? 34.260  -10.051 -0.268  1.00 62.74 ? 45   LYS A NZ    1 
ATOM   292   N  N     . GLU A 1 46  ? 34.240  -4.298  -2.747  1.00 39.22 ? 46   GLU A N     1 
ATOM   293   C  CA    . GLU A 1 46  ? 34.150  -3.240  -1.744  1.00 38.01 ? 46   GLU A CA    1 
ATOM   294   C  C     . GLU A 1 46  ? 32.725  -2.953  -1.320  1.00 36.81 ? 46   GLU A C     1 
ATOM   295   O  O     . GLU A 1 46  ? 32.447  -2.569  -0.182  1.00 36.30 ? 46   GLU A O     1 
ATOM   296   C  CB    . GLU A 1 46  ? 34.800  -1.972  -2.330  1.00 39.83 ? 46   GLU A CB    1 
ATOM   297   C  CG    . GLU A 1 46  ? 36.288  -2.018  -2.577  1.00 38.27 ? 46   GLU A CG    1 
ATOM   298   C  CD    . GLU A 1 46  ? 37.128  -1.820  -1.341  1.00 44.24 ? 46   GLU A CD    1 
ATOM   299   O  OE1   . GLU A 1 46  ? 36.562  -1.657  -0.234  1.00 48.93 ? 46   GLU A OE1   1 
ATOM   300   O  OE2   . GLU A 1 46  ? 38.373  -1.812  -1.424  1.00 43.00 ? 46   GLU A OE2   1 
ATOM   301   N  N     . MET A 1 47  ? 31.759  -3.012  -2.234  1.00 37.80 ? 47   MET A N     1 
ATOM   302   C  CA    . MET A 1 47  ? 30.343  -2.825  -1.887  1.00 37.46 ? 47   MET A CA    1 
ATOM   303   C  C     . MET A 1 47  ? 29.906  -3.963  -0.960  1.00 38.81 ? 47   MET A C     1 
ATOM   304   O  O     . MET A 1 47  ? 29.197  -3.853  0.015   1.00 38.89 ? 47   MET A O     1 
ATOM   305   C  CB    . MET A 1 47  ? 29.506  -2.943  -3.160  1.00 37.47 ? 47   MET A CB    1 
ATOM   306   C  CG    . MET A 1 47  ? 29.392  -1.654  -3.976  1.00 40.43 ? 47   MET A CG    1 
ATOM   307   S  SD    . MET A 1 47  ? 28.229  -1.803  -5.362  1.00 40.07 ? 47   MET A SD    1 
ATOM   308   C  CE    . MET A 1 47  ? 29.165  -2.576  -6.586  1.00 30.57 ? 47   MET A CE    1 
ATOM   309   N  N     . LYS A 1 48  ? 30.291  -5.161  -1.386  1.00 40.27 ? 48   LYS A N     1 
ATOM   310   C  CA    . LYS A 1 48  ? 29.943  -6.415  -0.704  1.00 41.56 ? 48   LYS A CA    1 
ATOM   311   C  C     . LYS A 1 48  ? 30.604  -6.319  0.670   1.00 43.18 ? 48   LYS A C     1 
ATOM   312   O  O     . LYS A 1 48  ? 29.942  -6.306  1.698   1.00 44.98 ? 48   LYS A O     1 
ATOM   313   C  CB    . LYS A 1 48  ? 30.597  -7.545  -1.499  1.00 39.96 ? 48   LYS A CB    1 
ATOM   314   C  CG    . LYS A 1 48  ? 30.374  -8.918  -0.921  1.00 45.60 ? 48   LYS A CG    1 
ATOM   315   C  CD    . LYS A 1 48  ? 31.206  -9.991  -1.606  1.00 47.00 ? 48   LYS A CD    1 
ATOM   316   C  CE    . LYS A 1 48  ? 31.376  -11.195 -0.697  1.00 52.27 ? 48   LYS A CE    1 
ATOM   317   N  NZ    . LYS A 1 48  ? 30.271  -12.178 -0.894  1.00 53.17 ? 48   LYS A NZ    1 
ATOM   318   N  N     . ASN A 1 49  ? 31.893  -5.972  0.589   1.00 42.79 ? 49   ASN A N     1 
ATOM   319   C  CA    . ASN A 1 49  ? 32.621  -5.595  1.797   1.00 43.00 ? 49   ASN A CA    1 
ATOM   320   C  C     . ASN A 1 49  ? 31.804  -4.614  2.627   1.00 42.64 ? 49   ASN A C     1 
ATOM   321   O  O     . ASN A 1 49  ? 31.788  -4.730  3.851   1.00 43.82 ? 49   ASN A O     1 
ATOM   322   C  CB    . ASN A 1 49  ? 33.970  -4.954  1.453   1.00 45.20 ? 49   ASN A CB    1 
ATOM   323   C  CG    . ASN A 1 49  ? 35.096  -5.982  1.381   1.00 47.70 ? 49   ASN A CG    1 
ATOM   324   O  OD1   . ASN A 1 49  ? 34.901  -7.180  1.528   1.00 46.52 ? 49   ASN A OD1   1 
ATOM   325   N  ND2   . ASN A 1 49  ? 36.291  -5.438  1.148   1.00 52.02 ? 49   ASN A ND2   1 
ATOM   326   N  N     . GLY A 1 50  ? 31.261  -3.512  2.079   1.00 40.74 ? 50   GLY A N     1 
ATOM   327   C  CA    . GLY A 1 50  ? 30.527  -2.578  2.895   1.00 38.07 ? 50   GLY A CA    1 
ATOM   328   C  C     . GLY A 1 50  ? 29.205  -2.991  3.503   1.00 37.94 ? 50   GLY A C     1 
ATOM   329   O  O     . GLY A 1 50  ? 28.723  -2.360  4.474   1.00 37.57 ? 50   GLY A O     1 
ATOM   330   N  N     . LEU A 1 51  ? 28.516  -3.918  2.855   1.00 35.80 ? 51   LEU A N     1 
ATOM   331   C  CA    . LEU A 1 51  ? 27.222  -4.366  3.334   1.00 36.54 ? 51   LEU A CA    1 
ATOM   332   C  C     . LEU A 1 51  ? 27.341  -5.441  4.414   1.00 37.56 ? 51   LEU A C     1 
ATOM   333   O  O     . LEU A 1 51  ? 26.501  -5.457  5.317   1.00 37.19 ? 51   LEU A O     1 
ATOM   334   C  CB    . LEU A 1 51  ? 26.344  -4.868  2.188   1.00 33.89 ? 51   LEU A CB    1 
ATOM   335   C  CG    . LEU A 1 51  ? 25.990  -3.776  1.156   1.00 34.53 ? 51   LEU A CG    1 
ATOM   336   C  CD1   . LEU A 1 51  ? 25.769  -4.463  -0.179  1.00 33.44 ? 51   LEU A CD1   1 
ATOM   337   C  CD2   . LEU A 1 51  ? 24.754  -3.011  1.591   1.00 33.65 ? 51   LEU A CD2   1 
ATOM   338   N  N     . SER A 1 52  ? 28.446  -6.192  4.470   1.00 38.70 ? 52   SER A N     1 
ATOM   339   C  CA    . SER A 1 52  ? 28.509  -7.278  5.450   1.00 41.24 ? 52   SER A CA    1 
ATOM   340   C  C     . SER A 1 52  ? 28.978  -6.827  6.830   1.00 41.47 ? 52   SER A C     1 
ATOM   341   O  O     . SER A 1 52  ? 29.929  -6.047  6.912   1.00 41.00 ? 52   SER A O     1 
ATOM   342   C  CB    . SER A 1 52  ? 29.455  -8.422  5.045   1.00 40.82 ? 52   SER A CB    1 
ATOM   343   O  OG    . SER A 1 52  ? 30.781  -7.981  5.288   1.00 49.99 ? 52   SER A OG    1 
ATOM   344   N  N     . ARG A 1 53  ? 28.351  -7.395  7.852   1.00 41.18 ? 53   ARG A N     1 
ATOM   345   C  CA    . ARG A 1 53  ? 28.797  -7.092  9.205   1.00 42.84 ? 53   ARG A CA    1 
ATOM   346   C  C     . ARG A 1 53  ? 30.207  -7.614  9.493   1.00 43.68 ? 53   ARG A C     1 
ATOM   347   O  O     . ARG A 1 53  ? 30.783  -7.128  10.477  1.00 43.26 ? 53   ARG A O     1 
ATOM   348   C  CB    . ARG A 1 53  ? 27.777  -7.683  10.197  1.00 45.63 ? 53   ARG A CB    1 
ATOM   349   C  CG    . ARG A 1 53  ? 28.237  -9.061  10.656  1.00 46.76 ? 53   ARG A CG    1 
ATOM   350   C  CD    . ARG A 1 53  ? 27.120  -10.075 10.528  1.00 48.31 ? 53   ARG A CD    1 
ATOM   351   N  NE    . ARG A 1 53  ? 25.901  -9.490  11.034  1.00 46.61 ? 53   ARG A NE    1 
ATOM   352   C  CZ    . ARG A 1 53  ? 24.704  -9.744  10.529  1.00 50.27 ? 53   ARG A CZ    1 
ATOM   353   N  NH1   . ARG A 1 53  ? 24.525  -10.565 9.493   1.00 48.87 ? 53   ARG A NH1   1 
ATOM   354   N  NH2   . ARG A 1 53  ? 23.735  -9.067  11.127  1.00 50.70 ? 53   ARG A NH2   1 
ATOM   355   N  N     . ASP A 1 54  ? 30.797  -8.523  8.713   1.00 44.05 ? 54   ASP A N     1 
ATOM   356   C  CA    . ASP A 1 54  ? 32.136  -8.990  8.985   1.00 46.91 ? 54   ASP A CA    1 
ATOM   357   C  C     . ASP A 1 54  ? 33.262  -8.100  8.467   1.00 49.22 ? 54   ASP A C     1 
ATOM   358   O  O     . ASP A 1 54  ? 34.462  -8.418  8.695   1.00 52.28 ? 54   ASP A O     1 
ATOM   359   C  CB    . ASP A 1 54  ? 32.436  -10.370 8.418   1.00 48.17 ? 54   ASP A CB    1 
ATOM   360   C  CG    . ASP A 1 54  ? 31.527  -11.438 8.999   1.00 54.43 ? 54   ASP A CG    1 
ATOM   361   O  OD1   . ASP A 1 54  ? 31.099  -11.296 10.169  1.00 54.45 ? 54   ASP A OD1   1 
ATOM   362   O  OD2   . ASP A 1 54  ? 31.264  -12.410 8.244   1.00 57.09 ? 54   ASP A OD2   1 
ATOM   363   N  N     . PHE A 1 55  ? 32.938  -7.155  7.603   1.00 48.14 ? 55   PHE A N     1 
ATOM   364   C  CA    . PHE A 1 55  ? 33.985  -6.323  7.050   1.00 47.94 ? 55   PHE A CA    1 
ATOM   365   C  C     . PHE A 1 55  ? 33.613  -4.856  6.995   1.00 46.86 ? 55   PHE A C     1 
ATOM   366   O  O     . PHE A 1 55  ? 34.440  -4.176  6.415   1.00 48.76 ? 55   PHE A O     1 
ATOM   367   C  CB    . PHE A 1 55  ? 34.399  -6.740  5.654   1.00 49.83 ? 55   PHE A CB    1 
ATOM   368   C  CG    . PHE A 1 55  ? 34.696  -8.196  5.447   1.00 53.21 ? 55   PHE A CG    1 
ATOM   369   C  CD1   . PHE A 1 55  ? 35.891  -8.744  5.881   1.00 49.70 ? 55   PHE A CD1   1 
ATOM   370   C  CD2   . PHE A 1 55  ? 33.766  -9.015  4.811   1.00 48.69 ? 55   PHE A CD2   1 
ATOM   371   C  CE1   . PHE A 1 55  ? 36.137  -10.093 5.668   1.00 53.56 ? 55   PHE A CE1   1 
ATOM   372   C  CE2   . PHE A 1 55  ? 34.032  -10.350 4.585   1.00 48.38 ? 55   PHE A CE2   1 
ATOM   373   C  CZ    . PHE A 1 55  ? 35.217  -10.911 5.033   1.00 51.11 ? 55   PHE A CZ    1 
ATOM   374   N  N     . ASN A 1 56  ? 32.578  -4.349  7.595   1.00 45.39 ? 56   ASN A N     1 
ATOM   375   C  CA    . ASN A 1 56  ? 32.154  -2.977  7.411   1.00 45.44 ? 56   ASN A CA    1 
ATOM   376   C  C     . ASN A 1 56  ? 32.954  -1.940  8.174   1.00 44.93 ? 56   ASN A C     1 
ATOM   377   O  O     . ASN A 1 56  ? 33.150  -0.781  7.829   1.00 41.65 ? 56   ASN A O     1 
ATOM   378   C  CB    . ASN A 1 56  ? 30.643  -2.912  7.796   1.00 42.29 ? 56   ASN A CB    1 
ATOM   379   C  CG    . ASN A 1 56  ? 30.235  -1.460  7.900   1.00 45.37 ? 56   ASN A CG    1 
ATOM   380   O  OD1   . ASN A 1 56  ? 29.862  -0.904  6.862   1.00 47.26 ? 56   ASN A OD1   1 
ATOM   381   N  ND2   . ASN A 1 56  ? 30.448  -0.853  9.054   1.00 40.21 ? 56   ASN A ND2   1 
ATOM   382   N  N     . PRO A 1 57  ? 33.376  -2.313  9.378   1.00 47.69 ? 57   PRO A N     1 
ATOM   383   C  CA    . PRO A 1 57  ? 34.061  -1.406  10.293  1.00 47.78 ? 57   PRO A CA    1 
ATOM   384   C  C     . PRO A 1 57  ? 35.389  -0.924  9.738   1.00 47.88 ? 57   PRO A C     1 
ATOM   385   O  O     . PRO A 1 57  ? 35.814  0.177   10.097  1.00 47.89 ? 57   PRO A O     1 
ATOM   386   C  CB    . PRO A 1 57  ? 34.212  -2.239  11.557  1.00 49.05 ? 57   PRO A CB    1 
ATOM   387   C  CG    . PRO A 1 57  ? 33.162  -3.288  11.444  1.00 48.50 ? 57   PRO A CG    1 
ATOM   388   C  CD    . PRO A 1 57  ? 33.188  -3.674  9.977   1.00 47.82 ? 57   PRO A CD    1 
ATOM   389   N  N     . THR A 1 58  ? 35.986  -1.633  8.789   1.00 47.09 ? 58   THR A N     1 
ATOM   390   C  CA    . THR A 1 58  ? 37.195  -1.194  8.135   1.00 47.81 ? 58   THR A CA    1 
ATOM   391   C  C     . THR A 1 58  ? 37.033  -0.891  6.644   1.00 47.57 ? 58   THR A C     1 
ATOM   392   O  O     . THR A 1 58  ? 37.979  -0.479  5.958   1.00 47.01 ? 58   THR A O     1 
ATOM   393   C  CB    . THR A 1 58  ? 38.340  -2.225  8.321   1.00 50.36 ? 58   THR A CB    1 
ATOM   394   O  OG1   . THR A 1 58  ? 37.946  -3.470  7.709   1.00 53.56 ? 58   THR A OG1   1 
ATOM   395   C  CG2   . THR A 1 58  ? 38.588  -2.442  9.810   1.00 49.09 ? 58   THR A CG2   1 
ATOM   396   N  N     . ALA A 1 59  ? 35.847  -1.112  6.090   1.00 46.23 ? 59   ALA A N     1 
ATOM   397   C  CA    . ALA A 1 59  ? 35.515  -0.830  4.690   1.00 43.65 ? 59   ALA A CA    1 
ATOM   398   C  C     . ALA A 1 59  ? 35.733  0.616   4.305   1.00 43.16 ? 59   ALA A C     1 
ATOM   399   O  O     . ALA A 1 59  ? 35.444  1.511   5.107   1.00 44.11 ? 59   ALA A O     1 
ATOM   400   C  CB    . ALA A 1 59  ? 34.020  -1.158  4.591   1.00 41.06 ? 59   ALA A CB    1 
ATOM   401   N  N     . THR A 1 60  ? 36.160  0.964   3.086   1.00 42.93 ? 60   THR A N     1 
ATOM   402   C  CA    . THR A 1 60  ? 36.308  2.377   2.716   1.00 40.72 ? 60   THR A CA    1 
ATOM   403   C  C     . THR A 1 60  ? 35.056  2.899   2.023   1.00 37.42 ? 60   THR A C     1 
ATOM   404   O  O     . THR A 1 60  ? 34.706  4.066   2.090   1.00 35.10 ? 60   THR A O     1 
ATOM   405   C  CB    . THR A 1 60  ? 37.584  2.707   1.956   1.00 43.09 ? 60   THR A CB    1 
ATOM   406   O  OG1   . THR A 1 60  ? 37.818  1.874   0.824   1.00 52.69 ? 60   THR A OG1   1 
ATOM   407   C  CG2   . THR A 1 60  ? 38.800  2.655   2.874   1.00 44.03 ? 60   THR A CG2   1 
ATOM   408   N  N     . VAL A 1 61  ? 34.287  1.977   1.451   1.00 35.36 ? 61   VAL A N     1 
ATOM   409   C  CA    . VAL A 1 61  ? 33.001  2.245   0.833   1.00 32.91 ? 61   VAL A CA    1 
ATOM   410   C  C     . VAL A 1 61  ? 31.860  1.927   1.791   1.00 31.59 ? 61   VAL A C     1 
ATOM   411   O  O     . VAL A 1 61  ? 31.284  0.850   1.785   1.00 32.36 ? 61   VAL A O     1 
ATOM   412   C  CB    . VAL A 1 61  ? 32.786  1.429   -0.464  1.00 30.50 ? 61   VAL A CB    1 
ATOM   413   C  CG1   . VAL A 1 61  ? 31.502  1.956   -1.107  1.00 23.88 ? 61   VAL A CG1   1 
ATOM   414   C  CG2   . VAL A 1 61  ? 34.032  1.601   -1.315  1.00 28.85 ? 61   VAL A CG2   1 
ATOM   415   N  N     . LYS A 1 62  ? 31.406  2.916   2.543   1.00 30.65 ? 62   LYS A N     1 
ATOM   416   C  CA    . LYS A 1 62  ? 30.533  2.759   3.671   1.00 31.49 ? 62   LYS A CA    1 
ATOM   417   C  C     . LYS A 1 62  ? 29.161  2.162   3.463   1.00 34.22 ? 62   LYS A C     1 
ATOM   418   O  O     . LYS A 1 62  ? 28.519  1.720   4.428   1.00 33.85 ? 62   LYS A O     1 
ATOM   419   C  CB    . LYS A 1 62  ? 30.420  4.040   4.480   1.00 30.54 ? 62   LYS A CB    1 
ATOM   420   C  CG    . LYS A 1 62  ? 31.744  4.432   5.119   1.00 35.39 ? 62   LYS A CG    1 
ATOM   421   C  CD    . LYS A 1 62  ? 31.538  5.722   5.895   1.00 37.42 ? 62   LYS A CD    1 
ATOM   422   C  CE    . LYS A 1 62  ? 32.161  6.905   5.194   1.00 41.05 ? 62   LYS A CE    1 
ATOM   423   N  NZ    . LYS A 1 62  ? 31.190  7.775   4.461   1.00 42.72 ? 62   LYS A NZ    1 
ATOM   424   N  N     . MET A 1 63  ? 28.743  2.158   2.199   1.00 35.34 ? 63   MET A N     1 
ATOM   425   C  CA    . MET A 1 63  ? 27.486  1.524   1.796   1.00 34.15 ? 63   MET A CA    1 
ATOM   426   C  C     . MET A 1 63  ? 26.414  1.878   2.801   1.00 34.97 ? 63   MET A C     1 
ATOM   427   O  O     . MET A 1 63  ? 25.928  0.971   3.483   1.00 35.57 ? 63   MET A O     1 
ATOM   428   C  CB    . MET A 1 63  ? 27.702  -0.011  1.726   1.00 30.52 ? 63   MET A CB    1 
ATOM   429   C  CG    . MET A 1 63  ? 28.742  -0.375  0.662   1.00 33.03 ? 63   MET A CG    1 
ATOM   430   S  SD    . MET A 1 63  ? 28.174  0.192   -0.977  1.00 33.69 ? 63   MET A SD    1 
ATOM   431   C  CE    . MET A 1 63  ? 27.013  -1.185  -1.247  1.00 30.57 ? 63   MET A CE    1 
ATOM   432   N  N     . LEU A 1 64  ? 26.016  3.146   2.975   1.00 34.93 ? 64   LEU A N     1 
ATOM   433   C  CA    . LEU A 1 64  ? 25.208  3.540   4.115   1.00 33.18 ? 64   LEU A CA    1 
ATOM   434   C  C     . LEU A 1 64  ? 23.709  3.494   3.935   1.00 34.78 ? 64   LEU A C     1 
ATOM   435   O  O     . LEU A 1 64  ? 23.187  3.935   2.893   1.00 35.50 ? 64   LEU A O     1 
ATOM   436   C  CB    . LEU A 1 64  ? 25.541  4.941   4.622   1.00 28.44 ? 64   LEU A CB    1 
ATOM   437   C  CG    . LEU A 1 64  ? 26.968  5.355   5.004   1.00 34.70 ? 64   LEU A CG    1 
ATOM   438   C  CD1   . LEU A 1 64  ? 27.133  6.875   4.727   1.00 29.60 ? 64   LEU A CD1   1 
ATOM   439   C  CD2   . LEU A 1 64  ? 27.346  5.040   6.461   1.00 24.66 ? 64   LEU A CD2   1 
ATOM   440   N  N     . PRO A 1 65  ? 23.000  3.032   4.966   1.00 34.39 ? 65   PRO A N     1 
ATOM   441   C  CA    . PRO A 1 65  ? 21.526  2.964   4.981   1.00 34.58 ? 65   PRO A CA    1 
ATOM   442   C  C     . PRO A 1 65  ? 20.852  4.317   5.031   1.00 34.62 ? 65   PRO A C     1 
ATOM   443   O  O     . PRO A 1 65  ? 21.378  5.219   5.710   1.00 35.92 ? 65   PRO A O     1 
ATOM   444   C  CB    . PRO A 1 65  ? 21.234  2.263   6.333   1.00 35.36 ? 65   PRO A CB    1 
ATOM   445   C  CG    . PRO A 1 65  ? 22.469  1.397   6.546   1.00 34.60 ? 65   PRO A CG    1 
ATOM   446   C  CD    . PRO A 1 65  ? 23.589  2.344   6.136   1.00 33.16 ? 65   PRO A CD    1 
ATOM   447   N  N     . THR A 1 66  ? 19.796  4.582   4.271   1.00 34.01 ? 66   THR A N     1 
ATOM   448   C  CA    . THR A 1 66  ? 19.182  5.935   4.160   1.00 33.91 ? 66   THR A CA    1 
ATOM   449   C  C     . THR A 1 66  ? 17.747  5.977   4.659   1.00 34.96 ? 66   THR A C     1 
ATOM   450   O  O     . THR A 1 66  ? 17.152  7.065   4.759   1.00 34.77 ? 66   THR A O     1 
ATOM   451   C  CB    . THR A 1 66  ? 19.023  6.267   2.639   1.00 29.34 ? 66   THR A CB    1 
ATOM   452   O  OG1   . THR A 1 66  ? 18.442  4.980   2.159   1.00 39.36 ? 66   THR A OG1   1 
ATOM   453   C  CG2   . THR A 1 66  ? 20.418  6.234   2.010   1.00 26.59 ? 66   THR A CG2   1 
ATOM   454   N  N     . PHE A 1 67  ? 17.182  4.806   4.967   1.00 35.69 ? 67   PHE A N     1 
ATOM   455   C  CA    . PHE A 1 67  ? 15.798  4.711   5.399   1.00 38.13 ? 67   PHE A CA    1 
ATOM   456   C  C     . PHE A 1 67  ? 14.765  5.023   4.331   1.00 38.71 ? 67   PHE A C     1 
ATOM   457   O  O     . PHE A 1 67  ? 13.619  5.312   4.658   1.00 40.26 ? 67   PHE A O     1 
ATOM   458   C  CB    . PHE A 1 67  ? 15.491  5.384   6.759   1.00 32.45 ? 67   PHE A CB    1 
ATOM   459   C  CG    . PHE A 1 67  ? 16.162  4.459   7.760   1.00 37.71 ? 67   PHE A CG    1 
ATOM   460   C  CD1   . PHE A 1 67  ? 17.512  4.579   8.012   1.00 42.36 ? 67   PHE A CD1   1 
ATOM   461   C  CD2   . PHE A 1 67  ? 15.468  3.399   8.319   1.00 40.09 ? 67   PHE A CD2   1 
ATOM   462   C  CE1   . PHE A 1 67  ? 18.177  3.644   8.801   1.00 44.13 ? 67   PHE A CE1   1 
ATOM   463   C  CE2   . PHE A 1 67  ? 16.110  2.479   9.126   1.00 40.29 ? 67   PHE A CE2   1 
ATOM   464   C  CZ    . PHE A 1 67  ? 17.461  2.597   9.350   1.00 41.25 ? 67   PHE A CZ    1 
ATOM   465   N  N     . VAL A 1 68  ? 15.161  5.081   3.061   1.00 38.70 ? 68   VAL A N     1 
ATOM   466   C  CA    . VAL A 1 68  ? 14.234  5.413   1.970   1.00 36.64 ? 68   VAL A CA    1 
ATOM   467   C  C     . VAL A 1 68  ? 13.837  4.084   1.370   1.00 37.64 ? 68   VAL A C     1 
ATOM   468   O  O     . VAL A 1 68  ? 14.788  3.317   1.081   1.00 36.67 ? 68   VAL A O     1 
ATOM   469   C  CB    . VAL A 1 68  ? 14.888  6.253   0.859   1.00 34.75 ? 68   VAL A CB    1 
ATOM   470   C  CG1   . VAL A 1 68  ? 13.904  6.575   -0.265  1.00 35.47 ? 68   VAL A CG1   1 
ATOM   471   C  CG2   . VAL A 1 68  ? 15.427  7.563   1.435   1.00 30.35 ? 68   VAL A CG2   1 
ATOM   472   N  N     . ARG A 1 69  ? 12.601  3.601   1.492   1.00 39.44 ? 69   ARG A N     1 
ATOM   473   C  CA    . ARG A 1 69  ? 12.363  2.191   1.127   1.00 41.70 ? 69   ARG A CA    1 
ATOM   474   C  C     . ARG A 1 69  ? 11.911  1.993   -0.306  1.00 42.36 ? 69   ARG A C     1 
ATOM   475   O  O     . ARG A 1 69  ? 11.971  0.881   -0.851  1.00 42.31 ? 69   ARG A O     1 
ATOM   476   C  CB    . ARG A 1 69  ? 11.552  1.444   2.171   1.00 47.19 ? 69   ARG A CB    1 
ATOM   477   C  CG    . ARG A 1 69  ? 12.192  1.430   3.562   1.00 49.59 ? 69   ARG A CG    1 
ATOM   478   C  CD    . ARG A 1 69  ? 11.344  0.625   4.536   1.00 51.82 ? 69   ARG A CD    1 
ATOM   479   N  NE    . ARG A 1 69  ? 12.161  -0.193  5.461   1.00 60.45 ? 69   ARG A NE    1 
ATOM   480   C  CZ    . ARG A 1 69  ? 12.570  0.302   6.634   1.00 61.48 ? 69   ARG A CZ    1 
ATOM   481   N  NH1   . ARG A 1 69  ? 12.262  1.576   6.888   1.00 64.87 ? 69   ARG A NH1   1 
ATOM   482   N  NH2   . ARG A 1 69  ? 13.284  -0.353  7.537   1.00 62.72 ? 69   ARG A NH2   1 
ATOM   483   N  N     . SER A 1 70  ? 11.562  3.123   -0.962  1.00 41.43 ? 70   SER A N     1 
ATOM   484   C  CA    . SER A 1 70  ? 11.219  3.028   -2.377  1.00 40.25 ? 70   SER A CA    1 
ATOM   485   C  C     . SER A 1 70  ? 10.977  4.368   -3.037  1.00 39.76 ? 70   SER A C     1 
ATOM   486   O  O     . SER A 1 70  ? 10.797  5.391   -2.403  1.00 38.31 ? 70   SER A O     1 
ATOM   487   C  CB    . SER A 1 70  ? 9.972   2.130   -2.484  1.00 44.59 ? 70   SER A CB    1 
ATOM   488   O  OG    . SER A 1 70  ? 8.842   2.979   -2.430  1.00 40.16 ? 70   SER A OG    1 
ATOM   489   N  N     . ILE A 1 71  ? 10.902  4.366   -4.351  1.00 40.40 ? 71   ILE A N     1 
ATOM   490   C  CA    . ILE A 1 71  ? 10.697  5.541   -5.245  1.00 40.06 ? 71   ILE A CA    1 
ATOM   491   C  C     . ILE A 1 71  ? 9.270   5.983   -5.084  1.00 40.31 ? 71   ILE A C     1 
ATOM   492   O  O     . ILE A 1 71  ? 8.511   5.209   -4.509  1.00 40.82 ? 71   ILE A O     1 
ATOM   493   C  CB    . ILE A 1 71  ? 11.172  4.970   -6.547  1.00 43.33 ? 71   ILE A CB    1 
ATOM   494   C  CG1   . ILE A 1 71  ? 12.659  5.240   -6.757  1.00 38.85 ? 71   ILE A CG1   1 
ATOM   495   C  CG2   . ILE A 1 71  ? 10.395  4.599   -7.750  1.00 40.10 ? 71   ILE A CG2   1 
ATOM   496   C  CD1   . ILE A 1 71  ? 12.958  6.351   -7.706  1.00 48.86 ? 71   ILE A CD1   1 
ATOM   497   N  N     . PRO A 1 72  ? 8.941   7.247   -5.231  1.00 41.06 ? 72   PRO A N     1 
ATOM   498   C  CA    . PRO A 1 72  ? 7.609   7.792   -4.994  1.00 42.85 ? 72   PRO A CA    1 
ATOM   499   C  C     . PRO A 1 72  ? 6.529   6.953   -5.636  1.00 44.30 ? 72   PRO A C     1 
ATOM   500   O  O     . PRO A 1 72  ? 6.820   6.431   -6.700  1.00 45.70 ? 72   PRO A O     1 
ATOM   501   C  CB    . PRO A 1 72  ? 7.671   9.168   -5.687  1.00 41.38 ? 72   PRO A CB    1 
ATOM   502   C  CG    . PRO A 1 72  ? 9.109   9.547   -5.558  1.00 41.13 ? 72   PRO A CG    1 
ATOM   503   C  CD    . PRO A 1 72  ? 9.866   8.273   -5.780  1.00 40.70 ? 72   PRO A CD    1 
ATOM   504   N  N     . ASP A 1 73  ? 5.357   6.738   -5.085  1.00 48.11 ? 73   ASP A N     1 
ATOM   505   C  CA    . ASP A 1 73  ? 4.354   5.925   -5.802  1.00 52.03 ? 73   ASP A CA    1 
ATOM   506   C  C     . ASP A 1 73  ? 3.163   6.794   -6.208  1.00 54.53 ? 73   ASP A C     1 
ATOM   507   O  O     . ASP A 1 73  ? 2.110   6.285   -6.626  1.00 56.69 ? 73   ASP A O     1 
ATOM   508   C  CB    . ASP A 1 73  ? 3.820   4.750   -4.981  1.00 48.44 ? 73   ASP A CB    1 
ATOM   509   C  CG    . ASP A 1 73  ? 3.322   5.271   -3.647  1.00 48.05 ? 73   ASP A CG    1 
ATOM   510   O  OD1   . ASP A 1 73  ? 2.935   6.470   -3.620  1.00 46.94 ? 73   ASP A OD1   1 
ATOM   511   O  OD2   . ASP A 1 73  ? 3.413   4.480   -2.686  1.00 48.76 ? 73   ASP A OD2   1 
ATOM   512   N  N     . GLY A 1 74  ? 3.291   8.095   -5.925  1.00 55.27 ? 74   GLY A N     1 
ATOM   513   C  CA    . GLY A 1 74  ? 2.263   9.009   -6.389  1.00 55.27 ? 74   GLY A CA    1 
ATOM   514   C  C     . GLY A 1 74  ? 1.192   9.307   -5.367  1.00 54.98 ? 74   GLY A C     1 
ATOM   515   O  O     . GLY A 1 74  ? 0.339   10.157  -5.652  1.00 55.72 ? 74   GLY A O     1 
ATOM   516   N  N     . SER A 1 75  ? 1.262   8.741   -4.173  1.00 54.48 ? 75   SER A N     1 
ATOM   517   C  CA    . SER A 1 75  ? 0.284   9.137   -3.156  1.00 54.09 ? 75   SER A CA    1 
ATOM   518   C  C     . SER A 1 75  ? 0.779   10.391  -2.443  1.00 54.67 ? 75   SER A C     1 
ATOM   519   O  O     . SER A 1 75  ? 0.030   10.915  -1.613  1.00 54.38 ? 75   SER A O     1 
ATOM   520   C  CB    . SER A 1 75  ? 0.097   8.018   -2.137  1.00 53.68 ? 75   SER A CB    1 
ATOM   521   O  OG    . SER A 1 75  ? 1.357   7.436   -1.849  1.00 62.21 ? 75   SER A OG    1 
ATOM   522   N  N     . GLU A 1 76  ? 2.026   10.824  -2.740  1.00 54.24 ? 76   GLU A N     1 
ATOM   523   C  CA    . GLU A 1 76  ? 2.538   11.943  -1.948  1.00 54.14 ? 76   GLU A CA    1 
ATOM   524   C  C     . GLU A 1 76  ? 1.679   13.175  -2.158  1.00 53.53 ? 76   GLU A C     1 
ATOM   525   O  O     . GLU A 1 76  ? 1.398   13.503  -3.297  1.00 54.29 ? 76   GLU A O     1 
ATOM   526   C  CB    . GLU A 1 76  ? 4.017   12.242  -2.170  1.00 53.67 ? 76   GLU A CB    1 
ATOM   527   C  CG    . GLU A 1 76  ? 4.917   11.041  -1.912  1.00 50.26 ? 76   GLU A CG    1 
ATOM   528   C  CD    . GLU A 1 76  ? 4.882   10.059  -3.067  1.00 50.50 ? 76   GLU A CD    1 
ATOM   529   O  OE1   . GLU A 1 76  ? 4.240   10.392  -4.091  1.00 50.82 ? 76   GLU A OE1   1 
ATOM   530   O  OE2   . GLU A 1 76  ? 5.465   8.948   -2.959  1.00 48.95 ? 76   GLU A OE2   1 
ATOM   531   N  N     . LYS A 1 77  ? 1.288   13.872  -1.111  1.00 52.98 ? 77   LYS A N     1 
ATOM   532   C  CA    . LYS A 1 77  ? 0.510   15.082  -1.270  1.00 53.01 ? 77   LYS A CA    1 
ATOM   533   C  C     . LYS A 1 77  ? 0.755   15.977  -0.059  1.00 52.62 ? 77   LYS A C     1 
ATOM   534   O  O     . LYS A 1 77  ? 0.943   15.449  1.037   1.00 52.45 ? 77   LYS A O     1 
ATOM   535   C  CB    . LYS A 1 77  ? -0.979  14.783  -1.442  1.00 61.02 ? 77   LYS A CB    1 
ATOM   536   C  CG    . LYS A 1 77  ? -1.838  14.761  -0.186  1.00 66.04 ? 77   LYS A CG    1 
ATOM   537   C  CD    . LYS A 1 77  ? -3.294  15.086  -0.483  1.00 66.23 ? 77   LYS A CD    1 
ATOM   538   C  CE    . LYS A 1 77  ? -4.288  14.224  0.257   1.00 72.17 ? 77   LYS A CE    1 
ATOM   539   N  NZ    . LYS A 1 77  ? -4.490  12.842  -0.290  1.00 72.51 ? 77   LYS A NZ    1 
ATOM   540   N  N     . GLY A 1 78  ? 0.773   17.295  -0.298  1.00 51.21 ? 78   GLY A N     1 
ATOM   541   C  CA    . GLY A 1 78  ? 1.013   18.221  0.796   1.00 50.53 ? 78   GLY A CA    1 
ATOM   542   C  C     . GLY A 1 78  ? 2.030   19.266  0.374   1.00 51.20 ? 78   GLY A C     1 
ATOM   543   O  O     . GLY A 1 78  ? 2.256   19.567  -0.803  1.00 51.25 ? 78   GLY A O     1 
ATOM   544   N  N     . ASP A 1 79  ? 2.552   19.949  1.394   1.00 52.22 ? 79   ASP A N     1 
ATOM   545   C  CA    . ASP A 1 79  ? 3.397   21.122  1.134   1.00 52.27 ? 79   ASP A CA    1 
ATOM   546   C  C     . ASP A 1 79  ? 4.442   21.293  2.219   1.00 52.52 ? 79   ASP A C     1 
ATOM   547   O  O     . ASP A 1 79  ? 4.213   20.941  3.382   1.00 52.69 ? 79   ASP A O     1 
ATOM   548   C  CB    . ASP A 1 79  ? 2.481   22.293  0.891   1.00 54.24 ? 79   ASP A CB    1 
ATOM   549   C  CG    . ASP A 1 79  ? 2.878   23.633  1.447   1.00 57.45 ? 79   ASP A CG    1 
ATOM   550   O  OD1   . ASP A 1 79  ? 3.693   24.368  0.840   1.00 59.36 ? 79   ASP A OD1   1 
ATOM   551   O  OD2   . ASP A 1 79  ? 2.316   24.029  2.495   1.00 62.65 ? 79   ASP A OD2   1 
ATOM   552   N  N     . PHE A 1 80  ? 5.688   21.430  1.759   1.00 51.70 ? 80   PHE A N     1 
ATOM   553   C  CA    . PHE A 1 80  ? 6.860   21.281  2.600   1.00 51.51 ? 80   PHE A CA    1 
ATOM   554   C  C     . PHE A 1 80  ? 8.053   22.033  2.015   1.00 50.84 ? 80   PHE A C     1 
ATOM   555   O  O     . PHE A 1 80  ? 8.040   22.436  0.855   1.00 50.70 ? 80   PHE A O     1 
ATOM   556   C  CB    . PHE A 1 80  ? 7.332   19.825  2.673   1.00 54.58 ? 80   PHE A CB    1 
ATOM   557   C  CG    . PHE A 1 80  ? 6.424   18.724  2.219   1.00 51.38 ? 80   PHE A CG    1 
ATOM   558   C  CD1   . PHE A 1 80  ? 5.888   18.705  0.941   1.00 53.97 ? 80   PHE A CD1   1 
ATOM   559   C  CD2   . PHE A 1 80  ? 6.078   17.734  3.113   1.00 52.12 ? 80   PHE A CD2   1 
ATOM   560   C  CE1   . PHE A 1 80  ? 5.034   17.688  0.571   1.00 55.79 ? 80   PHE A CE1   1 
ATOM   561   C  CE2   . PHE A 1 80  ? 5.219   16.718  2.746   1.00 53.70 ? 80   PHE A CE2   1 
ATOM   562   C  CZ    . PHE A 1 80  ? 4.709   16.673  1.463   1.00 53.75 ? 80   PHE A CZ    1 
ATOM   563   N  N     . ILE A 1 81  ? 8.950   22.448  2.904   1.00 50.53 ? 81   ILE A N     1 
ATOM   564   C  CA    . ILE A 1 81  ? 10.150  23.177  2.497   1.00 50.49 ? 81   ILE A CA    1 
ATOM   565   C  C     . ILE A 1 81  ? 11.157  22.173  1.929   1.00 52.29 ? 81   ILE A C     1 
ATOM   566   O  O     . ILE A 1 81  ? 10.737  21.255  1.224   1.00 55.80 ? 81   ILE A O     1 
ATOM   567   C  CB    . ILE A 1 81  ? 10.753  23.915  3.693   1.00 47.47 ? 81   ILE A CB    1 
ATOM   568   C  CG1   . ILE A 1 81  ? 9.693   24.632  4.516   1.00 52.21 ? 81   ILE A CG1   1 
ATOM   569   C  CG2   . ILE A 1 81  ? 11.854  24.867  3.269   1.00 43.96 ? 81   ILE A CG2   1 
ATOM   570   C  CD1   . ILE A 1 81  ? 9.237   26.007  4.076   1.00 53.34 ? 81   ILE A CD1   1 
ATOM   571   N  N     . ALA A 1 82  ? 12.446  22.396  2.188   1.00 51.63 ? 82   ALA A N     1 
ATOM   572   C  CA    . ALA A 1 82  ? 13.447  21.474  1.610   1.00 50.52 ? 82   ALA A CA    1 
ATOM   573   C  C     . ALA A 1 82  ? 14.796  22.171  1.501   1.00 49.18 ? 82   ALA A C     1 
ATOM   574   O  O     . ALA A 1 82  ? 14.858  23.211  0.796   1.00 48.95 ? 82   ALA A O     1 
ATOM   575   C  CB    . ALA A 1 82  ? 12.964  21.202  0.186   1.00 51.55 ? 82   ALA A CB    1 
ATOM   576   N  N     . LEU A 1 83  ? 15.777  21.825  2.321   1.00 48.03 ? 83   LEU A N     1 
ATOM   577   C  CA    . LEU A 1 83  ? 17.040  22.569  2.313   1.00 46.00 ? 83   LEU A CA    1 
ATOM   578   C  C     . LEU A 1 83  ? 18.091  21.852  1.486   1.00 45.23 ? 83   LEU A C     1 
ATOM   579   O  O     . LEU A 1 83  ? 18.148  20.606  1.537   1.00 46.16 ? 83   LEU A O     1 
ATOM   580   C  CB    . LEU A 1 83  ? 17.522  22.837  3.737   1.00 45.52 ? 83   LEU A CB    1 
ATOM   581   C  CG    . LEU A 1 83  ? 16.519  23.519  4.669   1.00 45.33 ? 83   LEU A CG    1 
ATOM   582   C  CD1   . LEU A 1 83  ? 16.805  23.339  6.138   1.00 47.67 ? 83   LEU A CD1   1 
ATOM   583   C  CD2   . LEU A 1 83  ? 16.440  24.999  4.303   1.00 47.40 ? 83   LEU A CD2   1 
ATOM   584   N  N     . ASP A 1 84  ? 18.875  22.586  0.699   1.00 42.85 ? 84   ASP A N     1 
ATOM   585   C  CA    . ASP A 1 84  ? 19.862  21.916  -0.158  1.00 41.90 ? 84   ASP A CA    1 
ATOM   586   C  C     . ASP A 1 84  ? 21.279  22.393  0.133   1.00 40.86 ? 84   ASP A C     1 
ATOM   587   O  O     . ASP A 1 84  ? 21.632  23.437  -0.413  1.00 39.89 ? 84   ASP A O     1 
ATOM   588   C  CB    . ASP A 1 84  ? 19.498  22.099  -1.627  1.00 42.10 ? 84   ASP A CB    1 
ATOM   589   C  CG    . ASP A 1 84  ? 20.194  21.177  -2.592  1.00 42.27 ? 84   ASP A CG    1 
ATOM   590   O  OD1   . ASP A 1 84  ? 21.099  20.395  -2.238  1.00 42.80 ? 84   ASP A OD1   1 
ATOM   591   O  OD2   . ASP A 1 84  ? 19.863  21.216  -3.795  1.00 45.84 ? 84   ASP A OD2   1 
ATOM   592   N  N     . LEU A 1 85  ? 21.991  21.665  1.006   1.00 40.52 ? 85   LEU A N     1 
ATOM   593   C  CA    . LEU A 1 85  ? 23.295  22.118  1.468   1.00 38.22 ? 85   LEU A CA    1 
ATOM   594   C  C     . LEU A 1 85  ? 24.443  21.156  1.147   1.00 38.10 ? 85   LEU A C     1 
ATOM   595   O  O     . LEU A 1 85  ? 24.450  19.965  1.448   1.00 40.05 ? 85   LEU A O     1 
ATOM   596   C  CB    . LEU A 1 85  ? 23.342  22.470  2.965   1.00 33.88 ? 85   LEU A CB    1 
ATOM   597   C  CG    . LEU A 1 85  ? 24.635  23.073  3.519   1.00 30.07 ? 85   LEU A CG    1 
ATOM   598   C  CD1   . LEU A 1 85  ? 24.890  24.450  2.907   1.00 31.52 ? 85   LEU A CD1   1 
ATOM   599   C  CD2   . LEU A 1 85  ? 24.579  23.264  5.027   1.00 32.82 ? 85   LEU A CD2   1 
ATOM   600   N  N     . GLY A 1 86  ? 25.468  21.765  0.525   1.00 36.50 ? 86   GLY A N     1 
ATOM   601   C  CA    . GLY A 1 86  ? 26.694  21.094  0.207   1.00 35.89 ? 86   GLY A CA    1 
ATOM   602   C  C     . GLY A 1 86  ? 27.144  20.901  -1.215  1.00 35.38 ? 86   GLY A C     1 
ATOM   603   O  O     . GLY A 1 86  ? 28.280  20.419  -1.426  1.00 36.67 ? 86   GLY A O     1 
ATOM   604   N  N     . GLY A 1 87  ? 26.397  21.313  -2.209  1.00 33.49 ? 87   GLY A N     1 
ATOM   605   C  CA    . GLY A 1 87  ? 26.763  21.358  -3.607  1.00 31.70 ? 87   GLY A CA    1 
ATOM   606   C  C     . GLY A 1 87  ? 27.309  22.757  -3.907  1.00 33.21 ? 87   GLY A C     1 
ATOM   607   O  O     . GLY A 1 87  ? 27.712  23.485  -2.981  1.00 33.45 ? 87   GLY A O     1 
ATOM   608   N  N     . SER A 1 88  ? 27.286  23.165  -5.174  1.00 34.87 ? 88   SER A N     1 
ATOM   609   C  CA    . SER A 1 88  ? 27.767  24.487  -5.549  1.00 37.48 ? 88   SER A CA    1 
ATOM   610   C  C     . SER A 1 88  ? 26.857  25.621  -5.100  1.00 38.00 ? 88   SER A C     1 
ATOM   611   O  O     . SER A 1 88  ? 27.358  26.745  -4.961  1.00 37.29 ? 88   SER A O     1 
ATOM   612   C  CB    . SER A 1 88  ? 27.949  24.650  -7.065  1.00 38.05 ? 88   SER A CB    1 
ATOM   613   O  OG    . SER A 1 88  ? 26.771  24.097  -7.625  1.00 41.58 ? 88   SER A OG    1 
ATOM   614   N  N     . SER A 1 89  ? 25.565  25.335  -4.920  1.00 39.26 ? 89   SER A N     1 
ATOM   615   C  CA    . SER A 1 89  ? 24.682  26.385  -4.406  1.00 39.00 ? 89   SER A CA    1 
ATOM   616   C  C     . SER A 1 89  ? 23.830  25.912  -3.244  1.00 39.28 ? 89   SER A C     1 
ATOM   617   O  O     . SER A 1 89  ? 23.215  24.857  -3.259  1.00 39.43 ? 89   SER A O     1 
ATOM   618   C  CB    . SER A 1 89  ? 23.752  26.842  -5.536  1.00 35.93 ? 89   SER A CB    1 
ATOM   619   O  OG    . SER A 1 89  ? 24.599  27.193  -6.650  1.00 46.20 ? 89   SER A OG    1 
ATOM   620   N  N     . PHE A 1 90  ? 23.801  26.700  -2.188  1.00 39.69 ? 90   PHE A N     1 
ATOM   621   C  CA    . PHE A 1 90  ? 22.869  26.502  -1.090  1.00 40.55 ? 90   PHE A CA    1 
ATOM   622   C  C     . PHE A 1 90  ? 21.482  26.979  -1.552  1.00 41.96 ? 90   PHE A C     1 
ATOM   623   O  O     . PHE A 1 90  ? 21.210  28.173  -1.612  1.00 40.29 ? 90   PHE A O     1 
ATOM   624   C  CB    . PHE A 1 90  ? 23.373  27.407  0.039   1.00 37.84 ? 90   PHE A CB    1 
ATOM   625   C  CG    . PHE A 1 90  ? 22.445  27.350  1.222   1.00 42.82 ? 90   PHE A CG    1 
ATOM   626   C  CD1   . PHE A 1 90  ? 21.551  26.291  1.344   1.00 42.85 ? 90   PHE A CD1   1 
ATOM   627   C  CD2   . PHE A 1 90  ? 22.491  28.316  2.205   1.00 41.71 ? 90   PHE A CD2   1 
ATOM   628   C  CE1   . PHE A 1 90  ? 20.681  26.245  2.415   1.00 41.32 ? 90   PHE A CE1   1 
ATOM   629   C  CE2   . PHE A 1 90  ? 21.639  28.249  3.284   1.00 39.45 ? 90   PHE A CE2   1 
ATOM   630   C  CZ    . PHE A 1 90  ? 20.729  27.208  3.394   1.00 40.59 ? 90   PHE A CZ    1 
ATOM   631   N  N     . ARG A 1 91  ? 20.570  26.052  -1.844  1.00 43.67 ? 91   ARG A N     1 
ATOM   632   C  CA    . ARG A 1 91  ? 19.259  26.433  -2.339  1.00 44.27 ? 91   ARG A CA    1 
ATOM   633   C  C     . ARG A 1 91  ? 18.169  26.193  -1.314  1.00 46.17 ? 91   ARG A C     1 
ATOM   634   O  O     . ARG A 1 91  ? 18.353  25.339  -0.433  1.00 45.91 ? 91   ARG A O     1 
ATOM   635   C  CB    . ARG A 1 91  ? 18.983  25.753  -3.665  1.00 48.65 ? 91   ARG A CB    1 
ATOM   636   C  CG    . ARG A 1 91  ? 17.510  25.657  -4.070  1.00 55.77 ? 91   ARG A CG    1 
ATOM   637   C  CD    . ARG A 1 91  ? 17.446  25.700  -5.607  1.00 61.70 ? 91   ARG A CD    1 
ATOM   638   N  NE    . ARG A 1 91  ? 18.790  25.452  -6.118  1.00 64.10 ? 91   ARG A NE    1 
ATOM   639   C  CZ    . ARG A 1 91  ? 19.320  26.066  -7.167  1.00 69.66 ? 91   ARG A CZ    1 
ATOM   640   N  NH1   . ARG A 1 91  ? 18.630  26.986  -7.836  1.00 68.56 ? 91   ARG A NH1   1 
ATOM   641   N  NH2   . ARG A 1 91  ? 20.567  25.737  -7.495  1.00 69.85 ? 91   ARG A NH2   1 
ATOM   642   N  N     . ILE A 1 92  ? 17.042  26.925  -1.393  1.00 46.26 ? 92   ILE A N     1 
ATOM   643   C  CA    . ILE A 1 92  ? 15.906  26.616  -0.547  1.00 46.94 ? 92   ILE A CA    1 
ATOM   644   C  C     . ILE A 1 92  ? 14.625  26.596  -1.346  1.00 48.39 ? 92   ILE A C     1 
ATOM   645   O  O     . ILE A 1 92  ? 14.292  27.580  -2.005  1.00 48.53 ? 92   ILE A O     1 
ATOM   646   C  CB    . ILE A 1 92  ? 15.754  27.453  0.727   1.00 47.14 ? 92   ILE A CB    1 
ATOM   647   C  CG1   . ILE A 1 92  ? 16.977  27.226  1.634   1.00 47.37 ? 92   ILE A CG1   1 
ATOM   648   C  CG2   . ILE A 1 92  ? 14.521  26.921  1.474   1.00 46.38 ? 92   ILE A CG2   1 
ATOM   649   C  CD1   . ILE A 1 92  ? 17.317  28.430  2.486   1.00 43.66 ? 92   ILE A CD1   1 
ATOM   650   N  N     . LEU A 1 93  ? 13.914  25.466  -1.366  1.00 50.65 ? 93   LEU A N     1 
ATOM   651   C  CA    . LEU A 1 93  ? 12.746  25.286  -2.207  1.00 51.36 ? 93   LEU A CA    1 
ATOM   652   C  C     . LEU A 1 93  ? 11.393  25.282  -1.481  1.00 52.34 ? 93   LEU A C     1 
ATOM   653   O  O     . LEU A 1 93  ? 11.304  25.117  -0.263  1.00 51.95 ? 93   LEU A O     1 
ATOM   654   C  CB    . LEU A 1 93  ? 12.799  23.950  -2.939  1.00 52.88 ? 93   LEU A CB    1 
ATOM   655   C  CG    . LEU A 1 93  ? 14.017  23.346  -3.583  1.00 56.47 ? 93   LEU A CG    1 
ATOM   656   C  CD1   . LEU A 1 93  ? 14.050  23.544  -5.087  1.00 50.41 ? 93   LEU A CD1   1 
ATOM   657   C  CD2   . LEU A 1 93  ? 15.320  23.770  -2.921  1.00 57.95 ? 93   LEU A CD2   1 
ATOM   658   N  N     . ARG A 1 94  ? 10.317  25.345  -2.280  1.00 52.22 ? 94   ARG A N     1 
ATOM   659   C  CA    . ARG A 1 94  ? 8.989   25.055  -1.757  1.00 52.60 ? 94   ARG A CA    1 
ATOM   660   C  C     . ARG A 1 94  ? 8.294   24.110  -2.725  1.00 53.17 ? 94   ARG A C     1 
ATOM   661   O  O     . ARG A 1 94  ? 8.415   24.295  -3.937  1.00 53.19 ? 94   ARG A O     1 
ATOM   662   C  CB    . ARG A 1 94  ? 8.107   26.228  -1.384  1.00 55.14 ? 94   ARG A CB    1 
ATOM   663   C  CG    . ARG A 1 94  ? 7.037   25.867  -0.374  1.00 51.50 ? 94   ARG A CG    1 
ATOM   664   C  CD    . ARG A 1 94  ? 6.200   27.060  0.023   1.00 54.07 ? 94   ARG A CD    1 
ATOM   665   N  NE    . ARG A 1 94  ? 4.789   26.710  0.194   1.00 48.52 ? 94   ARG A NE    1 
ATOM   666   C  CZ    . ARG A 1 94  ? 3.812   27.613  0.063   1.00 55.57 ? 94   ARG A CZ    1 
ATOM   667   N  NH1   . ARG A 1 94  ? 4.064   28.885  -0.241  1.00 51.18 ? 94   ARG A NH1   1 
ATOM   668   N  NH2   . ARG A 1 94  ? 2.562   27.178  0.232   1.00 54.63 ? 94   ARG A NH2   1 
ATOM   669   N  N     . VAL A 1 95  ? 7.799   22.986  -2.216  1.00 54.14 ? 95   VAL A N     1 
ATOM   670   C  CA    . VAL A 1 95  ? 7.258   22.000  -3.132  1.00 56.47 ? 95   VAL A CA    1 
ATOM   671   C  C     . VAL A 1 95  ? 5.805   21.657  -2.848  1.00 59.50 ? 95   VAL A C     1 
ATOM   672   O  O     . VAL A 1 95  ? 5.533   21.243  -1.714  1.00 60.42 ? 95   VAL A O     1 
ATOM   673   C  CB    . VAL A 1 95  ? 8.074   20.697  -3.060  1.00 54.04 ? 95   VAL A CB    1 
ATOM   674   C  CG1   . VAL A 1 95  ? 7.550   19.807  -4.178  1.00 48.98 ? 95   VAL A CG1   1 
ATOM   675   C  CG2   . VAL A 1 95  ? 9.546   21.053  -3.240  1.00 52.99 ? 95   VAL A CG2   1 
ATOM   676   N  N     . GLN A 1 96  ? 4.939   21.832  -3.853  1.00 60.58 ? 96   GLN A N     1 
ATOM   677   C  CA    . GLN A 1 96  ? 3.538   21.477  -3.670  1.00 62.51 ? 96   GLN A CA    1 
ATOM   678   C  C     . GLN A 1 96  ? 3.083   20.356  -4.591  1.00 63.31 ? 96   GLN A C     1 
ATOM   679   O  O     . GLN A 1 96  ? 3.528   20.231  -5.733  1.00 63.08 ? 96   GLN A O     1 
ATOM   680   C  CB    . GLN A 1 96  ? 2.641   22.710  -3.734  1.00 65.19 ? 96   GLN A CB    1 
ATOM   681   C  CG    . GLN A 1 96  ? 2.043   23.104  -2.402  1.00 69.19 ? 96   GLN A CG    1 
ATOM   682   C  CD    . GLN A 1 96  ? 0.574   22.802  -2.181  1.00 73.73 ? 96   GLN A CD    1 
ATOM   683   O  OE1   . GLN A 1 96  ? -0.200  23.719  -1.823  1.00 74.29 ? 96   GLN A OE1   1 
ATOM   684   N  NE2   . GLN A 1 96  ? 0.124   21.552  -2.308  1.00 71.86 ? 96   GLN A NE2   1 
ATOM   685   N  N     . VAL A 1 97  ? 2.322   19.410  -4.042  1.00 64.75 ? 97   VAL A N     1 
ATOM   686   C  CA    . VAL A 1 97  ? 1.644   18.373  -4.777  1.00 66.76 ? 97   VAL A CA    1 
ATOM   687   C  C     . VAL A 1 97  ? 0.415   17.849  -4.019  1.00 68.36 ? 97   VAL A C     1 
ATOM   688   O  O     . VAL A 1 97  ? 0.550   17.579  -2.827  1.00 68.48 ? 97   VAL A O     1 
ATOM   689   C  CB    . VAL A 1 97  ? 2.427   17.092  -5.092  1.00 66.10 ? 97   VAL A CB    1 
ATOM   690   C  CG1   . VAL A 1 97  ? 2.987   17.174  -6.498  1.00 70.95 ? 97   VAL A CG1   1 
ATOM   691   C  CG2   . VAL A 1 97  ? 3.456   16.751  -4.042  1.00 65.24 ? 97   VAL A CG2   1 
ATOM   692   N  N     . ASN A 1 98  ? -0.619  17.503  -4.767  1.00 69.73 ? 98   ASN A N     1 
ATOM   693   C  CA    . ASN A 1 98  ? -1.783  16.796  -4.236  1.00 71.31 ? 98   ASN A CA    1 
ATOM   694   C  C     . ASN A 1 98  ? -2.745  16.452  -5.374  1.00 72.02 ? 98   ASN A C     1 
ATOM   695   O  O     . ASN A 1 98  ? -3.753  17.122  -5.568  1.00 71.86 ? 98   ASN A O     1 
ATOM   696   C  CB    . ASN A 1 98  ? -2.467  17.486  -3.075  1.00 72.59 ? 98   ASN A CB    1 
ATOM   697   C  CG    . ASN A 1 98  ? -3.804  16.971  -2.594  1.00 73.11 ? 98   ASN A CG    1 
ATOM   698   O  OD1   . ASN A 1 98  ? -4.340  15.934  -2.999  1.00 71.20 ? 98   ASN A OD1   1 
ATOM   699   N  ND2   . ASN A 1 98  ? -4.404  17.729  -1.672  1.00 71.86 ? 98   ASN A ND2   1 
ATOM   700   N  N     . HIS A 1 99  ? -2.400  15.430  -6.167  1.00 72.80 ? 99   HIS A N     1 
ATOM   701   C  CA    . HIS A 1 99  ? -3.158  15.041  -7.347  1.00 72.67 ? 99   HIS A CA    1 
ATOM   702   C  C     . HIS A 1 99  ? -4.527  14.456  -7.056  1.00 72.69 ? 99   HIS A C     1 
ATOM   703   O  O     . HIS A 1 99  ? -5.514  15.162  -6.849  1.00 72.60 ? 99   HIS A O     1 
ATOM   704   C  CB    . HIS A 1 99  ? -2.714  13.734  -7.967  0.00 30.00 ? 99   HIS A CB    1 
ATOM   705   C  CG    . HIS A 1 99  ? -1.281  13.836  -8.570  0.00 30.00 ? 99   HIS A CG    1 
ATOM   706   N  ND1   . HIS A 1 99  ? -0.915  14.866  -9.393  0.00 30.00 ? 99   HIS A ND1   1 
ATOM   707   C  CD2   . HIS A 1 99  ? -0.200  13.022  -8.441  0.00 30.00 ? 99   HIS A CD2   1 
ATOM   708   C  CE1   . HIS A 1 99  ? 0.350   14.699  -9.737  0.00 30.00 ? 99   HIS A CE1   1 
ATOM   709   N  NE2   . HIS A 1 99  ? 0.794   13.591  -9.168  0.00 30.00 ? 99   HIS A NE2   1 
ATOM   710   N  N     . GLU A 1 100 ? -4.897  13.794  -6.309  0.00 30.00 ? 100  GLU A N     1 
ATOM   711   C  CA    . GLU A 1 100 ? -6.167  13.340  -5.795  0.00 30.00 ? 100  GLU A CA    1 
ATOM   712   C  C     . GLU A 1 100 ? -7.116  14.442  -5.353  0.00 30.00 ? 100  GLU A C     1 
ATOM   713   O  O     . GLU A 1 100 ? -8.306  14.161  -5.140  0.00 30.00 ? 100  GLU A O     1 
ATOM   714   C  CB    . GLU A 1 100 ? -5.737  12.128  -4.759  0.00 30.00 ? 100  GLU A CB    1 
ATOM   715   C  CG    . GLU A 1 100 ? -5.692  10.656  -5.163  0.00 30.00 ? 100  GLU A CG    1 
ATOM   716   C  CD    . GLU A 1 100 ? -5.936  9.748   -3.968  0.00 30.00 ? 100  GLU A CD    1 
ATOM   717   O  OE1   . GLU A 1 100 ? -4.976  9.417   -3.246  0.00 30.00 ? 100  GLU A OE1   1 
ATOM   718   O  OE2   . GLU A 1 100 ? -7.118  9.384   -3.746  0.00 30.00 ? 100  GLU A OE2   1 
ATOM   719   N  N     . LYS A 1 101 ? -6.888  15.246  -6.241  0.00 30.00 ? 101  LYS A N     1 
ATOM   720   C  CA    . LYS A 1 101 ? -7.734  16.389  -6.037  0.00 30.00 ? 101  LYS A CA    1 
ATOM   721   C  C     . LYS A 1 101 ? -7.502  17.472  -7.086  0.00 30.00 ? 101  LYS A C     1 
ATOM   722   O  O     . LYS A 1 101 ? -8.309  18.375  -7.222  0.00 30.00 ? 101  LYS A O     1 
ATOM   723   C  CB    . LYS A 1 101 ? -7.600  16.868  -4.572  0.00 30.00 ? 101  LYS A CB    1 
ATOM   724   C  CG    . LYS A 1 101 ? -8.292  15.969  -3.562  0.00 30.00 ? 101  LYS A CG    1 
ATOM   725   C  CD    . LYS A 1 101 ? -9.573  15.356  -4.138  0.00 30.00 ? 101  LYS A CD    1 
ATOM   726   C  CE    . LYS A 1 101 ? -10.747 15.542  -3.204  0.00 30.00 ? 101  LYS A CE    1 
ATOM   727   N  NZ    . LYS A 1 101 ? -11.076 16.980  -3.011  0.00 30.00 ? 101  LYS A NZ    1 
ATOM   728   N  N     . ASN A 1 102 ? -6.521  18.004  -7.574  0.00 30.00 ? 102  ASN A N     1 
ATOM   729   C  CA    . ASN A 1 102 ? -6.048  18.388  -8.910  0.00 30.00 ? 102  ASN A CA    1 
ATOM   730   C  C     . ASN A 1 102 ? -4.558  18.697  -8.895  0.00 30.00 ? 102  ASN A C     1 
ATOM   731   O  O     . ASN A 1 102 ? -3.714  17.798  -8.895  0.00 30.00 ? 102  ASN A O     1 
ATOM   732   C  CB    . ASN A 1 102 ? -6.888  19.570  -8.897  0.00 30.00 ? 102  ASN A CB    1 
ATOM   733   C  CG    . ASN A 1 102 ? -7.354  20.041  -10.273 0.00 30.00 ? 102  ASN A CG    1 
ATOM   734   O  OD1   . ASN A 1 102 ? -7.684  21.214  -10.448 0.00 30.00 ? 102  ASN A OD1   1 
ATOM   735   N  ND2   . ASN A 1 102 ? -7.370  19.138  -11.239 0.00 30.00 ? 102  ASN A ND2   1 
ATOM   736   N  N     . GLN A 1 103 ? -4.201  19.959  -8.825  0.00 30.00 ? 103  GLN A N     1 
ATOM   737   C  CA    . GLN A 1 103 ? -2.885  20.541  -8.752  0.00 30.00 ? 103  GLN A CA    1 
ATOM   738   C  C     . GLN A 1 103 ? -1.637  19.691  -8.695  0.00 30.00 ? 103  GLN A C     1 
ATOM   739   O  O     . GLN A 1 103 ? -1.304  19.078  -7.669  0.00 30.00 ? 103  GLN A O     1 
ATOM   740   C  CB    . GLN A 1 103 ? -2.903  21.554  -7.578  0.00 30.00 ? 103  GLN A CB    1 
ATOM   741   C  CG    . GLN A 1 103 ? -2.189  22.860  -7.878  0.00 30.00 ? 103  GLN A CG    1 
ATOM   742   C  CD    . GLN A 1 103 ? -3.048  24.010  -8.364  0.00 30.00 ? 103  GLN A CD    1 
ATOM   743   O  OE1   . GLN A 1 103 ? -2.541  25.097  -8.695  0.00 30.00 ? 103  GLN A OE1   1 
ATOM   744   N  NE2   . GLN A 1 103 ? -4.370  23.825  -8.411  0.00 30.00 ? 103  GLN A NE2   1 
ATOM   745   N  N     . ASN A 1 104 ? -0.596  19.354  -9.739  1.00 75.58 ? 104  ASN A N     1 
ATOM   746   C  CA    . ASN A 1 104 ? 0.678   18.648  -9.909  1.00 75.21 ? 104  ASN A CA    1 
ATOM   747   C  C     . ASN A 1 104 ? 1.795   19.328  -9.110  1.00 74.32 ? 104  ASN A C     1 
ATOM   748   O  O     . ASN A 1 104 ? 1.662   20.494  -8.693  1.00 74.64 ? 104  ASN A O     1 
ATOM   749   C  CB    . ASN A 1 104 ? 1.100   18.581  -11.374 1.00 77.04 ? 104  ASN A CB    1 
ATOM   750   C  CG    . ASN A 1 104 ? 0.211   17.695  -12.223 1.00 80.23 ? 104  ASN A CG    1 
ATOM   751   O  OD1   . ASN A 1 104 ? 0.217   16.459  -12.084 1.00 80.98 ? 104  ASN A OD1   1 
ATOM   752   N  ND2   . ASN A 1 104 ? -0.538  18.318  -13.130 1.00 78.28 ? 104  ASN A ND2   1 
ATOM   753   N  N     . VAL A 1 105 ? 2.914   18.614  -8.993  1.00 71.90 ? 105  VAL A N     1 
ATOM   754   C  CA    . VAL A 1 105 ? 4.051   19.215  -8.269  1.00 69.46 ? 105  VAL A CA    1 
ATOM   755   C  C     . VAL A 1 105 ? 4.415   20.562  -8.876  1.00 67.68 ? 105  VAL A C     1 
ATOM   756   O  O     . VAL A 1 105 ? 4.549   20.685  -10.091 1.00 67.48 ? 105  VAL A O     1 
ATOM   757   C  CB    . VAL A 1 105 ? 5.279   18.284  -8.412  1.00 67.15 ? 105  VAL A CB    1 
ATOM   758   C  CG1   . VAL A 1 105 ? 5.317   17.816  -9.858  1.00 67.73 ? 105  VAL A CG1   1 
ATOM   759   C  CG2   . VAL A 1 105 ? 6.536   19.064  -8.072  1.00 66.20 ? 105  VAL A CG2   1 
ATOM   760   N  N     . HIS A 1 106 ? 4.686   21.539  -8.034  1.00 66.66 ? 106  HIS A N     1 
ATOM   761   C  CA    . HIS A 1 106 ? 5.038   22.904  -8.433  1.00 65.01 ? 106  HIS A CA    1 
ATOM   762   C  C     . HIS A 1 106 ? 6.191   23.403  -7.570  1.00 63.54 ? 106  HIS A C     1 
ATOM   763   O  O     . HIS A 1 106 ? 6.065   23.342  -6.349  1.00 63.16 ? 106  HIS A O     1 
ATOM   764   C  CB    . HIS A 1 106 ? 3.800   23.796  -8.196  1.00 66.55 ? 106  HIS A CB    1 
ATOM   765   C  CG    . HIS A 1 106 ? 3.994   25.210  -8.638  1.00 69.09 ? 106  HIS A CG    1 
ATOM   766   N  ND1   . HIS A 1 106 ? 3.866   26.287  -7.780  1.00 71.58 ? 106  HIS A ND1   1 
ATOM   767   C  CD2   . HIS A 1 106 ? 4.343   25.729  -9.843  1.00 69.54 ? 106  HIS A CD2   1 
ATOM   768   C  CE1   . HIS A 1 106 ? 4.148   27.404  -8.419  1.00 69.58 ? 106  HIS A CE1   1 
ATOM   769   N  NE2   . HIS A 1 106 ? 4.438   27.091  -9.671  1.00 70.36 ? 106  HIS A NE2   1 
ATOM   770   N  N     . MET A 1 107 ? 7.275   23.908  -8.139  1.00 62.87 ? 107  MET A N     1 
ATOM   771   C  CA    . MET A 1 107 ? 8.509   24.201  -7.413  1.00 61.57 ? 107  MET A CA    1 
ATOM   772   C  C     . MET A 1 107 ? 8.899   25.666  -7.314  1.00 60.97 ? 107  MET A C     1 
ATOM   773   O  O     . MET A 1 107 ? 9.196   26.287  -8.344  1.00 61.50 ? 107  MET A O     1 
ATOM   774   C  CB    . MET A 1 107 ? 9.622   23.483  -8.198  1.00 59.24 ? 107  MET A CB    1 
ATOM   775   C  CG    . MET A 1 107 ? 10.794  22.949  -7.411  1.00 63.00 ? 107  MET A CG    1 
ATOM   776   S  SD    . MET A 1 107 ? 10.984  21.151  -7.534  1.00 62.91 ? 107  MET A SD    1 
ATOM   777   C  CE    . MET A 1 107 ? 9.295   20.740  -7.995  1.00 62.84 ? 107  MET A CE    1 
ATOM   778   N  N     . GLU A 1 108 ? 9.065   26.235  -6.126  1.00 60.07 ? 108  GLU A N     1 
ATOM   779   C  CA    . GLU A 1 108 ? 9.613   27.587  -6.018  1.00 60.55 ? 108  GLU A CA    1 
ATOM   780   C  C     . GLU A 1 108 ? 10.901  27.550  -5.188  1.00 60.71 ? 108  GLU A C     1 
ATOM   781   O  O     . GLU A 1 108 ? 10.965  26.860  -4.161  1.00 60.77 ? 108  GLU A O     1 
ATOM   782   C  CB    . GLU A 1 108 ? 8.614   28.597  -5.503  1.00 62.01 ? 108  GLU A CB    1 
ATOM   783   C  CG    . GLU A 1 108 ? 8.824   29.183  -4.117  1.00 67.23 ? 108  GLU A CG    1 
ATOM   784   C  CD    . GLU A 1 108 ? 7.654   30.065  -3.710  1.00 70.77 ? 108  GLU A CD    1 
ATOM   785   O  OE1   . GLU A 1 108 ? 7.336   31.009  -4.471  1.00 74.23 ? 108  GLU A OE1   1 
ATOM   786   O  OE2   . GLU A 1 108 ? 6.989   29.821  -2.681  1.00 73.61 ? 108  GLU A OE2   1 
ATOM   787   N  N     . SER A 1 109 ? 11.940  28.240  -5.651  1.00 59.78 ? 109  SER A N     1 
ATOM   788   C  CA    . SER A 1 109 ? 13.186  28.296  -4.912  1.00 59.43 ? 109  SER A CA    1 
ATOM   789   C  C     . SER A 1 109 ? 13.904  29.641  -4.913  1.00 58.78 ? 109  SER A C     1 
ATOM   790   O  O     . SER A 1 109 ? 13.616  30.608  -5.584  1.00 57.89 ? 109  SER A O     1 
ATOM   791   C  CB    . SER A 1 109 ? 14.125  27.183  -5.355  1.00 56.98 ? 109  SER A CB    1 
ATOM   792   O  OG    . SER A 1 109 ? 14.634  27.392  -6.658  1.00 55.74 ? 109  SER A OG    1 
ATOM   793   N  N     . GLU A 1 110 ? 14.992  29.674  -4.155  1.00 59.01 ? 110  GLU A N     1 
ATOM   794   C  CA    . GLU A 1 110 ? 15.849  30.841  -4.004  1.00 59.06 ? 110  GLU A CA    1 
ATOM   795   C  C     . GLU A 1 110 ? 17.286  30.439  -4.255  1.00 58.90 ? 110  GLU A C     1 
ATOM   796   O  O     . GLU A 1 110 ? 17.524  29.779  -5.277  1.00 60.59 ? 110  GLU A O     1 
ATOM   797   C  CB    . GLU A 1 110 ? 15.593  31.370  -2.599  1.00 64.29 ? 110  GLU A CB    1 
ATOM   798   C  CG    . GLU A 1 110 ? 14.565  32.509  -2.569  1.00 69.08 ? 110  GLU A CG    1 
ATOM   799   C  CD    . GLU A 1 110 ? 15.353  33.809  -2.429  1.00 69.79 ? 110  GLU A CD    1 
ATOM   800   O  OE1   . GLU A 1 110 ? 16.566  33.706  -2.737  1.00 72.85 ? 110  GLU A OE1   1 
ATOM   801   O  OE2   . GLU A 1 110 ? 14.784  34.811  -1.978  1.00 69.90 ? 110  GLU A OE2   1 
ATOM   802   N  N     . VAL A 1 111 ? 18.273  30.823  -3.493  1.00 56.66 ? 111  VAL A N     1 
ATOM   803   C  CA    . VAL A 1 111 ? 19.684  30.542  -3.658  1.00 54.09 ? 111  VAL A CA    1 
ATOM   804   C  C     . VAL A 1 111 ? 20.443  31.510  -2.734  1.00 52.81 ? 111  VAL A C     1 
ATOM   805   O  O     . VAL A 1 111 ? 20.278  32.707  -2.954  1.00 54.10 ? 111  VAL A O     1 
ATOM   806   C  CB    . VAL A 1 111 ? 20.336  30.644  -5.030  1.00 50.22 ? 111  VAL A CB    1 
ATOM   807   C  CG1   . VAL A 1 111 ? 21.868  30.554  -4.890  1.00 44.70 ? 111  VAL A CG1   1 
ATOM   808   C  CG2   . VAL A 1 111 ? 19.923  29.534  -5.973  1.00 51.21 ? 111  VAL A CG2   1 
ATOM   809   N  N     . TYR A 1 112 ? 21.062  31.053  -1.668  1.00 51.02 ? 112  TYR A N     1 
ATOM   810   C  CA    . TYR A 1 112 ? 21.645  31.974  -0.702  1.00 51.28 ? 112  TYR A CA    1 
ATOM   811   C  C     . TYR A 1 112 ? 23.154  31.962  -0.777  1.00 52.69 ? 112  TYR A C     1 
ATOM   812   O  O     . TYR A 1 112 ? 23.766  30.895  -0.779  1.00 52.93 ? 112  TYR A O     1 
ATOM   813   C  CB    . TYR A 1 112 ? 21.135  31.496  0.670   1.00 51.38 ? 112  TYR A CB    1 
ATOM   814   C  CG    . TYR A 1 112 ? 19.652  31.825  0.772   1.00 51.35 ? 112  TYR A CG    1 
ATOM   815   C  CD1   . TYR A 1 112 ? 19.330  33.111  1.205   1.00 50.53 ? 112  TYR A CD1   1 
ATOM   816   C  CD2   . TYR A 1 112 ? 18.641  30.938  0.402   1.00 51.49 ? 112  TYR A CD2   1 
ATOM   817   C  CE1   . TYR A 1 112 ? 18.013  33.498  1.310   1.00 50.01 ? 112  TYR A CE1   1 
ATOM   818   C  CE2   . TYR A 1 112 ? 17.326  31.384  0.492   1.00 51.86 ? 112  TYR A CE2   1 
ATOM   819   C  CZ    . TYR A 1 112 ? 17.006  32.635  0.945   1.00 50.87 ? 112  TYR A CZ    1 
ATOM   820   O  OH    . TYR A 1 112 ? 15.707  33.072  1.049   1.00 51.92 ? 112  TYR A OH    1 
ATOM   821   N  N     . ASP A 1 113 ? 23.782  33.111  -0.925  1.00 54.27 ? 113  ASP A N     1 
ATOM   822   C  CA    . ASP A 1 113 ? 25.225  33.209  -1.098  1.00 55.06 ? 113  ASP A CA    1 
ATOM   823   C  C     . ASP A 1 113 ? 25.932  32.810  0.181   1.00 55.20 ? 113  ASP A C     1 
ATOM   824   O  O     . ASP A 1 113 ? 25.732  33.468  1.205   1.00 55.57 ? 113  ASP A O     1 
ATOM   825   C  CB    . ASP A 1 113 ? 25.560  34.648  -1.498  1.00 60.29 ? 113  ASP A CB    1 
ATOM   826   C  CG    . ASP A 1 113 ? 27.044  34.863  -1.742  1.00 66.14 ? 113  ASP A CG    1 
ATOM   827   O  OD1   . ASP A 1 113 ? 27.553  34.533  -2.850  1.00 65.46 ? 113  ASP A OD1   1 
ATOM   828   O  OD2   . ASP A 1 113 ? 27.660  35.402  -0.782  1.00 64.85 ? 113  ASP A OD2   1 
ATOM   829   N  N     . THR A 1 114 ? 26.704  31.734  0.135   1.00 54.78 ? 114  THR A N     1 
ATOM   830   C  CA    . THR A 1 114 ? 27.396  31.297  1.350   1.00 54.82 ? 114  THR A CA    1 
ATOM   831   C  C     . THR A 1 114 ? 28.900  31.468  1.129   1.00 56.08 ? 114  THR A C     1 
ATOM   832   O  O     . THR A 1 114 ? 29.476  30.551  0.513   1.00 56.85 ? 114  THR A O     1 
ATOM   833   C  CB    . THR A 1 114 ? 27.100  29.821  1.653   1.00 51.42 ? 114  THR A CB    1 
ATOM   834   O  OG1   . THR A 1 114 ? 25.689  29.592  1.738   1.00 53.89 ? 114  THR A OG1   1 
ATOM   835   C  CG2   . THR A 1 114 ? 27.759  29.373  2.947   1.00 51.31 ? 114  THR A CG2   1 
ATOM   836   N  N     . PRO A 1 115 ? 29.518  32.342  1.892   1.00 55.28 ? 115  PRO A N     1 
ATOM   837   C  CA    . PRO A 1 115 ? 30.919  32.637  1.751   1.00 54.61 ? 115  PRO A CA    1 
ATOM   838   C  C     . PRO A 1 115 ? 31.889  31.662  2.368   1.00 53.79 ? 115  PRO A C     1 
ATOM   839   O  O     . PRO A 1 115 ? 31.574  30.811  3.202   1.00 53.45 ? 115  PRO A O     1 
ATOM   840   C  CB    . PRO A 1 115 ? 31.075  34.051  2.322   1.00 55.08 ? 115  PRO A CB    1 
ATOM   841   C  CG    . PRO A 1 115 ? 29.698  34.580  2.508   1.00 55.27 ? 115  PRO A CG    1 
ATOM   842   C  CD    . PRO A 1 115 ? 28.819  33.370  2.708   1.00 55.18 ? 115  PRO A CD    1 
ATOM   843   N  N     . GLU A 1 116 ? 33.115  31.702  1.850   1.00 53.65 ? 116  GLU A N     1 
ATOM   844   C  CA    . GLU A 1 116 ? 34.191  30.831  2.274   1.00 52.23 ? 116  GLU A CA    1 
ATOM   845   C  C     . GLU A 1 116 ? 34.295  30.728  3.791   1.00 50.59 ? 116  GLU A C     1 
ATOM   846   O  O     . GLU A 1 116 ? 34.629  29.676  4.350   1.00 50.37 ? 116  GLU A O     1 
ATOM   847   C  CB    . GLU A 1 116 ? 35.524  31.327  1.700   1.00 55.21 ? 116  GLU A CB    1 
ATOM   848   C  CG    . GLU A 1 116 ? 36.593  30.259  1.570   1.00 65.30 ? 116  GLU A CG    1 
ATOM   849   C  CD    . GLU A 1 116 ? 36.653  29.662  0.169   1.00 71.53 ? 116  GLU A CD    1 
ATOM   850   O  OE1   . GLU A 1 116 ? 36.696  30.542  -0.732  1.00 73.86 ? 116  GLU A OE1   1 
ATOM   851   O  OE2   . GLU A 1 116 ? 36.654  28.426  -0.030  1.00 70.29 ? 116  GLU A OE2   1 
ATOM   852   N  N     . ASN A 1 117 ? 34.185  31.863  4.451   1.00 49.51 ? 117  ASN A N     1 
ATOM   853   C  CA    . ASN A 1 117 ? 34.458  31.977  5.871   1.00 48.11 ? 117  ASN A CA    1 
ATOM   854   C  C     . ASN A 1 117 ? 33.400  31.253  6.675   1.00 46.69 ? 117  ASN A C     1 
ATOM   855   O  O     . ASN A 1 117 ? 33.653  30.714  7.767   1.00 47.58 ? 117  ASN A O     1 
ATOM   856   C  CB    . ASN A 1 117 ? 34.626  33.437  6.267   1.00 52.72 ? 117  ASN A CB    1 
ATOM   857   C  CG    . ASN A 1 117 ? 33.295  34.068  6.623   1.00 57.77 ? 117  ASN A CG    1 
ATOM   858   O  OD1   . ASN A 1 117 ? 33.072  34.344  7.811   1.00 58.61 ? 117  ASN A OD1   1 
ATOM   859   N  ND2   . ASN A 1 117 ? 32.463  34.204  5.594   1.00 59.23 ? 117  ASN A ND2   1 
ATOM   860   N  N     . ILE A 1 118 ? 32.231  31.158  6.073   1.00 44.00 ? 118  ILE A N     1 
ATOM   861   C  CA    . ILE A 1 118 ? 31.179  30.323  6.631   1.00 42.73 ? 118  ILE A CA    1 
ATOM   862   C  C     . ILE A 1 118 ? 31.419  28.854  6.333   1.00 41.16 ? 118  ILE A C     1 
ATOM   863   O  O     . ILE A 1 118 ? 31.076  27.996  7.139   1.00 41.17 ? 118  ILE A O     1 
ATOM   864   C  CB    . ILE A 1 118 ? 29.822  30.715  6.002   1.00 39.60 ? 118  ILE A CB    1 
ATOM   865   C  CG1   . ILE A 1 118 ? 29.653  32.220  6.130   1.00 44.44 ? 118  ILE A CG1   1 
ATOM   866   C  CG2   . ILE A 1 118 ? 28.740  29.917  6.679   1.00 43.36 ? 118  ILE A CG2   1 
ATOM   867   C  CD1   . ILE A 1 118 ? 28.814  32.720  7.275   1.00 46.23 ? 118  ILE A CD1   1 
ATOM   868   N  N     . VAL A 1 119 ? 31.820  28.507  5.124   1.00 40.83 ? 119  VAL A N     1 
ATOM   869   C  CA    . VAL A 1 119 ? 31.925  27.079  4.735   1.00 41.20 ? 119  VAL A CA    1 
ATOM   870   C  C     . VAL A 1 119 ? 33.094  26.473  5.531   1.00 41.58 ? 119  VAL A C     1 
ATOM   871   O  O     . VAL A 1 119 ? 33.277  25.270  5.720   1.00 39.09 ? 119  VAL A O     1 
ATOM   872   C  CB    . VAL A 1 119 ? 32.178  27.106  3.230   1.00 39.47 ? 119  VAL A CB    1 
ATOM   873   C  CG1   . VAL A 1 119 ? 33.193  26.111  2.743   1.00 42.28 ? 119  VAL A CG1   1 
ATOM   874   C  CG2   . VAL A 1 119 ? 30.887  27.108  2.434   1.00 46.23 ? 119  VAL A CG2   1 
ATOM   875   N  N     . HIS A 1 120 ? 33.954  27.389  5.984   1.00 41.82 ? 120  HIS A N     1 
ATOM   876   C  CA    . HIS A 1 120 ? 35.119  27.031  6.758   1.00 42.97 ? 120  HIS A CA    1 
ATOM   877   C  C     . HIS A 1 120 ? 35.087  27.473  8.202   1.00 43.35 ? 120  HIS A C     1 
ATOM   878   O  O     . HIS A 1 120 ? 36.102  27.243  8.862   1.00 44.16 ? 120  HIS A O     1 
ATOM   879   C  CB    . HIS A 1 120 ? 36.350  27.736  6.114   1.00 46.87 ? 120  HIS A CB    1 
ATOM   880   C  CG    . HIS A 1 120 ? 36.593  27.168  4.763   1.00 47.31 ? 120  HIS A CG    1 
ATOM   881   N  ND1   . HIS A 1 120 ? 36.639  27.844  3.579   1.00 52.40 ? 120  HIS A ND1   1 
ATOM   882   C  CD2   . HIS A 1 120 ? 36.752  25.850  4.453   1.00 54.52 ? 120  HIS A CD2   1 
ATOM   883   C  CE1   . HIS A 1 120 ? 36.848  26.983  2.588   1.00 49.36 ? 120  HIS A CE1   1 
ATOM   884   N  NE2   . HIS A 1 120 ? 36.930  25.779  3.094   1.00 54.66 ? 120  HIS A NE2   1 
ATOM   885   N  N     . GLY A 1 121 ? 34.108  28.239  8.669   1.00 43.34 ? 121  GLY A N     1 
ATOM   886   C  CA    . GLY A 1 121 ? 34.169  28.721  10.057  1.00 42.99 ? 121  GLY A CA    1 
ATOM   887   C  C     . GLY A 1 121 ? 33.761  27.659  11.052  1.00 42.50 ? 121  GLY A C     1 
ATOM   888   O  O     . GLY A 1 121 ? 34.015  26.488  10.814  1.00 43.27 ? 121  GLY A O     1 
ATOM   889   N  N     . SER A 1 122 ? 32.994  28.009  12.076  1.00 42.97 ? 122  SER A N     1 
ATOM   890   C  CA    . SER A 1 122 ? 32.506  27.027  13.041  1.00 42.06 ? 122  SER A CA    1 
ATOM   891   C  C     . SER A 1 122 ? 31.207  26.440  12.498  1.00 40.32 ? 122  SER A C     1 
ATOM   892   O  O     . SER A 1 122 ? 30.538  27.154  11.776  1.00 39.49 ? 122  SER A O     1 
ATOM   893   C  CB    . SER A 1 122 ? 32.132  27.677  14.388  1.00 41.42 ? 122  SER A CB    1 
ATOM   894   O  OG    . SER A 1 122 ? 31.556  28.947  14.122  1.00 50.86 ? 122  SER A OG    1 
ATOM   895   N  N     . GLY A 1 123 ? 30.800  25.311  13.066  1.00 41.65 ? 123  GLY A N     1 
ATOM   896   C  CA    . GLY A 1 123 ? 29.506  24.744  12.692  1.00 43.29 ? 123  GLY A CA    1 
ATOM   897   C  C     . GLY A 1 123 ? 28.371  25.676  13.122  1.00 44.64 ? 123  GLY A C     1 
ATOM   898   O  O     . GLY A 1 123 ? 27.313  25.749  12.501  1.00 44.91 ? 123  GLY A O     1 
ATOM   899   N  N     . SER A 1 124 ? 28.600  26.375  14.226  1.00 45.98 ? 124  SER A N     1 
ATOM   900   C  CA    . SER A 1 124 ? 27.642  27.332  14.740  1.00 48.27 ? 124  SER A CA    1 
ATOM   901   C  C     . SER A 1 124 ? 27.392  28.470  13.757  1.00 48.75 ? 124  SER A C     1 
ATOM   902   O  O     . SER A 1 124 ? 26.234  28.752  13.440  1.00 49.79 ? 124  SER A O     1 
ATOM   903   C  CB    . SER A 1 124 ? 28.048  27.854  16.134  1.00 45.54 ? 124  SER A CB    1 
ATOM   904   O  OG    . SER A 1 124 ? 27.334  26.995  17.020  1.00 48.48 ? 124  SER A OG    1 
ATOM   905   N  N     . GLN A 1 125 ? 28.478  29.043  13.249  1.00 47.89 ? 125  GLN A N     1 
ATOM   906   C  CA    . GLN A 1 125 ? 28.322  30.051  12.212  1.00 48.07 ? 125  GLN A CA    1 
ATOM   907   C  C     . GLN A 1 125 ? 27.567  29.480  11.010  1.00 46.95 ? 125  GLN A C     1 
ATOM   908   O  O     . GLN A 1 125 ? 26.752  30.170  10.411  1.00 47.85 ? 125  GLN A O     1 
ATOM   909   C  CB    . GLN A 1 125 ? 29.709  30.502  11.719  1.00 50.84 ? 125  GLN A CB    1 
ATOM   910   C  CG    . GLN A 1 125 ? 29.860  32.004  11.812  1.00 55.23 ? 125  GLN A CG    1 
ATOM   911   C  CD    . GLN A 1 125 ? 30.551  32.572  10.592  1.00 57.94 ? 125  GLN A CD    1 
ATOM   912   O  OE1   . GLN A 1 125 ? 31.364  31.857  10.001  1.00 62.44 ? 125  GLN A OE1   1 
ATOM   913   N  NE2   . GLN A 1 125 ? 30.239  33.827  10.281  1.00 59.22 ? 125  GLN A NE2   1 
ATOM   914   N  N     . LEU A 1 126 ? 27.933  28.260  10.621  1.00 45.29 ? 126  LEU A N     1 
ATOM   915   C  CA    . LEU A 1 126 ? 27.395  27.583  9.475   1.00 42.40 ? 126  LEU A CA    1 
ATOM   916   C  C     . LEU A 1 126 ? 25.890  27.371  9.610   1.00 41.90 ? 126  LEU A C     1 
ATOM   917   O  O     . LEU A 1 126 ? 25.122  27.741  8.738   1.00 40.56 ? 126  LEU A O     1 
ATOM   918   C  CB    . LEU A 1 126 ? 28.048  26.207  9.269   1.00 38.45 ? 126  LEU A CB    1 
ATOM   919   C  CG    . LEU A 1 126 ? 27.380  25.335  8.178   1.00 31.99 ? 126  LEU A CG    1 
ATOM   920   C  CD1   . LEU A 1 126 ? 27.221  26.160  6.897   1.00 29.30 ? 126  LEU A CD1   1 
ATOM   921   C  CD2   . LEU A 1 126 ? 28.196  24.120  7.880   1.00 29.96 ? 126  LEU A CD2   1 
ATOM   922   N  N     . PHE A 1 127 ? 25.486  26.760  10.719  1.00 43.12 ? 127  PHE A N     1 
ATOM   923   C  CA    . PHE A 1 127 ? 24.079  26.517  10.973  1.00 43.57 ? 127  PHE A CA    1 
ATOM   924   C  C     . PHE A 1 127 ? 23.267  27.739  11.339  1.00 44.00 ? 127  PHE A C     1 
ATOM   925   O  O     . PHE A 1 127 ? 22.054  27.807  11.067  1.00 42.94 ? 127  PHE A O     1 
ATOM   926   C  CB    . PHE A 1 127 ? 23.913  25.352  11.935  1.00 43.50 ? 127  PHE A CB    1 
ATOM   927   C  CG    . PHE A 1 127 ? 24.195  24.024  11.289  1.00 40.68 ? 127  PHE A CG    1 
ATOM   928   C  CD1   . PHE A 1 127 ? 23.229  23.412  10.524  1.00 40.78 ? 127  PHE A CD1   1 
ATOM   929   C  CD2   . PHE A 1 127 ? 25.396  23.368  11.505  1.00 38.24 ? 127  PHE A CD2   1 
ATOM   930   C  CE1   . PHE A 1 127 ? 23.467  22.169  9.960   1.00 39.89 ? 127  PHE A CE1   1 
ATOM   931   C  CE2   . PHE A 1 127 ? 25.638  22.140  10.952  1.00 36.96 ? 127  PHE A CE2   1 
ATOM   932   C  CZ    . PHE A 1 127 ? 24.686  21.546  10.142  1.00 38.87 ? 127  PHE A CZ    1 
ATOM   933   N  N     . ASP A 1 128 ? 23.919  28.753  11.912  1.00 45.65 ? 128  ASP A N     1 
ATOM   934   C  CA    . ASP A 1 128 ? 23.220  30.021  12.164  1.00 46.84 ? 128  ASP A CA    1 
ATOM   935   C  C     . ASP A 1 128 ? 22.891  30.634  10.788  1.00 46.91 ? 128  ASP A C     1 
ATOM   936   O  O     . ASP A 1 128 ? 21.803  31.174  10.602  1.00 46.21 ? 128  ASP A O     1 
ATOM   937   C  CB    . ASP A 1 128 ? 24.055  31.019  12.954  1.00 44.25 ? 128  ASP A CB    1 
ATOM   938   C  CG    . ASP A 1 128 ? 24.115  30.718  14.437  1.00 49.71 ? 128  ASP A CG    1 
ATOM   939   O  OD1   . ASP A 1 128 ? 23.408  29.797  14.901  1.00 48.73 ? 128  ASP A OD1   1 
ATOM   940   O  OD2   . ASP A 1 128 ? 24.953  31.373  15.118  1.00 50.45 ? 128  ASP A OD2   1 
ATOM   941   N  N     . HIS A 1 129 ? 23.853  30.491  9.867   1.00 47.05 ? 129  HIS A N     1 
ATOM   942   C  CA    . HIS A 1 129 ? 23.607  31.083  8.546   1.00 48.64 ? 129  HIS A CA    1 
ATOM   943   C  C     . HIS A 1 129 ? 22.473  30.353  7.833   1.00 49.45 ? 129  HIS A C     1 
ATOM   944   O  O     . HIS A 1 129 ? 21.661  30.998  7.180   1.00 48.91 ? 129  HIS A O     1 
ATOM   945   C  CB    . HIS A 1 129 ? 24.854  31.119  7.697   1.00 48.24 ? 129  HIS A CB    1 
ATOM   946   C  CG    . HIS A 1 129 ? 24.670  31.350  6.234   1.00 45.22 ? 129  HIS A CG    1 
ATOM   947   N  ND1   . HIS A 1 129 ? 24.410  32.590  5.708   1.00 45.37 ? 129  HIS A ND1   1 
ATOM   948   C  CD2   . HIS A 1 129 ? 24.772  30.502  5.178   1.00 43.98 ? 129  HIS A CD2   1 
ATOM   949   C  CE1   . HIS A 1 129 ? 24.346  32.511  4.383   1.00 42.83 ? 129  HIS A CE1   1 
ATOM   950   N  NE2   . HIS A 1 129 ? 24.581  31.255  4.033   1.00 46.13 ? 129  HIS A NE2   1 
ATOM   951   N  N     . VAL A 1 130 ? 22.454  29.030  7.958   1.00 49.73 ? 130  VAL A N     1 
ATOM   952   C  CA    . VAL A 1 130 ? 21.374  28.260  7.320   1.00 50.94 ? 130  VAL A CA    1 
ATOM   953   C  C     . VAL A 1 130 ? 20.046  28.628  7.986   1.00 51.25 ? 130  VAL A C     1 
ATOM   954   O  O     . VAL A 1 130 ? 19.024  28.801  7.332   1.00 49.94 ? 130  VAL A O     1 
ATOM   955   C  CB    . VAL A 1 130 ? 21.670  26.756  7.472   1.00 50.66 ? 130  VAL A CB    1 
ATOM   956   C  CG1   . VAL A 1 130 ? 20.488  25.907  7.054   1.00 48.79 ? 130  VAL A CG1   1 
ATOM   957   C  CG2   . VAL A 1 130 ? 22.904  26.401  6.648   1.00 49.12 ? 130  VAL A CG2   1 
ATOM   958   N  N     . ALA A 1 131 ? 20.076  28.830  9.303   1.00 52.11 ? 131  ALA A N     1 
ATOM   959   C  CA    . ALA A 1 131 ? 18.864  29.197  10.041  1.00 52.73 ? 131  ALA A CA    1 
ATOM   960   C  C     . ALA A 1 131 ? 18.378  30.579  9.608   1.00 52.86 ? 131  ALA A C     1 
ATOM   961   O  O     . ALA A 1 131 ? 17.206  30.793  9.262   1.00 53.59 ? 131  ALA A O     1 
ATOM   962   C  CB    . ALA A 1 131 ? 19.151  29.166  11.536  1.00 52.56 ? 131  ALA A CB    1 
ATOM   963   N  N     . GLU A 1 132 ? 19.326  31.508  9.522   1.00 52.17 ? 132  GLU A N     1 
ATOM   964   C  CA    . GLU A 1 132 ? 19.017  32.833  8.996   1.00 51.36 ? 132  GLU A CA    1 
ATOM   965   C  C     . GLU A 1 132 ? 18.335  32.718  7.642   1.00 50.80 ? 132  GLU A C     1 
ATOM   966   O  O     . GLU A 1 132 ? 17.169  33.092  7.586   1.00 52.77 ? 132  GLU A O     1 
ATOM   967   C  CB    . GLU A 1 132 ? 20.274  33.680  8.829   1.00 51.85 ? 132  GLU A CB    1 
ATOM   968   C  CG    . GLU A 1 132 ? 19.907  35.163  8.717   1.00 54.62 ? 132  GLU A CG    1 
ATOM   969   C  CD    . GLU A 1 132 ? 21.160  35.939  8.353   1.00 52.86 ? 132  GLU A CD    1 
ATOM   970   O  OE1   . GLU A 1 132 ? 22.210  35.296  8.193   1.00 54.27 ? 132  GLU A OE1   1 
ATOM   971   O  OE2   . GLU A 1 132 ? 21.052  37.172  8.234   1.00 61.55 ? 132  GLU A OE2   1 
ATOM   972   N  N     . CYS A 1 133 ? 18.965  32.210  6.604   1.00 49.05 ? 133  CYS A N     1 
ATOM   973   C  CA    . CYS A 1 133 ? 18.339  32.021  5.315   1.00 49.21 ? 133  CYS A CA    1 
ATOM   974   C  C     . CYS A 1 133 ? 16.953  31.381  5.324   1.00 50.26 ? 133  CYS A C     1 
ATOM   975   O  O     . CYS A 1 133 ? 16.064  31.843  4.586   1.00 50.00 ? 133  CYS A O     1 
ATOM   976   C  CB    . CYS A 1 133 ? 19.296  31.223  4.419   1.00 43.66 ? 133  CYS A CB    1 
ATOM   977   S  SG    . CYS A 1 133 ? 20.850  32.070  4.083   1.00 49.18 ? 133  CYS A SG    1 
ATOM   978   N  N     . LEU A 1 134 ? 16.696  30.336  6.113   1.00 50.15 ? 134  LEU A N     1 
ATOM   979   C  CA    . LEU A 1 134 ? 15.382  29.698  6.159   1.00 51.07 ? 134  LEU A CA    1 
ATOM   980   C  C     . LEU A 1 134 ? 14.315  30.691  6.609   1.00 52.91 ? 134  LEU A C     1 
ATOM   981   O  O     . LEU A 1 134 ? 13.245  30.903  6.004   1.00 52.57 ? 134  LEU A O     1 
ATOM   982   C  CB    . LEU A 1 134 ? 15.427  28.426  7.018   1.00 45.72 ? 134  LEU A CB    1 
ATOM   983   C  CG    . LEU A 1 134 ? 14.129  27.624  7.058   1.00 44.79 ? 134  LEU A CG    1 
ATOM   984   C  CD1   . LEU A 1 134 ? 13.703  27.211  5.663   1.00 39.47 ? 134  LEU A CD1   1 
ATOM   985   C  CD2   . LEU A 1 134 ? 14.207  26.406  7.974   1.00 41.46 ? 134  LEU A CD2   1 
ATOM   986   N  N     . GLY A 1 135 ? 14.672  31.430  7.666   1.00 54.36 ? 135  GLY A N     1 
ATOM   987   C  CA    . GLY A 1 135 ? 13.816  32.494  8.196   1.00 55.05 ? 135  GLY A CA    1 
ATOM   988   C  C     . GLY A 1 135 ? 13.400  33.491  7.119   1.00 55.10 ? 135  GLY A C     1 
ATOM   989   O  O     . GLY A 1 135 ? 12.217  33.622  6.802   1.00 54.49 ? 135  GLY A O     1 
ATOM   990   N  N     . ASP A 1 136 ? 14.392  34.136  6.498   1.00 55.18 ? 136  ASP A N     1 
ATOM   991   C  CA    . ASP A 1 136 ? 14.101  35.114  5.450   1.00 54.72 ? 136  ASP A CA    1 
ATOM   992   C  C     . ASP A 1 136 ? 13.264  34.510  4.336   1.00 54.70 ? 136  ASP A C     1 
ATOM   993   O  O     . ASP A 1 136 ? 12.187  34.991  3.974   1.00 53.12 ? 136  ASP A O     1 
ATOM   994   C  CB    . ASP A 1 136 ? 15.373  35.774  4.973   1.00 57.76 ? 136  ASP A CB    1 
ATOM   995   C  CG    . ASP A 1 136 ? 15.315  36.350  3.577   1.00 61.10 ? 136  ASP A CG    1 
ATOM   996   O  OD1   . ASP A 1 136 ? 15.319  35.551  2.614   1.00 63.24 ? 136  ASP A OD1   1 
ATOM   997   O  OD2   . ASP A 1 136 ? 15.269  37.594  3.449   1.00 65.46 ? 136  ASP A OD2   1 
ATOM   998   N  N     . PHE A 1 137 ? 13.717  33.352  3.849   1.00 55.56 ? 137  PHE A N     1 
ATOM   999   C  CA    . PHE A 1 137 ? 12.954  32.643  2.828   1.00 56.07 ? 137  PHE A CA    1 
ATOM   1000  C  C     . PHE A 1 137 ? 11.541  32.401  3.335   1.00 58.42 ? 137  PHE A C     1 
ATOM   1001  O  O     . PHE A 1 137 ? 10.620  32.491  2.511   1.00 58.59 ? 137  PHE A O     1 
ATOM   1002  C  CB    . PHE A 1 137 ? 13.650  31.363  2.412   1.00 51.40 ? 137  PHE A CB    1 
ATOM   1003  C  CG    . PHE A 1 137 ? 12.884  30.463  1.488   1.00 43.76 ? 137  PHE A CG    1 
ATOM   1004  C  CD1   . PHE A 1 137 ? 11.797  29.747  1.944   1.00 40.45 ? 137  PHE A CD1   1 
ATOM   1005  C  CD2   . PHE A 1 137 ? 13.244  30.348  0.156   1.00 44.65 ? 137  PHE A CD2   1 
ATOM   1006  C  CE1   . PHE A 1 137 ? 11.112  28.880  1.106   1.00 41.42 ? 137  PHE A CE1   1 
ATOM   1007  C  CE2   . PHE A 1 137 ? 12.550  29.505  -0.691  1.00 39.87 ? 137  PHE A CE2   1 
ATOM   1008  C  CZ    . PHE A 1 137 ? 11.486  28.760  -0.219  1.00 39.67 ? 137  PHE A CZ    1 
ATOM   1009  N  N     . MET A 1 138 ? 11.333  32.215  4.645   1.00 59.99 ? 138  MET A N     1 
ATOM   1010  C  CA    . MET A 1 138 ? 9.953   32.012  5.099   1.00 61.70 ? 138  MET A CA    1 
ATOM   1011  C  C     . MET A 1 138 ? 9.164   33.317  5.154   1.00 63.29 ? 138  MET A C     1 
ATOM   1012  O  O     . MET A 1 138 ? 7.941   33.290  5.024   1.00 63.04 ? 138  MET A O     1 
ATOM   1013  C  CB    . MET A 1 138 ? 9.849   31.301  6.443   1.00 60.24 ? 138  MET A CB    1 
ATOM   1014  C  CG    . MET A 1 138 ? 10.685  30.041  6.551   1.00 58.70 ? 138  MET A CG    1 
ATOM   1015  S  SD    . MET A 1 138 ? 10.045  28.897  7.799   1.00 57.33 ? 138  MET A SD    1 
ATOM   1016  C  CE    . MET A 1 138 ? 9.258   27.713  6.682   1.00 53.43 ? 138  MET A CE    1 
ATOM   1017  N  N     . GLU A 1 139 ? 9.827   34.451  5.354   1.00 65.69 ? 139  GLU A N     1 
ATOM   1018  C  CA    . GLU A 1 139 ? 9.121   35.727  5.335   1.00 67.56 ? 139  GLU A CA    1 
ATOM   1019  C  C     . GLU A 1 139 ? 8.817   36.188  3.920   1.00 68.06 ? 139  GLU A C     1 
ATOM   1020  O  O     . GLU A 1 139 ? 7.636   36.339  3.602   1.00 68.80 ? 139  GLU A O     1 
ATOM   1021  C  CB    . GLU A 1 139 ? 9.879   36.794  6.113   1.00 73.99 ? 139  GLU A CB    1 
ATOM   1022  C  CG    . GLU A 1 139 ? 8.925   37.696  6.904   1.00 77.66 ? 139  GLU A CG    1 
ATOM   1023  C  CD    . GLU A 1 139 ? 9.518   38.014  8.265   1.00 80.03 ? 139  GLU A CD    1 
ATOM   1024  O  OE1   . GLU A 1 139 ? 10.732  38.325  8.328   1.00 81.75 ? 139  GLU A OE1   1 
ATOM   1025  O  OE2   . GLU A 1 139 ? 8.744   37.923  9.240   1.00 82.12 ? 139  GLU A OE2   1 
ATOM   1026  N  N     . LYS A 1 140 ? 9.804   36.340  3.049   1.00 68.05 ? 140  LYS A N     1 
ATOM   1027  C  CA    . LYS A 1 140 ? 9.537   36.722  1.668   1.00 68.36 ? 140  LYS A CA    1 
ATOM   1028  C  C     . LYS A 1 140 ? 8.283   36.067  1.100   1.00 68.46 ? 140  LYS A C     1 
ATOM   1029  O  O     . LYS A 1 140 ? 7.583   36.717  0.313   1.00 68.85 ? 140  LYS A O     1 
ATOM   1030  C  CB    . LYS A 1 140 ? 10.756  36.496  0.782   1.00 71.37 ? 140  LYS A CB    1 
ATOM   1031  C  CG    . LYS A 1 140 ? 12.063  37.033  1.339   1.00 77.03 ? 140  LYS A CG    1 
ATOM   1032  C  CD    . LYS A 1 140 ? 12.565  38.251  0.580   1.00 80.58 ? 140  LYS A CD    1 
ATOM   1033  C  CE    . LYS A 1 140 ? 14.049  38.131  0.252   1.00 81.21 ? 140  LYS A CE    1 
ATOM   1034  N  NZ    . LYS A 1 140 ? 14.407  36.721  -0.116  1.00 86.22 ? 140  LYS A NZ    1 
ATOM   1035  N  N     . ARG A 1 141 ? 7.988   34.837  1.515   1.00 67.09 ? 141  ARG A N     1 
ATOM   1036  C  CA    . ARG A 1 141 ? 6.833   34.077  1.097   1.00 66.79 ? 141  ARG A CA    1 
ATOM   1037  C  C     . ARG A 1 141 ? 5.629   34.152  2.035   1.00 66.98 ? 141  ARG A C     1 
ATOM   1038  O  O     . ARG A 1 141 ? 4.552   33.646  1.696   1.00 66.66 ? 141  ARG A O     1 
ATOM   1039  C  CB    . ARG A 1 141 ? 7.223   32.582  1.035   1.00 62.63 ? 141  ARG A CB    1 
ATOM   1040  C  CG    . ARG A 1 141 ? 7.797   32.106  -0.280  1.00 60.51 ? 141  ARG A CG    1 
ATOM   1041  C  CD    . ARG A 1 141 ? 9.312   31.978  -0.217  1.00 57.24 ? 141  ARG A CD    1 
ATOM   1042  N  NE    . ARG A 1 141 ? 9.867   31.776  -1.537  1.00 57.13 ? 141  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A 1 141 ? 10.883  32.431  -2.084  1.00 58.56 ? 141  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A 1 141 ? 11.523  33.404  -1.447  1.00 54.13 ? 141  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A 1 141 ? 11.243  32.088  -3.328  1.00 58.44 ? 141  ARG A NH2   1 
ATOM   1046  N  N     . LYS A 1 142 ? 5.816   34.586  3.268   1.00 67.22 ? 142  LYS A N     1 
ATOM   1047  C  CA    . LYS A 1 142 ? 4.805   34.643  4.297   1.00 67.25 ? 142  LYS A CA    1 
ATOM   1048  C  C     . LYS A 1 142 ? 4.297   33.272  4.734   1.00 67.03 ? 142  LYS A C     1 
ATOM   1049  O  O     . LYS A 1 142 ? 3.080   33.130  4.866   1.00 66.89 ? 142  LYS A O     1 
ATOM   1050  C  CB    . LYS A 1 142 ? 3.599   35.518  3.962   1.00 69.45 ? 142  LYS A CB    1 
ATOM   1051  C  CG    . LYS A 1 142 ? 3.847   37.023  3.951   1.00 68.58 ? 142  LYS A CG    1 
ATOM   1052  C  CD    . LYS A 1 142 ? 3.366   37.693  5.229   1.00 67.14 ? 142  LYS A CD    1 
ATOM   1053  C  CE    . LYS A 1 142 ? 4.557   38.062  6.111   1.00 66.91 ? 142  LYS A CE    1 
ATOM   1054  N  NZ    . LYS A 1 142 ? 4.144   38.623  7.432   1.00 65.51 ? 142  LYS A NZ    1 
ATOM   1055  N  N     . ILE A 1 143 ? 5.198   32.344  5.061   1.00 65.81 ? 143  ILE A N     1 
ATOM   1056  C  CA    . ILE A 1 143 ? 4.781   31.020  5.478   1.00 64.29 ? 143  ILE A CA    1 
ATOM   1057  C  C     . ILE A 1 143 ? 5.269   30.601  6.854   1.00 63.62 ? 143  ILE A C     1 
ATOM   1058  O  O     . ILE A 1 143 ? 5.052   29.442  7.228   1.00 62.62 ? 143  ILE A O     1 
ATOM   1059  C  CB    . ILE A 1 143 ? 5.204   29.926  4.483   1.00 63.44 ? 143  ILE A CB    1 
ATOM   1060  C  CG1   . ILE A 1 143 ? 6.706   30.061  4.189   1.00 62.61 ? 143  ILE A CG1   1 
ATOM   1061  C  CG2   . ILE A 1 143 ? 4.383   29.937  3.213   1.00 61.69 ? 143  ILE A CG2   1 
ATOM   1062  C  CD1   . ILE A 1 143 ? 7.540   29.642  5.381   1.00 61.66 ? 143  ILE A CD1   1 
ATOM   1063  N  N     . LYS A 1 144 ? 5.902   31.487  7.613   1.00 63.50 ? 144  LYS A N     1 
ATOM   1064  C  CA    . LYS A 1 144 ? 6.322   31.158  8.973   1.00 63.82 ? 144  LYS A CA    1 
ATOM   1065  C  C     . LYS A 1 144 ? 5.196   30.470  9.754   1.00 64.57 ? 144  LYS A C     1 
ATOM   1066  O  O     . LYS A 1 144 ? 5.436   29.734  10.706  1.00 64.69 ? 144  LYS A O     1 
ATOM   1067  C  CB    . LYS A 1 144 ? 6.688   32.421  9.744   1.00 60.81 ? 144  LYS A CB    1 
ATOM   1068  C  CG    . LYS A 1 144 ? 8.068   33.009  9.576   1.00 66.02 ? 144  LYS A CG    1 
ATOM   1069  C  CD    . LYS A 1 144 ? 8.951   33.164  9.402   0.00 30.00 ? 144  LYS A CD    1 
ATOM   1070  C  CE    . LYS A 1 144 ? 9.655   34.498  9.641   0.00 30.00 ? 144  LYS A CE    1 
ATOM   1071  N  NZ    . LYS A 1 144 ? 9.262   35.067  10.972  0.00 30.00 ? 144  LYS A NZ    1 
ATOM   1072  N  N     . ASP A 1 145 ? 3.957   30.843  9.464   1.00 65.17 ? 145  ASP A N     1 
ATOM   1073  C  CA    . ASP A 1 145 ? 2.777   30.483  10.215  1.00 65.74 ? 145  ASP A CA    1 
ATOM   1074  C  C     . ASP A 1 145 ? 2.090   29.216  9.720   1.00 65.41 ? 145  ASP A C     1 
ATOM   1075  O  O     . ASP A 1 145 ? 1.149   28.719  10.348  1.00 64.64 ? 145  ASP A O     1 
ATOM   1076  C  CB    . ASP A 1 145 ? 1.770   31.652  10.071  1.00 72.13 ? 145  ASP A CB    1 
ATOM   1077  C  CG    . ASP A 1 145 ? 1.638   31.968  8.579   1.00 75.48 ? 145  ASP A CG    1 
ATOM   1078  O  OD1   . ASP A 1 145 ? 2.603   32.530  8.010   1.00 75.27 ? 145  ASP A OD1   1 
ATOM   1079  O  OD2   . ASP A 1 145 ? 0.590   31.576  8.005   1.00 78.94 ? 145  ASP A OD2   1 
ATOM   1080  N  N     . LYS A 1 146 ? 2.421   28.809  8.497   1.00 64.62 ? 146  LYS A N     1 
ATOM   1081  C  CA    . LYS A 1 146 ? 1.868   27.511  8.026   1.00 64.11 ? 146  LYS A CA    1 
ATOM   1082  C  C     . LYS A 1 146 ? 2.685   26.531  8.843   1.00 64.58 ? 146  LYS A C     1 
ATOM   1083  O  O     . LYS A 1 146 ? 3.360   27.090  9.764   1.00 65.69 ? 146  LYS A O     1 
ATOM   1084  C  CB    . LYS A 1 146 ? 2.000   27.515  6.524   1.00 62.54 ? 146  LYS A CB    1 
ATOM   1085  C  CG    . LYS A 1 146 ? 1.681   28.885  5.922   1.00 62.30 ? 146  LYS A CG    1 
ATOM   1086  C  CD    . LYS A 1 146 ? 1.336   28.805  4.441   1.00 66.65 ? 146  LYS A CD    1 
ATOM   1087  C  CE    . LYS A 1 146 ? -0.031  29.406  4.099   1.00 66.84 ? 146  LYS A CE    1 
ATOM   1088  N  NZ    . LYS A 1 146 ? -0.125  30.844  4.498   1.00 63.31 ? 146  LYS A NZ    1 
ATOM   1089  N  N     . LYS A 1 147 ? 2.617   25.211  8.770   1.00 63.51 ? 147  LYS A N     1 
ATOM   1090  C  CA    . LYS A 1 147 ? 3.547   24.479  9.680   1.00 62.33 ? 147  LYS A CA    1 
ATOM   1091  C  C     . LYS A 1 147 ? 4.356   23.486  8.861   1.00 60.73 ? 147  LYS A C     1 
ATOM   1092  O  O     . LYS A 1 147 ? 4.439   22.316  9.188   1.00 61.55 ? 147  LYS A O     1 
ATOM   1093  C  CB    . LYS A 1 147 ? 2.880   23.860  10.880  1.00 63.79 ? 147  LYS A CB    1 
ATOM   1094  C  CG    . LYS A 1 147 ? 1.358   23.835  10.948  1.00 66.45 ? 147  LYS A CG    1 
ATOM   1095  C  CD    . LYS A 1 147 ? 1.515   23.872  13.029  0.00 30.00 ? 147  LYS A CD    1 
ATOM   1096  C  CE    . LYS A 1 147 ? 0.811   24.817  13.990  0.00 30.00 ? 147  LYS A CE    1 
ATOM   1097  N  NZ    . LYS A 1 147 ? 0.254   24.100  15.168  0.00 30.00 ? 147  LYS A NZ    1 
ATOM   1098  N  N     . LEU A 1 148 ? 4.866   23.935  7.722   1.00 58.41 ? 148  LEU A N     1 
ATOM   1099  C  CA    . LEU A 1 148 ? 5.395   23.102  6.678   1.00 55.67 ? 148  LEU A CA    1 
ATOM   1100  C  C     . LEU A 1 148 ? 6.543   22.178  7.078   1.00 53.91 ? 148  LEU A C     1 
ATOM   1101  O  O     . LEU A 1 148 ? 7.576   22.649  7.568   1.00 53.12 ? 148  LEU A O     1 
ATOM   1102  C  CB    . LEU A 1 148 ? 5.805   23.954  5.480   1.00 53.07 ? 148  LEU A CB    1 
ATOM   1103  C  CG    . LEU A 1 148 ? 4.931   25.113  5.039   1.00 52.94 ? 148  LEU A CG    1 
ATOM   1104  C  CD1   . LEU A 1 148 ? 5.548   25.773  3.811   1.00 53.30 ? 148  LEU A CD1   1 
ATOM   1105  C  CD2   . LEU A 1 148 ? 3.505   24.673  4.725   1.00 49.98 ? 148  LEU A CD2   1 
ATOM   1106  N  N     . PRO A 1 149 ? 6.360   20.893  6.796   1.00 51.58 ? 149  PRO A N     1 
ATOM   1107  C  CA    . PRO A 1 149 ? 7.373   19.882  6.985   1.00 50.52 ? 149  PRO A CA    1 
ATOM   1108  C  C     . PRO A 1 149 ? 8.617   20.205  6.138   1.00 49.80 ? 149  PRO A C     1 
ATOM   1109  O  O     . PRO A 1 149 ? 8.557   20.664  4.990   1.00 48.77 ? 149  PRO A O     1 
ATOM   1110  C  CB    . PRO A 1 149 ? 6.723   18.603  6.488   1.00 50.22 ? 149  PRO A CB    1 
ATOM   1111  C  CG    . PRO A 1 149 ? 5.255   18.859  6.552   1.00 50.72 ? 149  PRO A CG    1 
ATOM   1112  C  CD    . PRO A 1 149 ? 5.101   20.319  6.253   1.00 51.49 ? 149  PRO A CD    1 
ATOM   1113  N  N     . VAL A 1 150 ? 9.787   20.002  6.749   1.00 47.64 ? 150  VAL A N     1 
ATOM   1114  C  CA    . VAL A 1 150 ? 11.067  20.348  6.158   1.00 46.24 ? 150  VAL A CA    1 
ATOM   1115  C  C     . VAL A 1 150 ? 11.957  19.164  5.808   1.00 44.50 ? 150  VAL A C     1 
ATOM   1116  O  O     . VAL A 1 150 ? 12.250  18.278  6.597   1.00 44.47 ? 150  VAL A O     1 
ATOM   1117  C  CB    . VAL A 1 150 ? 11.873  21.249  7.124   1.00 46.48 ? 150  VAL A CB    1 
ATOM   1118  C  CG1   . VAL A 1 150 ? 13.074  21.856  6.420   1.00 48.48 ? 150  VAL A CG1   1 
ATOM   1119  C  CG2   . VAL A 1 150 ? 10.977  22.332  7.701   1.00 46.87 ? 150  VAL A CG2   1 
ATOM   1120  N  N     . GLY A 1 151 ? 12.498  19.217  4.606   1.00 43.79 ? 151  GLY A N     1 
ATOM   1121  C  CA    . GLY A 1 151 ? 13.437  18.230  4.107   1.00 43.40 ? 151  GLY A CA    1 
ATOM   1122  C  C     . GLY A 1 151 ? 14.841  18.836  3.949   1.00 41.81 ? 151  GLY A C     1 
ATOM   1123  O  O     . GLY A 1 151 ? 14.984  19.992  3.604   1.00 41.04 ? 151  GLY A O     1 
ATOM   1124  N  N     . PHE A 1 152 ? 15.862  18.055  4.296   1.00 41.97 ? 152  PHE A N     1 
ATOM   1125  C  CA    . PHE A 1 152 ? 17.224  18.592  4.384   1.00 40.95 ? 152  PHE A CA    1 
ATOM   1126  C  C     . PHE A 1 152 ? 18.161  17.717  3.556   1.00 39.11 ? 152  PHE A C     1 
ATOM   1127  O  O     . PHE A 1 152 ? 18.477  16.633  4.030   1.00 40.44 ? 152  PHE A O     1 
ATOM   1128  C  CB    . PHE A 1 152 ? 17.707  18.655  5.833   1.00 37.71 ? 152  PHE A CB    1 
ATOM   1129  C  CG    . PHE A 1 152 ? 19.062  19.265  6.077   1.00 40.23 ? 152  PHE A CG    1 
ATOM   1130  C  CD1   . PHE A 1 152 ? 19.769  19.943  5.118   1.00 34.77 ? 152  PHE A CD1   1 
ATOM   1131  C  CD2   . PHE A 1 152 ? 19.596  19.259  7.357   1.00 42.49 ? 152  PHE A CD2   1 
ATOM   1132  C  CE1   . PHE A 1 152 ? 20.956  20.569  5.409   1.00 40.99 ? 152  PHE A CE1   1 
ATOM   1133  C  CE2   . PHE A 1 152 ? 20.794  19.860  7.655   1.00 41.99 ? 152  PHE A CE2   1 
ATOM   1134  C  CZ    . PHE A 1 152 ? 21.496  20.530  6.670   1.00 38.68 ? 152  PHE A CZ    1 
ATOM   1135  N  N     . THR A 1 153 ? 18.358  18.056  2.307   1.00 37.56 ? 153  THR A N     1 
ATOM   1136  C  CA    . THR A 1 153 ? 19.403  17.454  1.494   1.00 39.52 ? 153  THR A CA    1 
ATOM   1137  C  C     . THR A 1 153 ? 20.697  18.188  1.942   1.00 39.28 ? 153  THR A C     1 
ATOM   1138  O  O     . THR A 1 153 ? 20.862  19.408  1.973   1.00 37.96 ? 153  THR A O     1 
ATOM   1139  C  CB    . THR A 1 153 ? 19.162  17.701  0.010   1.00 39.27 ? 153  THR A CB    1 
ATOM   1140  O  OG1   . THR A 1 153 ? 17.800  17.390  -0.260  1.00 45.24 ? 153  THR A OG1   1 
ATOM   1141  C  CG2   . THR A 1 153 ? 20.122  17.043  -0.921  1.00 35.92 ? 153  THR A CG2   1 
ATOM   1142  N  N     . PHE A 1 154 ? 21.486  17.226  2.461   1.00 36.63 ? 154  PHE A N     1 
ATOM   1143  C  CA    . PHE A 1 154 ? 22.783  17.609  3.034   1.00 35.47 ? 154  PHE A CA    1 
ATOM   1144  C  C     . PHE A 1 154 ? 23.782  16.610  2.421   1.00 34.72 ? 154  PHE A C     1 
ATOM   1145  O  O     . PHE A 1 154 ? 23.700  15.443  2.804   1.00 33.64 ? 154  PHE A O     1 
ATOM   1146  C  CB    . PHE A 1 154 ? 22.715  17.351  4.547   1.00 32.03 ? 154  PHE A CB    1 
ATOM   1147  C  CG    . PHE A 1 154 ? 23.979  17.694  5.305   1.00 30.58 ? 154  PHE A CG    1 
ATOM   1148  C  CD1   . PHE A 1 154 ? 24.412  19.009  5.386   1.00 30.01 ? 154  PHE A CD1   1 
ATOM   1149  C  CD2   . PHE A 1 154 ? 24.701  16.758  5.992   1.00 26.73 ? 154  PHE A CD2   1 
ATOM   1150  C  CE1   . PHE A 1 154 ? 25.532  19.367  6.109   1.00 31.59 ? 154  PHE A CE1   1 
ATOM   1151  C  CE2   . PHE A 1 154 ? 25.773  17.091  6.762   1.00 27.17 ? 154  PHE A CE2   1 
ATOM   1152  C  CZ    . PHE A 1 154 ? 26.243  18.401  6.795   1.00 31.75 ? 154  PHE A CZ    1 
ATOM   1153  N  N     . SER A 1 155 ? 24.564  17.052  1.452   1.00 32.68 ? 155  SER A N     1 
ATOM   1154  C  CA    . SER A 1 155 ? 25.396  16.170  0.639   1.00 31.61 ? 155  SER A CA    1 
ATOM   1155  C  C     . SER A 1 155 ? 26.715  15.724  1.237   1.00 30.91 ? 155  SER A C     1 
ATOM   1156  O  O     . SER A 1 155 ? 27.776  16.137  0.744   1.00 30.68 ? 155  SER A O     1 
ATOM   1157  C  CB    . SER A 1 155 ? 25.653  16.935  -0.697  1.00 30.63 ? 155  SER A CB    1 
ATOM   1158  O  OG    . SER A 1 155 ? 25.937  18.311  -0.371  1.00 37.04 ? 155  SER A OG    1 
ATOM   1159  N  N     . PHE A 1 156 ? 26.723  15.002  2.343   1.00 31.58 ? 156  PHE A N     1 
ATOM   1160  C  CA    . PHE A 1 156 ? 27.925  14.529  3.046   1.00 31.72 ? 156  PHE A CA    1 
ATOM   1161  C  C     . PHE A 1 156 ? 27.631  13.189  3.715   1.00 30.71 ? 156  PHE A C     1 
ATOM   1162  O  O     . PHE A 1 156 ? 26.443  12.944  3.964   1.00 30.73 ? 156  PHE A O     1 
ATOM   1163  C  CB    . PHE A 1 156 ? 28.179  15.558  4.186   1.00 30.38 ? 156  PHE A CB    1 
ATOM   1164  C  CG    . PHE A 1 156 ? 28.487  16.907  3.619   1.00 30.09 ? 156  PHE A CG    1 
ATOM   1165  C  CD1   . PHE A 1 156 ? 29.736  17.145  3.035   1.00 30.11 ? 156  PHE A CD1   1 
ATOM   1166  C  CD2   . PHE A 1 156 ? 27.518  17.887  3.587   1.00 28.73 ? 156  PHE A CD2   1 
ATOM   1167  C  CE1   . PHE A 1 156 ? 29.967  18.382  2.432   1.00 24.83 ? 156  PHE A CE1   1 
ATOM   1168  C  CE2   . PHE A 1 156 ? 27.756  19.126  3.030   1.00 27.67 ? 156  PHE A CE2   1 
ATOM   1169  C  CZ    . PHE A 1 156 ? 29.005  19.346  2.456   1.00 26.66 ? 156  PHE A CZ    1 
ATOM   1170  N  N     . PRO A 1 157 ? 28.632  12.346  3.934   1.00 29.20 ? 157  PRO A N     1 
ATOM   1171  C  CA    . PRO A 1 157 ? 28.429  11.024  4.510   1.00 29.02 ? 157  PRO A CA    1 
ATOM   1172  C  C     . PRO A 1 157 ? 27.939  11.103  5.940   1.00 31.37 ? 157  PRO A C     1 
ATOM   1173  O  O     . PRO A 1 157 ? 28.530  11.815  6.754   1.00 32.01 ? 157  PRO A O     1 
ATOM   1174  C  CB    . PRO A 1 157 ? 29.781  10.361  4.407   1.00 27.32 ? 157  PRO A CB    1 
ATOM   1175  C  CG    . PRO A 1 157 ? 30.752  11.527  4.323   1.00 27.52 ? 157  PRO A CG    1 
ATOM   1176  C  CD    . PRO A 1 157 ? 30.042  12.595  3.560   1.00 26.82 ? 157  PRO A CD    1 
ATOM   1177  N  N     . CYS A 1 158 ? 26.845  10.468  6.287   1.00 33.26 ? 158  CYS A N     1 
ATOM   1178  C  CA    . CYS A 1 158 ? 26.186  10.654  7.574   1.00 35.71 ? 158  CYS A CA    1 
ATOM   1179  C  C     . CYS A 1 158 ? 25.645  9.336   8.127   1.00 36.34 ? 158  CYS A C     1 
ATOM   1180  O  O     . CYS A 1 158 ? 25.049  8.604   7.349   1.00 36.57 ? 158  CYS A O     1 
ATOM   1181  C  CB    . CYS A 1 158 ? 24.923  11.525  7.309   1.00 39.23 ? 158  CYS A CB    1 
ATOM   1182  S  SG    . CYS A 1 158 ? 25.191  13.302  7.298   1.00 39.12 ? 158  CYS A SG    1 
ATOM   1183  N  N     . GLN A 1 159 ? 25.740  9.079   9.425   1.00 36.46 ? 159  GLN A N     1 
ATOM   1184  C  CA    . GLN A 1 159 ? 25.222  7.796   9.920   1.00 37.17 ? 159  GLN A CA    1 
ATOM   1185  C  C     . GLN A 1 159 ? 23.815  8.034   10.449  1.00 37.30 ? 159  GLN A C     1 
ATOM   1186  O  O     . GLN A 1 159 ? 23.451  9.057   11.075  1.00 37.50 ? 159  GLN A O     1 
ATOM   1187  C  CB    . GLN A 1 159 ? 26.175  7.152   10.915  1.00 42.59 ? 159  GLN A CB    1 
ATOM   1188  C  CG    . GLN A 1 159 ? 25.573  5.959   11.660  1.00 54.09 ? 159  GLN A CG    1 
ATOM   1189  C  CD    . GLN A 1 159 ? 25.212  6.296   13.102  1.00 59.86 ? 159  GLN A CD    1 
ATOM   1190  O  OE1   . GLN A 1 159 ? 24.107  6.083   13.650  1.00 58.80 ? 159  GLN A OE1   1 
ATOM   1191  N  NE2   . GLN A 1 159 ? 26.218  6.883   13.762  1.00 61.35 ? 159  GLN A NE2   1 
ATOM   1192  N  N     . GLN A 1 160 ? 22.900  7.252   9.912   1.00 37.00 ? 160  GLN A N     1 
ATOM   1193  C  CA    . GLN A 1 160 ? 21.490  7.443   10.204  1.00 37.96 ? 160  GLN A CA    1 
ATOM   1194  C  C     . GLN A 1 160 ? 20.933  6.140   10.776  1.00 38.41 ? 160  GLN A C     1 
ATOM   1195  O  O     . GLN A 1 160 ? 21.120  5.089   10.156  1.00 39.19 ? 160  GLN A O     1 
ATOM   1196  C  CB    . GLN A 1 160 ? 20.686  7.850   8.973   1.00 35.78 ? 160  GLN A CB    1 
ATOM   1197  C  CG    . GLN A 1 160 ? 21.161  9.117   8.284   1.00 39.79 ? 160  GLN A CG    1 
ATOM   1198  C  CD    . GLN A 1 160 ? 20.266  9.446   7.085   1.00 38.28 ? 160  GLN A CD    1 
ATOM   1199  O  OE1   . GLN A 1 160 ? 19.277  10.148  7.294   1.00 36.59 ? 160  GLN A OE1   1 
ATOM   1200  N  NE2   . GLN A 1 160 ? 20.593  8.900   5.921   1.00 32.35 ? 160  GLN A NE2   1 
ATOM   1201  N  N     . SER A 1 161 ? 20.253  6.266   11.891  1.00 38.83 ? 161  SER A N     1 
ATOM   1202  C  CA    . SER A 1 161 ? 19.600  5.097   12.489  1.00 40.88 ? 161  SER A CA    1 
ATOM   1203  C  C     . SER A 1 161 ? 18.105  5.376   12.260  1.00 41.54 ? 161  SER A C     1 
ATOM   1204  O  O     . SER A 1 161 ? 17.283  4.519   12.544  1.00 43.39 ? 161  SER A O     1 
ATOM   1205  C  CB    . SER A 1 161 ? 19.867  4.974   13.988  1.00 42.21 ? 161  SER A CB    1 
ATOM   1206  O  OG    . SER A 1 161 ? 19.058  5.946   14.691  1.00 49.25 ? 161  SER A OG    1 
ATOM   1207  N  N     . LYS A 1 162 ? 17.774  6.548   11.757  1.00 40.29 ? 162  LYS A N     1 
ATOM   1208  C  CA    . LYS A 1 162 ? 16.420  6.832   11.290  1.00 41.32 ? 162  LYS A CA    1 
ATOM   1209  C  C     . LYS A 1 162 ? 16.516  8.069   10.388  1.00 41.97 ? 162  LYS A C     1 
ATOM   1210  O  O     . LYS A 1 162 ? 17.478  8.819   10.450  1.00 42.21 ? 162  LYS A O     1 
ATOM   1211  C  CB    . LYS A 1 162 ? 15.435  7.118   12.447  1.00 44.57 ? 162  LYS A CB    1 
ATOM   1212  C  CG    . LYS A 1 162 ? 16.136  7.841   13.584  1.00 44.15 ? 162  LYS A CG    1 
ATOM   1213  C  CD    . LYS A 1 162 ? 15.306  8.401   14.688  1.00 44.72 ? 162  LYS A CD    1 
ATOM   1214  C  CE    . LYS A 1 162 ? 16.152  9.421   15.465  1.00 47.81 ? 162  LYS A CE    1 
ATOM   1215  N  NZ    . LYS A 1 162 ? 15.302  10.069  16.514  1.00 52.19 ? 162  LYS A NZ    1 
ATOM   1216  N  N     . ILE A 1 163 ? 15.460  8.337   9.661   1.00 42.48 ? 163  ILE A N     1 
ATOM   1217  C  CA    . ILE A 1 163 ? 15.366  9.358   8.629   1.00 42.93 ? 163  ILE A CA    1 
ATOM   1218  C  C     . ILE A 1 163 ? 15.497  10.762  9.152   1.00 42.85 ? 163  ILE A C     1 
ATOM   1219  O  O     . ILE A 1 163 ? 15.874  11.667  8.381   1.00 44.22 ? 163  ILE A O     1 
ATOM   1220  C  CB    . ILE A 1 163 ? 14.085  9.065   7.804   1.00 40.80 ? 163  ILE A CB    1 
ATOM   1221  C  CG1   . ILE A 1 163 ? 14.075  9.568   6.380   1.00 40.51 ? 163  ILE A CG1   1 
ATOM   1222  C  CG2   . ILE A 1 163 ? 12.847  9.590   8.526   1.00 38.33 ? 163  ILE A CG2   1 
ATOM   1223  C  CD1   . ILE A 1 163 ? 15.123  9.085   5.432   1.00 37.29 ? 163  ILE A CD1   1 
ATOM   1224  N  N     . ASP A 1 164 ? 15.259  11.031  10.433  1.00 42.56 ? 164  ASP A N     1 
ATOM   1225  C  CA    . ASP A 1 164 ? 15.371  12.392  10.936  1.00 43.00 ? 164  ASP A CA    1 
ATOM   1226  C  C     . ASP A 1 164 ? 16.594  12.580  11.825  1.00 44.10 ? 164  ASP A C     1 
ATOM   1227  O  O     . ASP A 1 164 ? 16.717  13.579  12.536  1.00 45.41 ? 164  ASP A O     1 
ATOM   1228  C  CB    . ASP A 1 164 ? 14.143  12.965  11.612  1.00 40.90 ? 164  ASP A CB    1 
ATOM   1229  C  CG    . ASP A 1 164 ? 13.594  12.135  12.752  1.00 44.97 ? 164  ASP A CG    1 
ATOM   1230  O  OD1   . ASP A 1 164 ? 13.802  10.911  12.850  1.00 45.40 ? 164  ASP A OD1   1 
ATOM   1231  O  OD2   . ASP A 1 164 ? 12.874  12.649  13.634  1.00 50.12 ? 164  ASP A OD2   1 
ATOM   1232  N  N     . GLU A 1 165 ? 17.579  11.728  11.678  1.00 43.78 ? 165  GLU A N     1 
ATOM   1233  C  CA    . GLU A 1 165 ? 18.872  11.860  12.345  1.00 43.66 ? 165  GLU A CA    1 
ATOM   1234  C  C     . GLU A 1 165 ? 19.941  11.917  11.238  1.00 43.49 ? 165  GLU A C     1 
ATOM   1235  O  O     . GLU A 1 165 ? 19.778  11.163  10.269  1.00 44.93 ? 165  GLU A O     1 
ATOM   1236  C  CB    . GLU A 1 165 ? 19.091  10.536  13.090  1.00 45.85 ? 165  GLU A CB    1 
ATOM   1237  C  CG    . GLU A 1 165 ? 20.485  10.347  13.638  1.00 52.26 ? 165  GLU A CG    1 
ATOM   1238  C  CD    . GLU A 1 165 ? 20.544  9.081   14.487  1.00 53.84 ? 165  GLU A CD    1 
ATOM   1239  O  OE1   . GLU A 1 165 ? 20.361  7.979   13.934  1.00 54.91 ? 165  GLU A OE1   1 
ATOM   1240  O  OE2   . GLU A 1 165 ? 20.771  9.241   15.706  1.00 58.13 ? 165  GLU A OE2   1 
ATOM   1241  N  N     . ALA A 1 166 ? 20.972  12.724  11.374  1.00 41.72 ? 166  ALA A N     1 
ATOM   1242  C  CA    . ALA A 1 166 ? 22.071  12.661  10.422  1.00 41.36 ? 166  ALA A CA    1 
ATOM   1243  C  C     . ALA A 1 166 ? 23.378  13.001  11.133  1.00 40.31 ? 166  ALA A C     1 
ATOM   1244  O  O     . ALA A 1 166 ? 23.687  14.154  11.368  1.00 40.10 ? 166  ALA A O     1 
ATOM   1245  C  CB    . ALA A 1 166 ? 21.769  13.426  9.146   1.00 34.97 ? 166  ALA A CB    1 
ATOM   1246  N  N     . ILE A 1 167 ? 24.124  11.976  11.553  1.00 40.37 ? 167  ILE A N     1 
ATOM   1247  C  CA    . ILE A 1 167 ? 25.396  12.197  12.260  1.00 39.52 ? 167  ILE A CA    1 
ATOM   1248  C  C     . ILE A 1 167 ? 26.526  12.280  11.230  1.00 37.36 ? 167  ILE A C     1 
ATOM   1249  O  O     . ILE A 1 167 ? 26.842  11.270  10.607  1.00 36.88 ? 167  ILE A O     1 
ATOM   1250  C  CB    . ILE A 1 167 ? 25.782  11.033  13.204  1.00 40.39 ? 167  ILE A CB    1 
ATOM   1251  C  CG1   . ILE A 1 167 ? 24.600  10.637  14.088  1.00 41.53 ? 167  ILE A CG1   1 
ATOM   1252  C  CG2   . ILE A 1 167 ? 26.975  11.404  14.067  1.00 37.23 ? 167  ILE A CG2   1 
ATOM   1253  C  CD1   . ILE A 1 167 ? 24.639  11.376  15.409  1.00 44.95 ? 167  ILE A CD1   1 
ATOM   1254  N  N     . LEU A 1 168 ? 27.155  13.422  11.144  1.00 36.07 ? 168  LEU A N     1 
ATOM   1255  C  CA    . LEU A 1 168 ? 28.194  13.660  10.177  1.00 35.01 ? 168  LEU A CA    1 
ATOM   1256  C  C     . LEU A 1 168 ? 29.435  12.837  10.490  1.00 36.85 ? 168  LEU A C     1 
ATOM   1257  O  O     . LEU A 1 168 ? 30.112  12.985  11.508  1.00 37.92 ? 168  LEU A O     1 
ATOM   1258  C  CB    . LEU A 1 168 ? 28.540  15.127  10.003  1.00 27.80 ? 168  LEU A CB    1 
ATOM   1259  C  CG    . LEU A 1 168 ? 29.740  15.424  9.093   1.00 31.16 ? 168  LEU A CG    1 
ATOM   1260  C  CD1   . LEU A 1 168 ? 29.432  15.051  7.630   1.00 27.74 ? 168  LEU A CD1   1 
ATOM   1261  C  CD2   . LEU A 1 168 ? 30.062  16.917  9.120   1.00 24.67 ? 168  LEU A CD2   1 
ATOM   1262  N  N     . ILE A 1 169 ? 29.746  11.955  9.537   1.00 36.66 ? 169  ILE A N     1 
ATOM   1263  C  CA    . ILE A 1 169 ? 30.913  11.139  9.595   1.00 35.32 ? 169  ILE A CA    1 
ATOM   1264  C  C     . ILE A 1 169 ? 32.132  11.973  9.267   1.00 38.01 ? 169  ILE A C     1 
ATOM   1265  O  O     . ILE A 1 169 ? 33.027  12.079  10.102  1.00 39.19 ? 169  ILE A O     1 
ATOM   1266  C  CB    . ILE A 1 169 ? 30.852  9.885   8.727   1.00 31.69 ? 169  ILE A CB    1 
ATOM   1267  C  CG1   . ILE A 1 169 ? 29.574  9.112   8.993   1.00 28.88 ? 169  ILE A CG1   1 
ATOM   1268  C  CG2   . ILE A 1 169 ? 32.105  9.066   9.112   1.00 30.75 ? 169  ILE A CG2   1 
ATOM   1269  C  CD1   . ILE A 1 169 ? 29.150  7.919   8.169   1.00 22.13 ? 169  ILE A CD1   1 
ATOM   1270  N  N     . THR A 1 170 ? 32.089  12.694  8.151   1.00 37.80 ? 170  THR A N     1 
ATOM   1271  C  CA    . THR A 1 170 ? 33.199  13.512  7.734   1.00 37.31 ? 170  THR A CA    1 
ATOM   1272  C  C     . THR A 1 170 ? 32.836  14.548  6.682   1.00 38.22 ? 170  THR A C     1 
ATOM   1273  O  O     . THR A 1 170 ? 31.938  14.350  5.849   1.00 38.29 ? 170  THR A O     1 
ATOM   1274  C  CB    . THR A 1 170 ? 34.384  12.627  7.295   1.00 38.71 ? 170  THR A CB    1 
ATOM   1275  O  OG1   . THR A 1 170 ? 35.416  13.442  6.747   1.00 40.33 ? 170  THR A OG1   1 
ATOM   1276  C  CG2   . THR A 1 170 ? 34.041  11.547  6.307   1.00 42.41 ? 170  THR A CG2   1 
ATOM   1277  N  N     . TRP A 1 171 ? 33.529  15.701  6.736   1.00 36.92 ? 171  TRP A N     1 
ATOM   1278  C  CA    . TRP A 1 171 ? 33.369  16.719  5.722   1.00 35.36 ? 171  TRP A CA    1 
ATOM   1279  C  C     . TRP A 1 171 ? 34.120  16.251  4.466   1.00 34.60 ? 171  TRP A C     1 
ATOM   1280  O  O     . TRP A 1 171 ? 35.138  15.608  4.588   1.00 32.49 ? 171  TRP A O     1 
ATOM   1281  C  CB    . TRP A 1 171 ? 33.947  18.057  6.163   1.00 36.14 ? 171  TRP A CB    1 
ATOM   1282  C  CG    . TRP A 1 171 ? 33.113  18.845  7.139   1.00 35.92 ? 171  TRP A CG    1 
ATOM   1283  C  CD1   . TRP A 1 171 ? 33.515  19.192  8.406   1.00 34.17 ? 171  TRP A CD1   1 
ATOM   1284  C  CD2   . TRP A 1 171 ? 31.791  19.339  6.992   1.00 33.17 ? 171  TRP A CD2   1 
ATOM   1285  N  NE1   . TRP A 1 171 ? 32.496  19.861  9.037   1.00 38.74 ? 171  TRP A NE1   1 
ATOM   1286  C  CE2   . TRP A 1 171 ? 31.447  20.003  8.180   1.00 33.12 ? 171  TRP A CE2   1 
ATOM   1287  C  CE3   . TRP A 1 171 ? 30.854  19.324  5.949   1.00 39.10 ? 171  TRP A CE3   1 
ATOM   1288  C  CZ2   . TRP A 1 171 ? 30.215  20.623  8.389   1.00 33.20 ? 171  TRP A CZ2   1 
ATOM   1289  C  CZ3   . TRP A 1 171 ? 29.617  19.941  6.136   1.00 31.77 ? 171  TRP A CZ3   1 
ATOM   1290  C  CH2   . TRP A 1 171 ? 29.336  20.576  7.355   1.00 34.65 ? 171  TRP A CH2   1 
ATOM   1291  N  N     . THR A 1 172 ? 33.628  16.618  3.289   1.00 34.33 ? 172  THR A N     1 
ATOM   1292  C  CA    . THR A 1 172 ? 34.303  16.435  2.028   1.00 32.90 ? 172  THR A CA    1 
ATOM   1293  C  C     . THR A 1 172 ? 34.053  17.608  1.088   1.00 31.44 ? 172  THR A C     1 
ATOM   1294  O  O     . THR A 1 172 ? 33.216  18.464  1.378   1.00 32.66 ? 172  THR A O     1 
ATOM   1295  C  CB    . THR A 1 172 ? 33.745  15.205  1.271   1.00 37.83 ? 172  THR A CB    1 
ATOM   1296  O  OG1   . THR A 1 172 ? 32.341  15.414  1.057   1.00 33.10 ? 172  THR A OG1   1 
ATOM   1297  C  CG2   . THR A 1 172 ? 33.969  13.916  2.036   1.00 32.48 ? 172  THR A CG2   1 
ATOM   1298  N  N     . LYS A 1 173 ? 34.756  17.629  -0.038  1.00 32.25 ? 173  LYS A N     1 
ATOM   1299  C  CA    . LYS A 1 173 ? 34.553  18.671  -1.031  1.00 33.07 ? 173  LYS A CA    1 
ATOM   1300  C  C     . LYS A 1 173 ? 34.999  20.005  -0.443  1.00 34.14 ? 173  LYS A C     1 
ATOM   1301  O  O     . LYS A 1 173 ? 36.087  20.038  0.143   1.00 35.94 ? 173  LYS A O     1 
ATOM   1302  C  CB    . LYS A 1 173 ? 33.086  18.724  -1.473  1.00 34.41 ? 173  LYS A CB    1 
ATOM   1303  C  CG    . LYS A 1 173 ? 32.764  17.648  -2.515  1.00 31.38 ? 173  LYS A CG    1 
ATOM   1304  C  CD    . LYS A 1 173 ? 31.259  17.516  -2.706  1.00 33.85 ? 173  LYS A CD    1 
ATOM   1305  C  CE    . LYS A 1 173 ? 30.487  17.631  -1.424  1.00 28.74 ? 173  LYS A CE    1 
ATOM   1306  N  NZ    . LYS A 1 173 ? 29.041  17.341  -1.559  1.00 33.24 ? 173  LYS A NZ    1 
ATOM   1307  N  N     . ARG A 1 174 ? 34.124  20.994  -0.500  1.00 33.60 ? 174  ARG A N     1 
ATOM   1308  C  CA    . ARG A 1 174 ? 34.555  22.296  -0.065  1.00 34.63 ? 174  ARG A CA    1 
ATOM   1309  C  C     . ARG A 1 174 ? 34.371  22.676  1.385   1.00 35.03 ? 174  ARG A C     1 
ATOM   1310  O  O     . ARG A 1 174 ? 34.684  23.869  1.664   1.00 34.07 ? 174  ARG A O     1 
ATOM   1311  C  CB    . ARG A 1 174 ? 33.925  23.486  -0.870  1.00 35.33 ? 174  ARG A CB    1 
ATOM   1312  C  CG    . ARG A 1 174 ? 34.311  23.426  -2.328  1.00 36.53 ? 174  ARG A CG    1 
ATOM   1313  C  CD    . ARG A 1 174 ? 33.965  24.646  -3.146  1.00 35.47 ? 174  ARG A CD    1 
ATOM   1314  N  NE    . ARG A 1 174 ? 33.820  24.225  -4.570  1.00 32.65 ? 174  ARG A NE    1 
ATOM   1315  C  CZ    . ARG A 1 174 ? 34.882  24.304  -5.344  1.00 39.15 ? 174  ARG A CZ    1 
ATOM   1316  N  NH1   . ARG A 1 174 ? 36.064  24.658  -4.849  1.00 37.48 ? 174  ARG A NH1   1 
ATOM   1317  N  NH2   . ARG A 1 174 ? 34.865  23.978  -6.624  1.00 44.81 ? 174  ARG A NH2   1 
ATOM   1318  N  N     . PHE A 1 175 ? 33.657  21.937  2.200   1.00 35.40 ? 175  PHE A N     1 
ATOM   1319  C  CA    . PHE A 1 175 ? 33.300  22.448  3.525   1.00 35.79 ? 175  PHE A CA    1 
ATOM   1320  C  C     . PHE A 1 175 ? 34.234  21.906  4.617   1.00 36.33 ? 175  PHE A C     1 
ATOM   1321  O  O     . PHE A 1 175 ? 34.591  20.719  4.637   1.00 37.17 ? 175  PHE A O     1 
ATOM   1322  C  CB    . PHE A 1 175 ? 31.928  21.875  3.858   1.00 34.72 ? 175  PHE A CB    1 
ATOM   1323  C  CG    . PHE A 1 175 ? 30.747  22.616  3.321   1.00 38.06 ? 175  PHE A CG    1 
ATOM   1324  C  CD1   . PHE A 1 175 ? 30.559  22.777  1.959   1.00 37.42 ? 175  PHE A CD1   1 
ATOM   1325  C  CD2   . PHE A 1 175 ? 29.743  23.022  4.186   1.00 35.15 ? 175  PHE A CD2   1 
ATOM   1326  C  CE1   . PHE A 1 175 ? 29.429  23.409  1.471   1.00 39.86 ? 175  PHE A CE1   1 
ATOM   1327  C  CE2   . PHE A 1 175 ? 28.587  23.591  3.701   1.00 36.08 ? 175  PHE A CE2   1 
ATOM   1328  C  CZ    . PHE A 1 175 ? 28.434  23.792  2.345   1.00 39.00 ? 175  PHE A CZ    1 
ATOM   1329  N  N     . LYS A 1 176 ? 34.455  22.712  5.651   1.00 35.67 ? 176  LYS A N     1 
ATOM   1330  C  CA    . LYS A 1 176 ? 35.198  22.179  6.790   1.00 35.03 ? 176  LYS A CA    1 
ATOM   1331  C  C     . LYS A 1 176 ? 34.925  23.007  8.042   1.00 34.20 ? 176  LYS A C     1 
ATOM   1332  O  O     . LYS A 1 176 ? 35.697  23.925  8.292   1.00 33.72 ? 176  LYS A O     1 
ATOM   1333  C  CB    . LYS A 1 176 ? 36.696  22.112  6.520   1.00 39.06 ? 176  LYS A CB    1 
ATOM   1334  C  CG    . LYS A 1 176 ? 37.416  21.217  7.517   1.00 34.71 ? 176  LYS A CG    1 
ATOM   1335  C  CD    . LYS A 1 176 ? 38.916  21.247  7.279   1.00 37.04 ? 176  LYS A CD    1 
ATOM   1336  C  CE    . LYS A 1 176 ? 39.434  19.826  7.499   1.00 46.66 ? 176  LYS A CE    1 
ATOM   1337  N  NZ    . LYS A 1 176 ? 39.075  19.262  8.853   1.00 51.58 ? 176  LYS A NZ    1 
ATOM   1338  N  N     . ALA A 1 177 ? 33.731  22.815  8.580   1.00 33.48 ? 177  ALA A N     1 
ATOM   1339  C  CA    . ALA A 1 177 ? 33.288  23.599  9.722   1.00 35.15 ? 177  ALA A CA    1 
ATOM   1340  C  C     . ALA A 1 177 ? 33.525  22.795  11.001  1.00 36.10 ? 177  ALA A C     1 
ATOM   1341  O  O     . ALA A 1 177 ? 33.147  21.631  11.098  1.00 35.84 ? 177  ALA A O     1 
ATOM   1342  C  CB    . ALA A 1 177 ? 31.831  23.987  9.584   1.00 30.13 ? 177  ALA A CB    1 
ATOM   1343  N  N     . SER A 1 178 ? 34.086  23.459  11.995  1.00 36.95 ? 178  SER A N     1 
ATOM   1344  C  CA    . SER A 1 178 ? 34.461  22.721  13.193  1.00 39.98 ? 178  SER A CA    1 
ATOM   1345  C  C     . SER A 1 178 ? 33.255  22.474  14.108  1.00 40.78 ? 178  SER A C     1 
ATOM   1346  O  O     . SER A 1 178 ? 32.266  23.201  14.100  1.00 41.11 ? 178  SER A O     1 
ATOM   1347  C  CB    . SER A 1 178 ? 35.584  23.489  13.912  1.00 36.90 ? 178  SER A CB    1 
ATOM   1348  O  OG    . SER A 1 178 ? 34.989  24.698  14.383  1.00 41.36 ? 178  SER A OG    1 
ATOM   1349  N  N     . GLY A 1 179 ? 33.443  21.472  14.974  1.00 40.62 ? 179  GLY A N     1 
ATOM   1350  C  CA    . GLY A 1 179 ? 32.398  21.105  15.900  1.00 41.40 ? 179  GLY A CA    1 
ATOM   1351  C  C     . GLY A 1 179 ? 31.164  20.490  15.247  1.00 40.73 ? 179  GLY A C     1 
ATOM   1352  O  O     . GLY A 1 179 ? 30.126  20.613  15.890  1.00 41.32 ? 179  GLY A O     1 
ATOM   1353  N  N     . VAL A 1 180 ? 31.227  19.843  14.101  1.00 39.29 ? 180  VAL A N     1 
ATOM   1354  C  CA    . VAL A 1 180 ? 30.071  19.227  13.464  1.00 38.45 ? 180  VAL A CA    1 
ATOM   1355  C  C     . VAL A 1 180 ? 30.221  17.715  13.282  1.00 38.11 ? 180  VAL A C     1 
ATOM   1356  O  O     . VAL A 1 180 ? 29.306  16.901  13.528  1.00 38.52 ? 180  VAL A O     1 
ATOM   1357  C  CB    . VAL A 1 180 ? 29.816  19.919  12.100  1.00 37.39 ? 180  VAL A CB    1 
ATOM   1358  C  CG1   . VAL A 1 180 ? 28.533  19.442  11.413  1.00 36.78 ? 180  VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A 1 180 ? 29.696  21.425  12.272  1.00 31.42 ? 180  VAL A CG2   1 
ATOM   1360  N  N     . GLU A 1 181 ? 31.391  17.271  12.845  1.00 36.16 ? 181  GLU A N     1 
ATOM   1361  C  CA    . GLU A 1 181 ? 31.684  15.861  12.673  1.00 37.48 ? 181  GLU A CA    1 
ATOM   1362  C  C     . GLU A 1 181 ? 31.421  15.110  13.974  1.00 38.01 ? 181  GLU A C     1 
ATOM   1363  O  O     . GLU A 1 181 ? 31.735  15.640  15.038  1.00 37.62 ? 181  GLU A O     1 
ATOM   1364  C  CB    . GLU A 1 181 ? 33.097  15.553  12.188  1.00 36.01 ? 181  GLU A CB    1 
ATOM   1365  C  CG    . GLU A 1 181 ? 33.438  16.233  10.879  1.00 33.25 ? 181  GLU A CG    1 
ATOM   1366  C  CD    . GLU A 1 181 ? 34.850  16.003  10.431  1.00 34.28 ? 181  GLU A CD    1 
ATOM   1367  O  OE1   . GLU A 1 181 ? 35.777  15.948  11.265  1.00 43.24 ? 181  GLU A OE1   1 
ATOM   1368  O  OE2   . GLU A 1 181 ? 35.118  15.923  9.220   1.00 41.77 ? 181  GLU A OE2   1 
ATOM   1369  N  N     . GLY A 1 182 ? 30.771  13.948  13.847  1.00 37.22 ? 182  GLY A N     1 
ATOM   1370  C  CA    . GLY A 1 182 ? 30.360  13.275  15.078  1.00 36.79 ? 182  GLY A CA    1 
ATOM   1371  C  C     . GLY A 1 182 ? 29.072  13.868  15.624  1.00 38.34 ? 182  GLY A C     1 
ATOM   1372  O  O     . GLY A 1 182 ? 28.481  13.257  16.521  1.00 39.29 ? 182  GLY A O     1 
ATOM   1373  N  N     . ALA A 1 183 ? 28.621  15.045  15.211  1.00 38.85 ? 183  ALA A N     1 
ATOM   1374  C  CA    . ALA A 1 183 ? 27.358  15.575  15.741  1.00 40.37 ? 183  ALA A CA    1 
ATOM   1375  C  C     . ALA A 1 183 ? 26.243  15.428  14.709  1.00 42.05 ? 183  ALA A C     1 
ATOM   1376  O  O     . ALA A 1 183 ? 26.478  15.175  13.508  1.00 43.18 ? 183  ALA A O     1 
ATOM   1377  C  CB    . ALA A 1 183 ? 27.521  17.004  16.242  1.00 30.34 ? 183  ALA A CB    1 
ATOM   1378  N  N     . ASP A 1 184 ? 25.003  15.383  15.180  1.00 42.94 ? 184  ASP A N     1 
ATOM   1379  C  CA    . ASP A 1 184 ? 23.808  15.173  14.366  1.00 42.18 ? 184  ASP A CA    1 
ATOM   1380  C  C     . ASP A 1 184 ? 23.305  16.531  13.864  1.00 41.75 ? 184  ASP A C     1 
ATOM   1381  O  O     . ASP A 1 184 ? 22.841  17.359  14.633  1.00 40.76 ? 184  ASP A O     1 
ATOM   1382  C  CB    . ASP A 1 184 ? 22.716  14.465  15.151  1.00 43.95 ? 184  ASP A CB    1 
ATOM   1383  C  CG    . ASP A 1 184 ? 21.370  14.344  14.476  1.00 45.14 ? 184  ASP A CG    1 
ATOM   1384  O  OD1   . ASP A 1 184 ? 21.033  15.004  13.484  1.00 48.58 ? 184  ASP A OD1   1 
ATOM   1385  O  OD2   . ASP A 1 184 ? 20.532  13.561  14.994  1.00 53.28 ? 184  ASP A OD2   1 
ATOM   1386  N  N     . VAL A 1 185 ? 23.441  16.734  12.559  1.00 41.66 ? 185  VAL A N     1 
ATOM   1387  C  CA    . VAL A 1 185 ? 23.143  18.028  11.957  1.00 41.75 ? 185  VAL A CA    1 
ATOM   1388  C  C     . VAL A 1 185 ? 21.698  18.423  12.208  1.00 41.47 ? 185  VAL A C     1 
ATOM   1389  O  O     . VAL A 1 185 ? 21.367  19.617  12.175  1.00 40.63 ? 185  VAL A O     1 
ATOM   1390  C  CB    . VAL A 1 185 ? 23.528  18.056  10.470  1.00 40.98 ? 185  VAL A CB    1 
ATOM   1391  C  CG1   . VAL A 1 185 ? 24.860  17.338  10.230  1.00 39.42 ? 185  VAL A CG1   1 
ATOM   1392  C  CG2   . VAL A 1 185 ? 22.446  17.391  9.619   1.00 44.05 ? 185  VAL A CG2   1 
ATOM   1393  N  N     . VAL A 1 186 ? 20.836  17.449  12.530  1.00 41.74 ? 186  VAL A N     1 
ATOM   1394  C  CA    . VAL A 1 186 ? 19.458  17.868  12.848  1.00 42.65 ? 186  VAL A CA    1 
ATOM   1395  C  C     . VAL A 1 186 ? 19.433  18.606  14.183  1.00 43.13 ? 186  VAL A C     1 
ATOM   1396  O  O     . VAL A 1 186 ? 18.855  19.678  14.297  1.00 43.98 ? 186  VAL A O     1 
ATOM   1397  C  CB    . VAL A 1 186 ? 18.468  16.697  12.887  1.00 40.57 ? 186  VAL A CB    1 
ATOM   1398  C  CG1   . VAL A 1 186 ? 17.115  17.235  13.352  1.00 38.42 ? 186  VAL A CG1   1 
ATOM   1399  C  CG2   . VAL A 1 186 ? 18.335  16.075  11.520  1.00 37.64 ? 186  VAL A CG2   1 
ATOM   1400  N  N     . LYS A 1 187 ? 20.149  18.113  15.169  1.00 44.27 ? 187  LYS A N     1 
ATOM   1401  C  CA    . LYS A 1 187 ? 20.269  18.716  16.492  1.00 46.52 ? 187  LYS A CA    1 
ATOM   1402  C  C     . LYS A 1 187 ? 20.754  20.158  16.373  1.00 47.04 ? 187  LYS A C     1 
ATOM   1403  O  O     . LYS A 1 187 ? 20.150  21.153  16.736  1.00 48.08 ? 187  LYS A O     1 
ATOM   1404  C  CB    . LYS A 1 187 ? 21.306  17.902  17.278  1.00 51.63 ? 187  LYS A CB    1 
ATOM   1405  C  CG    . LYS A 1 187 ? 20.962  17.154  18.543  1.00 51.06 ? 187  LYS A CG    1 
ATOM   1406  C  CD    . LYS A 1 187 ? 22.159  17.055  19.496  1.00 55.72 ? 187  LYS A CD    1 
ATOM   1407  C  CE    . LYS A 1 187 ? 23.521  17.411  18.926  1.00 58.13 ? 187  LYS A CE    1 
ATOM   1408  N  NZ    . LYS A 1 187 ? 24.366  16.270  18.455  1.00 55.50 ? 187  LYS A NZ    1 
ATOM   1409  N  N     . LEU A 1 188 ? 21.898  20.304  15.740  1.00 47.06 ? 188  LEU A N     1 
ATOM   1410  C  CA    . LEU A 1 188 ? 22.605  21.516  15.399  1.00 46.75 ? 188  LEU A CA    1 
ATOM   1411  C  C     . LEU A 1 188 ? 21.750  22.541  14.660  1.00 45.71 ? 188  LEU A C     1 
ATOM   1412  O  O     . LEU A 1 188 ? 21.787  23.726  14.995  1.00 45.31 ? 188  LEU A O     1 
ATOM   1413  C  CB    . LEU A 1 188 ? 23.814  21.080  14.551  1.00 46.09 ? 188  LEU A CB    1 
ATOM   1414  C  CG    . LEU A 1 188 ? 25.163  20.942  15.221  1.00 49.39 ? 188  LEU A CG    1 
ATOM   1415  C  CD1   . LEU A 1 188 ? 25.083  20.672  16.701  1.00 45.54 ? 188  LEU A CD1   1 
ATOM   1416  C  CD2   . LEU A 1 188 ? 26.071  19.930  14.508  1.00 49.17 ? 188  LEU A CD2   1 
ATOM   1417  N  N     . LEU A 1 189 ? 20.928  22.130  13.713  1.00 44.80 ? 189  LEU A N     1 
ATOM   1418  C  CA    . LEU A 1 189 ? 20.082  23.029  12.963  1.00 45.40 ? 189  LEU A CA    1 
ATOM   1419  C  C     . LEU A 1 189 ? 18.951  23.544  13.857  1.00 47.70 ? 189  LEU A C     1 
ATOM   1420  O  O     . LEU A 1 189 ? 18.777  24.741  14.069  1.00 47.70 ? 189  LEU A O     1 
ATOM   1421  C  CB    . LEU A 1 189 ? 19.518  22.344  11.725  1.00 40.98 ? 189  LEU A CB    1 
ATOM   1422  C  CG    . LEU A 1 189 ? 19.245  23.258  10.535  1.00 44.84 ? 189  LEU A CG    1 
ATOM   1423  C  CD1   . LEU A 1 189 ? 18.024  22.836  9.756   1.00 39.56 ? 189  LEU A CD1   1 
ATOM   1424  C  CD2   . LEU A 1 189 ? 19.095  24.708  10.954  1.00 42.45 ? 189  LEU A CD2   1 
ATOM   1425  N  N     . ASN A 1 190 ? 18.263  22.621  14.510  1.00 49.56 ? 190  ASN A N     1 
ATOM   1426  C  CA    . ASN A 1 190 ? 17.259  22.927  15.523  1.00 50.59 ? 190  ASN A CA    1 
ATOM   1427  C  C     . ASN A 1 190 ? 17.896  23.894  16.535  1.00 52.23 ? 190  ASN A C     1 
ATOM   1428  O  O     . ASN A 1 190 ? 17.177  24.744  17.076  1.00 53.94 ? 190  ASN A O     1 
ATOM   1429  C  CB    . ASN A 1 190 ? 16.976  21.690  16.401  1.00 50.03 ? 190  ASN A CB    1 
ATOM   1430  C  CG    . ASN A 1 190 ? 16.086  20.657  15.766  1.00 44.90 ? 190  ASN A CG    1 
ATOM   1431  O  OD1   . ASN A 1 190 ? 15.391  20.974  14.817  1.00 49.46 ? 190  ASN A OD1   1 
ATOM   1432  N  ND2   . ASN A 1 190 ? 16.113  19.450  16.316  1.00 49.97 ? 190  ASN A ND2   1 
ATOM   1433  N  N     . LYS A 1 191 ? 19.134  23.582  16.935  1.00 51.95 ? 191  LYS A N     1 
ATOM   1434  C  CA    . LYS A 1 191 ? 19.698  24.440  17.970  1.00 53.00 ? 191  LYS A CA    1 
ATOM   1435  C  C     . LYS A 1 191 ? 19.916  25.849  17.452  1.00 53.93 ? 191  LYS A C     1 
ATOM   1436  O  O     . LYS A 1 191 ? 19.581  26.815  18.151  1.00 54.94 ? 191  LYS A O     1 
ATOM   1437  C  CB    . LYS A 1 191 ? 20.835  23.847  18.748  1.00 53.30 ? 191  LYS A CB    1 
ATOM   1438  C  CG    . LYS A 1 191 ? 21.574  24.871  19.584  1.00 54.06 ? 191  LYS A CG    1 
ATOM   1439  C  CD    . LYS A 1 191 ? 22.983  25.079  19.057  1.00 55.04 ? 191  LYS A CD    1 
ATOM   1440  C  CE    . LYS A 1 191 ? 23.941  24.225  19.881  1.00 58.05 ? 191  LYS A CE    1 
ATOM   1441  N  NZ    . LYS A 1 191 ? 25.358  24.435  19.423  1.00 63.82 ? 191  LYS A NZ    1 
ATOM   1442  N  N     . ALA A 1 192 ? 20.309  25.996  16.195  1.00 53.30 ? 192  ALA A N     1 
ATOM   1443  C  CA    . ALA A 1 192 ? 20.409  27.343  15.633  1.00 53.10 ? 192  ALA A CA    1 
ATOM   1444  C  C     . ALA A 1 192 ? 19.022  27.967  15.540  1.00 53.49 ? 192  ALA A C     1 
ATOM   1445  O  O     . ALA A 1 192 ? 18.784  29.088  15.980  1.00 53.65 ? 192  ALA A O     1 
ATOM   1446  C  CB    . ALA A 1 192 ? 21.093  27.263  14.280  1.00 52.37 ? 192  ALA A CB    1 
ATOM   1447  N  N     . ILE A 1 193 ? 18.091  27.264  14.905  1.00 54.23 ? 193  ILE A N     1 
ATOM   1448  C  CA    . ILE A 1 193 ? 16.735  27.746  14.781  1.00 55.94 ? 193  ILE A CA    1 
ATOM   1449  C  C     . ILE A 1 193 ? 16.196  28.256  16.123  1.00 57.60 ? 193  ILE A C     1 
ATOM   1450  O  O     . ILE A 1 193 ? 15.856  29.437  16.256  1.00 56.73 ? 193  ILE A O     1 
ATOM   1451  C  CB    . ILE A 1 193 ? 15.778  26.686  14.215  1.00 54.56 ? 193  ILE A CB    1 
ATOM   1452  C  CG1   . ILE A 1 193 ? 16.180  26.360  12.768  1.00 53.63 ? 193  ILE A CG1   1 
ATOM   1453  C  CG2   . ILE A 1 193 ? 14.379  27.287  14.253  1.00 51.15 ? 193  ILE A CG2   1 
ATOM   1454  C  CD1   . ILE A 1 193 ? 15.583  25.086  12.224  1.00 48.51 ? 193  ILE A CD1   1 
ATOM   1455  N  N     . LYS A 1 194 ? 16.241  27.381  17.121  1.00 58.76 ? 194  LYS A N     1 
ATOM   1456  C  CA    . LYS A 1 194 ? 15.808  27.700  18.482  1.00 59.86 ? 194  LYS A CA    1 
ATOM   1457  C  C     . LYS A 1 194 ? 16.359  29.015  18.989  1.00 60.86 ? 194  LYS A C     1 
ATOM   1458  O  O     . LYS A 1 194 ? 15.646  29.904  19.432  1.00 62.37 ? 194  LYS A O     1 
ATOM   1459  C  CB    . LYS A 1 194 ? 16.326  26.595  19.393  1.00 63.18 ? 194  LYS A CB    1 
ATOM   1460  C  CG    . LYS A 1 194 ? 15.769  26.416  20.781  1.00 65.20 ? 194  LYS A CG    1 
ATOM   1461  C  CD    . LYS A 1 194 ? 16.368  25.163  21.428  1.00 67.37 ? 194  LYS A CD    1 
ATOM   1462  C  CE    . LYS A 1 194 ? 17.887  25.120  21.289  1.00 72.10 ? 194  LYS A CE    1 
ATOM   1463  N  NZ    . LYS A 1 194 ? 18.473  23.775  21.004  1.00 66.02 ? 194  LYS A NZ    1 
ATOM   1464  N  N     . LYS A 1 195 ? 17.670  29.174  18.953  1.00 61.48 ? 195  LYS A N     1 
ATOM   1465  C  CA    . LYS A 1 195 ? 18.316  30.378  19.437  1.00 62.05 ? 195  LYS A CA    1 
ATOM   1466  C  C     . LYS A 1 195 ? 17.817  31.644  18.747  1.00 62.57 ? 195  LYS A C     1 
ATOM   1467  O  O     . LYS A 1 195 ? 18.223  32.753  19.134  1.00 61.98 ? 195  LYS A O     1 
ATOM   1468  C  CB    . LYS A 1 195 ? 19.825  30.285  19.140  1.00 59.96 ? 195  LYS A CB    1 
ATOM   1469  C  CG    . LYS A 1 195 ? 20.573  31.360  19.916  1.00 58.10 ? 195  LYS A CG    1 
ATOM   1470  C  CD    . LYS A 1 195 ? 21.585  32.055  19.024  1.00 58.74 ? 195  LYS A CD    1 
ATOM   1471  C  CE    . LYS A 1 195 ? 22.741  31.156  18.616  1.00 53.50 ? 195  LYS A CE    1 
ATOM   1472  N  NZ    . LYS A 1 195 ? 23.829  32.003  18.048  1.00 56.99 ? 195  LYS A NZ    1 
ATOM   1473  N  N     . ARG A 1 196 ? 17.213  31.446  17.562  1.00 62.95 ? 196  ARG A N     1 
ATOM   1474  C  CA    . ARG A 1 196 ? 16.855  32.651  16.821  1.00 63.92 ? 196  ARG A CA    1 
ATOM   1475  C  C     . ARG A 1 196 ? 15.510  33.207  17.219  1.00 64.56 ? 196  ARG A C     1 
ATOM   1476  O  O     . ARG A 1 196 ? 15.527  34.313  17.790  1.00 64.89 ? 196  ARG A O     1 
ATOM   1477  C  CB    . ARG A 1 196 ? 17.382  32.718  15.430  1.00 60.64 ? 196  ARG A CB    1 
ATOM   1478  C  CG    . ARG A 1 196 ? 16.693  32.027  14.287  1.00 61.74 ? 196  ARG A CG    1 
ATOM   1479  C  CD    . ARG A 1 196 ? 16.767  32.891  13.033  1.00 60.57 ? 196  ARG A CD    1 
ATOM   1480  N  NE    . ARG A 1 196 ? 17.992  33.694  13.029  1.00 61.22 ? 196  ARG A NE    1 
ATOM   1481  C  CZ    . ARG A 1 196 ? 17.989  34.928  12.529  1.00 61.36 ? 196  ARG A CZ    1 
ATOM   1482  N  NH1   . ARG A 1 196 ? 16.843  35.372  12.031  1.00 63.75 ? 196  ARG A NH1   1 
ATOM   1483  N  NH2   . ARG A 1 196 ? 19.066  35.700  12.494  1.00 61.68 ? 196  ARG A NH2   1 
ATOM   1484  N  N     . GLY A 1 197 ? 14.399  32.486  17.135  1.00 64.72 ? 197  GLY A N     1 
ATOM   1485  C  CA    . GLY A 1 197 ? 13.112  32.974  17.589  1.00 65.43 ? 197  GLY A CA    1 
ATOM   1486  C  C     . GLY A 1 197 ? 12.085  33.209  16.499  1.00 66.32 ? 197  GLY A C     1 
ATOM   1487  O  O     . GLY A 1 197 ? 10.879  32.956  16.660  1.00 67.11 ? 197  GLY A O     1 
ATOM   1488  N  N     . ASP A 1 198 ? 12.524  33.699  15.343  1.00 66.02 ? 198  ASP A N     1 
ATOM   1489  C  CA    . ASP A 1 198 ? 11.648  34.007  14.228  1.00 65.26 ? 198  ASP A CA    1 
ATOM   1490  C  C     . ASP A 1 198 ? 10.509  33.014  14.005  1.00 64.32 ? 198  ASP A C     1 
ATOM   1491  O  O     . ASP A 1 198 ? 9.437   33.428  13.540  1.00 64.84 ? 198  ASP A O     1 
ATOM   1492  C  CB    . ASP A 1 198 ? 12.484  34.016  12.940  1.00 69.84 ? 198  ASP A CB    1 
ATOM   1493  C  CG    . ASP A 1 198 ? 13.171  35.319  12.629  1.00 73.86 ? 198  ASP A CG    1 
ATOM   1494  O  OD1   . ASP A 1 198 ? 13.286  36.176  13.532  1.00 74.36 ? 198  ASP A OD1   1 
ATOM   1495  O  OD2   . ASP A 1 198 ? 13.639  35.457  11.468  1.00 76.52 ? 198  ASP A OD2   1 
ATOM   1496  N  N     . TYR A 1 199 ? 10.801  31.718  13.989  1.00 62.60 ? 199  TYR A N     1 
ATOM   1497  C  CA    . TYR A 1 199 ? 9.841   30.731  13.505  1.00 61.45 ? 199  TYR A CA    1 
ATOM   1498  C  C     . TYR A 1 199 ? 10.101  29.343  14.069  1.00 61.24 ? 199  TYR A C     1 
ATOM   1499  O  O     . TYR A 1 199 ? 11.087  29.105  14.775  1.00 61.30 ? 199  TYR A O     1 
ATOM   1500  C  CB    . TYR A 1 199 ? 9.975   30.692  11.960  1.00 60.83 ? 199  TYR A CB    1 
ATOM   1501  C  CG    . TYR A 1 199 ? 11.375  30.296  11.533  1.00 59.49 ? 199  TYR A CG    1 
ATOM   1502  C  CD1   . TYR A 1 199 ? 12.391  31.235  11.539  1.00 58.65 ? 199  TYR A CD1   1 
ATOM   1503  C  CD2   . TYR A 1 199 ? 11.686  28.985  11.191  1.00 59.04 ? 199  TYR A CD2   1 
ATOM   1504  C  CE1   . TYR A 1 199 ? 13.679  30.880  11.213  1.00 58.72 ? 199  TYR A CE1   1 
ATOM   1505  C  CE2   . TYR A 1 199 ? 12.981  28.631  10.848  1.00 59.11 ? 199  TYR A CE2   1 
ATOM   1506  C  CZ    . TYR A 1 199 ? 13.983  29.577  10.871  1.00 58.59 ? 199  TYR A CZ    1 
ATOM   1507  O  OH    . TYR A 1 199 ? 15.285  29.248  10.563  1.00 57.44 ? 199  TYR A OH    1 
ATOM   1508  N  N     . ASP A 1 200 ? 9.221   28.411  13.744  1.00 61.68 ? 200  ASP A N     1 
ATOM   1509  C  CA    . ASP A 1 200 ? 9.372   27.009  14.076  1.00 62.15 ? 200  ASP A CA    1 
ATOM   1510  C  C     . ASP A 1 200 ? 9.621   26.188  12.801  1.00 61.81 ? 200  ASP A C     1 
ATOM   1511  O  O     . ASP A 1 200 ? 8.901   26.314  11.805  1.00 62.74 ? 200  ASP A O     1 
ATOM   1512  C  CB    . ASP A 1 200 ? 8.105   26.392  14.681  1.00 66.06 ? 200  ASP A CB    1 
ATOM   1513  C  CG    . ASP A 1 200 ? 8.010   26.662  16.171  1.00 71.29 ? 200  ASP A CG    1 
ATOM   1514  O  OD1   . ASP A 1 200 ? 8.649   27.664  16.587  1.00 73.14 ? 200  ASP A OD1   1 
ATOM   1515  O  OD2   . ASP A 1 200 ? 7.299   25.902  16.875  1.00 72.96 ? 200  ASP A OD2   1 
ATOM   1516  N  N     . ALA A 1 201 ? 10.520  25.234  12.957  1.00 60.35 ? 201  ALA A N     1 
ATOM   1517  C  CA    . ALA A 1 201 ? 10.851  24.304  11.890  1.00 58.55 ? 201  ALA A CA    1 
ATOM   1518  C  C     . ALA A 1 201 ? 10.590  22.850  12.297  1.00 56.45 ? 201  ALA A C     1 
ATOM   1519  O  O     . ALA A 1 201 ? 11.361  22.327  13.104  1.00 56.21 ? 201  ALA A O     1 
ATOM   1520  C  CB    . ALA A 1 201 ? 12.355  24.404  11.609  1.00 58.05 ? 201  ALA A CB    1 
ATOM   1521  N  N     . ASN A 1 202 ? 9.722   22.145  11.575  1.00 54.49 ? 202  ASN A N     1 
ATOM   1522  C  CA    . ASN A 1 202 ? 9.670   20.708  11.819  1.00 53.05 ? 202  ASN A CA    1 
ATOM   1523  C  C     . ASN A 1 202 ? 10.538  19.978  10.793  1.00 52.20 ? 202  ASN A C     1 
ATOM   1524  O  O     . ASN A 1 202 ? 10.046  19.617  9.714   1.00 51.92 ? 202  ASN A O     1 
ATOM   1525  C  CB    . ASN A 1 202 ? 8.265   20.123  11.816  1.00 52.57 ? 202  ASN A CB    1 
ATOM   1526  C  CG    . ASN A 1 202 ? 8.402   18.667  12.256  1.00 56.13 ? 202  ASN A CG    1 
ATOM   1527  O  OD1   . ASN A 1 202 ? 9.530   18.238  12.556  1.00 59.06 ? 202  ASN A OD1   1 
ATOM   1528  N  ND2   . ASN A 1 202 ? 7.297   17.949  12.260  1.00 56.72 ? 202  ASN A ND2   1 
ATOM   1529  N  N     . ILE A 1 203 ? 11.797  19.727  11.136  1.00 49.86 ? 203  ILE A N     1 
ATOM   1530  C  CA    . ILE A 1 203 ? 12.681  19.066  10.168  1.00 48.71 ? 203  ILE A CA    1 
ATOM   1531  C  C     . ILE A 1 203 ? 12.401  17.576  10.182  1.00 48.37 ? 203  ILE A C     1 
ATOM   1532  O  O     . ILE A 1 203 ? 12.625  16.964  11.240  1.00 49.23 ? 203  ILE A O     1 
ATOM   1533  C  CB    . ILE A 1 203 ? 14.139  19.336  10.581  1.00 47.60 ? 203  ILE A CB    1 
ATOM   1534  C  CG1   . ILE A 1 203 ? 14.491  20.795  10.214  1.00 42.89 ? 203  ILE A CG1   1 
ATOM   1535  C  CG2   . ILE A 1 203 ? 15.111  18.390  9.895   1.00 50.07 ? 203  ILE A CG2   1 
ATOM   1536  C  CD1   . ILE A 1 203 ? 15.875  21.071  10.768  1.00 44.27 ? 203  ILE A CD1   1 
ATOM   1537  N  N     . VAL A 1 204 ? 11.890  16.964  9.109   1.00 46.06 ? 204  VAL A N     1 
ATOM   1538  C  CA    . VAL A 1 204 ? 11.498  15.558  9.345   1.00 44.01 ? 204  VAL A CA    1 
ATOM   1539  C  C     . VAL A 1 204 ? 12.413  14.563  8.711   1.00 42.80 ? 204  VAL A C     1 
ATOM   1540  O  O     . VAL A 1 204 ? 12.405  13.381  9.032   1.00 42.51 ? 204  VAL A O     1 
ATOM   1541  C  CB    . VAL A 1 204 ? 10.009  15.381  8.994   1.00 48.78 ? 204  VAL A CB    1 
ATOM   1542  C  CG1   . VAL A 1 204 ? 9.176   16.403  9.797   1.00 44.49 ? 204  VAL A CG1   1 
ATOM   1543  C  CG2   . VAL A 1 204 ? 9.777   15.672  7.510   1.00 48.20 ? 204  VAL A CG2   1 
ATOM   1544  N  N     . ALA A 1 205 ? 13.352  15.023  7.877   1.00 42.52 ? 205  ALA A N     1 
ATOM   1545  C  CA    . ALA A 1 205 ? 14.191  14.070  7.169   1.00 41.60 ? 205  ALA A CA    1 
ATOM   1546  C  C     . ALA A 1 205 ? 15.459  14.686  6.603   1.00 40.07 ? 205  ALA A C     1 
ATOM   1547  O  O     . ALA A 1 205 ? 15.421  15.722  5.964   1.00 39.65 ? 205  ALA A O     1 
ATOM   1548  C  CB    . ALA A 1 205 ? 13.318  13.478  6.051   1.00 36.33 ? 205  ALA A CB    1 
ATOM   1549  N  N     . VAL A 1 206 ? 16.519  13.882  6.653   1.00 40.03 ? 206  VAL A N     1 
ATOM   1550  C  CA    . VAL A 1 206 ? 17.784  14.202  5.985   1.00 38.03 ? 206  VAL A CA    1 
ATOM   1551  C  C     . VAL A 1 206 ? 18.081  13.206  4.873   1.00 37.37 ? 206  VAL A C     1 
ATOM   1552  O  O     . VAL A 1 206 ? 18.111  11.980  5.081   1.00 37.95 ? 206  VAL A O     1 
ATOM   1553  C  CB    . VAL A 1 206 ? 18.924  14.171  7.029   1.00 37.50 ? 206  VAL A CB    1 
ATOM   1554  C  CG1   . VAL A 1 206 ? 20.193  14.762  6.429   1.00 36.18 ? 206  VAL A CG1   1 
ATOM   1555  C  CG2   . VAL A 1 206 ? 18.565  14.976  8.268   1.00 31.54 ? 206  VAL A CG2   1 
ATOM   1556  N  N     . VAL A 1 207 ? 18.314  13.653  3.632   1.00 36.65 ? 207  VAL A N     1 
ATOM   1557  C  CA    . VAL A 1 207 ? 18.764  12.676  2.614   1.00 34.99 ? 207  VAL A CA    1 
ATOM   1558  C  C     . VAL A 1 207 ? 20.056  13.223  2.015   1.00 33.98 ? 207  VAL A C     1 
ATOM   1559  O  O     . VAL A 1 207 ? 20.447  14.380  2.230   1.00 36.10 ? 207  VAL A O     1 
ATOM   1560  C  CB    . VAL A 1 207 ? 17.721  12.485  1.499   1.00 40.10 ? 207  VAL A CB    1 
ATOM   1561  C  CG1   . VAL A 1 207 ? 16.393  12.009  2.061   1.00 40.26 ? 207  VAL A CG1   1 
ATOM   1562  C  CG2   . VAL A 1 207 ? 17.517  13.899  0.890   1.00 40.15 ? 207  VAL A CG2   1 
ATOM   1563  N  N     . ASN A 1 208 ? 20.671  12.472  1.190   1.00 33.12 ? 208  ASN A N     1 
ATOM   1564  C  CA    . ASN A 1 208 ? 21.838  12.724  0.361   1.00 33.03 ? 208  ASN A CA    1 
ATOM   1565  C  C     . ASN A 1 208 ? 21.422  13.216  -1.019  1.00 33.82 ? 208  ASN A C     1 
ATOM   1566  O  O     . ASN A 1 208 ? 20.236  12.924  -1.328  1.00 34.20 ? 208  ASN A O     1 
ATOM   1567  C  CB    . ASN A 1 208 ? 22.698  11.465  0.250   1.00 34.31 ? 208  ASN A CB    1 
ATOM   1568  C  CG    . ASN A 1 208 ? 24.065  11.745  -0.343  1.00 33.53 ? 208  ASN A CG    1 
ATOM   1569  O  OD1   . ASN A 1 208 ? 24.939  12.298  0.325   1.00 35.59 ? 208  ASN A OD1   1 
ATOM   1570  N  ND2   . ASN A 1 208 ? 24.252  11.364  -1.600  1.00 23.48 ? 208  ASN A ND2   1 
ATOM   1571  N  N     . ASP A 1 209 ? 22.209  13.975  -1.665  1.00 33.92 ? 209  ASP A N     1 
ATOM   1572  C  CA    . ASP A 1 209 ? 21.752  14.567  -2.953  1.00 32.71 ? 209  ASP A CA    1 
ATOM   1573  C  C     . ASP A 1 209 ? 21.687  13.420  -3.937  1.00 32.56 ? 209  ASP A C     1 
ATOM   1574  O  O     . ASP A 1 209 ? 20.850  13.401  -4.884  1.00 33.69 ? 209  ASP A O     1 
ATOM   1575  C  CB    . ASP A 1 209 ? 22.692  15.725  -3.260  1.00 36.12 ? 209  ASP A CB    1 
ATOM   1576  C  CG    . ASP A 1 209 ? 24.146  15.246  -3.398  1.00 37.40 ? 209  ASP A CG    1 
ATOM   1577  O  OD1   . ASP A 1 209 ? 24.419  14.108  -2.964  1.00 41.27 ? 209  ASP A OD1   1 
ATOM   1578  O  OD2   . ASP A 1 209 ? 25.014  15.935  -3.951  1.00 33.96 ? 209  ASP A OD2   1 
ATOM   1579  N  N     . THR A 1 210 ? 22.356  12.310  -3.590  1.00 31.55 ? 210  THR A N     1 
ATOM   1580  C  CA    . THR A 1 210 ? 22.155  11.152  -4.468  1.00 33.68 ? 210  THR A CA    1 
ATOM   1581  C  C     . THR A 1 210 ? 20.750  10.583  -4.405  1.00 34.29 ? 210  THR A C     1 
ATOM   1582  O  O     . THR A 1 210 ? 20.075  10.271  -5.375  1.00 35.53 ? 210  THR A O     1 
ATOM   1583  C  CB    . THR A 1 210 ? 23.152  10.011  -4.339  1.00 34.21 ? 210  THR A CB    1 
ATOM   1584  O  OG1   . THR A 1 210 ? 23.251  9.564   -2.997  1.00 35.44 ? 210  THR A OG1   1 
ATOM   1585  C  CG2   . THR A 1 210 ? 24.485  10.400  -4.935  1.00 35.13 ? 210  THR A CG2   1 
ATOM   1586  N  N     . VAL A 1 211 ? 20.207  10.485  -3.231  1.00 35.80 ? 211  VAL A N     1 
ATOM   1587  C  CA    . VAL A 1 211 ? 18.945  9.856   -2.879  1.00 35.41 ? 211  VAL A CA    1 
ATOM   1588  C  C     . VAL A 1 211 ? 17.848  10.784  -3.361  1.00 35.91 ? 211  VAL A C     1 
ATOM   1589  O  O     . VAL A 1 211 ? 16.966  10.330  -4.114  1.00 37.50 ? 211  VAL A O     1 
ATOM   1590  C  CB    . VAL A 1 211 ? 18.956  9.590   -1.361  1.00 32.56 ? 211  VAL A CB    1 
ATOM   1591  C  CG1   . VAL A 1 211 ? 17.599  9.318   -0.752  1.00 37.10 ? 211  VAL A CG1   1 
ATOM   1592  C  CG2   . VAL A 1 211 ? 19.907  8.419   -1.094  1.00 31.51 ? 211  VAL A CG2   1 
ATOM   1593  N  N     . GLY A 1 212 ? 18.059  12.067  -3.198  1.00 35.91 ? 212  GLY A N     1 
ATOM   1594  C  CA    . GLY A 1 212 ? 17.103  13.066  -3.696  1.00 36.73 ? 212  GLY A CA    1 
ATOM   1595  C  C     . GLY A 1 212 ? 17.033  13.024  -5.220  1.00 37.22 ? 212  GLY A C     1 
ATOM   1596  O  O     . GLY A 1 212 ? 15.965  13.047  -5.788  1.00 36.07 ? 212  GLY A O     1 
ATOM   1597  N  N     . THR A 1 213 ? 18.187  12.832  -5.863  1.00 39.15 ? 213  THR A N     1 
ATOM   1598  C  CA    . THR A 1 213 ? 18.237  12.692  -7.315  1.00 39.50 ? 213  THR A CA    1 
ATOM   1599  C  C     . THR A 1 213 ? 17.489  11.462  -7.784  1.00 39.63 ? 213  THR A C     1 
ATOM   1600  O  O     . THR A 1 213 ? 16.643  11.529  -8.702  1.00 39.85 ? 213  THR A O     1 
ATOM   1601  C  CB    . THR A 1 213 ? 19.690  12.672  -7.824  1.00 38.79 ? 213  THR A CB    1 
ATOM   1602  O  OG1   . THR A 1 213 ? 20.274  13.951  -7.565  1.00 37.86 ? 213  THR A OG1   1 
ATOM   1603  C  CG2   . THR A 1 213 ? 19.738  12.458  -9.322  1.00 38.66 ? 213  THR A CG2   1 
ATOM   1604  N  N     . MET A 1 214 ? 17.753  10.332  -7.129  1.00 38.64 ? 214  MET A N     1 
ATOM   1605  C  CA    . MET A 1 214 ? 17.100  9.077   -7.469  1.00 36.34 ? 214  MET A CA    1 
ATOM   1606  C  C     . MET A 1 214 ? 15.580  9.254   -7.303  1.00 37.88 ? 214  MET A C     1 
ATOM   1607  O  O     . MET A 1 214 ? 14.858  8.522   -7.997  1.00 38.20 ? 214  MET A O     1 
ATOM   1608  C  CB    . MET A 1 214 ? 17.500  7.936   -6.565  1.00 35.14 ? 214  MET A CB    1 
ATOM   1609  C  CG    . MET A 1 214 ? 17.235  6.511   -7.002  1.00 36.10 ? 214  MET A CG    1 
ATOM   1610  S  SD    . MET A 1 214 ? 17.162  5.340   -5.618  1.00 36.34 ? 214  MET A SD    1 
ATOM   1611  C  CE    . MET A 1 214 ? 16.081  6.266   -4.550  1.00 30.00 ? 214  MET A CE    1 
ATOM   1612  N  N     . MET A 1 215 ? 15.153  9.941   -6.259  1.00 36.66 ? 215  MET A N     1 
ATOM   1613  C  CA    . MET A 1 215 ? 13.718  10.054  -6.016  1.00 37.76 ? 215  MET A CA    1 
ATOM   1614  C  C     . MET A 1 215 ? 13.103  11.078  -6.985  1.00 38.74 ? 215  MET A C     1 
ATOM   1615  O  O     . MET A 1 215 ? 11.926  10.997  -7.337  1.00 37.82 ? 215  MET A O     1 
ATOM   1616  C  CB    . MET A 1 215 ? 13.440  10.493  -4.579  1.00 36.72 ? 215  MET A CB    1 
ATOM   1617  C  CG    . MET A 1 215 ? 13.801  9.540   -3.466  1.00 31.37 ? 215  MET A CG    1 
ATOM   1618  S  SD    . MET A 1 215 ? 12.779  8.085   -3.279  1.00 32.25 ? 215  MET A SD    1 
ATOM   1619  C  CE    . MET A 1 215 ? 13.187  7.133   -4.661  1.00 35.24 ? 215  MET A CE    1 
ATOM   1620  N  N     . THR A 1 216 ? 13.888  12.060  -7.430  1.00 38.69 ? 216  THR A N     1 
ATOM   1621  C  CA    . THR A 1 216 ? 13.337  13.107  -8.293  1.00 38.50 ? 216  THR A CA    1 
ATOM   1622  C  C     . THR A 1 216 ? 13.016  12.444  -9.625  1.00 39.64 ? 216  THR A C     1 
ATOM   1623  O  O     . THR A 1 216 ? 11.921  12.563  -10.177 1.00 40.28 ? 216  THR A O     1 
ATOM   1624  C  CB    . THR A 1 216 ? 14.329  14.264  -8.501  1.00 40.50 ? 216  THR A CB    1 
ATOM   1625  O  OG1   . THR A 1 216 ? 14.335  15.028  -7.276  1.00 39.19 ? 216  THR A OG1   1 
ATOM   1626  C  CG2   . THR A 1 216 ? 13.964  15.183  -9.669  1.00 33.39 ? 216  THR A CG2   1 
ATOM   1627  N  N     . CYS A 1 217 ? 13.964  11.608  -10.031 1.00 39.50 ? 217  CYS A N     1 
ATOM   1628  C  CA    . CYS A 1 217 ? 13.898  10.956  -11.314 1.00 39.41 ? 217  CYS A CA    1 
ATOM   1629  C  C     . CYS A 1 217 ? 12.927  9.799   -11.237 1.00 40.54 ? 217  CYS A C     1 
ATOM   1630  O  O     . CYS A 1 217 ? 12.291  9.455   -12.236 1.00 41.54 ? 217  CYS A O     1 
ATOM   1631  C  CB    . CYS A 1 217 ? 15.299  10.588  -11.803 1.00 40.61 ? 217  CYS A CB    1 
ATOM   1632  S  SG    . CYS A 1 217 ? 16.369  12.047  -12.146 1.00 45.44 ? 217  CYS A SG    1 
ATOM   1633  N  N     . GLY A 1 218 ? 12.746  9.199   -10.065 1.00 40.07 ? 218  GLY A N     1 
ATOM   1634  C  CA    . GLY A 1 218 ? 11.862  8.059   -9.892  1.00 39.54 ? 218  GLY A CA    1 
ATOM   1635  C  C     . GLY A 1 218 ? 10.414  8.531   -9.960  1.00 42.28 ? 218  GLY A C     1 
ATOM   1636  O  O     . GLY A 1 218 ? 9.520   7.840   -10.435 1.00 42.66 ? 218  GLY A O     1 
ATOM   1637  N  N     . TYR A 1 219 ? 10.185  9.750   -9.467  1.00 44.34 ? 219  TYR A N     1 
ATOM   1638  C  CA    . TYR A 1 219 ? 8.856   10.343  -9.472  1.00 46.07 ? 219  TYR A CA    1 
ATOM   1639  C  C     . TYR A 1 219 ? 8.359   10.339  -10.917 1.00 46.84 ? 219  TYR A C     1 
ATOM   1640  O  O     . TYR A 1 219 ? 7.178   10.177  -11.109 1.00 46.76 ? 219  TYR A O     1 
ATOM   1641  C  CB    . TYR A 1 219 ? 8.851   11.769  -8.946  1.00 46.60 ? 219  TYR A CB    1 
ATOM   1642  C  CG    . TYR A 1 219 ? 7.493   12.420  -8.901  1.00 48.06 ? 219  TYR A CG    1 
ATOM   1643  C  CD1   . TYR A 1 219 ? 6.939   13.079  -9.993  1.00 48.89 ? 219  TYR A CD1   1 
ATOM   1644  C  CD2   . TYR A 1 219 ? 6.776   12.386  -7.712  1.00 49.20 ? 219  TYR A CD2   1 
ATOM   1645  C  CE1   . TYR A 1 219 ? 5.705   13.689  -9.907  1.00 49.41 ? 219  TYR A CE1   1 
ATOM   1646  C  CE2   . TYR A 1 219 ? 5.524   12.952  -7.610  1.00 50.18 ? 219  TYR A CE2   1 
ATOM   1647  C  CZ    . TYR A 1 219 ? 4.991   13.590  -8.721  1.00 51.20 ? 219  TYR A CZ    1 
ATOM   1648  O  OH    . TYR A 1 219 ? 3.754   14.190  -8.571  1.00 52.27 ? 219  TYR A OH    1 
ATOM   1649  N  N     . ASP A 1 220 ? 9.281   10.406  -11.870 1.00 47.63 ? 220  ASP A N     1 
ATOM   1650  C  CA    . ASP A 1 220 ? 8.892   10.399  -13.259 1.00 48.42 ? 220  ASP A CA    1 
ATOM   1651  C  C     . ASP A 1 220 ? 9.033   9.036   -13.909 1.00 49.59 ? 220  ASP A C     1 
ATOM   1652  O  O     . ASP A 1 220 ? 8.380   8.801   -14.933 1.00 51.14 ? 220  ASP A O     1 
ATOM   1653  C  CB    . ASP A 1 220 ? 9.743   11.409  -14.032 1.00 52.17 ? 220  ASP A CB    1 
ATOM   1654  C  CG    . ASP A 1 220 ? 9.348   12.854  -13.869 1.00 52.45 ? 220  ASP A CG    1 
ATOM   1655  O  OD1   . ASP A 1 220 ? 8.277   13.210  -13.343 1.00 56.28 ? 220  ASP A OD1   1 
ATOM   1656  O  OD2   . ASP A 1 220 ? 10.172  13.708  -14.267 1.00 57.54 ? 220  ASP A OD2   1 
ATOM   1657  N  N     . ASP A 1 221 ? 9.949   8.186   -13.476 1.00 48.74 ? 221  ASP A N     1 
ATOM   1658  C  CA    . ASP A 1 221 ? 10.222  6.903   -14.151 1.00 47.53 ? 221  ASP A CA    1 
ATOM   1659  C  C     . ASP A 1 221 ? 10.328  5.831   -13.066 1.00 46.70 ? 221  ASP A C     1 
ATOM   1660  O  O     . ASP A 1 221 ? 11.233  5.865   -12.234 1.00 46.11 ? 221  ASP A O     1 
ATOM   1661  C  CB    . ASP A 1 221 ? 11.484  7.038   -14.988 1.00 43.33 ? 221  ASP A CB    1 
ATOM   1662  C  CG    . ASP A 1 221 ? 12.015  5.910   -15.797 1.00 40.99 ? 221  ASP A CG    1 
ATOM   1663  O  OD1   . ASP A 1 221 ? 11.646  4.732   -15.620 1.00 46.58 ? 221  ASP A OD1   1 
ATOM   1664  O  OD2   . ASP A 1 221 ? 12.962  6.099   -16.607 1.00 43.18 ? 221  ASP A OD2   1 
ATOM   1665  N  N     . GLN A 1 222 ? 9.330   4.962   -13.004 1.00 45.17 ? 222  GLN A N     1 
ATOM   1666  C  CA    . GLN A 1 222 ? 9.249   3.956   -11.959 1.00 44.49 ? 222  GLN A CA    1 
ATOM   1667  C  C     . GLN A 1 222 ? 10.262  2.871   -12.164 1.00 43.75 ? 222  GLN A C     1 
ATOM   1668  O  O     . GLN A 1 222 ? 10.225  1.861   -11.478 1.00 44.61 ? 222  GLN A O     1 
ATOM   1669  C  CB    . GLN A 1 222 ? 7.798   3.461   -11.803 1.00 46.49 ? 222  GLN A CB    1 
ATOM   1670  C  CG    . GLN A 1 222 ? 6.932   4.673   -11.408 1.00 48.00 ? 222  GLN A CG    1 
ATOM   1671  C  CD    . GLN A 1 222 ? 7.027   4.950   -9.913  1.00 53.08 ? 222  GLN A CD    1 
ATOM   1672  O  OE1   . GLN A 1 222 ? 7.488   5.998   -9.437  1.00 52.07 ? 222  GLN A OE1   1 
ATOM   1673  N  NE2   . GLN A 1 222 ? 6.609   3.959   -9.116  1.00 53.06 ? 222  GLN A NE2   1 
ATOM   1674  N  N     . HIS A 1 223 ? 11.158  3.036   -13.118 1.00 43.14 ? 223  HIS A N     1 
ATOM   1675  C  CA    . HIS A 1 223 ? 12.252  2.107   -13.321 1.00 43.19 ? 223  HIS A CA    1 
ATOM   1676  C  C     . HIS A 1 223 ? 13.512  2.619   -12.617 1.00 43.04 ? 223  HIS A C     1 
ATOM   1677  O  O     . HIS A 1 223 ? 14.555  1.946   -12.678 1.00 43.77 ? 223  HIS A O     1 
ATOM   1678  C  CB    . HIS A 1 223 ? 12.489  1.910   -14.822 1.00 47.01 ? 223  HIS A CB    1 
ATOM   1679  C  CG    . HIS A 1 223 ? 11.399  1.052   -15.423 1.00 53.78 ? 223  HIS A CG    1 
ATOM   1680  N  ND1   . HIS A 1 223 ? 10.223  1.573   -15.940 1.00 53.63 ? 223  HIS A ND1   1 
ATOM   1681  C  CD2   . HIS A 1 223 ? 11.311  -0.301  -15.538 1.00 49.58 ? 223  HIS A CD2   1 
ATOM   1682  C  CE1   . HIS A 1 223 ? 9.463   0.577   -16.349 1.00 51.29 ? 223  HIS A CE1   1 
ATOM   1683  N  NE2   . HIS A 1 223 ? 10.106  -0.564  -16.102 1.00 51.34 ? 223  HIS A NE2   1 
ATOM   1684  N  N     . CYS A 1 224 ? 13.449  3.808   -12.023 1.00 40.92 ? 224  CYS A N     1 
ATOM   1685  C  CA    . CYS A 1 224 ? 14.615  4.422   -11.439 1.00 41.96 ? 224  CYS A CA    1 
ATOM   1686  C  C     . CYS A 1 224 ? 15.141  3.731   -10.177 1.00 41.76 ? 224  CYS A C     1 
ATOM   1687  O  O     . CYS A 1 224 ? 14.472  3.675   -9.150  1.00 42.33 ? 224  CYS A O     1 
ATOM   1688  C  CB    . CYS A 1 224 ? 14.485  5.934   -11.209 1.00 34.55 ? 224  CYS A CB    1 
ATOM   1689  S  SG    . CYS A 1 224 ? 16.096  6.675   -10.836 1.00 36.18 ? 224  CYS A SG    1 
ATOM   1690  N  N     . GLU A 1 225 ? 16.377  3.225   -10.238 1.00 40.44 ? 225  GLU A N     1 
ATOM   1691  C  CA    . GLU A 1 225 ? 16.932  2.498   -9.101  1.00 39.03 ? 225  GLU A CA    1 
ATOM   1692  C  C     . GLU A 1 225 ? 18.286  2.993   -8.639  1.00 37.56 ? 225  GLU A C     1 
ATOM   1693  O  O     . GLU A 1 225 ? 18.891  2.369   -7.747  1.00 36.66 ? 225  GLU A O     1 
ATOM   1694  C  CB    . GLU A 1 225 ? 17.113  1.010   -9.530  1.00 40.71 ? 225  GLU A CB    1 
ATOM   1695  C  CG    . GLU A 1 225 ? 15.724  0.463   -9.880  1.00 43.51 ? 225  GLU A CG    1 
ATOM   1696  C  CD    . GLU A 1 225 ? 15.670  -1.035  -9.973  1.00 44.95 ? 225  GLU A CD    1 
ATOM   1697  O  OE1   . GLU A 1 225 ? 16.277  -1.605  -10.894 1.00 44.20 ? 225  GLU A OE1   1 
ATOM   1698  O  OE2   . GLU A 1 225 ? 15.024  -1.607  -9.054  1.00 51.14 ? 225  GLU A OE2   1 
ATOM   1699  N  N     . VAL A 1 226 ? 18.779  4.025   -9.324  1.00 35.31 ? 226  VAL A N     1 
ATOM   1700  C  CA    . VAL A 1 226 ? 20.139  4.491   -9.027  1.00 33.75 ? 226  VAL A CA    1 
ATOM   1701  C  C     . VAL A 1 226 ? 20.124  6.004   -9.002  1.00 33.51 ? 226  VAL A C     1 
ATOM   1702  O  O     . VAL A 1 226 ? 19.479  6.593   -9.851  1.00 32.86 ? 226  VAL A O     1 
ATOM   1703  C  CB    . VAL A 1 226 ? 21.148  3.970   -10.043 1.00 30.83 ? 226  VAL A CB    1 
ATOM   1704  C  CG1   . VAL A 1 226 ? 22.557  4.526   -9.814  1.00 29.54 ? 226  VAL A CG1   1 
ATOM   1705  C  CG2   . VAL A 1 226 ? 21.174  2.469   -10.104 1.00 25.52 ? 226  VAL A CG2   1 
ATOM   1706  N  N     . GLY A 1 227 ? 20.833  6.647   -8.101  1.00 34.74 ? 227  GLY A N     1 
ATOM   1707  C  CA    . GLY A 1 227 ? 20.973  8.130   -8.088  1.00 33.73 ? 227  GLY A CA    1 
ATOM   1708  C  C     . GLY A 1 227 ? 22.479  8.431   -8.209  1.00 35.01 ? 227  GLY A C     1 
ATOM   1709  O  O     . GLY A 1 227 ? 23.314  7.842   -7.490  1.00 32.13 ? 227  GLY A O     1 
ATOM   1710  N  N     . LEU A 1 228 ? 22.788  9.305   -9.207  1.00 35.18 ? 228  LEU A N     1 
ATOM   1711  C  CA    . LEU A 1 228 ? 24.187  9.447   -9.600  1.00 33.97 ? 228  LEU A CA    1 
ATOM   1712  C  C     . LEU A 1 228 ? 24.606  10.900  -9.575  1.00 34.13 ? 228  LEU A C     1 
ATOM   1713  O  O     . LEU A 1 228 ? 23.815  11.697  -10.063 1.00 34.13 ? 228  LEU A O     1 
ATOM   1714  C  CB    . LEU A 1 228 ? 24.453  8.828   -10.973 1.00 32.36 ? 228  LEU A CB    1 
ATOM   1715  C  CG    . LEU A 1 228 ? 25.800  9.256   -11.599 1.00 36.71 ? 228  LEU A CG    1 
ATOM   1716  C  CD1   . LEU A 1 228 ? 26.927  8.818   -10.692 1.00 32.72 ? 228  LEU A CD1   1 
ATOM   1717  C  CD2   . LEU A 1 228 ? 25.947  8.672   -13.002 1.00 31.16 ? 228  LEU A CD2   1 
ATOM   1718  N  N     . ILE A 1 229 ? 25.739  11.252  -8.941  1.00 33.12 ? 229  ILE A N     1 
ATOM   1719  C  CA    . ILE A 1 229 ? 26.131  12.654  -8.860  1.00 32.81 ? 229  ILE A CA    1 
ATOM   1720  C  C     . ILE A 1 229 ? 27.577  12.765  -9.343  1.00 32.55 ? 229  ILE A C     1 
ATOM   1721  O  O     . ILE A 1 229 ? 28.438  11.950  -9.013  1.00 32.70 ? 229  ILE A O     1 
ATOM   1722  C  CB    . ILE A 1 229 ? 26.114  13.330  -7.468  1.00 34.71 ? 229  ILE A CB    1 
ATOM   1723  C  CG1   . ILE A 1 229 ? 24.709  13.384  -6.883  1.00 35.89 ? 229  ILE A CG1   1 
ATOM   1724  C  CG2   . ILE A 1 229 ? 26.748  14.722  -7.553  1.00 29.27 ? 229  ILE A CG2   1 
ATOM   1725  C  CD1   . ILE A 1 229 ? 23.723  14.423  -7.362  1.00 30.07 ? 229  ILE A CD1   1 
ATOM   1726  N  N     . ILE A 1 230 ? 27.767  13.594  -10.356 1.00 33.29 ? 230  ILE A N     1 
ATOM   1727  C  CA    . ILE A 1 230 ? 29.095  13.914  -10.882 1.00 33.04 ? 230  ILE A CA    1 
ATOM   1728  C  C     . ILE A 1 230 ? 29.158  15.433  -10.964 1.00 32.37 ? 230  ILE A C     1 
ATOM   1729  O  O     . ILE A 1 230 ? 29.017  16.028  -12.035 1.00 33.87 ? 230  ILE A O     1 
ATOM   1730  C  CB    . ILE A 1 230 ? 29.355  13.243  -12.249 1.00 37.33 ? 230  ILE A CB    1 
ATOM   1731  C  CG1   . ILE A 1 230 ? 29.162  11.738  -12.255 1.00 38.22 ? 230  ILE A CG1   1 
ATOM   1732  C  CG2   . ILE A 1 230 ? 30.792  13.463  -12.740 1.00 37.19 ? 230  ILE A CG2   1 
ATOM   1733  C  CD1   . ILE A 1 230 ? 29.058  11.074  -13.625 1.00 33.21 ? 230  ILE A CD1   1 
ATOM   1734  N  N     . GLY A 1 231 ? 29.312  16.156  -9.877  1.00 31.56 ? 231  GLY A N     1 
ATOM   1735  C  CA    . GLY A 1 231 ? 29.425  17.599  -9.774  1.00 30.45 ? 231  GLY A CA    1 
ATOM   1736  C  C     . GLY A 1 231 ? 30.656  18.083  -9.009  1.00 30.98 ? 231  GLY A C     1 
ATOM   1737  O  O     . GLY A 1 231 ? 31.798  17.712  -9.331  1.00 31.09 ? 231  GLY A O     1 
ATOM   1738  N  N     . THR A 1 232 ? 30.476  18.967  -8.010  1.00 30.96 ? 232  THR A N     1 
ATOM   1739  C  CA    . THR A 1 232 ? 31.595  19.330  -7.153  1.00 31.04 ? 232  THR A CA    1 
ATOM   1740  C  C     . THR A 1 232 ? 32.218  17.996  -6.668  1.00 32.57 ? 232  THR A C     1 
ATOM   1741  O  O     . THR A 1 232 ? 33.437  17.814  -6.738  1.00 32.27 ? 232  THR A O     1 
ATOM   1742  C  CB    . THR A 1 232 ? 31.227  20.113  -5.914  1.00 31.06 ? 232  THR A CB    1 
ATOM   1743  O  OG1   . THR A 1 232 ? 30.369  21.185  -6.206  1.00 31.37 ? 232  THR A OG1   1 
ATOM   1744  C  CG2   . THR A 1 232 ? 32.462  20.506  -5.102  1.00 27.59 ? 232  THR A CG2   1 
ATOM   1745  N  N     . GLY A 1 233 ? 31.357  17.136  -6.144  1.00 32.46 ? 233  GLY A N     1 
ATOM   1746  C  CA    . GLY A 1 233 ? 31.801  15.779  -5.789  1.00 31.41 ? 233  GLY A CA    1 
ATOM   1747  C  C     . GLY A 1 233 ? 31.052  14.751  -6.667  1.00 31.47 ? 233  GLY A C     1 
ATOM   1748  O  O     . GLY A 1 233 ? 30.323  15.066  -7.579  1.00 29.13 ? 233  GLY A O     1 
ATOM   1749  N  N     . THR A 1 234 ? 31.312  13.489  -6.422  1.00 32.57 ? 234  THR A N     1 
ATOM   1750  C  CA    . THR A 1 234 ? 30.701  12.353  -7.078  1.00 31.57 ? 234  THR A CA    1 
ATOM   1751  C  C     . THR A 1 234 ? 30.355  11.335  -5.995  1.00 32.53 ? 234  THR A C     1 
ATOM   1752  O  O     . THR A 1 234 ? 31.132  11.082  -5.064  1.00 31.13 ? 234  THR A O     1 
ATOM   1753  C  CB    . THR A 1 234 ? 31.689  11.719  -8.081  1.00 29.11 ? 234  THR A CB    1 
ATOM   1754  O  OG1   . THR A 1 234 ? 30.993  10.676  -8.782  1.00 31.07 ? 234  THR A OG1   1 
ATOM   1755  C  CG2   . THR A 1 234 ? 32.844  11.057  -7.381  1.00 20.57 ? 234  THR A CG2   1 
ATOM   1756  N  N     . ASN A 1 235 ? 29.209  10.743  -6.158  1.00 33.07 ? 235  ASN A N     1 
ATOM   1757  C  CA    . ASN A 1 235 ? 28.679  9.635   -5.380  1.00 33.29 ? 235  ASN A CA    1 
ATOM   1758  C  C     . ASN A 1 235 ? 27.532  8.959   -6.119  1.00 34.92 ? 235  ASN A C     1 
ATOM   1759  O  O     . ASN A 1 235 ? 27.124  9.507   -7.149  1.00 34.57 ? 235  ASN A O     1 
ATOM   1760  C  CB    . ASN A 1 235 ? 28.225  10.117  -4.002  1.00 30.20 ? 235  ASN A CB    1 
ATOM   1761  C  CG    . ASN A 1 235 ? 27.940  8.972   -3.050  1.00 29.13 ? 235  ASN A CG    1 
ATOM   1762  O  OD1   . ASN A 1 235 ? 27.213  9.135   -2.070  1.00 31.16 ? 235  ASN A OD1   1 
ATOM   1763  N  ND2   . ASN A 1 235 ? 28.513  7.810   -3.337  1.00 27.70 ? 235  ASN A ND2   1 
ATOM   1764  N  N     . ALA A 1 236 ? 27.100  7.791   -5.702  1.00 35.90 ? 236  ALA A N     1 
ATOM   1765  C  CA    . ALA A 1 236 ? 25.976  7.060   -6.271  1.00 36.05 ? 236  ALA A CA    1 
ATOM   1766  C  C     . ALA A 1 236 ? 25.187  6.451   -5.109  1.00 36.25 ? 236  ALA A C     1 
ATOM   1767  O  O     . ALA A 1 236 ? 25.710  6.120   -4.053  1.00 37.79 ? 236  ALA A O     1 
ATOM   1768  C  CB    . ALA A 1 236 ? 26.348  5.933   -7.223  1.00 25.79 ? 236  ALA A CB    1 
ATOM   1769  N  N     . CYS A 1 237 ? 23.948  6.152   -5.351  1.00 37.62 ? 237  CYS A N     1 
ATOM   1770  C  CA    . CYS A 1 237 ? 23.063  5.416   -4.425  1.00 37.00 ? 237  CYS A CA    1 
ATOM   1771  C  C     . CYS A 1 237 ? 22.143  4.530   -5.292  1.00 36.27 ? 237  CYS A C     1 
ATOM   1772  O  O     . CYS A 1 237 ? 22.270  4.611   -6.529  1.00 37.20 ? 237  CYS A O     1 
ATOM   1773  C  CB    . CYS A 1 237 ? 22.251  6.399   -3.626  1.00 36.63 ? 237  CYS A CB    1 
ATOM   1774  S  SG    . CYS A 1 237 ? 20.799  6.987   -4.498  1.00 32.43 ? 237  CYS A SG    1 
ATOM   1775  N  N     . TYR A 1 238 ? 21.643  3.456   -4.730  1.00 34.83 ? 238  TYR A N     1 
ATOM   1776  C  CA    . TYR A 1 238 ? 20.883  2.445   -5.433  1.00 35.39 ? 238  TYR A CA    1 
ATOM   1777  C  C     . TYR A 1 238 ? 20.003  1.687   -4.432  1.00 36.39 ? 238  TYR A C     1 
ATOM   1778  O  O     . TYR A 1 238 ? 20.240  1.799   -3.227  1.00 36.87 ? 238  TYR A O     1 
ATOM   1779  C  CB    . TYR A 1 238 ? 21.776  1.501   -6.245  1.00 33.65 ? 238  TYR A CB    1 
ATOM   1780  C  CG    . TYR A 1 238 ? 22.494  0.471   -5.398  1.00 33.50 ? 238  TYR A CG    1 
ATOM   1781  C  CD1   . TYR A 1 238 ? 23.638  0.772   -4.673  1.00 31.84 ? 238  TYR A CD1   1 
ATOM   1782  C  CD2   . TYR A 1 238 ? 22.051  -0.841  -5.374  1.00 34.42 ? 238  TYR A CD2   1 
ATOM   1783  C  CE1   . TYR A 1 238 ? 24.225  -0.171  -3.856  1.00 33.02 ? 238  TYR A CE1   1 
ATOM   1784  C  CE2   . TYR A 1 238 ? 22.673  -1.813  -4.605  1.00 33.19 ? 238  TYR A CE2   1 
ATOM   1785  C  CZ    . TYR A 1 238 ? 23.730  -1.451  -3.802  1.00 32.65 ? 238  TYR A CZ    1 
ATOM   1786  O  OH    . TYR A 1 238 ? 24.341  -2.415  -3.046  1.00 32.56 ? 238  TYR A OH    1 
ATOM   1787  N  N     . MET A 1 239 ? 19.007  0.964   -4.919  1.00 36.01 ? 239  MET A N     1 
ATOM   1788  C  CA    . MET A 1 239 ? 18.124  0.124   -4.166  1.00 35.00 ? 239  MET A CA    1 
ATOM   1789  C  C     . MET A 1 239 ? 18.627  -1.313  -3.987  1.00 34.98 ? 239  MET A C     1 
ATOM   1790  O  O     . MET A 1 239 ? 18.946  -2.090  -4.891  1.00 33.91 ? 239  MET A O     1 
ATOM   1791  C  CB    . MET A 1 239 ? 16.721  0.213   -4.737  1.00 39.72 ? 239  MET A CB    1 
ATOM   1792  C  CG    . MET A 1 239 ? 16.131  1.601   -4.962  1.00 31.86 ? 239  MET A CG    1 
ATOM   1793  S  SD    . MET A 1 239 ? 15.718  2.483   -3.437  1.00 36.92 ? 239  MET A SD    1 
ATOM   1794  C  CE    . MET A 1 239 ? 14.711  1.238   -2.633  1.00 34.21 ? 239  MET A CE    1 
ATOM   1795  N  N     . GLU A 1 240 ? 18.933  -1.637  -2.714  1.00 33.39 ? 240  GLU A N     1 
ATOM   1796  C  CA    . GLU A 1 240 ? 19.452  -2.910  -2.275  1.00 33.52 ? 240  GLU A CA    1 
ATOM   1797  C  C     . GLU A 1 240 ? 18.385  -3.783  -1.629  1.00 32.14 ? 240  GLU A C     1 
ATOM   1798  O  O     . GLU A 1 240 ? 17.385  -3.327  -1.104  1.00 32.43 ? 240  GLU A O     1 
ATOM   1799  C  CB    . GLU A 1 240 ? 20.652  -2.723  -1.329  1.00 39.05 ? 240  GLU A CB    1 
ATOM   1800  C  CG    . GLU A 1 240 ? 21.407  -3.985  -0.882  1.00 34.83 ? 240  GLU A CG    1 
ATOM   1801  C  CD    . GLU A 1 240 ? 21.868  -4.845  -2.036  1.00 34.02 ? 240  GLU A CD    1 
ATOM   1802  O  OE1   . GLU A 1 240 ? 22.978  -4.582  -2.550  1.00 36.06 ? 240  GLU A OE1   1 
ATOM   1803  O  OE2   . GLU A 1 240 ? 21.101  -5.712  -2.484  1.00 34.35 ? 240  GLU A OE2   1 
ATOM   1804  N  N     . GLU A 1 241 ? 18.579  -5.080  -1.661  1.00 33.53 ? 241  GLU A N     1 
ATOM   1805  C  CA    . GLU A 1 241 ? 17.606  -6.001  -1.029  1.00 35.09 ? 241  GLU A CA    1 
ATOM   1806  C  C     . GLU A 1 241 ? 17.875  -5.937  0.466   1.00 35.35 ? 241  GLU A C     1 
ATOM   1807  O  O     . GLU A 1 241 ? 19.015  -6.187  0.885   1.00 34.88 ? 241  GLU A O     1 
ATOM   1808  C  CB    . GLU A 1 241 ? 17.833  -7.414  -1.542  1.00 37.94 ? 241  GLU A CB    1 
ATOM   1809  C  CG    . GLU A 1 241 ? 17.824  -7.583  -3.058  1.00 47.05 ? 241  GLU A CG    1 
ATOM   1810  C  CD    . GLU A 1 241 ? 16.615  -6.846  -3.625  1.00 54.98 ? 241  GLU A CD    1 
ATOM   1811  O  OE1   . GLU A 1 241 ? 15.501  -7.154  -3.136  1.00 57.87 ? 241  GLU A OE1   1 
ATOM   1812  O  OE2   . GLU A 1 241 ? 16.782  -5.910  -4.450  1.00 58.92 ? 241  GLU A OE2   1 
ATOM   1813  N  N     . LEU A 1 242 ? 16.900  -5.517  1.249   1.00 35.59 ? 242  LEU A N     1 
ATOM   1814  C  CA    . LEU A 1 242 ? 17.087  -5.514  2.705   1.00 38.74 ? 242  LEU A CA    1 
ATOM   1815  C  C     . LEU A 1 242 ? 17.672  -6.871  3.160   1.00 40.64 ? 242  LEU A C     1 
ATOM   1816  O  O     . LEU A 1 242 ? 18.393  -6.836  4.163   1.00 40.28 ? 242  LEU A O     1 
ATOM   1817  C  CB    . LEU A 1 242 ? 15.727  -5.331  3.339   1.00 43.83 ? 242  LEU A CB    1 
ATOM   1818  C  CG    . LEU A 1 242 ? 15.560  -4.568  4.651   1.00 46.15 ? 242  LEU A CG    1 
ATOM   1819  C  CD1   . LEU A 1 242 ? 16.547  -3.474  4.944   1.00 45.12 ? 242  LEU A CD1   1 
ATOM   1820  C  CD2   . LEU A 1 242 ? 14.130  -4.065  4.696   1.00 45.97 ? 242  LEU A CD2   1 
ATOM   1821  N  N     . ARG A 1 243 ? 17.470  -7.936  2.405   1.00 42.02 ? 243  ARG A N     1 
ATOM   1822  C  CA    . ARG A 1 243 ? 18.102  -9.182  2.841   1.00 42.95 ? 243  ARG A CA    1 
ATOM   1823  C  C     . ARG A 1 243 ? 19.609  -8.973  2.957   1.00 42.57 ? 243  ARG A C     1 
ATOM   1824  O  O     . ARG A 1 243 ? 20.228  -9.833  3.609   1.00 42.80 ? 243  ARG A O     1 
ATOM   1825  C  CB    . ARG A 1 243 ? 17.764  -10.454 2.070   1.00 46.24 ? 243  ARG A CB    1 
ATOM   1826  C  CG    . ARG A 1 243 ? 18.791  -10.870 1.035   1.00 56.37 ? 243  ARG A CG    1 
ATOM   1827  C  CD    . ARG A 1 243 ? 18.321  -12.094 0.230   1.00 58.56 ? 243  ARG A CD    1 
ATOM   1828  N  NE    . ARG A 1 243 ? 17.659  -11.596 -1.000  1.00 60.54 ? 243  ARG A NE    1 
ATOM   1829  C  CZ    . ARG A 1 243 ? 16.354  -11.338 -0.883  1.00 59.57 ? 243  ARG A CZ    1 
ATOM   1830  N  NH1   . ARG A 1 243 ? 15.812  -11.655 0.290   1.00 63.04 ? 243  ARG A NH1   1 
ATOM   1831  N  NH2   . ARG A 1 243 ? 15.667  -10.798 -1.862  1.00 58.64 ? 243  ARG A NH2   1 
ATOM   1832  N  N     . HIS A 1 244 ? 20.247  -8.167  2.140   1.00 42.21 ? 244  HIS A N     1 
ATOM   1833  C  CA    . HIS A 1 244 ? 21.695  -8.046  2.138   1.00 43.40 ? 244  HIS A CA    1 
ATOM   1834  C  C     . HIS A 1 244 ? 22.259  -6.885  2.938   1.00 43.29 ? 244  HIS A C     1 
ATOM   1835  O  O     . HIS A 1 244 ? 23.461  -6.605  2.821   1.00 43.21 ? 244  HIS A O     1 
ATOM   1836  C  CB    . HIS A 1 244 ? 22.151  -7.842  0.676   1.00 45.97 ? 244  HIS A CB    1 
ATOM   1837  C  CG    . HIS A 1 244 ? 21.796  -9.066  -0.122  1.00 49.12 ? 244  HIS A CG    1 
ATOM   1838  N  ND1   . HIS A 1 244 ? 21.429  -9.056  -1.444  1.00 51.78 ? 244  HIS A ND1   1 
ATOM   1839  C  CD2   . HIS A 1 244 ? 21.757  -10.346 0.290   1.00 49.78 ? 244  HIS A CD2   1 
ATOM   1840  C  CE1   . HIS A 1 244 ? 21.178  -10.294 -1.842  1.00 50.32 ? 244  HIS A CE1   1 
ATOM   1841  N  NE2   . HIS A 1 244 ? 21.352  -11.077 -0.797  1.00 54.00 ? 244  HIS A NE2   1 
ATOM   1842  N  N     . ILE A 1 245 ? 21.419  -6.135  3.644   1.00 42.71 ? 245  ILE A N     1 
ATOM   1843  C  CA    . ILE A 1 245 ? 21.946  -5.005  4.411   1.00 41.90 ? 245  ILE A CA    1 
ATOM   1844  C  C     . ILE A 1 245 ? 22.094  -5.437  5.857   1.00 41.48 ? 245  ILE A C     1 
ATOM   1845  O  O     . ILE A 1 245 ? 21.143  -5.396  6.639   1.00 43.17 ? 245  ILE A O     1 
ATOM   1846  C  CB    . ILE A 1 245 ? 21.064  -3.770  4.253   1.00 39.00 ? 245  ILE A CB    1 
ATOM   1847  C  CG1   . ILE A 1 245 ? 20.853  -3.474  2.766   1.00 40.54 ? 245  ILE A CG1   1 
ATOM   1848  C  CG2   . ILE A 1 245 ? 21.565  -2.562  5.026   1.00 35.18 ? 245  ILE A CG2   1 
ATOM   1849  C  CD1   . ILE A 1 245 ? 19.904  -2.325  2.499   1.00 36.37 ? 245  ILE A CD1   1 
ATOM   1850  N  N     . ASP A 1 246 ? 23.252  -5.968  6.212   1.00 40.98 ? 246  ASP A N     1 
ATOM   1851  C  CA    . ASP A 1 246 ? 23.484  -6.517  7.527   1.00 39.55 ? 246  ASP A CA    1 
ATOM   1852  C  C     . ASP A 1 246 ? 23.316  -5.448  8.580   1.00 40.60 ? 246  ASP A C     1 
ATOM   1853  O  O     . ASP A 1 246 ? 22.955  -5.815  9.713   1.00 42.04 ? 246  ASP A O     1 
ATOM   1854  C  CB    . ASP A 1 246 ? 24.822  -7.193  7.675   1.00 42.49 ? 246  ASP A CB    1 
ATOM   1855  C  CG    . ASP A 1 246 ? 25.169  -8.436  6.916   1.00 46.61 ? 246  ASP A CG    1 
ATOM   1856  O  OD1   . ASP A 1 246 ? 24.311  -9.039  6.225   1.00 47.72 ? 246  ASP A OD1   1 
ATOM   1857  O  OD2   . ASP A 1 246 ? 26.366  -8.854  6.989   1.00 49.90 ? 246  ASP A OD2   1 
ATOM   1858  N  N     . LEU A 1 247 ? 23.567  -4.175  8.318   1.00 39.99 ? 247  LEU A N     1 
ATOM   1859  C  CA    . LEU A 1 247 ? 23.495  -3.211  9.414   1.00 39.00 ? 247  LEU A CA    1 
ATOM   1860  C  C     . LEU A 1 247 ? 22.066  -2.773  9.706   1.00 37.40 ? 247  LEU A C     1 
ATOM   1861  O  O     . LEU A 1 247 ? 21.854  -1.925  10.592  1.00 35.08 ? 247  LEU A O     1 
ATOM   1862  C  CB    . LEU A 1 247 ? 24.412  -2.019  9.350   1.00 38.49 ? 247  LEU A CB    1 
ATOM   1863  C  CG    . LEU A 1 247 ? 25.913  -2.176  9.221   1.00 43.51 ? 247  LEU A CG    1 
ATOM   1864  C  CD1   . LEU A 1 247 ? 26.644  -1.073  9.959   1.00 47.65 ? 247  LEU A CD1   1 
ATOM   1865  C  CD2   . LEU A 1 247 ? 26.431  -3.546  9.523   1.00 43.10 ? 247  LEU A CD2   1 
ATOM   1866  N  N     . VAL A 1 248 ? 21.137  -3.270  8.879   1.00 36.27 ? 248  VAL A N     1 
ATOM   1867  C  CA    . VAL A 1 248 ? 19.735  -3.001  9.187   1.00 36.65 ? 248  VAL A CA    1 
ATOM   1868  C  C     . VAL A 1 248 ? 19.049  -4.327  9.520   1.00 37.85 ? 248  VAL A C     1 
ATOM   1869  O  O     . VAL A 1 248 ? 19.194  -5.288  8.760   1.00 37.76 ? 248  VAL A O     1 
ATOM   1870  C  CB    . VAL A 1 248 ? 18.921  -2.276  8.105   1.00 34.52 ? 248  VAL A CB    1 
ATOM   1871  C  CG1   . VAL A 1 248 ? 17.498  -2.030  8.619   1.00 34.82 ? 248  VAL A CG1   1 
ATOM   1872  C  CG2   . VAL A 1 248 ? 19.513  -0.898  7.829   1.00 36.10 ? 248  VAL A CG2   1 
ATOM   1873  N  N     . GLU A 1 249 ? 18.348  -4.320  10.628  1.00 39.77 ? 249  GLU A N     1 
ATOM   1874  C  CA    . GLU A 1 249 ? 17.562  -5.467  11.064  1.00 42.20 ? 249  GLU A CA    1 
ATOM   1875  C  C     . GLU A 1 249 ? 16.241  -5.575  10.294  1.00 42.55 ? 249  GLU A C     1 
ATOM   1876  O  O     . GLU A 1 249 ? 15.312  -4.798  10.464  1.00 44.52 ? 249  GLU A O     1 
ATOM   1877  C  CB    . GLU A 1 249 ? 17.233  -5.368  12.556  1.00 44.38 ? 249  GLU A CB    1 
ATOM   1878  C  CG    . GLU A 1 249 ? 17.319  -6.717  13.241  1.00 48.67 ? 249  GLU A CG    1 
ATOM   1879  C  CD    . GLU A 1 249 ? 17.462  -6.585  14.743  1.00 53.19 ? 249  GLU A CD    1 
ATOM   1880  O  OE1   . GLU A 1 249 ? 17.502  -5.411  15.189  1.00 55.99 ? 249  GLU A OE1   1 
ATOM   1881  O  OE2   . GLU A 1 249 ? 17.479  -7.615  15.462  1.00 53.26 ? 249  GLU A OE2   1 
ATOM   1882  N  N     . GLY A 1 250 ? 16.161  -6.527  9.390   1.00 40.86 ? 250  GLY A N     1 
ATOM   1883  C  CA    . GLY A 1 250 ? 14.943  -6.726  8.646   1.00 41.15 ? 250  GLY A CA    1 
ATOM   1884  C  C     . GLY A 1 250 ? 15.375  -7.466  7.384   1.00 42.02 ? 250  GLY A C     1 
ATOM   1885  O  O     . GLY A 1 250 ? 16.582  -7.373  7.124   1.00 43.93 ? 250  GLY A O     1 
ATOM   1886  N  N     . ASP A 1 251 ? 14.453  -8.110  6.714   1.00 41.67 ? 251  ASP A N     1 
ATOM   1887  C  CA    . ASP A 1 251 ? 14.830  -8.897  5.541   1.00 41.26 ? 251  ASP A CA    1 
ATOM   1888  C  C     . ASP A 1 251 ? 13.760  -8.847  4.472   1.00 40.63 ? 251  ASP A C     1 
ATOM   1889  O  O     . ASP A 1 251 ? 13.747  -9.713  3.599   1.00 42.12 ? 251  ASP A O     1 
ATOM   1890  C  CB    . ASP A 1 251 ? 15.077  -10.339 6.018   1.00 43.44 ? 251  ASP A CB    1 
ATOM   1891  C  CG    . ASP A 1 251 ? 13.881  -11.036 6.634   1.00 43.09 ? 251  ASP A CG    1 
ATOM   1892  O  OD1   . ASP A 1 251 ? 12.811  -10.411 6.766   1.00 46.93 ? 251  ASP A OD1   1 
ATOM   1893  O  OD2   . ASP A 1 251 ? 13.905  -12.251 6.942   1.00 43.27 ? 251  ASP A OD2   1 
ATOM   1894  N  N     . GLU A 1 252 ? 12.887  -7.869  4.468   1.00 41.05 ? 252  GLU A N     1 
ATOM   1895  C  CA    . GLU A 1 252 ? 11.849  -7.753  3.460   1.00 42.07 ? 252  GLU A CA    1 
ATOM   1896  C  C     . GLU A 1 252 ? 11.935  -6.469  2.654   1.00 41.45 ? 252  GLU A C     1 
ATOM   1897  O  O     . GLU A 1 252 ? 12.494  -5.496  3.138   1.00 43.54 ? 252  GLU A O     1 
ATOM   1898  C  CB    . GLU A 1 252 ? 10.495  -7.962  4.109   1.00 49.26 ? 252  GLU A CB    1 
ATOM   1899  C  CG    . GLU A 1 252 ? 9.959   -6.877  5.018   1.00 51.29 ? 252  GLU A CG    1 
ATOM   1900  C  CD    . GLU A 1 252 ? 10.131  -7.207  6.504   1.00 58.63 ? 252  GLU A CD    1 
ATOM   1901  O  OE1   . GLU A 1 252 ? 9.262   -7.945  7.049   1.00 46.65 ? 252  GLU A OE1   1 
ATOM   1902  O  OE2   . GLU A 1 252 ? 11.190  -6.703  7.012   1.00 57.11 ? 252  GLU A OE2   1 
ATOM   1903  N  N     . GLY A 1 253 ? 11.508  -6.537  1.394   1.00 41.02 ? 253  GLY A N     1 
ATOM   1904  C  CA    . GLY A 1 253 ? 11.530  -5.348  0.542   1.00 40.58 ? 253  GLY A CA    1 
ATOM   1905  C  C     . GLY A 1 253 ? 12.934  -4.808  0.340   1.00 40.44 ? 253  GLY A C     1 
ATOM   1906  O  O     . GLY A 1 253 ? 13.929  -5.439  0.687   1.00 38.82 ? 253  GLY A O     1 
ATOM   1907  N  N     . ARG A 1 254 ? 13.008  -3.545  -0.120  1.00 41.53 ? 254  ARG A N     1 
ATOM   1908  C  CA    . ARG A 1 254 ? 14.289  -2.905  -0.359  1.00 39.45 ? 254  ARG A CA    1 
ATOM   1909  C  C     . ARG A 1 254 ? 14.518  -1.579  0.321   1.00 37.64 ? 254  ARG A C     1 
ATOM   1910  O  O     . ARG A 1 254 ? 13.614  -0.874  0.758   1.00 37.05 ? 254  ARG A O     1 
ATOM   1911  C  CB    . ARG A 1 254 ? 14.573  -2.812  -1.847  1.00 41.45 ? 254  ARG A CB    1 
ATOM   1912  C  CG    . ARG A 1 254 ? 13.673  -3.640  -2.736  1.00 44.94 ? 254  ARG A CG    1 
ATOM   1913  C  CD    . ARG A 1 254 ? 13.553  -2.973  -4.112  1.00 47.11 ? 254  ARG A CD    1 
ATOM   1914  N  NE    . ARG A 1 254 ? 14.713  -3.315  -4.946  1.00 43.69 ? 254  ARG A NE    1 
ATOM   1915  C  CZ    . ARG A 1 254 ? 14.864  -2.829  -6.175  1.00 40.03 ? 254  ARG A CZ    1 
ATOM   1916  N  NH1   . ARG A 1 254 ? 14.009  -1.972  -6.723  1.00 40.36 ? 254  ARG A NH1   1 
ATOM   1917  N  NH2   . ARG A 1 254 ? 15.935  -3.210  -6.838  1.00 37.49 ? 254  ARG A NH2   1 
ATOM   1918  N  N     . MET A 1 255 ? 15.812  -1.214  0.401   1.00 36.87 ? 255  MET A N     1 
ATOM   1919  C  CA    . MET A 1 255 ? 16.241  0.029   0.929   1.00 34.69 ? 255  MET A CA    1 
ATOM   1920  C  C     . MET A 1 255 ? 17.400  0.620   0.157   1.00 33.89 ? 255  MET A C     1 
ATOM   1921  O  O     . MET A 1 255 ? 18.412  0.073   -0.222  1.00 34.52 ? 255  MET A O     1 
ATOM   1922  C  CB    . MET A 1 255 ? 16.227  0.312   2.404   1.00 36.33 ? 255  MET A CB    1 
ATOM   1923  C  CG    . MET A 1 255 ? 17.517  0.371   3.173   1.00 36.31 ? 255  MET A CG    1 
ATOM   1924  S  SD    . MET A 1 255 ? 17.521  1.351   4.668   1.00 36.17 ? 255  MET A SD    1 
ATOM   1925  C  CE    . MET A 1 255 ? 16.160  0.754   5.631   1.00 32.22 ? 255  MET A CE    1 
ATOM   1926  N  N     . CYS A 1 256 ? 17.200  1.893   -0.224  1.00 34.23 ? 256  CYS A N     1 
ATOM   1927  C  CA    . CYS A 1 256 ? 18.211  2.595   -1.001  1.00 34.93 ? 256  CYS A CA    1 
ATOM   1928  C  C     . CYS A 1 256 ? 19.492  2.635   -0.148  1.00 36.53 ? 256  CYS A C     1 
ATOM   1929  O  O     . CYS A 1 256 ? 19.475  3.208   0.948   1.00 36.76 ? 256  CYS A O     1 
ATOM   1930  C  CB    . CYS A 1 256 ? 17.723  4.037   -1.174  1.00 34.16 ? 256  CYS A CB    1 
ATOM   1931  S  SG    . CYS A 1 256 ? 18.867  5.059   -2.084  1.00 30.33 ? 256  CYS A SG    1 
ATOM   1932  N  N     . ILE A 1 257 ? 20.625  2.370   -0.785  1.00 36.00 ? 257  ILE A N     1 
ATOM   1933  C  CA    . ILE A 1 257 ? 21.921  2.506   -0.165  1.00 34.17 ? 257  ILE A CA    1 
ATOM   1934  C  C     . ILE A 1 257 ? 22.769  3.567   -0.845  1.00 33.67 ? 257  ILE A C     1 
ATOM   1935  O  O     . ILE A 1 257 ? 23.063  3.529   -2.032  1.00 33.78 ? 257  ILE A O     1 
ATOM   1936  C  CB    . ILE A 1 257 ? 22.691  1.172   -0.261  1.00 35.56 ? 257  ILE A CB    1 
ATOM   1937  C  CG1   . ILE A 1 257 ? 21.937  0.022   0.401   1.00 34.63 ? 257  ILE A CG1   1 
ATOM   1938  C  CG2   . ILE A 1 257 ? 24.095  1.359   0.302   1.00 27.23 ? 257  ILE A CG2   1 
ATOM   1939  C  CD1   . ILE A 1 257 ? 21.763  0.182   1.895   1.00 37.97 ? 257  ILE A CD1   1 
ATOM   1940  N  N     . ASN A 1 258 ? 23.373  4.375   0.010   1.00 33.11 ? 258  ASN A N     1 
ATOM   1941  C  CA    . ASN A 1 258 ? 24.229  5.498   -0.399  1.00 32.55 ? 258  ASN A CA    1 
ATOM   1942  C  C     . ASN A 1 258 ? 25.689  5.096   -0.224  1.00 33.83 ? 258  ASN A C     1 
ATOM   1943  O  O     . ASN A 1 258 ? 26.091  4.809   0.913   1.00 35.12 ? 258  ASN A O     1 
ATOM   1944  C  CB    . ASN A 1 258 ? 23.985  6.706   0.490   1.00 27.89 ? 258  ASN A CB    1 
ATOM   1945  C  CG    . ASN A 1 258 ? 25.096  7.735   0.434   1.00 31.53 ? 258  ASN A CG    1 
ATOM   1946  O  OD1   . ASN A 1 258 ? 25.960  7.756   -0.448  1.00 35.23 ? 258  ASN A OD1   1 
ATOM   1947  N  ND2   . ASN A 1 258 ? 25.081  8.657   1.398   1.00 32.60 ? 258  ASN A ND2   1 
ATOM   1948  N  N     . THR A 1 259 ? 26.327  4.687   -1.317  1.00 32.87 ? 259  THR A N     1 
ATOM   1949  C  CA    . THR A 1 259 ? 27.584  4.000   -1.226  1.00 31.49 ? 259  THR A CA    1 
ATOM   1950  C  C     . THR A 1 259 ? 28.747  4.861   -0.712  1.00 31.04 ? 259  THR A C     1 
ATOM   1951  O  O     . THR A 1 259 ? 29.759  4.181   -0.382  1.00 29.49 ? 259  THR A O     1 
ATOM   1952  C  CB    . THR A 1 259 ? 28.088  3.470   -2.586  1.00 32.50 ? 259  THR A CB    1 
ATOM   1953  O  OG1   . THR A 1 259 ? 28.356  4.588   -3.404  1.00 29.19 ? 259  THR A OG1   1 
ATOM   1954  C  CG2   . THR A 1 259 ? 27.118  2.539   -3.270  1.00 33.98 ? 259  THR A CG2   1 
ATOM   1955  N  N     . GLU A 1 260 ? 28.734  6.170   -0.968  1.00 30.38 ? 260  GLU A N     1 
ATOM   1956  C  CA    . GLU A 1 260 ? 29.933  6.950   -0.640  1.00 31.27 ? 260  GLU A CA    1 
ATOM   1957  C  C     . GLU A 1 260 ? 31.170  6.425   -1.379  1.00 31.77 ? 260  GLU A C     1 
ATOM   1958  O  O     . GLU A 1 260 ? 32.298  6.432   -0.862  1.00 31.88 ? 260  GLU A O     1 
ATOM   1959  C  CB    . GLU A 1 260 ? 30.211  6.941   0.857   1.00 35.73 ? 260  GLU A CB    1 
ATOM   1960  C  CG    . GLU A 1 260 ? 29.490  7.937   1.713   1.00 35.32 ? 260  GLU A CG    1 
ATOM   1961  C  CD    . GLU A 1 260 ? 29.496  9.400   1.423   1.00 44.92 ? 260  GLU A CD    1 
ATOM   1962  O  OE1   . GLU A 1 260 ? 30.440  10.245  1.571   1.00 53.13 ? 260  GLU A OE1   1 
ATOM   1963  O  OE2   . GLU A 1 260 ? 28.431  10.022  1.093   1.00 32.18 ? 260  GLU A OE2   1 
ATOM   1964  N  N     . TRP A 1 261 ? 31.013  6.205   -2.690  1.00 30.92 ? 261  TRP A N     1 
ATOM   1965  C  CA    . TRP A 1 261 ? 32.081  5.735   -3.519  1.00 30.66 ? 261  TRP A CA    1 
ATOM   1966  C  C     . TRP A 1 261 ? 33.229  6.699   -3.706  1.00 30.78 ? 261  TRP A C     1 
ATOM   1967  O  O     . TRP A 1 261 ? 34.318  6.213   -3.998  1.00 32.23 ? 261  TRP A O     1 
ATOM   1968  C  CB    . TRP A 1 261 ? 31.588  5.069   -4.799  1.00 32.93 ? 261  TRP A CB    1 
ATOM   1969  C  CG    . TRP A 1 261 ? 31.225  6.024   -5.884  1.00 32.46 ? 261  TRP A CG    1 
ATOM   1970  C  CD1   . TRP A 1 261 ? 31.523  7.356   -5.965  1.00 29.86 ? 261  TRP A CD1   1 
ATOM   1971  C  CD2   . TRP A 1 261 ? 30.511  5.699   -7.070  1.00 33.08 ? 261  TRP A CD2   1 
ATOM   1972  N  NE1   . TRP A 1 261 ? 31.042  7.900   -7.113  1.00 28.52 ? 261  TRP A NE1   1 
ATOM   1973  C  CE2   . TRP A 1 261 ? 30.443  6.896   -7.841  1.00 35.15 ? 261  TRP A CE2   1 
ATOM   1974  C  CE3   . TRP A 1 261 ? 29.955  4.514   -7.568  1.00 30.33 ? 261  TRP A CE3   1 
ATOM   1975  C  CZ2   . TRP A 1 261 ? 29.781  6.964   -9.075  1.00 25.57 ? 261  TRP A CZ2   1 
ATOM   1976  C  CZ3   . TRP A 1 261 ? 29.316  4.601   -8.784  1.00 28.15 ? 261  TRP A CZ3   1 
ATOM   1977  C  CH2   . TRP A 1 261 ? 29.199  5.804   -9.496  1.00 30.70 ? 261  TRP A CH2   1 
ATOM   1978  N  N     . GLY A 1 262 ? 33.144  7.941   -3.282  1.00 30.24 ? 262  GLY A N     1 
ATOM   1979  C  CA    . GLY A 1 262 ? 34.240  8.892   -3.327  1.00 31.46 ? 262  GLY A CA    1 
ATOM   1980  C  C     . GLY A 1 262 ? 35.451  8.402   -2.520  1.00 31.01 ? 262  GLY A C     1 
ATOM   1981  O  O     . GLY A 1 262 ? 36.589  8.821   -2.739  1.00 28.43 ? 262  GLY A O     1 
ATOM   1982  N  N     . ALA A 1 263 ? 35.177  7.709   -1.414  1.00 31.88 ? 263  ALA A N     1 
ATOM   1983  C  CA    . ALA A 1 263 ? 36.259  7.199   -0.565  1.00 33.06 ? 263  ALA A CA    1 
ATOM   1984  C  C     . ALA A 1 263 ? 36.821  5.873   -1.049  1.00 34.38 ? 263  ALA A C     1 
ATOM   1985  O  O     . ALA A 1 263 ? 37.666  5.246   -0.366  1.00 37.41 ? 263  ALA A O     1 
ATOM   1986  C  CB    . ALA A 1 263 ? 35.823  7.166   0.887   1.00 26.09 ? 263  ALA A CB    1 
ATOM   1987  N  N     . PHE A 1 264 ? 36.313  5.374   -2.198  1.00 32.01 ? 264  PHE A N     1 
ATOM   1988  C  CA    . PHE A 1 264 ? 36.931  4.167   -2.789  1.00 29.73 ? 264  PHE A CA    1 
ATOM   1989  C  C     . PHE A 1 264 ? 38.418  4.367   -2.841  1.00 29.65 ? 264  PHE A C     1 
ATOM   1990  O  O     . PHE A 1 264 ? 38.838  5.433   -3.285  1.00 29.14 ? 264  PHE A O     1 
ATOM   1991  C  CB    . PHE A 1 264 ? 36.345  4.011   -4.205  1.00 25.97 ? 264  PHE A CB    1 
ATOM   1992  C  CG    . PHE A 1 264 ? 36.736  2.800   -4.976  1.00 24.26 ? 264  PHE A CG    1 
ATOM   1993  C  CD1   . PHE A 1 264 ? 37.237  1.671   -4.337  1.00 23.75 ? 264  PHE A CD1   1 
ATOM   1994  C  CD2   . PHE A 1 264 ? 36.628  2.770   -6.357  1.00 23.13 ? 264  PHE A CD2   1 
ATOM   1995  C  CE1   . PHE A 1 264 ? 37.692  0.597   -5.074  1.00 26.31 ? 264  PHE A CE1   1 
ATOM   1996  C  CE2   . PHE A 1 264 ? 36.976  1.637   -7.087  1.00 21.28 ? 264  PHE A CE2   1 
ATOM   1997  C  CZ    . PHE A 1 264 ? 37.528  0.547   -6.445  1.00 19.64 ? 264  PHE A CZ    1 
ATOM   1998  N  N     . GLY A 1 265 ? 39.247  3.401   -2.430  1.00 32.43 ? 265  GLY A N     1 
ATOM   1999  C  CA    . GLY A 1 265 ? 40.721  3.518   -2.598  1.00 31.61 ? 265  GLY A CA    1 
ATOM   2000  C  C     . GLY A 1 265 ? 41.396  4.310   -1.491  1.00 31.76 ? 265  GLY A C     1 
ATOM   2001  O  O     . GLY A 1 265 ? 42.588  4.547   -1.449  1.00 28.96 ? 265  GLY A O     1 
ATOM   2002  N  N     . ASP A 1 266 ? 40.659  4.746   -0.468  1.00 35.27 ? 266  ASP A N     1 
ATOM   2003  C  CA    . ASP A 1 266 ? 41.353  5.503   0.587   1.00 40.13 ? 266  ASP A CA    1 
ATOM   2004  C  C     . ASP A 1 266 ? 42.549  4.709   1.039   1.00 43.92 ? 266  ASP A C     1 
ATOM   2005  O  O     . ASP A 1 266 ? 43.660  4.860   0.525   1.00 50.77 ? 266  ASP A O     1 
ATOM   2006  C  CB    . ASP A 1 266 ? 40.364  6.048   1.595   1.00 35.41 ? 266  ASP A CB    1 
ATOM   2007  C  CG    . ASP A 1 266 ? 39.787  7.298   0.918   1.00 37.68 ? 266  ASP A CG    1 
ATOM   2008  O  OD1   . ASP A 1 266 ? 40.186  7.507   -0.260  1.00 36.27 ? 266  ASP A OD1   1 
ATOM   2009  O  OD2   . ASP A 1 266 ? 39.042  8.074   1.539   1.00 36.85 ? 266  ASP A OD2   1 
ATOM   2010  N  N     . ASP A 1 267 ? 42.254  3.646   1.767   1.00 41.91 ? 267  ASP A N     1 
ATOM   2011  C  CA    . ASP A 1 267 ? 43.176  2.509   2.021   1.00 41.25 ? 267  ASP A CA    1 
ATOM   2012  C  C     . ASP A 1 267 ? 43.851  2.293   0.674   1.00 40.92 ? 267  ASP A C     1 
ATOM   2013  O  O     . ASP A 1 267 ? 43.167  2.712   -0.278  1.00 43.83 ? 267  ASP A O     1 
ATOM   2014  C  CB    . ASP A 1 267 ? 42.162  1.442   2.378   1.00 36.96 ? 267  ASP A CB    1 
ATOM   2015  C  CG    . ASP A 1 267 ? 41.626  0.643   1.222   1.00 42.03 ? 267  ASP A CG    1 
ATOM   2016  O  OD1   . ASP A 1 267 ? 41.929  0.789   0.022   1.00 41.62 ? 267  ASP A OD1   1 
ATOM   2017  O  OD2   . ASP A 1 267 ? 40.901  -0.357  1.519   1.00 40.83 ? 267  ASP A OD2   1 
ATOM   2018  N  N     . GLY A 1 268 ? 45.147  2.115   0.512   1.00 40.33 ? 268  GLY A N     1 
ATOM   2019  C  CA    . GLY A 1 268 ? 45.708  2.282   -0.825  1.00 36.85 ? 268  GLY A CA    1 
ATOM   2020  C  C     . GLY A 1 268 ? 45.188  1.296   -1.830  1.00 35.47 ? 268  GLY A C     1 
ATOM   2021  O  O     . GLY A 1 268 ? 46.020  0.780   -2.582  1.00 34.97 ? 268  GLY A O     1 
ATOM   2022  N  N     . SER A 1 269 ? 43.907  1.005   -2.028  1.00 34.90 ? 269  SER A N     1 
ATOM   2023  C  CA    . SER A 1 269 ? 43.633  -0.024  -3.031  1.00 36.31 ? 269  SER A CA    1 
ATOM   2024  C  C     . SER A 1 269 ? 43.566  0.486   -4.457  1.00 36.85 ? 269  SER A C     1 
ATOM   2025  O  O     . SER A 1 269 ? 43.318  -0.349  -5.338  1.00 37.22 ? 269  SER A O     1 
ATOM   2026  C  CB    . SER A 1 269 ? 42.312  -0.729  -2.718  1.00 36.39 ? 269  SER A CB    1 
ATOM   2027  O  OG    . SER A 1 269 ? 41.362  0.314   -2.901  1.00 45.79 ? 269  SER A OG    1 
ATOM   2028  N  N     . LEU A 1 270 ? 43.797  1.769   -4.694  1.00 37.02 ? 270  LEU A N     1 
ATOM   2029  C  CA    . LEU A 1 270 ? 43.852  2.286   -6.072  1.00 37.16 ? 270  LEU A CA    1 
ATOM   2030  C  C     . LEU A 1 270 ? 45.232  2.893   -6.372  1.00 36.51 ? 270  LEU A C     1 
ATOM   2031  O  O     . LEU A 1 270 ? 45.492  3.642   -7.313  1.00 35.50 ? 270  LEU A O     1 
ATOM   2032  C  CB    . LEU A 1 270 ? 42.725  3.325   -6.232  1.00 36.09 ? 270  LEU A CB    1 
ATOM   2033  C  CG    . LEU A 1 270 ? 41.298  2.789   -6.419  1.00 35.80 ? 270  LEU A CG    1 
ATOM   2034  C  CD1   . LEU A 1 270 ? 40.303  3.903   -6.628  1.00 25.71 ? 270  LEU A CD1   1 
ATOM   2035  C  CD2   . LEU A 1 270 ? 41.237  1.735   -7.504  1.00 30.92 ? 270  LEU A CD2   1 
ATOM   2036  N  N     . GLU A 1 271 ? 46.202  2.589   -5.521  1.00 38.24 ? 271  GLU A N     1 
ATOM   2037  C  CA    . GLU A 1 271 ? 47.535  3.152   -5.600  1.00 40.12 ? 271  GLU A CA    1 
ATOM   2038  C  C     . GLU A 1 271 ? 48.217  2.821   -6.914  1.00 40.29 ? 271  GLU A C     1 
ATOM   2039  O  O     . GLU A 1 271 ? 49.062  3.625   -7.285  1.00 42.05 ? 271  GLU A O     1 
ATOM   2040  C  CB    . GLU A 1 271 ? 48.507  2.848   -4.478  1.00 34.23 ? 271  GLU A CB    1 
ATOM   2041  C  CG    . GLU A 1 271 ? 48.058  3.535   -3.195  1.00 32.75 ? 271  GLU A CG    1 
ATOM   2042  C  CD    . GLU A 1 271 ? 47.908  5.016   -3.394  1.00 34.20 ? 271  GLU A CD    1 
ATOM   2043  O  OE1   . GLU A 1 271 ? 48.954  5.615   -3.699  1.00 41.89 ? 271  GLU A OE1   1 
ATOM   2044  O  OE2   . GLU A 1 271 ? 46.803  5.595   -3.236  1.00 40.83 ? 271  GLU A OE2   1 
ATOM   2045  N  N     . ASP A 1 272 ? 47.810  1.759   -7.560  1.00 40.49 ? 272  ASP A N     1 
ATOM   2046  C  CA    . ASP A 1 272 ? 48.298  1.465   -8.890  1.00 39.87 ? 272  ASP A CA    1 
ATOM   2047  C  C     . ASP A 1 272 ? 47.604  2.335   -9.933  1.00 39.75 ? 272  ASP A C     1 
ATOM   2048  O  O     . ASP A 1 272 ? 48.214  2.406   -11.007 1.00 41.62 ? 272  ASP A O     1 
ATOM   2049  C  CB    . ASP A 1 272 ? 48.152  0.007   -9.267  1.00 43.76 ? 272  ASP A CB    1 
ATOM   2050  C  CG    . ASP A 1 272 ? 46.764  -0.605  -9.204  1.00 43.39 ? 272  ASP A CG    1 
ATOM   2051  O  OD1   . ASP A 1 272 ? 45.787  0.000   -8.747  1.00 40.40 ? 272  ASP A OD1   1 
ATOM   2052  O  OD2   . ASP A 1 272 ? 46.652  -1.821  -9.515  1.00 49.10 ? 272  ASP A OD2   1 
ATOM   2053  N  N     . ILE A 1 273 ? 46.398  2.863   -9.795  1.00 38.34 ? 273  ILE A N     1 
ATOM   2054  C  CA    . ILE A 1 273 ? 45.929  3.709   -10.885 1.00 38.95 ? 273  ILE A CA    1 
ATOM   2055  C  C     . ILE A 1 273 ? 46.181  5.199   -10.633 1.00 38.97 ? 273  ILE A C     1 
ATOM   2056  O  O     . ILE A 1 273 ? 46.510  5.986   -11.521 1.00 37.23 ? 273  ILE A O     1 
ATOM   2057  C  CB    . ILE A 1 273 ? 44.564  3.389   -11.445 1.00 39.35 ? 273  ILE A CB    1 
ATOM   2058  C  CG1   . ILE A 1 273 ? 43.491  4.091   -10.654 1.00 35.38 ? 273  ILE A CG1   1 
ATOM   2059  C  CG2   . ILE A 1 273 ? 44.266  1.892   -11.605 1.00 32.91 ? 273  ILE A CG2   1 
ATOM   2060  C  CD1   . ILE A 1 273 ? 42.784  5.188   -11.415 1.00 46.22 ? 273  ILE A CD1   1 
ATOM   2061  N  N     . ARG A 1 274 ? 46.248  5.579   -9.350  1.00 37.62 ? 274  ARG A N     1 
ATOM   2062  C  CA    . ARG A 1 274 ? 46.596  6.949   -8.981  1.00 35.63 ? 274  ARG A CA    1 
ATOM   2063  C  C     . ARG A 1 274 ? 47.945  7.407   -9.473  1.00 34.53 ? 274  ARG A C     1 
ATOM   2064  O  O     . ARG A 1 274 ? 48.880  6.616   -9.480  1.00 34.66 ? 274  ARG A O     1 
ATOM   2065  C  CB    . ARG A 1 274 ? 46.462  7.066   -7.462  1.00 31.34 ? 274  ARG A CB    1 
ATOM   2066  C  CG    . ARG A 1 274 ? 45.033  7.318   -7.029  1.00 29.68 ? 274  ARG A CG    1 
ATOM   2067  C  CD    . ARG A 1 274 ? 44.948  7.480   -5.509  1.00 30.41 ? 274  ARG A CD    1 
ATOM   2068  N  NE    . ARG A 1 274 ? 45.089  8.921   -5.136  1.00 29.81 ? 274  ARG A NE    1 
ATOM   2069  C  CZ    . ARG A 1 274 ? 46.100  9.215   -4.311  1.00 31.31 ? 274  ARG A CZ    1 
ATOM   2070  N  NH1   . ARG A 1 274 ? 46.890  8.268   -3.816  1.00 34.53 ? 274  ARG A NH1   1 
ATOM   2071  N  NH2   . ARG A 1 274 ? 46.236  10.425  -3.850  1.00 29.78 ? 274  ARG A NH2   1 
ATOM   2072  N  N     . THR A 1 275 ? 48.147  8.668   -9.885  1.00 33.56 ? 275  THR A N     1 
ATOM   2073  C  CA    . THR A 1 275 ? 49.495  9.080   -10.303 1.00 32.99 ? 275  THR A CA    1 
ATOM   2074  C  C     . THR A 1 275 ? 50.097  10.180  -9.451  1.00 34.09 ? 275  THR A C     1 
ATOM   2075  O  O     . THR A 1 275 ? 49.456  10.829  -8.626  1.00 33.73 ? 275  THR A O     1 
ATOM   2076  C  CB    . THR A 1 275 ? 49.424  9.681   -11.732 1.00 32.26 ? 275  THR A CB    1 
ATOM   2077  O  OG1   . THR A 1 275 ? 48.651  10.918  -11.699 1.00 32.16 ? 275  THR A OG1   1 
ATOM   2078  C  CG2   . THR A 1 275 ? 48.667  8.708   -12.611 1.00 31.83 ? 275  THR A CG2   1 
ATOM   2079  N  N     . GLU A 1 276 ? 51.332  10.548  -9.793  1.00 35.66 ? 276  GLU A N     1 
ATOM   2080  C  CA    . GLU A 1 276 ? 51.990  11.700  -9.179  1.00 36.50 ? 276  GLU A CA    1 
ATOM   2081  C  C     . GLU A 1 276 ? 51.076  12.913  -9.212  1.00 35.61 ? 276  GLU A C     1 
ATOM   2082  O  O     . GLU A 1 276 ? 51.107  13.703  -8.254  1.00 37.05 ? 276  GLU A O     1 
ATOM   2083  C  CB    . GLU A 1 276 ? 53.317  12.082  -9.872  1.00 37.00 ? 276  GLU A CB    1 
ATOM   2084  C  CG    . GLU A 1 276 ? 53.139  12.487  -11.333 1.00 44.12 ? 276  GLU A CG    1 
ATOM   2085  C  CD    . GLU A 1 276 ? 54.498  12.718  -11.971 1.00 47.89 ? 276  GLU A CD    1 
ATOM   2086  O  OE1   . GLU A 1 276 ? 55.250  13.610  -11.527 1.00 53.44 ? 276  GLU A OE1   1 
ATOM   2087  O  OE2   . GLU A 1 276 ? 54.895  12.005  -12.904 1.00 48.17 ? 276  GLU A OE2   1 
ATOM   2088  N  N     . PHE A 1 277 ? 50.291  13.072  -10.261 1.00 33.82 ? 277  PHE A N     1 
ATOM   2089  C  CA    . PHE A 1 277 ? 49.413  14.256  -10.355 1.00 32.40 ? 277  PHE A CA    1 
ATOM   2090  C  C     . PHE A 1 277 ? 48.370  14.190  -9.272  1.00 30.71 ? 277  PHE A C     1 
ATOM   2091  O  O     . PHE A 1 277 ? 48.050  15.176  -8.623  1.00 32.83 ? 277  PHE A O     1 
ATOM   2092  C  CB    . PHE A 1 277 ? 48.861  14.411  -11.788 1.00 28.27 ? 277  PHE A CB    1 
ATOM   2093  C  CG    . PHE A 1 277 ? 49.987  14.498  -12.789 1.00 27.61 ? 277  PHE A CG    1 
ATOM   2094  C  CD1   . PHE A 1 277 ? 50.853  15.579  -12.747 1.00 27.76 ? 277  PHE A CD1   1 
ATOM   2095  C  CD2   . PHE A 1 277 ? 50.198  13.551  -13.748 1.00 26.52 ? 277  PHE A CD2   1 
ATOM   2096  C  CE1   . PHE A 1 277 ? 51.927  15.692  -13.595 1.00 27.58 ? 277  PHE A CE1   1 
ATOM   2097  C  CE2   . PHE A 1 277 ? 51.309  13.625  -14.588 1.00 25.64 ? 277  PHE A CE2   1 
ATOM   2098  C  CZ    . PHE A 1 277 ? 52.121  14.713  -14.552 1.00 26.88 ? 277  PHE A CZ    1 
ATOM   2099  N  N     . ASP A 1 278 ? 47.828  13.046  -8.979  1.00 31.10 ? 278  ASP A N     1 
ATOM   2100  C  CA    . ASP A 1 278 ? 46.763  12.801  -7.986  1.00 30.21 ? 278  ASP A CA    1 
ATOM   2101  C  C     . ASP A 1 278 ? 47.350  12.823  -6.562  1.00 29.33 ? 278  ASP A C     1 
ATOM   2102  O  O     . ASP A 1 278 ? 46.682  13.324  -5.673  1.00 29.90 ? 278  ASP A O     1 
ATOM   2103  C  CB    . ASP A 1 278 ? 46.186  11.401  -8.233  1.00 23.11 ? 278  ASP A CB    1 
ATOM   2104  C  CG    . ASP A 1 278 ? 45.615  11.201  -9.604  1.00 31.33 ? 278  ASP A CG    1 
ATOM   2105  O  OD1   . ASP A 1 278 ? 44.593  11.861  -9.978  1.00 36.29 ? 278  ASP A OD1   1 
ATOM   2106  O  OD2   . ASP A 1 278 ? 46.141  10.346  -10.355 1.00 37.49 ? 278  ASP A OD2   1 
ATOM   2107  N  N     . ARG A 1 279 ? 48.615  12.478  -6.404  1.00 27.81 ? 279  ARG A N     1 
ATOM   2108  C  CA    . ARG A 1 279 ? 49.290  12.582  -5.130  1.00 29.03 ? 279  ARG A CA    1 
ATOM   2109  C  C     . ARG A 1 279 ? 49.679  14.027  -4.833  1.00 29.13 ? 279  ARG A C     1 
ATOM   2110  O  O     . ARG A 1 279 ? 49.551  14.449  -3.693  1.00 30.12 ? 279  ARG A O     1 
ATOM   2111  C  CB    . ARG A 1 279 ? 50.539  11.710  -4.991  1.00 23.17 ? 279  ARG A CB    1 
ATOM   2112  C  CG    . ARG A 1 279 ? 50.126  10.267  -4.787  1.00 26.44 ? 279  ARG A CG    1 
ATOM   2113  C  CD    . ARG A 1 279 ? 51.299  9.298   -5.057  1.00 31.08 ? 279  ARG A CD    1 
ATOM   2114  N  NE    . ARG A 1 279 ? 50.658  7.972   -5.240  1.00 39.93 ? 279  ARG A NE    1 
ATOM   2115  C  CZ    . ARG A 1 279 ? 50.751  7.365   -6.445  1.00 40.21 ? 279  ARG A CZ    1 
ATOM   2116  N  NH1   . ARG A 1 279 ? 51.464  7.901   -7.442  1.00 34.18 ? 279  ARG A NH1   1 
ATOM   2117  N  NH2   . ARG A 1 279 ? 50.114  6.204   -6.540  1.00 36.81 ? 279  ARG A NH2   1 
ATOM   2118  N  N     . GLU A 1 280 ? 49.899  14.838  -5.874  1.00 30.14 ? 280  GLU A N     1 
ATOM   2119  C  CA    . GLU A 1 280 ? 50.183  16.199  -5.510  1.00 31.22 ? 280  GLU A CA    1 
ATOM   2120  C  C     . GLU A 1 280 ? 48.872  16.926  -5.219  1.00 31.79 ? 280  GLU A C     1 
ATOM   2121  O  O     . GLU A 1 280 ? 48.852  17.748  -4.297  1.00 34.18 ? 280  GLU A O     1 
ATOM   2122  C  CB    . GLU A 1 280 ? 51.086  16.954  -6.468  1.00 32.93 ? 280  GLU A CB    1 
ATOM   2123  C  CG    . GLU A 1 280 ? 51.147  18.397  -5.946  1.00 32.35 ? 280  GLU A CG    1 
ATOM   2124  C  CD    . GLU A 1 280 ? 52.219  19.148  -6.724  1.00 39.10 ? 280  GLU A CD    1 
ATOM   2125  O  OE1   . GLU A 1 280 ? 52.863  18.502  -7.591  1.00 35.83 ? 280  GLU A OE1   1 
ATOM   2126  O  OE2   . GLU A 1 280 ? 52.373  20.344  -6.397  1.00 39.63 ? 280  GLU A OE2   1 
ATOM   2127  N  N     . ILE A 1 281 ? 47.798  16.675  -5.936  1.00 29.41 ? 281  ILE A N     1 
ATOM   2128  C  CA    . ILE A 1 281 ? 46.553  17.319  -5.601  1.00 29.07 ? 281  ILE A CA    1 
ATOM   2129  C  C     . ILE A 1 281 ? 46.136  17.004  -4.196  1.00 29.95 ? 281  ILE A C     1 
ATOM   2130  O  O     . ILE A 1 281 ? 45.672  17.886  -3.452  1.00 32.17 ? 281  ILE A O     1 
ATOM   2131  C  CB    . ILE A 1 281 ? 45.474  17.160  -6.681  1.00 31.75 ? 281  ILE A CB    1 
ATOM   2132  C  CG1   . ILE A 1 281 ? 44.457  18.316  -6.599  1.00 31.99 ? 281  ILE A CG1   1 
ATOM   2133  C  CG2   . ILE A 1 281 ? 44.736  15.863  -6.668  1.00 27.85 ? 281  ILE A CG2   1 
ATOM   2134  C  CD1   . ILE A 1 281 ? 43.510  18.350  -7.786  1.00 30.56 ? 281  ILE A CD1   1 
ATOM   2135  N  N     . ASP A 1 282 ? 46.216  15.769  -3.741  1.00 29.03 ? 282  ASP A N     1 
ATOM   2136  C  CA    . ASP A 1 282 ? 45.866  15.418  -2.369  1.00 29.75 ? 282  ASP A CA    1 
ATOM   2137  C  C     . ASP A 1 282 ? 46.641  16.216  -1.326  1.00 28.48 ? 282  ASP A C     1 
ATOM   2138  O  O     . ASP A 1 282 ? 46.092  16.660  -0.319  1.00 30.34 ? 282  ASP A O     1 
ATOM   2139  C  CB    . ASP A 1 282 ? 46.097  13.906  -2.212  1.00 30.82 ? 282  ASP A CB    1 
ATOM   2140  C  CG    . ASP A 1 282 ? 45.733  13.393  -0.844  1.00 28.78 ? 282  ASP A CG    1 
ATOM   2141  O  OD1   . ASP A 1 282 ? 44.583  13.589  -0.391  1.00 31.51 ? 282  ASP A OD1   1 
ATOM   2142  O  OD2   . ASP A 1 282 ? 46.579  12.781  -0.173  1.00 38.63 ? 282  ASP A OD2   1 
ATOM   2143  N  N     . ARG A 1 283 ? 47.886  16.539  -1.502  1.00 28.70 ? 283  ARG A N     1 
ATOM   2144  C  CA    . ARG A 1 283 ? 48.738  17.296  -0.623  1.00 29.32 ? 283  ARG A CA    1 
ATOM   2145  C  C     . ARG A 1 283 ? 48.283  18.695  -0.335  1.00 30.11 ? 283  ARG A C     1 
ATOM   2146  O  O     . ARG A 1 283 ? 48.707  19.330  0.651   1.00 28.96 ? 283  ARG A O     1 
ATOM   2147  C  CB    . ARG A 1 283 ? 50.211  17.271  -1.074  1.00 31.03 ? 283  ARG A CB    1 
ATOM   2148  C  CG    . ARG A 1 283 ? 50.851  15.898  -0.844  1.00 29.45 ? 283  ARG A CG    1 
ATOM   2149  C  CD    . ARG A 1 283 ? 52.160  15.615  -1.611  1.00 36.90 ? 283  ARG A CD    1 
ATOM   2150  N  NE    . ARG A 1 283 ? 52.899  16.817  -1.859  1.00 34.19 ? 283  ARG A NE    1 
ATOM   2151  C  CZ    . ARG A 1 283 ? 54.073  17.310  -1.496  1.00 43.99 ? 283  ARG A CZ    1 
ATOM   2152  N  NH1   . ARG A 1 283 ? 55.148  16.606  -0.994  1.00 34.57 ? 283  ARG A NH1   1 
ATOM   2153  N  NH2   . ARG A 1 283 ? 54.117  18.615  -1.830  1.00 21.02 ? 283  ARG A NH2   1 
ATOM   2154  N  N     . GLY A 1 284 ? 47.458  19.300  -1.197  1.00 30.75 ? 284  GLY A N     1 
ATOM   2155  C  CA    . GLY A 1 284 ? 47.059  20.702  -1.090  1.00 28.49 ? 284  GLY A CA    1 
ATOM   2156  C  C     . GLY A 1 284 ? 45.573  20.808  -0.801  1.00 30.36 ? 284  GLY A C     1 
ATOM   2157  O  O     . GLY A 1 284 ? 45.062  21.938  -0.594  1.00 32.78 ? 284  GLY A O     1 
ATOM   2158  N  N     . SER A 1 285 ? 44.880  19.694  -0.682  1.00 28.66 ? 285  SER A N     1 
ATOM   2159  C  CA    . SER A 1 285 ? 43.422  19.744  -0.488  1.00 29.98 ? 285  SER A CA    1 
ATOM   2160  C  C     . SER A 1 285 ? 43.073  19.876  0.985   1.00 32.55 ? 285  SER A C     1 
ATOM   2161  O  O     . SER A 1 285 ? 43.916  19.713  1.869   1.00 31.15 ? 285  SER A O     1 
ATOM   2162  C  CB    . SER A 1 285 ? 42.893  18.419  -1.064  1.00 26.92 ? 285  SER A CB    1 
ATOM   2163  O  OG    . SER A 1 285 ? 43.216  17.300  -0.263  1.00 30.36 ? 285  SER A OG    1 
ATOM   2164  N  N     . LEU A 1 286 ? 41.805  20.092  1.288   1.00 33.69 ? 286  LEU A N     1 
ATOM   2165  C  CA    . LEU A 1 286 ? 41.270  20.310  2.621   1.00 34.46 ? 286  LEU A CA    1 
ATOM   2166  C  C     . LEU A 1 286 ? 41.172  19.037  3.476   1.00 33.95 ? 286  LEU A C     1 
ATOM   2167  O  O     . LEU A 1 286 ? 41.121  19.090  4.707   1.00 34.24 ? 286  LEU A O     1 
ATOM   2168  C  CB    . LEU A 1 286 ? 39.806  20.748  2.437   1.00 34.87 ? 286  LEU A CB    1 
ATOM   2169  C  CG    . LEU A 1 286 ? 39.491  22.192  2.715   1.00 38.80 ? 286  LEU A CG    1 
ATOM   2170  C  CD1   . LEU A 1 286 ? 37.993  22.408  2.625   1.00 31.35 ? 286  LEU A CD1   1 
ATOM   2171  C  CD2   . LEU A 1 286 ? 40.081  22.711  4.018   1.00 35.36 ? 286  LEU A CD2   1 
ATOM   2172  N  N     . ASN A 1 287 ? 41.177  17.891  2.851   1.00 32.91 ? 287  ASN A N     1 
ATOM   2173  C  CA    . ASN A 1 287 ? 41.097  16.574  3.442   1.00 32.62 ? 287  ASN A CA    1 
ATOM   2174  C  C     . ASN A 1 287 ? 42.041  15.569  2.809   1.00 33.87 ? 287  ASN A C     1 
ATOM   2175  O  O     . ASN A 1 287 ? 41.641  14.639  2.103   1.00 34.12 ? 287  ASN A O     1 
ATOM   2176  C  CB    . ASN A 1 287 ? 39.666  16.088  3.228   1.00 36.55 ? 287  ASN A CB    1 
ATOM   2177  C  CG    . ASN A 1 287 ? 39.249  16.072  1.771   1.00 39.77 ? 287  ASN A CG    1 
ATOM   2178  O  OD1   . ASN A 1 287 ? 38.276  15.383  1.435   1.00 35.93 ? 287  ASN A OD1   1 
ATOM   2179  N  ND2   . ASN A 1 287 ? 40.014  16.698  0.894   1.00 34.18 ? 287  ASN A ND2   1 
ATOM   2180  N  N     . PRO A 1 288 ? 43.357  15.691  3.107   1.00 33.60 ? 288  PRO A N     1 
ATOM   2181  C  CA    . PRO A 1 288 ? 44.354  14.843  2.465   1.00 33.16 ? 288  PRO A CA    1 
ATOM   2182  C  C     . PRO A 1 288 ? 44.258  13.414  2.956   1.00 33.51 ? 288  PRO A C     1 
ATOM   2183  O  O     . PRO A 1 288 ? 44.090  13.263  4.157   1.00 33.92 ? 288  PRO A O     1 
ATOM   2184  C  CB    . PRO A 1 288 ? 45.686  15.465  2.880   1.00 32.57 ? 288  PRO A CB    1 
ATOM   2185  C  CG    . PRO A 1 288 ? 45.340  16.253  4.102   1.00 33.81 ? 288  PRO A CG    1 
ATOM   2186  C  CD    . PRO A 1 288 ? 43.937  16.764  3.966   1.00 31.61 ? 288  PRO A CD    1 
ATOM   2187  N  N     . GLY A 1 289 ? 44.342  12.409  2.085   1.00 34.25 ? 289  GLY A N     1 
ATOM   2188  C  CA    . GLY A 1 289 ? 44.192  11.040  2.521   1.00 34.31 ? 289  GLY A CA    1 
ATOM   2189  C  C     . GLY A 1 289 ? 42.729  10.613  2.448   1.00 35.49 ? 289  GLY A C     1 
ATOM   2190  O  O     . GLY A 1 289 ? 42.423  9.446   2.712   1.00 38.96 ? 289  GLY A O     1 
ATOM   2191  N  N     . LYS A 1 290 ? 41.845  11.535  2.079   1.00 33.70 ? 290  LYS A N     1 
ATOM   2192  C  CA    . LYS A 1 290 ? 40.420  11.206  2.012   1.00 34.59 ? 290  LYS A CA    1 
ATOM   2193  C  C     . LYS A 1 290 ? 39.812  11.529  0.668   1.00 32.70 ? 290  LYS A C     1 
ATOM   2194  O  O     . LYS A 1 290 ? 40.443  12.155  -0.189  1.00 31.49 ? 290  LYS A O     1 
ATOM   2195  C  CB    . LYS A 1 290 ? 39.726  11.720  3.283   1.00 38.27 ? 290  LYS A CB    1 
ATOM   2196  C  CG    . LYS A 1 290 ? 40.058  10.762  4.439   1.00 40.56 ? 290  LYS A CG    1 
ATOM   2197  C  CD    . LYS A 1 290 ? 40.479  11.474  5.689   1.00 48.49 ? 290  LYS A CD    1 
ATOM   2198  C  CE    . LYS A 1 290 ? 39.444  12.476  6.188   1.00 51.67 ? 290  LYS A CE    1 
ATOM   2199  N  NZ    . LYS A 1 290 ? 39.217  12.312  7.666   1.00 49.67 ? 290  LYS A NZ    1 
ATOM   2200  N  N     . GLN A 1 291 ? 38.738  10.831  0.310   1.00 32.98 ? 291  GLN A N     1 
ATOM   2201  C  CA    . GLN A 1 291 ? 38.033  10.863  -0.950  1.00 32.99 ? 291  GLN A CA    1 
ATOM   2202  C  C     . GLN A 1 291 ? 38.901  10.711  -2.206  1.00 32.04 ? 291  GLN A C     1 
ATOM   2203  O  O     . GLN A 1 291 ? 38.664  11.436  -3.177  1.00 31.27 ? 291  GLN A O     1 
ATOM   2204  C  CB    . GLN A 1 291 ? 37.229  12.149  -1.154  1.00 27.83 ? 291  GLN A CB    1 
ATOM   2205  C  CG    . GLN A 1 291 ? 36.299  12.556  -0.036  1.00 30.33 ? 291  GLN A CG    1 
ATOM   2206  C  CD    . GLN A 1 291 ? 35.169  11.551  0.018   1.00 35.84 ? 291  GLN A CD    1 
ATOM   2207  O  OE1   . GLN A 1 291 ? 35.254  10.551  0.745   1.00 36.91 ? 291  GLN A OE1   1 
ATOM   2208  N  NE2   . GLN A 1 291 ? 34.166  11.693  -0.827  1.00 34.17 ? 291  GLN A NE2   1 
ATOM   2209  N  N     . LEU A 1 292 ? 39.824  9.800   -2.253  1.00 33.42 ? 292  LEU A N     1 
ATOM   2210  C  CA    . LEU A 1 292 ? 40.759  9.614   -3.324  1.00 34.47 ? 292  LEU A CA    1 
ATOM   2211  C  C     . LEU A 1 292 ? 40.227  9.245   -4.692  1.00 35.65 ? 292  LEU A C     1 
ATOM   2212  O  O     . LEU A 1 292 ? 40.911  9.608   -5.690  1.00 38.27 ? 292  LEU A O     1 
ATOM   2213  C  CB    . LEU A 1 292 ? 41.957  8.720   -2.956  1.00 33.79 ? 292  LEU A CB    1 
ATOM   2214  C  CG    . LEU A 1 292 ? 42.679  9.003   -1.619  1.00 31.86 ? 292  LEU A CG    1 
ATOM   2215  C  CD1   . LEU A 1 292 ? 43.781  7.987   -1.376  1.00 24.68 ? 292  LEU A CD1   1 
ATOM   2216  C  CD2   . LEU A 1 292 ? 43.258  10.408  -1.667  1.00 28.82 ? 292  LEU A CD2   1 
ATOM   2217  N  N     . PHE A 1 293 ? 39.193  8.458   -4.848  1.00 33.73 ? 293  PHE A N     1 
ATOM   2218  C  CA    . PHE A 1 293 ? 38.585  8.141   -6.142  1.00 31.12 ? 293  PHE A CA    1 
ATOM   2219  C  C     . PHE A 1 293 ? 37.868  9.408   -6.568  1.00 30.31 ? 293  PHE A C     1 
ATOM   2220  O  O     . PHE A 1 293 ? 37.948  9.786   -7.723  1.00 32.35 ? 293  PHE A O     1 
ATOM   2221  C  CB    . PHE A 1 293 ? 37.520  7.004   -5.846  1.00 32.07 ? 293  PHE A CB    1 
ATOM   2222  C  CG    . PHE A 1 293 ? 36.747  6.642   -7.086  1.00 30.43 ? 293  PHE A CG    1 
ATOM   2223  C  CD1   . PHE A 1 293 ? 37.367  5.976   -8.124  1.00 28.03 ? 293  PHE A CD1   1 
ATOM   2224  C  CD2   . PHE A 1 293 ? 35.427  7.035   -7.253  1.00 28.38 ? 293  PHE A CD2   1 
ATOM   2225  C  CE1   . PHE A 1 293 ? 36.715  5.690   -9.297  1.00 29.50 ? 293  PHE A CE1   1 
ATOM   2226  C  CE2   . PHE A 1 293 ? 34.726  6.724   -8.403  1.00 29.90 ? 293  PHE A CE2   1 
ATOM   2227  C  CZ    . PHE A 1 293 ? 35.377  6.055   -9.442  1.00 29.18 ? 293  PHE A CZ    1 
ATOM   2228  N  N     . GLU A 1 294 ? 37.213  10.165  -5.717  1.00 28.91 ? 294  GLU A N     1 
ATOM   2229  C  CA    . GLU A 1 294 ? 36.497  11.389  -6.078  1.00 29.83 ? 294  GLU A CA    1 
ATOM   2230  C  C     . GLU A 1 294 ? 37.432  12.469  -6.631  1.00 31.14 ? 294  GLU A C     1 
ATOM   2231  O  O     . GLU A 1 294 ? 37.196  13.206  -7.617  1.00 30.60 ? 294  GLU A O     1 
ATOM   2232  C  CB    . GLU A 1 294 ? 35.724  11.840  -4.841  1.00 29.89 ? 294  GLU A CB    1 
ATOM   2233  C  CG    . GLU A 1 294 ? 35.410  13.321  -4.694  1.00 27.93 ? 294  GLU A CG    1 
ATOM   2234  C  CD    . GLU A 1 294 ? 34.325  13.561  -3.673  1.00 30.75 ? 294  GLU A CD    1 
ATOM   2235  O  OE1   . GLU A 1 294 ? 33.156  13.246  -4.008  1.00 31.12 ? 294  GLU A OE1   1 
ATOM   2236  O  OE2   . GLU A 1 294 ? 34.645  14.022  -2.543  1.00 34.22 ? 294  GLU A OE2   1 
ATOM   2237  N  N     . LYS A 1 295 ? 38.645  12.506  -6.101  1.00 29.80 ? 295  LYS A N     1 
ATOM   2238  C  CA    . LYS A 1 295 ? 39.685  13.405  -6.533  1.00 29.48 ? 295  LYS A CA    1 
ATOM   2239  C  C     . LYS A 1 295 ? 40.206  13.097  -7.912  1.00 28.70 ? 295  LYS A C     1 
ATOM   2240  O  O     . LYS A 1 295 ? 40.996  13.894  -8.418  1.00 27.67 ? 295  LYS A O     1 
ATOM   2241  C  CB    . LYS A 1 295 ? 40.877  13.433  -5.545  1.00 29.19 ? 295  LYS A CB    1 
ATOM   2242  C  CG    . LYS A 1 295 ? 40.386  14.139  -4.296  1.00 28.39 ? 295  LYS A CG    1 
ATOM   2243  C  CD    . LYS A 1 295 ? 41.312  14.000  -3.120  1.00 28.29 ? 295  LYS A CD    1 
ATOM   2244  C  CE    . LYS A 1 295 ? 40.921  15.051  -2.076  1.00 29.18 ? 295  LYS A CE    1 
ATOM   2245  N  NZ    . LYS A 1 295 ? 41.531  14.624  -0.771  1.00 35.87 ? 295  LYS A NZ    1 
ATOM   2246  N  N     . MET A 1 296 ? 39.862  11.926  -8.434  1.00 29.89 ? 296  MET A N     1 
ATOM   2247  C  CA    . MET A 1 296 ? 40.283  11.592  -9.790  1.00 30.76 ? 296  MET A CA    1 
ATOM   2248  C  C     . MET A 1 296 ? 39.162  11.924  -10.775 1.00 30.22 ? 296  MET A C     1 
ATOM   2249  O  O     . MET A 1 296 ? 39.373  11.880  -12.011 1.00 31.41 ? 296  MET A O     1 
ATOM   2250  C  CB    . MET A 1 296 ? 40.660  10.099  -9.895  1.00 31.48 ? 296  MET A CB    1 
ATOM   2251  C  CG    . MET A 1 296 ? 42.088  9.758   -9.531  1.00 32.91 ? 296  MET A CG    1 
ATOM   2252  S  SD    . MET A 1 296 ? 42.594  8.068   -9.900  1.00 32.43 ? 296  MET A SD    1 
ATOM   2253  C  CE    . MET A 1 296 ? 41.518  7.189   -8.764  1.00 30.26 ? 296  MET A CE    1 
ATOM   2254  N  N     . VAL A 1 297 ? 37.966  12.130  -10.266 1.00 30.64 ? 297  VAL A N     1 
ATOM   2255  C  CA    . VAL A 1 297 ? 36.772  12.264  -11.089 1.00 30.91 ? 297  VAL A CA    1 
ATOM   2256  C  C     . VAL A 1 297 ? 36.066  13.590  -11.136 1.00 31.59 ? 297  VAL A C     1 
ATOM   2257  O  O     . VAL A 1 297 ? 35.584  14.033  -12.164 1.00 32.65 ? 297  VAL A O     1 
ATOM   2258  C  CB    . VAL A 1 297 ? 35.733  11.241  -10.517 1.00 30.87 ? 297  VAL A CB    1 
ATOM   2259  C  CG1   . VAL A 1 297 ? 34.322  11.448  -11.055 1.00 23.03 ? 297  VAL A CG1   1 
ATOM   2260  C  CG2   . VAL A 1 297 ? 36.219  9.842   -10.903 1.00 25.51 ? 297  VAL A CG2   1 
ATOM   2261  N  N     . SER A 1 298 ? 35.798  14.250  -10.033 1.00 30.58 ? 298  SER A N     1 
ATOM   2262  C  CA    . SER A 1 298 ? 34.837  15.287  -9.885  1.00 30.18 ? 298  SER A CA    1 
ATOM   2263  C  C     . SER A 1 298 ? 35.221  16.704  -10.264 1.00 31.38 ? 298  SER A C     1 
ATOM   2264  O  O     . SER A 1 298 ? 36.403  17.028  -10.382 1.00 32.59 ? 298  SER A O     1 
ATOM   2265  C  CB    . SER A 1 298 ? 34.232  15.152  -8.497  1.00 25.79 ? 298  SER A CB    1 
ATOM   2266  O  OG    . SER A 1 298 ? 34.790  16.003  -7.531  1.00 30.69 ? 298  SER A OG    1 
ATOM   2267  N  N     . GLY A 1 299 ? 34.206  17.575  -10.420 1.00 29.62 ? 299  GLY A N     1 
ATOM   2268  C  CA    . GLY A 1 299 ? 34.366  18.911  -10.869 1.00 30.34 ? 299  GLY A CA    1 
ATOM   2269  C  C     . GLY A 1 299 ? 35.251  19.843  -10.112 1.00 30.76 ? 299  GLY A C     1 
ATOM   2270  O  O     . GLY A 1 299 ? 36.042  20.649  -10.636 1.00 29.01 ? 299  GLY A O     1 
ATOM   2271  N  N     . MET A 1 300 ? 35.308  19.618  -8.801  1.00 33.01 ? 300  MET A N     1 
ATOM   2272  C  CA    . MET A 1 300 ? 36.156  20.514  -7.974  1.00 33.64 ? 300  MET A CA    1 
ATOM   2273  C  C     . MET A 1 300 ? 37.641  20.199  -8.191  1.00 33.71 ? 300  MET A C     1 
ATOM   2274  O  O     . MET A 1 300 ? 38.465  21.109  -7.971  1.00 32.93 ? 300  MET A O     1 
ATOM   2275  C  CB    . MET A 1 300 ? 35.733  20.278  -6.530  1.00 35.29 ? 300  MET A CB    1 
ATOM   2276  C  CG    . MET A 1 300 ? 36.821  20.610  -5.518  1.00 31.84 ? 300  MET A CG    1 
ATOM   2277  S  SD    . MET A 1 300 ? 36.100  20.377  -3.850  1.00 32.51 ? 300  MET A SD    1 
ATOM   2278  C  CE    . MET A 1 300 ? 37.277  21.476  -3.071  1.00 25.26 ? 300  MET A CE    1 
ATOM   2279  N  N     . TYR A 1 301 ? 37.943  19.019  -8.746  1.00 32.36 ? 301  TYR A N     1 
ATOM   2280  C  CA    . TYR A 1 301 ? 39.339  18.648  -8.938  1.00 32.49 ? 301  TYR A CA    1 
ATOM   2281  C  C     . TYR A 1 301 ? 39.848  18.592  -10.357 1.00 33.14 ? 301  TYR A C     1 
ATOM   2282  O  O     . TYR A 1 301 ? 41.069  18.527  -10.566 1.00 33.47 ? 301  TYR A O     1 
ATOM   2283  C  CB    . TYR A 1 301 ? 39.599  17.306  -8.215  1.00 31.08 ? 301  TYR A CB    1 
ATOM   2284  C  CG    . TYR A 1 301 ? 39.086  17.268  -6.788  1.00 30.97 ? 301  TYR A CG    1 
ATOM   2285  C  CD1   . TYR A 1 301 ? 39.796  17.965  -5.800  1.00 31.04 ? 301  TYR A CD1   1 
ATOM   2286  C  CD2   . TYR A 1 301 ? 37.949  16.568  -6.405  1.00 30.38 ? 301  TYR A CD2   1 
ATOM   2287  C  CE1   . TYR A 1 301 ? 39.390  17.947  -4.469  1.00 30.63 ? 301  TYR A CE1   1 
ATOM   2288  C  CE2   . TYR A 1 301 ? 37.511  16.556  -5.080  1.00 30.78 ? 301  TYR A CE2   1 
ATOM   2289  C  CZ    . TYR A 1 301 ? 38.258  17.249  -4.125  1.00 31.07 ? 301  TYR A CZ    1 
ATOM   2290  O  OH    . TYR A 1 301 ? 37.845  17.286  -2.820  1.00 30.54 ? 301  TYR A OH    1 
ATOM   2291  N  N     . LEU A 1 302 ? 38.996  18.459  -11.392 1.00 32.90 ? 302  LEU A N     1 
ATOM   2292  C  CA    . LEU A 1 302 ? 39.566  18.185  -12.731 1.00 31.46 ? 302  LEU A CA    1 
ATOM   2293  C  C     . LEU A 1 302 ? 40.396  19.366  -13.195 1.00 31.73 ? 302  LEU A C     1 
ATOM   2294  O  O     . LEU A 1 302 ? 41.462  19.193  -13.843 1.00 31.68 ? 302  LEU A O     1 
ATOM   2295  C  CB    . LEU A 1 302 ? 38.421  17.756  -13.617 1.00 31.98 ? 302  LEU A CB    1 
ATOM   2296  C  CG    . LEU A 1 302 ? 38.245  16.332  -14.079 1.00 37.07 ? 302  LEU A CG    1 
ATOM   2297  C  CD1   . LEU A 1 302 ? 38.634  15.256  -13.084 1.00 35.16 ? 302  LEU A CD1   1 
ATOM   2298  C  CD2   . LEU A 1 302 ? 36.885  16.058  -14.695 1.00 30.58 ? 302  LEU A CD2   1 
ATOM   2299  N  N     . GLY A 1 303 ? 40.032  20.594  -12.788 1.00 30.74 ? 303  GLY A N     1 
ATOM   2300  C  CA    . GLY A 1 303 ? 40.785  21.755  -13.273 1.00 31.78 ? 303  GLY A CA    1 
ATOM   2301  C  C     . GLY A 1 303 ? 42.170  21.907  -12.691 1.00 33.88 ? 303  GLY A C     1 
ATOM   2302  O  O     . GLY A 1 303 ? 43.136  22.138  -13.448 1.00 36.18 ? 303  GLY A O     1 
ATOM   2303  N  N     . GLU A 1 304 ? 42.371  21.578  -11.408 1.00 32.67 ? 304  GLU A N     1 
ATOM   2304  C  CA    . GLU A 1 304 ? 43.681  21.566  -10.795 1.00 31.81 ? 304  GLU A CA    1 
ATOM   2305  C  C     . GLU A 1 304 ? 44.617  20.496  -11.267 1.00 31.88 ? 304  GLU A C     1 
ATOM   2306  O  O     . GLU A 1 304 ? 45.847  20.565  -11.325 1.00 32.00 ? 304  GLU A O     1 
ATOM   2307  C  CB    . GLU A 1 304 ? 43.403  21.413  -9.280  1.00 32.27 ? 304  GLU A CB    1 
ATOM   2308  C  CG    . GLU A 1 304 ? 43.790  22.607  -8.501  1.00 34.68 ? 304  GLU A CG    1 
ATOM   2309  C  CD    . GLU A 1 304 ? 45.086  23.328  -8.602  1.00 30.07 ? 304  GLU A CD    1 
ATOM   2310  O  OE1   . GLU A 1 304 ? 46.094  23.000  -7.941  1.00 33.62 ? 304  GLU A OE1   1 
ATOM   2311  O  OE2   . GLU A 1 304 ? 45.095  24.439  -9.167  1.00 34.84 ? 304  GLU A OE2   1 
ATOM   2312  N  N     . LEU A 1 305 ? 44.055  19.325  -11.533 1.00 32.92 ? 305  LEU A N     1 
ATOM   2313  C  CA    . LEU A 1 305 ? 44.738  18.187  -12.144 1.00 32.95 ? 305  LEU A CA    1 
ATOM   2314  C  C     . LEU A 1 305 ? 45.331  18.574  -13.507 1.00 32.81 ? 305  LEU A C     1 
ATOM   2315  O  O     . LEU A 1 305 ? 46.523  18.304  -13.738 1.00 33.30 ? 305  LEU A O     1 
ATOM   2316  C  CB    . LEU A 1 305 ? 43.743  17.058  -12.193 1.00 30.68 ? 305  LEU A CB    1 
ATOM   2317  C  CG    . LEU A 1 305 ? 43.889  15.664  -11.640 1.00 37.09 ? 305  LEU A CG    1 
ATOM   2318  C  CD1   . LEU A 1 305 ? 44.873  15.492  -10.479 1.00 28.88 ? 305  LEU A CD1   1 
ATOM   2319  C  CD2   . LEU A 1 305 ? 42.525  15.135  -11.245 1.00 31.89 ? 305  LEU A CD2   1 
ATOM   2320  N  N     . VAL A 1 306 ? 44.625  19.250  -14.392 1.00 31.72 ? 306  VAL A N     1 
ATOM   2321  C  CA    . VAL A 1 306 ? 45.192  19.704  -15.663 1.00 32.10 ? 306  VAL A CA    1 
ATOM   2322  C  C     . VAL A 1 306 ? 46.322  20.716  -15.450 1.00 30.92 ? 306  VAL A C     1 
ATOM   2323  O  O     . VAL A 1 306 ? 47.385  20.701  -16.067 1.00 31.02 ? 306  VAL A O     1 
ATOM   2324  C  CB    . VAL A 1 306 ? 44.098  20.343  -16.532 1.00 32.80 ? 306  VAL A CB    1 
ATOM   2325  C  CG1   . VAL A 1 306 ? 44.583  21.390  -17.512 1.00 32.45 ? 306  VAL A CG1   1 
ATOM   2326  C  CG2   . VAL A 1 306 ? 43.308  19.282  -17.267 1.00 30.38 ? 306  VAL A CG2   1 
ATOM   2327  N  N     . ARG A 1 307 ? 46.099  21.660  -14.556 1.00 30.73 ? 307  ARG A N     1 
ATOM   2328  C  CA    . ARG A 1 307 ? 47.075  22.693  -14.228 1.00 29.49 ? 307  ARG A CA    1 
ATOM   2329  C  C     . ARG A 1 307 ? 48.350  22.057  -13.728 1.00 30.12 ? 307  ARG A C     1 
ATOM   2330  O  O     . ARG A 1 307 ? 49.458  22.394  -14.151 1.00 32.60 ? 307  ARG A O     1 
ATOM   2331  C  CB    . ARG A 1 307 ? 46.407  23.679  -13.257 1.00 28.99 ? 307  ARG A CB    1 
ATOM   2332  C  CG    . ARG A 1 307 ? 47.177  24.969  -13.025 1.00 27.27 ? 307  ARG A CG    1 
ATOM   2333  C  CD    . ARG A 1 307 ? 46.906  25.628  -11.701 1.00 31.83 ? 307  ARG A CD    1 
ATOM   2334  N  NE    . ARG A 1 307 ? 47.398  25.105  -10.476 1.00 31.92 ? 307  ARG A NE    1 
ATOM   2335  C  CZ    . ARG A 1 307 ? 48.573  24.847  -9.917  1.00 30.29 ? 307  ARG A CZ    1 
ATOM   2336  N  NH1   . ARG A 1 307 ? 49.717  25.117  -10.518 1.00 25.14 ? 307  ARG A NH1   1 
ATOM   2337  N  NH2   . ARG A 1 307 ? 48.627  24.294  -8.697  1.00 23.05 ? 307  ARG A NH2   1 
ATOM   2338  N  N     . LEU A 1 308 ? 48.317  21.099  -12.813 1.00 29.32 ? 308  LEU A N     1 
ATOM   2339  C  CA    . LEU A 1 308 ? 49.461  20.357  -12.377 1.00 27.93 ? 308  LEU A CA    1 
ATOM   2340  C  C     . LEU A 1 308 ? 50.195  19.732  -13.522 1.00 29.56 ? 308  LEU A C     1 
ATOM   2341  O  O     . LEU A 1 308 ? 51.442  19.751  -13.530 1.00 31.56 ? 308  LEU A O     1 
ATOM   2342  C  CB    . LEU A 1 308 ? 49.026  19.290  -11.337 1.00 29.43 ? 308  LEU A CB    1 
ATOM   2343  C  CG    . LEU A 1 308 ? 48.576  20.021  -10.020 1.00 27.62 ? 308  LEU A CG    1 
ATOM   2344  C  CD1   . LEU A 1 308 ? 47.976  18.977  -9.086  1.00 26.17 ? 308  LEU A CD1   1 
ATOM   2345  C  CD2   . LEU A 1 308 ? 49.882  20.573  -9.472  1.00 24.32 ? 308  LEU A CD2   1 
ATOM   2346  N  N     . ILE A 1 309 ? 49.524  19.162  -14.499 1.00 30.49 ? 309  ILE A N     1 
ATOM   2347  C  CA    . ILE A 1 309 ? 50.195  18.539  -15.623 1.00 31.03 ? 309  ILE A CA    1 
ATOM   2348  C  C     . ILE A 1 309 ? 50.895  19.568  -16.497 1.00 32.66 ? 309  ILE A C     1 
ATOM   2349  O  O     . ILE A 1 309 ? 52.008  19.369  -16.992 1.00 34.13 ? 309  ILE A O     1 
ATOM   2350  C  CB    . ILE A 1 309 ? 49.177  17.765  -16.495 1.00 31.59 ? 309  ILE A CB    1 
ATOM   2351  C  CG1   . ILE A 1 309 ? 48.620  16.668  -15.625 1.00 29.37 ? 309  ILE A CG1   1 
ATOM   2352  C  CG2   . ILE A 1 309 ? 49.894  17.323  -17.775 1.00 24.38 ? 309  ILE A CG2   1 
ATOM   2353  C  CD1   . ILE A 1 309 ? 47.414  15.831  -15.976 1.00 29.21 ? 309  ILE A CD1   1 
ATOM   2354  N  N     . LEU A 1 310 ? 50.233  20.690  -16.705 1.00 33.51 ? 310  LEU A N     1 
ATOM   2355  C  CA    . LEU A 1 310 ? 50.770  21.802  -17.480 1.00 33.45 ? 310  LEU A CA    1 
ATOM   2356  C  C     . LEU A 1 310 ? 52.019  22.374  -16.806 1.00 32.18 ? 310  LEU A C     1 
ATOM   2357  O  O     . LEU A 1 310 ? 53.025  22.664  -17.488 1.00 31.84 ? 310  LEU A O     1 
ATOM   2358  C  CB    . LEU A 1 310 ? 49.678  22.860  -17.706 1.00 25.06 ? 310  LEU A CB    1 
ATOM   2359  C  CG    . LEU A 1 310 ? 48.372  22.390  -18.343 1.00 33.42 ? 310  LEU A CG    1 
ATOM   2360  C  CD1   . LEU A 1 310 ? 47.525  23.595  -18.741 1.00 32.00 ? 310  LEU A CD1   1 
ATOM   2361  C  CD2   . LEU A 1 310 ? 48.514  21.518  -19.564 1.00 25.30 ? 310  LEU A CD2   1 
ATOM   2362  N  N     . VAL A 1 311 ? 52.035  22.515  -15.487 1.00 31.10 ? 311  VAL A N     1 
ATOM   2363  C  CA    . VAL A 1 311 ? 53.267  23.060  -14.833 1.00 30.20 ? 311  VAL A CA    1 
ATOM   2364  C  C     . VAL A 1 311 ? 54.435  22.133  -15.059 1.00 31.51 ? 311  VAL A C     1 
ATOM   2365  O  O     . VAL A 1 311 ? 55.563  22.501  -15.436 1.00 31.91 ? 311  VAL A O     1 
ATOM   2366  C  CB    . VAL A 1 311 ? 52.961  23.196  -13.320 1.00 29.63 ? 311  VAL A CB    1 
ATOM   2367  C  CG1   . VAL A 1 311 ? 54.176  23.254  -12.427 1.00 23.73 ? 311  VAL A CG1   1 
ATOM   2368  C  CG2   . VAL A 1 311 ? 51.994  24.354  -13.170 1.00 23.30 ? 311  VAL A CG2   1 
ATOM   2369  N  N     . LYS A 1 312 ? 54.165  20.821  -14.888 1.00 31.61 ? 312  LYS A N     1 
ATOM   2370  C  CA    . LYS A 1 312 ? 55.299  19.898  -15.063 1.00 34.21 ? 312  LYS A CA    1 
ATOM   2371  C  C     . LYS A 1 312 ? 55.709  19.867  -16.526 1.00 36.18 ? 312  LYS A C     1 
ATOM   2372  O  O     . LYS A 1 312 ? 56.899  19.696  -16.788 1.00 36.86 ? 312  LYS A O     1 
ATOM   2373  C  CB    . LYS A 1 312 ? 55.042  18.548  -14.437 1.00 35.85 ? 312  LYS A CB    1 
ATOM   2374  C  CG    . LYS A 1 312 ? 56.092  17.461  -14.568 1.00 42.91 ? 312  LYS A CG    1 
ATOM   2375  C  CD    . LYS A 1 312 ? 56.093  16.468  -13.398 1.00 46.90 ? 312  LYS A CD    1 
ATOM   2376  C  CE    . LYS A 1 312 ? 57.117  16.816  -12.322 1.00 54.85 ? 312  LYS A CE    1 
ATOM   2377  N  NZ    . LYS A 1 312 ? 56.631  17.688  -11.205 1.00 51.65 ? 312  LYS A NZ    1 
ATOM   2378  N  N     . MET A 1 313 ? 54.754  19.847  -17.480 1.00 36.17 ? 313  MET A N     1 
ATOM   2379  C  CA    . MET A 1 313 ? 55.110  19.901  -18.899 1.00 35.64 ? 313  MET A CA    1 
ATOM   2380  C  C     . MET A 1 313 ? 55.830  21.192  -19.243 1.00 35.31 ? 313  MET A C     1 
ATOM   2381  O  O     . MET A 1 313 ? 56.862  21.195  -19.908 1.00 36.50 ? 313  MET A O     1 
ATOM   2382  C  CB    . MET A 1 313 ? 53.847  19.757  -19.767 1.00 34.07 ? 313  MET A CB    1 
ATOM   2383  C  CG    . MET A 1 313 ? 53.454  18.275  -19.840 1.00 33.89 ? 313  MET A CG    1 
ATOM   2384  S  SD    . MET A 1 313 ? 51.939  18.089  -20.806 1.00 38.94 ? 313  MET A SD    1 
ATOM   2385  C  CE    . MET A 1 313 ? 51.297  19.706  -20.529 1.00 46.59 ? 313  MET A CE    1 
ATOM   2386  N  N     . ALA A 1 314 ? 55.469  22.287  -18.600 1.00 34.38 ? 314  ALA A N     1 
ATOM   2387  C  CA    . ALA A 1 314 ? 56.156  23.543  -18.863 1.00 34.66 ? 314  ALA A CA    1 
ATOM   2388  C  C     . ALA A 1 314 ? 57.547  23.427  -18.291 1.00 36.00 ? 314  ALA A C     1 
ATOM   2389  O  O     . ALA A 1 314 ? 58.465  23.795  -19.011 1.00 35.00 ? 314  ALA A O     1 
ATOM   2390  C  CB    . ALA A 1 314 ? 55.399  24.746  -18.311 1.00 31.53 ? 314  ALA A CB    1 
ATOM   2391  N  N     . LYS A 1 315 ? 57.703  22.931  -17.054 1.00 37.87 ? 315  LYS A N     1 
ATOM   2392  C  CA    . LYS A 1 315 ? 59.062  22.810  -16.514 1.00 39.56 ? 315  LYS A CA    1 
ATOM   2393  C  C     . LYS A 1 315 ? 59.982  21.954  -17.387 1.00 40.33 ? 315  LYS A C     1 
ATOM   2394  O  O     . LYS A 1 315 ? 61.190  22.112  -17.238 1.00 40.20 ? 315  LYS A O     1 
ATOM   2395  C  CB    . LYS A 1 315 ? 59.157  22.209  -15.103 1.00 36.77 ? 315  LYS A CB    1 
ATOM   2396  C  CG    . LYS A 1 315 ? 58.665  23.239  -14.075 1.00 43.72 ? 315  LYS A CG    1 
ATOM   2397  C  CD    . LYS A 1 315 ? 58.306  22.542  -12.766 1.00 44.61 ? 315  LYS A CD    1 
ATOM   2398  C  CE    . LYS A 1 315 ? 57.713  23.488  -11.733 1.00 39.68 ? 315  LYS A CE    1 
ATOM   2399  N  NZ    . LYS A 1 315 ? 57.256  22.706  -10.523 1.00 47.26 ? 315  LYS A NZ    1 
ATOM   2400  N  N     . GLU A 1 316 ? 59.442  21.045  -18.173 1.00 40.41 ? 316  GLU A N     1 
ATOM   2401  C  CA    . GLU A 1 316 ? 60.296  20.152  -18.945 1.00 42.40 ? 316  GLU A CA    1 
ATOM   2402  C  C     . GLU A 1 316 ? 60.485  20.716  -20.338 1.00 43.32 ? 316  GLU A C     1 
ATOM   2403  O  O     . GLU A 1 316 ? 61.235  20.182  -21.153 1.00 44.49 ? 316  GLU A O     1 
ATOM   2404  C  CB    . GLU A 1 316 ? 59.657  18.740  -18.963 1.00 44.58 ? 316  GLU A CB    1 
ATOM   2405  C  CG    . GLU A 1 316 ? 59.962  17.941  -17.724 1.00 47.37 ? 316  GLU A CG    1 
ATOM   2406  C  CD    . GLU A 1 316 ? 59.147  16.783  -17.247 1.00 48.35 ? 316  GLU A CD    1 
ATOM   2407  O  OE1   . GLU A 1 316 ? 58.339  16.128  -17.925 1.00 46.86 ? 316  GLU A OE1   1 
ATOM   2408  O  OE2   . GLU A 1 316 ? 59.275  16.503  -16.027 1.00 49.67 ? 316  GLU A OE2   1 
ATOM   2409  N  N     . GLY A 1 317 ? 59.834  21.844  -20.639 1.00 42.74 ? 317  GLY A N     1 
ATOM   2410  C  CA    . GLY A 1 317 ? 59.993  22.437  -21.964 1.00 40.45 ? 317  GLY A CA    1 
ATOM   2411  C  C     . GLY A 1 317 ? 59.047  21.893  -23.004 1.00 38.64 ? 317  GLY A C     1 
ATOM   2412  O  O     . GLY A 1 317 ? 59.192  22.291  -24.158 1.00 39.37 ? 317  GLY A O     1 
ATOM   2413  N  N     . LEU A 1 318 ? 57.996  21.167  -22.676 1.00 38.46 ? 318  LEU A N     1 
ATOM   2414  C  CA    . LEU A 1 318 ? 57.087  20.611  -23.683 1.00 38.17 ? 318  LEU A CA    1 
ATOM   2415  C  C     . LEU A 1 318 ? 55.997  21.595  -24.072 1.00 37.14 ? 318  LEU A C     1 
ATOM   2416  O  O     . LEU A 1 318 ? 55.181  21.414  -24.974 1.00 36.04 ? 318  LEU A O     1 
ATOM   2417  C  CB    . LEU A 1 318 ? 56.359  19.396  -23.076 1.00 43.12 ? 318  LEU A CB    1 
ATOM   2418  C  CG    . LEU A 1 318 ? 57.158  18.200  -22.555 1.00 47.18 ? 318  LEU A CG    1 
ATOM   2419  C  CD1   . LEU A 1 318 ? 56.142  17.179  -22.011 1.00 48.83 ? 318  LEU A CD1   1 
ATOM   2420  C  CD2   . LEU A 1 318 ? 57.939  17.533  -23.686 1.00 44.56 ? 318  LEU A CD2   1 
ATOM   2421  N  N     . LEU A 1 319 ? 55.775  22.534  -23.127 1.00 36.52 ? 319  LEU A N     1 
ATOM   2422  C  CA    . LEU A 1 319 ? 54.723  23.550  -23.332 1.00 34.25 ? 319  LEU A CA    1 
ATOM   2423  C  C     . LEU A 1 319 ? 55.365  24.937  -23.150 1.00 33.01 ? 319  LEU A C     1 
ATOM   2424  O  O     . LEU A 1 319 ? 56.342  25.108  -22.396 1.00 30.95 ? 319  LEU A O     1 
ATOM   2425  C  CB    . LEU A 1 319 ? 53.593  23.380  -22.327 1.00 33.85 ? 319  LEU A CB    1 
ATOM   2426  C  CG    . LEU A 1 319 ? 52.666  22.178  -22.364 1.00 39.01 ? 319  LEU A CG    1 
ATOM   2427  C  CD1   . LEU A 1 319 ? 51.686  22.276  -21.170 1.00 33.03 ? 319  LEU A CD1   1 
ATOM   2428  C  CD2   . LEU A 1 319 ? 51.840  22.129  -23.653 1.00 39.34 ? 319  LEU A CD2   1 
ATOM   2429  N  N     . PHE A 1 320 ? 54.844  25.867  -23.956 1.00 31.70 ? 320  PHE A N     1 
ATOM   2430  C  CA    . PHE A 1 320 ? 55.271  27.254  -23.933 1.00 29.68 ? 320  PHE A CA    1 
ATOM   2431  C  C     . PHE A 1 320 ? 56.750  27.467  -24.161 1.00 31.43 ? 320  PHE A C     1 
ATOM   2432  O  O     . PHE A 1 320 ? 57.302  28.499  -23.714 1.00 33.16 ? 320  PHE A O     1 
ATOM   2433  C  CB    . PHE A 1 320 ? 54.815  27.801  -22.583 1.00 22.81 ? 320  PHE A CB    1 
ATOM   2434  C  CG    . PHE A 1 320 ? 53.498  27.247  -22.103 1.00 28.01 ? 320  PHE A CG    1 
ATOM   2435  C  CD1   . PHE A 1 320 ? 52.419  27.082  -22.968 1.00 23.53 ? 320  PHE A CD1   1 
ATOM   2436  C  CD2   . PHE A 1 320 ? 53.319  26.940  -20.769 1.00 24.44 ? 320  PHE A CD2   1 
ATOM   2437  C  CE1   . PHE A 1 320 ? 51.193  26.628  -22.527 1.00 25.51 ? 320  PHE A CE1   1 
ATOM   2438  C  CE2   . PHE A 1 320 ? 52.072  26.496  -20.321 1.00 31.74 ? 320  PHE A CE2   1 
ATOM   2439  C  CZ    . PHE A 1 320 ? 51.004  26.270  -21.188 1.00 27.59 ? 320  PHE A CZ    1 
ATOM   2440  N  N     . GLU A 1 321 ? 57.437  26.539  -24.809 1.00 30.85 ? 321  GLU A N     1 
ATOM   2441  C  CA    . GLU A 1 321 ? 58.885  26.583  -24.950 1.00 32.62 ? 321  GLU A CA    1 
ATOM   2442  C  C     . GLU A 1 321 ? 59.590  26.748  -23.601 1.00 32.49 ? 321  GLU A C     1 
ATOM   2443  O  O     . GLU A 1 321 ? 60.556  27.509  -23.508 1.00 32.30 ? 321  GLU A O     1 
ATOM   2444  C  CB    . GLU A 1 321 ? 59.349  27.719  -25.862 1.00 36.40 ? 321  GLU A CB    1 
ATOM   2445  C  CG    . GLU A 1 321 ? 58.742  27.661  -27.250 1.00 40.51 ? 321  GLU A CG    1 
ATOM   2446  C  CD    . GLU A 1 321 ? 58.949  28.976  -27.961 1.00 43.63 ? 321  GLU A CD    1 
ATOM   2447  O  OE1   . GLU A 1 321 ? 58.281  29.961  -27.605 1.00 50.96 ? 321  GLU A OE1   1 
ATOM   2448  O  OE2   . GLU A 1 321 ? 59.802  29.031  -28.866 1.00 52.99 ? 321  GLU A OE2   1 
ATOM   2449  N  N     . GLY A 1 322 ? 58.981  26.247  -22.543 1.00 33.06 ? 322  GLY A N     1 
ATOM   2450  C  CA    . GLY A 1 322 ? 59.521  26.275  -21.193 1.00 31.95 ? 322  GLY A CA    1 
ATOM   2451  C  C     . GLY A 1 322 ? 59.153  27.441  -20.315 1.00 32.46 ? 322  GLY A C     1 
ATOM   2452  O  O     . GLY A 1 322 ? 59.633  27.523  -19.173 1.00 32.54 ? 322  GLY A O     1 
ATOM   2453  N  N     . ARG A 1 323 ? 58.344  28.381  -20.809 1.00 33.40 ? 323  ARG A N     1 
ATOM   2454  C  CA    . ARG A 1 323 ? 57.995  29.555  -20.039 1.00 34.27 ? 323  ARG A CA    1 
ATOM   2455  C  C     . ARG A 1 323 ? 57.036  29.122  -18.951 1.00 35.63 ? 323  ARG A C     1 
ATOM   2456  O  O     . ARG A 1 323 ? 56.127  28.310  -19.186 1.00 37.25 ? 323  ARG A O     1 
ATOM   2457  C  CB    . ARG A 1 323 ? 57.349  30.686  -20.883 1.00 35.89 ? 323  ARG A CB    1 
ATOM   2458  C  CG    . ARG A 1 323 ? 58.262  31.317  -21.928 1.00 35.66 ? 323  ARG A CG    1 
ATOM   2459  C  CD    . ARG A 1 323 ? 57.628  32.513  -22.657 1.00 28.69 ? 323  ARG A CD    1 
ATOM   2460  N  NE    . ARG A 1 323 ? 56.470  32.089  -23.427 1.00 26.38 ? 323  ARG A NE    1 
ATOM   2461  C  CZ    . ARG A 1 323 ? 56.513  31.455  -24.592 1.00 26.66 ? 323  ARG A CZ    1 
ATOM   2462  N  NH1   . ARG A 1 323 ? 57.637  31.201  -25.244 1.00 25.77 ? 323  ARG A NH1   1 
ATOM   2463  N  NH2   . ARG A 1 323 ? 55.348  31.037  -25.056 1.00 28.72 ? 323  ARG A NH2   1 
ATOM   2464  N  N     . ILE A 1 324 ? 57.090  29.730  -17.801 1.00 35.24 ? 324  ILE A N     1 
ATOM   2465  C  CA    . ILE A 1 324 ? 56.159  29.359  -16.701 1.00 35.42 ? 324  ILE A CA    1 
ATOM   2466  C  C     . ILE A 1 324 ? 55.817  30.718  -16.103 1.00 35.98 ? 324  ILE A C     1 
ATOM   2467  O  O     . ILE A 1 324 ? 56.748  31.532  -15.898 1.00 36.96 ? 324  ILE A O     1 
ATOM   2468  C  CB    . ILE A 1 324 ? 57.052  28.590  -15.684 1.00 38.03 ? 324  ILE A CB    1 
ATOM   2469  C  CG1   . ILE A 1 324 ? 57.288  27.139  -16.158 1.00 41.12 ? 324  ILE A CG1   1 
ATOM   2470  C  CG2   . ILE A 1 324 ? 56.482  28.570  -14.293 1.00 34.58 ? 324  ILE A CG2   1 
ATOM   2471  C  CD1   . ILE A 1 324 ? 58.696  26.629  -15.875 1.00 34.53 ? 324  ILE A CD1   1 
ATOM   2472  N  N     . THR A 1 325 ? 54.556  31.016  -15.859 1.00 33.71 ? 325  THR A N     1 
ATOM   2473  C  CA    . THR A 1 325 ? 54.314  32.345  -15.272 1.00 31.65 ? 325  THR A CA    1 
ATOM   2474  C  C     . THR A 1 325 ? 53.854  32.068  -13.851 1.00 30.33 ? 325  THR A C     1 
ATOM   2475  O  O     . THR A 1 325 ? 53.497  30.947  -13.587 1.00 30.31 ? 325  THR A O     1 
ATOM   2476  C  CB    . THR A 1 325 ? 53.207  33.020  -16.121 1.00 33.46 ? 325  THR A CB    1 
ATOM   2477  O  OG1   . THR A 1 325 ? 52.039  32.229  -16.010 1.00 34.21 ? 325  THR A OG1   1 
ATOM   2478  C  CG2   . THR A 1 325 ? 53.559  33.031  -17.601 1.00 26.58 ? 325  THR A CG2   1 
ATOM   2479  N  N     . PRO A 1 326 ? 53.777  33.040  -12.989 1.00 31.48 ? 326  PRO A N     1 
ATOM   2480  C  CA    . PRO A 1 326 ? 53.193  32.929  -11.674 1.00 31.36 ? 326  PRO A CA    1 
ATOM   2481  C  C     . PRO A 1 326 ? 51.711  32.581  -11.706 1.00 32.39 ? 326  PRO A C     1 
ATOM   2482  O  O     . PRO A 1 326 ? 51.258  31.919  -10.761 1.00 32.29 ? 326  PRO A O     1 
ATOM   2483  C  CB    . PRO A 1 326 ? 53.364  34.328  -11.088 1.00 30.09 ? 326  PRO A CB    1 
ATOM   2484  C  CG    . PRO A 1 326 ? 53.555  35.220  -12.258 1.00 30.62 ? 326  PRO A CG    1 
ATOM   2485  C  CD    . PRO A 1 326 ? 54.391  34.410  -13.226 1.00 30.94 ? 326  PRO A CD    1 
ATOM   2486  N  N     . GLU A 1 327 ? 50.932  32.992  -12.700 1.00 33.27 ? 327  GLU A N     1 
ATOM   2487  C  CA    . GLU A 1 327 ? 49.543  32.518  -12.806 1.00 33.25 ? 327  GLU A CA    1 
ATOM   2488  C  C     . GLU A 1 327 ? 49.497  31.007  -13.046 1.00 32.63 ? 327  GLU A C     1 
ATOM   2489  O  O     . GLU A 1 327 ? 48.675  30.274  -12.563 1.00 32.53 ? 327  GLU A O     1 
ATOM   2490  C  CB    . GLU A 1 327 ? 48.782  33.184  -13.935 1.00 35.18 ? 327  GLU A CB    1 
ATOM   2491  C  CG    . GLU A 1 327 ? 48.589  34.668  -13.820 1.00 42.41 ? 327  GLU A CG    1 
ATOM   2492  C  CD    . GLU A 1 327 ? 49.751  35.483  -14.357 1.00 43.80 ? 327  GLU A CD    1 
ATOM   2493  O  OE1   . GLU A 1 327 ? 50.925  35.050  -14.415 1.00 44.77 ? 327  GLU A OE1   1 
ATOM   2494  O  OE2   . GLU A 1 327 ? 49.414  36.640  -14.695 1.00 48.73 ? 327  GLU A OE2   1 
ATOM   2495  N  N     . LEU A 1 328 ? 50.271  30.472  -13.980 1.00 32.92 ? 328  LEU A N     1 
ATOM   2496  C  CA    . LEU A 1 328 ? 50.260  29.048  -14.229 1.00 33.53 ? 328  LEU A CA    1 
ATOM   2497  C  C     . LEU A 1 328 ? 50.653  28.298  -12.956 1.00 33.55 ? 328  LEU A C     1 
ATOM   2498  O  O     . LEU A 1 328 ? 50.161  27.185  -12.758 1.00 34.53 ? 328  LEU A O     1 
ATOM   2499  C  CB    . LEU A 1 328 ? 51.204  28.708  -15.372 1.00 33.11 ? 328  LEU A CB    1 
ATOM   2500  C  CG    . LEU A 1 328 ? 51.176  27.222  -15.762 1.00 41.65 ? 328  LEU A CG    1 
ATOM   2501  C  CD1   . LEU A 1 328 ? 49.777  26.892  -16.283 1.00 40.01 ? 328  LEU A CD1   1 
ATOM   2502  C  CD2   . LEU A 1 328 ? 52.255  27.037  -16.829 1.00 40.42 ? 328  LEU A CD2   1 
ATOM   2503  N  N     . LEU A 1 329 ? 51.394  28.901  -12.043 1.00 31.87 ? 329  LEU A N     1 
ATOM   2504  C  CA    . LEU A 1 329 ? 51.806  28.227  -10.826 1.00 30.87 ? 329  LEU A CA    1 
ATOM   2505  C  C     . LEU A 1 329 ? 50.875  28.280  -9.635  1.00 29.61 ? 329  LEU A C     1 
ATOM   2506  O  O     . LEU A 1 329 ? 51.117  27.656  -8.606  1.00 31.15 ? 329  LEU A O     1 
ATOM   2507  C  CB    . LEU A 1 329 ? 53.190  28.680  -10.383 1.00 27.03 ? 329  LEU A CB    1 
ATOM   2508  C  CG    . LEU A 1 329 ? 54.403  28.300  -11.207 1.00 31.56 ? 329  LEU A CG    1 
ATOM   2509  C  CD1   . LEU A 1 329 ? 55.647  29.148  -10.829 1.00 27.89 ? 329  LEU A CD1   1 
ATOM   2510  C  CD2   . LEU A 1 329 ? 54.688  26.806  -11.190 1.00 23.04 ? 329  LEU A CD2   1 
ATOM   2511  N  N     . THR A 1 330 ? 49.803  28.995  -9.615  1.00 28.08 ? 330  THR A N     1 
ATOM   2512  C  CA    . THR A 1 330 ? 48.889  29.330  -8.577  1.00 27.41 ? 330  THR A CA    1 
ATOM   2513  C  C     . THR A 1 330 ? 47.681  28.390  -8.493  1.00 28.84 ? 330  THR A C     1 
ATOM   2514  O  O     . THR A 1 330 ? 46.919  28.241  -9.422  1.00 27.88 ? 330  THR A O     1 
ATOM   2515  C  CB    . THR A 1 330 ? 48.384  30.767  -8.844  1.00 23.00 ? 330  THR A CB    1 
ATOM   2516  O  OG1   . THR A 1 330 ? 49.459  31.674  -8.995  1.00 25.49 ? 330  THR A OG1   1 
ATOM   2517  C  CG2   . THR A 1 330 ? 47.396  31.318  -7.858  1.00 19.73 ? 330  THR A CG2   1 
ATOM   2518  N  N     . ARG A 1 331 ? 47.487  27.792  -7.321  1.00 28.79 ? 331  ARG A N     1 
ATOM   2519  C  CA    . ARG A 1 331 ? 46.369  26.967  -7.002  1.00 30.46 ? 331  ARG A CA    1 
ATOM   2520  C  C     . ARG A 1 331 ? 45.084  27.582  -7.600  1.00 31.56 ? 331  ARG A C     1 
ATOM   2521  O  O     . ARG A 1 331 ? 44.843  28.765  -7.364  1.00 29.98 ? 331  ARG A O     1 
ATOM   2522  C  CB    . ARG A 1 331 ? 46.201  26.910  -5.461  1.00 30.62 ? 331  ARG A CB    1 
ATOM   2523  C  CG    . ARG A 1 331 ? 45.213  25.820  -5.068  1.00 37.29 ? 331  ARG A CG    1 
ATOM   2524  C  CD    . ARG A 1 331 ? 44.796  25.878  -3.581  1.00 34.38 ? 331  ARG A CD    1 
ATOM   2525  N  NE    . ARG A 1 331 ? 44.299  24.481  -3.274  1.00 40.16 ? 331  ARG A NE    1 
ATOM   2526  C  CZ    . ARG A 1 331 ? 43.002  24.360  -2.977  1.00 32.35 ? 331  ARG A CZ    1 
ATOM   2527  N  NH1   . ARG A 1 331 ? 42.268  25.468  -3.025  1.00 39.65 ? 331  ARG A NH1   1 
ATOM   2528  N  NH2   . ARG A 1 331 ? 42.432  23.246  -2.655  1.00 39.07 ? 331  ARG A NH2   1 
ATOM   2529  N  N     . GLY A 1 332 ? 44.275  26.751  -8.289  1.00 31.40 ? 332  GLY A N     1 
ATOM   2530  C  CA    . GLY A 1 332 ? 42.949  27.248  -8.682  1.00 30.82 ? 332  GLY A CA    1 
ATOM   2531  C  C     . GLY A 1 332 ? 42.928  28.032  -9.983  1.00 32.83 ? 332  GLY A C     1 
ATOM   2532  O  O     . GLY A 1 332 ? 41.813  28.436  -10.304 1.00 31.29 ? 332  GLY A O     1 
ATOM   2533  N  N     . LYS A 1 333 ? 44.017  28.354  -10.690 1.00 33.00 ? 333  LYS A N     1 
ATOM   2534  C  CA    . LYS A 1 333 ? 43.843  29.300  -11.785 1.00 36.39 ? 333  LYS A CA    1 
ATOM   2535  C  C     . LYS A 1 333 ? 43.327  28.676  -13.083 1.00 38.29 ? 333  LYS A C     1 
ATOM   2536  O  O     . LYS A 1 333 ? 43.372  29.393  -14.097 1.00 38.87 ? 333  LYS A O     1 
ATOM   2537  C  CB    . LYS A 1 333 ? 45.158  30.042  -12.123 1.00 38.39 ? 333  LYS A CB    1 
ATOM   2538  C  CG    . LYS A 1 333 ? 45.484  31.173  -11.164 1.00 41.54 ? 333  LYS A CG    1 
ATOM   2539  C  CD    . LYS A 1 333 ? 44.607  32.377  -11.340 1.00 47.33 ? 333  LYS A CD    1 
ATOM   2540  C  CE    . LYS A 1 333 ? 45.308  33.548  -11.985 1.00 49.84 ? 333  LYS A CE    1 
ATOM   2541  N  NZ    . LYS A 1 333 ? 45.306  34.770  -11.114 1.00 53.18 ? 333  LYS A NZ    1 
ATOM   2542  N  N     . PHE A 1 334 ? 43.276  27.352  -13.191 1.00 37.39 ? 334  PHE A N     1 
ATOM   2543  C  CA    . PHE A 1 334 ? 42.757  26.700  -14.373 1.00 37.68 ? 334  PHE A CA    1 
ATOM   2544  C  C     . PHE A 1 334 ? 41.509  25.921  -13.981 1.00 37.93 ? 334  PHE A C     1 
ATOM   2545  O  O     . PHE A 1 334 ? 41.634  24.970  -13.191 1.00 39.48 ? 334  PHE A O     1 
ATOM   2546  C  CB    . PHE A 1 334 ? 43.864  25.874  -15.003 1.00 34.59 ? 334  PHE A CB    1 
ATOM   2547  C  CG    . PHE A 1 334 ? 43.567  25.401  -16.397 1.00 37.80 ? 334  PHE A CG    1 
ATOM   2548  C  CD1   . PHE A 1 334 ? 42.837  24.242  -16.599 1.00 36.55 ? 334  PHE A CD1   1 
ATOM   2549  C  CD2   . PHE A 1 334 ? 44.088  26.054  -17.507 1.00 34.55 ? 334  PHE A CD2   1 
ATOM   2550  C  CE1   . PHE A 1 334 ? 42.627  23.758  -17.881 1.00 38.41 ? 334  PHE A CE1   1 
ATOM   2551  C  CE2   . PHE A 1 334 ? 43.917  25.542  -18.777 1.00 35.50 ? 334  PHE A CE2   1 
ATOM   2552  C  CZ    . PHE A 1 334 ? 43.131  24.412  -18.979 1.00 33.86 ? 334  PHE A CZ    1 
ATOM   2553  N  N     . ASN A 1 335 ? 40.274  26.379  -14.173 1.00 38.04 ? 335  ASN A N     1 
ATOM   2554  C  CA    . ASN A 1 335 ? 39.216  25.558  -13.561 1.00 39.10 ? 335  ASN A CA    1 
ATOM   2555  C  C     . ASN A 1 335 ? 38.503  24.611  -14.494 1.00 37.48 ? 335  ASN A C     1 
ATOM   2556  O  O     . ASN A 1 335 ? 38.863  24.442  -15.662 1.00 36.69 ? 335  ASN A O     1 
ATOM   2557  C  CB    . ASN A 1 335 ? 38.325  26.262  -12.546 1.00 44.19 ? 335  ASN A CB    1 
ATOM   2558  C  CG    . ASN A 1 335 ? 37.605  27.319  -13.361 1.00 49.14 ? 335  ASN A CG    1 
ATOM   2559  O  OD1   . ASN A 1 335 ? 37.191  28.346  -12.837 1.00 54.31 ? 335  ASN A OD1   1 
ATOM   2560  N  ND2   . ASN A 1 335 ? 37.629  26.957  -14.645 1.00 50.72 ? 335  ASN A ND2   1 
ATOM   2561  N  N     . THR A 1 336 ? 37.654  23.782  -13.912 1.00 37.20 ? 336  THR A N     1 
ATOM   2562  C  CA    . THR A 1 336 ? 37.002  22.754  -14.664 1.00 38.21 ? 336  THR A CA    1 
ATOM   2563  C  C     . THR A 1 336 ? 36.099  23.320  -15.744 1.00 36.66 ? 336  THR A C     1 
ATOM   2564  O  O     . THR A 1 336 ? 36.124  22.777  -16.851 1.00 36.63 ? 336  THR A O     1 
ATOM   2565  C  CB    . THR A 1 336 ? 36.600  21.488  -13.975 1.00 39.19 ? 336  THR A CB    1 
ATOM   2566  O  OG1   . THR A 1 336 ? 35.220  21.353  -13.762 1.00 48.59 ? 336  THR A OG1   1 
ATOM   2567  C  CG2   . THR A 1 336 ? 37.396  21.120  -12.756 1.00 41.67 ? 336  THR A CG2   1 
ATOM   2568  N  N     . SER A 1 337 ? 35.652  24.553  -15.601 1.00 36.18 ? 337  SER A N     1 
ATOM   2569  C  CA    . SER A 1 337 ? 34.833  25.166  -16.662 1.00 37.59 ? 337  SER A CA    1 
ATOM   2570  C  C     . SER A 1 337 ? 35.778  25.662  -17.763 1.00 38.68 ? 337  SER A C     1 
ATOM   2571  O  O     . SER A 1 337 ? 35.371  25.676  -18.926 1.00 38.22 ? 337  SER A O     1 
ATOM   2572  C  CB    . SER A 1 337 ? 33.948  26.282  -16.098 1.00 32.87 ? 337  SER A CB    1 
ATOM   2573  O  OG    . SER A 1 337 ? 34.869  27.340  -15.823 1.00 40.25 ? 337  SER A OG    1 
ATOM   2574  N  N     . ASP A 1 338 ? 37.087  25.744  -17.442 1.00 38.28 ? 338  ASP A N     1 
ATOM   2575  C  CA    . ASP A 1 338 ? 38.089  25.974  -18.455 1.00 36.92 ? 338  ASP A CA    1 
ATOM   2576  C  C     . ASP A 1 338 ? 38.313  24.689  -19.238 1.00 37.21 ? 338  ASP A C     1 
ATOM   2577  O  O     . ASP A 1 338 ? 38.529  24.779  -20.455 1.00 39.02 ? 338  ASP A O     1 
ATOM   2578  C  CB    . ASP A 1 338 ? 39.415  26.532  -17.984 1.00 35.35 ? 338  ASP A CB    1 
ATOM   2579  C  CG    . ASP A 1 338 ? 39.364  27.890  -17.333 1.00 37.22 ? 338  ASP A CG    1 
ATOM   2580  O  OD1   . ASP A 1 338 ? 38.538  28.754  -17.654 1.00 37.41 ? 338  ASP A OD1   1 
ATOM   2581  O  OD2   . ASP A 1 338 ? 40.156  28.177  -16.405 1.00 39.89 ? 338  ASP A OD2   1 
ATOM   2582  N  N     . VAL A 1 339 ? 38.244  23.523  -18.604 1.00 35.17 ? 339  VAL A N     1 
ATOM   2583  C  CA    . VAL A 1 339 ? 38.446  22.257  -19.270 1.00 32.61 ? 339  VAL A CA    1 
ATOM   2584  C  C     . VAL A 1 339 ? 37.282  22.014  -20.240 1.00 33.02 ? 339  VAL A C     1 
ATOM   2585  O  O     . VAL A 1 339 ? 37.448  21.636  -21.397 1.00 34.49 ? 339  VAL A O     1 
ATOM   2586  C  CB    . VAL A 1 339 ? 38.538  21.063  -18.317 1.00 29.68 ? 339  VAL A CB    1 
ATOM   2587  C  CG1   . VAL A 1 339 ? 38.749  19.764  -19.075 1.00 24.47 ? 339  VAL A CG1   1 
ATOM   2588  C  CG2   . VAL A 1 339 ? 39.715  21.215  -17.364 1.00 27.99 ? 339  VAL A CG2   1 
ATOM   2589  N  N     . SER A 1 340 ? 36.107  22.362  -19.812 1.00 33.31 ? 340  SER A N     1 
ATOM   2590  C  CA    . SER A 1 340 ? 34.898  22.275  -20.623 1.00 35.54 ? 340  SER A CA    1 
ATOM   2591  C  C     . SER A 1 340 ? 35.001  23.146  -21.877 1.00 35.18 ? 340  SER A C     1 
ATOM   2592  O  O     . SER A 1 340 ? 34.688  22.668  -22.959 1.00 35.24 ? 340  SER A O     1 
ATOM   2593  C  CB    . SER A 1 340 ? 33.683  22.770  -19.794 1.00 31.18 ? 340  SER A CB    1 
ATOM   2594  O  OG    . SER A 1 340 ? 33.506  21.763  -18.788 1.00 39.74 ? 340  SER A OG    1 
ATOM   2595  N  N     . ALA A 1 341 ? 35.312  24.426  -21.675 1.00 34.20 ? 341  ALA A N     1 
ATOM   2596  C  CA    . ALA A 1 341 ? 35.336  25.342  -22.811 1.00 33.45 ? 341  ALA A CA    1 
ATOM   2597  C  C     . ALA A 1 341 ? 36.392  24.906  -23.800 1.00 33.22 ? 341  ALA A C     1 
ATOM   2598  O  O     . ALA A 1 341 ? 36.146  25.112  -24.985 1.00 35.83 ? 341  ALA A O     1 
ATOM   2599  C  CB    . ALA A 1 341 ? 35.574  26.772  -22.379 1.00 30.06 ? 341  ALA A CB    1 
ATOM   2600  N  N     . ILE A 1 342 ? 37.476  24.313  -23.398 1.00 32.72 ? 342  ILE A N     1 
ATOM   2601  C  CA    . ILE A 1 342 ? 38.549  23.947  -24.340 1.00 33.43 ? 342  ILE A CA    1 
ATOM   2602  C  C     . ILE A 1 342 ? 38.154  22.713  -25.138 1.00 35.06 ? 342  ILE A C     1 
ATOM   2603  O  O     . ILE A 1 342 ? 38.666  22.464  -26.237 1.00 35.77 ? 342  ILE A O     1 
ATOM   2604  C  CB    . ILE A 1 342 ? 39.854  23.682  -23.522 1.00 29.25 ? 342  ILE A CB    1 
ATOM   2605  C  CG1   . ILE A 1 342 ? 40.342  25.030  -23.001 1.00 24.62 ? 342  ILE A CG1   1 
ATOM   2606  C  CG2   . ILE A 1 342 ? 40.920  22.943  -24.324 1.00 19.55 ? 342  ILE A CG2   1 
ATOM   2607  C  CD1   . ILE A 1 342 ? 41.697  25.056  -22.304 1.00 33.50 ? 342  ILE A CD1   1 
ATOM   2608  N  N     . GLU A 1 343 ? 37.316  21.867  -24.522 1.00 36.17 ? 343  GLU A N     1 
ATOM   2609  C  CA    . GLU A 1 343 ? 36.927  20.631  -25.177 1.00 38.70 ? 343  GLU A CA    1 
ATOM   2610  C  C     . GLU A 1 343 ? 35.747  20.853  -26.120 1.00 39.24 ? 343  GLU A C     1 
ATOM   2611  O  O     . GLU A 1 343 ? 35.378  19.913  -26.809 1.00 39.83 ? 343  GLU A O     1 
ATOM   2612  C  CB    . GLU A 1 343 ? 36.597  19.519  -24.176 1.00 44.08 ? 343  GLU A CB    1 
ATOM   2613  C  CG    . GLU A 1 343 ? 37.865  18.898  -23.596 1.00 46.51 ? 343  GLU A CG    1 
ATOM   2614  C  CD    . GLU A 1 343 ? 37.556  17.667  -22.774 1.00 49.82 ? 343  GLU A CD    1 
ATOM   2615  O  OE1   . GLU A 1 343 ? 37.213  16.653  -23.422 1.00 52.06 ? 343  GLU A OE1   1 
ATOM   2616  O  OE2   . GLU A 1 343 ? 37.644  17.775  -21.529 1.00 48.56 ? 343  GLU A OE2   1 
ATOM   2617  N  N     . LYS A 1 344 ? 35.266  22.070  -26.253 1.00 39.28 ? 344  LYS A N     1 
ATOM   2618  C  CA    . LYS A 1 344 ? 34.229  22.370  -27.244 1.00 40.60 ? 344  LYS A CA    1 
ATOM   2619  C  C     . LYS A 1 344 ? 34.631  21.992  -28.644 1.00 41.88 ? 344  LYS A C     1 
ATOM   2620  O  O     . LYS A 1 344 ? 35.807  22.079  -29.031 1.00 43.78 ? 344  LYS A O     1 
ATOM   2621  C  CB    . LYS A 1 344 ? 33.847  23.849  -27.149 1.00 37.09 ? 344  LYS A CB    1 
ATOM   2622  C  CG    . LYS A 1 344 ? 32.397  24.014  -26.754 1.00 38.17 ? 344  LYS A CG    1 
ATOM   2623  C  CD    . LYS A 1 344 ? 32.236  24.321  -25.292 1.00 45.27 ? 344  LYS A CD    1 
ATOM   2624  C  CE    . LYS A 1 344 ? 30.816  24.776  -24.996 1.00 39.08 ? 344  LYS A CE    1 
ATOM   2625  N  NZ    . LYS A 1 344 ? 29.870  23.698  -25.462 1.00 49.24 ? 344  LYS A NZ    1 
ATOM   2626  N  N     . ASN A 1 345 ? 33.742  21.400  -29.416 1.00 43.36 ? 345  ASN A N     1 
ATOM   2627  C  CA    . ASN A 1 345 ? 33.980  20.966  -30.783 1.00 44.88 ? 345  ASN A CA    1 
ATOM   2628  C  C     . ASN A 1 345 ? 34.397  22.096  -31.722 1.00 45.79 ? 345  ASN A C     1 
ATOM   2629  O  O     . ASN A 1 345 ? 35.351  21.960  -32.478 1.00 45.67 ? 345  ASN A O     1 
ATOM   2630  C  CB    . ASN A 1 345 ? 32.640  20.486  -31.377 1.00 50.43 ? 345  ASN A CB    1 
ATOM   2631  C  CG    . ASN A 1 345 ? 31.834  19.670  -30.371 1.00 56.45 ? 345  ASN A CG    1 
ATOM   2632  O  OD1   . ASN A 1 345 ? 31.093  20.205  -29.510 1.00 56.28 ? 345  ASN A OD1   1 
ATOM   2633  N  ND2   . ASN A 1 345 ? 32.081  18.373  -30.555 1.00 52.99 ? 345  ASN A ND2   1 
ATOM   2634  N  N     . LYS A 1 346 ? 33.606  23.180  -31.782 1.00 46.61 ? 346  LYS A N     1 
ATOM   2635  C  CA    . LYS A 1 346 ? 33.997  24.173  -32.788 1.00 47.32 ? 346  LYS A CA    1 
ATOM   2636  C  C     . LYS A 1 346 ? 35.108  25.061  -32.202 1.00 45.06 ? 346  LYS A C     1 
ATOM   2637  O  O     . LYS A 1 346 ? 36.090  25.301  -32.868 1.00 44.20 ? 346  LYS A O     1 
ATOM   2638  C  CB    . LYS A 1 346 ? 32.888  25.104  -33.293 1.00 48.80 ? 346  LYS A CB    1 
ATOM   2639  C  CG    . LYS A 1 346 ? 31.669  24.437  -33.866 1.00 56.67 ? 346  LYS A CG    1 
ATOM   2640  C  CD    . LYS A 1 346 ? 31.994  23.391  -34.936 1.00 60.48 ? 346  LYS A CD    1 
ATOM   2641  C  CE    . LYS A 1 346 ? 30.725  22.582  -35.220 1.00 62.41 ? 346  LYS A CE    1 
ATOM   2642  N  NZ    . LYS A 1 346 ? 30.093  22.093  -33.944 1.00 64.64 ? 346  LYS A NZ    1 
ATOM   2643  N  N     . GLU A 1 347 ? 34.694  25.808  -31.214 1.00 43.82 ? 347  GLU A N     1 
ATOM   2644  C  CA    . GLU A 1 347 ? 35.343  26.849  -30.498 1.00 43.59 ? 347  GLU A CA    1 
ATOM   2645  C  C     . GLU A 1 347 ? 36.425  26.431  -29.502 1.00 42.53 ? 347  GLU A C     1 
ATOM   2646  O  O     . GLU A 1 347 ? 37.005  27.333  -28.886 1.00 43.37 ? 347  GLU A O     1 
ATOM   2647  C  CB    . GLU A 1 347 ? 34.240  27.595  -29.703 1.00 47.49 ? 347  GLU A CB    1 
ATOM   2648  C  CG    . GLU A 1 347 ? 33.466  28.597  -30.521 1.00 56.41 ? 347  GLU A CG    1 
ATOM   2649  C  CD    . GLU A 1 347 ? 34.321  29.293  -31.576 1.00 66.27 ? 347  GLU A CD    1 
ATOM   2650  O  OE1   . GLU A 1 347 ? 35.431  29.830  -31.302 1.00 65.23 ? 347  GLU A OE1   1 
ATOM   2651  O  OE2   . GLU A 1 347 ? 33.856  29.278  -32.757 1.00 69.84 ? 347  GLU A OE2   1 
ATOM   2652  N  N     . GLY A 1 348 ? 36.729  25.164  -29.310 1.00 40.00 ? 348  GLY A N     1 
ATOM   2653  C  CA    . GLY A 1 348 ? 37.716  24.697  -28.371 1.00 39.65 ? 348  GLY A CA    1 
ATOM   2654  C  C     . GLY A 1 348 ? 39.118  25.288  -28.428 1.00 38.18 ? 348  GLY A C     1 
ATOM   2655  O  O     . GLY A 1 348 ? 39.544  25.868  -27.430 1.00 36.92 ? 348  GLY A O     1 
ATOM   2656  N  N     . LEU A 1 349 ? 39.897  25.015  -29.459 1.00 37.22 ? 349  LEU A N     1 
ATOM   2657  C  CA    . LEU A 1 349 ? 41.212  25.594  -29.652 1.00 37.55 ? 349  LEU A CA    1 
ATOM   2658  C  C     . LEU A 1 349 ? 41.263  27.096  -29.487 1.00 37.92 ? 349  LEU A C     1 
ATOM   2659  O  O     . LEU A 1 349 ? 42.243  27.595  -28.979 1.00 36.38 ? 349  LEU A O     1 
ATOM   2660  C  CB    . LEU A 1 349 ? 41.705  25.264  -31.074 1.00 33.54 ? 349  LEU A CB    1 
ATOM   2661  C  CG    . LEU A 1 349 ? 41.957  23.753  -31.226 1.00 38.12 ? 349  LEU A CG    1 
ATOM   2662  C  CD1   . LEU A 1 349 ? 42.524  23.498  -32.632 1.00 38.07 ? 349  LEU A CD1   1 
ATOM   2663  C  CD2   . LEU A 1 349 ? 42.938  23.330  -30.131 1.00 30.87 ? 349  LEU A CD2   1 
ATOM   2664  N  N     . HIS A 1 350 ? 40.245  27.840  -29.904 1.00 39.54 ? 350  HIS A N     1 
ATOM   2665  C  CA    . HIS A 1 350 ? 40.149  29.266  -29.748 1.00 40.21 ? 350  HIS A CA    1 
ATOM   2666  C  C     . HIS A 1 350 ? 39.831  29.739  -28.327 1.00 40.68 ? 350  HIS A C     1 
ATOM   2667  O  O     . HIS A 1 350 ? 40.339  30.750  -27.781 1.00 40.30 ? 350  HIS A O     1 
ATOM   2668  C  CB    . HIS A 1 350 ? 39.158  29.855  -30.773 1.00 43.16 ? 350  HIS A CB    1 
ATOM   2669  C  CG    . HIS A 1 350 ? 38.934  31.295  -30.384 1.00 53.48 ? 350  HIS A CG    1 
ATOM   2670  N  ND1   . HIS A 1 350 ? 39.889  32.279  -30.643 1.00 54.13 ? 350  HIS A ND1   1 
ATOM   2671  C  CD2   . HIS A 1 350 ? 37.932  31.883  -29.689 1.00 55.02 ? 350  HIS A CD2   1 
ATOM   2672  C  CE1   . HIS A 1 350 ? 39.453  33.428  -30.162 1.00 55.40 ? 350  HIS A CE1   1 
ATOM   2673  N  NE2   . HIS A 1 350 ? 38.264  33.228  -29.600 1.00 59.47 ? 350  HIS A NE2   1 
ATOM   2674  N  N     . ASN A 1 351 ? 39.067  28.922  -27.609 1.00 39.41 ? 351  ASN A N     1 
ATOM   2675  C  CA    . ASN A 1 351 ? 38.882  29.071  -26.169 1.00 39.00 ? 351  ASN A CA    1 
ATOM   2676  C  C     . ASN A 1 351 ? 40.225  28.792  -25.432 1.00 36.25 ? 351  ASN A C     1 
ATOM   2677  O  O     . ASN A 1 351 ? 40.608  29.416  -24.445 1.00 34.98 ? 351  ASN A O     1 
ATOM   2678  C  CB    . ASN A 1 351 ? 37.857  28.011  -25.678 1.00 40.00 ? 351  ASN A CB    1 
ATOM   2679  C  CG    . ASN A 1 351 ? 36.422  28.409  -25.952 1.00 40.43 ? 351  ASN A CG    1 
ATOM   2680  O  OD1   . ASN A 1 351 ? 36.136  29.580  -26.219 1.00 41.26 ? 351  ASN A OD1   1 
ATOM   2681  N  ND2   . ASN A 1 351 ? 35.503  27.452  -25.821 1.00 32.14 ? 351  ASN A ND2   1 
ATOM   2682  N  N     . ALA A 1 352 ? 40.964  27.815  -25.895 1.00 34.25 ? 352  ALA A N     1 
ATOM   2683  C  CA    . ALA A 1 352 ? 42.257  27.498  -25.336 1.00 36.18 ? 352  ALA A CA    1 
ATOM   2684  C  C     . ALA A 1 352 ? 43.190  28.709  -25.446 1.00 37.62 ? 352  ALA A C     1 
ATOM   2685  O  O     . ALA A 1 352 ? 43.967  28.981  -24.523 1.00 38.48 ? 352  ALA A O     1 
ATOM   2686  C  CB    . ALA A 1 352 ? 42.887  26.296  -26.013 1.00 30.27 ? 352  ALA A CB    1 
ATOM   2687  N  N     . LYS A 1 353 ? 43.133  29.365  -26.612 1.00 38.65 ? 353  LYS A N     1 
ATOM   2688  C  CA    . LYS A 1 353 ? 43.954  30.538  -26.860 1.00 37.81 ? 353  LYS A CA    1 
ATOM   2689  C  C     . LYS A 1 353 ? 43.648  31.575  -25.791 1.00 36.67 ? 353  LYS A C     1 
ATOM   2690  O  O     . LYS A 1 353 ? 44.586  32.105  -25.261 1.00 37.42 ? 353  LYS A O     1 
ATOM   2691  C  CB    . LYS A 1 353 ? 43.708  31.180  -28.222 1.00 42.39 ? 353  LYS A CB    1 
ATOM   2692  C  CG    . LYS A 1 353 ? 44.806  32.058  -28.822 1.00 41.02 ? 353  LYS A CG    1 
ATOM   2693  C  CD    . LYS A 1 353 ? 45.608  31.232  -29.834 1.00 50.16 ? 353  LYS A CD    1 
ATOM   2694  C  CE    . LYS A 1 353 ? 47.075  31.675  -29.948 1.00 49.65 ? 353  LYS A CE    1 
ATOM   2695  N  NZ    . LYS A 1 353 ? 47.108  33.006  -30.660 1.00 52.80 ? 353  LYS A NZ    1 
ATOM   2696  N  N     . GLU A 1 354 ? 42.420  31.944  -25.541 1.00 37.41 ? 354  GLU A N     1 
ATOM   2697  C  CA    . GLU A 1 354 ? 42.096  33.070  -24.686 1.00 37.39 ? 354  GLU A CA    1 
ATOM   2698  C  C     . GLU A 1 354 ? 42.606  32.765  -23.272 1.00 36.00 ? 354  GLU A C     1 
ATOM   2699  O  O     . GLU A 1 354 ? 42.958  33.637  -22.523 1.00 35.86 ? 354  GLU A O     1 
ATOM   2700  C  CB    . GLU A 1 354 ? 40.619  33.427  -24.601 1.00 35.18 ? 354  GLU A CB    1 
ATOM   2701  C  CG    . GLU A 1 354 ? 39.856  34.113  -25.674 1.00 53.06 ? 354  GLU A CG    1 
ATOM   2702  C  CD    . GLU A 1 354 ? 39.380  35.518  -25.326 1.00 63.55 ? 354  GLU A CD    1 
ATOM   2703  O  OE1   . GLU A 1 354 ? 40.246  36.441  -25.274 1.00 66.58 ? 354  GLU A OE1   1 
ATOM   2704  O  OE2   . GLU A 1 354 ? 38.158  35.786  -25.149 1.00 67.36 ? 354  GLU A OE2   1 
ATOM   2705  N  N     . ILE A 1 355 ? 42.268  31.587  -22.809 1.00 35.95 ? 355  ILE A N     1 
ATOM   2706  C  CA    . ILE A 1 355 ? 42.419  31.105  -21.444 1.00 34.84 ? 355  ILE A CA    1 
ATOM   2707  C  C     . ILE A 1 355 ? 43.913  31.113  -21.128 1.00 33.72 ? 355  ILE A C     1 
ATOM   2708  O  O     . ILE A 1 355 ? 44.321  31.636  -20.118 1.00 31.50 ? 355  ILE A O     1 
ATOM   2709  C  CB    . ILE A 1 355 ? 41.778  29.700  -21.344 1.00 29.76 ? 355  ILE A CB    1 
ATOM   2710  C  CG1   . ILE A 1 355 ? 40.250  29.787  -21.224 1.00 30.01 ? 355  ILE A CG1   1 
ATOM   2711  C  CG2   . ILE A 1 355 ? 42.364  28.873  -20.222 1.00 27.30 ? 355  ILE A CG2   1 
ATOM   2712  C  CD1   . ILE A 1 355 ? 39.553  28.415  -21.346 1.00 28.56 ? 355  ILE A CD1   1 
ATOM   2713  N  N     . LEU A 1 356 ? 44.707  30.609  -22.075 1.00 34.57 ? 356  LEU A N     1 
ATOM   2714  C  CA    . LEU A 1 356 ? 46.148  30.486  -21.874 1.00 33.82 ? 356  LEU A CA    1 
ATOM   2715  C  C     . LEU A 1 356 ? 46.874  31.827  -21.928 1.00 35.46 ? 356  LEU A C     1 
ATOM   2716  O  O     . LEU A 1 356 ? 47.717  32.185  -21.080 1.00 36.43 ? 356  LEU A O     1 
ATOM   2717  C  CB    . LEU A 1 356 ? 46.682  29.461  -22.848 1.00 31.30 ? 356  LEU A CB    1 
ATOM   2718  C  CG    . LEU A 1 356 ? 46.358  27.983  -22.662 1.00 30.01 ? 356  LEU A CG    1 
ATOM   2719  C  CD1   . LEU A 1 356 ? 46.729  27.160  -23.878 1.00 34.27 ? 356  LEU A CD1   1 
ATOM   2720  C  CD2   . LEU A 1 356 ? 47.063  27.377  -21.452 1.00 36.30 ? 356  LEU A CD2   1 
ATOM   2721  N  N     . THR A 1 357 ? 46.417  32.731  -22.796 1.00 36.21 ? 357  THR A N     1 
ATOM   2722  C  CA    . THR A 1 357 ? 46.896  34.084  -22.877 1.00 35.50 ? 357  THR A CA    1 
ATOM   2723  C  C     . THR A 1 357 ? 46.631  34.847  -21.607 1.00 36.20 ? 357  THR A C     1 
ATOM   2724  O  O     . THR A 1 357 ? 47.531  35.555  -21.138 1.00 37.53 ? 357  THR A O     1 
ATOM   2725  C  CB    . THR A 1 357 ? 46.679  34.852  -24.159 1.00 34.60 ? 357  THR A CB    1 
ATOM   2726  O  OG1   . THR A 1 357 ? 46.016  36.108  -24.077 1.00 38.15 ? 357  THR A OG1   1 
ATOM   2727  C  CG2   . THR A 1 357 ? 46.304  34.080  -25.368 1.00 26.41 ? 357  THR A CG2   1 
ATOM   2728  N  N     . ARG A 1 358 ? 45.515  34.636  -20.933 1.00 36.76 ? 358  ARG A N     1 
ATOM   2729  C  CA    . ARG A 1 358 ? 45.278  35.246  -19.617 1.00 36.62 ? 358  ARG A CA    1 
ATOM   2730  C  C     . ARG A 1 358 ? 46.195  34.669  -18.536 1.00 35.34 ? 358  ARG A C     1 
ATOM   2731  O  O     . ARG A 1 358 ? 46.448  35.285  -17.487 1.00 34.01 ? 358  ARG A O     1 
ATOM   2732  C  CB    . ARG A 1 358 ? 43.817  35.088  -19.189 1.00 35.64 ? 358  ARG A CB    1 
ATOM   2733  C  CG    . ARG A 1 358 ? 42.870  35.943  -20.016 1.00 40.85 ? 358  ARG A CG    1 
ATOM   2734  C  CD    . ARG A 1 358 ? 41.501  35.946  -19.313 1.00 42.77 ? 358  ARG A CD    1 
ATOM   2735  N  NE    . ARG A 1 358 ? 40.554  35.224  -20.138 1.00 58.40 ? 358  ARG A NE    1 
ATOM   2736  C  CZ    . ARG A 1 358 ? 40.048  34.002  -19.979 1.00 59.63 ? 358  ARG A CZ    1 
ATOM   2737  N  NH1   . ARG A 1 358 ? 40.312  33.266  -18.889 1.00 58.14 ? 358  ARG A NH1   1 
ATOM   2738  N  NH2   . ARG A 1 358 ? 39.215  33.556  -20.928 1.00 55.57 ? 358  ARG A NH2   1 
ATOM   2739  N  N     . LEU A 1 359 ? 46.714  33.481  -18.802 1.00 34.02 ? 359  LEU A N     1 
ATOM   2740  C  CA    . LEU A 1 359 ? 47.721  32.940  -17.916 1.00 35.98 ? 359  LEU A CA    1 
ATOM   2741  C  C     . LEU A 1 359 ? 49.089  33.534  -18.194 1.00 36.40 ? 359  LEU A C     1 
ATOM   2742  O  O     . LEU A 1 359 ? 50.008  33.334  -17.396 1.00 37.79 ? 359  LEU A O     1 
ATOM   2743  C  CB    . LEU A 1 359 ? 47.669  31.422  -17.834 1.00 34.70 ? 359  LEU A CB    1 
ATOM   2744  C  CG    . LEU A 1 359 ? 46.333  30.798  -17.447 1.00 31.22 ? 359  LEU A CG    1 
ATOM   2745  C  CD1   . LEU A 1 359 ? 46.415  29.295  -17.523 1.00 28.33 ? 359  LEU A CD1   1 
ATOM   2746  C  CD2   . LEU A 1 359 ? 45.812  31.251  -16.103 1.00 34.55 ? 359  LEU A CD2   1 
ATOM   2747  N  N     . GLY A 1 360 ? 49.282  34.401  -19.180 1.00 35.82 ? 360  GLY A N     1 
ATOM   2748  C  CA    . GLY A 1 360 ? 50.558  35.086  -19.379 1.00 32.67 ? 360  GLY A CA    1 
ATOM   2749  C  C     . GLY A 1 360 ? 51.546  34.274  -20.200 1.00 31.66 ? 360  GLY A C     1 
ATOM   2750  O  O     . GLY A 1 360 ? 52.708  34.695  -20.396 1.00 32.54 ? 360  GLY A O     1 
ATOM   2751  N  N     . VAL A 1 361 ? 51.202  33.070  -20.610 1.00 29.22 ? 361  VAL A N     1 
ATOM   2752  C  CA    . VAL A 1 361 ? 52.125  32.206  -21.312 1.00 28.25 ? 361  VAL A CA    1 
ATOM   2753  C  C     . VAL A 1 361 ? 52.348  32.356  -22.803 1.00 28.41 ? 361  VAL A C     1 
ATOM   2754  O  O     . VAL A 1 361 ? 53.079  31.500  -23.346 1.00 27.78 ? 361  VAL A O     1 
ATOM   2755  C  CB    . VAL A 1 361 ? 51.839  30.724  -21.053 1.00 30.68 ? 361  VAL A CB    1 
ATOM   2756  C  CG1   . VAL A 1 361 ? 51.523  30.466  -19.592 1.00 27.11 ? 361  VAL A CG1   1 
ATOM   2757  C  CG2   . VAL A 1 361 ? 50.794  30.181  -22.031 1.00 30.57 ? 361  VAL A CG2   1 
ATOM   2758  N  N     . GLU A 1 362 ? 51.755  33.308  -23.484 1.00 28.71 ? 362  GLU A N     1 
ATOM   2759  C  CA    . GLU A 1 362 ? 51.971  33.537  -24.909 1.00 29.53 ? 362  GLU A CA    1 
ATOM   2760  C  C     . GLU A 1 362 ? 51.848  32.292  -25.745 1.00 30.07 ? 362  GLU A C     1 
ATOM   2761  O  O     . GLU A 1 362 ? 52.770  31.767  -26.366 1.00 29.44 ? 362  GLU A O     1 
ATOM   2762  C  CB    . GLU A 1 362 ? 53.382  34.153  -25.050 1.00 31.23 ? 362  GLU A CB    1 
ATOM   2763  C  CG    . GLU A 1 362 ? 53.304  35.526  -24.319 1.00 32.28 ? 362  GLU A CG    1 
ATOM   2764  C  CD    . GLU A 1 362 ? 54.662  36.165  -24.283 1.00 35.86 ? 362  GLU A CD    1 
ATOM   2765  O  OE1   . GLU A 1 362 ? 55.622  35.451  -24.002 1.00 36.48 ? 362  GLU A OE1   1 
ATOM   2766  O  OE2   . GLU A 1 362 ? 54.803  37.342  -24.701 1.00 42.45 ? 362  GLU A OE2   1 
ATOM   2767  N  N     . PRO A 1 363 ? 50.667  31.712  -25.672 1.00 31.11 ? 363  PRO A N     1 
ATOM   2768  C  CA    . PRO A 1 363 ? 50.474  30.355  -26.211 1.00 31.65 ? 363  PRO A CA    1 
ATOM   2769  C  C     . PRO A 1 363 ? 50.585  30.396  -27.735 1.00 32.71 ? 363  PRO A C     1 
ATOM   2770  O  O     . PRO A 1 363 ? 50.166  31.357  -28.356 1.00 32.19 ? 363  PRO A O     1 
ATOM   2771  C  CB    . PRO A 1 363 ? 49.074  30.018  -25.750 1.00 30.57 ? 363  PRO A CB    1 
ATOM   2772  C  CG    . PRO A 1 363 ? 48.437  31.356  -25.558 1.00 32.21 ? 363  PRO A CG    1 
ATOM   2773  C  CD    . PRO A 1 363 ? 49.484  32.256  -24.959 1.00 30.90 ? 363  PRO A CD    1 
ATOM   2774  N  N     . SER A 1 364 ? 51.247  29.434  -28.321 1.00 33.65 ? 364  SER A N     1 
ATOM   2775  C  CA    . SER A 1 364 ? 51.283  29.266  -29.776 1.00 36.50 ? 364  SER A CA    1 
ATOM   2776  C  C     . SER A 1 364 ? 50.134  28.302  -30.131 1.00 37.74 ? 364  SER A C     1 
ATOM   2777  O  O     . SER A 1 364 ? 49.604  27.672  -29.224 1.00 38.74 ? 364  SER A O     1 
ATOM   2778  C  CB    . SER A 1 364 ? 52.575  28.483  -30.098 1.00 31.77 ? 364  SER A CB    1 
ATOM   2779  O  OG    . SER A 1 364 ? 52.279  27.107  -29.671 1.00 42.80 ? 364  SER A OG    1 
ATOM   2780  N  N     . ASP A 1 365 ? 49.838  28.120  -31.397 1.00 39.53 ? 365  ASP A N     1 
ATOM   2781  C  CA    . ASP A 1 365 ? 48.790  27.181  -31.800 1.00 41.70 ? 365  ASP A CA    1 
ATOM   2782  C  C     . ASP A 1 365 ? 49.128  25.745  -31.461 1.00 40.26 ? 365  ASP A C     1 
ATOM   2783  O  O     . ASP A 1 365 ? 48.255  25.026  -30.981 1.00 41.13 ? 365  ASP A O     1 
ATOM   2784  C  CB    . ASP A 1 365 ? 48.387  27.339  -33.272 1.00 47.29 ? 365  ASP A CB    1 
ATOM   2785  C  CG    . ASP A 1 365 ? 47.777  28.708  -33.549 1.00 50.72 ? 365  ASP A CG    1 
ATOM   2786  O  OD1   . ASP A 1 365 ? 47.150  29.386  -32.694 1.00 55.84 ? 365  ASP A OD1   1 
ATOM   2787  O  OD2   . ASP A 1 365 ? 47.882  29.118  -34.722 1.00 52.72 ? 365  ASP A OD2   1 
ATOM   2788  N  N     . ASP A 1 366 ? 50.352  25.276  -31.580 1.00 40.43 ? 366  ASP A N     1 
ATOM   2789  C  CA    . ASP A 1 366 ? 50.711  23.977  -31.023 1.00 40.08 ? 366  ASP A CA    1 
ATOM   2790  C  C     . ASP A 1 366 ? 50.335  23.894  -29.539 1.00 39.76 ? 366  ASP A C     1 
ATOM   2791  O  O     . ASP A 1 366 ? 50.049  22.822  -29.037 1.00 40.21 ? 366  ASP A O     1 
ATOM   2792  C  CB    . ASP A 1 366 ? 52.250  23.826  -31.053 1.00 41.40 ? 366  ASP A CB    1 
ATOM   2793  C  CG    . ASP A 1 366 ? 52.699  23.333  -32.422 1.00 47.65 ? 366  ASP A CG    1 
ATOM   2794  O  OD1   . ASP A 1 366 ? 51.759  22.940  -33.146 1.00 45.30 ? 366  ASP A OD1   1 
ATOM   2795  O  OD2   . ASP A 1 366 ? 53.925  23.335  -32.713 1.00 50.93 ? 366  ASP A OD2   1 
ATOM   2796  N  N     . ASP A 1 367 ? 50.596  24.957  -28.757 1.00 39.12 ? 367  ASP A N     1 
ATOM   2797  C  CA    . ASP A 1 367 ? 50.345  24.884  -27.321 1.00 37.07 ? 367  ASP A CA    1 
ATOM   2798  C  C     . ASP A 1 367 ? 48.857  24.671  -27.060 1.00 34.34 ? 367  ASP A C     1 
ATOM   2799  O  O     . ASP A 1 367 ? 48.527  23.954  -26.121 1.00 35.10 ? 367  ASP A O     1 
ATOM   2800  C  CB    . ASP A 1 367 ? 50.812  26.119  -26.581 1.00 33.56 ? 367  ASP A CB    1 
ATOM   2801  C  CG    . ASP A 1 367 ? 52.278  26.287  -26.335 1.00 34.34 ? 367  ASP A CG    1 
ATOM   2802  O  OD1   . ASP A 1 367 ? 53.069  25.317  -26.270 1.00 34.00 ? 367  ASP A OD1   1 
ATOM   2803  O  OD2   . ASP A 1 367 ? 52.666  27.467  -26.170 1.00 30.11 ? 367  ASP A OD2   1 
ATOM   2804  N  N     . CYS A 1 368 ? 47.976  25.295  -27.799 1.00 33.05 ? 368  CYS A N     1 
ATOM   2805  C  CA    . CYS A 1 368 ? 46.546  25.091  -27.610 1.00 33.55 ? 368  CYS A CA    1 
ATOM   2806  C  C     . CYS A 1 368 ? 46.112  23.658  -27.896 1.00 33.93 ? 368  CYS A C     1 
ATOM   2807  O  O     . CYS A 1 368 ? 45.214  23.157  -27.220 1.00 32.05 ? 368  CYS A O     1 
ATOM   2808  C  CB    . CYS A 1 368 ? 45.723  26.093  -28.433 1.00 27.98 ? 368  CYS A CB    1 
ATOM   2809  S  SG    . CYS A 1 368 ? 46.158  27.854  -28.149 1.00 36.63 ? 368  CYS A SG    1 
ATOM   2810  N  N     . VAL A 1 369 ? 46.743  22.982  -28.874 1.00 35.51 ? 369  VAL A N     1 
ATOM   2811  C  CA    . VAL A 1 369 ? 46.286  21.643  -29.274 1.00 36.65 ? 369  VAL A CA    1 
ATOM   2812  C  C     . VAL A 1 369 ? 46.755  20.660  -28.183 1.00 37.61 ? 369  VAL A C     1 
ATOM   2813  O  O     . VAL A 1 369 ? 45.996  19.751  -27.798 1.00 36.22 ? 369  VAL A O     1 
ATOM   2814  C  CB    . VAL A 1 369 ? 46.900  21.276  -30.638 1.00 38.19 ? 369  VAL A CB    1 
ATOM   2815  C  CG1   . VAL A 1 369 ? 47.117  19.798  -30.861 1.00 38.88 ? 369  VAL A CG1   1 
ATOM   2816  C  CG2   . VAL A 1 369 ? 46.139  21.874  -31.816 1.00 39.43 ? 369  VAL A CG2   1 
ATOM   2817  N  N     . SER A 1 370 ? 47.977  20.925  -27.679 1.00 36.33 ? 370  SER A N     1 
ATOM   2818  C  CA    . SER A 1 370 ? 48.517  20.153  -26.573 1.00 35.82 ? 370  SER A CA    1 
ATOM   2819  C  C     . SER A 1 370 ? 47.686  20.207  -25.297 1.00 35.07 ? 370  SER A C     1 
ATOM   2820  O  O     . SER A 1 370 ? 47.383  19.153  -24.737 1.00 36.70 ? 370  SER A O     1 
ATOM   2821  C  CB    . SER A 1 370 ? 49.912  20.631  -26.227 1.00 33.50 ? 370  SER A CB    1 
ATOM   2822  O  OG    . SER A 1 370 ? 50.810  20.339  -27.287 1.00 37.69 ? 370  SER A OG    1 
ATOM   2823  N  N     . VAL A 1 371 ? 47.306  21.382  -24.862 1.00 34.07 ? 371  VAL A N     1 
ATOM   2824  C  CA    . VAL A 1 371 ? 46.474  21.583  -23.683 1.00 34.31 ? 371  VAL A CA    1 
ATOM   2825  C  C     . VAL A 1 371 ? 45.110  20.978  -23.892 1.00 35.78 ? 371  VAL A C     1 
ATOM   2826  O  O     . VAL A 1 371 ? 44.578  20.291  -23.021 1.00 38.02 ? 371  VAL A O     1 
ATOM   2827  C  CB    . VAL A 1 371 ? 46.400  23.099  -23.389 1.00 32.99 ? 371  VAL A CB    1 
ATOM   2828  C  CG1   . VAL A 1 371 ? 45.406  23.507  -22.308 1.00 25.07 ? 371  VAL A CG1   1 
ATOM   2829  C  CG2   . VAL A 1 371 ? 47.800  23.575  -22.969 1.00 31.38 ? 371  VAL A CG2   1 
ATOM   2830  N  N     . GLN A 1 372 ? 44.453  21.170  -25.038 1.00 35.80 ? 372  GLN A N     1 
ATOM   2831  C  CA    . GLN A 1 372 ? 43.154  20.542  -25.257 1.00 34.70 ? 372  GLN A CA    1 
ATOM   2832  C  C     . GLN A 1 372 ? 43.318  19.036  -25.035 1.00 34.10 ? 372  GLN A C     1 
ATOM   2833  O  O     . GLN A 1 372 ? 42.494  18.353  -24.468 1.00 33.40 ? 372  GLN A O     1 
ATOM   2834  C  CB    . GLN A 1 372 ? 42.705  20.728  -26.718 1.00 34.90 ? 372  GLN A CB    1 
ATOM   2835  C  CG    . GLN A 1 372 ? 41.261  20.188  -26.921 1.00 32.60 ? 372  GLN A CG    1 
ATOM   2836  C  CD    . GLN A 1 372 ? 40.811  20.647  -28.306 1.00 32.48 ? 372  GLN A CD    1 
ATOM   2837  O  OE1   . GLN A 1 372 ? 41.429  20.190  -29.241 1.00 29.39 ? 372  GLN A OE1   1 
ATOM   2838  N  NE2   . GLN A 1 372 ? 39.861  21.555  -28.377 1.00 30.60 ? 372  GLN A NE2   1 
ATOM   2839  N  N     . HIS A 1 373 ? 44.439  18.499  -25.540 1.00 33.80 ? 373  HIS A N     1 
ATOM   2840  C  CA    . HIS A 1 373 ? 44.610  17.068  -25.420 1.00 32.63 ? 373  HIS A CA    1 
ATOM   2841  C  C     . HIS A 1 373 ? 44.769  16.646  -23.982 1.00 33.42 ? 373  HIS A C     1 
ATOM   2842  O  O     . HIS A 1 373 ? 44.325  15.540  -23.655 1.00 32.91 ? 373  HIS A O     1 
ATOM   2843  C  CB    . HIS A 1 373 ? 45.621  16.527  -26.418 1.00 31.21 ? 373  HIS A CB    1 
ATOM   2844  C  CG    . HIS A 1 373 ? 45.532  15.038  -26.607 1.00 26.52 ? 373  HIS A CG    1 
ATOM   2845  N  ND1   . HIS A 1 373 ? 46.652  14.248  -26.416 1.00 29.28 ? 373  HIS A ND1   1 
ATOM   2846  C  CD2   . HIS A 1 373 ? 44.554  14.208  -26.972 1.00 26.76 ? 373  HIS A CD2   1 
ATOM   2847  C  CE1   . HIS A 1 373 ? 46.295  12.975  -26.586 1.00 28.22 ? 373  HIS A CE1   1 
ATOM   2848  N  NE2   . HIS A 1 373 ? 45.028  12.910  -26.897 1.00 25.80 ? 373  HIS A NE2   1 
ATOM   2849  N  N     . VAL A 1 374 ? 45.529  17.378  -23.153 1.00 33.66 ? 374  VAL A N     1 
ATOM   2850  C  CA    . VAL A 1 374 ? 45.642  16.973  -21.742 1.00 31.52 ? 374  VAL A CA    1 
ATOM   2851  C  C     . VAL A 1 374 ? 44.256  17.110  -21.119 1.00 32.35 ? 374  VAL A C     1 
ATOM   2852  O  O     . VAL A 1 374 ? 43.845  16.256  -20.322 1.00 32.88 ? 374  VAL A O     1 
ATOM   2853  C  CB    . VAL A 1 374 ? 46.573  17.971  -21.022 1.00 33.34 ? 374  VAL A CB    1 
ATOM   2854  C  CG1   . VAL A 1 374 ? 46.494  17.938  -19.508 1.00 21.81 ? 374  VAL A CG1   1 
ATOM   2855  C  CG2   . VAL A 1 374 ? 48.021  17.714  -21.452 1.00 28.55 ? 374  VAL A CG2   1 
ATOM   2856  N  N     . CYS A 1 375 ? 43.472  18.104  -21.521 1.00 31.36 ? 375  CYS A N     1 
ATOM   2857  C  CA    . CYS A 1 375 ? 42.148  18.249  -20.909 1.00 32.78 ? 375  CYS A CA    1 
ATOM   2858  C  C     . CYS A 1 375 ? 41.284  17.025  -21.239 1.00 35.26 ? 375  CYS A C     1 
ATOM   2859  O  O     . CYS A 1 375 ? 40.510  16.531  -20.422 1.00 36.87 ? 375  CYS A O     1 
ATOM   2860  C  CB    . CYS A 1 375 ? 41.406  19.484  -21.326 1.00 27.66 ? 375  CYS A CB    1 
ATOM   2861  S  SG    . CYS A 1 375 ? 41.979  21.109  -20.861 1.00 26.83 ? 375  CYS A SG    1 
ATOM   2862  N  N     . THR A 1 376 ? 41.328  16.603  -22.502 1.00 36.12 ? 376  THR A N     1 
ATOM   2863  C  CA    . THR A 1 376 ? 40.620  15.440  -22.962 1.00 35.62 ? 376  THR A CA    1 
ATOM   2864  C  C     . THR A 1 376 ? 41.117  14.198  -22.249 1.00 34.28 ? 376  THR A C     1 
ATOM   2865  O  O     . THR A 1 376 ? 40.260  13.423  -21.871 1.00 32.95 ? 376  THR A O     1 
ATOM   2866  C  CB    . THR A 1 376 ? 40.467  15.217  -24.459 1.00 40.43 ? 376  THR A CB    1 
ATOM   2867  O  OG1   . THR A 1 376 ? 40.872  13.935  -24.951 1.00 42.66 ? 376  THR A OG1   1 
ATOM   2868  C  CG2   . THR A 1 376 ? 40.861  16.294  -25.408 1.00 31.70 ? 376  THR A CG2   1 
ATOM   2869  N  N     . ILE A 1 377 ? 42.432  13.955  -22.063 1.00 35.04 ? 377  ILE A N     1 
ATOM   2870  C  CA    . ILE A 1 377 ? 42.760  12.754  -21.302 1.00 34.52 ? 377  ILE A CA    1 
ATOM   2871  C  C     . ILE A 1 377 ? 42.238  12.787  -19.860 1.00 34.22 ? 377  ILE A C     1 
ATOM   2872  O  O     . ILE A 1 377 ? 41.605  11.841  -19.377 1.00 36.26 ? 377  ILE A O     1 
ATOM   2873  C  CB    . ILE A 1 377 ? 44.062  12.064  -21.511 1.00 35.05 ? 377  ILE A CB    1 
ATOM   2874  C  CG1   . ILE A 1 377 ? 44.794  11.938  -20.143 1.00 32.55 ? 377  ILE A CG1   1 
ATOM   2875  C  CG2   . ILE A 1 377 ? 45.107  12.333  -22.572 1.00 33.11 ? 377  ILE A CG2   1 
ATOM   2876  C  CD1   . ILE A 1 377 ? 45.341  10.539  -20.059 1.00 33.28 ? 377  ILE A CD1   1 
ATOM   2877  N  N     . VAL A 1 378 ? 42.323  13.841  -19.084 1.00 33.98 ? 378  VAL A N     1 
ATOM   2878  C  CA    . VAL A 1 378 ? 41.923  14.007  -17.704 1.00 32.81 ? 378  VAL A CA    1 
ATOM   2879  C  C     . VAL A 1 378 ? 40.412  13.802  -17.539 1.00 32.48 ? 378  VAL A C     1 
ATOM   2880  O  O     . VAL A 1 378 ? 39.964  13.172  -16.570 1.00 32.49 ? 378  VAL A O     1 
ATOM   2881  C  CB    . VAL A 1 378 ? 42.315  15.332  -17.051 1.00 28.67 ? 378  VAL A CB    1 
ATOM   2882  C  CG1   . VAL A 1 378 ? 41.496  15.748  -15.837 1.00 23.46 ? 378  VAL A CG1   1 
ATOM   2883  C  CG2   . VAL A 1 378 ? 43.791  15.479  -16.695 1.00 25.16 ? 378  VAL A CG2   1 
ATOM   2884  N  N     . SER A 1 379 ? 39.616  14.430  -18.382 1.00 32.49 ? 379  SER A N     1 
ATOM   2885  C  CA    . SER A 1 379 ? 38.162  14.321  -18.250 1.00 31.37 ? 379  SER A CA    1 
ATOM   2886  C  C     . SER A 1 379 ? 37.650  12.955  -18.718 1.00 30.48 ? 379  SER A C     1 
ATOM   2887  O  O     . SER A 1 379 ? 36.625  12.500  -18.212 1.00 29.97 ? 379  SER A O     1 
ATOM   2888  C  CB    . SER A 1 379 ? 37.485  15.528  -18.897 1.00 33.42 ? 379  SER A CB    1 
ATOM   2889  O  OG    . SER A 1 379 ? 37.446  15.435  -20.316 1.00 33.72 ? 379  SER A OG    1 
ATOM   2890  N  N     . PHE A 1 380 ? 38.362  12.292  -19.615 1.00 30.48 ? 380  PHE A N     1 
ATOM   2891  C  CA    . PHE A 1 380 ? 37.988  11.008  -20.169 1.00 33.58 ? 380  PHE A CA    1 
ATOM   2892  C  C     . PHE A 1 380 ? 38.284  9.889   -19.133 1.00 34.22 ? 380  PHE A C     1 
ATOM   2893  O  O     . PHE A 1 380 ? 37.476  8.978   -18.918 1.00 32.65 ? 380  PHE A O     1 
ATOM   2894  C  CB    . PHE A 1 380 ? 38.749  10.740  -21.491 1.00 34.52 ? 380  PHE A CB    1 
ATOM   2895  C  CG    . PHE A 1 380 ? 38.013  9.835   -22.458 1.00 42.16 ? 380  PHE A CG    1 
ATOM   2896  C  CD1   . PHE A 1 380 ? 37.198  8.807   -22.026 1.00 42.64 ? 380  PHE A CD1   1 
ATOM   2897  C  CD2   . PHE A 1 380 ? 38.054  10.068  -23.829 1.00 41.87 ? 380  PHE A CD2   1 
ATOM   2898  C  CE1   . PHE A 1 380 ? 36.518  7.983   -22.918 1.00 42.33 ? 380  PHE A CE1   1 
ATOM   2899  C  CE2   . PHE A 1 380 ? 37.370  9.292   -24.736 1.00 42.29 ? 380  PHE A CE2   1 
ATOM   2900  C  CZ    . PHE A 1 380 ? 36.609  8.228   -24.277 1.00 45.55 ? 380  PHE A CZ    1 
ATOM   2901  N  N     . ARG A 1 381 ? 39.433  10.039  -18.450 1.00 32.88 ? 381  ARG A N     1 
ATOM   2902  C  CA    . ARG A 1 381 ? 39.724  9.164   -17.337 1.00 33.23 ? 381  ARG A CA    1 
ATOM   2903  C  C     . ARG A 1 381 ? 38.661  9.192   -16.238 1.00 31.03 ? 381  ARG A C     1 
ATOM   2904  O  O     . ARG A 1 381 ? 38.278  8.157   -15.727 1.00 30.99 ? 381  ARG A O     1 
ATOM   2905  C  CB    . ARG A 1 381 ? 41.088  9.512   -16.700 1.00 33.89 ? 381  ARG A CB    1 
ATOM   2906  C  CG    . ARG A 1 381 ? 41.368  8.524   -15.570 1.00 27.93 ? 381  ARG A CG    1 
ATOM   2907  C  CD    . ARG A 1 381 ? 42.721  8.865   -14.953 1.00 27.21 ? 381  ARG A CD    1 
ATOM   2908  N  NE    . ARG A 1 381 ? 42.513  10.119  -14.183 1.00 29.91 ? 381  ARG A NE    1 
ATOM   2909  C  CZ    . ARG A 1 381 ? 43.377  10.378  -13.185 1.00 27.09 ? 381  ARG A CZ    1 
ATOM   2910  N  NH1   . ARG A 1 381 ? 44.404  9.562   -12.926 1.00 28.46 ? 381  ARG A NH1   1 
ATOM   2911  N  NH2   . ARG A 1 381 ? 43.173  11.463  -12.497 1.00 28.00 ? 381  ARG A NH2   1 
ATOM   2912  N  N     . SER A 1 382 ? 38.134  10.348  -15.943 1.00 30.56 ? 382  SER A N     1 
ATOM   2913  C  CA    . SER A 1 382 ? 37.057  10.584  -15.006 1.00 31.93 ? 382  SER A CA    1 
ATOM   2914  C  C     . SER A 1 382 ? 35.781  9.880   -15.505 1.00 34.31 ? 382  SER A C     1 
ATOM   2915  O  O     . SER A 1 382 ? 35.222  9.140   -14.681 1.00 35.33 ? 382  SER A O     1 
ATOM   2916  C  CB    . SER A 1 382 ? 36.751  12.061  -14.836 1.00 25.79 ? 382  SER A CB    1 
ATOM   2917  O  OG    . SER A 1 382 ? 35.506  12.356  -14.189 1.00 23.79 ? 382  SER A OG    1 
ATOM   2918  N  N     . ALA A 1 383 ? 35.392  10.101  -16.774 1.00 33.38 ? 383  ALA A N     1 
ATOM   2919  C  CA    . ALA A 1 383 ? 34.230  9.432   -17.304 1.00 34.05 ? 383  ALA A CA    1 
ATOM   2920  C  C     . ALA A 1 383 ? 34.415  7.922   -17.327 1.00 34.27 ? 383  ALA A C     1 
ATOM   2921  O  O     . ALA A 1 383 ? 33.526  7.191   -16.867 1.00 34.31 ? 383  ALA A O     1 
ATOM   2922  C  CB    . ALA A 1 383 ? 33.795  10.012  -18.648 1.00 32.28 ? 383  ALA A CB    1 
ATOM   2923  N  N     . ASN A 1 384 ? 35.580  7.418   -17.706 1.00 34.36 ? 384  ASN A N     1 
ATOM   2924  C  CA    . ASN A 1 384 ? 35.832  5.983   -17.643 1.00 34.54 ? 384  ASN A CA    1 
ATOM   2925  C  C     . ASN A 1 384 ? 35.692  5.435   -16.220 1.00 35.73 ? 384  ASN A C     1 
ATOM   2926  O  O     . ASN A 1 384 ? 35.045  4.408   -16.025 1.00 37.53 ? 384  ASN A O     1 
ATOM   2927  C  CB    . ASN A 1 384 ? 37.231  5.683   -18.186 1.00 37.14 ? 384  ASN A CB    1 
ATOM   2928  C  CG    . ASN A 1 384 ? 37.255  5.786   -19.688 1.00 36.24 ? 384  ASN A CG    1 
ATOM   2929  O  OD1   . ASN A 1 384 ? 38.302  5.992   -20.274 1.00 38.29 ? 384  ASN A OD1   1 
ATOM   2930  N  ND2   . ASN A 1 384 ? 36.086  5.709   -20.301 1.00 37.59 ? 384  ASN A ND2   1 
ATOM   2931  N  N     . LEU A 1 385 ? 36.317  6.016   -15.214 1.00 33.92 ? 385  LEU A N     1 
ATOM   2932  C  CA    . LEU A 1 385 ? 36.153  5.655   -13.830 1.00 34.05 ? 385  LEU A CA    1 
ATOM   2933  C  C     . LEU A 1 385 ? 34.731  5.520   -13.320 1.00 33.27 ? 385  LEU A C     1 
ATOM   2934  O  O     . LEU A 1 385 ? 34.430  4.511   -12.654 1.00 33.66 ? 385  LEU A O     1 
ATOM   2935  C  CB    . LEU A 1 385 ? 36.950  6.615   -12.906 1.00 32.40 ? 385  LEU A CB    1 
ATOM   2936  C  CG    . LEU A 1 385 ? 38.475  6.349   -13.027 1.00 33.65 ? 385  LEU A CG    1 
ATOM   2937  C  CD1   . LEU A 1 385 ? 39.266  7.428   -12.367 1.00 29.58 ? 385  LEU A CD1   1 
ATOM   2938  C  CD2   . LEU A 1 385 ? 38.859  4.967   -12.541 1.00 34.88 ? 385  LEU A CD2   1 
ATOM   2939  N  N     . VAL A 1 386 ? 33.867  6.509   -13.451 1.00 32.47 ? 386  VAL A N     1 
ATOM   2940  C  CA    . VAL A 1 386 ? 32.488  6.388   -12.999 1.00 32.26 ? 386  VAL A CA    1 
ATOM   2941  C  C     . VAL A 1 386 ? 31.708  5.333   -13.751 1.00 31.05 ? 386  VAL A C     1 
ATOM   2942  O  O     . VAL A 1 386 ? 30.830  4.706   -13.185 1.00 29.66 ? 386  VAL A O     1 
ATOM   2943  C  CB    . VAL A 1 386 ? 31.823  7.755   -12.865 1.00 31.60 ? 386  VAL A CB    1 
ATOM   2944  C  CG1   . VAL A 1 386 ? 32.562  8.491   -11.703 1.00 27.35 ? 386  VAL A CG1   1 
ATOM   2945  C  CG2   . VAL A 1 386 ? 32.177  8.587   -14.082 1.00 35.78 ? 386  VAL A CG2   1 
ATOM   2946  N  N     . ALA A 1 387 ? 32.095  5.023   -14.973 1.00 31.50 ? 387  ALA A N     1 
ATOM   2947  C  CA    . ALA A 1 387 ? 31.477  3.952   -15.750 1.00 32.94 ? 387  ALA A CA    1 
ATOM   2948  C  C     . ALA A 1 387 ? 31.847  2.607   -15.112 1.00 33.13 ? 387  ALA A C     1 
ATOM   2949  O  O     . ALA A 1 387 ? 31.040  1.701   -15.111 1.00 34.30 ? 387  ALA A O     1 
ATOM   2950  C  CB    . ALA A 1 387 ? 32.100  3.965   -17.162 1.00 26.37 ? 387  ALA A CB    1 
ATOM   2951  N  N     . ALA A 1 388 ? 33.090  2.399   -14.715 1.00 32.51 ? 388  ALA A N     1 
ATOM   2952  C  CA    . ALA A 1 388 ? 33.493  1.210   -13.989 1.00 33.60 ? 388  ALA A CA    1 
ATOM   2953  C  C     . ALA A 1 388 ? 32.778  1.042   -12.655 1.00 33.92 ? 388  ALA A C     1 
ATOM   2954  O  O     . ALA A 1 388 ? 32.373  -0.083  -12.331 1.00 33.93 ? 388  ALA A O     1 
ATOM   2955  C  CB    . ALA A 1 388 ? 35.005  1.182   -13.785 1.00 31.02 ? 388  ALA A CB    1 
ATOM   2956  N  N     . THR A 1 389 ? 32.665  2.096   -11.830 1.00 33.17 ? 389  THR A N     1 
ATOM   2957  C  CA    . THR A 1 389 ? 31.991  1.861   -10.549 1.00 33.93 ? 389  THR A CA    1 
ATOM   2958  C  C     . THR A 1 389 ? 30.476  1.737   -10.727 1.00 35.45 ? 389  THR A C     1 
ATOM   2959  O  O     . THR A 1 389 ? 29.865  0.873   -10.101 1.00 34.32 ? 389  THR A O     1 
ATOM   2960  C  CB    . THR A 1 389 ? 32.353  2.947   -9.513  1.00 29.71 ? 389  THR A CB    1 
ATOM   2961  O  OG1   . THR A 1 389 ? 32.109  4.232   -10.086 1.00 31.18 ? 389  THR A OG1   1 
ATOM   2962  C  CG2   . THR A 1 389 ? 33.837  2.864   -9.165  1.00 32.13 ? 389  THR A CG2   1 
ATOM   2963  N  N     . LEU A 1 390 ? 29.855  2.504   -11.639 1.00 35.73 ? 390  LEU A N     1 
ATOM   2964  C  CA    . LEU A 1 390 ? 28.421  2.320   -11.878 1.00 37.78 ? 390  LEU A CA    1 
ATOM   2965  C  C     . LEU A 1 390 ? 28.237  0.895   -12.439 1.00 38.02 ? 390  LEU A C     1 
ATOM   2966  O  O     . LEU A 1 390 ? 27.274  0.237   -12.078 1.00 36.90 ? 390  LEU A O     1 
ATOM   2967  C  CB    . LEU A 1 390 ? 27.899  3.327   -12.889 1.00 39.40 ? 390  LEU A CB    1 
ATOM   2968  C  CG    . LEU A 1 390 ? 26.464  3.745   -13.076 1.00 41.60 ? 390  LEU A CG    1 
ATOM   2969  C  CD1   . LEU A 1 390 ? 26.017  3.580   -14.508 1.00 40.60 ? 390  LEU A CD1   1 
ATOM   2970  C  CD2   . LEU A 1 390 ? 25.454  3.316   -12.035 1.00 37.79 ? 390  LEU A CD2   1 
ATOM   2971  N  N     . GLY A 1 391 ? 29.141  0.480   -13.322 1.00 37.79 ? 391  GLY A N     1 
ATOM   2972  C  CA    . GLY A 1 391 ? 29.081  -0.869  -13.884 1.00 36.71 ? 391  GLY A CA    1 
ATOM   2973  C  C     . GLY A 1 391 ? 28.941  -1.905  -12.772 1.00 37.30 ? 391  GLY A C     1 
ATOM   2974  O  O     . GLY A 1 391 ? 28.140  -2.829  -12.867 1.00 36.17 ? 391  GLY A O     1 
ATOM   2975  N  N     . ALA A 1 392 ? 29.596  -1.658  -11.625 1.00 38.08 ? 392  ALA A N     1 
ATOM   2976  C  CA    . ALA A 1 392 ? 29.560  -2.614  -10.525 1.00 37.82 ? 392  ALA A CA    1 
ATOM   2977  C  C     . ALA A 1 392 ? 28.201  -2.601  -9.842  1.00 37.62 ? 392  ALA A C     1 
ATOM   2978  O  O     . ALA A 1 392 ? 27.720  -3.667  -9.447  1.00 37.51 ? 392  ALA A O     1 
ATOM   2979  C  CB    . ALA A 1 392 ? 30.662  -2.391  -9.503  1.00 32.47 ? 392  ALA A CB    1 
ATOM   2980  N  N     . ILE A 1 393 ? 27.661  -1.409  -9.649  1.00 36.76 ? 393  ILE A N     1 
ATOM   2981  C  CA    . ILE A 1 393 ? 26.341  -1.261  -9.069  1.00 36.34 ? 393  ILE A CA    1 
ATOM   2982  C  C     . ILE A 1 393 ? 25.279  -1.844  -9.985  1.00 37.70 ? 393  ILE A C     1 
ATOM   2983  O  O     . ILE A 1 393 ? 24.235  -2.255  -9.477  1.00 38.62 ? 393  ILE A O     1 
ATOM   2984  C  CB    . ILE A 1 393 ? 26.004  0.210   -8.879  1.00 35.60 ? 393  ILE A CB    1 
ATOM   2985  C  CG1   . ILE A 1 393 ? 26.800  0.908   -7.760  1.00 34.13 ? 393  ILE A CG1   1 
ATOM   2986  C  CG2   . ILE A 1 393 ? 24.507  0.446   -8.765  1.00 31.33 ? 393  ILE A CG2   1 
ATOM   2987  C  CD1   . ILE A 1 393 ? 26.326  2.363   -7.608  1.00 30.19 ? 393  ILE A CD1   1 
ATOM   2988  N  N     . LEU A 1 394 ? 25.433  -1.766  -11.304 1.00 38.29 ? 394  LEU A N     1 
ATOM   2989  C  CA    . LEU A 1 394 ? 24.430  -2.312  -12.221 1.00 37.86 ? 394  LEU A CA    1 
ATOM   2990  C  C     . LEU A 1 394 ? 24.462  -3.851  -12.210 1.00 37.26 ? 394  LEU A C     1 
ATOM   2991  O  O     . LEU A 1 394 ? 23.425  -4.522  -12.302 1.00 37.80 ? 394  LEU A O     1 
ATOM   2992  C  CB    . LEU A 1 394 ? 24.490  -1.712  -13.623 1.00 29.14 ? 394  LEU A CB    1 
ATOM   2993  C  CG    . LEU A 1 394 ? 24.157  -0.275  -13.882 1.00 32.03 ? 394  LEU A CG    1 
ATOM   2994  C  CD1   . LEU A 1 394 ? 24.467  0.234   -15.272 1.00 32.04 ? 394  LEU A CD1   1 
ATOM   2995  C  CD2   . LEU A 1 394 ? 22.785  0.210   -13.518 1.00 32.16 ? 394  LEU A CD2   1 
ATOM   2996  N  N     . ASN A 1 395 ? 25.614  -4.477  -12.203 1.00 36.40 ? 395  ASN A N     1 
ATOM   2997  C  CA    . ASN A 1 395 ? 25.800  -5.895  -12.136 1.00 37.66 ? 395  ASN A CA    1 
ATOM   2998  C  C     . ASN A 1 395 ? 25.229  -6.440  -10.821 1.00 39.30 ? 395  ASN A C     1 
ATOM   2999  O  O     . ASN A 1 395 ? 24.729  -7.574  -10.800 1.00 39.65 ? 395  ASN A O     1 
ATOM   3000  C  CB    . ASN A 1 395 ? 27.243  -6.403  -12.246 1.00 34.35 ? 395  ASN A CB    1 
ATOM   3001  C  CG    . ASN A 1 395 ? 27.752  -6.231  -13.660 1.00 37.99 ? 395  ASN A CG    1 
ATOM   3002  O  OD1   . ASN A 1 395 ? 26.910  -6.240  -14.560 1.00 41.06 ? 395  ASN A OD1   1 
ATOM   3003  N  ND2   . ASN A 1 395 ? 29.018  -5.954  -13.889 1.00 39.69 ? 395  ASN A ND2   1 
ATOM   3004  N  N     . ARG A 1 396 ? 25.358  -5.624  -9.774  1.00 39.18 ? 396  ARG A N     1 
ATOM   3005  C  CA    . ARG A 1 396 ? 24.817  -6.058  -8.497  1.00 40.04 ? 396  ARG A CA    1 
ATOM   3006  C  C     . ARG A 1 396 ? 23.292  -6.132  -8.629  1.00 41.02 ? 396  ARG A C     1 
ATOM   3007  O  O     . ARG A 1 396 ? 22.651  -7.122  -8.323  1.00 40.22 ? 396  ARG A O     1 
ATOM   3008  C  CB    . ARG A 1 396 ? 25.323  -5.194  -7.375  1.00 36.27 ? 396  ARG A CB    1 
ATOM   3009  C  CG    . ARG A 1 396 ? 24.326  -4.856  -6.306  1.00 47.03 ? 396  ARG A CG    1 
ATOM   3010  C  CD    . ARG A 1 396 ? 24.245  -5.914  -5.212  1.00 49.89 ? 396  ARG A CD    1 
ATOM   3011  N  NE    . ARG A 1 396 ? 25.537  -6.078  -4.558  1.00 56.64 ? 396  ARG A NE    1 
ATOM   3012  C  CZ    . ARG A 1 396 ? 25.780  -6.815  -3.466  1.00 55.77 ? 396  ARG A CZ    1 
ATOM   3013  N  NH1   . ARG A 1 396 ? 24.755  -7.462  -2.913  1.00 50.35 ? 396  ARG A NH1   1 
ATOM   3014  N  NH2   . ARG A 1 396 ? 27.048  -6.853  -3.052  1.00 47.65 ? 396  ARG A NH2   1 
ATOM   3015  N  N     . LEU A 1 397 ? 22.705  -5.083  -9.152  1.00 41.98 ? 397  LEU A N     1 
ATOM   3016  C  CA    . LEU A 1 397 ? 21.299  -4.989  -9.450  1.00 44.05 ? 397  LEU A CA    1 
ATOM   3017  C  C     . LEU A 1 397 ? 20.836  -6.149  -10.333 1.00 45.51 ? 397  LEU A C     1 
ATOM   3018  O  O     . LEU A 1 397 ? 19.869  -6.859  -10.005 1.00 46.56 ? 397  LEU A O     1 
ATOM   3019  C  CB    . LEU A 1 397 ? 21.078  -3.637  -10.112 1.00 41.65 ? 397  LEU A CB    1 
ATOM   3020  C  CG    . LEU A 1 397 ? 20.756  -2.433  -9.247  1.00 38.98 ? 397  LEU A CG    1 
ATOM   3021  C  CD1   . LEU A 1 397 ? 20.412  -1.245  -10.156 1.00 41.39 ? 397  LEU A CD1   1 
ATOM   3022  C  CD2   . LEU A 1 397 ? 19.569  -2.691  -8.337  1.00 37.71 ? 397  LEU A CD2   1 
ATOM   3023  N  N     . ARG A 1 398 ? 21.586  -6.465  -11.381 1.00 46.04 ? 398  ARG A N     1 
ATOM   3024  C  CA    . ARG A 1 398 ? 21.210  -7.612  -12.208 1.00 46.82 ? 398  ARG A CA    1 
ATOM   3025  C  C     . ARG A 1 398 ? 21.280  -8.879  -11.361 1.00 48.22 ? 398  ARG A C     1 
ATOM   3026  O  O     . ARG A 1 398 ? 20.421  -9.760  -11.483 1.00 48.71 ? 398  ARG A O     1 
ATOM   3027  C  CB    . ARG A 1 398 ? 22.078  -7.714  -13.438 1.00 43.01 ? 398  ARG A CB    1 
ATOM   3028  C  CG    . ARG A 1 398 ? 21.844  -8.889  -14.350 1.00 46.38 ? 398  ARG A CG    1 
ATOM   3029  C  CD    . ARG A 1 398 ? 22.717  -8.915  -15.580 1.00 50.49 ? 398  ARG A CD    1 
ATOM   3030  N  NE    . ARG A 1 398 ? 24.069  -9.457  -15.396 1.00 60.05 ? 398  ARG A NE    1 
ATOM   3031  C  CZ    . ARG A 1 398 ? 24.273  -10.766 -15.585 1.00 65.11 ? 398  ARG A CZ    1 
ATOM   3032  N  NH1   . ARG A 1 398 ? 23.221  -11.536 -15.901 1.00 68.30 ? 398  ARG A NH1   1 
ATOM   3033  N  NH2   . ARG A 1 398 ? 25.469  -11.331 -15.472 1.00 66.56 ? 398  ARG A NH2   1 
ATOM   3034  N  N     . ASP A 1 399 ? 22.322  -9.031  -10.548 1.00 48.96 ? 399  ASP A N     1 
ATOM   3035  C  CA    . ASP A 1 399 ? 22.407  -10.256 -9.750  1.00 49.58 ? 399  ASP A CA    1 
ATOM   3036  C  C     . ASP A 1 399 ? 21.389  -10.331 -8.664  1.00 50.10 ? 399  ASP A C     1 
ATOM   3037  O  O     . ASP A 1 399 ? 20.685  -11.364 -8.587  1.00 50.77 ? 399  ASP A O     1 
ATOM   3038  C  CB    . ASP A 1 399 ? 23.817  -10.783 -9.709  1.00 55.15 ? 399  ASP A CB    1 
ATOM   3039  C  CG    . ASP A 1 399 ? 24.239  -10.983 -11.189 1.00 63.34 ? 399  ASP A CG    1 
ATOM   3040  O  OD1   . ASP A 1 399 ? 23.866  -12.014 -11.805 1.00 61.41 ? 399  ASP A OD1   1 
ATOM   3041  O  OD2   . ASP A 1 399 ? 24.883  -10.098 -11.817 1.00 66.50 ? 399  ASP A OD2   1 
ATOM   3042  N  N     . ASN A 1 400 ? 20.846  -9.219  -8.148  1.00 49.23 ? 400  ASN A N     1 
ATOM   3043  C  CA    . ASN A 1 400 ? 19.743  -9.326  -7.195  1.00 49.23 ? 400  ASN A CA    1 
ATOM   3044  C  C     . ASN A 1 400 ? 18.453  -9.663  -7.934  1.00 50.23 ? 400  ASN A C     1 
ATOM   3045  O  O     . ASN A 1 400 ? 17.596  -10.375 -7.404  1.00 50.69 ? 400  ASN A O     1 
ATOM   3046  C  CB    . ASN A 1 400 ? 19.576  -8.172  -6.232  1.00 43.44 ? 400  ASN A CB    1 
ATOM   3047  C  CG    . ASN A 1 400 ? 20.697  -7.870  -5.264  1.00 41.74 ? 400  ASN A CG    1 
ATOM   3048  O  OD1   . ASN A 1 400 ? 20.814  -6.739  -4.764  1.00 43.30 ? 400  ASN A OD1   1 
ATOM   3049  N  ND2   . ASN A 1 400 ? 21.583  -8.788  -4.946  1.00 32.36 ? 400  ASN A ND2   1 
ATOM   3050  N  N     . LYS A 1 401 ? 18.277  -9.188  -9.175  1.00 51.13 ? 401  LYS A N     1 
ATOM   3051  C  CA    . LYS A 1 401 ? 17.064  -9.594  -9.887  1.00 51.14 ? 401  LYS A CA    1 
ATOM   3052  C  C     . LYS A 1 401 ? 17.095  -11.056 -10.293 1.00 51.74 ? 401  LYS A C     1 
ATOM   3053  O  O     . LYS A 1 401 ? 16.054  -11.698 -10.394 1.00 52.53 ? 401  LYS A O     1 
ATOM   3054  C  CB    . LYS A 1 401 ? 16.670  -8.697  -11.023 1.00 46.03 ? 401  LYS A CB    1 
ATOM   3055  C  CG    . LYS A 1 401 ? 17.047  -7.253  -11.026 1.00 47.27 ? 401  LYS A CG    1 
ATOM   3056  C  CD    . LYS A 1 401 ? 16.012  -6.301  -10.500 1.00 49.62 ? 401  LYS A CD    1 
ATOM   3057  C  CE    . LYS A 1 401 ? 16.374  -4.841  -10.688 1.00 52.16 ? 401  LYS A CE    1 
ATOM   3058  N  NZ    . LYS A 1 401 ? 15.488  -4.207  -11.718 1.00 55.32 ? 401  LYS A NZ    1 
ATOM   3059  N  N     . GLY A 1 402 ? 18.222  -11.653 -10.642 1.00 53.41 ? 402  GLY A N     1 
ATOM   3060  C  CA    . GLY A 1 402 ? 18.248  -13.017 -11.150 1.00 53.65 ? 402  GLY A CA    1 
ATOM   3061  C  C     . GLY A 1 402 ? 17.903  -13.191 -12.617 1.00 53.57 ? 402  GLY A C     1 
ATOM   3062  O  O     . GLY A 1 402 ? 17.814  -14.329 -13.083 1.00 54.51 ? 402  GLY A O     1 
ATOM   3063  N  N     . THR A 1 403 ? 17.869  -12.152 -13.429 1.00 53.57 ? 403  THR A N     1 
ATOM   3064  C  CA    . THR A 1 403 ? 17.684  -12.212 -14.875 1.00 52.93 ? 403  THR A CA    1 
ATOM   3065  C  C     . THR A 1 403 ? 18.997  -12.256 -15.639 1.00 52.02 ? 403  THR A C     1 
ATOM   3066  O  O     . THR A 1 403 ? 20.092  -12.085 -15.095 1.00 53.16 ? 403  THR A O     1 
ATOM   3067  C  CB    . THR A 1 403 ? 16.939  -10.923 -15.300 1.00 54.63 ? 403  THR A CB    1 
ATOM   3068  O  OG1   . THR A 1 403 ? 17.807  -9.801  -15.152 1.00 57.02 ? 403  THR A OG1   1 
ATOM   3069  C  CG2   . THR A 1 403 ? 15.745  -10.680 -14.381 1.00 55.87 ? 403  THR A CG2   1 
ATOM   3070  N  N     . PRO A 1 404 ? 18.948  -12.459 -16.938 1.00 50.70 ? 404  PRO A N     1 
ATOM   3071  C  CA    . PRO A 1 404 ? 20.118  -12.484 -17.797 1.00 49.57 ? 404  PRO A CA    1 
ATOM   3072  C  C     . PRO A 1 404 ? 20.507  -11.065 -18.202 1.00 47.92 ? 404  PRO A C     1 
ATOM   3073  O  O     . PRO A 1 404 ? 21.637  -10.704 -18.515 1.00 46.27 ? 404  PRO A O     1 
ATOM   3074  C  CB    . PRO A 1 404 ? 19.685  -13.285 -19.024 1.00 50.15 ? 404  PRO A CB    1 
ATOM   3075  C  CG    . PRO A 1 404 ? 18.237  -13.603 -18.834 1.00 50.89 ? 404  PRO A CG    1 
ATOM   3076  C  CD    . PRO A 1 404 ? 17.716  -12.719 -17.723 1.00 51.05 ? 404  PRO A CD    1 
ATOM   3077  N  N     . ARG A 1 405 ? 19.489  -10.232 -18.263 1.00 48.26 ? 405  ARG A N     1 
ATOM   3078  C  CA    . ARG A 1 405 ? 19.606  -8.839  -18.696 1.00 48.29 ? 405  ARG A CA    1 
ATOM   3079  C  C     . ARG A 1 405 ? 18.993  -7.999  -17.566 1.00 47.60 ? 405  ARG A C     1 
ATOM   3080  O  O     . ARG A 1 405 ? 18.097  -8.550  -16.959 1.00 47.74 ? 405  ARG A O     1 
ATOM   3081  C  CB    . ARG A 1 405 ? 18.629  -8.567  -19.853 1.00 48.65 ? 405  ARG A CB    1 
ATOM   3082  C  CG    . ARG A 1 405 ? 19.030  -9.198  -21.162 1.00 53.13 ? 405  ARG A CG    1 
ATOM   3083  C  CD    . ARG A 1 405 ? 19.465  -8.109  -22.148 1.00 55.70 ? 405  ARG A CD    1 
ATOM   3084  N  NE    . ARG A 1 405 ? 20.854  -8.488  -22.486 1.00 57.36 ? 405  ARG A NE    1 
ATOM   3085  C  CZ    . ARG A 1 405 ? 21.688  -7.612  -23.031 1.00 59.07 ? 405  ARG A CZ    1 
ATOM   3086  N  NH1   . ARG A 1 405 ? 21.239  -6.380  -23.268 1.00 58.30 ? 405  ARG A NH1   1 
ATOM   3087  N  NH2   . ARG A 1 405 ? 22.911  -8.039  -23.324 1.00 57.71 ? 405  ARG A NH2   1 
ATOM   3088  N  N     . LEU A 1 406 ? 19.320  -6.734  -17.517 1.00 46.70 ? 406  LEU A N     1 
ATOM   3089  C  CA    . LEU A 1 406 ? 18.668  -5.853  -16.535 1.00 44.87 ? 406  LEU A CA    1 
ATOM   3090  C  C     . LEU A 1 406 ? 18.187  -4.653  -17.346 1.00 44.59 ? 406  LEU A C     1 
ATOM   3091  O  O     . LEU A 1 406 ? 18.808  -4.271  -18.329 1.00 46.92 ? 406  LEU A O     1 
ATOM   3092  C  CB    . LEU A 1 406 ? 19.778  -5.391  -15.544 1.00 40.70 ? 406  LEU A CB    1 
ATOM   3093  C  CG    . LEU A 1 406 ? 19.540  -4.002  -14.942 1.00 41.46 ? 406  LEU A CG    1 
ATOM   3094  C  CD1   . LEU A 1 406 ? 18.666  -4.122  -13.708 1.00 40.73 ? 406  LEU A CD1   1 
ATOM   3095  C  CD2   . LEU A 1 406 ? 20.798  -3.229  -14.643 1.00 41.06 ? 406  LEU A CD2   1 
ATOM   3096  N  N     . ARG A 1 407 ? 17.142  -3.997  -16.957 1.00 43.92 ? 407  ARG A N     1 
ATOM   3097  C  CA    . ARG A 1 407 ? 16.583  -2.795  -17.467 1.00 43.83 ? 407  ARG A CA    1 
ATOM   3098  C  C     . ARG A 1 407 ? 16.552  -1.819  -16.284 1.00 43.21 ? 407  ARG A C     1 
ATOM   3099  O  O     . ARG A 1 407 ? 15.899  -2.105  -15.286 1.00 44.22 ? 407  ARG A O     1 
ATOM   3100  C  CB    . ARG A 1 407 ? 15.134  -2.966  -17.986 1.00 40.33 ? 407  ARG A CB    1 
ATOM   3101  C  CG    . ARG A 1 407 ? 14.452  -1.603  -17.955 1.00 47.15 ? 407  ARG A CG    1 
ATOM   3102  C  CD    . ARG A 1 407 ? 12.995  -1.664  -18.410 1.00 52.95 ? 407  ARG A CD    1 
ATOM   3103  N  NE    . ARG A 1 407 ? 12.556  -0.317  -18.756 1.00 52.57 ? 407  ARG A NE    1 
ATOM   3104  C  CZ    . ARG A 1 407 ? 11.348  0.031   -19.156 1.00 56.75 ? 407  ARG A CZ    1 
ATOM   3105  N  NH1   . ARG A 1 407 ? 10.337  -0.814  -19.314 1.00 51.29 ? 407  ARG A NH1   1 
ATOM   3106  N  NH2   . ARG A 1 407 ? 11.146  1.334   -19.343 1.00 57.34 ? 407  ARG A NH2   1 
ATOM   3107  N  N     . THR A 1 408 ? 17.156  -0.649  -16.424 1.00 42.94 ? 408  THR A N     1 
ATOM   3108  C  CA    . THR A 1 408 ? 17.152  0.307   -15.327 1.00 41.29 ? 408  THR A CA    1 
ATOM   3109  C  C     . THR A 1 408 ? 17.289  1.727   -15.798 1.00 40.99 ? 408  THR A C     1 
ATOM   3110  O  O     . THR A 1 408 ? 17.916  2.022   -16.798 1.00 42.91 ? 408  THR A O     1 
ATOM   3111  C  CB    . THR A 1 408 ? 18.190  -0.054  -14.249 1.00 40.05 ? 408  THR A CB    1 
ATOM   3112  O  OG1   . THR A 1 408 ? 17.846  0.664   -13.069 1.00 40.09 ? 408  THR A OG1   1 
ATOM   3113  C  CG2   . THR A 1 408 ? 19.638  0.220   -14.572 1.00 36.48 ? 408  THR A CG2   1 
ATOM   3114  N  N     . THR A 1 409 ? 16.735  2.659   -15.061 1.00 41.26 ? 409  THR A N     1 
ATOM   3115  C  CA    . THR A 1 409 ? 17.003  4.068   -15.182 1.00 41.14 ? 409  THR A CA    1 
ATOM   3116  C  C     . THR A 1 409 ? 17.964  4.547   -14.091 1.00 40.14 ? 409  THR A C     1 
ATOM   3117  O  O     . THR A 1 409 ? 17.734  4.268   -12.917 1.00 39.67 ? 409  THR A O     1 
ATOM   3118  C  CB    . THR A 1 409 ? 15.672  4.862   -15.085 1.00 42.87 ? 409  THR A CB    1 
ATOM   3119  O  OG1   . THR A 1 409 ? 14.930  4.431   -16.238 1.00 44.54 ? 409  THR A OG1   1 
ATOM   3120  C  CG2   . THR A 1 409 ? 15.952  6.356   -15.238 1.00 32.64 ? 409  THR A CG2   1 
ATOM   3121  N  N     . VAL A 1 410 ? 18.968  5.335   -14.446 1.00 39.77 ? 410  VAL A N     1 
ATOM   3122  C  CA    . VAL A 1 410 ? 19.822  6.054   -13.500 1.00 38.57 ? 410  VAL A CA    1 
ATOM   3123  C  C     . VAL A 1 410 ? 19.451  7.530   -13.463 1.00 37.85 ? 410  VAL A C     1 
ATOM   3124  O  O     . VAL A 1 410 ? 19.428  8.188   -14.504 1.00 39.91 ? 410  VAL A O     1 
ATOM   3125  C  CB    . VAL A 1 410 ? 21.295  5.865   -13.932 1.00 35.14 ? 410  VAL A CB    1 
ATOM   3126  C  CG1   . VAL A 1 410 ? 22.239  6.501   -12.925 1.00 36.50 ? 410  VAL A CG1   1 
ATOM   3127  C  CG2   . VAL A 1 410 ? 21.642  4.381   -13.998 1.00 33.86 ? 410  VAL A CG2   1 
ATOM   3128  N  N     . GLY A 1 411 ? 19.105  8.161   -12.370 1.00 36.73 ? 411  GLY A N     1 
ATOM   3129  C  CA    . GLY A 1 411 ? 18.845  9.597   -12.263 1.00 35.18 ? 411  GLY A CA    1 
ATOM   3130  C  C     . GLY A 1 411 ? 20.160  10.334  -12.047 1.00 34.45 ? 411  GLY A C     1 
ATOM   3131  O  O     . GLY A 1 411 ? 21.027  9.760   -11.403 1.00 35.12 ? 411  GLY A O     1 
ATOM   3132  N  N     . VAL A 1 412 ? 20.431  11.434  -12.727 1.00 34.27 ? 412  VAL A N     1 
ATOM   3133  C  CA    . VAL A 1 412 ? 21.764  12.002  -12.755 1.00 34.36 ? 412  VAL A CA    1 
ATOM   3134  C  C     . VAL A 1 412 ? 21.747  13.513  -12.519 1.00 34.13 ? 412  VAL A C     1 
ATOM   3135  O  O     . VAL A 1 412 ? 20.780  14.152  -12.948 1.00 35.06 ? 412  VAL A O     1 
ATOM   3136  C  CB    . VAL A 1 412 ? 22.486  11.815  -14.096 1.00 37.98 ? 412  VAL A CB    1 
ATOM   3137  C  CG1   . VAL A 1 412 ? 23.841  12.533  -14.094 1.00 35.43 ? 412  VAL A CG1   1 
ATOM   3138  C  CG2   . VAL A 1 412 ? 22.741  10.358  -14.461 1.00 38.37 ? 412  VAL A CG2   1 
ATOM   3139  N  N     . ASP A 1 413 ? 22.689  13.958  -11.697 1.00 33.33 ? 413  ASP A N     1 
ATOM   3140  C  CA    . ASP A 1 413 ? 22.885  15.404  -11.526 1.00 33.11 ? 413  ASP A CA    1 
ATOM   3141  C  C     . ASP A 1 413 ? 24.327  15.792  -11.296 1.00 32.09 ? 413  ASP A C     1 
ATOM   3142  O  O     . ASP A 1 413 ? 25.207  14.921  -11.330 1.00 30.52 ? 413  ASP A O     1 
ATOM   3143  C  CB    . ASP A 1 413 ? 21.837  15.980  -10.617 1.00 35.59 ? 413  ASP A CB    1 
ATOM   3144  C  CG    . ASP A 1 413 ? 21.601  17.458  -10.772 1.00 37.33 ? 413  ASP A CG    1 
ATOM   3145  O  OD1   . ASP A 1 413 ? 22.357  18.104  -11.519 1.00 38.45 ? 413  ASP A OD1   1 
ATOM   3146  O  OD2   . ASP A 1 413 ? 20.676  17.989  -10.112 1.00 37.61 ? 413  ASP A OD2   1 
ATOM   3147  N  N     . GLY A 1 414 ? 24.670  17.069  -11.267 1.00 34.10 ? 414  GLY A N     1 
ATOM   3148  C  CA    . GLY A 1 414 ? 26.043  17.539  -11.160 1.00 35.95 ? 414  GLY A CA    1 
ATOM   3149  C  C     . GLY A 1 414 ? 26.519  18.439  -12.284 1.00 37.29 ? 414  GLY A C     1 
ATOM   3150  O  O     . GLY A 1 414 ? 26.346  18.111  -13.474 1.00 38.83 ? 414  GLY A O     1 
ATOM   3151  N  N     . SER A 1 415 ? 27.071  19.602  -11.964 1.00 36.55 ? 415  SER A N     1 
ATOM   3152  C  CA    . SER A 1 415 ? 27.564  20.555  -12.932 1.00 36.39 ? 415  SER A CA    1 
ATOM   3153  C  C     . SER A 1 415 ? 28.478  20.023  -14.003 1.00 36.56 ? 415  SER A C     1 
ATOM   3154  O  O     . SER A 1 415 ? 28.251  20.411  -15.143 1.00 37.86 ? 415  SER A O     1 
ATOM   3155  C  CB    . SER A 1 415 ? 28.279  21.752  -12.277 1.00 39.94 ? 415  SER A CB    1 
ATOM   3156  O  OG    . SER A 1 415 ? 27.369  22.348  -11.354 1.00 35.96 ? 415  SER A OG    1 
ATOM   3157  N  N     . LEU A 1 416 ? 29.482  19.209  -13.737 1.00 35.42 ? 416  LEU A N     1 
ATOM   3158  C  CA    . LEU A 1 416 ? 30.370  18.710  -14.787 1.00 34.27 ? 416  LEU A CA    1 
ATOM   3159  C  C     . LEU A 1 416 ? 29.638  17.889  -15.839 1.00 34.13 ? 416  LEU A C     1 
ATOM   3160  O  O     . LEU A 1 416 ? 29.920  17.930  -17.042 1.00 32.61 ? 416  LEU A O     1 
ATOM   3161  C  CB    . LEU A 1 416 ? 31.477  17.899  -14.111 1.00 31.91 ? 416  LEU A CB    1 
ATOM   3162  C  CG    . LEU A 1 416 ? 32.309  16.979  -15.012 1.00 37.93 ? 416  LEU A CG    1 
ATOM   3163  C  CD1   . LEU A 1 416 ? 33.107  17.850  -15.969 1.00 31.44 ? 416  LEU A CD1   1 
ATOM   3164  C  CD2   . LEU A 1 416 ? 33.308  16.166  -14.169 1.00 34.15 ? 416  LEU A CD2   1 
ATOM   3165  N  N     . TYR A 1 417 ? 28.823  16.931  -15.407 1.00 34.20 ? 417  TYR A N     1 
ATOM   3166  C  CA    . TYR A 1 417 ? 28.038  16.091  -16.309 1.00 33.75 ? 417  TYR A CA    1 
ATOM   3167  C  C     . TYR A 1 417 ? 27.157  16.975  -17.196 1.00 35.12 ? 417  TYR A C     1 
ATOM   3168  O  O     . TYR A 1 417 ? 26.954  16.682  -18.377 1.00 35.12 ? 417  TYR A O     1 
ATOM   3169  C  CB    . TYR A 1 417 ? 27.175  15.154  -15.456 1.00 34.32 ? 417  TYR A CB    1 
ATOM   3170  C  CG    . TYR A 1 417 ? 26.251  14.221  -16.208 1.00 34.47 ? 417  TYR A CG    1 
ATOM   3171  C  CD1   . TYR A 1 417 ? 26.758  13.012  -16.619 1.00 35.41 ? 417  TYR A CD1   1 
ATOM   3172  C  CD2   . TYR A 1 417 ? 24.920  14.527  -16.491 1.00 33.45 ? 417  TYR A CD2   1 
ATOM   3173  C  CE1   . TYR A 1 417 ? 25.955  12.091  -17.279 1.00 36.45 ? 417  TYR A CE1   1 
ATOM   3174  C  CE2   . TYR A 1 417 ? 24.107  13.628  -17.169 1.00 33.29 ? 417  TYR A CE2   1 
ATOM   3175  C  CZ    . TYR A 1 417 ? 24.643  12.443  -17.565 1.00 35.93 ? 417  TYR A CZ    1 
ATOM   3176  O  OH    . TYR A 1 417 ? 23.938  11.477  -18.233 1.00 38.26 ? 417  TYR A OH    1 
ATOM   3177  N  N     . LYS A 1 418 ? 26.552  18.013  -16.654 1.00 36.04 ? 418  LYS A N     1 
ATOM   3178  C  CA    . LYS A 1 418 ? 25.653  18.862  -17.372 1.00 38.23 ? 418  LYS A CA    1 
ATOM   3179  C  C     . LYS A 1 418 ? 26.353  19.762  -18.385 1.00 40.44 ? 418  LYS A C     1 
ATOM   3180  O  O     . LYS A 1 418 ? 25.849  20.005  -19.501 1.00 43.07 ? 418  LYS A O     1 
ATOM   3181  C  CB    . LYS A 1 418 ? 24.838  19.758  -16.447 1.00 38.57 ? 418  LYS A CB    1 
ATOM   3182  C  CG    . LYS A 1 418 ? 23.758  19.033  -15.679 1.00 41.38 ? 418  LYS A CG    1 
ATOM   3183  C  CD    . LYS A 1 418 ? 22.545  19.948  -15.484 1.00 43.03 ? 418  LYS A CD    1 
ATOM   3184  C  CE    . LYS A 1 418 ? 22.533  20.502  -14.071 1.00 42.85 ? 418  LYS A CE    1 
ATOM   3185  N  NZ    . LYS A 1 418 ? 21.740  21.764  -14.040 1.00 46.19 ? 418  LYS A NZ    1 
ATOM   3186  N  N     . THR A 1 419 ? 27.453  20.379  -17.973 1.00 38.73 ? 419  THR A N     1 
ATOM   3187  C  CA    . THR A 1 419 ? 28.087  21.356  -18.834 1.00 36.39 ? 419  THR A CA    1 
ATOM   3188  C  C     . THR A 1 419 ? 29.182  20.841  -19.704 1.00 36.36 ? 419  THR A C     1 
ATOM   3189  O  O     . THR A 1 419 ? 29.422  21.539  -20.698 1.00 38.42 ? 419  THR A O     1 
ATOM   3190  C  CB    . THR A 1 419 ? 28.536  22.542  -17.940 1.00 37.18 ? 419  THR A CB    1 
ATOM   3191  O  OG1   . THR A 1 419 ? 29.509  22.036  -17.030 1.00 33.32 ? 419  THR A OG1   1 
ATOM   3192  C  CG2   . THR A 1 419 ? 27.304  23.019  -17.171 1.00 29.32 ? 419  THR A CG2   1 
ATOM   3193  N  N     . HIS A 1 420 ? 29.863  19.724  -19.481 1.00 34.66 ? 420  HIS A N     1 
ATOM   3194  C  CA    . HIS A 1 420 ? 31.045  19.443  -20.337 1.00 34.97 ? 420  HIS A CA    1 
ATOM   3195  C  C     . HIS A 1 420 ? 30.514  18.999  -21.688 1.00 36.59 ? 420  HIS A C     1 
ATOM   3196  O  O     . HIS A 1 420 ? 29.577  18.196  -21.789 1.00 38.56 ? 420  HIS A O     1 
ATOM   3197  C  CB    . HIS A 1 420 ? 31.964  18.467  -19.622 1.00 23.76 ? 420  HIS A CB    1 
ATOM   3198  C  CG    . HIS A 1 420 ? 33.210  18.068  -20.321 1.00 25.16 ? 420  HIS A CG    1 
ATOM   3199  N  ND1   . HIS A 1 420 ? 34.443  18.602  -19.968 1.00 27.63 ? 420  HIS A ND1   1 
ATOM   3200  C  CD2   . HIS A 1 420 ? 33.494  17.162  -21.272 1.00 21.55 ? 420  HIS A CD2   1 
ATOM   3201  C  CE1   . HIS A 1 420 ? 35.390  18.126  -20.739 1.00 21.96 ? 420  HIS A CE1   1 
ATOM   3202  N  NE2   . HIS A 1 420 ? 34.840  17.247  -21.537 1.00 26.74 ? 420  HIS A NE2   1 
ATOM   3203  N  N     . PRO A 1 421 ? 31.094  19.445  -22.779 1.00 37.12 ? 421  PRO A N     1 
ATOM   3204  C  CA    . PRO A 1 421 ? 30.634  19.153  -24.130 1.00 36.82 ? 421  PRO A CA    1 
ATOM   3205  C  C     . PRO A 1 421 ? 30.744  17.723  -24.599 1.00 37.00 ? 421  PRO A C     1 
ATOM   3206  O  O     . PRO A 1 421 ? 30.042  17.359  -25.543 1.00 38.75 ? 421  PRO A O     1 
ATOM   3207  C  CB    . PRO A 1 421 ? 31.551  19.999  -25.020 1.00 36.16 ? 421  PRO A CB    1 
ATOM   3208  C  CG    . PRO A 1 421 ? 32.761  20.240  -24.183 1.00 35.07 ? 421  PRO A CG    1 
ATOM   3209  C  CD    . PRO A 1 421 ? 32.222  20.421  -22.790 1.00 35.59 ? 421  PRO A CD    1 
ATOM   3210  N  N     . GLN A 1 422 ? 31.631  16.920  -24.078 1.00 36.72 ? 422  GLN A N     1 
ATOM   3211  C  CA    . GLN A 1 422 ? 31.898  15.558  -24.415 1.00 35.28 ? 422  GLN A CA    1 
ATOM   3212  C  C     . GLN A 1 422 ? 31.658  14.527  -23.294 1.00 36.24 ? 422  GLN A C     1 
ATOM   3213  O  O     . GLN A 1 422 ? 31.689  13.335  -23.671 1.00 34.33 ? 422  GLN A O     1 
ATOM   3214  C  CB    . GLN A 1 422 ? 33.414  15.473  -24.763 1.00 41.12 ? 422  GLN A CB    1 
ATOM   3215  C  CG    . GLN A 1 422 ? 33.890  16.542  -25.736 1.00 42.20 ? 422  GLN A CG    1 
ATOM   3216  C  CD    . GLN A 1 422 ? 33.063  16.511  -27.026 1.00 40.67 ? 422  GLN A CD    1 
ATOM   3217  O  OE1   . GLN A 1 422 ? 32.576  15.465  -27.475 1.00 38.90 ? 422  GLN A OE1   1 
ATOM   3218  N  NE2   . GLN A 1 422 ? 32.866  17.670  -27.605 1.00 35.74 ? 422  GLN A NE2   1 
ATOM   3219  N  N     . TYR A 1 423 ? 31.665  14.894  -21.996 1.00 34.90 ? 423  TYR A N     1 
ATOM   3220  C  CA    . TYR A 1 423 ? 31.658  13.931  -20.913 1.00 34.91 ? 423  TYR A CA    1 
ATOM   3221  C  C     . TYR A 1 423 ? 30.534  12.906  -20.886 1.00 34.05 ? 423  TYR A C     1 
ATOM   3222  O  O     . TYR A 1 423 ? 30.779  11.703  -20.939 1.00 34.60 ? 423  TYR A O     1 
ATOM   3223  C  CB    . TYR A 1 423 ? 31.698  14.625  -19.542 1.00 34.51 ? 423  TYR A CB    1 
ATOM   3224  C  CG    . TYR A 1 423 ? 32.088  13.819  -18.328 1.00 34.00 ? 423  TYR A CG    1 
ATOM   3225  C  CD1   . TYR A 1 423 ? 31.194  13.028  -17.661 1.00 34.45 ? 423  TYR A CD1   1 
ATOM   3226  C  CD2   . TYR A 1 423 ? 33.361  13.916  -17.754 1.00 35.44 ? 423  TYR A CD2   1 
ATOM   3227  C  CE1   . TYR A 1 423 ? 31.477  12.341  -16.502 1.00 35.01 ? 423  TYR A CE1   1 
ATOM   3228  C  CE2   . TYR A 1 423 ? 33.690  13.254  -16.570 1.00 35.06 ? 423  TYR A CE2   1 
ATOM   3229  C  CZ    . TYR A 1 423 ? 32.749  12.477  -15.953 1.00 35.72 ? 423  TYR A CZ    1 
ATOM   3230  O  OH    . TYR A 1 423 ? 33.055  11.723  -14.827 1.00 36.30 ? 423  TYR A OH    1 
ATOM   3231  N  N     . SER A 1 424 ? 29.311  13.302  -20.653 1.00 33.19 ? 424  SER A N     1 
ATOM   3232  C  CA    . SER A 1 424 ? 28.174  12.397  -20.635 1.00 36.29 ? 424  SER A CA    1 
ATOM   3233  C  C     . SER A 1 424 ? 28.126  11.422  -21.793 1.00 37.28 ? 424  SER A C     1 
ATOM   3234  O  O     . SER A 1 424 ? 27.867  10.233  -21.568 1.00 39.64 ? 424  SER A O     1 
ATOM   3235  C  CB    . SER A 1 424 ? 26.816  13.110  -20.540 1.00 34.09 ? 424  SER A CB    1 
ATOM   3236  O  OG    . SER A 1 424 ? 26.702  13.951  -21.679 1.00 42.58 ? 424  SER A OG    1 
ATOM   3237  N  N     . ARG A 1 425 ? 28.521  11.839  -22.984 1.00 36.99 ? 425  ARG A N     1 
ATOM   3238  C  CA    . ARG A 1 425 ? 28.564  10.962  -24.128 1.00 35.20 ? 425  ARG A CA    1 
ATOM   3239  C  C     . ARG A 1 425 ? 29.554  9.848   -23.914 1.00 34.85 ? 425  ARG A C     1 
ATOM   3240  O  O     . ARG A 1 425 ? 29.173  8.736   -24.292 1.00 36.77 ? 425  ARG A O     1 
ATOM   3241  C  CB    . ARG A 1 425 ? 28.813  11.639  -25.471 1.00 31.98 ? 425  ARG A CB    1 
ATOM   3242  C  CG    . ARG A 1 425 ? 29.079  10.721  -26.650 1.00 34.85 ? 425  ARG A CG    1 
ATOM   3243  C  CD    . ARG A 1 425 ? 29.304  11.563  -27.915 1.00 37.50 ? 425  ARG A CD    1 
ATOM   3244  N  NE    . ARG A 1 425 ? 30.557  12.325  -27.812 1.00 38.14 ? 425  ARG A NE    1 
ATOM   3245  C  CZ    . ARG A 1 425 ? 31.807  12.005  -27.917 1.00 35.45 ? 425  ARG A CZ    1 
ATOM   3246  N  NH1   . ARG A 1 425 ? 32.256  10.795  -28.252 1.00 39.98 ? 425  ARG A NH1   1 
ATOM   3247  N  NH2   . ARG A 1 425 ? 32.721  12.964  -27.760 1.00 36.18 ? 425  ARG A NH2   1 
ATOM   3248  N  N     . ARG A 1 426 ? 30.782  10.129  -23.533 1.00 33.45 ? 426  ARG A N     1 
ATOM   3249  C  CA    . ARG A 1 426 ? 31.804  9.100   -23.418 1.00 33.16 ? 426  ARG A CA    1 
ATOM   3250  C  C     . ARG A 1 426 ? 31.538  8.199   -22.196 1.00 33.35 ? 426  ARG A C     1 
ATOM   3251  O  O     . ARG A 1 426 ? 31.715  6.998   -22.182 1.00 32.28 ? 426  ARG A O     1 
ATOM   3252  C  CB    . ARG A 1 426 ? 33.185  9.714   -23.317 1.00 33.16 ? 426  ARG A CB    1 
ATOM   3253  C  CG    . ARG A 1 426 ? 33.539  10.990  -24.007 1.00 39.46 ? 426  ARG A CG    1 
ATOM   3254  C  CD    . ARG A 1 426 ? 35.020  11.377  -23.827 1.00 39.55 ? 426  ARG A CD    1 
ATOM   3255  N  NE    . ARG A 1 426 ? 35.558  12.073  -24.968 1.00 43.60 ? 426  ARG A NE    1 
ATOM   3256  C  CZ    . ARG A 1 426 ? 36.275  13.176  -25.077 1.00 42.56 ? 426  ARG A CZ    1 
ATOM   3257  N  NH1   . ARG A 1 426 ? 36.786  13.859  -24.057 1.00 41.95 ? 426  ARG A NH1   1 
ATOM   3258  N  NH2   . ARG A 1 426 ? 36.592  13.569  -26.299 1.00 41.21 ? 426  ARG A NH2   1 
ATOM   3259  N  N     . PHE A 1 427 ? 31.010  8.793   -21.124 1.00 33.48 ? 427  PHE A N     1 
ATOM   3260  C  CA    . PHE A 1 427 ? 30.563  8.045   -19.963 1.00 33.77 ? 427  PHE A CA    1 
ATOM   3261  C  C     . PHE A 1 427 ? 29.549  6.980   -20.370 1.00 35.03 ? 427  PHE A C     1 
ATOM   3262  O  O     . PHE A 1 427 ? 29.698  5.785   -20.110 1.00 35.34 ? 427  PHE A O     1 
ATOM   3263  C  CB    . PHE A 1 427 ? 29.980  9.052   -18.970 1.00 31.64 ? 427  PHE A CB    1 
ATOM   3264  C  CG    . PHE A 1 427 ? 29.233  8.463   -17.815 1.00 33.95 ? 427  PHE A CG    1 
ATOM   3265  C  CD1   . PHE A 1 427 ? 29.849  7.577   -16.939 1.00 32.67 ? 427  PHE A CD1   1 
ATOM   3266  C  CD2   . PHE A 1 427 ? 27.915  8.820   -17.582 1.00 33.24 ? 427  PHE A CD2   1 
ATOM   3267  C  CE1   . PHE A 1 427 ? 29.152  7.012   -15.893 1.00 28.96 ? 427  PHE A CE1   1 
ATOM   3268  C  CE2   . PHE A 1 427 ? 27.196  8.287   -16.523 1.00 37.79 ? 427  PHE A CE2   1 
ATOM   3269  C  CZ    . PHE A 1 427 ? 27.832  7.356   -15.698 1.00 37.51 ? 427  PHE A CZ    1 
ATOM   3270  N  N     . HIS A 1 428 ? 28.480  7.409   -21.044 1.00 36.79 ? 428  HIS A N     1 
ATOM   3271  C  CA    . HIS A 1 428 ? 27.326  6.583   -21.358 1.00 36.16 ? 428  HIS A CA    1 
ATOM   3272  C  C     . HIS A 1 428 ? 27.754  5.438   -22.260 1.00 36.67 ? 428  HIS A C     1 
ATOM   3273  O  O     . HIS A 1 428 ? 27.355  4.293   -22.059 1.00 36.17 ? 428  HIS A O     1 
ATOM   3274  C  CB    . HIS A 1 428 ? 26.247  7.369   -22.047 1.00 34.81 ? 428  HIS A CB    1 
ATOM   3275  C  CG    . HIS A 1 428 ? 25.559  8.387   -21.189 1.00 32.43 ? 428  HIS A CG    1 
ATOM   3276  N  ND1   . HIS A 1 428 ? 24.805  9.389   -21.776 1.00 30.88 ? 428  HIS A ND1   1 
ATOM   3277  C  CD2   . HIS A 1 428 ? 25.486  8.557   -19.866 1.00 32.05 ? 428  HIS A CD2   1 
ATOM   3278  C  CE1   . HIS A 1 428 ? 24.245  10.165  -20.829 1.00 30.28 ? 428  HIS A CE1   1 
ATOM   3279  N  NE2   . HIS A 1 428 ? 24.681  9.698   -19.663 1.00 38.57 ? 428  HIS A NE2   1 
ATOM   3280  N  N     . LYS A 1 429 ? 28.778  5.776   -23.034 1.00 37.71 ? 429  LYS A N     1 
ATOM   3281  C  CA    . LYS A 1 429 ? 29.327  4.815   -23.992 1.00 39.42 ? 429  LYS A CA    1 
ATOM   3282  C  C     . LYS A 1 429 ? 30.220  3.781   -23.329 1.00 40.84 ? 429  LYS A C     1 
ATOM   3283  O  O     . LYS A 1 429 ? 30.108  2.594   -23.608 1.00 42.47 ? 429  LYS A O     1 
ATOM   3284  C  CB    . LYS A 1 429 ? 30.123  5.636   -25.009 1.00 40.49 ? 429  LYS A CB    1 
ATOM   3285  C  CG    . LYS A 1 429 ? 30.643  4.857   -26.220 1.00 44.23 ? 429  LYS A CG    1 
ATOM   3286  C  CD    . LYS A 1 429 ? 30.620  5.853   -27.387 1.00 48.68 ? 429  LYS A CD    1 
ATOM   3287  C  CE    . LYS A 1 429 ? 31.931  5.895   -28.152 1.00 51.00 ? 429  LYS A CE    1 
ATOM   3288  N  NZ    . LYS A 1 429 ? 32.396  4.545   -28.576 1.00 55.48 ? 429  LYS A NZ    1 
ATOM   3289  N  N     . THR A 1 430 ? 31.211  4.232   -22.539 1.00 39.40 ? 430  THR A N     1 
ATOM   3290  C  CA    . THR A 1 430 ? 32.083  3.255   -21.893 1.00 37.90 ? 430  THR A CA    1 
ATOM   3291  C  C     . THR A 1 430 ? 31.199  2.424   -20.974 1.00 37.40 ? 430  THR A C     1 
ATOM   3292  O  O     . THR A 1 430 ? 31.443  1.241   -20.771 1.00 37.07 ? 430  THR A O     1 
ATOM   3293  C  CB    . THR A 1 430 ? 33.176  3.999   -21.122 1.00 36.57 ? 430  THR A CB    1 
ATOM   3294  O  OG1   . THR A 1 430 ? 33.773  4.982   -21.999 1.00 39.44 ? 430  THR A OG1   1 
ATOM   3295  C  CG2   . THR A 1 430 ? 34.219  3.070   -20.596 1.00 33.32 ? 430  THR A CG2   1 
ATOM   3296  N  N     . LEU A 1 431 ? 30.178  3.062   -20.387 1.00 35.89 ? 431  LEU A N     1 
ATOM   3297  C  CA    . LEU A 1 431 ? 29.325  2.322   -19.459 1.00 35.48 ? 431  LEU A CA    1 
ATOM   3298  C  C     . LEU A 1 431 ? 28.672  1.128   -20.153 1.00 37.29 ? 431  LEU A C     1 
ATOM   3299  O  O     . LEU A 1 431 ? 28.751  -0.059  -19.775 1.00 36.81 ? 431  LEU A O     1 
ATOM   3300  C  CB    . LEU A 1 431 ? 28.255  3.213   -18.789 1.00 30.65 ? 431  LEU A CB    1 
ATOM   3301  C  CG    . LEU A 1 431 ? 27.362  2.308   -17.916 1.00 36.32 ? 431  LEU A CG    1 
ATOM   3302  C  CD1   . LEU A 1 431 ? 28.046  1.874   -16.648 1.00 35.92 ? 431  LEU A CD1   1 
ATOM   3303  C  CD2   . LEU A 1 431 ? 25.940  2.691   -17.768 1.00 37.63 ? 431  LEU A CD2   1 
ATOM   3304  N  N     . ARG A 1 432 ? 27.992  1.456   -21.257 1.00 38.07 ? 432  ARG A N     1 
ATOM   3305  C  CA    . ARG A 1 432 ? 27.273  0.476   -22.049 1.00 38.24 ? 432  ARG A CA    1 
ATOM   3306  C  C     . ARG A 1 432 ? 28.164  -0.612  -22.558 1.00 39.48 ? 432  ARG A C     1 
ATOM   3307  O  O     . ARG A 1 432 ? 27.720  -1.769  -22.613 1.00 41.32 ? 432  ARG A O     1 
ATOM   3308  C  CB    . ARG A 1 432 ? 26.463  1.138   -23.174 1.00 33.94 ? 432  ARG A CB    1 
ATOM   3309  C  CG    . ARG A 1 432 ? 25.333  1.952   -22.512 1.00 30.30 ? 432  ARG A CG    1 
ATOM   3310  C  CD    . ARG A 1 432 ? 24.709  2.845   -23.607 1.00 31.06 ? 432  ARG A CD    1 
ATOM   3311  N  NE    . ARG A 1 432 ? 23.370  3.209   -23.129 1.00 30.58 ? 432  ARG A NE    1 
ATOM   3312  C  CZ    . ARG A 1 432 ? 22.918  4.436   -23.278 1.00 27.27 ? 432  ARG A CZ    1 
ATOM   3313  N  NH1   . ARG A 1 432 ? 23.700  5.292   -23.867 1.00 31.28 ? 432  ARG A NH1   1 
ATOM   3314  N  NH2   . ARG A 1 432 ? 21.714  4.744   -22.825 1.00 36.37 ? 432  ARG A NH2   1 
ATOM   3315  N  N     . ARG A 1 433 ? 29.414  -0.289  -22.853 1.00 40.22 ? 433  ARG A N     1 
ATOM   3316  C  CA    . ARG A 1 433 ? 30.334  -1.335  -23.312 1.00 40.86 ? 433  ARG A CA    1 
ATOM   3317  C  C     . ARG A 1 433 ? 30.847  -2.205  -22.178 1.00 42.05 ? 433  ARG A C     1 
ATOM   3318  O  O     . ARG A 1 433 ? 31.178  -3.396  -22.376 1.00 43.08 ? 433  ARG A O     1 
ATOM   3319  C  CB    . ARG A 1 433 ? 31.438  -0.681  -24.142 1.00 39.59 ? 433  ARG A CB    1 
ATOM   3320  C  CG    . ARG A 1 433 ? 32.636  -1.552  -24.377 1.00 42.00 ? 433  ARG A CG    1 
ATOM   3321  C  CD    . ARG A 1 433 ? 33.638  -0.871  -25.328 1.00 47.16 ? 433  ARG A CD    1 
ATOM   3322  N  NE    . ARG A 1 433 ? 34.705  -0.335  -24.478 1.00 46.57 ? 433  ARG A NE    1 
ATOM   3323  C  CZ    . ARG A 1 433 ? 34.775  0.978   -24.201 1.00 49.32 ? 433  ARG A CZ    1 
ATOM   3324  N  NH1   . ARG A 1 433 ? 33.901  1.795   -24.774 1.00 43.67 ? 433  ARG A NH1   1 
ATOM   3325  N  NH2   . ARG A 1 433 ? 35.737  1.361   -23.367 1.00 42.58 ? 433  ARG A NH2   1 
ATOM   3326  N  N     . LEU A 1 434 ? 30.864  -1.702  -20.944 1.00 42.18 ? 434  LEU A N     1 
ATOM   3327  C  CA    . LEU A 1 434 ? 31.379  -2.473  -19.806 1.00 42.83 ? 434  LEU A CA    1 
ATOM   3328  C  C     . LEU A 1 434 ? 30.318  -3.434  -19.268 1.00 43.37 ? 434  LEU A C     1 
ATOM   3329  O  O     . LEU A 1 434 ? 30.581  -4.487  -18.682 1.00 43.17 ? 434  LEU A O     1 
ATOM   3330  C  CB    . LEU A 1 434 ? 31.878  -1.482  -18.753 1.00 40.16 ? 434  LEU A CB    1 
ATOM   3331  C  CG    . LEU A 1 434 ? 33.368  -1.196  -18.638 1.00 39.58 ? 434  LEU A CG    1 
ATOM   3332  C  CD1   . LEU A 1 434 ? 34.285  -1.980  -19.551 1.00 40.24 ? 434  LEU A CD1   1 
ATOM   3333  C  CD2   . LEU A 1 434 ? 33.683  0.282   -18.710 1.00 36.25 ? 434  LEU A CD2   1 
ATOM   3334  N  N     . VAL A 1 435 ? 29.054  -3.091  -19.481 1.00 43.27 ? 435  VAL A N     1 
ATOM   3335  C  CA    . VAL A 1 435 ? 27.919  -3.860  -18.989 1.00 44.49 ? 435  VAL A CA    1 
ATOM   3336  C  C     . VAL A 1 435 ? 26.970  -4.182  -20.122 1.00 45.37 ? 435  VAL A C     1 
ATOM   3337  O  O     . VAL A 1 435 ? 25.876  -3.617  -20.191 1.00 46.54 ? 435  VAL A O     1 
ATOM   3338  C  CB    . VAL A 1 435 ? 27.263  -3.050  -17.852 1.00 46.82 ? 435  VAL A CB    1 
ATOM   3339  C  CG1   . VAL A 1 435 ? 25.972  -3.612  -17.317 1.00 46.24 ? 435  VAL A CG1   1 
ATOM   3340  C  CG2   . VAL A 1 435 ? 28.238  -2.902  -16.682 1.00 47.81 ? 435  VAL A CG2   1 
ATOM   3341  N  N     . PRO A 1 436 ? 27.381  -5.047  -21.049 1.00 46.06 ? 436  PRO A N     1 
ATOM   3342  C  CA    . PRO A 1 436 ? 26.608  -5.373  -22.234 1.00 47.08 ? 436  PRO A CA    1 
ATOM   3343  C  C     . PRO A 1 436 ? 25.254  -6.018  -22.009 1.00 48.60 ? 436  PRO A C     1 
ATOM   3344  O  O     . PRO A 1 436 ? 24.354  -5.846  -22.844 1.00 47.92 ? 436  PRO A O     1 
ATOM   3345  C  CB    . PRO A 1 436 ? 27.522  -6.185  -23.120 1.00 45.88 ? 436  PRO A CB    1 
ATOM   3346  C  CG    . PRO A 1 436 ? 28.693  -6.587  -22.278 1.00 45.55 ? 436  PRO A CG    1 
ATOM   3347  C  CD    . PRO A 1 436 ? 28.698  -5.730  -21.054 1.00 45.57 ? 436  PRO A CD    1 
ATOM   3348  N  N     . ASP A 1 437 ? 24.957  -6.570  -20.832 1.00 50.53 ? 437  ASP A N     1 
ATOM   3349  C  CA    . ASP A 1 437 ? 23.668  -7.198  -20.575 1.00 51.78 ? 437  ASP A CA    1 
ATOM   3350  C  C     . ASP A 1 437 ? 22.661  -6.313  -19.874 1.00 51.91 ? 437  ASP A C     1 
ATOM   3351  O  O     . ASP A 1 437 ? 21.632  -6.778  -19.376 1.00 52.90 ? 437  ASP A O     1 
ATOM   3352  C  CB    . ASP A 1 437 ? 23.881  -8.468  -19.753 1.00 59.49 ? 437  ASP A CB    1 
ATOM   3353  C  CG    . ASP A 1 437 ? 25.252  -8.442  -19.095 1.00 66.29 ? 437  ASP A CG    1 
ATOM   3354  O  OD1   . ASP A 1 437 ? 25.725  -7.322  -18.770 1.00 68.99 ? 437  ASP A OD1   1 
ATOM   3355  O  OD2   . ASP A 1 437 ? 25.802  -9.555  -18.930 1.00 68.74 ? 437  ASP A OD2   1 
ATOM   3356  N  N     . SER A 1 438 ? 22.961  -5.029  -19.786 1.00 51.74 ? 438  SER A N     1 
ATOM   3357  C  CA    . SER A 1 438 ? 22.079  -4.093  -19.062 1.00 50.94 ? 438  SER A CA    1 
ATOM   3358  C  C     . SER A 1 438 ? 21.465  -3.162  -20.099 1.00 50.23 ? 438  SER A C     1 
ATOM   3359  O  O     . SER A 1 438 ? 22.254  -2.709  -20.913 1.00 51.04 ? 438  SER A O     1 
ATOM   3360  C  CB    . SER A 1 438 ? 23.004  -3.181  -18.229 1.00 50.77 ? 438  SER A CB    1 
ATOM   3361  O  OG    . SER A 1 438 ? 22.857  -3.441  -16.848 1.00 56.14 ? 438  SER A OG    1 
ATOM   3362  N  N     . ASP A 1 439 ? 20.202  -2.802  -20.012 1.00 49.72 ? 439  ASP A N     1 
ATOM   3363  C  CA    . ASP A 1 439 ? 19.662  -1.753  -20.873 1.00 47.66 ? 439  ASP A CA    1 
ATOM   3364  C  C     . ASP A 1 439 ? 19.369  -0.538  -20.006 1.00 45.06 ? 439  ASP A C     1 
ATOM   3365  O  O     . ASP A 1 439 ? 18.412  -0.504  -19.234 1.00 44.17 ? 439  ASP A O     1 
ATOM   3366  C  CB    . ASP A 1 439 ? 18.358  -2.292  -21.505 1.00 54.75 ? 439  ASP A CB    1 
ATOM   3367  C  CG    . ASP A 1 439 ? 18.716  -3.639  -22.131 1.00 55.04 ? 439  ASP A CG    1 
ATOM   3368  O  OD1   . ASP A 1 439 ? 19.502  -3.582  -23.092 1.00 55.11 ? 439  ASP A OD1   1 
ATOM   3369  O  OD2   . ASP A 1 439 ? 18.267  -4.656  -21.576 1.00 60.64 ? 439  ASP A OD2   1 
ATOM   3370  N  N     . VAL A 1 440 ? 20.236  0.465   -20.123 1.00 43.44 ? 440  VAL A N     1 
ATOM   3371  C  CA    . VAL A 1 440 ? 20.144  1.605   -19.207 1.00 40.88 ? 440  VAL A CA    1 
ATOM   3372  C  C     . VAL A 1 440 ? 19.614  2.850   -19.896 1.00 39.84 ? 440  VAL A C     1 
ATOM   3373  O  O     . VAL A 1 440 ? 20.187  3.315   -20.889 1.00 39.17 ? 440  VAL A O     1 
ATOM   3374  C  CB    . VAL A 1 440 ? 21.571  1.947   -18.706 1.00 37.78 ? 440  VAL A CB    1 
ATOM   3375  C  CG1   . VAL A 1 440 ? 21.596  2.882   -17.512 1.00 37.24 ? 440  VAL A CG1   1 
ATOM   3376  C  CG2   . VAL A 1 440 ? 22.319  0.660   -18.494 1.00 36.48 ? 440  VAL A CG2   1 
ATOM   3377  N  N     . ARG A 1 441 ? 18.779  3.550   -19.131 1.00 39.00 ? 441  ARG A N     1 
ATOM   3378  C  CA    . ARG A 1 441 ? 18.394  4.907   -19.482 1.00 39.13 ? 441  ARG A CA    1 
ATOM   3379  C  C     . ARG A 1 441 ? 19.050  5.904   -18.525 1.00 39.45 ? 441  ARG A C     1 
ATOM   3380  O  O     . ARG A 1 441 ? 18.807  5.796   -17.306 1.00 41.03 ? 441  ARG A O     1 
ATOM   3381  C  CB    . ARG A 1 441 ? 16.858  5.023   -19.396 1.00 34.81 ? 441  ARG A CB    1 
ATOM   3382  C  CG    . ARG A 1 441 ? 16.358  6.453   -19.493 1.00 38.45 ? 441  ARG A CG    1 
ATOM   3383  C  CD    . ARG A 1 441 ? 14.856  6.577   -19.522 1.00 40.69 ? 441  ARG A CD    1 
ATOM   3384  N  NE    . ARG A 1 441 ? 14.294  7.695   -20.251 1.00 45.46 ? 441  ARG A NE    1 
ATOM   3385  C  CZ    . ARG A 1 441 ? 13.552  8.655   -19.699 1.00 47.10 ? 441  ARG A CZ    1 
ATOM   3386  N  NH1   . ARG A 1 441 ? 13.302  8.631   -18.399 1.00 49.73 ? 441  ARG A NH1   1 
ATOM   3387  N  NH2   . ARG A 1 441 ? 13.027  9.625   -20.430 1.00 45.96 ? 441  ARG A NH2   1 
ATOM   3388  N  N     . PHE A 1 442 ? 19.554  7.041   -19.002 1.00 39.12 ? 442  PHE A N     1 
ATOM   3389  C  CA    . PHE A 1 442 ? 20.081  8.087   -18.135 1.00 39.54 ? 442  PHE A CA    1 
ATOM   3390  C  C     . PHE A 1 442 ? 19.105  9.217   -18.062 1.00 40.46 ? 442  PHE A C     1 
ATOM   3391  O  O     . PHE A 1 442 ? 18.869  9.814   -19.096 1.00 42.67 ? 442  PHE A O     1 
ATOM   3392  C  CB    . PHE A 1 442 ? 21.480  8.582   -18.560 1.00 34.46 ? 442  PHE A CB    1 
ATOM   3393  C  CG    . PHE A 1 442 ? 22.478  7.445   -18.472 1.00 34.25 ? 442  PHE A CG    1 
ATOM   3394  C  CD1   . PHE A 1 442 ? 22.678  6.599   -19.561 1.00 36.46 ? 442  PHE A CD1   1 
ATOM   3395  C  CD2   . PHE A 1 442 ? 23.206  7.178   -17.352 1.00 36.42 ? 442  PHE A CD2   1 
ATOM   3396  C  CE1   . PHE A 1 442 ? 23.574  5.545   -19.511 1.00 35.55 ? 442  PHE A CE1   1 
ATOM   3397  C  CE2   . PHE A 1 442 ? 24.138  6.155   -17.293 1.00 34.24 ? 442  PHE A CE2   1 
ATOM   3398  C  CZ    . PHE A 1 442 ? 24.321  5.307   -18.372 1.00 33.80 ? 442  PHE A CZ    1 
ATOM   3399  N  N     . LEU A 1 443 ? 18.509  9.575   -16.943 1.00 41.08 ? 443  LEU A N     1 
ATOM   3400  C  CA    . LEU A 1 443 ? 17.537  10.671  -16.938 1.00 41.47 ? 443  LEU A CA    1 
ATOM   3401  C  C     . LEU A 1 443 ? 18.144  11.844  -16.194 1.00 44.09 ? 443  LEU A C     1 
ATOM   3402  O  O     . LEU A 1 443 ? 18.527  11.721  -15.023 1.00 44.98 ? 443  LEU A O     1 
ATOM   3403  C  CB    . LEU A 1 443 ? 16.316  10.040  -16.287 1.00 37.10 ? 443  LEU A CB    1 
ATOM   3404  C  CG    . LEU A 1 443 ? 15.050  10.814  -16.059 1.00 40.14 ? 443  LEU A CG    1 
ATOM   3405  C  CD1   . LEU A 1 443 ? 14.840  11.817  -17.196 1.00 43.73 ? 443  LEU A CD1   1 
ATOM   3406  C  CD2   . LEU A 1 443 ? 13.846  9.867   -16.068 1.00 40.96 ? 443  LEU A CD2   1 
ATOM   3407  N  N     . LEU A 1 444 ? 18.317  12.995  -16.804 1.00 45.51 ? 444  LEU A N     1 
ATOM   3408  C  CA    . LEU A 1 444 ? 18.943  14.153  -16.178 1.00 47.94 ? 444  LEU A CA    1 
ATOM   3409  C  C     . LEU A 1 444 ? 17.992  14.883  -15.250 1.00 49.78 ? 444  LEU A C     1 
ATOM   3410  O  O     . LEU A 1 444 ? 17.028  15.527  -15.664 1.00 49.54 ? 444  LEU A O     1 
ATOM   3411  C  CB    . LEU A 1 444 ? 19.360  15.076  -17.333 1.00 51.13 ? 444  LEU A CB    1 
ATOM   3412  C  CG    . LEU A 1 444 ? 20.264  16.266  -17.039 1.00 56.86 ? 444  LEU A CG    1 
ATOM   3413  C  CD1   . LEU A 1 444 ? 19.621  17.255  -16.094 1.00 54.42 ? 444  LEU A CD1   1 
ATOM   3414  C  CD2   . LEU A 1 444 ? 21.624  15.810  -16.513 1.00 52.11 ? 444  LEU A CD2   1 
ATOM   3415  N  N     . SER A 1 445 ? 18.263  14.929  -13.947 1.00 52.19 ? 445  SER A N     1 
ATOM   3416  C  CA    . SER A 1 445 ? 17.409  15.715  -13.043 1.00 53.53 ? 445  SER A CA    1 
ATOM   3417  C  C     . SER A 1 445 ? 17.452  17.182  -13.409 1.00 55.00 ? 445  SER A C     1 
ATOM   3418  O  O     . SER A 1 445 ? 18.191  17.974  -12.824 1.00 56.04 ? 445  SER A O     1 
ATOM   3419  C  CB    . SER A 1 445 ? 17.882  15.428  -11.615 1.00 56.93 ? 445  SER A CB    1 
ATOM   3420  O  OG    . SER A 1 445 ? 17.109  16.157  -10.673 1.00 55.36 ? 445  SER A OG    1 
ATOM   3421  N  N     . GLU A 1 446 ? 16.764  17.622  -14.457 1.00 56.46 ? 446  GLU A N     1 
ATOM   3422  C  CA    . GLU A 1 446 ? 16.834  18.994  -14.939 1.00 56.89 ? 446  GLU A CA    1 
ATOM   3423  C  C     . GLU A 1 446 ? 16.782  20.065  -13.857 1.00 56.14 ? 446  GLU A C     1 
ATOM   3424  O  O     . GLU A 1 446 ? 17.495  21.071  -14.033 1.00 56.14 ? 446  GLU A O     1 
ATOM   3425  C  CB    . GLU A 1 446 ? 15.732  19.309  -15.948 1.00 62.68 ? 446  GLU A CB    1 
ATOM   3426  C  CG    . GLU A 1 446 ? 15.649  18.376  -17.140 1.00 70.19 ? 446  GLU A CG    1 
ATOM   3427  C  CD    . GLU A 1 446 ? 16.543  18.764  -18.299 1.00 74.38 ? 446  GLU A CD    1 
ATOM   3428  O  OE1   . GLU A 1 446 ? 16.546  19.962  -18.671 1.00 78.07 ? 446  GLU A OE1   1 
ATOM   3429  O  OE2   . GLU A 1 446 ? 17.222  17.856  -18.850 1.00 76.59 ? 446  GLU A OE2   1 
ATOM   3430  N  N     . SER A 1 447 ? 15.902  19.928  -12.861 1.00 54.43 ? 447  SER A N     1 
ATOM   3431  C  CA    . SER A 1 447 ? 15.797  20.918  -11.836 1.00 54.03 ? 447  SER A CA    1 
ATOM   3432  C  C     . SER A 1 447 ? 16.090  20.546  -10.393 1.00 54.59 ? 447  SER A C     1 
ATOM   3433  O  O     . SER A 1 447 ? 15.355  20.962  -9.471  1.00 55.51 ? 447  SER A O     1 
ATOM   3434  C  CB    . SER A 1 447 ? 14.460  21.643  -11.905 1.00 57.66 ? 447  SER A CB    1 
ATOM   3435  O  OG    . SER A 1 447 ? 13.427  20.840  -11.373 1.00 61.12 ? 447  SER A OG    1 
ATOM   3436  N  N     . GLY A 1 448 ? 17.192  19.873  -10.092 1.00 52.88 ? 448  GLY A N     1 
ATOM   3437  C  CA    . GLY A 1 448 ? 17.643  19.734  -8.717  1.00 51.23 ? 448  GLY A CA    1 
ATOM   3438  C  C     . GLY A 1 448 ? 17.089  18.496  -8.039  1.00 50.09 ? 448  GLY A C     1 
ATOM   3439  O  O     . GLY A 1 448 ? 16.376  17.733  -8.694  1.00 49.30 ? 448  GLY A O     1 
ATOM   3440  N  N     . SER A 1 449 ? 17.453  18.357  -6.767  1.00 47.78 ? 449  SER A N     1 
ATOM   3441  C  CA    . SER A 1 449 ? 17.077  17.170  -6.014  1.00 46.10 ? 449  SER A CA    1 
ATOM   3442  C  C     . SER A 1 449 ? 15.873  17.462  -5.126  1.00 44.50 ? 449  SER A C     1 
ATOM   3443  O  O     . SER A 1 449 ? 15.477  16.550  -4.399  1.00 44.13 ? 449  SER A O     1 
ATOM   3444  C  CB    . SER A 1 449 ? 18.251  16.778  -5.077  1.00 45.10 ? 449  SER A CB    1 
ATOM   3445  O  OG    . SER A 1 449 ? 18.467  17.851  -4.166  1.00 47.44 ? 449  SER A OG    1 
ATOM   3446  N  N     . GLY A 1 450 ? 15.293  18.654  -5.178  1.00 43.40 ? 450  GLY A N     1 
ATOM   3447  C  CA    . GLY A 1 450 ? 14.251  19.030  -4.237  1.00 43.05 ? 450  GLY A CA    1 
ATOM   3448  C  C     . GLY A 1 450 ? 12.912  18.299  -4.422  1.00 43.17 ? 450  GLY A C     1 
ATOM   3449  O  O     . GLY A 1 450 ? 12.271  17.961  -3.423  1.00 42.15 ? 450  GLY A O     1 
ATOM   3450  N  N     . LYS A 1 451 ? 12.493  18.044  -5.658  1.00 42.45 ? 451  LYS A N     1 
ATOM   3451  C  CA    . LYS A 1 451 ? 11.264  17.292  -5.862  1.00 42.67 ? 451  LYS A CA    1 
ATOM   3452  C  C     . LYS A 1 451 ? 11.402  15.995  -5.050  1.00 42.21 ? 451  LYS A C     1 
ATOM   3453  O  O     . LYS A 1 451 ? 10.446  15.608  -4.376  1.00 41.78 ? 451  LYS A O     1 
ATOM   3454  C  CB    . LYS A 1 451 ? 11.117  16.882  -7.338  1.00 44.64 ? 451  LYS A CB    1 
ATOM   3455  C  CG    . LYS A 1 451 ? 9.687   16.830  -7.832  1.00 46.83 ? 451  LYS A CG    1 
ATOM   3456  C  CD    . LYS A 1 451 ? 9.667   16.838  -9.344  1.00 49.00 ? 451  LYS A CD    1 
ATOM   3457  C  CE    . LYS A 1 451 ? 9.592   15.465  -9.964  1.00 54.39 ? 451  LYS A CE    1 
ATOM   3458  N  NZ    . LYS A 1 451 ? 10.473  15.302  -11.176 1.00 54.93 ? 451  LYS A NZ    1 
ATOM   3459  N  N     . GLY A 1 452 ? 12.537  15.303  -5.286  1.00 40.23 ? 452  GLY A N     1 
ATOM   3460  C  CA    . GLY A 1 452 ? 12.729  14.033  -4.611  1.00 39.94 ? 452  GLY A CA    1 
ATOM   3461  C  C     . GLY A 1 452 ? 12.810  14.108  -3.094  1.00 39.61 ? 452  GLY A C     1 
ATOM   3462  O  O     . GLY A 1 452 ? 12.235  13.263  -2.388  1.00 38.59 ? 452  GLY A O     1 
ATOM   3463  N  N     . ALA A 1 453 ? 13.671  14.981  -2.576  1.00 40.08 ? 453  ALA A N     1 
ATOM   3464  C  CA    . ALA A 1 453 ? 13.713  15.230  -1.133  1.00 41.00 ? 453  ALA A CA    1 
ATOM   3465  C  C     . ALA A 1 453 ? 12.291  15.517  -0.645  1.00 41.67 ? 453  ALA A C     1 
ATOM   3466  O  O     . ALA A 1 453 ? 11.905  14.964  0.386   1.00 42.39 ? 453  ALA A O     1 
ATOM   3467  C  CB    . ALA A 1 453 ? 14.606  16.430  -0.798  1.00 38.12 ? 453  ALA A CB    1 
ATOM   3468  N  N     . ALA A 1 454 ? 11.532  16.397  -1.290  1.00 41.31 ? 454  ALA A N     1 
ATOM   3469  C  CA    . ALA A 1 454 ? 10.138  16.623  -0.893  1.00 41.97 ? 454  ALA A CA    1 
ATOM   3470  C  C     . ALA A 1 454 ? 9.310   15.341  -0.852  1.00 42.43 ? 454  ALA A C     1 
ATOM   3471  O  O     . ALA A 1 454 ? 8.509   15.200  0.079   1.00 44.01 ? 454  ALA A O     1 
ATOM   3472  C  CB    . ALA A 1 454 ? 9.380   17.667  -1.695  1.00 41.48 ? 454  ALA A CB    1 
ATOM   3473  N  N     . MET A 1 455 ? 9.520   14.365  -1.720  1.00 40.74 ? 455  MET A N     1 
ATOM   3474  C  CA    . MET A 1 455 ? 8.792   13.117  -1.743  1.00 39.59 ? 455  MET A CA    1 
ATOM   3475  C  C     . MET A 1 455 ? 9.112   12.225  -0.550  1.00 40.24 ? 455  MET A C     1 
ATOM   3476  O  O     . MET A 1 455 ? 8.240   11.542  -0.033  1.00 39.08 ? 455  MET A O     1 
ATOM   3477  C  CB    . MET A 1 455 ? 9.042   12.355  -3.044  1.00 43.41 ? 455  MET A CB    1 
ATOM   3478  C  CG    . MET A 1 455 ? 8.461   12.889  -4.345  1.00 43.64 ? 455  MET A CG    1 
ATOM   3479  S  SD    . MET A 1 455 ? 6.729   13.397  -4.183  1.00 48.50 ? 455  MET A SD    1 
ATOM   3480  C  CE    . MET A 1 455 ? 6.783   15.043  -4.904  1.00 41.14 ? 455  MET A CE    1 
ATOM   3481  N  N     . VAL A 1 456 ? 10.361  12.167  -0.109  1.00 40.04 ? 456  VAL A N     1 
ATOM   3482  C  CA    . VAL A 1 456 ? 10.862  11.590  1.108   1.00 38.83 ? 456  VAL A CA    1 
ATOM   3483  C  C     . VAL A 1 456 ? 10.293  12.318  2.335   1.00 39.69 ? 456  VAL A C     1 
ATOM   3484  O  O     . VAL A 1 456 ? 9.767   11.661  3.252   1.00 37.94 ? 456  VAL A O     1 
ATOM   3485  C  CB    . VAL A 1 456 ? 12.399  11.611  1.236   1.00 40.85 ? 456  VAL A CB    1 
ATOM   3486  C  CG1   . VAL A 1 456 ? 12.868  11.144  2.615   1.00 28.92 ? 456  VAL A CG1   1 
ATOM   3487  C  CG2   . VAL A 1 456 ? 13.094  10.741  0.196   1.00 28.18 ? 456  VAL A CG2   1 
ATOM   3488  N  N     . THR A 1 457 ? 10.400  13.654  2.297   1.00 39.90 ? 457  THR A N     1 
ATOM   3489  C  CA    . THR A 1 457 ? 9.861   14.393  3.427   1.00 40.19 ? 457  THR A CA    1 
ATOM   3490  C  C     . THR A 1 457 ? 8.376   14.036  3.627   1.00 40.85 ? 457  THR A C     1 
ATOM   3491  O  O     . THR A 1 457 ? 7.856   14.163  4.724   1.00 39.16 ? 457  THR A O     1 
ATOM   3492  C  CB    . THR A 1 457 ? 9.953   15.894  3.174   1.00 35.80 ? 457  THR A CB    1 
ATOM   3493  O  OG1   . THR A 1 457 ? 11.321  16.226  2.968   1.00 46.69 ? 457  THR A OG1   1 
ATOM   3494  C  CG2   . THR A 1 457 ? 9.420   16.648  4.372   1.00 37.83 ? 457  THR A CG2   1 
ATOM   3495  N  N     . ALA A 1 458 ? 7.743   13.663  2.516   1.00 41.06 ? 458  ALA A N     1 
ATOM   3496  C  CA    . ALA A 1 458 ? 6.299   13.471  2.536   1.00 42.16 ? 458  ALA A CA    1 
ATOM   3497  C  C     . ALA A 1 458 ? 6.023   12.086  3.142   1.00 43.26 ? 458  ALA A C     1 
ATOM   3498  O  O     . ALA A 1 458 ? 5.159   12.022  4.009   1.00 43.26 ? 458  ALA A O     1 
ATOM   3499  C  CB    . ALA A 1 458 ? 5.703   13.586  1.149   1.00 44.33 ? 458  ALA A CB    1 
ATOM   3500  N  N     . VAL A 1 459 ? 6.776   11.037  2.769   1.00 42.82 ? 459  VAL A N     1 
ATOM   3501  C  CA    . VAL A 1 459 ? 6.622   9.748   3.379   1.00 42.78 ? 459  VAL A CA    1 
ATOM   3502  C  C     . VAL A 1 459 ? 7.032   9.692   4.833   1.00 43.17 ? 459  VAL A C     1 
ATOM   3503  O  O     . VAL A 1 459 ? 6.186   9.404   5.682   1.00 43.49 ? 459  VAL A O     1 
ATOM   3504  C  CB    . VAL A 1 459 ? 7.032   8.557   2.538   1.00 45.97 ? 459  VAL A CB    1 
ATOM   3505  C  CG1   . VAL A 1 459 ? 7.915   8.838   1.341   1.00 54.79 ? 459  VAL A CG1   1 
ATOM   3506  C  CG2   . VAL A 1 459 ? 7.672   7.501   3.418   1.00 44.98 ? 459  VAL A CG2   1 
ATOM   3507  N  N     . ALA A 1 460 ? 8.091   10.306  5.285   1.00 43.49 ? 460  ALA A N     1 
ATOM   3508  C  CA    . ALA A 1 460 ? 8.554   10.506  6.625   1.00 43.88 ? 460  ALA A CA    1 
ATOM   3509  C  C     . ALA A 1 460 ? 7.651   11.350  7.504   1.00 45.42 ? 460  ALA A C     1 
ATOM   3510  O  O     . ALA A 1 460 ? 7.539   11.152  8.723   1.00 45.83 ? 460  ALA A O     1 
ATOM   3511  C  CB    . ALA A 1 460 ? 9.946   11.148  6.543   1.00 39.20 ? 460  ALA A CB    1 
ATOM   3512  N  N     . TYR A 1 461 ? 6.929   12.305  6.963   1.00 47.40 ? 461  TYR A N     1 
ATOM   3513  C  CA    . TYR A 1 461 ? 5.933   13.083  7.693   1.00 48.05 ? 461  TYR A CA    1 
ATOM   3514  C  C     . TYR A 1 461 ? 4.703   12.296  8.137   1.00 47.73 ? 461  TYR A C     1 
ATOM   3515  O  O     . TYR A 1 461 ? 4.274   12.297  9.290   1.00 48.00 ? 461  TYR A O     1 
ATOM   3516  C  CB    . TYR A 1 461 ? 5.457   14.262  6.839   1.00 48.69 ? 461  TYR A CB    1 
ATOM   3517  C  CG    . TYR A 1 461 ? 4.421   15.031  7.649   1.00 50.97 ? 461  TYR A CG    1 
ATOM   3518  C  CD1   . TYR A 1 461 ? 4.816   15.776  8.753   1.00 52.25 ? 461  TYR A CD1   1 
ATOM   3519  C  CD2   . TYR A 1 461 ? 3.080   14.938  7.349   1.00 50.40 ? 461  TYR A CD2   1 
ATOM   3520  C  CE1   . TYR A 1 461 ? 3.890   16.467  9.512   1.00 53.06 ? 461  TYR A CE1   1 
ATOM   3521  C  CE2   . TYR A 1 461 ? 2.137   15.597  8.113   1.00 51.96 ? 461  TYR A CE2   1 
ATOM   3522  C  CZ    . TYR A 1 461 ? 2.555   16.367  9.183   1.00 54.33 ? 461  TYR A CZ    1 
ATOM   3523  O  OH    . TYR A 1 461 ? 1.603   17.043  9.926   1.00 56.53 ? 461  TYR A OH    1 
ATOM   3524  N  N     . ARG A 1 462 ? 4.121   11.514  7.272   1.00 47.82 ? 462  ARG A N     1 
ATOM   3525  C  CA    . ARG A 1 462 ? 3.010   10.604  7.454   1.00 47.40 ? 462  ARG A CA    1 
ATOM   3526  C  C     . ARG A 1 462 ? 3.344   9.511   8.464   1.00 47.09 ? 462  ARG A C     1 
ATOM   3527  O  O     . ARG A 1 462 ? 2.594   9.261   9.412   1.00 46.76 ? 462  ARG A O     1 
ATOM   3528  C  CB    . ARG A 1 462 ? 2.712   10.006  6.080   1.00 50.82 ? 462  ARG A CB    1 
ATOM   3529  C  CG    . ARG A 1 462 ? 1.662   8.909   6.040   1.00 60.60 ? 462  ARG A CG    1 
ATOM   3530  C  CD    . ARG A 1 462 ? 1.084   8.781   4.645   1.00 67.16 ? 462  ARG A CD    1 
ATOM   3531  N  NE    . ARG A 1 462 ? -0.125  9.588   4.457   1.00 78.04 ? 462  ARG A NE    1 
ATOM   3532  C  CZ    . ARG A 1 462 ? -0.287  10.746  3.838   1.00 77.66 ? 462  ARG A CZ    1 
ATOM   3533  N  NH1   . ARG A 1 462 ? 0.715   11.410  3.263   1.00 82.77 ? 462  ARG A NH1   1 
ATOM   3534  N  NH2   . ARG A 1 462 ? -1.497  11.293  3.781   1.00 79.73 ? 462  ARG A NH2   1 
ATOM   3535  N  N     . LEU A 1 463 ? 4.559   8.990   8.379   1.00 46.29 ? 463  LEU A N     1 
ATOM   3536  C  CA    . LEU A 1 463 ? 5.103   8.002   9.290   1.00 46.26 ? 463  LEU A CA    1 
ATOM   3537  C  C     . LEU A 1 463 ? 5.300   8.505   10.714  1.00 45.34 ? 463  LEU A C     1 
ATOM   3538  O  O     . LEU A 1 463 ? 4.994   7.813   11.671  1.00 45.14 ? 463  LEU A O     1 
ATOM   3539  C  CB    . LEU A 1 463 ? 6.445   7.461   8.777   1.00 45.82 ? 463  LEU A CB    1 
ATOM   3540  C  CG    . LEU A 1 463 ? 6.324   6.258   7.843   1.00 51.50 ? 463  LEU A CG    1 
ATOM   3541  C  CD1   . LEU A 1 463 ? 5.061   6.334   6.983   1.00 49.68 ? 463  LEU A CD1   1 
ATOM   3542  C  CD2   . LEU A 1 463 ? 7.564   6.110   6.962   1.00 48.56 ? 463  LEU A CD2   1 
ATOM   3543  N  N     . ALA A 1 464 ? 5.660   9.762   10.849  1.00 45.35 ? 464  ALA A N     1 
ATOM   3544  C  CA    . ALA A 1 464 ? 5.834   10.411  12.141  1.00 45.36 ? 464  ALA A CA    1 
ATOM   3545  C  C     . ALA A 1 464 ? 4.499   10.746  12.775  1.00 45.00 ? 464  ALA A C     1 
ATOM   3546  O  O     . ALA A 1 464 ? 4.363   10.719  13.991  1.00 44.25 ? 464  ALA A O     1 
ATOM   3547  C  CB    . ALA A 1 464 ? 6.740   11.632  11.941  1.00 40.73 ? 464  ALA A CB    1 
ATOM   3548  N  N     . GLU A 1 465 ? 3.446   10.992  11.976  1.00 45.78 ? 465  GLU A N     1 
ATOM   3549  C  CA    . GLU A 1 465 ? 2.119   11.254  12.548  1.00 44.75 ? 465  GLU A CA    1 
ATOM   3550  C  C     . GLU A 1 465 ? 1.570   9.962   13.192  1.00 42.78 ? 465  GLU A C     1 
ATOM   3551  O  O     . GLU A 1 465 ? 1.025   9.945   14.318  1.00 40.93 ? 465  GLU A O     1 
ATOM   3552  C  CB    . GLU A 1 465 ? 1.181   11.787  11.489  1.00 50.71 ? 465  GLU A CB    1 
ATOM   3553  C  CG    . GLU A 1 465 ? 0.833   13.251  11.533  1.00 58.04 ? 465  GLU A CG    1 
ATOM   3554  C  CD    . GLU A 1 465 ? 0.758   13.845  12.929  1.00 64.05 ? 465  GLU A CD    1 
ATOM   3555  O  OE1   . GLU A 1 465 ? -0.332  13.767  13.554  1.00 61.30 ? 465  GLU A OE1   1 
ATOM   3556  O  OE2   . GLU A 1 465 ? 1.814   14.386  13.364  1.00 65.32 ? 465  GLU A OE2   1 
ATOM   3557  N  N     . GLN A 1 466 ? 1.870   8.857   12.517  1.00 40.34 ? 466  GLN A N     1 
ATOM   3558  C  CA    . GLN A 1 466 ? 1.490   7.564   13.086  1.00 41.03 ? 466  GLN A CA    1 
ATOM   3559  C  C     . GLN A 1 466 ? 2.254   7.342   14.399  1.00 42.06 ? 466  GLN A C     1 
ATOM   3560  O  O     . GLN A 1 466 ? 1.718   7.012   15.473  1.00 43.13 ? 466  GLN A O     1 
ATOM   3561  C  CB    . GLN A 1 466 ? 1.837   6.475   12.080  1.00 40.03 ? 466  GLN A CB    1 
ATOM   3562  C  CG    . GLN A 1 466 ? 1.726   5.094   12.731  1.00 49.05 ? 466  GLN A CG    1 
ATOM   3563  C  CD    . GLN A 1 466 ? 1.866   4.027   11.667  1.00 54.60 ? 466  GLN A CD    1 
ATOM   3564  O  OE1   . GLN A 1 466 ? 1.104   4.049   10.702  1.00 58.84 ? 466  GLN A OE1   1 
ATOM   3565  N  NE2   . GLN A 1 466 ? 2.848   3.140   11.817  1.00 58.20 ? 466  GLN A NE2   1 
ATOM   3566  N  N     . HIS A 1 467 ? 3.553   7.626   14.328  1.00 40.42 ? 467  HIS A N     1 
ATOM   3567  C  CA    . HIS A 1 467 ? 4.424   7.344   15.455  1.00 40.13 ? 467  HIS A CA    1 
ATOM   3568  C  C     . HIS A 1 467 ? 3.941   8.206   16.612  1.00 39.09 ? 467  HIS A C     1 
ATOM   3569  O  O     . HIS A 1 467 ? 3.811   7.783   17.759  1.00 39.58 ? 467  HIS A O     1 
ATOM   3570  C  CB    . HIS A 1 467 ? 5.884   7.610   15.131  1.00 45.10 ? 467  HIS A CB    1 
ATOM   3571  C  CG    . HIS A 1 467 ? 6.612   6.716   14.184  1.00 53.04 ? 467  HIS A CG    1 
ATOM   3572  N  ND1   . HIS A 1 467 ? 6.081   5.611   13.544  1.00 55.30 ? 467  HIS A ND1   1 
ATOM   3573  C  CD2   . HIS A 1 467 ? 7.919   6.777   13.766  1.00 54.55 ? 467  HIS A CD2   1 
ATOM   3574  C  CE1   . HIS A 1 467 ? 6.996   5.047   12.775  1.00 54.93 ? 467  HIS A CE1   1 
ATOM   3575  N  NE2   . HIS A 1 467 ? 8.120   5.739   12.887  1.00 55.47 ? 467  HIS A NE2   1 
ATOM   3576  N  N     . ARG A 1 468 ? 3.600   9.448   16.308  1.00 37.56 ? 468  ARG A N     1 
ATOM   3577  C  CA    . ARG A 1 468 ? 3.152   10.369  17.356  1.00 35.89 ? 468  ARG A CA    1 
ATOM   3578  C  C     . ARG A 1 468 ? 1.852   9.878   17.992  1.00 36.24 ? 468  ARG A C     1 
ATOM   3579  O  O     . ARG A 1 468 ? 1.715   10.069  19.185  1.00 34.83 ? 468  ARG A O     1 
ATOM   3580  C  CB    . ARG A 1 468 ? 2.940   11.762  16.754  1.00 36.05 ? 468  ARG A CB    1 
ATOM   3581  C  CG    . ARG A 1 468 ? 2.237   12.711  17.698  1.00 38.58 ? 468  ARG A CG    1 
ATOM   3582  C  CD    . ARG A 1 468 ? 1.841   14.020  16.996  1.00 42.57 ? 468  ARG A CD    1 
ATOM   3583  N  NE    . ARG A 1 468 ? 0.673   13.823  16.179  1.00 44.51 ? 468  ARG A NE    1 
ATOM   3584  C  CZ    . ARG A 1 468 ? -0.561  13.514  16.552  1.00 48.82 ? 468  ARG A CZ    1 
ATOM   3585  N  NH1   . ARG A 1 468 ? -0.957  13.341  17.805  1.00 45.99 ? 468  ARG A NH1   1 
ATOM   3586  N  NH2   . ARG A 1 468 ? -1.447  13.341  15.578  1.00 46.89 ? 468  ARG A NH2   1 
ATOM   3587  N  N     . GLN A 1 469 ? 0.925   9.294   17.222  1.00 36.43 ? 469  GLN A N     1 
ATOM   3588  C  CA    . GLN A 1 469 ? -0.319  8.785   17.716  1.00 37.60 ? 469  GLN A CA    1 
ATOM   3589  C  C     . GLN A 1 469 ? -0.144  7.464   18.489  1.00 38.66 ? 469  GLN A C     1 
ATOM   3590  O  O     . GLN A 1 469 ? -0.711  7.364   19.576  1.00 38.44 ? 469  GLN A O     1 
ATOM   3591  C  CB    . GLN A 1 469 ? -1.350  8.541   16.601  1.00 39.59 ? 469  GLN A CB    1 
ATOM   3592  C  CG    . GLN A 1 469 ? -2.010  9.800   16.063  1.00 46.58 ? 469  GLN A CG    1 
ATOM   3593  C  CD    . GLN A 1 469 ? -2.540  9.628   14.655  1.00 47.92 ? 469  GLN A CD    1 
ATOM   3594  O  OE1   . GLN A 1 469 ? -3.354  8.760   14.349  1.00 55.17 ? 469  GLN A OE1   1 
ATOM   3595  N  NE2   . GLN A 1 469 ? -2.116  10.476  13.722  1.00 56.59 ? 469  GLN A NE2   1 
ATOM   3596  N  N     . ILE A 1 470 ? 0.788   6.596   18.066  1.00 38.10 ? 470  ILE A N     1 
ATOM   3597  C  CA    . ILE A 1 470 ? 1.090   5.442   18.911  1.00 37.00 ? 470  ILE A CA    1 
ATOM   3598  C  C     . ILE A 1 470 ? 1.610   5.870   20.275  1.00 37.62 ? 470  ILE A C     1 
ATOM   3599  O  O     . ILE A 1 470 ? 1.133   5.403   21.321  1.00 36.49 ? 470  ILE A O     1 
ATOM   3600  C  CB    . ILE A 1 470 ? 2.130   4.538   18.220  1.00 36.00 ? 470  ILE A CB    1 
ATOM   3601  C  CG1   . ILE A 1 470 ? 1.493   3.734   17.090  1.00 32.28 ? 470  ILE A CG1   1 
ATOM   3602  C  CG2   . ILE A 1 470 ? 2.765   3.619   19.243  1.00 35.32 ? 470  ILE A CG2   1 
ATOM   3603  C  CD1   . ILE A 1 470 ? 2.406   3.508   15.890  1.00 31.31 ? 470  ILE A CD1   1 
ATOM   3604  N  N     . GLU A 1 471 ? 2.521   6.838   20.345  1.00 39.30 ? 471  GLU A N     1 
ATOM   3605  C  CA    . GLU A 1 471 ? 3.126   7.277   21.602  1.00 41.38 ? 471  GLU A CA    1 
ATOM   3606  C  C     . GLU A 1 471 ? 2.136   7.878   22.585  1.00 42.06 ? 471  GLU A C     1 
ATOM   3607  O  O     . GLU A 1 471 ? 2.274   7.849   23.807  1.00 42.00 ? 471  GLU A O     1 
ATOM   3608  C  CB    . GLU A 1 471 ? 4.232   8.338   21.358  1.00 40.89 ? 471  GLU A CB    1 
ATOM   3609  C  CG    . GLU A 1 471 ? 5.569   7.682   21.097  1.00 53.06 ? 471  GLU A CG    1 
ATOM   3610  C  CD    . GLU A 1 471 ? 6.128   6.832   22.221  1.00 55.98 ? 471  GLU A CD    1 
ATOM   3611  O  OE1   . GLU A 1 471 ? 5.413   6.259   23.074  1.00 60.82 ? 471  GLU A OE1   1 
ATOM   3612  O  OE2   . GLU A 1 471 ? 7.376   6.707   22.307  1.00 63.28 ? 471  GLU A OE2   1 
ATOM   3613  N  N     . GLU A 1 472 ? 1.193   8.622   22.011  1.00 43.02 ? 472  GLU A N     1 
ATOM   3614  C  CA    . GLU A 1 472 ? 0.083   9.228   22.728  1.00 41.72 ? 472  GLU A CA    1 
ATOM   3615  C  C     . GLU A 1 472 ? -0.802  8.157   23.374  1.00 40.17 ? 472  GLU A C     1 
ATOM   3616  O  O     . GLU A 1 472 ? -1.280  8.329   24.493  1.00 40.43 ? 472  GLU A O     1 
ATOM   3617  C  CB    . GLU A 1 472 ? -0.761  10.030  21.751  1.00 43.51 ? 472  GLU A CB    1 
ATOM   3618  C  CG    . GLU A 1 472 ? -0.592  11.528  21.754  1.00 52.24 ? 472  GLU A CG    1 
ATOM   3619  C  CD    . GLU A 1 472 ? -1.156  12.149  20.471  1.00 58.29 ? 472  GLU A CD    1 
ATOM   3620  O  OE1   . GLU A 1 472 ? -2.265  11.703  20.055  1.00 63.15 ? 472  GLU A OE1   1 
ATOM   3621  O  OE2   . GLU A 1 472 ? -0.508  13.042  19.873  1.00 57.09 ? 472  GLU A OE2   1 
ATOM   3622  N  N     . THR A 1 473 ? -1.088  7.074   22.673  1.00 37.50 ? 473  THR A N     1 
ATOM   3623  C  CA    . THR A 1 473 ? -1.847  6.013   23.342  1.00 37.15 ? 473  THR A CA    1 
ATOM   3624  C  C     . THR A 1 473 ? -0.991  5.413   24.462  1.00 38.25 ? 473  THR A C     1 
ATOM   3625  O  O     . THR A 1 473 ? -1.358  5.425   25.645  1.00 38.29 ? 473  THR A O     1 
ATOM   3626  C  CB    . THR A 1 473 ? -2.129  4.969   22.276  1.00 35.01 ? 473  THR A CB    1 
ATOM   3627  O  OG1   . THR A 1 473 ? -3.143  5.480   21.415  1.00 41.11 ? 473  THR A OG1   1 
ATOM   3628  C  CG2   . THR A 1 473 ? -2.476  3.638   22.878  1.00 39.93 ? 473  THR A CG2   1 
ATOM   3629  N  N     . LEU A 1 474 ? 0.265   5.078   24.121  1.00 37.18 ? 474  LEU A N     1 
ATOM   3630  C  CA    . LEU A 1 474 ? 1.135   4.452   25.074  1.00 37.57 ? 474  LEU A CA    1 
ATOM   3631  C  C     . LEU A 1 474 ? 1.494   5.303   26.277  1.00 37.05 ? 474  LEU A C     1 
ATOM   3632  O  O     . LEU A 1 474 ? 1.598   4.779   27.410  1.00 36.54 ? 474  LEU A O     1 
ATOM   3633  C  CB    . LEU A 1 474 ? 2.349   3.871   24.337  1.00 36.82 ? 474  LEU A CB    1 
ATOM   3634  C  CG    . LEU A 1 474 ? 1.917   2.763   23.341  1.00 40.86 ? 474  LEU A CG    1 
ATOM   3635  C  CD1   . LEU A 1 474 ? 3.146   2.358   22.547  1.00 38.12 ? 474  LEU A CD1   1 
ATOM   3636  C  CD2   . LEU A 1 474 ? 1.311   1.593   24.093  1.00 36.16 ? 474  LEU A CD2   1 
ATOM   3637  N  N     . ALA A 1 475 ? 1.630   6.604   26.110  1.00 36.46 ? 475  ALA A N     1 
ATOM   3638  C  CA    . ALA A 1 475 ? 1.958   7.459   27.244  1.00 37.66 ? 475  ALA A CA    1 
ATOM   3639  C  C     . ALA A 1 475 ? 0.906   7.302   28.330  1.00 38.43 ? 475  ALA A C     1 
ATOM   3640  O  O     . ALA A 1 475 ? 1.170   7.728   29.457  1.00 38.23 ? 475  ALA A O     1 
ATOM   3641  C  CB    . ALA A 1 475 ? 2.089   8.944   26.878  1.00 33.75 ? 475  ALA A CB    1 
ATOM   3642  N  N     . HIS A 1 476 ? -0.281  6.785   28.019  1.00 39.82 ? 476  HIS A N     1 
ATOM   3643  C  CA    . HIS A 1 476 ? -1.282  6.609   29.059  1.00 40.63 ? 476  HIS A CA    1 
ATOM   3644  C  C     . HIS A 1 476 ? -0.852  5.570   30.086  1.00 41.03 ? 476  HIS A C     1 
ATOM   3645  O  O     . HIS A 1 476 ? -1.496  5.479   31.138  1.00 41.63 ? 476  HIS A O     1 
ATOM   3646  C  CB    . HIS A 1 476 ? -2.667  6.259   28.486  1.00 41.95 ? 476  HIS A CB    1 
ATOM   3647  C  CG    . HIS A 1 476 ? -3.318  7.539   28.026  1.00 47.59 ? 476  HIS A CG    1 
ATOM   3648  N  ND1   . HIS A 1 476 ? -3.486  7.852   26.706  1.00 45.68 ? 476  HIS A ND1   1 
ATOM   3649  C  CD2   . HIS A 1 476 ? -3.764  8.602   28.761  1.00 44.80 ? 476  HIS A CD2   1 
ATOM   3650  C  CE1   . HIS A 1 476 ? -4.031  9.044   26.608  1.00 46.61 ? 476  HIS A CE1   1 
ATOM   3651  N  NE2   . HIS A 1 476 ? -4.202  9.507   27.838  1.00 50.54 ? 476  HIS A NE2   1 
ATOM   3652  N  N     . PHE A 1 477 ? 0.105   4.731   29.749  1.00 40.15 ? 477  PHE A N     1 
ATOM   3653  C  CA    . PHE A 1 477 ? 0.506   3.655   30.661  1.00 41.72 ? 477  PHE A CA    1 
ATOM   3654  C  C     . PHE A 1 477 ? 1.712   4.142   31.453  1.00 42.94 ? 477  PHE A C     1 
ATOM   3655  O  O     . PHE A 1 477 ? 2.249   3.402   32.266  1.00 44.90 ? 477  PHE A O     1 
ATOM   3656  C  CB    . PHE A 1 477 ? 0.854   2.390   29.844  1.00 36.86 ? 477  PHE A CB    1 
ATOM   3657  C  CG    . PHE A 1 477 ? -0.373  1.732   29.247  1.00 32.59 ? 477  PHE A CG    1 
ATOM   3658  C  CD1   . PHE A 1 477 ? -0.914  2.134   28.045  1.00 31.67 ? 477  PHE A CD1   1 
ATOM   3659  C  CD2   . PHE A 1 477 ? -0.973  0.654   29.884  1.00 32.24 ? 477  PHE A CD2   1 
ATOM   3660  C  CE1   . PHE A 1 477 ? -2.042  1.504   27.542  1.00 33.77 ? 477  PHE A CE1   1 
ATOM   3661  C  CE2   . PHE A 1 477 ? -2.126  0.052   29.400  1.00 31.43 ? 477  PHE A CE2   1 
ATOM   3662  C  CZ    . PHE A 1 477 ? -2.687  0.469   28.220  1.00 24.85 ? 477  PHE A CZ    1 
ATOM   3663  N  N     . HIS A 1 478 ? 2.265   5.307   31.164  1.00 42.45 ? 478  HIS A N     1 
ATOM   3664  C  CA    . HIS A 1 478 ? 3.445   5.825   31.843  1.00 42.50 ? 478  HIS A CA    1 
ATOM   3665  C  C     . HIS A 1 478 ? 3.162   6.476   33.187  1.00 42.60 ? 478  HIS A C     1 
ATOM   3666  O  O     . HIS A 1 478 ? 2.339   7.359   33.349  1.00 43.27 ? 478  HIS A O     1 
ATOM   3667  C  CB    . HIS A 1 478 ? 4.087   6.889   30.944  1.00 43.08 ? 478  HIS A CB    1 
ATOM   3668  C  CG    . HIS A 1 478 ? 5.317   7.437   31.589  1.00 49.49 ? 478  HIS A CG    1 
ATOM   3669  N  ND1   . HIS A 1 478 ? 5.261   8.420   32.579  1.00 51.12 ? 478  HIS A ND1   1 
ATOM   3670  C  CD2   . HIS A 1 478 ? 6.627   7.135   31.394  1.00 46.26 ? 478  HIS A CD2   1 
ATOM   3671  C  CE1   . HIS A 1 478 ? 6.501   8.680   32.973  1.00 48.07 ? 478  HIS A CE1   1 
ATOM   3672  N  NE2   . HIS A 1 478 ? 7.339   7.922   32.268  1.00 48.67 ? 478  HIS A NE2   1 
ATOM   3673  N  N     . LEU A 1 479 ? 3.694   5.982   34.279  1.00 42.89 ? 479  LEU A N     1 
ATOM   3674  C  CA    . LEU A 1 479 ? 3.373   6.452   35.619  1.00 41.44 ? 479  LEU A CA    1 
ATOM   3675  C  C     . LEU A 1 479 ? 4.605   7.152   36.171  1.00 41.04 ? 479  LEU A C     1 
ATOM   3676  O  O     . LEU A 1 479 ? 5.699   6.634   36.290  1.00 40.47 ? 479  LEU A O     1 
ATOM   3677  C  CB    . LEU A 1 479 ? 2.930   5.259   36.459  1.00 39.67 ? 479  LEU A CB    1 
ATOM   3678  C  CG    . LEU A 1 479 ? 1.564   4.628   36.163  1.00 42.72 ? 479  LEU A CG    1 
ATOM   3679  C  CD1   . LEU A 1 479 ? 1.173   3.585   37.202  1.00 39.37 ? 479  LEU A CD1   1 
ATOM   3680  C  CD2   . LEU A 1 479 ? 0.481   5.701   36.172  1.00 39.25 ? 479  LEU A CD2   1 
ATOM   3681  N  N     . THR A 1 480 ? 4.489   8.435   36.353  1.00 41.89 ? 480  THR A N     1 
ATOM   3682  C  CA    . THR A 1 480 ? 5.372   9.348   37.062  1.00 42.64 ? 480  THR A CA    1 
ATOM   3683  C  C     . THR A 1 480 ? 5.571   8.940   38.525  1.00 42.92 ? 480  THR A C     1 
ATOM   3684  O  O     . THR A 1 480 ? 4.660   8.394   39.134  1.00 41.52 ? 480  THR A O     1 
ATOM   3685  C  CB    . THR A 1 480 ? 4.572   10.674  37.050  1.00 41.91 ? 480  THR A CB    1 
ATOM   3686  O  OG1   . THR A 1 480 ? 5.016   11.497  35.996  1.00 41.31 ? 480  THR A OG1   1 
ATOM   3687  C  CG2   . THR A 1 480 ? 4.323   11.285  38.366  1.00 39.78 ? 480  THR A CG2   1 
ATOM   3688  N  N     . LYS A 1 481 ? 6.728   9.274   39.113  1.00 43.86 ? 481  LYS A N     1 
ATOM   3689  C  CA    . LYS A 1 481 ? 7.058   9.057   40.489  1.00 43.60 ? 481  LYS A CA    1 
ATOM   3690  C  C     . LYS A 1 481 ? 6.114   9.648   41.526  1.00 43.51 ? 481  LYS A C     1 
ATOM   3691  O  O     . LYS A 1 481 ? 6.157   9.135   42.655  1.00 45.33 ? 481  LYS A O     1 
ATOM   3692  C  CB    . LYS A 1 481 ? 8.476   9.567   40.861  1.00 45.48 ? 481  LYS A CB    1 
ATOM   3693  C  CG    . LYS A 1 481 ? 8.906   9.050   42.232  1.00 48.55 ? 481  LYS A CG    1 
ATOM   3694  C  CD    . LYS A 1 481 ? 10.369  9.276   42.558  1.00 48.39 ? 481  LYS A CD    1 
ATOM   3695  C  CE    . LYS A 1 481 ? 10.592  9.588   44.031  1.00 52.87 ? 481  LYS A CE    1 
ATOM   3696  N  NZ    . LYS A 1 481 ? 12.033  9.735   44.401  1.00 48.76 ? 481  LYS A NZ    1 
ATOM   3697  N  N     . ASP A 1 482 ? 5.276   10.621  41.231  1.00 43.21 ? 482  ASP A N     1 
ATOM   3698  C  CA    . ASP A 1 482 ? 4.396   11.155  42.275  1.00 44.44 ? 482  ASP A CA    1 
ATOM   3699  C  C     . ASP A 1 482 ? 2.991   10.568  42.205  1.00 42.04 ? 482  ASP A C     1 
ATOM   3700  O  O     . ASP A 1 482 ? 2.202   10.612  43.144  1.00 41.12 ? 482  ASP A O     1 
ATOM   3701  C  CB    . ASP A 1 482 ? 4.246   12.663  41.980  1.00 58.65 ? 482  ASP A CB    1 
ATOM   3702  C  CG    . ASP A 1 482 ? 4.640   13.711  42.968  1.00 66.05 ? 482  ASP A CG    1 
ATOM   3703  O  OD1   . ASP A 1 482 ? 4.595   13.568  44.213  1.00 71.53 ? 482  ASP A OD1   1 
ATOM   3704  O  OD2   . ASP A 1 482 ? 4.984   14.836  42.503  1.00 73.01 ? 482  ASP A OD2   1 
ATOM   3705  N  N     . MET A 1 483 ? 2.680   10.134  40.993  1.00 40.00 ? 483  MET A N     1 
ATOM   3706  C  CA    . MET A 1 483 ? 1.502   9.315   40.726  1.00 39.73 ? 483  MET A CA    1 
ATOM   3707  C  C     . MET A 1 483 ? 1.644   7.977   41.436  1.00 38.08 ? 483  MET A C     1 
ATOM   3708  O  O     . MET A 1 483 ? 0.695   7.429   41.986  1.00 39.50 ? 483  MET A O     1 
ATOM   3709  C  CB    . MET A 1 483 ? 1.393   9.088   39.205  1.00 37.94 ? 483  MET A CB    1 
ATOM   3710  C  CG    . MET A 1 483 ? 0.018   8.535   38.847  1.00 43.90 ? 483  MET A CG    1 
ATOM   3711  S  SD    . MET A 1 483 ? -1.328  9.616   39.408  1.00 47.82 ? 483  MET A SD    1 
ATOM   3712  C  CE    . MET A 1 483 ? -2.347  8.492   40.297  1.00 39.37 ? 483  MET A CE    1 
ATOM   3713  N  N     . LEU A 1 484 ? 2.874   7.480   41.417  1.00 37.28 ? 484  LEU A N     1 
ATOM   3714  C  CA    . LEU A 1 484 ? 3.159   6.123   41.966  1.00 37.27 ? 484  LEU A CA    1 
ATOM   3715  C  C     . LEU A 1 484 ? 3.061   6.200   43.487  1.00 37.16 ? 484  LEU A C     1 
ATOM   3716  O  O     . LEU A 1 484 ? 2.282   5.595   44.203  1.00 37.81 ? 484  LEU A O     1 
ATOM   3717  C  CB    . LEU A 1 484 ? 4.590   5.787   41.517  1.00 31.81 ? 484  LEU A CB    1 
ATOM   3718  C  CG    . LEU A 1 484 ? 4.660   4.878   40.278  1.00 38.30 ? 484  LEU A CG    1 
ATOM   3719  C  CD1   . LEU A 1 484 ? 6.091   4.458   39.974  1.00 32.99 ? 484  LEU A CD1   1 
ATOM   3720  C  CD2   . LEU A 1 484 ? 3.774   3.663   40.510  1.00 38.23 ? 484  LEU A CD2   1 
ATOM   3721  N  N     . LEU A 1 485 ? 3.652   7.331   43.939  1.00 38.02 ? 485  LEU A N     1 
ATOM   3722  C  CA    . LEU A 1 485 ? 3.590   7.855   45.284  1.00 38.93 ? 485  LEU A CA    1 
ATOM   3723  C  C     . LEU A 1 485 ? 2.157   8.117   45.735  1.00 39.82 ? 485  LEU A C     1 
ATOM   3724  O  O     . LEU A 1 485 ? 1.762   7.796   46.875  1.00 40.43 ? 485  LEU A O     1 
ATOM   3725  C  CB    . LEU A 1 485 ? 4.438   9.110   45.502  1.00 39.61 ? 485  LEU A CB    1 
ATOM   3726  C  CG    . LEU A 1 485 ? 5.942   8.970   45.663  1.00 44.74 ? 485  LEU A CG    1 
ATOM   3727  C  CD1   . LEU A 1 485 ? 6.646   10.289  45.378  1.00 40.69 ? 485  LEU A CD1   1 
ATOM   3728  C  CD2   . LEU A 1 485 ? 6.376   8.382   47.008  1.00 38.81 ? 485  LEU A CD2   1 
ATOM   3729  N  N     . GLU A 1 486 ? 1.292   8.613   44.846  1.00 40.31 ? 486  GLU A N     1 
ATOM   3730  C  CA    . GLU A 1 486 ? -0.122  8.833   45.256  1.00 39.15 ? 486  GLU A CA    1 
ATOM   3731  C  C     . GLU A 1 486 ? -0.847  7.495   45.317  1.00 39.77 ? 486  GLU A C     1 
ATOM   3732  O  O     . GLU A 1 486 ? -1.782  7.229   46.091  1.00 39.73 ? 486  GLU A O     1 
ATOM   3733  C  CB    . GLU A 1 486 ? -0.729  9.832   44.286  1.00 39.54 ? 486  GLU A CB    1 
ATOM   3734  C  CG    . GLU A 1 486 ? -2.245  9.798   44.139  1.00 38.97 ? 486  GLU A CG    1 
ATOM   3735  C  CD    . GLU A 1 486 ? -2.860  10.532  45.305  1.00 42.45 ? 486  GLU A CD    1 
ATOM   3736  O  OE1   . GLU A 1 486 ? -2.097  11.381  45.837  1.00 44.82 ? 486  GLU A OE1   1 
ATOM   3737  O  OE2   . GLU A 1 486 ? -4.002  10.236  45.706  1.00 42.80 ? 486  GLU A OE2   1 
ATOM   3738  N  N     . VAL A 1 487 ? -0.364  6.535   44.510  1.00 39.76 ? 487  VAL A N     1 
ATOM   3739  C  CA    . VAL A 1 487 ? -0.984  5.199   44.519  1.00 39.64 ? 487  VAL A CA    1 
ATOM   3740  C  C     . VAL A 1 487 ? -0.623  4.451   45.785  1.00 39.09 ? 487  VAL A C     1 
ATOM   3741  O  O     . VAL A 1 487 ? -1.536  4.018   46.498  1.00 37.83 ? 487  VAL A O     1 
ATOM   3742  C  CB    . VAL A 1 487 ? -0.692  4.430   43.247  1.00 38.94 ? 487  VAL A CB    1 
ATOM   3743  C  CG1   . VAL A 1 487 ? -0.422  2.967   43.588  1.00 44.68 ? 487  VAL A CG1   1 
ATOM   3744  C  CG2   . VAL A 1 487 ? -1.875  4.476   42.283  1.00 48.09 ? 487  VAL A CG2   1 
ATOM   3745  N  N     . LYS A 1 488 ? 0.635   4.564   46.216  1.00 40.39 ? 488  LYS A N     1 
ATOM   3746  C  CA    . LYS A 1 488 ? 1.037   4.063   47.540  1.00 41.07 ? 488  LYS A CA    1 
ATOM   3747  C  C     . LYS A 1 488 ? 0.187   4.679   48.638  1.00 41.22 ? 488  LYS A C     1 
ATOM   3748  O  O     . LYS A 1 488 ? -0.427  4.010   49.463  1.00 40.86 ? 488  LYS A O     1 
ATOM   3749  C  CB    . LYS A 1 488 ? 2.529   4.334   47.817  1.00 42.49 ? 488  LYS A CB    1 
ATOM   3750  C  CG    . LYS A 1 488 ? 2.932   4.440   49.295  1.00 36.65 ? 488  LYS A CG    1 
ATOM   3751  C  CD    . LYS A 1 488 ? 4.417   4.809   49.394  1.00 37.83 ? 488  LYS A CD    1 
ATOM   3752  C  CE    . LYS A 1 488 ? 5.029   4.310   50.692  1.00 40.69 ? 488  LYS A CE    1 
ATOM   3753  N  NZ    . LYS A 1 488 ? 6.178   5.155   51.141  1.00 38.16 ? 488  LYS A NZ    1 
ATOM   3754  N  N     . LYS A 1 489 ? 0.070   6.008   48.637  1.00 42.55 ? 489  LYS A N     1 
ATOM   3755  C  CA    . LYS A 1 489 ? -0.721  6.665   49.684  1.00 42.18 ? 489  LYS A CA    1 
ATOM   3756  C  C     . LYS A 1 489 ? -2.164  6.212   49.607  1.00 42.45 ? 489  LYS A C     1 
ATOM   3757  O  O     . LYS A 1 489 ? -2.809  5.934   50.632  1.00 43.64 ? 489  LYS A O     1 
ATOM   3758  C  CB    . LYS A 1 489 ? -0.561  8.176   49.585  1.00 42.65 ? 489  LYS A CB    1 
ATOM   3759  C  CG    . LYS A 1 489 ? -1.822  8.908   50.048  1.00 41.76 ? 489  LYS A CG    1 
ATOM   3760  C  CD    . LYS A 1 489 ? -1.420  10.267  50.592  1.00 47.61 ? 489  LYS A CD    1 
ATOM   3761  C  CE    . LYS A 1 489 ? -2.680  11.142  50.668  1.00 51.35 ? 489  LYS A CE    1 
ATOM   3762  N  NZ    . LYS A 1 489 ? -2.380  12.367  49.865  1.00 52.76 ? 489  LYS A NZ    1 
ATOM   3763  N  N     . ARG A 1 490 ? -2.688  6.048   48.399  1.00 42.33 ? 490  ARG A N     1 
ATOM   3764  C  CA    . ARG A 1 490 ? -4.022  5.449   48.245  1.00 42.30 ? 490  ARG A CA    1 
ATOM   3765  C  C     . ARG A 1 490 ? -4.080  3.999   48.745  1.00 42.48 ? 490  ARG A C     1 
ATOM   3766  O  O     . ARG A 1 490 ? -5.105  3.544   49.306  1.00 43.47 ? 490  ARG A O     1 
ATOM   3767  C  CB    . ARG A 1 490 ? -4.434  5.545   46.786  1.00 41.19 ? 490  ARG A CB    1 
ATOM   3768  C  CG    . ARG A 1 490 ? -4.916  6.911   46.353  1.00 46.56 ? 490  ARG A CG    1 
ATOM   3769  C  CD    . ARG A 1 490 ? -4.892  7.063   44.832  1.00 51.66 ? 490  ARG A CD    1 
ATOM   3770  N  NE    . ARG A 1 490 ? -5.308  8.386   44.363  1.00 53.66 ? 490  ARG A NE    1 
ATOM   3771  C  CZ    . ARG A 1 490 ? -6.035  8.557   43.262  1.00 58.05 ? 490  ARG A CZ    1 
ATOM   3772  N  NH1   . ARG A 1 490 ? -6.379  7.496   42.542  1.00 62.90 ? 490  ARG A NH1   1 
ATOM   3773  N  NH2   . ARG A 1 490 ? -6.432  9.752   42.847  1.00 64.85 ? 490  ARG A NH2   1 
ATOM   3774  N  N     . MET A 1 491 ? -3.088  3.170   48.415  1.00 41.15 ? 491  MET A N     1 
ATOM   3775  C  CA    . MET A 1 491 ? -3.097  1.795   48.909  1.00 41.35 ? 491  MET A CA    1 
ATOM   3776  C  C     . MET A 1 491 ? -3.132  1.847   50.441  1.00 40.37 ? 491  MET A C     1 
ATOM   3777  O  O     . MET A 1 491 ? -3.971  1.191   51.085  1.00 41.29 ? 491  MET A O     1 
ATOM   3778  C  CB    . MET A 1 491 ? -1.911  0.919   48.427  1.00 36.04 ? 491  MET A CB    1 
ATOM   3779  C  CG    . MET A 1 491 ? -1.922  -0.415  49.170  1.00 38.29 ? 491  MET A CG    1 
ATOM   3780  S  SD    . MET A 1 491 ? -3.263  -1.557  48.669  1.00 38.97 ? 491  MET A SD    1 
ATOM   3781  C  CE    . MET A 1 491 ? -2.586  -1.926  47.039  1.00 33.52 ? 491  MET A CE    1 
ATOM   3782  N  N     . ARG A 1 492 ? -2.263  2.669   50.998  1.00 38.47 ? 492  ARG A N     1 
ATOM   3783  C  CA    . ARG A 1 492 ? -2.183  2.887   52.419  1.00 39.02 ? 492  ARG A CA    1 
ATOM   3784  C  C     . ARG A 1 492 ? -3.492  3.329   53.047  1.00 40.16 ? 492  ARG A C     1 
ATOM   3785  O  O     . ARG A 1 492 ? -3.720  2.903   54.203  1.00 41.93 ? 492  ARG A O     1 
ATOM   3786  C  CB    . ARG A 1 492 ? -1.165  3.991   52.771  1.00 46.53 ? 492  ARG A CB    1 
ATOM   3787  C  CG    . ARG A 1 492 ? -1.189  4.343   54.267  1.00 42.41 ? 492  ARG A CG    1 
ATOM   3788  C  CD    . ARG A 1 492 ? -1.048  2.994   55.011  1.00 51.16 ? 492  ARG A CD    1 
ATOM   3789  N  NE    . ARG A 1 492 ? -1.201  3.150   56.446  1.00 49.83 ? 492  ARG A NE    1 
ATOM   3790  C  CZ    . ARG A 1 492 ? -0.233  3.542   57.275  1.00 49.87 ? 492  ARG A CZ    1 
ATOM   3791  N  NH1   . ARG A 1 492 ? 1.007   3.768   56.859  1.00 43.07 ? 492  ARG A NH1   1 
ATOM   3792  N  NH2   . ARG A 1 492 ? -0.607  3.703   58.541  1.00 51.10 ? 492  ARG A NH2   1 
ATOM   3793  N  N     . ALA A 1 493 ? -4.334  4.133   52.396  1.00 39.13 ? 493  ALA A N     1 
ATOM   3794  C  CA    . ALA A 1 493 ? -5.581  4.501   53.071  1.00 39.32 ? 493  ALA A CA    1 
ATOM   3795  C  C     . ALA A 1 493 ? -6.655  3.433   53.070  1.00 40.77 ? 493  ALA A C     1 
ATOM   3796  O  O     . ALA A 1 493 ? -7.536  3.389   53.951  1.00 41.96 ? 493  ALA A O     1 
ATOM   3797  C  CB    . ALA A 1 493 ? -6.108  5.848   52.677  1.00 35.77 ? 493  ALA A CB    1 
ATOM   3798  N  N     . GLU A 1 494 ? -6.588  2.522   52.112  1.00 41.21 ? 494  GLU A N     1 
ATOM   3799  C  CA    . GLU A 1 494 ? -7.508  1.403   52.011  1.00 42.21 ? 494  GLU A CA    1 
ATOM   3800  C  C     . GLU A 1 494 ? -7.159  0.335   53.052  1.00 43.76 ? 494  GLU A C     1 
ATOM   3801  O  O     . GLU A 1 494 ? -8.016  -0.429  53.524  1.00 44.19 ? 494  GLU A O     1 
ATOM   3802  C  CB    . GLU A 1 494 ? -7.385  0.802   50.603  1.00 40.84 ? 494  GLU A CB    1 
ATOM   3803  C  CG    . GLU A 1 494 ? -7.653  1.808   49.489  1.00 43.00 ? 494  GLU A CG    1 
ATOM   3804  C  CD    . GLU A 1 494 ? -9.103  2.210   49.395  1.00 45.71 ? 494  GLU A CD    1 
ATOM   3805  O  OE1   . GLU A 1 494 ? -9.985  1.410   49.710  1.00 46.58 ? 494  GLU A OE1   1 
ATOM   3806  O  OE2   . GLU A 1 494 ? -9.429  3.376   49.087  1.00 51.65 ? 494  GLU A OE2   1 
ATOM   3807  N  N     . MET A 1 495 ? -5.868  0.222   53.332  1.00 43.83 ? 495  MET A N     1 
ATOM   3808  C  CA    . MET A 1 495 ? -5.430  -0.739  54.356  1.00 44.27 ? 495  MET A CA    1 
ATOM   3809  C  C     . MET A 1 495 ? -6.191  -0.400  55.625  1.00 44.45 ? 495  MET A C     1 
ATOM   3810  O  O     . MET A 1 495 ? -7.139  -1.077  55.982  1.00 44.82 ? 495  MET A O     1 
ATOM   3811  C  CB    . MET A 1 495 ? -3.883  -0.661  54.474  1.00 42.44 ? 495  MET A CB    1 
ATOM   3812  C  CG    . MET A 1 495 ? -3.251  -1.216  53.196  1.00 36.75 ? 495  MET A CG    1 
ATOM   3813  S  SD    . MET A 1 495 ? -1.466  -1.179  53.160  1.00 37.40 ? 495  MET A SD    1 
ATOM   3814  C  CE    . MET A 1 495 ? -1.132  -2.530  54.344  1.00 26.43 ? 495  MET A CE    1 
ATOM   3815  N  N     . GLU A 1 496 ? -5.937  0.770   56.202  1.00 45.98 ? 496  GLU A N     1 
ATOM   3816  C  CA    . GLU A 1 496 ? -6.641  1.327   57.341  1.00 45.05 ? 496  GLU A CA    1 
ATOM   3817  C  C     . GLU A 1 496 ? -8.141  1.072   57.286  1.00 43.54 ? 496  GLU A C     1 
ATOM   3818  O  O     . GLU A 1 496 ? -8.674  0.504   58.225  1.00 43.22 ? 496  GLU A O     1 
ATOM   3819  C  CB    . GLU A 1 496 ? -6.452  2.836   57.440  1.00 48.68 ? 496  GLU A CB    1 
ATOM   3820  C  CG    . GLU A 1 496 ? -5.042  3.374   57.378  1.00 53.67 ? 496  GLU A CG    1 
ATOM   3821  C  CD    . GLU A 1 496 ? -4.151  2.898   58.497  1.00 55.87 ? 496  GLU A CD    1 
ATOM   3822  O  OE1   . GLU A 1 496 ? -4.657  2.091   59.302  1.00 59.94 ? 496  GLU A OE1   1 
ATOM   3823  O  OE2   . GLU A 1 496 ? -2.962  3.308   58.550  1.00 60.20 ? 496  GLU A OE2   1 
ATOM   3824  N  N     . LEU A 1 497 ? -8.794  1.439   56.204  1.00 43.61 ? 497  LEU A N     1 
ATOM   3825  C  CA    . LEU A 1 497 ? -10.230 1.273   56.072  1.00 44.03 ? 497  LEU A CA    1 
ATOM   3826  C  C     . LEU A 1 497 ? -10.676 -0.159  56.304  1.00 44.73 ? 497  LEU A C     1 
ATOM   3827  O  O     . LEU A 1 497 ? -11.758 -0.390  56.838  1.00 44.16 ? 497  LEU A O     1 
ATOM   3828  C  CB    . LEU A 1 497 ? -10.813 1.758   54.749  1.00 42.48 ? 497  LEU A CB    1 
ATOM   3829  C  CG    . LEU A 1 497 ? -10.919 3.281   54.547  1.00 45.78 ? 497  LEU A CG    1 
ATOM   3830  C  CD1   . LEU A 1 497 ? -11.132 3.631   53.091  1.00 38.04 ? 497  LEU A CD1   1 
ATOM   3831  C  CD2   . LEU A 1 497 ? -12.022 3.901   55.381  1.00 39.79 ? 497  LEU A CD2   1 
ATOM   3832  N  N     . GLY A 1 498 ? -9.899  -1.108  55.793  1.00 46.34 ? 498  GLY A N     1 
ATOM   3833  C  CA    . GLY A 1 498 ? -10.323 -2.517  55.829  1.00 45.82 ? 498  GLY A CA    1 
ATOM   3834  C  C     . GLY A 1 498 ? -10.060 -3.089  57.222  1.00 46.33 ? 498  GLY A C     1 
ATOM   3835  O  O     . GLY A 1 498 ? -10.689 -4.089  57.577  1.00 44.98 ? 498  GLY A O     1 
ATOM   3836  N  N     . LEU A 1 499 ? -9.073  -2.521  57.916  1.00 47.07 ? 499  LEU A N     1 
ATOM   3837  C  CA    . LEU A 1 499 ? -8.851  -2.915  59.294  1.00 50.08 ? 499  LEU A CA    1 
ATOM   3838  C  C     . LEU A 1 499 ? -9.894  -2.345  60.260  1.00 52.64 ? 499  LEU A C     1 
ATOM   3839  O  O     . LEU A 1 499 ? -10.090 -2.977  61.300  1.00 52.59 ? 499  LEU A O     1 
ATOM   3840  C  CB    . LEU A 1 499 ? -7.477  -2.502  59.819  1.00 44.68 ? 499  LEU A CB    1 
ATOM   3841  C  CG    . LEU A 1 499 ? -6.326  -3.148  59.041  1.00 47.21 ? 499  LEU A CG    1 
ATOM   3842  C  CD1   . LEU A 1 499 ? -5.007  -2.573  59.505  1.00 47.07 ? 499  LEU A CD1   1 
ATOM   3843  C  CD2   . LEU A 1 499 ? -6.415  -4.669  59.158  1.00 44.66 ? 499  LEU A CD2   1 
ATOM   3844  N  N     . ARG A 1 500 ? -10.343 -1.115  60.066  1.00 54.47 ? 500  ARG A N     1 
ATOM   3845  C  CA    . ARG A 1 500 ? -11.284 -0.462  60.968  1.00 56.02 ? 500  ARG A CA    1 
ATOM   3846  C  C     . ARG A 1 500 ? -12.638 -1.159  61.002  1.00 57.29 ? 500  ARG A C     1 
ATOM   3847  O  O     . ARG A 1 500 ? -13.312 -1.320  59.982  1.00 58.92 ? 500  ARG A O     1 
ATOM   3848  C  CB    . ARG A 1 500 ? -11.472 0.995   60.565  1.00 55.03 ? 500  ARG A CB    1 
ATOM   3849  C  CG    . ARG A 1 500 ? -10.277 1.898   60.888  1.00 61.56 ? 500  ARG A CG    1 
ATOM   3850  C  CD    . ARG A 1 500 ? -10.825 3.284   61.232  1.00 68.14 ? 500  ARG A CD    1 
ATOM   3851  N  NE    . ARG A 1 500 ? -10.990 4.145   60.058  1.00 71.80 ? 500  ARG A NE    1 
ATOM   3852  C  CZ    . ARG A 1 500 ? -11.832 5.170   59.963  1.00 72.59 ? 500  ARG A CZ    1 
ATOM   3853  N  NH1   . ARG A 1 500 ? -12.641 5.436   60.987  1.00 72.60 ? 500  ARG A NH1   1 
ATOM   3854  N  NH2   . ARG A 1 500 ? -11.867 5.919   58.857  1.00 73.21 ? 500  ARG A NH2   1 
ATOM   3855  N  N     . LYS A 1 501 ? -13.090 -1.529  62.189  1.00 58.14 ? 501  LYS A N     1 
ATOM   3856  C  CA    . LYS A 1 501 ? -14.316 -2.263  62.431  1.00 59.08 ? 501  LYS A CA    1 
ATOM   3857  C  C     . LYS A 1 501 ? -15.505 -1.595  61.759  1.00 59.75 ? 501  LYS A C     1 
ATOM   3858  O  O     . LYS A 1 501 ? -16.387 -2.223  61.163  1.00 60.43 ? 501  LYS A O     1 
ATOM   3859  C  CB    . LYS A 1 501 ? -14.544 -2.277  63.953  1.00 64.10 ? 501  LYS A CB    1 
ATOM   3860  C  CG    . LYS A 1 501 ? -15.735 -3.115  64.386  1.00 66.90 ? 501  LYS A CG    1 
ATOM   3861  C  CD    . LYS A 1 501 ? -15.791 -3.231  65.903  1.00 71.24 ? 501  LYS A CD    1 
ATOM   3862  C  CE    . LYS A 1 501 ? -14.556 -3.902  66.478  1.00 70.41 ? 501  LYS A CE    1 
ATOM   3863  N  NZ    . LYS A 1 501 ? -13.541 -2.909  66.944  1.00 72.51 ? 501  LYS A NZ    1 
ATOM   3864  N  N     . GLN A 1 502 ? -15.471 -0.269  61.762  1.00 59.73 ? 502  GLN A N     1 
ATOM   3865  C  CA    . GLN A 1 502 ? -16.575 0.500   61.222  1.00 61.02 ? 502  GLN A CA    1 
ATOM   3866  C  C     . GLN A 1 502 ? -16.419 0.925   59.779  1.00 61.92 ? 502  GLN A C     1 
ATOM   3867  O  O     . GLN A 1 502 ? -17.248 1.722   59.293  1.00 63.00 ? 502  GLN A O     1 
ATOM   3868  C  CB    . GLN A 1 502 ? -16.802 1.707   62.140  1.00 62.38 ? 502  GLN A CB    1 
ATOM   3869  C  CG    . GLN A 1 502 ? -17.150 1.292   63.567  1.00 65.36 ? 502  GLN A CG    1 
ATOM   3870  C  CD    . GLN A 1 502 ? -18.429 0.506   63.741  1.00 64.43 ? 502  GLN A CD    1 
ATOM   3871  O  OE1   . GLN A 1 502 ? -19.542 1.030   63.618  1.00 66.05 ? 502  GLN A OE1   1 
ATOM   3872  N  NE2   . GLN A 1 502 ? -18.343 -0.779  64.083  1.00 64.35 ? 502  GLN A NE2   1 
ATOM   3873  N  N     . THR A 1 503 ? -15.388 0.443   59.075  1.00 61.00 ? 503  THR A N     1 
ATOM   3874  C  CA    . THR A 1 503 ? -15.249 0.871   57.696  1.00 59.78 ? 503  THR A CA    1 
ATOM   3875  C  C     . THR A 1 503 ? -15.271 -0.243  56.677  1.00 59.44 ? 503  THR A C     1 
ATOM   3876  O  O     . THR A 1 503 ? -15.308 0.104   55.487  1.00 57.83 ? 503  THR A O     1 
ATOM   3877  C  CB    . THR A 1 503 ? -14.109 1.860   57.502  1.00 58.53 ? 503  THR A CB    1 
ATOM   3878  O  OG1   . THR A 1 503 ? -12.947 1.396   58.194  1.00 56.29 ? 503  THR A OG1   1 
ATOM   3879  C  CG2   . THR A 1 503 ? -14.491 3.217   58.054  1.00 58.86 ? 503  THR A CG2   1 
ATOM   3880  N  N     . HIS A 1 504 ? -15.327 -1.512  57.074  1.00 60.12 ? 504  HIS A N     1 
ATOM   3881  C  CA    . HIS A 1 504 ? -15.548 -2.607  56.139  1.00 61.33 ? 504  HIS A CA    1 
ATOM   3882  C  C     . HIS A 1 504 ? -16.674 -2.400  55.127  1.00 62.32 ? 504  HIS A C     1 
ATOM   3883  O  O     . HIS A 1 504 ? -17.684 -3.114  55.131  1.00 62.53 ? 504  HIS A O     1 
ATOM   3884  C  CB    . HIS A 1 504 ? -15.938 -3.889  56.915  1.00 60.92 ? 504  HIS A CB    1 
ATOM   3885  C  CG    . HIS A 1 504 ? -14.740 -4.781  56.953  1.00 59.74 ? 504  HIS A CG    1 
ATOM   3886  N  ND1   . HIS A 1 504 ? -14.743 -6.095  56.595  1.00 61.86 ? 504  HIS A ND1   1 
ATOM   3887  C  CD2   . HIS A 1 504 ? -13.476 -4.484  57.293  1.00 60.83 ? 504  HIS A CD2   1 
ATOM   3888  C  CE1   . HIS A 1 504 ? -13.526 -6.593  56.671  1.00 59.32 ? 504  HIS A CE1   1 
ATOM   3889  N  NE2   . HIS A 1 504 ? -12.740 -5.628  57.100  1.00 61.94 ? 504  HIS A NE2   1 
ATOM   3890  N  N     . ASN A 1 505 ? -16.469 -1.492  54.182  1.00 62.57 ? 505  ASN A N     1 
ATOM   3891  C  CA    . ASN A 1 505 ? -17.437 -1.174  53.116  1.00 61.16 ? 505  ASN A CA    1 
ATOM   3892  C  C     . ASN A 1 505 ? -16.584 -0.604  51.983  1.00 59.77 ? 505  ASN A C     1 
ATOM   3893  O  O     . ASN A 1 505 ? -15.576 -1.266  51.750  1.00 58.00 ? 505  ASN A O     1 
ATOM   3894  C  CB    . ASN A 1 505 ? -18.452 -0.172  53.615  1.00 62.15 ? 505  ASN A CB    1 
ATOM   3895  C  CG    . ASN A 1 505 ? -19.528 0.168   52.607  1.00 66.20 ? 505  ASN A CG    1 
ATOM   3896  O  OD1   . ASN A 1 505 ? -19.186 0.622   51.511  1.00 65.44 ? 505  ASN A OD1   1 
ATOM   3897  N  ND2   . ASN A 1 505 ? -20.787 -0.011  52.994  1.00 64.65 ? 505  ASN A ND2   1 
ATOM   3898  N  N     . ASN A 1 506 ? -16.641 0.640   51.563  1.00 59.96 ? 506  ASN A N     1 
ATOM   3899  C  CA    . ASN A 1 506 ? -15.678 1.226   50.626  1.00 58.65 ? 506  ASN A CA    1 
ATOM   3900  C  C     . ASN A 1 506 ? -14.270 0.717   50.972  1.00 57.06 ? 506  ASN A C     1 
ATOM   3901  O  O     . ASN A 1 506 ? -13.184 1.229   50.641  1.00 57.65 ? 506  ASN A O     1 
ATOM   3902  C  CB    . ASN A 1 506 ? -15.620 2.761   50.833  1.00 58.33 ? 506  ASN A CB    1 
ATOM   3903  C  CG    . ASN A 1 506 ? -14.635 2.911   51.992  1.00 58.45 ? 506  ASN A CG    1 
ATOM   3904  O  OD1   . ASN A 1 506 ? -13.634 3.604   51.819  1.00 64.00 ? 506  ASN A OD1   1 
ATOM   3905  N  ND2   . ASN A 1 506 ? -14.910 2.184   53.065  1.00 53.45 ? 506  ASN A ND2   1 
ATOM   3906  N  N     . ALA A 1 507 ? -14.335 -0.306  51.818  1.00 53.40 ? 507  ALA A N     1 
ATOM   3907  C  CA    . ALA A 1 507 ? -13.214 -1.169  52.124  1.00 49.12 ? 507  ALA A CA    1 
ATOM   3908  C  C     . ALA A 1 507 ? -13.381 -2.278  51.067  1.00 45.60 ? 507  ALA A C     1 
ATOM   3909  O  O     . ALA A 1 507 ? -14.152 -3.213  51.191  1.00 43.20 ? 507  ALA A O     1 
ATOM   3910  C  CB    . ALA A 1 507 ? -13.273 -1.645  53.549  1.00 50.40 ? 507  ALA A CB    1 
ATOM   3911  N  N     . VAL A 1 508 ? -12.976 -1.882  49.869  1.00 44.21 ? 508  VAL A N     1 
ATOM   3912  C  CA    . VAL A 1 508 ? -12.776 -2.847  48.805  1.00 43.89 ? 508  VAL A CA    1 
ATOM   3913  C  C     . VAL A 1 508 ? -11.546 -3.698  49.172  1.00 43.88 ? 508  VAL A C     1 
ATOM   3914  O  O     . VAL A 1 508 ? -11.581 -4.888  48.898  1.00 44.72 ? 508  VAL A O     1 
ATOM   3915  C  CB    . VAL A 1 508 ? -12.561 -2.125  47.469  1.00 44.34 ? 508  VAL A CB    1 
ATOM   3916  C  CG1   . VAL A 1 508 ? -13.894 -1.780  46.848  1.00 37.83 ? 508  VAL A CG1   1 
ATOM   3917  C  CG2   . VAL A 1 508 ? -11.646 -0.924  47.691  1.00 37.64 ? 508  VAL A CG2   1 
ATOM   3918  N  N     . VAL A 1 509 ? -10.568 -3.187  49.895  1.00 43.10 ? 509  VAL A N     1 
ATOM   3919  C  CA    . VAL A 1 509 ? -9.449  -3.982  50.400  1.00 43.76 ? 509  VAL A CA    1 
ATOM   3920  C  C     . VAL A 1 509 ? -9.788  -4.528  51.798  1.00 43.78 ? 509  VAL A C     1 
ATOM   3921  O  O     . VAL A 1 509 ? -9.524  -3.863  52.801  1.00 44.94 ? 509  VAL A O     1 
ATOM   3922  C  CB    . VAL A 1 509 ? -8.148  -3.160  50.501  1.00 46.72 ? 509  VAL A CB    1 
ATOM   3923  C  CG1   . VAL A 1 509 ? -6.987  -3.966  51.064  1.00 40.48 ? 509  VAL A CG1   1 
ATOM   3924  C  CG2   . VAL A 1 509 ? -7.752  -2.541  49.158  1.00 42.96 ? 509  VAL A CG2   1 
ATOM   3925  N  N     . LYS A 1 510 ? -10.177 -5.782  51.919  1.00 41.97 ? 510  LYS A N     1 
ATOM   3926  C  CA    . LYS A 1 510 ? -10.697 -6.408  53.087  1.00 42.29 ? 510  LYS A CA    1 
ATOM   3927  C  C     . LYS A 1 510 ? -9.775  -6.694  54.258  1.00 43.22 ? 510  LYS A C     1 
ATOM   3928  O  O     . LYS A 1 510 ? -10.250 -6.995  55.370  1.00 44.07 ? 510  LYS A O     1 
ATOM   3929  C  CB    . LYS A 1 510 ? -11.409 -7.710  52.703  1.00 41.21 ? 510  LYS A CB    1 
ATOM   3930  C  CG    . LYS A 1 510 ? -12.599 -7.612  51.786  1.00 47.84 ? 510  LYS A CG    1 
ATOM   3931  C  CD    . LYS A 1 510 ? -13.699 -6.781  52.442  1.00 49.85 ? 510  LYS A CD    1 
ATOM   3932  C  CE    . LYS A 1 510 ? -14.301 -5.848  51.403  1.00 51.51 ? 510  LYS A CE    1 
ATOM   3933  N  NZ    . LYS A 1 510 ? -15.399 -5.044  52.026  1.00 57.96 ? 510  LYS A NZ    1 
ATOM   3934  N  N     . MET A 1 511 ? -8.466  -6.749  54.072  1.00 42.98 ? 511  MET A N     1 
ATOM   3935  C  CA    . MET A 1 511 ? -7.600  -7.052  55.204  1.00 42.49 ? 511  MET A CA    1 
ATOM   3936  C  C     . MET A 1 511 ? -8.173  -8.218  55.989  1.00 42.49 ? 511  MET A C     1 
ATOM   3937  O  O     . MET A 1 511 ? -8.509  -8.022  57.150  1.00 43.28 ? 511  MET A O     1 
ATOM   3938  C  CB    . MET A 1 511 ? -7.618  -5.784  56.081  1.00 41.92 ? 511  MET A CB    1 
ATOM   3939  C  CG    . MET A 1 511 ? -7.073  -4.562  55.376  1.00 42.32 ? 511  MET A CG    1 
ATOM   3940  S  SD    . MET A 1 511 ? -5.567  -4.824  54.430  1.00 41.38 ? 511  MET A SD    1 
ATOM   3941  C  CE    . MET A 1 511 ? -4.349  -3.944  55.371  1.00 39.12 ? 511  MET A CE    1 
ATOM   3942  N  N     . LEU A 1 512 ? -8.273  -9.410  55.450  1.00 42.88 ? 512  LEU A N     1 
ATOM   3943  C  CA    . LEU A 1 512 ? -8.712  -10.613 56.107  1.00 43.21 ? 512  LEU A CA    1 
ATOM   3944  C  C     . LEU A 1 512 ? -7.679  -11.330 56.969  1.00 45.70 ? 512  LEU A C     1 
ATOM   3945  O  O     . LEU A 1 512 ? -6.569  -11.675 56.553  1.00 45.67 ? 512  LEU A O     1 
ATOM   3946  C  CB    . LEU A 1 512 ? -9.186  -11.640 55.063  1.00 38.75 ? 512  LEU A CB    1 
ATOM   3947  C  CG    . LEU A 1 512 ? -10.182 -11.003 54.078  1.00 39.27 ? 512  LEU A CG    1 
ATOM   3948  C  CD1   . LEU A 1 512 ? -10.322 -11.891 52.864  1.00 40.40 ? 512  LEU A CD1   1 
ATOM   3949  C  CD2   . LEU A 1 512 ? -11.501 -10.787 54.793  1.00 39.36 ? 512  LEU A CD2   1 
ATOM   3950  N  N     . PRO A 1 513 ? -8.095  -11.664 58.193  1.00 47.08 ? 513  PRO A N     1 
ATOM   3951  C  CA    . PRO A 1 513 ? -7.258  -12.300 59.206  1.00 45.95 ? 513  PRO A CA    1 
ATOM   3952  C  C     . PRO A 1 513 ? -7.060  -13.763 58.819  1.00 45.34 ? 513  PRO A C     1 
ATOM   3953  O  O     . PRO A 1 513 ? -8.059  -14.322 58.342  1.00 45.26 ? 513  PRO A O     1 
ATOM   3954  C  CB    . PRO A 1 513 ? -8.153  -12.272 60.455  1.00 46.99 ? 513  PRO A CB    1 
ATOM   3955  C  CG    . PRO A 1 513 ? -9.053  -11.086 60.193  1.00 48.06 ? 513  PRO A CG    1 
ATOM   3956  C  CD    . PRO A 1 513 ? -9.444  -11.305 58.742  1.00 47.29 ? 513  PRO A CD    1 
ATOM   3957  N  N     . SER A 1 514 ? -5.836  -14.240 58.826  1.00 44.39 ? 514  SER A N     1 
ATOM   3958  C  CA    . SER A 1 514 ? -5.544  -15.617 58.444  1.00 46.18 ? 514  SER A CA    1 
ATOM   3959  C  C     . SER A 1 514 ? -5.618  -16.491 59.705  1.00 47.86 ? 514  SER A C     1 
ATOM   3960  O  O     . SER A 1 514 ? -5.451  -17.712 59.674  1.00 49.38 ? 514  SER A O     1 
ATOM   3961  C  CB    . SER A 1 514 ? -4.057  -15.718 58.012  1.00 45.16 ? 514  SER A CB    1 
ATOM   3962  O  OG    . SER A 1 514 ? -3.252  -15.127 59.044  1.00 43.59 ? 514  SER A OG    1 
ATOM   3963  N  N     . PHE A 1 515 ? -5.499  -15.798 60.842  1.00 48.69 ? 515  PHE A N     1 
ATOM   3964  C  CA    . PHE A 1 515 ? -5.440  -16.513 62.115  1.00 48.49 ? 515  PHE A CA    1 
ATOM   3965  C  C     . PHE A 1 515 ? -4.120  -17.248 62.217  1.00 47.80 ? 515  PHE A C     1 
ATOM   3966  O  O     . PHE A 1 515 ? -4.056  -18.235 62.964  1.00 47.30 ? 515  PHE A O     1 
ATOM   3967  C  CB    . PHE A 1 515 ? -6.647  -17.473 62.216  1.00 50.32 ? 515  PHE A CB    1 
ATOM   3968  C  CG    . PHE A 1 515 ? -7.888  -16.818 62.754  1.00 52.74 ? 515  PHE A CG    1 
ATOM   3969  C  CD1   . PHE A 1 515 ? -8.025  -16.554 64.110  1.00 53.72 ? 515  PHE A CD1   1 
ATOM   3970  C  CD2   . PHE A 1 515 ? -8.925  -16.441 61.916  1.00 54.16 ? 515  PHE A CD2   1 
ATOM   3971  C  CE1   . PHE A 1 515 ? -9.173  -15.954 64.600  1.00 55.18 ? 515  PHE A CE1   1 
ATOM   3972  C  CE2   . PHE A 1 515 ? -10.073 -15.843 62.402  1.00 52.68 ? 515  PHE A CE2   1 
ATOM   3973  C  CZ    . PHE A 1 515 ? -10.186 -15.577 63.743  1.00 53.87 ? 515  PHE A CZ    1 
ATOM   3974  N  N     . VAL A 1 516 ? -3.089  -16.840 61.466  1.00 48.21 ? 516  VAL A N     1 
ATOM   3975  C  CA    . VAL A 1 516 ? -1.751  -17.377 61.718  1.00 47.44 ? 516  VAL A CA    1 
ATOM   3976  C  C     . VAL A 1 516 ? -1.006  -16.357 62.547  1.00 48.93 ? 516  VAL A C     1 
ATOM   3977  O  O     . VAL A 1 516 ? -0.979  -15.180 62.170  1.00 49.87 ? 516  VAL A O     1 
ATOM   3978  C  CB    . VAL A 1 516 ? -0.960  -18.128 60.696  1.00 50.19 ? 516  VAL A CB    1 
ATOM   3979  C  CG1   . VAL A 1 516 ? -1.801  -18.709 59.568  1.00 43.98 ? 516  VAL A CG1   1 
ATOM   3980  C  CG2   . VAL A 1 516 ? 0.377   -17.584 60.248  1.00 40.18 ? 516  VAL A CG2   1 
ATOM   3981  N  N     . ARG A 1 517 ? -0.626  -16.716 63.781  1.00 49.28 ? 517  ARG A N     1 
ATOM   3982  C  CA    . ARG A 1 517 ? -0.230  -15.705 64.742  1.00 49.53 ? 517  ARG A CA    1 
ATOM   3983  C  C     . ARG A 1 517 ? 1.241   -15.453 64.823  1.00 50.05 ? 517  ARG A C     1 
ATOM   3984  O  O     . ARG A 1 517 ? 1.693   -14.441 65.333  1.00 49.94 ? 517  ARG A O     1 
ATOM   3985  C  CB    . ARG A 1 517 ? -0.995  -15.799 66.055  1.00 52.08 ? 517  ARG A CB    1 
ATOM   3986  C  CG    . ARG A 1 517 ? -2.470  -15.452 65.872  1.00 52.03 ? 517  ARG A CG    1 
ATOM   3987  C  CD    . ARG A 1 517 ? -3.418  -16.143 66.856  1.00 55.38 ? 517  ARG A CD    1 
ATOM   3988  N  NE    . ARG A 1 517 ? -4.404  -15.211 67.382  1.00 54.77 ? 517  ARG A NE    1 
ATOM   3989  C  CZ    . ARG A 1 517 ? -5.687  -15.398 67.580  1.00 56.42 ? 517  ARG A CZ    1 
ATOM   3990  N  NH1   . ARG A 1 517 ? -6.288  -16.570 67.373  1.00 59.36 ? 517  ARG A NH1   1 
ATOM   3991  N  NH2   . ARG A 1 517 ? -6.391  -14.371 68.026  1.00 56.08 ? 517  ARG A NH2   1 
ATOM   3992  N  N     . ARG A 1 518 ? 2.032   -16.247 64.129  1.00 51.10 ? 518  ARG A N     1 
ATOM   3993  C  CA    . ARG A 1 518 ? 3.471   -16.091 64.152  1.00 53.08 ? 518  ARG A CA    1 
ATOM   3994  C  C     . ARG A 1 518 ? 4.076   -16.900 63.012  1.00 52.90 ? 518  ARG A C     1 
ATOM   3995  O  O     . ARG A 1 518 ? 3.437   -17.820 62.520  1.00 52.18 ? 518  ARG A O     1 
ATOM   3996  C  CB    . ARG A 1 518 ? 4.075   -16.535 65.498  1.00 57.64 ? 518  ARG A CB    1 
ATOM   3997  C  CG    . ARG A 1 518 ? 3.598   -17.897 65.962  1.00 62.96 ? 518  ARG A CG    1 
ATOM   3998  C  CD    . ARG A 1 518 ? 4.588   -18.584 66.885  1.00 67.02 ? 518  ARG A CD    1 
ATOM   3999  N  NE    . ARG A 1 518 ? 4.341   -20.016 67.009  1.00 71.59 ? 518  ARG A NE    1 
ATOM   4000  C  CZ    . ARG A 1 518 ? 4.807   -20.966 66.200  1.00 75.78 ? 518  ARG A CZ    1 
ATOM   4001  N  NH1   . ARG A 1 518 ? 5.577   -20.675 65.153  1.00 75.55 ? 518  ARG A NH1   1 
ATOM   4002  N  NH2   . ARG A 1 518 ? 4.522   -22.253 66.432  1.00 77.27 ? 518  ARG A NH2   1 
ATOM   4003  N  N     . THR A 1 519 ? 5.329   -16.589 62.746  1.00 54.02 ? 519  THR A N     1 
ATOM   4004  C  CA    . THR A 1 519 ? 6.046   -17.351 61.697  1.00 55.85 ? 519  THR A CA    1 
ATOM   4005  C  C     . THR A 1 519 ? 6.559   -18.619 62.336  1.00 55.93 ? 519  THR A C     1 
ATOM   4006  O  O     . THR A 1 519 ? 6.150   -18.911 63.473  1.00 55.64 ? 519  THR A O     1 
ATOM   4007  C  CB    . THR A 1 519 ? 7.047   -16.372 61.094  1.00 58.42 ? 519  THR A CB    1 
ATOM   4008  O  OG1   . THR A 1 519 ? 7.733   -16.985 60.007  1.00 66.04 ? 519  THR A OG1   1 
ATOM   4009  C  CG2   . THR A 1 519 ? 7.976   -15.830 62.158  1.00 56.85 ? 519  THR A CG2   1 
ATOM   4010  N  N     . PRO A 1 520 ? 7.205   -19.514 61.614  1.00 55.79 ? 520  PRO A N     1 
ATOM   4011  C  CA    . PRO A 1 520 ? 7.605   -20.812 62.139  1.00 56.30 ? 520  PRO A CA    1 
ATOM   4012  C  C     . PRO A 1 520 ? 8.610   -20.670 63.268  1.00 57.24 ? 520  PRO A C     1 
ATOM   4013  O  O     . PRO A 1 520 ? 9.210   -19.615 63.471  1.00 57.83 ? 520  PRO A O     1 
ATOM   4014  C  CB    . PRO A 1 520 ? 8.071   -21.605 60.946  1.00 55.21 ? 520  PRO A CB    1 
ATOM   4015  C  CG    . PRO A 1 520 ? 7.528   -20.857 59.777  1.00 55.17 ? 520  PRO A CG    1 
ATOM   4016  C  CD    . PRO A 1 520 ? 7.557   -19.395 60.185  1.00 55.61 ? 520  PRO A CD    1 
ATOM   4017  N  N     . ASP A 1 521 ? 8.681   -21.676 64.109  1.00 58.05 ? 521  ASP A N     1 
ATOM   4018  C  CA    . ASP A 1 521 ? 9.400   -21.605 65.374  1.00 60.30 ? 521  ASP A CA    1 
ATOM   4019  C  C     . ASP A 1 521 ? 10.055  -22.953 65.678  1.00 60.61 ? 521  ASP A C     1 
ATOM   4020  O  O     . ASP A 1 521 ? 9.532   -23.646 66.551  1.00 61.54 ? 521  ASP A O     1 
ATOM   4021  C  CB    . ASP A 1 521 ? 8.266   -21.494 66.406  1.00 65.89 ? 521  ASP A CB    1 
ATOM   4022  C  CG    . ASP A 1 521 ? 8.323   -20.337 67.354  1.00 70.41 ? 521  ASP A CG    1 
ATOM   4023  O  OD1   . ASP A 1 521 ? 9.237   -19.492 67.198  1.00 71.64 ? 521  ASP A OD1   1 
ATOM   4024  O  OD2   . ASP A 1 521 ? 7.421   -20.333 68.235  1.00 70.16 ? 521  ASP A OD2   1 
ATOM   4025  N  N     . GLY A 1 522 ? 10.945  -23.424 64.842  1.00 59.60 ? 522  GLY A N     1 
ATOM   4026  C  CA    . GLY A 1 522 ? 11.647  -24.655 64.920  1.00 58.64 ? 522  GLY A CA    1 
ATOM   4027  C  C     . GLY A 1 522 ? 11.103  -25.863 65.643  1.00 57.59 ? 522  GLY A C     1 
ATOM   4028  O  O     . GLY A 1 522 ? 11.830  -26.853 65.768  1.00 57.80 ? 522  GLY A O     1 
ATOM   4029  N  N     . THR A 1 523 ? 9.871   -25.846 66.113  1.00 56.30 ? 523  THR A N     1 
ATOM   4030  C  CA    . THR A 1 523 ? 9.242   -26.908 66.849  1.00 55.11 ? 523  THR A CA    1 
ATOM   4031  C  C     . THR A 1 523 ? 8.185   -27.637 66.057  1.00 54.40 ? 523  THR A C     1 
ATOM   4032  O  O     . THR A 1 523 ? 7.832   -28.734 66.487  1.00 55.47 ? 523  THR A O     1 
ATOM   4033  C  CB    . THR A 1 523 ? 8.708   -26.423 68.211  1.00 56.41 ? 523  THR A CB    1 
ATOM   4034  O  OG1   . THR A 1 523 ? 7.555   -25.588 68.118  1.00 61.34 ? 523  THR A OG1   1 
ATOM   4035  C  CG2   . THR A 1 523 ? 9.741   -25.550 68.939  1.00 58.58 ? 523  THR A CG2   1 
ATOM   4036  N  N     . GLU A 1 524 ? 7.748   -27.177 64.888  1.00 52.98 ? 524  GLU A N     1 
ATOM   4037  C  CA    . GLU A 1 524 ? 6.747   -27.904 64.103  1.00 51.76 ? 524  GLU A CA    1 
ATOM   4038  C  C     . GLU A 1 524 ? 7.232   -29.273 63.649  1.00 50.49 ? 524  GLU A C     1 
ATOM   4039  O  O     . GLU A 1 524 ? 8.369   -29.423 63.187  1.00 49.06 ? 524  GLU A O     1 
ATOM   4040  C  CB    . GLU A 1 524 ? 6.181   -27.057 62.978  1.00 50.76 ? 524  GLU A CB    1 
ATOM   4041  C  CG    . GLU A 1 524 ? 5.699   -25.676 63.374  1.00 48.75 ? 524  GLU A CG    1 
ATOM   4042  C  CD    . GLU A 1 524 ? 6.742   -24.583 63.493  1.00 51.78 ? 524  GLU A CD    1 
ATOM   4043  O  OE1   . GLU A 1 524 ? 7.973   -24.773 63.575  1.00 49.80 ? 524  GLU A OE1   1 
ATOM   4044  O  OE2   . GLU A 1 524 ? 6.323   -23.394 63.563  1.00 51.05 ? 524  GLU A OE2   1 
ATOM   4045  N  N     . ASN A 1 525 ? 6.411   -30.313 63.874  1.00 49.71 ? 525  ASN A N     1 
ATOM   4046  C  CA    . ASN A 1 525 ? 6.894   -31.672 63.621  1.00 49.77 ? 525  ASN A CA    1 
ATOM   4047  C  C     . ASN A 1 525 ? 5.803   -32.611 63.158  1.00 48.73 ? 525  ASN A C     1 
ATOM   4048  O  O     . ASN A 1 525 ? 4.727   -32.677 63.769  1.00 50.28 ? 525  ASN A O     1 
ATOM   4049  C  CB    . ASN A 1 525 ? 7.622   -32.176 64.883  1.00 48.56 ? 525  ASN A CB    1 
ATOM   4050  C  CG    . ASN A 1 525 ? 8.516   -33.382 64.672  1.00 52.80 ? 525  ASN A CG    1 
ATOM   4051  O  OD1   . ASN A 1 525 ? 9.756   -33.340 64.568  1.00 54.27 ? 525  ASN A OD1   1 
ATOM   4052  N  ND2   . ASN A 1 525 ? 7.920   -34.575 64.657  1.00 49.84 ? 525  ASN A ND2   1 
ATOM   4053  N  N     . GLY A 1 526 ? 6.026   -33.394 62.099  1.00 46.67 ? 526  GLY A N     1 
ATOM   4054  C  CA    . GLY A 1 526 ? 4.965   -34.337 61.729  1.00 45.36 ? 526  GLY A CA    1 
ATOM   4055  C  C     . GLY A 1 526 ? 4.805   -34.565 60.231  1.00 44.73 ? 526  GLY A C     1 
ATOM   4056  O  O     . GLY A 1 526 ? 5.539   -34.039 59.395  1.00 43.85 ? 526  GLY A O     1 
ATOM   4057  N  N     . ASP A 1 527 ? 3.785   -35.358 59.932  1.00 43.53 ? 527  ASP A N     1 
ATOM   4058  C  CA    . ASP A 1 527 ? 3.344   -35.822 58.651  1.00 43.91 ? 527  ASP A CA    1 
ATOM   4059  C  C     . ASP A 1 527 ? 1.989   -35.276 58.209  1.00 43.90 ? 527  ASP A C     1 
ATOM   4060  O  O     . ASP A 1 527 ? 0.924   -35.584 58.736  1.00 44.85 ? 527  ASP A O     1 
ATOM   4061  C  CB    . ASP A 1 527 ? 3.271   -37.363 58.653  1.00 41.19 ? 527  ASP A CB    1 
ATOM   4062  C  CG    . ASP A 1 527 ? 4.651   -38.010 58.650  1.00 41.88 ? 527  ASP A CG    1 
ATOM   4063  O  OD1   . ASP A 1 527 ? 5.688   -37.344 58.679  1.00 41.04 ? 527  ASP A OD1   1 
ATOM   4064  O  OD2   . ASP A 1 527 ? 4.692   -39.264 58.586  1.00 46.41 ? 527  ASP A OD2   1 
ATOM   4065  N  N     . PHE A 1 528 ? 1.982   -34.375 57.226  1.00 43.79 ? 528  PHE A N     1 
ATOM   4066  C  CA    . PHE A 1 528 ? 0.758   -33.660 56.868  1.00 42.72 ? 528  PHE A CA    1 
ATOM   4067  C  C     . PHE A 1 528 ? 0.397   -33.882 55.422  1.00 41.82 ? 528  PHE A C     1 
ATOM   4068  O  O     . PHE A 1 528 ? 1.306   -33.828 54.608  1.00 42.92 ? 528  PHE A O     1 
ATOM   4069  C  CB    . PHE A 1 528 ? 1.010   -32.137 57.033  1.00 38.54 ? 528  PHE A CB    1 
ATOM   4070  C  CG    . PHE A 1 528 ? 1.441   -31.847 58.435  1.00 35.77 ? 528  PHE A CG    1 
ATOM   4071  C  CD1   . PHE A 1 528 ? 0.490   -31.665 59.427  1.00 37.32 ? 528  PHE A CD1   1 
ATOM   4072  C  CD2   . PHE A 1 528 ? 2.783   -31.808 58.756  1.00 38.18 ? 528  PHE A CD2   1 
ATOM   4073  C  CE1   . PHE A 1 528 ? 0.886   -31.428 60.734  1.00 37.21 ? 528  PHE A CE1   1 
ATOM   4074  C  CE2   . PHE A 1 528 ? 3.184   -31.594 60.072  1.00 39.01 ? 528  PHE A CE2   1 
ATOM   4075  C  CZ    . PHE A 1 528 ? 2.229   -31.398 61.054  1.00 38.36 ? 528  PHE A CZ    1 
ATOM   4076  N  N     . LEU A 1 529 ? -0.881  -33.873 55.135  1.00 42.09 ? 529  LEU A N     1 
ATOM   4077  C  CA    . LEU A 1 529 ? -1.354  -33.779 53.752  1.00 42.01 ? 529  LEU A CA    1 
ATOM   4078  C  C     . LEU A 1 529 ? -1.651  -32.282 53.536  1.00 42.88 ? 529  LEU A C     1 
ATOM   4079  O  O     . LEU A 1 529 ? -1.963  -31.575 54.486  1.00 42.34 ? 529  LEU A O     1 
ATOM   4080  C  CB    . LEU A 1 529 ? -2.626  -34.545 53.535  1.00 38.07 ? 529  LEU A CB    1 
ATOM   4081  C  CG    . LEU A 1 529 ? -2.596  -36.070 53.505  1.00 43.30 ? 529  LEU A CG    1 
ATOM   4082  C  CD1   . LEU A 1 529 ? -4.042  -36.563 53.427  1.00 37.38 ? 529  LEU A CD1   1 
ATOM   4083  C  CD2   . LEU A 1 529 ? -1.783  -36.602 52.325  1.00 36.96 ? 529  LEU A CD2   1 
ATOM   4084  N  N     . ALA A 1 530 ? -1.472  -31.803 52.305  1.00 42.53 ? 530  ALA A N     1 
ATOM   4085  C  CA    . ALA A 1 530 ? -1.813  -30.418 52.016  1.00 41.27 ? 530  ALA A CA    1 
ATOM   4086  C  C     . ALA A 1 530 ? -2.449  -30.418 50.631  1.00 41.15 ? 530  ALA A C     1 
ATOM   4087  O  O     . ALA A 1 530 ? -2.377  -31.396 49.902  1.00 40.49 ? 530  ALA A O     1 
ATOM   4088  C  CB    . ALA A 1 530 ? -0.650  -29.474 52.169  1.00 37.32 ? 530  ALA A CB    1 
ATOM   4089  N  N     . LEU A 1 531 ? -3.181  -29.371 50.316  1.00 41.13 ? 531  LEU A N     1 
ATOM   4090  C  CA    . LEU A 1 531 ? -3.919  -29.294 49.046  1.00 42.69 ? 531  LEU A CA    1 
ATOM   4091  C  C     . LEU A 1 531 ? -3.545  -27.932 48.454  1.00 43.89 ? 531  LEU A C     1 
ATOM   4092  O  O     . LEU A 1 531 ? -3.257  -27.036 49.253  1.00 44.44 ? 531  LEU A O     1 
ATOM   4093  C  CB    . LEU A 1 531 ? -5.377  -29.352 49.502  1.00 39.64 ? 531  LEU A CB    1 
ATOM   4094  C  CG    . LEU A 1 531 ? -6.362  -30.317 48.883  1.00 45.96 ? 531  LEU A CG    1 
ATOM   4095  C  CD1   . LEU A 1 531 ? -5.819  -31.714 48.738  1.00 40.07 ? 531  LEU A CD1   1 
ATOM   4096  C  CD2   . LEU A 1 531 ? -7.725  -30.264 49.585  1.00 40.55 ? 531  LEU A CD2   1 
ATOM   4097  N  N     . ASP A 1 532 ? -3.362  -27.781 47.136  1.00 44.08 ? 532  ASP A N     1 
ATOM   4098  C  CA    . ASP A 1 532 ? -3.029  -26.468 46.570  1.00 42.12 ? 532  ASP A CA    1 
ATOM   4099  C  C     . ASP A 1 532 ? -4.012  -26.120 45.453  1.00 41.34 ? 532  ASP A C     1 
ATOM   4100  O  O     . ASP A 1 532 ? -3.798  -26.538 44.303  1.00 42.07 ? 532  ASP A O     1 
ATOM   4101  C  CB    . ASP A 1 532 ? -1.649  -26.549 45.912  1.00 42.75 ? 532  ASP A CB    1 
ATOM   4102  C  CG    . ASP A 1 532 ? -0.970  -25.203 45.815  1.00 43.92 ? 532  ASP A CG    1 
ATOM   4103  O  OD1   . ASP A 1 532 ? -1.577  -24.151 46.122  1.00 42.05 ? 532  ASP A OD1   1 
ATOM   4104  O  OD2   . ASP A 1 532 ? 0.225   -25.224 45.430  1.00 45.49 ? 532  ASP A OD2   1 
ATOM   4105  N  N     . LEU A 1 533 ? -5.038  -25.336 45.743  1.00 39.58 ? 533  LEU A N     1 
ATOM   4106  C  CA    . LEU A 1 533 ? -6.040  -25.017 44.731  1.00 38.18 ? 533  LEU A CA    1 
ATOM   4107  C  C     . LEU A 1 533 ? -6.127  -23.527 44.462  1.00 37.06 ? 533  LEU A C     1 
ATOM   4108  O  O     . LEU A 1 533 ? -6.434  -22.837 45.438  1.00 38.31 ? 533  LEU A O     1 
ATOM   4109  C  CB    . LEU A 1 533 ? -7.412  -25.459 45.297  1.00 38.01 ? 533  LEU A CB    1 
ATOM   4110  C  CG    . LEU A 1 533 ? -8.550  -25.463 44.261  1.00 39.46 ? 533  LEU A CG    1 
ATOM   4111  C  CD1   . LEU A 1 533 ? -8.149  -26.273 43.037  1.00 34.00 ? 533  LEU A CD1   1 
ATOM   4112  C  CD2   . LEU A 1 533 ? -9.818  -26.103 44.825  1.00 41.25 ? 533  LEU A CD2   1 
ATOM   4113  N  N     . GLY A 1 534 ? -6.023  -23.023 43.263  1.00 36.85 ? 534  GLY A N     1 
ATOM   4114  C  CA    . GLY A 1 534 ? -6.213  -21.637 42.935  1.00 37.53 ? 534  GLY A CA    1 
ATOM   4115  C  C     . GLY A 1 534 ? -5.278  -21.045 41.898  1.00 38.53 ? 534  GLY A C     1 
ATOM   4116  O  O     . GLY A 1 534 ? -5.582  -20.051 41.226  1.00 38.66 ? 534  GLY A O     1 
ATOM   4117  N  N     . GLY A 1 535 ? -4.039  -21.494 41.888  1.00 38.57 ? 535  GLY A N     1 
ATOM   4118  C  CA    . GLY A 1 535 ? -3.011  -21.173 40.933  1.00 39.85 ? 535  GLY A CA    1 
ATOM   4119  C  C     . GLY A 1 535 ? -3.070  -22.078 39.706  1.00 39.69 ? 535  GLY A C     1 
ATOM   4120  O  O     . GLY A 1 535 ? -4.039  -22.768 39.466  1.00 39.73 ? 535  GLY A O     1 
ATOM   4121  N  N     . THR A 1 536 ? -1.982  -22.108 38.953  1.00 41.33 ? 536  THR A N     1 
ATOM   4122  C  CA    . THR A 1 536 ? -1.864  -22.888 37.740  1.00 40.64 ? 536  THR A CA    1 
ATOM   4123  C  C     . THR A 1 536 ? -2.051  -24.358 37.915  1.00 39.58 ? 536  THR A C     1 
ATOM   4124  O  O     . THR A 1 536 ? -2.789  -24.927 37.112  1.00 40.16 ? 536  THR A O     1 
ATOM   4125  C  CB    . THR A 1 536 ? -0.649  -22.541 36.876  1.00 44.39 ? 536  THR A CB    1 
ATOM   4126  O  OG1   . THR A 1 536 ? 0.576   -23.057 37.387  1.00 53.32 ? 536  THR A OG1   1 
ATOM   4127  C  CG2   . THR A 1 536 ? -0.479  -21.040 36.724  1.00 45.67 ? 536  THR A CG2   1 
ATOM   4128  N  N     . ASN A 1 537 ? -1.583  -25.006 38.986  1.00 39.70 ? 537  ASN A N     1 
ATOM   4129  C  CA    . ASN A 1 537 ? -1.928  -26.426 39.114  1.00 39.14 ? 537  ASN A CA    1 
ATOM   4130  C  C     . ASN A 1 537 ? -2.664  -26.729 40.406  1.00 40.40 ? 537  ASN A C     1 
ATOM   4131  O  O     . ASN A 1 537 ? -2.225  -26.381 41.498  1.00 43.27 ? 537  ASN A O     1 
ATOM   4132  C  CB    . ASN A 1 537 ? -0.678  -27.299 38.968  1.00 38.82 ? 537  ASN A CB    1 
ATOM   4133  C  CG    . ASN A 1 537 ? 0.229   -26.999 37.803  1.00 41.43 ? 537  ASN A CG    1 
ATOM   4134  O  OD1   . ASN A 1 537 ? -0.039  -27.411 36.658  1.00 40.11 ? 537  ASN A OD1   1 
ATOM   4135  N  ND2   . ASN A 1 537 ? 1.331   -26.296 38.058  1.00 38.83 ? 537  ASN A ND2   1 
ATOM   4136  N  N     . PHE A 1 538 ? -3.594  -27.704 40.294  1.00 40.47 ? 538  PHE A N     1 
ATOM   4137  C  CA    . PHE A 1 538 ? -4.253  -28.215 41.493  1.00 39.94 ? 538  PHE A CA    1 
ATOM   4138  C  C     . PHE A 1 538 ? -3.343  -29.348 41.996  1.00 41.49 ? 538  PHE A C     1 
ATOM   4139  O  O     . PHE A 1 538 ? -3.228  -30.332 41.261  1.00 40.44 ? 538  PHE A O     1 
ATOM   4140  C  CB    . PHE A 1 538 ? -5.612  -28.876 41.193  1.00 34.28 ? 538  PHE A CB    1 
ATOM   4141  C  CG    . PHE A 1 538 ? -6.090  -29.660 42.391  1.00 37.58 ? 538  PHE A CG    1 
ATOM   4142  C  CD1   . PHE A 1 538 ? -5.912  -29.154 43.662  1.00 36.29 ? 538  PHE A CD1   1 
ATOM   4143  C  CD2   . PHE A 1 538 ? -6.671  -30.908 42.234  1.00 37.62 ? 538  PHE A CD2   1 
ATOM   4144  C  CE1   . PHE A 1 538 ? -6.308  -29.885 44.770  1.00 36.36 ? 538  PHE A CE1   1 
ATOM   4145  C  CE2   . PHE A 1 538 ? -7.092  -31.639 43.328  1.00 38.93 ? 538  PHE A CE2   1 
ATOM   4146  C  CZ    . PHE A 1 538 ? -6.918  -31.107 44.594  1.00 39.91 ? 538  PHE A CZ    1 
ATOM   4147  N  N     . ARG A 1 539 ? -2.699  -29.192 43.145  1.00 41.68 ? 539  ARG A N     1 
ATOM   4148  C  CA    . ARG A 1 539 ? -1.884  -30.264 43.637  1.00 41.08 ? 539  ARG A CA    1 
ATOM   4149  C  C     . ARG A 1 539 ? -2.196  -30.842 45.001  1.00 41.51 ? 539  ARG A C     1 
ATOM   4150  O  O     . ARG A 1 539 ? -2.758  -30.156 45.886  1.00 41.58 ? 539  ARG A O     1 
ATOM   4151  C  CB    . ARG A 1 539 ? -0.440  -30.156 43.249  1.00 40.39 ? 539  ARG A CB    1 
ATOM   4152  C  CG    . ARG A 1 539 ? 0.468   -29.282 44.012  1.00 43.24 ? 539  ARG A CG    1 
ATOM   4153  C  CD    . ARG A 1 539 ? 1.868   -29.148 43.492  1.00 44.02 ? 539  ARG A CD    1 
ATOM   4154  N  NE    . ARG A 1 539 ? 2.022   -28.776 42.103  1.00 54.12 ? 539  ARG A NE    1 
ATOM   4155  C  CZ    . ARG A 1 539 ? 3.108   -28.069 41.735  1.00 52.09 ? 539  ARG A CZ    1 
ATOM   4156  N  NH1   . ARG A 1 539 ? 4.013   -27.841 42.674  1.00 62.93 ? 539  ARG A NH1   1 
ATOM   4157  N  NH2   . ARG A 1 539 ? 3.287   -27.801 40.460  1.00 56.07 ? 539  ARG A NH2   1 
ATOM   4158  N  N     . VAL A 1 540 ? -1.916  -32.163 45.110  1.00 39.51 ? 540  VAL A N     1 
ATOM   4159  C  CA    . VAL A 1 540 ? -2.048  -32.866 46.386  1.00 40.01 ? 540  VAL A CA    1 
ATOM   4160  C  C     . VAL A 1 540 ? -0.667  -33.253 46.908  1.00 40.79 ? 540  VAL A C     1 
ATOM   4161  O  O     . VAL A 1 540 ? 0.175   -33.707 46.160  1.00 41.48 ? 540  VAL A O     1 
ATOM   4162  C  CB    . VAL A 1 540 ? -2.900  -34.137 46.266  1.00 40.65 ? 540  VAL A CB    1 
ATOM   4163  C  CG1   . VAL A 1 540 ? -2.978  -34.749 47.654  1.00 39.31 ? 540  VAL A CG1   1 
ATOM   4164  C  CG2   . VAL A 1 540 ? -4.317  -33.834 45.783  1.00 33.42 ? 540  VAL A CG2   1 
ATOM   4165  N  N     . LEU A 1 541 ? -0.304  -32.987 48.135  1.00 41.45 ? 541  LEU A N     1 
ATOM   4166  C  CA    . LEU A 1 541 ? 1.021   -33.028 48.693  1.00 41.94 ? 541  LEU A CA    1 
ATOM   4167  C  C     . LEU A 1 541 ? 1.089   -33.876 49.972  1.00 42.06 ? 541  LEU A C     1 
ATOM   4168  O  O     . LEU A 1 541 ? 0.149   -33.879 50.750  1.00 42.54 ? 541  LEU A O     1 
ATOM   4169  C  CB    . LEU A 1 541 ? 1.454   -31.599 49.063  1.00 36.59 ? 541  LEU A CB    1 
ATOM   4170  C  CG    . LEU A 1 541 ? 1.690   -30.532 47.995  1.00 41.64 ? 541  LEU A CG    1 
ATOM   4171  C  CD1   . LEU A 1 541 ? 0.401   -29.728 47.782  1.00 37.25 ? 541  LEU A CD1   1 
ATOM   4172  C  CD2   . LEU A 1 541 ? 2.791   -29.540 48.382  1.00 30.30 ? 541  LEU A CD2   1 
ATOM   4173  N  N     . LEU A 1 542 ? 2.223   -34.479 50.263  1.00 41.72 ? 542  LEU A N     1 
ATOM   4174  C  CA    . LEU A 1 542 ? 2.602   -35.122 51.501  1.00 40.29 ? 542  LEU A CA    1 
ATOM   4175  C  C     . LEU A 1 542 ? 3.819   -34.370 52.017  1.00 40.16 ? 542  LEU A C     1 
ATOM   4176  O  O     . LEU A 1 542 ? 4.757   -34.179 51.233  1.00 39.22 ? 542  LEU A O     1 
ATOM   4177  C  CB    . LEU A 1 542 ? 2.980   -36.605 51.347  1.00 41.57 ? 542  LEU A CB    1 
ATOM   4178  C  CG    . LEU A 1 542 ? 3.672   -37.351 52.492  1.00 40.40 ? 542  LEU A CG    1 
ATOM   4179  C  CD1   . LEU A 1 542 ? 2.906   -37.293 53.798  1.00 34.84 ? 542  LEU A CD1   1 
ATOM   4180  C  CD2   . LEU A 1 542 ? 3.921   -38.822 52.174  1.00 38.27 ? 542  LEU A CD2   1 
ATOM   4181  N  N     . VAL A 1 543 ? 3.719   -33.759 53.191  1.00 41.69 ? 543  VAL A N     1 
ATOM   4182  C  CA    . VAL A 1 543 ? 4.839   -32.984 53.722  1.00 42.67 ? 543  VAL A CA    1 
ATOM   4183  C  C     . VAL A 1 543 ? 5.260   -33.478 55.115  1.00 44.75 ? 543  VAL A C     1 
ATOM   4184  O  O     . VAL A 1 543 ? 4.531   -33.401 56.101  1.00 46.43 ? 543  VAL A O     1 
ATOM   4185  C  CB    . VAL A 1 543 ? 4.655   -31.471 53.760  1.00 37.09 ? 543  VAL A CB    1 
ATOM   4186  C  CG1   . VAL A 1 543 ? 5.962   -30.779 54.152  1.00 32.06 ? 543  VAL A CG1   1 
ATOM   4187  C  CG2   . VAL A 1 543 ? 4.165   -30.925 52.433  1.00 32.97 ? 543  VAL A CG2   1 
ATOM   4188  N  N     . LYS A 1 544 ? 6.423   -34.107 55.203  1.00 44.31 ? 544  LYS A N     1 
ATOM   4189  C  CA    . LYS A 1 544 ? 6.974   -34.584 56.455  1.00 44.37 ? 544  LYS A CA    1 
ATOM   4190  C  C     . LYS A 1 544 ? 8.016   -33.605 56.997  1.00 44.33 ? 544  LYS A C     1 
ATOM   4191  O  O     . LYS A 1 544 ? 9.018   -33.388 56.344  1.00 44.54 ? 544  LYS A O     1 
ATOM   4192  C  CB    . LYS A 1 544 ? 7.646   -35.951 56.278  1.00 40.75 ? 544  LYS A CB    1 
ATOM   4193  C  CG    . LYS A 1 544 ? 6.614   -37.066 56.147  1.00 39.90 ? 544  LYS A CG    1 
ATOM   4194  C  CD    . LYS A 1 544 ? 7.354   -38.301 55.655  1.00 42.00 ? 544  LYS A CD    1 
ATOM   4195  C  CE    . LYS A 1 544 ? 6.376   -39.385 55.246  1.00 43.94 ? 544  LYS A CE    1 
ATOM   4196  N  NZ    . LYS A 1 544 ? 7.103   -40.682 55.063  1.00 49.64 ? 544  LYS A NZ    1 
ATOM   4197  N  N     . ILE A 1 545 ? 7.759   -33.058 58.171  1.00 45.19 ? 545  ILE A N     1 
ATOM   4198  C  CA    . ILE A 1 545 ? 8.653   -32.136 58.841  1.00 47.30 ? 545  ILE A CA    1 
ATOM   4199  C  C     . ILE A 1 545 ? 9.209   -32.734 60.138  1.00 48.81 ? 545  ILE A C     1 
ATOM   4200  O  O     . ILE A 1 545 ? 8.418   -33.193 60.986  1.00 49.70 ? 545  ILE A O     1 
ATOM   4201  C  CB    . ILE A 1 545 ? 7.836   -30.893 59.313  1.00 47.83 ? 545  ILE A CB    1 
ATOM   4202  C  CG1   . ILE A 1 545 ? 6.896   -30.416 58.213  1.00 49.58 ? 545  ILE A CG1   1 
ATOM   4203  C  CG2   . ILE A 1 545 ? 8.849   -29.835 59.728  1.00 48.86 ? 545  ILE A CG2   1 
ATOM   4204  C  CD1   . ILE A 1 545 ? 6.416   -28.977 58.352  1.00 49.44 ? 545  ILE A CD1   1 
ATOM   4205  N  N     . ARG A 1 546 ? 10.518  -32.728 60.351  1.00 49.52 ? 546  ARG A N     1 
ATOM   4206  C  CA    . ARG A 1 546 ? 10.997  -33.240 61.654  1.00 50.50 ? 546  ARG A CA    1 
ATOM   4207  C  C     . ARG A 1 546 ? 11.697  -32.050 62.297  1.00 50.63 ? 546  ARG A C     1 
ATOM   4208  O  O     . ARG A 1 546 ? 12.431  -31.406 61.546  1.00 49.49 ? 546  ARG A O     1 
ATOM   4209  C  CB    . ARG A 1 546 ? 11.944  -34.420 61.563  1.00 50.22 ? 546  ARG A CB    1 
ATOM   4210  C  CG    . ARG A 1 546 ? 11.376  -35.758 61.133  1.00 48.53 ? 546  ARG A CG    1 
ATOM   4211  C  CD    . ARG A 1 546 ? 10.377  -36.374 62.098  1.00 51.68 ? 546  ARG A CD    1 
ATOM   4212  N  NE    . ARG A 1 546 ? 9.049   -36.331 61.483  1.00 56.10 ? 546  ARG A NE    1 
ATOM   4213  C  CZ    . ARG A 1 546 ? 8.625   -37.219 60.589  1.00 53.99 ? 546  ARG A CZ    1 
ATOM   4214  N  NH1   . ARG A 1 546 ? 9.435   -38.220 60.323  1.00 53.60 ? 546  ARG A NH1   1 
ATOM   4215  N  NH2   . ARG A 1 546 ? 7.447   -37.079 60.012  1.00 54.28 ? 546  ARG A NH2   1 
ATOM   4216  N  N     . SER A 1 547 ? 11.551  -31.896 63.604  1.00 52.44 ? 547  SER A N     1 
ATOM   4217  C  CA    . SER A 1 547 ? 12.275  -30.813 64.263  1.00 55.28 ? 547  SER A CA    1 
ATOM   4218  C  C     . SER A 1 547 ? 13.636  -31.137 64.832  1.00 56.99 ? 547  SER A C     1 
ATOM   4219  O  O     . SER A 1 547 ? 14.280  -30.202 65.339  1.00 58.37 ? 547  SER A O     1 
ATOM   4220  C  CB    . SER A 1 547 ? 11.429  -30.175 65.386  1.00 49.81 ? 547  SER A CB    1 
ATOM   4221  O  OG    . SER A 1 547 ? 10.810  -31.232 66.103  1.00 59.83 ? 547  SER A OG    1 
ATOM   4222  N  N     . GLY A 1 548 ? 14.118  -32.346 64.889  1.00 59.88 ? 548  GLY A N     1 
ATOM   4223  C  CA    . GLY A 1 548 ? 15.340  -32.709 65.591  1.00 63.69 ? 548  GLY A CA    1 
ATOM   4224  C  C     . GLY A 1 548 ? 16.439  -31.670 65.742  1.00 65.85 ? 548  GLY A C     1 
ATOM   4225  O  O     . GLY A 1 548 ? 16.278  -30.442 65.767  1.00 65.44 ? 548  GLY A O     1 
ATOM   4226  N  N     . LYS A 1 549 ? 17.677  -32.202 65.878  1.00 67.06 ? 549  LYS A N     1 
ATOM   4227  C  CA    . LYS A 1 549 ? 18.847  -31.309 65.910  1.00 68.13 ? 549  LYS A CA    1 
ATOM   4228  C  C     . LYS A 1 549 ? 19.341  -31.391 64.464  1.00 68.61 ? 549  LYS A C     1 
ATOM   4229  O  O     . LYS A 1 549 ? 20.262  -30.739 64.003  1.00 69.79 ? 549  LYS A O     1 
ATOM   4230  C  CB    . LYS A 1 549 ? 19.861  -31.693 66.956  1.00 72.23 ? 549  LYS A CB    1 
ATOM   4231  C  CG    . LYS A 1 549 ? 20.567  -30.572 67.698  1.00 73.43 ? 549  LYS A CG    1 
ATOM   4232  C  CD    . LYS A 1 549 ? 19.714  -29.884 68.743  1.00 74.92 ? 549  LYS A CD    1 
ATOM   4233  C  CE    . LYS A 1 549 ? 20.034  -30.291 70.174  1.00 74.22 ? 549  LYS A CE    1 
ATOM   4234  N  NZ    . LYS A 1 549 ? 18.798  -30.756 70.882  1.00 73.06 ? 549  LYS A NZ    1 
ATOM   4235  N  N     . LYS A 1 550 ? 18.523  -32.148 63.731  1.00 68.07 ? 550  LYS A N     1 
ATOM   4236  C  CA    . LYS A 1 550 ? 18.683  -32.325 62.306  1.00 67.97 ? 550  LYS A CA    1 
ATOM   4237  C  C     . LYS A 1 550 ? 17.574  -31.761 61.431  1.00 66.58 ? 550  LYS A C     1 
ATOM   4238  O  O     . LYS A 1 550 ? 17.530  -32.120 60.246  1.00 66.12 ? 550  LYS A O     1 
ATOM   4239  C  CB    . LYS A 1 550 ? 18.949  -33.806 62.002  1.00 73.59 ? 550  LYS A CB    1 
ATOM   4240  C  CG    . LYS A 1 550 ? 20.032  -34.444 62.855  1.00 76.99 ? 550  LYS A CG    1 
ATOM   4241  C  CD    . LYS A 1 550 ? 21.304  -34.772 62.086  1.00 77.81 ? 550  LYS A CD    1 
ATOM   4242  C  CE    . LYS A 1 550 ? 22.566  -34.326 62.813  1.00 77.73 ? 550  LYS A CE    1 
ATOM   4243  N  NZ    . LYS A 1 550 ? 23.400  -35.469 63.279  1.00 78.97 ? 550  LYS A NZ    1 
ATOM   4244  N  N     . ARG A 1 551 ? 16.793  -30.782 61.858  1.00 64.96 ? 551  ARG A N     1 
ATOM   4245  C  CA    . ARG A 1 551 ? 15.814  -30.066 61.064  1.00 62.99 ? 551  ARG A CA    1 
ATOM   4246  C  C     . ARG A 1 551 ? 15.739  -30.537 59.620  1.00 61.89 ? 551  ARG A C     1 
ATOM   4247  O  O     . ARG A 1 551 ? 16.705  -30.304 58.881  1.00 62.81 ? 551  ARG A O     1 
ATOM   4248  C  CB    . ARG A 1 551 ? 16.236  -28.593 60.964  1.00 67.25 ? 551  ARG A CB    1 
ATOM   4249  C  CG    . ARG A 1 551 ? 15.624  -27.642 61.967  1.00 72.23 ? 551  ARG A CG    1 
ATOM   4250  C  CD    . ARG A 1 551 ? 15.359  -26.286 61.314  1.00 72.67 ? 551  ARG A CD    1 
ATOM   4251  N  NE    . ARG A 1 551 ? 14.286  -25.584 62.024  1.00 74.97 ? 551  ARG A NE    1 
ATOM   4252  C  CZ    . ARG A 1 551 ? 13.789  -24.418 61.611  1.00 77.10 ? 551  ARG A CZ    1 
ATOM   4253  N  NH1   . ARG A 1 551 ? 14.276  -23.884 60.494  1.00 77.06 ? 551  ARG A NH1   1 
ATOM   4254  N  NH2   . ARG A 1 551 ? 12.808  -23.791 62.258  1.00 76.73 ? 551  ARG A NH2   1 
ATOM   4255  N  N     . THR A 1 552 ? 14.651  -31.145 59.174  1.00 59.61 ? 552  THR A N     1 
ATOM   4256  C  CA    . THR A 1 552 ? 14.500  -31.597 57.803  1.00 56.46 ? 552  THR A CA    1 
ATOM   4257  C  C     . THR A 1 552 ? 13.041  -31.444 57.338  1.00 54.61 ? 552  THR A C     1 
ATOM   4258  O  O     . THR A 1 552 ? 12.154  -31.341 58.171  1.00 53.20 ? 552  THR A O     1 
ATOM   4259  C  CB    . THR A 1 552 ? 14.826  -33.076 57.588  1.00 55.79 ? 552  THR A CB    1 
ATOM   4260  O  OG1   . THR A 1 552 ? 13.899  -33.954 58.248  1.00 54.38 ? 552  THR A OG1   1 
ATOM   4261  C  CG2   . THR A 1 552 ? 16.252  -33.343 57.992  1.00 58.47 ? 552  THR A CG2   1 
ATOM   4262  N  N     . VAL A 1 553 ? 12.875  -31.462 56.027  1.00 52.90 ? 553  VAL A N     1 
ATOM   4263  C  CA    . VAL A 1 553 ? 11.591  -31.263 55.373  1.00 51.51 ? 553  VAL A CA    1 
ATOM   4264  C  C     . VAL A 1 553 ? 11.571  -32.193 54.162  1.00 50.03 ? 553  VAL A C     1 
ATOM   4265  O  O     . VAL A 1 553 ? 12.497  -32.113 53.382  1.00 52.00 ? 553  VAL A O     1 
ATOM   4266  C  CB    . VAL A 1 553 ? 11.271  -29.827 54.933  1.00 50.13 ? 553  VAL A CB    1 
ATOM   4267  C  CG1   . VAL A 1 553 ? 9.904   -29.655 54.282  1.00 49.05 ? 553  VAL A CG1   1 
ATOM   4268  C  CG2   . VAL A 1 553 ? 11.295  -28.856 56.116  1.00 45.36 ? 553  VAL A CG2   1 
ATOM   4269  N  N     . GLU A 1 554 ? 10.642  -33.113 54.098  1.00 47.72 ? 554  GLU A N     1 
ATOM   4270  C  CA    . GLU A 1 554 ? 10.479  -34.025 52.994  1.00 47.30 ? 554  GLU A CA    1 
ATOM   4271  C  C     . GLU A 1 554 ? 9.181   -33.721 52.236  1.00 46.66 ? 554  GLU A C     1 
ATOM   4272  O  O     . GLU A 1 554 ? 8.085   -33.917 52.767  1.00 46.31 ? 554  GLU A O     1 
ATOM   4273  C  CB    . GLU A 1 554 ? 10.330  -35.427 53.591  1.00 44.00 ? 554  GLU A CB    1 
ATOM   4274  C  CG    . GLU A 1 554 ? 10.777  -36.585 52.737  1.00 47.60 ? 554  GLU A CG    1 
ATOM   4275  C  CD    . GLU A 1 554 ? 9.814   -37.731 52.929  1.00 48.39 ? 554  GLU A CD    1 
ATOM   4276  O  OE1   . GLU A 1 554 ? 8.667   -37.416 53.357  1.00 60.56 ? 554  GLU A OE1   1 
ATOM   4277  O  OE2   . GLU A 1 554 ? 10.097  -38.901 52.721  1.00 48.78 ? 554  GLU A OE2   1 
ATOM   4278  N  N     . MET A 1 555 ? 9.265   -33.446 50.936  1.00 46.21 ? 555  MET A N     1 
ATOM   4279  C  CA    . MET A 1 555 ? 8.010   -33.193 50.213  1.00 44.89 ? 555  MET A CA    1 
ATOM   4280  C  C     . MET A 1 555 ? 7.701   -34.196 49.142  1.00 44.28 ? 555  MET A C     1 
ATOM   4281  O  O     . MET A 1 555 ? 8.559   -34.781 48.487  1.00 45.65 ? 555  MET A O     1 
ATOM   4282  C  CB    . MET A 1 555 ? 7.994   -31.736 49.703  1.00 40.98 ? 555  MET A CB    1 
ATOM   4283  C  CG    . MET A 1 555 ? 8.109   -30.818 50.924  1.00 42.42 ? 555  MET A CG    1 
ATOM   4284  S  SD    . MET A 1 555 ? 7.971   -29.073 50.540  1.00 49.55 ? 555  MET A SD    1 
ATOM   4285  C  CE    . MET A 1 555 ? 6.155   -29.066 50.620  1.00 39.61 ? 555  MET A CE    1 
ATOM   4286  N  N     . HIS A 1 556 ? 6.429   -34.479 48.983  1.00 43.49 ? 556  HIS A N     1 
ATOM   4287  C  CA    . HIS A 1 556 ? 5.913   -35.253 47.877  1.00 43.69 ? 556  HIS A CA    1 
ATOM   4288  C  C     . HIS A 1 556 ? 4.721   -34.505 47.300  1.00 44.09 ? 556  HIS A C     1 
ATOM   4289  O  O     . HIS A 1 556 ? 3.944   -33.911 48.070  1.00 44.04 ? 556  HIS A O     1 
ATOM   4290  C  CB    . HIS A 1 556 ? 5.535   -36.665 48.375  1.00 46.67 ? 556  HIS A CB    1 
ATOM   4291  C  CG    . HIS A 1 556 ? 6.786   -37.394 48.789  1.00 49.04 ? 556  HIS A CG    1 
ATOM   4292  N  ND1   . HIS A 1 556 ? 7.212   -37.490 50.093  1.00 48.65 ? 556  HIS A ND1   1 
ATOM   4293  C  CD2   . HIS A 1 556 ? 7.765   -37.941 48.018  1.00 48.57 ? 556  HIS A CD2   1 
ATOM   4294  C  CE1   . HIS A 1 556 ? 8.367   -38.131 50.133  1.00 48.71 ? 556  HIS A CE1   1 
ATOM   4295  N  NE2   . HIS A 1 556 ? 8.720   -38.411 48.879  1.00 50.23 ? 556  HIS A NE2   1 
ATOM   4296  N  N     . ASN A 1 557 ? 4.591   -34.464 45.973  1.00 44.07 ? 557  ASN A N     1 
ATOM   4297  C  CA    . ASN A 1 557 ? 3.344   -33.986 45.418  1.00 44.83 ? 557  ASN A CA    1 
ATOM   4298  C  C     . ASN A 1 557 ? 3.018   -34.667 44.085  1.00 45.34 ? 557  ASN A C     1 
ATOM   4299  O  O     . ASN A 1 557 ? 3.871   -35.273 43.458  1.00 44.02 ? 557  ASN A O     1 
ATOM   4300  C  CB    . ASN A 1 557 ? 3.174   -32.500 45.275  1.00 48.75 ? 557  ASN A CB    1 
ATOM   4301  C  CG    . ASN A 1 557 ? 4.340   -31.759 44.667  1.00 51.17 ? 557  ASN A CG    1 
ATOM   4302  O  OD1   . ASN A 1 557 ? 4.190   -31.249 43.550  1.00 58.80 ? 557  ASN A OD1   1 
ATOM   4303  N  ND2   . ASN A 1 557 ? 5.429   -31.609 45.408  1.00 47.35 ? 557  ASN A ND2   1 
ATOM   4304  N  N     . LYS A 1 558 ? 1.765   -34.394 43.709  1.00 44.68 ? 558  LYS A N     1 
ATOM   4305  C  CA    . LYS A 1 558 ? 1.247   -34.827 42.424  1.00 43.80 ? 558  LYS A CA    1 
ATOM   4306  C  C     . LYS A 1 558 ? 0.219   -33.823 41.894  1.00 43.19 ? 558  LYS A C     1 
ATOM   4307  O  O     . LYS A 1 558 ? -0.733  -33.489 42.602  1.00 42.26 ? 558  LYS A O     1 
ATOM   4308  C  CB    . LYS A 1 558 ? 0.488   -36.124 42.663  1.00 43.96 ? 558  LYS A CB    1 
ATOM   4309  C  CG    . LYS A 1 558 ? -0.160  -36.659 41.394  1.00 47.38 ? 558  LYS A CG    1 
ATOM   4310  C  CD    . LYS A 1 558 ? -0.255  -38.204 41.486  1.00 46.02 ? 558  LYS A CD    1 
ATOM   4311  C  CE    . LYS A 1 558 ? -0.923  -38.714 40.215  1.00 40.98 ? 558  LYS A CE    1 
ATOM   4312  N  NZ    . LYS A 1 558 ? -0.113  -39.822 39.638  1.00 41.96 ? 558  LYS A NZ    1 
ATOM   4313  N  N     . ILE A 1 559 ? 0.429   -33.272 40.712  1.00 41.96 ? 559  ILE A N     1 
ATOM   4314  C  CA    . ILE A 1 559 ? -0.522  -32.435 40.000  1.00 39.43 ? 559  ILE A CA    1 
ATOM   4315  C  C     . ILE A 1 559 ? -1.707  -33.253 39.480  1.00 40.33 ? 559  ILE A C     1 
ATOM   4316  O  O     . ILE A 1 559 ? -1.577  -34.403 39.064  1.00 39.57 ? 559  ILE A O     1 
ATOM   4317  C  CB    . ILE A 1 559 ? 0.195   -31.782 38.813  1.00 36.43 ? 559  ILE A CB    1 
ATOM   4318  C  CG1   . ILE A 1 559 ? 1.251   -30.768 39.287  1.00 35.14 ? 559  ILE A CG1   1 
ATOM   4319  C  CG2   . ILE A 1 559 ? -0.680  -31.085 37.803  1.00 32.31 ? 559  ILE A CG2   1 
ATOM   4320  C  CD1   . ILE A 1 559 ? 2.191   -30.475 38.147  1.00 33.44 ? 559  ILE A CD1   1 
ATOM   4321  N  N     . TYR A 1 560 ? -2.921  -32.711 39.621  1.00 41.71 ? 560  TYR A N     1 
ATOM   4322  C  CA    . TYR A 1 560 ? -4.149  -33.294 39.088  1.00 43.11 ? 560  TYR A CA    1 
ATOM   4323  C  C     . TYR A 1 560 ? -4.895  -32.229 38.265  1.00 45.59 ? 560  TYR A C     1 
ATOM   4324  O  O     . TYR A 1 560 ? -5.049  -31.080 38.698  1.00 44.40 ? 560  TYR A O     1 
ATOM   4325  C  CB    . TYR A 1 560 ? -5.078  -33.793 40.195  1.00 41.80 ? 560  TYR A CB    1 
ATOM   4326  C  CG    . TYR A 1 560 ? -4.507  -34.980 40.936  1.00 42.28 ? 560  TYR A CG    1 
ATOM   4327  C  CD1   . TYR A 1 560 ? -3.418  -34.808 41.780  1.00 42.46 ? 560  TYR A CD1   1 
ATOM   4328  C  CD2   . TYR A 1 560 ? -5.019  -36.269 40.763  1.00 42.49 ? 560  TYR A CD2   1 
ATOM   4329  C  CE1   . TYR A 1 560 ? -2.858  -35.885 42.454  1.00 42.93 ? 560  TYR A CE1   1 
ATOM   4330  C  CE2   . TYR A 1 560 ? -4.471  -37.325 41.451  1.00 41.78 ? 560  TYR A CE2   1 
ATOM   4331  C  CZ    . TYR A 1 560 ? -3.400  -37.122 42.285  1.00 42.44 ? 560  TYR A CZ    1 
ATOM   4332  O  OH    . TYR A 1 560 ? -2.817  -38.161 42.962  1.00 44.64 ? 560  TYR A OH    1 
ATOM   4333  N  N     . ALA A 1 561 ? -5.315  -32.601 37.051  1.00 47.23 ? 561  ALA A N     1 
ATOM   4334  C  CA    . ALA A 1 561 ? -6.043  -31.632 36.211  1.00 48.60 ? 561  ALA A CA    1 
ATOM   4335  C  C     . ALA A 1 561 ? -7.420  -31.372 36.821  1.00 49.63 ? 561  ALA A C     1 
ATOM   4336  O  O     . ALA A 1 561 ? -7.941  -32.275 37.485  1.00 50.28 ? 561  ALA A O     1 
ATOM   4337  C  CB    . ALA A 1 561 ? -6.306  -32.236 34.829  1.00 45.13 ? 561  ALA A CB    1 
ATOM   4338  N  N     . ILE A 1 562 ? -8.018  -30.244 36.498  1.00 50.21 ? 562  ILE A N     1 
ATOM   4339  C  CA    . ILE A 1 562 ? -9.442  -30.071 36.836  1.00 52.17 ? 562  ILE A CA    1 
ATOM   4340  C  C     . ILE A 1 562 ? -10.097 -29.699 35.498  1.00 52.70 ? 562  ILE A C     1 
ATOM   4341  O  O     . ILE A 1 562 ? -9.833  -28.619 34.996  1.00 52.04 ? 562  ILE A O     1 
ATOM   4342  C  CB    . ILE A 1 562 ? -9.742  -29.030 37.909  1.00 53.95 ? 562  ILE A CB    1 
ATOM   4343  C  CG1   . ILE A 1 562 ? -9.405  -27.647 37.323  1.00 57.70 ? 562  ILE A CG1   1 
ATOM   4344  C  CG2   . ILE A 1 562 ? -8.944  -29.224 39.194  1.00 51.41 ? 562  ILE A CG2   1 
ATOM   4345  C  CD1   . ILE A 1 562 ? -7.914  -27.504 37.027  1.00 62.32 ? 562  ILE A CD1   1 
ATOM   4346  N  N     . PRO A 1 563 ? -10.779 -30.636 34.873  1.00 54.60 ? 563  PRO A N     1 
ATOM   4347  C  CA    . PRO A 1 563 ? -11.335 -30.451 33.538  1.00 57.68 ? 563  PRO A CA    1 
ATOM   4348  C  C     . PRO A 1 563 ? -12.423 -29.398 33.547  1.00 60.33 ? 563  PRO A C     1 
ATOM   4349  O  O     . PRO A 1 563 ? -13.323 -29.612 34.363  1.00 59.88 ? 563  PRO A O     1 
ATOM   4350  C  CB    . PRO A 1 563 ? -11.904 -31.828 33.211  1.00 57.69 ? 563  PRO A CB    1 
ATOM   4351  C  CG    . PRO A 1 563 ? -12.201 -32.440 34.543  1.00 57.26 ? 563  PRO A CG    1 
ATOM   4352  C  CD    . PRO A 1 563 ? -11.158 -31.926 35.493  1.00 55.47 ? 563  PRO A CD    1 
ATOM   4353  N  N     . ILE A 1 564 ? -12.293 -28.246 32.878  1.00 63.75 ? 564  ILE A N     1 
ATOM   4354  C  CA    . ILE A 1 564 ? -13.233 -27.164 33.091  1.00 67.09 ? 564  ILE A CA    1 
ATOM   4355  C  C     . ILE A 1 564 ? -14.712 -27.538 33.099  1.00 68.69 ? 564  ILE A C     1 
ATOM   4356  O  O     . ILE A 1 564 ? -15.528 -26.700 33.501  1.00 69.43 ? 564  ILE A O     1 
ATOM   4357  C  CB    . ILE A 1 564 ? -13.050 -25.790 32.466  1.00 68.54 ? 564  ILE A CB    1 
ATOM   4358  C  CG1   . ILE A 1 564 ? -13.267 -25.762 30.955  1.00 69.37 ? 564  ILE A CG1   1 
ATOM   4359  C  CG2   . ILE A 1 564 ? -11.767 -25.097 32.874  1.00 67.17 ? 564  ILE A CG2   1 
ATOM   4360  C  CD1   . ILE A 1 564 ? -14.488 -26.537 30.498  1.00 67.96 ? 564  ILE A CD1   1 
ATOM   4361  N  N     . GLU A 1 565 ? -15.097 -28.773 32.810  1.00 69.15 ? 565  GLU A N     1 
ATOM   4362  C  CA    . GLU A 1 565 ? -16.431 -29.240 33.110  1.00 69.84 ? 565  GLU A CA    1 
ATOM   4363  C  C     . GLU A 1 565 ? -16.557 -29.561 34.609  1.00 71.01 ? 565  GLU A C     1 
ATOM   4364  O  O     . GLU A 1 565 ? -17.498 -30.260 35.024  1.00 71.51 ? 565  GLU A O     1 
ATOM   4365  C  CB    . GLU A 1 565 ? -16.850 -30.471 32.319  1.00 71.25 ? 565  GLU A CB    1 
ATOM   4366  C  CG    . GLU A 1 565 ? -15.770 -31.550 32.258  1.00 75.50 ? 565  GLU A CG    1 
ATOM   4367  C  CD    . GLU A 1 565 ? -15.154 -31.561 30.863  1.00 75.48 ? 565  GLU A CD    1 
ATOM   4368  O  OE1   . GLU A 1 565 ? -15.724 -32.241 29.979  1.00 75.62 ? 565  GLU A OE1   1 
ATOM   4369  O  OE2   . GLU A 1 565 ? -14.156 -30.831 30.689  1.00 77.85 ? 565  GLU A OE2   1 
ATOM   4370  N  N     . ILE A 1 566 ? -15.653 -29.022 35.435  1.00 70.14 ? 566  ILE A N     1 
ATOM   4371  C  CA    . ILE A 1 566 ? -15.771 -29.161 36.879  1.00 67.93 ? 566  ILE A CA    1 
ATOM   4372  C  C     . ILE A 1 566 ? -15.481 -27.798 37.487  1.00 67.48 ? 566  ILE A C     1 
ATOM   4373  O  O     . ILE A 1 566 ? -16.081 -27.407 38.483  1.00 68.57 ? 566  ILE A O     1 
ATOM   4374  C  CB    . ILE A 1 566 ? -14.848 -30.227 37.458  1.00 67.76 ? 566  ILE A CB    1 
ATOM   4375  C  CG1   . ILE A 1 566 ? -15.459 -31.592 37.157  1.00 67.47 ? 566  ILE A CG1   1 
ATOM   4376  C  CG2   . ILE A 1 566 ? -14.632 -30.035 38.953  1.00 65.66 ? 566  ILE A CG2   1 
ATOM   4377  C  CD1   . ILE A 1 566 ? -14.458 -32.716 37.002  1.00 69.39 ? 566  ILE A CD1   1 
ATOM   4378  N  N     . MET A 1 567 ? -14.692 -27.027 36.767  1.00 65.69 ? 567  MET A N     1 
ATOM   4379  C  CA    . MET A 1 567 ? -14.246 -25.718 37.208  1.00 64.97 ? 567  MET A CA    1 
ATOM   4380  C  C     . MET A 1 567 ? -15.385 -24.721 37.401  1.00 65.21 ? 567  MET A C     1 
ATOM   4381  O  O     . MET A 1 567 ? -15.354 -23.745 38.152  1.00 64.54 ? 567  MET A O     1 
ATOM   4382  C  CB    . MET A 1 567 ? -13.367 -25.177 36.052  1.00 65.89 ? 567  MET A CB    1 
ATOM   4383  C  CG    . MET A 1 567 ? -11.970 -25.793 36.198  1.00 63.98 ? 567  MET A CG    1 
ATOM   4384  S  SD    . MET A 1 567 ? -11.234 -25.042 37.675  1.00 68.08 ? 567  MET A SD    1 
ATOM   4385  C  CE    . MET A 1 567 ? -10.373 -23.658 36.912  1.00 65.57 ? 567  MET A CE    1 
ATOM   4386  N  N     . GLN A 1 568 ? -16.288 -24.853 36.461  1.00 65.16 ? 568  GLN A N     1 
ATOM   4387  C  CA    . GLN A 1 568 ? -17.495 -24.069 36.281  1.00 65.25 ? 568  GLN A CA    1 
ATOM   4388  C  C     . GLN A 1 568 ? -18.523 -25.189 35.951  1.00 64.98 ? 568  GLN A C     1 
ATOM   4389  O  O     . GLN A 1 568 ? -18.711 -25.688 34.847  1.00 64.86 ? 568  GLN A O     1 
ATOM   4390  C  CB    . GLN A 1 568 ? -17.357 -23.026 35.186  1.00 67.73 ? 568  GLN A CB    1 
ATOM   4391  C  CG    . GLN A 1 568 ? -16.504 -21.778 35.268  1.00 63.17 ? 568  GLN A CG    1 
ATOM   4392  C  CD    . GLN A 1 568 ? -16.531 -20.882 34.040  1.00 64.90 ? 568  GLN A CD    1 
ATOM   4393  O  OE1   . GLN A 1 568 ? -17.542 -20.366 33.542  1.00 63.33 ? 568  GLN A OE1   1 
ATOM   4394  N  NE2   . GLN A 1 568 ? -15.388 -20.599 33.418  1.00 61.39 ? 568  GLN A NE2   1 
ATOM   4395  N  N     . GLY A 1 569 ? -18.858 -25.878 37.019  1.00 63.30 ? 569  GLY A N     1 
ATOM   4396  C  CA    . GLY A 1 569 ? -19.841 -26.932 37.157  1.00 61.84 ? 569  GLY A CA    1 
ATOM   4397  C  C     . GLY A 1 569 ? -20.336 -26.722 38.607  1.00 61.15 ? 569  GLY A C     1 
ATOM   4398  O  O     . GLY A 1 569 ? -20.154 -25.571 39.068  1.00 61.16 ? 569  GLY A O     1 
ATOM   4399  N  N     . THR A 1 570 ? -20.751 -27.745 39.310  1.00 59.24 ? 570  THR A N     1 
ATOM   4400  C  CA    . THR A 1 570 ? -21.210 -27.605 40.691  1.00 59.14 ? 570  THR A CA    1 
ATOM   4401  C  C     . THR A 1 570 ? -20.114 -27.675 41.747  1.00 59.82 ? 570  THR A C     1 
ATOM   4402  O  O     . THR A 1 570 ? -19.037 -28.229 41.508  1.00 60.08 ? 570  THR A O     1 
ATOM   4403  C  CB    . THR A 1 570 ? -22.237 -28.721 40.965  1.00 57.38 ? 570  THR A CB    1 
ATOM   4404  O  OG1   . THR A 1 570 ? -23.389 -28.584 40.130  1.00 63.71 ? 570  THR A OG1   1 
ATOM   4405  C  CG2   . THR A 1 570 ? -22.659 -28.794 42.412  1.00 61.74 ? 570  THR A CG2   1 
ATOM   4406  N  N     . GLY A 1 571 ? -20.439 -27.358 42.996  1.00 59.38 ? 571  GLY A N     1 
ATOM   4407  C  CA    . GLY A 1 571 ? -19.563 -27.378 44.143  1.00 58.83 ? 571  GLY A CA    1 
ATOM   4408  C  C     . GLY A 1 571 ? -19.323 -28.755 44.744  1.00 59.03 ? 571  GLY A C     1 
ATOM   4409  O  O     . GLY A 1 571 ? -18.198 -29.135 45.123  1.00 58.49 ? 571  GLY A O     1 
ATOM   4410  N  N     . GLU A 1 572 ? -20.393 -29.545 44.799  1.00 58.71 ? 572  GLU A N     1 
ATOM   4411  C  CA    . GLU A 1 572 ? -20.278 -30.927 45.258  1.00 58.65 ? 572  GLU A CA    1 
ATOM   4412  C  C     . GLU A 1 572 ? -19.459 -31.681 44.214  1.00 57.80 ? 572  GLU A C     1 
ATOM   4413  O  O     . GLU A 1 572 ? -18.573 -32.466 44.539  1.00 58.01 ? 572  GLU A O     1 
ATOM   4414  C  CB    . GLU A 1 572 ? -21.650 -31.535 45.479  1.00 64.59 ? 572  GLU A CB    1 
ATOM   4415  C  CG    . GLU A 1 572 ? -21.751 -33.054 45.456  1.00 69.08 ? 572  GLU A CG    1 
ATOM   4416  C  CD    . GLU A 1 572 ? -23.194 -33.529 45.555  1.00 72.16 ? 572  GLU A CD    1 
ATOM   4417  O  OE1   . GLU A 1 572 ? -24.098 -32.701 45.277  1.00 74.39 ? 572  GLU A OE1   1 
ATOM   4418  O  OE2   . GLU A 1 572 ? -23.441 -34.690 45.940  1.00 72.36 ? 572  GLU A OE2   1 
ATOM   4419  N  N     . GLU A 1 573 ? -19.705 -31.353 42.956  1.00 56.96 ? 573  GLU A N     1 
ATOM   4420  C  CA    . GLU A 1 573 ? -18.976 -31.913 41.839  1.00 57.29 ? 573  GLU A CA    1 
ATOM   4421  C  C     . GLU A 1 573 ? -17.546 -31.391 41.751  1.00 57.49 ? 573  GLU A C     1 
ATOM   4422  O  O     . GLU A 1 573 ? -16.721 -31.993 41.058  1.00 58.46 ? 573  GLU A O     1 
ATOM   4423  C  CB    . GLU A 1 573 ? -19.673 -31.707 40.501  1.00 59.65 ? 573  GLU A CB    1 
ATOM   4424  C  CG    . GLU A 1 573 ? -21.096 -32.217 40.393  1.00 69.28 ? 573  GLU A CG    1 
ATOM   4425  C  CD    . GLU A 1 573 ? -21.878 -31.465 39.326  1.00 71.99 ? 573  GLU A CD    1 
ATOM   4426  O  OE1   . GLU A 1 573 ? -21.542 -30.299 39.040  1.00 73.86 ? 573  GLU A OE1   1 
ATOM   4427  O  OE2   . GLU A 1 573 ? -22.830 -32.069 38.781  1.00 77.60 ? 573  GLU A OE2   1 
ATOM   4428  N  N     . LEU A 1 574 ? -17.258 -30.297 42.435  1.00 55.36 ? 574  LEU A N     1 
ATOM   4429  C  CA    . LEU A 1 574 ? -15.903 -29.738 42.405  1.00 53.17 ? 574  LEU A CA    1 
ATOM   4430  C  C     . LEU A 1 574 ? -15.097 -30.371 43.537  1.00 52.39 ? 574  LEU A C     1 
ATOM   4431  O  O     . LEU A 1 574 ? -14.023 -30.921 43.322  1.00 52.90 ? 574  LEU A O     1 
ATOM   4432  C  CB    . LEU A 1 574 ? -15.941 -28.206 42.530  1.00 47.27 ? 574  LEU A CB    1 
ATOM   4433  C  CG    . LEU A 1 574 ? -14.623 -27.515 42.863  1.00 44.94 ? 574  LEU A CG    1 
ATOM   4434  C  CD1   . LEU A 1 574 ? -13.569 -27.926 41.840  1.00 38.82 ? 574  LEU A CD1   1 
ATOM   4435  C  CD2   . LEU A 1 574 ? -14.742 -26.006 42.971  1.00 38.24 ? 574  LEU A CD2   1 
ATOM   4436  N  N     . PHE A 1 575 ? -15.721 -30.430 44.716  1.00 51.06 ? 575  PHE A N     1 
ATOM   4437  C  CA    . PHE A 1 575 ? -15.099 -31.081 45.843  1.00 49.25 ? 575  PHE A CA    1 
ATOM   4438  C  C     . PHE A 1 575 ? -15.109 -32.594 45.712  1.00 49.74 ? 575  PHE A C     1 
ATOM   4439  O  O     . PHE A 1 575 ? -14.338 -33.238 46.458  1.00 48.63 ? 575  PHE A O     1 
ATOM   4440  C  CB    . PHE A 1 575 ? -15.716 -30.627 47.161  1.00 44.94 ? 575  PHE A CB    1 
ATOM   4441  C  CG    . PHE A 1 575 ? -15.298 -29.197 47.443  1.00 44.97 ? 575  PHE A CG    1 
ATOM   4442  C  CD1   . PHE A 1 575 ? -14.119 -28.927 48.096  1.00 41.55 ? 575  PHE A CD1   1 
ATOM   4443  C  CD2   . PHE A 1 575 ? -16.053 -28.144 46.956  1.00 43.90 ? 575  PHE A CD2   1 
ATOM   4444  C  CE1   . PHE A 1 575 ? -13.736 -27.625 48.320  1.00 38.39 ? 575  PHE A CE1   1 
ATOM   4445  C  CE2   . PHE A 1 575 ? -15.662 -26.850 47.172  1.00 42.15 ? 575  PHE A CE2   1 
ATOM   4446  C  CZ    . PHE A 1 575 ? -14.516 -26.577 47.884  1.00 41.21 ? 575  PHE A CZ    1 
ATOM   4447  N  N     . ASP A 1 576 ? -16.032 -33.126 44.889  1.00 49.26 ? 576  ASP A N     1 
ATOM   4448  C  CA    . ASP A 1 576 ? -16.078 -34.596 44.816  1.00 48.76 ? 576  ASP A CA    1 
ATOM   4449  C  C     . ASP A 1 576 ? -14.843 -35.046 44.050  1.00 48.29 ? 576  ASP A C     1 
ATOM   4450  O  O     . ASP A 1 576 ? -14.130 -35.977 44.385  1.00 49.04 ? 576  ASP A O     1 
ATOM   4451  C  CB    . ASP A 1 576 ? -17.365 -35.108 44.243  1.00 51.85 ? 576  ASP A CB    1 
ATOM   4452  C  CG    . ASP A 1 576 ? -18.510 -35.258 45.208  1.00 53.90 ? 576  ASP A CG    1 
ATOM   4453  O  OD1   . ASP A 1 576 ? -18.370 -35.171 46.438  1.00 58.33 ? 576  ASP A OD1   1 
ATOM   4454  O  OD2   . ASP A 1 576 ? -19.645 -35.489 44.720  1.00 61.07 ? 576  ASP A OD2   1 
ATOM   4455  N  N     . HIS A 1 577 ? -14.459 -34.229 43.098  1.00 47.81 ? 577  HIS A N     1 
ATOM   4456  C  CA    . HIS A 1 577 ? -13.227 -34.279 42.351  1.00 47.90 ? 577  HIS A CA    1 
ATOM   4457  C  C     . HIS A 1 577 ? -12.007 -34.043 43.230  1.00 47.46 ? 577  HIS A C     1 
ATOM   4458  O  O     . HIS A 1 577 ? -11.209 -34.980 43.350  1.00 47.23 ? 577  HIS A O     1 
ATOM   4459  C  CB    . HIS A 1 577 ? -13.250 -33.254 41.210  1.00 46.84 ? 577  HIS A CB    1 
ATOM   4460  C  CG    . HIS A 1 577 ? -12.116 -33.480 40.255  1.00 49.03 ? 577  HIS A CG    1 
ATOM   4461  N  ND1   . HIS A 1 577 ? -11.967 -34.679 39.585  1.00 49.57 ? 577  HIS A ND1   1 
ATOM   4462  C  CD2   . HIS A 1 577 ? -11.077 -32.692 39.899  1.00 48.25 ? 577  HIS A CD2   1 
ATOM   4463  C  CE1   . HIS A 1 577 ? -10.876 -34.591 38.832  1.00 50.10 ? 577  HIS A CE1   1 
ATOM   4464  N  NE2   . HIS A 1 577 ? -10.331 -33.396 38.984  1.00 48.16 ? 577  HIS A NE2   1 
ATOM   4465  N  N     . ILE A 1 578 ? -11.854 -32.922 43.911  1.00 46.66 ? 578  ILE A N     1 
ATOM   4466  C  CA    . ILE A 1 578 ? -10.724 -32.786 44.827  1.00 45.61 ? 578  ILE A CA    1 
ATOM   4467  C  C     . ILE A 1 578 ? -10.497 -34.076 45.620  1.00 44.70 ? 578  ILE A C     1 
ATOM   4468  O  O     . ILE A 1 578 ? -9.356  -34.448 45.860  1.00 42.95 ? 578  ILE A O     1 
ATOM   4469  C  CB    . ILE A 1 578 ? -10.944 -31.614 45.796  1.00 45.37 ? 578  ILE A CB    1 
ATOM   4470  C  CG1   . ILE A 1 578 ? -10.819 -30.276 45.043  1.00 43.63 ? 578  ILE A CG1   1 
ATOM   4471  C  CG2   . ILE A 1 578 ? -9.941  -31.639 46.950  1.00 38.50 ? 578  ILE A CG2   1 
ATOM   4472  C  CD1   . ILE A 1 578 ? -11.293 -29.138 45.922  1.00 46.31 ? 578  ILE A CD1   1 
ATOM   4473  N  N     . VAL A 1 579 ? -11.554 -34.699 46.137  1.00 44.33 ? 579  VAL A N     1 
ATOM   4474  C  CA    . VAL A 1 579 ? -11.456 -35.877 46.941  1.00 44.36 ? 579  VAL A CA    1 
ATOM   4475  C  C     . VAL A 1 579 ? -11.265 -37.161 46.172  1.00 45.02 ? 579  VAL A C     1 
ATOM   4476  O  O     . VAL A 1 579 ? -10.566 -38.024 46.721  1.00 45.13 ? 579  VAL A O     1 
ATOM   4477  C  CB    . VAL A 1 579 ? -12.302 -35.962 48.191  1.00 47.02 ? 579  VAL A CB    1 
ATOM   4478  C  CG1   . VAL A 1 579 ? -13.225 -34.784 48.405  1.00 45.63 ? 579  VAL A CG1   1 
ATOM   4479  C  CG2   . VAL A 1 579 ? -12.969 -37.293 48.460  1.00 43.83 ? 579  VAL A CG2   1 
ATOM   4480  N  N     . SER A 1 580 ? -11.607 -37.295 44.877  1.00 45.42 ? 580  SER A N     1 
ATOM   4481  C  CA    . SER A 1 580 ? -11.097 -38.503 44.223  1.00 46.70 ? 580  SER A CA    1 
ATOM   4482  C  C     . SER A 1 580 ? -9.560  -38.377 44.168  1.00 45.94 ? 580  SER A C     1 
ATOM   4483  O  O     . SER A 1 580 ? -8.805  -39.284 44.535  1.00 47.53 ? 580  SER A O     1 
ATOM   4484  C  CB    . SER A 1 580 ? -11.720 -38.928 42.922  1.00 49.38 ? 580  SER A CB    1 
ATOM   4485  O  OG    . SER A 1 580 ? -12.730 -38.062 42.468  1.00 57.64 ? 580  SER A OG    1 
ATOM   4486  N  N     . CYS A 1 581 ? -9.061  -37.226 43.793  1.00 43.07 ? 581  CYS A N     1 
ATOM   4487  C  CA    . CYS A 1 581 ? -7.671  -36.944 43.694  1.00 42.41 ? 581  CYS A CA    1 
ATOM   4488  C  C     . CYS A 1 581 ? -6.961  -37.118 45.022  1.00 43.34 ? 581  CYS A C     1 
ATOM   4489  O  O     . CYS A 1 581 ? -5.781  -37.492 44.923  1.00 45.75 ? 581  CYS A O     1 
ATOM   4490  C  CB    . CYS A 1 581 ? -7.337  -35.609 43.057  1.00 39.63 ? 581  CYS A CB    1 
ATOM   4491  S  SG    . CYS A 1 581 ? -8.350  -35.131 41.640  1.00 42.83 ? 581  CYS A SG    1 
ATOM   4492  N  N     . ILE A 1 582 ? -7.546  -36.889 46.178  1.00 41.93 ? 582  ILE A N     1 
ATOM   4493  C  CA    . ILE A 1 582 ? -6.876  -37.089 47.451  1.00 41.16 ? 582  ILE A CA    1 
ATOM   4494  C  C     . ILE A 1 582 ? -6.754  -38.591 47.727  1.00 40.97 ? 582  ILE A C     1 
ATOM   4495  O  O     . ILE A 1 582 ? -5.737  -39.148 48.102  1.00 40.49 ? 582  ILE A O     1 
ATOM   4496  C  CB    . ILE A 1 582 ? -7.625  -36.440 48.618  1.00 42.73 ? 582  ILE A CB    1 
ATOM   4497  C  CG1   . ILE A 1 582 ? -7.646  -34.916 48.533  1.00 40.97 ? 582  ILE A CG1   1 
ATOM   4498  C  CG2   . ILE A 1 582 ? -7.019  -36.875 49.954  1.00 42.61 ? 582  ILE A CG2   1 
ATOM   4499  C  CD1   . ILE A 1 582 ? -8.450  -34.271 49.670  1.00 44.16 ? 582  ILE A CD1   1 
ATOM   4500  N  N     . SER A 1 583 ? -7.786  -39.329 47.388  1.00 41.46 ? 583  SER A N     1 
ATOM   4501  C  CA    . SER A 1 583 ? -7.825  -40.776 47.481  1.00 42.76 ? 583  SER A CA    1 
ATOM   4502  C  C     . SER A 1 583 ? -6.704  -41.422 46.662  1.00 44.29 ? 583  SER A C     1 
ATOM   4503  O  O     . SER A 1 583 ? -5.865  -42.186 47.173  1.00 44.96 ? 583  SER A O     1 
ATOM   4504  C  CB    . SER A 1 583 ? -9.189  -41.278 46.962  1.00 41.31 ? 583  SER A CB    1 
ATOM   4505  O  OG    . SER A 1 583 ? -9.230  -42.624 47.443  1.00 43.54 ? 583  SER A OG    1 
ATOM   4506  N  N     . ASP A 1 584 ? -6.613  -40.925 45.408  1.00 44.19 ? 584  ASP A N     1 
ATOM   4507  C  CA    . ASP A 1 584 ? -5.567  -41.366 44.529  1.00 43.46 ? 584  ASP A CA    1 
ATOM   4508  C  C     . ASP A 1 584 ? -4.153  -41.105 45.045  1.00 41.69 ? 584  ASP A C     1 
ATOM   4509  O  O     . ASP A 1 584 ? -3.306  -42.014 44.996  1.00 39.62 ? 584  ASP A O     1 
ATOM   4510  C  CB    . ASP A 1 584 ? -5.795  -40.978 43.081  1.00 44.27 ? 584  ASP A CB    1 
ATOM   4511  C  CG    . ASP A 1 584 ? -4.670  -41.498 42.186  1.00 45.95 ? 584  ASP A CG    1 
ATOM   4512  O  OD1   . ASP A 1 584 ? -4.504  -42.720 42.021  1.00 48.39 ? 584  ASP A OD1   1 
ATOM   4513  O  OD2   . ASP A 1 584 ? -3.941  -40.612 41.678  1.00 46.72 ? 584  ASP A OD2   1 
ATOM   4514  N  N     . PHE A 1 585 ? -3.897  -39.931 45.599  1.00 40.72 ? 585  PHE A N     1 
ATOM   4515  C  CA    . PHE A 1 585 ? -2.612  -39.550 46.133  1.00 41.25 ? 585  PHE A CA    1 
ATOM   4516  C  C     . PHE A 1 585 ? -2.176  -40.341 47.362  1.00 42.85 ? 585  PHE A C     1 
ATOM   4517  O  O     . PHE A 1 585 ? -0.967  -40.573 47.555  1.00 43.63 ? 585  PHE A O     1 
ATOM   4518  C  CB    . PHE A 1 585 ? -2.525  -38.040 46.322  1.00 37.22 ? 585  PHE A CB    1 
ATOM   4519  C  CG    . PHE A 1 585 ? -1.215  -37.544 46.873  1.00 37.32 ? 585  PHE A CG    1 
ATOM   4520  C  CD1   . PHE A 1 585 ? -0.131  -37.333 46.036  1.00 36.24 ? 585  PHE A CD1   1 
ATOM   4521  C  CD2   . PHE A 1 585 ? -1.080  -37.260 48.231  1.00 31.46 ? 585  PHE A CD2   1 
ATOM   4522  C  CE1   . PHE A 1 585 ? 1.098   -36.923 46.566  1.00 33.83 ? 585  PHE A CE1   1 
ATOM   4523  C  CE2   . PHE A 1 585 ? 0.128   -36.858 48.741  1.00 36.53 ? 585  PHE A CE2   1 
ATOM   4524  C  CZ    . PHE A 1 585 ? 1.206   -36.656 47.910  1.00 34.64 ? 585  PHE A CZ    1 
ATOM   4525  N  N     . LEU A 1 586 ? -3.112  -40.843 48.168  1.00 43.37 ? 586  LEU A N     1 
ATOM   4526  C  CA    . LEU A 1 586 ? -2.760  -41.676 49.303  1.00 42.98 ? 586  LEU A CA    1 
ATOM   4527  C  C     . LEU A 1 586 ? -2.391  -43.072 48.841  1.00 42.30 ? 586  LEU A C     1 
ATOM   4528  O  O     . LEU A 1 586 ? -1.392  -43.571 49.371  1.00 44.71 ? 586  LEU A O     1 
ATOM   4529  C  CB    . LEU A 1 586 ? -3.759  -41.680 50.434  1.00 43.45 ? 586  LEU A CB    1 
ATOM   4530  C  CG    . LEU A 1 586 ? -4.508  -40.393 50.790  1.00 41.69 ? 586  LEU A CG    1 
ATOM   4531  C  CD1   . LEU A 1 586 ? -5.967  -40.699 51.028  1.00 33.63 ? 586  LEU A CD1   1 
ATOM   4532  C  CD2   . LEU A 1 586 ? -3.914  -39.687 51.990  1.00 33.24 ? 586  LEU A CD2   1 
ATOM   4533  N  N     . ASP A 1 587 ? -3.078  -43.681 47.893  1.00 40.56 ? 587  ASP A N     1 
ATOM   4534  C  CA    . ASP A 1 587 ? -2.631  -44.940 47.309  1.00 38.76 ? 587  ASP A CA    1 
ATOM   4535  C  C     . ASP A 1 587 ? -1.202  -44.723 46.788  1.00 39.60 ? 587  ASP A C     1 
ATOM   4536  O  O     . ASP A 1 587 ? -0.307  -45.554 46.986  1.00 39.35 ? 587  ASP A O     1 
ATOM   4537  C  CB    . ASP A 1 587 ? -3.455  -45.344 46.090  1.00 40.17 ? 587  ASP A CB    1 
ATOM   4538  C  CG    . ASP A 1 587 ? -4.940  -45.484 46.315  1.00 42.93 ? 587  ASP A CG    1 
ATOM   4539  O  OD1   . ASP A 1 587 ? -5.351  -45.503 47.483  1.00 43.34 ? 587  ASP A OD1   1 
ATOM   4540  O  OD2   . ASP A 1 587 ? -5.720  -45.603 45.334  1.00 45.74 ? 587  ASP A OD2   1 
ATOM   4541  N  N     . TYR A 1 588 ? -1.033  -43.624 46.035  1.00 39.24 ? 588  TYR A N     1 
ATOM   4542  C  CA    . TYR A 1 588 ? 0.221   -43.313 45.358  1.00 38.01 ? 588  TYR A CA    1 
ATOM   4543  C  C     . TYR A 1 588 ? 1.376   -43.281 46.338  1.00 39.52 ? 588  TYR A C     1 
ATOM   4544  O  O     . TYR A 1 588 ? 2.496   -43.663 46.004  1.00 40.64 ? 588  TYR A O     1 
ATOM   4545  C  CB    . TYR A 1 588 ? 0.144   -41.939 44.690  1.00 37.65 ? 588  TYR A CB    1 
ATOM   4546  C  CG    . TYR A 1 588 ? 1.296   -41.512 43.821  1.00 36.27 ? 588  TYR A CG    1 
ATOM   4547  C  CD1   . TYR A 1 588 ? 1.635   -42.221 42.683  1.00 33.86 ? 588  TYR A CD1   1 
ATOM   4548  C  CD2   . TYR A 1 588 ? 1.990   -40.320 44.047  1.00 35.21 ? 588  TYR A CD2   1 
ATOM   4549  C  CE1   . TYR A 1 588 ? 2.680   -41.869 41.863  1.00 33.01 ? 588  TYR A CE1   1 
ATOM   4550  C  CE2   . TYR A 1 588 ? 3.029   -39.933 43.222  1.00 34.54 ? 588  TYR A CE2   1 
ATOM   4551  C  CZ    . TYR A 1 588 ? 3.365   -40.698 42.128  1.00 34.48 ? 588  TYR A CZ    1 
ATOM   4552  O  OH    . TYR A 1 588 ? 4.402   -40.351 41.296  1.00 35.47 ? 588  TYR A OH    1 
ATOM   4553  N  N     . MET A 1 589 ? 1.140   -42.660 47.493  1.00 40.95 ? 589  MET A N     1 
ATOM   4554  C  CA    . MET A 1 589 ? 2.160   -42.478 48.508  1.00 41.37 ? 589  MET A CA    1 
ATOM   4555  C  C     . MET A 1 589 ? 2.215   -43.689 49.439  1.00 43.18 ? 589  MET A C     1 
ATOM   4556  O  O     . MET A 1 589 ? 2.896   -43.617 50.465  1.00 43.26 ? 589  MET A O     1 
ATOM   4557  C  CB    . MET A 1 589 ? 1.754   -41.262 49.359  1.00 38.17 ? 589  MET A CB    1 
ATOM   4558  C  CG    . MET A 1 589 ? 2.018   -39.935 48.667  1.00 36.71 ? 589  MET A CG    1 
ATOM   4559  S  SD    . MET A 1 589 ? 3.771   -39.610 48.546  1.00 41.42 ? 589  MET A SD    1 
ATOM   4560  C  CE    . MET A 1 589 ? 4.118   -40.147 46.879  1.00 30.19 ? 589  MET A CE    1 
ATOM   4561  N  N     . GLY A 1 590 ? 1.309   -44.630 49.225  1.00 44.58 ? 590  GLY A N     1 
ATOM   4562  C  CA    . GLY A 1 590 ? 1.207   -45.795 50.075  1.00 47.72 ? 590  GLY A CA    1 
ATOM   4563  C  C     . GLY A 1 590 ? 0.667   -45.532 51.469  1.00 49.43 ? 590  GLY A C     1 
ATOM   4564  O  O     . GLY A 1 590 ? 0.930   -46.349 52.365  1.00 50.20 ? 590  GLY A O     1 
ATOM   4565  N  N     . ILE A 1 591 ? -0.100  -44.487 51.731  1.00 49.95 ? 591  ILE A N     1 
ATOM   4566  C  CA    . ILE A 1 591 ? -0.483  -44.188 53.106  1.00 51.12 ? 591  ILE A CA    1 
ATOM   4567  C  C     . ILE A 1 591 ? -1.976  -44.197 53.385  1.00 53.93 ? 591  ILE A C     1 
ATOM   4568  O  O     . ILE A 1 591 ? -2.355  -43.387 54.248  1.00 54.18 ? 591  ILE A O     1 
ATOM   4569  C  CB    . ILE A 1 591 ? -0.024  -42.798 53.539  1.00 45.17 ? 591  ILE A CB    1 
ATOM   4570  C  CG1   . ILE A 1 591 ? -0.548  -41.716 52.600  1.00 45.59 ? 591  ILE A CG1   1 
ATOM   4571  C  CG2   . ILE A 1 591 ? 1.492   -42.690 53.629  1.00 48.39 ? 591  ILE A CG2   1 
ATOM   4572  C  CD1   . ILE A 1 591 ? 0.410   -40.536 52.567  1.00 42.59 ? 591  ILE A CD1   1 
ATOM   4573  N  N     . LYS A 1 592 ? -2.767  -44.922 52.596  1.00 55.49 ? 592  LYS A N     1 
ATOM   4574  C  CA    . LYS A 1 592 ? -4.204  -44.876 52.843  1.00 58.08 ? 592  LYS A CA    1 
ATOM   4575  C  C     . LYS A 1 592 ? -4.452  -45.670 54.129  1.00 59.98 ? 592  LYS A C     1 
ATOM   4576  O  O     . LYS A 1 592 ? -3.632  -46.536 54.469  1.00 59.93 ? 592  LYS A O     1 
ATOM   4577  C  CB    . LYS A 1 592 ? -5.036  -45.272 51.646  1.00 58.09 ? 592  LYS A CB    1 
ATOM   4578  C  CG    . LYS A 1 592 ? -6.527  -45.271 51.874  1.00 59.44 ? 592  LYS A CG    1 
ATOM   4579  C  CD    . LYS A 1 592 ? -7.330  -44.442 50.895  1.00 59.76 ? 592  LYS A CD    1 
ATOM   4580  C  CE    . LYS A 1 592 ? -7.341  -45.050 49.505  1.00 57.93 ? 592  LYS A CE    1 
ATOM   4581  N  NZ    . LYS A 1 592 ? -7.545  -44.005 48.475  1.00 60.06 ? 592  LYS A NZ    1 
ATOM   4582  N  N     . GLY A 1 593 ? -5.381  -45.154 54.954  1.00 60.43 ? 593  GLY A N     1 
ATOM   4583  C  CA    . GLY A 1 593 ? -5.620  -45.720 56.275  1.00 59.52 ? 593  GLY A CA    1 
ATOM   4584  C  C     . GLY A 1 593 ? -5.539  -44.694 57.390  1.00 59.14 ? 593  GLY A C     1 
ATOM   4585  O  O     . GLY A 1 593 ? -6.542  -44.342 58.010  1.00 58.56 ? 593  GLY A O     1 
ATOM   4586  N  N     . PRO A 1 594 ? -4.337  -44.272 57.749  1.00 59.97 ? 594  PRO A N     1 
ATOM   4587  C  CA    . PRO A 1 594 ? -4.101  -43.329 58.823  1.00 60.84 ? 594  PRO A CA    1 
ATOM   4588  C  C     . PRO A 1 594 ? -4.964  -42.071 58.739  1.00 61.55 ? 594  PRO A C     1 
ATOM   4589  O  O     . PRO A 1 594 ? -4.878  -41.355 57.732  1.00 62.48 ? 594  PRO A O     1 
ATOM   4590  C  CB    . PRO A 1 594 ? -2.651  -42.877 58.568  1.00 60.94 ? 594  PRO A CB    1 
ATOM   4591  C  CG    . PRO A 1 594 ? -1.992  -43.960 57.803  1.00 60.33 ? 594  PRO A CG    1 
ATOM   4592  C  CD    . PRO A 1 594 ? -3.079  -44.700 57.086  1.00 60.48 ? 594  PRO A CD    1 
ATOM   4593  N  N     . ARG A 1 595 ? -5.726  -41.753 59.786  1.00 60.74 ? 595  ARG A N     1 
ATOM   4594  C  CA    . ARG A 1 595 ? -6.436  -40.471 59.782  1.00 59.77 ? 595  ARG A CA    1 
ATOM   4595  C  C     . ARG A 1 595 ? -5.300  -39.433 59.795  1.00 59.15 ? 595  ARG A C     1 
ATOM   4596  O  O     . ARG A 1 595 ? -4.344  -39.683 60.539  1.00 60.39 ? 595  ARG A O     1 
ATOM   4597  C  CB    . ARG A 1 595 ? -7.327  -40.272 60.990  1.00 61.19 ? 595  ARG A CB    1 
ATOM   4598  C  CG    . ARG A 1 595 ? -8.558  -39.398 60.741  1.00 61.31 ? 595  ARG A CG    1 
ATOM   4599  C  CD    . ARG A 1 595 ? -9.221  -39.104 62.088  1.00 64.44 ? 595  ARG A CD    1 
ATOM   4600  N  NE    . ARG A 1 595 ? -10.312 -38.135 61.994  1.00 67.04 ? 595  ARG A NE    1 
ATOM   4601  C  CZ    . ARG A 1 595 ? -10.183 -36.890 62.466  1.00 66.96 ? 595  ARG A CZ    1 
ATOM   4602  N  NH1   . ARG A 1 595 ? -9.045  -36.533 63.049  1.00 67.25 ? 595  ARG A NH1   1 
ATOM   4603  N  NH2   . ARG A 1 595 ? -11.176 -36.022 62.348  1.00 65.53 ? 595  ARG A NH2   1 
ATOM   4604  N  N     . MET A 1 596 ? -5.316  -38.487 58.869  1.00 56.52 ? 596  MET A N     1 
ATOM   4605  C  CA    . MET A 1 596 ? -4.199  -37.564 58.759  1.00 54.18 ? 596  MET A CA    1 
ATOM   4606  C  C     . MET A 1 596 ? -4.693  -36.127 58.710  1.00 51.87 ? 596  MET A C     1 
ATOM   4607  O  O     . MET A 1 596 ? -5.709  -35.893 58.076  1.00 53.12 ? 596  MET A O     1 
ATOM   4608  C  CB    . MET A 1 596 ? -3.416  -37.844 57.474  1.00 53.66 ? 596  MET A CB    1 
ATOM   4609  C  CG    . MET A 1 596 ? -2.243  -38.767 57.693  1.00 53.44 ? 596  MET A CG    1 
ATOM   4610  S  SD    . MET A 1 596 ? -1.179  -38.954 56.250  1.00 50.90 ? 596  MET A SD    1 
ATOM   4611  C  CE    . MET A 1 596 ? -2.388  -39.695 55.143  1.00 48.25 ? 596  MET A CE    1 
ATOM   4612  N  N     . PRO A 1 597 ? -3.948  -35.225 59.310  1.00 49.22 ? 597  PRO A N     1 
ATOM   4613  C  CA    . PRO A 1 597 ? -4.257  -33.804 59.285  1.00 48.59 ? 597  PRO A CA    1 
ATOM   4614  C  C     . PRO A 1 597 ? -3.881  -33.206 57.929  1.00 47.55 ? 597  PRO A C     1 
ATOM   4615  O  O     . PRO A 1 597 ? -2.857  -33.603 57.402  1.00 47.90 ? 597  PRO A O     1 
ATOM   4616  C  CB    . PRO A 1 597 ? -3.303  -33.266 60.353  1.00 48.16 ? 597  PRO A CB    1 
ATOM   4617  C  CG    . PRO A 1 597 ? -2.094  -34.153 60.183  1.00 47.68 ? 597  PRO A CG    1 
ATOM   4618  C  CD    . PRO A 1 597 ? -2.662  -35.518 59.991  1.00 48.09 ? 597  PRO A CD    1 
ATOM   4619  N  N     . LEU A 1 598 ? -4.625  -32.263 57.419  1.00 46.94 ? 598  LEU A N     1 
ATOM   4620  C  CA    . LEU A 1 598 ? -4.514  -31.631 56.121  1.00 46.29 ? 598  LEU A CA    1 
ATOM   4621  C  C     . LEU A 1 598 ? -4.554  -30.106 56.228  1.00 45.96 ? 598  LEU A C     1 
ATOM   4622  O  O     . LEU A 1 598 ? -5.372  -29.597 56.997  1.00 47.19 ? 598  LEU A O     1 
ATOM   4623  C  CB    . LEU A 1 598 ? -5.734  -32.044 55.285  1.00 43.75 ? 598  LEU A CB    1 
ATOM   4624  C  CG    . LEU A 1 598 ? -5.895  -31.531 53.855  1.00 42.86 ? 598  LEU A CG    1 
ATOM   4625  C  CD1   . LEU A 1 598 ? -4.639  -30.794 53.411  1.00 49.05 ? 598  LEU A CD1   1 
ATOM   4626  C  CD2   . LEU A 1 598 ? -6.067  -32.718 52.923  1.00 43.85 ? 598  LEU A CD2   1 
ATOM   4627  N  N     . GLY A 1 599 ? -3.725  -29.406 55.494  1.00 44.61 ? 599  GLY A N     1 
ATOM   4628  C  CA    . GLY A 1 599 ? -3.671  -27.964 55.366  1.00 43.48 ? 599  GLY A CA    1 
ATOM   4629  C  C     . GLY A 1 599 ? -4.217  -27.610 53.966  1.00 44.85 ? 599  GLY A C     1 
ATOM   4630  O  O     . GLY A 1 599 ? -3.758  -28.186 52.959  1.00 45.33 ? 599  GLY A O     1 
ATOM   4631  N  N     . PHE A 1 600 ? -5.248  -26.773 53.904  1.00 43.87 ? 600  PHE A N     1 
ATOM   4632  C  CA    . PHE A 1 600 ? -5.939  -26.470 52.644  1.00 42.89 ? 600  PHE A CA    1 
ATOM   4633  C  C     . PHE A 1 600 ? -5.546  -25.088 52.126  1.00 42.14 ? 600  PHE A C     1 
ATOM   4634  O  O     . PHE A 1 600 ? -6.004  -24.092 52.692  1.00 40.76 ? 600  PHE A O     1 
ATOM   4635  C  CB    . PHE A 1 600 ? -7.456  -26.527 52.848  1.00 38.18 ? 600  PHE A CB    1 
ATOM   4636  C  CG    . PHE A 1 600 ? -8.322  -26.434 51.628  1.00 42.11 ? 600  PHE A CG    1 
ATOM   4637  C  CD1   . PHE A 1 600 ? -7.768  -26.278 50.353  1.00 38.88 ? 600  PHE A CD1   1 
ATOM   4638  C  CD2   . PHE A 1 600 ? -9.716  -26.516 51.743  1.00 40.45 ? 600  PHE A CD2   1 
ATOM   4639  C  CE1   . PHE A 1 600 ? -8.565  -26.280 49.223  1.00 34.58 ? 600  PHE A CE1   1 
ATOM   4640  C  CE2   . PHE A 1 600 ? -10.519 -26.436 50.601  1.00 40.61 ? 600  PHE A CE2   1 
ATOM   4641  C  CZ    . PHE A 1 600 ? -9.947  -26.330 49.342  1.00 35.90 ? 600  PHE A CZ    1 
ATOM   4642  N  N     . THR A 1 601 ? -4.616  -25.038 51.151  1.00 41.40 ? 601  THR A N     1 
ATOM   4643  C  CA    . THR A 1 601 ? -4.264  -23.743 50.568  1.00 40.26 ? 601  THR A CA    1 
ATOM   4644  C  C     . THR A 1 601 ? -5.254  -23.411 49.435  1.00 40.31 ? 601  THR A C     1 
ATOM   4645  O  O     . THR A 1 601 ? -5.229  -24.079 48.399  1.00 40.69 ? 601  THR A O     1 
ATOM   4646  C  CB    . THR A 1 601 ? -2.872  -23.764 49.934  1.00 38.21 ? 601  THR A CB    1 
ATOM   4647  O  OG1   . THR A 1 601 ? -1.868  -23.869 50.939  1.00 36.95 ? 601  THR A OG1   1 
ATOM   4648  C  CG2   . THR A 1 601 ? -2.634  -22.469 49.167  1.00 35.63 ? 601  THR A CG2   1 
ATOM   4649  N  N     . PHE A 1 602 ? -6.156  -22.479 49.673  1.00 38.73 ? 602  PHE A N     1 
ATOM   4650  C  CA    . PHE A 1 602 ? -7.252  -22.186 48.738  1.00 37.50 ? 602  PHE A CA    1 
ATOM   4651  C  C     . PHE A 1 602 ? -7.179  -20.707 48.389  1.00 37.97 ? 602  PHE A C     1 
ATOM   4652  O  O     . PHE A 1 602 ? -7.231  -19.780 49.191  1.00 39.47 ? 602  PHE A O     1 
ATOM   4653  C  CB    . PHE A 1 602 ? -8.554  -22.626 49.372  1.00 32.87 ? 602  PHE A CB    1 
ATOM   4654  C  CG    . PHE A 1 602 ? -9.845  -22.384 48.667  1.00 36.16 ? 602  PHE A CG    1 
ATOM   4655  C  CD1   . PHE A 1 602 ? -10.202 -23.073 47.522  1.00 30.38 ? 602  PHE A CD1   1 
ATOM   4656  C  CD2   . PHE A 1 602 ? -10.705 -21.397 49.123  1.00 37.50 ? 602  PHE A CD2   1 
ATOM   4657  C  CE1   . PHE A 1 602 ? -11.425 -22.871 46.943  1.00 31.66 ? 602  PHE A CE1   1 
ATOM   4658  C  CE2   . PHE A 1 602 ? -11.915 -21.141 48.520  1.00 34.00 ? 602  PHE A CE2   1 
ATOM   4659  C  CZ    . PHE A 1 602 ? -12.270 -21.881 47.411  1.00 35.62 ? 602  PHE A CZ    1 
ATOM   4660  N  N     . SER A 1 603 ? -6.665  -20.450 47.206  1.00 37.87 ? 603  SER A N     1 
ATOM   4661  C  CA    . SER A 1 603 ? -6.250  -19.127 46.748  1.00 38.99 ? 603  SER A CA    1 
ATOM   4662  C  C     . SER A 1 603 ? -7.333  -18.134 46.314  1.00 37.63 ? 603  SER A C     1 
ATOM   4663  O  O     . SER A 1 603 ? -7.356  -17.662 45.177  1.00 36.40 ? 603  SER A O     1 
ATOM   4664  C  CB    . SER A 1 603 ? -5.360  -19.459 45.498  1.00 34.12 ? 603  SER A CB    1 
ATOM   4665  O  OG    . SER A 1 603 ? -4.074  -19.232 46.055  1.00 51.71 ? 603  SER A OG    1 
ATOM   4666  N  N     . PHE A 1 604 ? -8.318  -17.920 47.151  1.00 36.39 ? 604  PHE A N     1 
ATOM   4667  C  CA    . PHE A 1 604 ? -9.440  -17.024 46.926  1.00 36.57 ? 604  PHE A CA    1 
ATOM   4668  C  C     . PHE A 1 604 ? -9.776  -16.356 48.263  1.00 35.74 ? 604  PHE A C     1 
ATOM   4669  O  O     . PHE A 1 604 ? -9.546  -16.937 49.317  1.00 34.89 ? 604  PHE A O     1 
ATOM   4670  C  CB    . PHE A 1 604 ? -10.655 -17.849 46.464  1.00 34.94 ? 604  PHE A CB    1 
ATOM   4671  C  CG    . PHE A 1 604 ? -10.281 -18.664 45.249  1.00 38.47 ? 604  PHE A CG    1 
ATOM   4672  C  CD1   . PHE A 1 604 ? -10.373 -18.058 44.001  1.00 34.49 ? 604  PHE A CD1   1 
ATOM   4673  C  CD2   . PHE A 1 604 ? -9.760  -19.951 45.379  1.00 34.96 ? 604  PHE A CD2   1 
ATOM   4674  C  CE1   . PHE A 1 604 ? -10.032 -18.766 42.869  1.00 33.10 ? 604  PHE A CE1   1 
ATOM   4675  C  CE2   . PHE A 1 604 ? -9.419  -20.653 44.233  1.00 36.06 ? 604  PHE A CE2   1 
ATOM   4676  C  CZ    . PHE A 1 604 ? -9.574  -20.061 42.988  1.00 33.77 ? 604  PHE A CZ    1 
ATOM   4677  N  N     . PRO A 1 605 ? -10.427 -15.221 48.218  1.00 36.36 ? 605  PRO A N     1 
ATOM   4678  C  CA    . PRO A 1 605 ? -10.863 -14.532 49.437  1.00 37.04 ? 605  PRO A CA    1 
ATOM   4679  C  C     . PRO A 1 605 ? -11.917 -15.250 50.270  1.00 37.92 ? 605  PRO A C     1 
ATOM   4680  O  O     . PRO A 1 605 ? -13.014 -15.675 49.874  1.00 38.18 ? 605  PRO A O     1 
ATOM   4681  C  CB    . PRO A 1 605 ? -11.323 -13.185 48.888  1.00 36.11 ? 605  PRO A CB    1 
ATOM   4682  C  CG    . PRO A 1 605 ? -11.792 -13.503 47.508  1.00 34.93 ? 605  PRO A CG    1 
ATOM   4683  C  CD    . PRO A 1 605 ? -10.933 -14.594 46.971  1.00 35.14 ? 605  PRO A CD    1 
ATOM   4684  N  N     . CYS A 1 606 ? -11.636 -15.357 51.568  1.00 38.99 ? 606  CYS A N     1 
ATOM   4685  C  CA    . CYS A 1 606 ? -12.508 -16.066 52.485  1.00 41.12 ? 606  CYS A CA    1 
ATOM   4686  C  C     . CYS A 1 606 ? -12.657 -15.310 53.803  1.00 42.31 ? 606  CYS A C     1 
ATOM   4687  O  O     . CYS A 1 606 ? -11.624 -15.021 54.408  1.00 40.72 ? 606  CYS A O     1 
ATOM   4688  C  CB    . CYS A 1 606 ? -11.844 -17.418 52.853  1.00 45.14 ? 606  CYS A CB    1 
ATOM   4689  S  SG    . CYS A 1 606 ? -11.890 -18.667 51.583  1.00 42.16 ? 606  CYS A SG    1 
ATOM   4690  N  N     . GLN A 1 607 ? -13.882 -15.293 54.344  1.00 44.12 ? 607  GLN A N     1 
ATOM   4691  C  CA    . GLN A 1 607 ? -13.996 -14.723 55.710  1.00 45.28 ? 607  GLN A CA    1 
ATOM   4692  C  C     . GLN A 1 607 ? -13.707 -15.787 56.755  1.00 45.32 ? 607  GLN A C     1 
ATOM   4693  O  O     . GLN A 1 607 ? -14.265 -16.885 56.714  1.00 45.42 ? 607  GLN A O     1 
ATOM   4694  C  CB    . GLN A 1 607 ? -15.328 -14.019 55.879  1.00 46.73 ? 607  GLN A CB    1 
ATOM   4695  C  CG    . GLN A 1 607 ? -15.366 -13.151 57.134  1.00 54.81 ? 607  GLN A CG    1 
ATOM   4696  C  CD    . GLN A 1 607 ? -14.726 -11.778 56.993  1.00 54.47 ? 607  GLN A CD    1 
ATOM   4697  O  OE1   . GLN A 1 607 ? -15.006 -11.029 56.038  1.00 54.36 ? 607  GLN A OE1   1 
ATOM   4698  N  NE2   . GLN A 1 607 ? -13.940 -11.441 58.013  1.00 53.04 ? 607  GLN A NE2   1 
ATOM   4699  N  N     . GLN A 1 608 ? -12.701 -15.631 57.592  1.00 45.95 ? 608  GLN A N     1 
ATOM   4700  C  CA    . GLN A 1 608 ? -12.338 -16.648 58.555  1.00 47.50 ? 608  GLN A CA    1 
ATOM   4701  C  C     . GLN A 1 608 ? -12.660 -16.330 60.015  1.00 47.86 ? 608  GLN A C     1 
ATOM   4702  O  O     . GLN A 1 608 ? -12.034 -15.402 60.550  1.00 46.95 ? 608  GLN A O     1 
ATOM   4703  C  CB    . GLN A 1 608 ? -10.825 -16.953 58.438  1.00 46.37 ? 608  GLN A CB    1 
ATOM   4704  C  CG    . GLN A 1 608 ? -10.577 -18.109 57.479  1.00 54.01 ? 608  GLN A CG    1 
ATOM   4705  C  CD    . GLN A 1 608 ? -9.114  -18.299 57.152  1.00 53.36 ? 608  GLN A CD    1 
ATOM   4706  O  OE1   . GLN A 1 608 ? -8.699  -17.991 56.040  1.00 57.28 ? 608  GLN A OE1   1 
ATOM   4707  N  NE2   . GLN A 1 608 ? -8.329  -18.789 58.099  1.00 51.85 ? 608  GLN A NE2   1 
ATOM   4708  N  N     . THR A 1 609 ? -13.350 -17.252 60.700  1.00 48.13 ? 609  THR A N     1 
ATOM   4709  C  CA    . THR A 1 609 ? -13.522 -17.129 62.151  1.00 49.87 ? 609  THR A CA    1 
ATOM   4710  C  C     . THR A 1 609 ? -12.479 -17.969 62.892  1.00 50.71 ? 609  THR A C     1 
ATOM   4711  O  O     . THR A 1 609 ? -12.382 -17.966 64.124  1.00 50.87 ? 609  THR A O     1 
ATOM   4712  C  CB    . THR A 1 609 ? -14.914 -17.449 62.708  1.00 44.66 ? 609  THR A CB    1 
ATOM   4713  O  OG1   . THR A 1 609 ? -15.434 -18.654 62.116  1.00 50.02 ? 609  THR A OG1   1 
ATOM   4714  C  CG2   . THR A 1 609 ? -15.897 -16.356 62.284  1.00 49.06 ? 609  THR A CG2   1 
ATOM   4715  N  N     . SER A 1 610 ? -11.574 -18.585 62.127  1.00 51.00 ? 610  SER A N     1 
ATOM   4716  C  CA    . SER A 1 610 ? -10.478 -19.303 62.766  1.00 50.51 ? 610  SER A CA    1 
ATOM   4717  C  C     . SER A 1 610 ? -9.683  -20.063 61.713  1.00 50.17 ? 610  SER A C     1 
ATOM   4718  O  O     . SER A 1 610 ? -10.197 -20.291 60.623  1.00 49.67 ? 610  SER A O     1 
ATOM   4719  C  CB    . SER A 1 610 ? -11.036 -20.349 63.743  1.00 51.78 ? 610  SER A CB    1 
ATOM   4720  O  OG    . SER A 1 610 ? -11.797 -21.312 63.020  1.00 51.58 ? 610  SER A OG    1 
ATOM   4721  N  N     . LEU A 1 611 ? -8.548  -20.596 62.163  1.00 49.25 ? 611  LEU A N     1 
ATOM   4722  C  CA    . LEU A 1 611 ? -7.704  -21.339 61.265  1.00 49.23 ? 611  LEU A CA    1 
ATOM   4723  C  C     . LEU A 1 611 ? -8.463  -22.373 60.447  1.00 49.64 ? 611  LEU A C     1 
ATOM   4724  O  O     . LEU A 1 611 ? -8.042  -22.612 59.309  1.00 49.60 ? 611  LEU A O     1 
ATOM   4725  C  CB    . LEU A 1 611 ? -6.549  -22.018 62.018  1.00 46.71 ? 611  LEU A CB    1 
ATOM   4726  C  CG    . LEU A 1 611 ? -5.360  -22.376 61.130  1.00 46.63 ? 611  LEU A CG    1 
ATOM   4727  C  CD1   . LEU A 1 611 ? -5.023  -21.204 60.206  1.00 48.37 ? 611  LEU A CD1   1 
ATOM   4728  C  CD2   . LEU A 1 611 ? -4.133  -22.705 61.958  1.00 47.10 ? 611  LEU A CD2   1 
ATOM   4729  N  N     . ASP A 1 612 ? -9.470  -23.061 60.978  1.00 49.06 ? 612  ASP A N     1 
ATOM   4730  C  CA    . ASP A 1 612 ? -10.012 -24.181 60.231  1.00 49.39 ? 612  ASP A CA    1 
ATOM   4731  C  C     . ASP A 1 612 ? -11.397 -23.996 59.645  1.00 48.63 ? 612  ASP A C     1 
ATOM   4732  O  O     . ASP A 1 612 ? -12.037 -25.004 59.290  1.00 48.71 ? 612  ASP A O     1 
ATOM   4733  C  CB    . ASP A 1 612 ? -9.997  -25.453 61.107  1.00 50.87 ? 612  ASP A CB    1 
ATOM   4734  C  CG    . ASP A 1 612 ? -11.100 -25.245 62.132  1.00 52.37 ? 612  ASP A CG    1 
ATOM   4735  O  OD1   . ASP A 1 612 ? -11.077 -24.170 62.754  1.00 55.69 ? 612  ASP A OD1   1 
ATOM   4736  O  OD2   . ASP A 1 612 ? -11.979 -26.105 62.253  1.00 58.37 ? 612  ASP A OD2   1 
ATOM   4737  N  N     . ALA A 1 613 ? -11.799 -22.754 59.428  1.00 47.39 ? 613  ALA A N     1 
ATOM   4738  C  CA    . ALA A 1 613 ? -13.024 -22.459 58.694  1.00 46.67 ? 613  ALA A CA    1 
ATOM   4739  C  C     . ALA A 1 613 ? -12.803 -21.197 57.857  1.00 46.33 ? 613  ALA A C     1 
ATOM   4740  O  O     . ALA A 1 613 ? -12.031 -20.317 58.262  1.00 46.66 ? 613  ALA A O     1 
ATOM   4741  C  CB    . ALA A 1 613 ? -14.203 -22.219 59.630  1.00 42.73 ? 613  ALA A CB    1 
ATOM   4742  N  N     . GLY A 1 614 ? -13.477 -21.134 56.714  1.00 45.28 ? 614  GLY A N     1 
ATOM   4743  C  CA    . GLY A 1 614 ? -13.370 -19.955 55.855  1.00 43.91 ? 614  GLY A CA    1 
ATOM   4744  C  C     . GLY A 1 614 ? -14.481 -19.971 54.807  1.00 43.39 ? 614  GLY A C     1 
ATOM   4745  O  O     . GLY A 1 614 ? -14.618 -20.875 54.002  1.00 42.30 ? 614  GLY A O     1 
ATOM   4746  N  N     . ILE A 1 615 ? -15.305 -18.928 54.846  1.00 43.81 ? 615  ILE A N     1 
ATOM   4747  C  CA    . ILE A 1 615 ? -16.456 -18.791 53.956  1.00 44.30 ? 615  ILE A CA    1 
ATOM   4748  C  C     . ILE A 1 615 ? -16.033 -18.104 52.668  1.00 43.61 ? 615  ILE A C     1 
ATOM   4749  O  O     . ILE A 1 615 ? -15.377 -17.049 52.718  1.00 44.09 ? 615  ILE A O     1 
ATOM   4750  C  CB    . ILE A 1 615 ? -17.510 -17.951 54.732  1.00 46.14 ? 615  ILE A CB    1 
ATOM   4751  C  CG1   . ILE A 1 615 ? -16.673 -17.014 55.641  1.00 49.02 ? 615  ILE A CG1   1 
ATOM   4752  C  CG2   . ILE A 1 615 ? -18.323 -18.859 55.657  1.00 45.06 ? 615  ILE A CG2   1 
ATOM   4753  C  CD1   . ILE A 1 615 ? -17.201 -16.931 57.067  1.00 52.65 ? 615  ILE A CD1   1 
ATOM   4754  N  N     . LEU A 1 616 ? -16.340 -18.691 51.511  1.00 42.04 ? 616  LEU A N     1 
ATOM   4755  C  CA    . LEU A 1 616 ? -15.846 -18.044 50.294  1.00 41.92 ? 616  LEU A CA    1 
ATOM   4756  C  C     . LEU A 1 616 ? -16.496 -16.677 50.108  1.00 42.27 ? 616  LEU A C     1 
ATOM   4757  O  O     . LEU A 1 616 ? -17.712 -16.637 49.914  1.00 42.51 ? 616  LEU A O     1 
ATOM   4758  C  CB    . LEU A 1 616 ? -16.026 -18.977 49.096  1.00 35.45 ? 616  LEU A CB    1 
ATOM   4759  C  CG    . LEU A 1 616 ? -15.714 -18.311 47.731  1.00 34.27 ? 616  LEU A CG    1 
ATOM   4760  C  CD1   . LEU A 1 616 ? -14.215 -18.025 47.647  1.00 32.99 ? 616  LEU A CD1   1 
ATOM   4761  C  CD2   . LEU A 1 616 ? -16.104 -19.272 46.608  1.00 38.00 ? 616  LEU A CD2   1 
ATOM   4762  N  N     . ILE A 1 617 ? -15.746 -15.575 50.083  1.00 42.31 ? 617  ILE A N     1 
ATOM   4763  C  CA    . ILE A 1 617 ? -16.336 -14.269 49.808  1.00 41.87 ? 617  ILE A CA    1 
ATOM   4764  C  C     . ILE A 1 617 ? -16.712 -14.053 48.341  1.00 41.92 ? 617  ILE A C     1 
ATOM   4765  O  O     . ILE A 1 617 ? -17.832 -13.625 48.038  1.00 41.83 ? 617  ILE A O     1 
ATOM   4766  C  CB    . ILE A 1 617 ? -15.481 -13.094 50.267  1.00 42.43 ? 617  ILE A CB    1 
ATOM   4767  C  CG1   . ILE A 1 617 ? -15.188 -13.194 51.765  1.00 35.03 ? 617  ILE A CG1   1 
ATOM   4768  C  CG2   . ILE A 1 617 ? -16.123 -11.737 49.976  1.00 37.27 ? 617  ILE A CG2   1 
ATOM   4769  C  CD1   . ILE A 1 617 ? -14.099 -12.171 52.081  1.00 41.68 ? 617  ILE A CD1   1 
ATOM   4770  N  N     . THR A 1 618 ? -15.792 -14.305 47.419  1.00 41.17 ? 618  THR A N     1 
ATOM   4771  C  CA    . THR A 1 618 ? -16.131 -14.321 46.008  1.00 39.99 ? 618  THR A CA    1 
ATOM   4772  C  C     . THR A 1 618 ? -15.251 -15.306 45.251  1.00 39.42 ? 618  THR A C     1 
ATOM   4773  O  O     . THR A 1 618 ? -14.048 -15.151 45.414  1.00 40.01 ? 618  THR A O     1 
ATOM   4774  C  CB    . THR A 1 618 ? -16.008 -12.926 45.396  1.00 41.51 ? 618  THR A CB    1 
ATOM   4775  O  OG1   . THR A 1 618 ? -16.500 -12.944 44.052  1.00 48.61 ? 618  THR A OG1   1 
ATOM   4776  C  CG2   . THR A 1 618 ? -14.558 -12.466 45.406  1.00 35.45 ? 618  THR A CG2   1 
ATOM   4777  N  N     . TRP A 1 619 ? -15.726 -15.726 44.089  1.00 39.37 ? 619  TRP A N     1 
ATOM   4778  C  CA    . TRP A 1 619 ? -14.780 -16.306 43.118  1.00 39.23 ? 619  TRP A CA    1 
ATOM   4779  C  C     . TRP A 1 619 ? -13.980 -15.149 42.534  1.00 40.00 ? 619  TRP A C     1 
ATOM   4780  O  O     . TRP A 1 619 ? -14.409 -13.959 42.538  1.00 42.04 ? 619  TRP A O     1 
ATOM   4781  C  CB    . TRP A 1 619 ? -15.610 -17.044 42.093  1.00 34.09 ? 619  TRP A CB    1 
ATOM   4782  C  CG    . TRP A 1 619 ? -15.895 -18.472 42.469  1.00 36.13 ? 619  TRP A CG    1 
ATOM   4783  C  CD1   . TRP A 1 619 ? -17.066 -19.142 42.240  1.00 37.02 ? 619  TRP A CD1   1 
ATOM   4784  C  CD2   . TRP A 1 619 ? -14.998 -19.431 43.043  1.00 37.62 ? 619  TRP A CD2   1 
ATOM   4785  N  NE1   . TRP A 1 619 ? -16.962 -20.417 42.660  1.00 41.48 ? 619  TRP A NE1   1 
ATOM   4786  C  CE2   . TRP A 1 619 ? -15.699 -20.639 43.156  1.00 39.16 ? 619  TRP A CE2   1 
ATOM   4787  C  CE3   . TRP A 1 619 ? -13.676 -19.386 43.486  1.00 37.79 ? 619  TRP A CE3   1 
ATOM   4788  C  CZ2   . TRP A 1 619 ? -15.144 -21.805 43.684  1.00 37.44 ? 619  TRP A CZ2   1 
ATOM   4789  C  CZ3   . TRP A 1 619 ? -13.114 -20.529 44.034  1.00 41.69 ? 619  TRP A CZ3   1 
ATOM   4790  C  CH2   . TRP A 1 619 ? -13.837 -21.725 44.101  1.00 41.48 ? 619  TRP A CH2   1 
ATOM   4791  N  N     . THR A 1 620 ? -12.700 -15.283 42.286  1.00 38.93 ? 620  THR A N     1 
ATOM   4792  C  CA    . THR A 1 620 ? -11.795 -14.402 41.574  1.00 38.64 ? 620  THR A CA    1 
ATOM   4793  C  C     . THR A 1 620 ? -11.066 -15.334 40.567  1.00 38.10 ? 620  THR A C     1 
ATOM   4794  O  O     . THR A 1 620 ? -11.164 -16.579 40.597  1.00 37.96 ? 620  THR A O     1 
ATOM   4795  C  CB    . THR A 1 620 ? -10.674 -13.794 42.453  1.00 36.99 ? 620  THR A CB    1 
ATOM   4796  O  OG1   . THR A 1 620 ? -9.869  -14.917 42.917  1.00 36.55 ? 620  THR A OG1   1 
ATOM   4797  C  CG2   . THR A 1 620 ? -11.300 -13.054 43.614  1.00 34.06 ? 620  THR A CG2   1 
ATOM   4798  N  N     . LYS A 1 621 ? -10.261 -14.697 39.732  1.00 37.44 ? 621  LYS A N     1 
ATOM   4799  C  CA    . LYS A 1 621 ? -9.489  -15.350 38.698  1.00 37.23 ? 621  LYS A CA    1 
ATOM   4800  C  C     . LYS A 1 621 ? -10.392 -16.123 37.759  1.00 37.65 ? 621  LYS A C     1 
ATOM   4801  O  O     . LYS A 1 621 ? -11.443 -15.564 37.459  1.00 39.36 ? 621  LYS A O     1 
ATOM   4802  C  CB    . LYS A 1 621 ? -8.381  -16.235 39.265  1.00 37.85 ? 621  LYS A CB    1 
ATOM   4803  C  CG    . LYS A 1 621 ? -7.362  -15.435 40.074  1.00 33.02 ? 621  LYS A CG    1 
ATOM   4804  C  CD    . LYS A 1 621 ? -6.254  -16.392 40.525  1.00 36.95 ? 621  LYS A CD    1 
ATOM   4805  C  CE    . LYS A 1 621 ? -6.764  -17.524 41.403  1.00 36.64 ? 621  LYS A CE    1 
ATOM   4806  N  NZ    . LYS A 1 621 ? -6.311  -17.349 42.816  1.00 27.47 ? 621  LYS A NZ    1 
ATOM   4807  N  N     . GLY A 1 622 ? -10.047 -17.317 37.309  1.00 36.41 ? 622  GLY A N     1 
ATOM   4808  C  CA    . GLY A 1 622 ? -10.886 -18.124 36.487  1.00 35.86 ? 622  GLY A CA    1 
ATOM   4809  C  C     . GLY A 1 622 ? -11.956 -19.009 37.085  1.00 35.35 ? 622  GLY A C     1 
ATOM   4810  O  O     . GLY A 1 622 ? -12.630 -19.725 36.311  1.00 33.87 ? 622  GLY A O     1 
ATOM   4811  N  N     . PHE A 1 623 ? -12.090 -19.138 38.385  1.00 36.06 ? 623  PHE A N     1 
ATOM   4812  C  CA    . PHE A 1 623 ? -13.051 -20.041 39.011  1.00 37.23 ? 623  PHE A CA    1 
ATOM   4813  C  C     . PHE A 1 623 ? -14.468 -19.511 39.107  1.00 41.06 ? 623  PHE A C     1 
ATOM   4814  O  O     . PHE A 1 623 ? -14.769 -18.315 39.370  1.00 43.05 ? 623  PHE A O     1 
ATOM   4815  C  CB    . PHE A 1 623 ? -12.496 -20.319 40.428  1.00 40.47 ? 623  PHE A CB    1 
ATOM   4816  C  CG    . PHE A 1 623 ? -11.554 -21.506 40.383  1.00 39.83 ? 623  PHE A CG    1 
ATOM   4817  C  CD1   . PHE A 1 623 ? -10.249 -21.288 39.959  1.00 36.13 ? 623  PHE A CD1   1 
ATOM   4818  C  CD2   . PHE A 1 623 ? -11.947 -22.809 40.697  1.00 40.29 ? 623  PHE A CD2   1 
ATOM   4819  C  CE1   . PHE A 1 623 ? -9.339  -22.340 39.896  1.00 37.33 ? 623  PHE A CE1   1 
ATOM   4820  C  CE2   . PHE A 1 623 ? -11.038 -23.834 40.639  1.00 38.21 ? 623  PHE A CE2   1 
ATOM   4821  C  CZ    . PHE A 1 623 ? -9.740  -23.609 40.234  1.00 36.04 ? 623  PHE A CZ    1 
ATOM   4822  N  N     . LYS A 1 624 ? -15.456 -20.375 38.897  1.00 42.34 ? 624  LYS A N     1 
ATOM   4823  C  CA    . LYS A 1 624 ? -16.844 -20.041 39.039  1.00 45.25 ? 624  LYS A CA    1 
ATOM   4824  C  C     . LYS A 1 624 ? -17.779 -21.214 39.217  1.00 46.15 ? 624  LYS A C     1 
ATOM   4825  O  O     . LYS A 1 624 ? -18.861 -21.293 38.606  1.00 47.04 ? 624  LYS A O     1 
ATOM   4826  C  CB    . LYS A 1 624 ? -17.343 -19.069 37.971  1.00 54.06 ? 624  LYS A CB    1 
ATOM   4827  C  CG    . LYS A 1 624 ? -17.286 -17.610 38.469  1.00 53.76 ? 624  LYS A CG    1 
ATOM   4828  C  CD    . LYS A 1 624 ? -17.513 -16.676 37.265  1.00 58.26 ? 624  LYS A CD    1 
ATOM   4829  C  CE    . LYS A 1 624 ? -19.010 -16.341 37.277  1.00 62.15 ? 624  LYS A CE    1 
ATOM   4830  N  NZ    . LYS A 1 624 ? -19.532 -16.845 38.611  1.00 65.69 ? 624  LYS A NZ    1 
ATOM   4831  N  N     . ALA A 1 625 ? -17.383 -22.105 40.127  1.00 45.11 ? 625  ALA A N     1 
ATOM   4832  C  CA    . ALA A 1 625 ? -18.223 -23.272 40.373  1.00 46.10 ? 625  ALA A CA    1 
ATOM   4833  C  C     . ALA A 1 625 ? -19.364 -22.898 41.306  1.00 45.92 ? 625  ALA A C     1 
ATOM   4834  O  O     . ALA A 1 625 ? -19.168 -22.129 42.240  1.00 45.92 ? 625  ALA A O     1 
ATOM   4835  C  CB    . ALA A 1 625 ? -17.502 -24.533 40.806  1.00 46.59 ? 625  ALA A CB    1 
ATOM   4836  N  N     . THR A 1 626 ? -20.563 -23.346 40.981  1.00 46.63 ? 626  THR A N     1 
ATOM   4837  C  CA    . THR A 1 626 ? -21.772 -22.993 41.690  1.00 47.89 ? 626  THR A CA    1 
ATOM   4838  C  C     . THR A 1 626 ? -21.971 -23.599 43.060  1.00 49.58 ? 626  THR A C     1 
ATOM   4839  O  O     . THR A 1 626 ? -21.663 -24.770 43.347  1.00 50.82 ? 626  THR A O     1 
ATOM   4840  C  CB    . THR A 1 626 ? -22.999 -23.227 40.782  1.00 49.14 ? 626  THR A CB    1 
ATOM   4841  O  OG1   . THR A 1 626 ? -22.899 -24.496 40.138  1.00 55.14 ? 626  THR A OG1   1 
ATOM   4842  C  CG2   . THR A 1 626 ? -22.985 -22.150 39.691  1.00 53.40 ? 626  THR A CG2   1 
ATOM   4843  N  N     . ASP A 1 627 ? -22.577 -22.815 43.953  1.00 49.63 ? 627  ASP A N     1 
ATOM   4844  C  CA    . ASP A 1 627 ? -22.900 -23.237 45.299  1.00 49.23 ? 627  ASP A CA    1 
ATOM   4845  C  C     . ASP A 1 627 ? -21.678 -23.240 46.201  1.00 48.27 ? 627  ASP A C     1 
ATOM   4846  O  O     . ASP A 1 627 ? -21.671 -23.756 47.328  1.00 47.92 ? 627  ASP A O     1 
ATOM   4847  C  CB    . ASP A 1 627 ? -23.733 -24.514 45.318  1.00 53.84 ? 627  ASP A CB    1 
ATOM   4848  C  CG    . ASP A 1 627 ? -25.026 -24.351 44.519  1.00 57.15 ? 627  ASP A CG    1 
ATOM   4849  O  OD1   . ASP A 1 627 ? -25.922 -23.579 44.949  1.00 59.91 ? 627  ASP A OD1   1 
ATOM   4850  O  OD2   . ASP A 1 627 ? -25.101 -24.922 43.413  1.00 56.09 ? 627  ASP A OD2   1 
ATOM   4851  N  N     . CYS A 1 628 ? -20.746 -22.344 45.825  1.00 46.65 ? 628  CYS A N     1 
ATOM   4852  C  CA    . CYS A 1 628 ? -19.563 -22.160 46.633  1.00 46.00 ? 628  CYS A CA    1 
ATOM   4853  C  C     . CYS A 1 628 ? -19.573 -20.910 47.465  1.00 45.76 ? 628  CYS A C     1 
ATOM   4854  O  O     . CYS A 1 628 ? -19.308 -21.029 48.658  1.00 47.09 ? 628  CYS A O     1 
ATOM   4855  C  CB    . CYS A 1 628 ? -18.305 -22.348 45.778  1.00 39.28 ? 628  CYS A CB    1 
ATOM   4856  S  SG    . CYS A 1 628 ? -18.218 -24.064 45.216  1.00 42.84 ? 628  CYS A SG    1 
ATOM   4857  N  N     . VAL A 1 629 ? -19.762 -19.743 46.872  1.00 45.47 ? 629  VAL A N     1 
ATOM   4858  C  CA    . VAL A 1 629 ? -19.725 -18.486 47.625  1.00 44.68 ? 629  VAL A CA    1 
ATOM   4859  C  C     . VAL A 1 629 ? -20.754 -18.491 48.757  1.00 45.25 ? 629  VAL A C     1 
ATOM   4860  O  O     . VAL A 1 629 ? -21.852 -19.007 48.591  1.00 44.35 ? 629  VAL A O     1 
ATOM   4861  C  CB    . VAL A 1 629 ? -20.122 -17.377 46.623  1.00 44.04 ? 629  VAL A CB    1 
ATOM   4862  C  CG1   . VAL A 1 629 ? -20.710 -16.158 47.302  1.00 34.95 ? 629  VAL A CG1   1 
ATOM   4863  C  CG2   . VAL A 1 629 ? -18.920 -17.100 45.733  1.00 39.27 ? 629  VAL A CG2   1 
ATOM   4864  N  N     . GLY A 1 630 ? -20.365 -17.959 49.914  1.00 45.10 ? 630  GLY A N     1 
ATOM   4865  C  CA    . GLY A 1 630 ? -21.230 -18.010 51.074  1.00 44.87 ? 630  GLY A CA    1 
ATOM   4866  C  C     . GLY A 1 630 ? -21.114 -19.341 51.789  1.00 46.27 ? 630  GLY A C     1 
ATOM   4867  O  O     . GLY A 1 630 ? -21.452 -19.390 52.976  1.00 47.32 ? 630  GLY A O     1 
ATOM   4868  N  N     . HIS A 1 631 ? -20.578 -20.386 51.161  1.00 46.17 ? 631  HIS A N     1 
ATOM   4869  C  CA    . HIS A 1 631 ? -20.286 -21.608 51.890  1.00 47.09 ? 631  HIS A CA    1 
ATOM   4870  C  C     . HIS A 1 631 ? -18.911 -21.677 52.547  1.00 47.71 ? 631  HIS A C     1 
ATOM   4871  O  O     . HIS A 1 631 ? -17.940 -21.034 52.149  1.00 47.53 ? 631  HIS A O     1 
ATOM   4872  C  CB    . HIS A 1 631 ? -20.400 -22.828 51.002  1.00 44.04 ? 631  HIS A CB    1 
ATOM   4873  C  CG    . HIS A 1 631 ? -21.762 -22.983 50.421  1.00 46.83 ? 631  HIS A CG    1 
ATOM   4874  N  ND1   . HIS A 1 631 ? -22.561 -24.055 50.718  1.00 43.15 ? 631  HIS A ND1   1 
ATOM   4875  C  CD2   . HIS A 1 631 ? -22.435 -22.194 49.533  1.00 48.01 ? 631  HIS A CD2   1 
ATOM   4876  C  CE1   . HIS A 1 631 ? -23.694 -23.917 50.053  1.00 47.07 ? 631  HIS A CE1   1 
ATOM   4877  N  NE2   . HIS A 1 631 ? -23.631 -22.827 49.306  1.00 45.43 ? 631  HIS A NE2   1 
ATOM   4878  N  N     . ASP A 1 632 ? -18.833 -22.553 53.554  1.00 48.07 ? 632  ASP A N     1 
ATOM   4879  C  CA    . ASP A 1 632 ? -17.537 -22.758 54.230  1.00 47.40 ? 632  ASP A CA    1 
ATOM   4880  C  C     . ASP A 1 632 ? -16.776 -23.797 53.409  1.00 46.70 ? 632  ASP A C     1 
ATOM   4881  O  O     . ASP A 1 632 ? -17.408 -24.801 53.074  1.00 46.16 ? 632  ASP A O     1 
ATOM   4882  C  CB    . ASP A 1 632 ? -17.714 -23.306 55.629  1.00 46.74 ? 632  ASP A CB    1 
ATOM   4883  C  CG    . ASP A 1 632 ? -16.458 -23.243 56.481  1.00 53.59 ? 632  ASP A CG    1 
ATOM   4884  O  OD1   . ASP A 1 632 ? -15.315 -23.467 56.002  1.00 51.05 ? 632  ASP A OD1   1 
ATOM   4885  O  OD2   . ASP A 1 632 ? -16.685 -22.989 57.691  1.00 55.62 ? 632  ASP A OD2   1 
ATOM   4886  N  N     . VAL A 1 633 ? -15.527 -23.481 53.032  1.00 45.90 ? 633  VAL A N     1 
ATOM   4887  C  CA    . VAL A 1 633 ? -14.839 -24.458 52.175  1.00 45.06 ? 633  VAL A CA    1 
ATOM   4888  C  C     . VAL A 1 633 ? -14.427 -25.692 52.927  1.00 44.45 ? 633  VAL A C     1 
ATOM   4889  O  O     . VAL A 1 633 ? -14.637 -26.787 52.407  1.00 45.44 ? 633  VAL A O     1 
ATOM   4890  C  CB    . VAL A 1 633 ? -13.799 -23.915 51.208  1.00 42.76 ? 633  VAL A CB    1 
ATOM   4891  C  CG1   . VAL A 1 633 ? -14.526 -22.872 50.325  1.00 42.15 ? 633  VAL A CG1   1 
ATOM   4892  C  CG2   . VAL A 1 633 ? -12.616 -23.278 51.934  1.00 37.88 ? 633  VAL A CG2   1 
ATOM   4893  N  N     . VAL A 1 634 ? -14.054 -25.556 54.184  1.00 44.71 ? 634  VAL A N     1 
ATOM   4894  C  CA    . VAL A 1 634 ? -13.707 -26.706 55.022  1.00 43.73 ? 634  VAL A CA    1 
ATOM   4895  C  C     . VAL A 1 634 ? -14.940 -27.556 55.253  1.00 44.53 ? 634  VAL A C     1 
ATOM   4896  O  O     . VAL A 1 634 ? -14.804 -28.785 55.118  1.00 45.17 ? 634  VAL A O     1 
ATOM   4897  C  CB    . VAL A 1 634 ? -12.982 -26.289 56.286  1.00 42.22 ? 634  VAL A CB    1 
ATOM   4898  C  CG1   . VAL A 1 634 ? -12.735 -27.410 57.260  1.00 45.34 ? 634  VAL A CG1   1 
ATOM   4899  C  CG2   . VAL A 1 634 ? -11.624 -25.691 55.897  1.00 44.65 ? 634  VAL A CG2   1 
ATOM   4900  N  N     . THR A 1 635 ? -16.137 -26.936 55.186  1.00 44.05 ? 635  THR A N     1 
ATOM   4901  C  CA    . THR A 1 635 ? -17.372 -27.728 55.210  1.00 42.19 ? 635  THR A CA    1 
ATOM   4902  C  C     . THR A 1 635 ? -17.583 -28.441 53.893  1.00 41.57 ? 635  THR A C     1 
ATOM   4903  O  O     . THR A 1 635 ? -17.739 -29.671 53.892  1.00 40.84 ? 635  THR A O     1 
ATOM   4904  C  CB    . THR A 1 635 ? -18.606 -26.934 55.673  1.00 41.33 ? 635  THR A CB    1 
ATOM   4905  O  OG1   . THR A 1 635 ? -18.371 -26.323 56.972  1.00 47.23 ? 635  THR A OG1   1 
ATOM   4906  C  CG2   . THR A 1 635 ? -19.806 -27.849 55.875  1.00 40.95 ? 635  THR A CG2   1 
ATOM   4907  N  N     . LEU A 1 636 ? -17.487 -27.794 52.725  1.00 42.38 ? 636  LEU A N     1 
ATOM   4908  C  CA    . LEU A 1 636 ? -17.617 -28.557 51.461  1.00 43.02 ? 636  LEU A CA    1 
ATOM   4909  C  C     . LEU A 1 636 ? -16.545 -29.642 51.373  1.00 43.57 ? 636  LEU A C     1 
ATOM   4910  O  O     . LEU A 1 636 ? -16.770 -30.732 50.849  1.00 43.62 ? 636  LEU A O     1 
ATOM   4911  C  CB    . LEU A 1 636 ? -17.521 -27.662 50.222  1.00 42.65 ? 636  LEU A CB    1 
ATOM   4912  C  CG    . LEU A 1 636 ? -18.568 -26.549 50.127  1.00 42.92 ? 636  LEU A CG    1 
ATOM   4913  C  CD1   . LEU A 1 636 ? -18.343 -25.625 48.951  1.00 43.36 ? 636  LEU A CD1   1 
ATOM   4914  C  CD2   . LEU A 1 636 ? -19.955 -27.170 50.118  1.00 44.61 ? 636  LEU A CD2   1 
ATOM   4915  N  N     . LEU A 1 637 ? -15.357 -29.351 51.916  1.00 44.53 ? 637  LEU A N     1 
ATOM   4916  C  CA    . LEU A 1 637 ? -14.296 -30.361 51.912  1.00 46.10 ? 637  LEU A CA    1 
ATOM   4917  C  C     . LEU A 1 637 ? -14.750 -31.551 52.747  1.00 46.48 ? 637  LEU A C     1 
ATOM   4918  O  O     . LEU A 1 637 ? -14.840 -32.649 52.221  1.00 46.68 ? 637  LEU A O     1 
ATOM   4919  C  CB    . LEU A 1 637 ? -12.953 -29.778 52.392  1.00 39.72 ? 637  LEU A CB    1 
ATOM   4920  C  CG    . LEU A 1 637 ? -11.823 -30.815 52.404  1.00 40.82 ? 637  LEU A CG    1 
ATOM   4921  C  CD1   . LEU A 1 637 ? -11.680 -31.408 51.008  1.00 40.23 ? 637  LEU A CD1   1 
ATOM   4922  C  CD2   . LEU A 1 637 ? -10.505 -30.219 52.900  1.00 35.83 ? 637  LEU A CD2   1 
ATOM   4923  N  N     . ARG A 1 638 ? -15.178 -31.329 53.989  1.00 48.01 ? 638  ARG A N     1 
ATOM   4924  C  CA    . ARG A 1 638 ? -15.689 -32.368 54.870  1.00 47.70 ? 638  ARG A CA    1 
ATOM   4925  C  C     . ARG A 1 638 ? -16.837 -33.185 54.312  1.00 47.80 ? 638  ARG A C     1 
ATOM   4926  O  O     . ARG A 1 638 ? -16.815 -34.409 54.509  1.00 47.63 ? 638  ARG A O     1 
ATOM   4927  C  CB    . ARG A 1 638 ? -16.028 -31.907 56.278  1.00 42.83 ? 638  ARG A CB    1 
ATOM   4928  C  CG    . ARG A 1 638 ? -14.851 -31.711 57.205  1.00 42.47 ? 638  ARG A CG    1 
ATOM   4929  C  CD    . ARG A 1 638 ? -15.034 -30.595 58.232  1.00 43.39 ? 638  ARG A CD    1 
ATOM   4930  N  NE    . ARG A 1 638 ? -13.775 -30.350 58.980  1.00 46.18 ? 638  ARG A NE    1 
ATOM   4931  C  CZ    . ARG A 1 638 ? -13.687 -29.279 59.780  1.00 48.22 ? 638  ARG A CZ    1 
ATOM   4932  N  NH1   . ARG A 1 638 ? -14.694 -28.419 59.895  1.00 43.93 ? 638  ARG A NH1   1 
ATOM   4933  N  NH2   . ARG A 1 638 ? -12.579 -28.991 60.447  1.00 49.09 ? 638  ARG A NH2   1 
ATOM   4934  N  N     . ASP A 1 639 ? -17.783 -32.575 53.615  1.00 49.39 ? 639  ASP A N     1 
ATOM   4935  C  CA    . ASP A 1 639 ? -18.875 -33.293 52.991  1.00 50.82 ? 639  ASP A CA    1 
ATOM   4936  C  C     . ASP A 1 639 ? -18.349 -34.322 51.973  1.00 51.75 ? 639  ASP A C     1 
ATOM   4937  O  O     . ASP A 1 639 ? -18.916 -35.423 51.883  1.00 53.03 ? 639  ASP A O     1 
ATOM   4938  C  CB    . ASP A 1 639 ? -19.845 -32.493 52.150  1.00 52.32 ? 639  ASP A CB    1 
ATOM   4939  C  CG    . ASP A 1 639 ? -20.663 -31.339 52.641  1.00 59.69 ? 639  ASP A CG    1 
ATOM   4940  O  OD1   . ASP A 1 639 ? -20.764 -31.106 53.876  1.00 53.34 ? 639  ASP A OD1   1 
ATOM   4941  O  OD2   . ASP A 1 639 ? -21.195 -30.647 51.698  1.00 58.44 ? 639  ASP A OD2   1 
ATOM   4942  N  N     . ALA A 1 640 ? -17.511 -33.844 51.045  1.00 50.81 ? 640  ALA A N     1 
ATOM   4943  C  CA    . ALA A 1 640 ? -17.131 -34.739 49.940  1.00 50.13 ? 640  ALA A CA    1 
ATOM   4944  C  C     . ALA A 1 640 ? -16.392 -35.971 50.455  1.00 48.89 ? 640  ALA A C     1 
ATOM   4945  O  O     . ALA A 1 640 ? -16.431 -37.064 49.905  1.00 45.85 ? 640  ALA A O     1 
ATOM   4946  C  CB    . ALA A 1 640 ? -16.450 -33.983 48.830  1.00 47.03 ? 640  ALA A CB    1 
ATOM   4947  N  N     . ILE A 1 641 ? -15.795 -35.797 51.625  1.00 50.41 ? 641  ILE A N     1 
ATOM   4948  C  CA    . ILE A 1 641 ? -15.045 -36.865 52.285  1.00 53.07 ? 641  ILE A CA    1 
ATOM   4949  C  C     . ILE A 1 641 ? -16.031 -37.885 52.853  1.00 55.93 ? 641  ILE A C     1 
ATOM   4950  O  O     . ILE A 1 641 ? -15.814 -39.083 52.690  1.00 55.14 ? 641  ILE A O     1 
ATOM   4951  C  CB    . ILE A 1 641 ? -14.096 -36.278 53.334  1.00 49.49 ? 641  ILE A CB    1 
ATOM   4952  C  CG1   . ILE A 1 641 ? -12.968 -35.475 52.670  1.00 48.59 ? 641  ILE A CG1   1 
ATOM   4953  C  CG2   . ILE A 1 641 ? -13.509 -37.343 54.235  1.00 50.22 ? 641  ILE A CG2   1 
ATOM   4954  C  CD1   . ILE A 1 641 ? -11.928 -34.954 53.644  1.00 46.85 ? 641  ILE A CD1   1 
ATOM   4955  N  N     . LYS A 1 642 ? -17.204 -37.430 53.317  1.00 58.54 ? 642  LYS A N     1 
ATOM   4956  C  CA    . LYS A 1 642 ? -18.244 -38.323 53.800  1.00 60.27 ? 642  LYS A CA    1 
ATOM   4957  C  C     . LYS A 1 642 ? -18.979 -38.975 52.630  1.00 60.54 ? 642  LYS A C     1 
ATOM   4958  O  O     . LYS A 1 642 ? -19.240 -40.189 52.686  1.00 60.37 ? 642  LYS A O     1 
ATOM   4959  C  CB    . LYS A 1 642 ? -19.266 -37.670 54.723  1.00 64.32 ? 642  LYS A CB    1 
ATOM   4960  C  CG    . LYS A 1 642 ? -18.688 -37.018 55.972  1.00 68.15 ? 642  LYS A CG    1 
ATOM   4961  C  CD    . LYS A 1 642 ? -19.755 -36.188 56.680  1.00 69.15 ? 642  LYS A CD    1 
ATOM   4962  C  CE    . LYS A 1 642 ? -19.646 -36.288 58.192  1.00 70.46 ? 642  LYS A CE    1 
ATOM   4963  N  NZ    . LYS A 1 642 ? -20.997 -36.214 58.835  1.00 73.34 ? 642  LYS A NZ    1 
ATOM   4964  N  N     . ARG A 1 643 ? -19.238 -38.200 51.573  1.00 60.77 ? 643  ARG A N     1 
ATOM   4965  C  CA    . ARG A 1 643 ? -19.818 -38.850 50.389  1.00 61.87 ? 643  ARG A CA    1 
ATOM   4966  C  C     . ARG A 1 643 ? -18.929 -40.037 49.992  1.00 63.24 ? 643  ARG A C     1 
ATOM   4967  O  O     . ARG A 1 643 ? -19.359 -41.198 49.852  1.00 63.38 ? 643  ARG A O     1 
ATOM   4968  C  CB    . ARG A 1 643 ? -20.028 -37.865 49.263  1.00 63.27 ? 643  ARG A CB    1 
ATOM   4969  C  CG    . ARG A 1 643 ? -21.032 -36.752 49.486  1.00 66.32 ? 643  ARG A CG    1 
ATOM   4970  C  CD    . ARG A 1 643 ? -20.907 -35.631 48.466  1.00 71.34 ? 643  ARG A CD    1 
ATOM   4971  N  NE    . ARG A 1 643 ? -21.046 -34.297 49.040  1.00 74.72 ? 643  ARG A NE    1 
ATOM   4972  C  CZ    . ARG A 1 643 ? -20.378 -33.200 48.711  1.00 77.75 ? 643  ARG A CZ    1 
ATOM   4973  N  NH1   . ARG A 1 643 ? -19.444 -33.179 47.761  1.00 75.96 ? 643  ARG A NH1   1 
ATOM   4974  N  NH2   . ARG A 1 643 ? -20.644 -32.057 49.356  1.00 80.73 ? 643  ARG A NH2   1 
ATOM   4975  N  N     . ARG A 1 644 ? -17.607 -39.805 49.982  1.00 63.32 ? 644  ARG A N     1 
ATOM   4976  C  CA    . ARG A 1 644 ? -16.707 -40.875 49.627  1.00 64.24 ? 644  ARG A CA    1 
ATOM   4977  C  C     . ARG A 1 644 ? -16.879 -42.070 50.549  1.00 64.83 ? 644  ARG A C     1 
ATOM   4978  O  O     . ARG A 1 644 ? -16.803 -43.200 50.056  1.00 64.62 ? 644  ARG A O     1 
ATOM   4979  C  CB    . ARG A 1 644 ? -15.239 -40.494 49.467  1.00 64.34 ? 644  ARG A CB    1 
ATOM   4980  C  CG    . ARG A 1 644 ? -14.468 -41.678 48.882  1.00 63.49 ? 644  ARG A CG    1 
ATOM   4981  C  CD    . ARG A 1 644 ? -13.291 -41.261 48.040  1.00 65.04 ? 644  ARG A CD    1 
ATOM   4982  N  NE    . ARG A 1 644 ? -13.677 -40.915 46.661  1.00 61.83 ? 644  ARG A NE    1 
ATOM   4983  C  CZ    . ARG A 1 644 ? -13.138 -41.611 45.657  1.00 59.42 ? 644  ARG A CZ    1 
ATOM   4984  N  NH1   . ARG A 1 644 ? -12.295 -42.596 45.984  1.00 61.06 ? 644  ARG A NH1   1 
ATOM   4985  N  NH2   . ARG A 1 644 ? -13.435 -41.348 44.403  1.00 55.56 ? 644  ARG A NH2   1 
ATOM   4986  N  N     . GLU A 1 645 ? -17.100 -41.843 51.842  1.00 65.51 ? 645  GLU A N     1 
ATOM   4987  C  CA    . GLU A 1 645 ? -17.280 -42.974 52.755  1.00 66.65 ? 645  GLU A CA    1 
ATOM   4988  C  C     . GLU A 1 645 ? -16.268 -44.049 52.360  1.00 67.38 ? 645  GLU A C     1 
ATOM   4989  O  O     . GLU A 1 645 ? -16.535 -45.224 52.134  1.00 68.45 ? 645  GLU A O     1 
ATOM   4990  C  CB    . GLU A 1 645 ? -18.696 -43.545 52.733  1.00 67.92 ? 645  GLU A CB    1 
ATOM   4991  C  CG    . GLU A 1 645 ? -19.070 -44.405 53.914  1.00 72.89 ? 645  GLU A CG    1 
ATOM   4992  C  CD    . GLU A 1 645 ? -20.372 -44.114 54.624  1.00 76.59 ? 645  GLU A CD    1 
ATOM   4993  O  OE1   . GLU A 1 645 ? -20.417 -43.187 55.471  1.00 79.77 ? 645  GLU A OE1   1 
ATOM   4994  O  OE2   . GLU A 1 645 ? -21.391 -44.819 54.416  1.00 77.25 ? 645  GLU A OE2   1 
ATOM   4995  N  N     . GLU A 1 646 ? -15.056 -43.581 52.138  1.00 66.81 ? 646  GLU A N     1 
ATOM   4996  C  CA    . GLU A 1 646 ? -13.888 -44.438 51.934  1.00 66.06 ? 646  GLU A CA    1 
ATOM   4997  C  C     . GLU A 1 646 ? -12.982 -44.027 53.096  1.00 65.49 ? 646  GLU A C     1 
ATOM   4998  O  O     . GLU A 1 646 ? -13.476 -44.146 54.233  1.00 66.62 ? 646  GLU A O     1 
ATOM   4999  C  CB    . GLU A 1 646 ? -13.272 -44.309 50.567  1.00 64.66 ? 646  GLU A CB    1 
ATOM   5000  C  CG    . GLU A 1 646 ? -11.751 -44.264 50.520  1.00 68.38 ? 646  GLU A CG    1 
ATOM   5001  C  CD    . GLU A 1 646 ? -11.241 -44.649 49.138  1.00 67.59 ? 646  GLU A CD    1 
ATOM   5002  O  OE1   . GLU A 1 646 ? -11.738 -44.021 48.174  1.00 68.44 ? 646  GLU A OE1   1 
ATOM   5003  O  OE2   . GLU A 1 646 ? -10.430 -45.595 49.099  1.00 63.85 ? 646  GLU A OE2   1 
ATOM   5004  N  N     . PHE A 1 647 ? -11.950 -43.247 52.864  1.00 64.26 ? 647  PHE A N     1 
ATOM   5005  C  CA    . PHE A 1 647 ? -11.107 -42.790 53.950  1.00 63.27 ? 647  PHE A CA    1 
ATOM   5006  C  C     . PHE A 1 647 ? -11.655 -41.552 54.652  1.00 62.78 ? 647  PHE A C     1 
ATOM   5007  O  O     . PHE A 1 647 ? -12.614 -40.905 54.269  1.00 63.63 ? 647  PHE A O     1 
ATOM   5008  C  CB    . PHE A 1 647 ? -9.726  -42.409 53.392  1.00 61.63 ? 647  PHE A CB    1 
ATOM   5009  C  CG    . PHE A 1 647 ? -9.921  -41.313 52.378  1.00 61.25 ? 647  PHE A CG    1 
ATOM   5010  C  CD1   . PHE A 1 647 ? -10.473 -41.611 51.143  1.00 60.99 ? 647  PHE A CD1   1 
ATOM   5011  C  CD2   . PHE A 1 647 ? -9.590  -40.007 52.688  1.00 60.91 ? 647  PHE A CD2   1 
ATOM   5012  C  CE1   . PHE A 1 647 ? -10.639 -40.612 50.194  1.00 60.27 ? 647  PHE A CE1   1 
ATOM   5013  C  CE2   . PHE A 1 647 ? -9.762  -39.014 51.739  1.00 60.82 ? 647  PHE A CE2   1 
ATOM   5014  C  CZ    . PHE A 1 647 ? -10.267 -39.322 50.490  1.00 59.07 ? 647  PHE A CZ    1 
ATOM   5015  N  N     . ASP A 1 648 ? -10.877 -41.147 55.625  1.00 61.50 ? 648  ASP A N     1 
ATOM   5016  C  CA    . ASP A 1 648 ? -11.098 -40.112 56.599  1.00 60.01 ? 648  ASP A CA    1 
ATOM   5017  C  C     . ASP A 1 648 ? -9.813  -39.306 56.804  1.00 59.39 ? 648  ASP A C     1 
ATOM   5018  O  O     . ASP A 1 648 ? -8.717  -39.885 56.808  1.00 60.13 ? 648  ASP A O     1 
ATOM   5019  C  CB    . ASP A 1 648 ? -11.300 -40.924 57.910  1.00 62.28 ? 648  ASP A CB    1 
ATOM   5020  C  CG    . ASP A 1 648 ? -11.862 -40.079 59.027  1.00 66.29 ? 648  ASP A CG    1 
ATOM   5021  O  OD1   . ASP A 1 648 ? -12.963 -39.528 58.810  1.00 67.41 ? 648  ASP A OD1   1 
ATOM   5022  O  OD2   . ASP A 1 648 ? -11.171 -39.941 60.063  1.00 67.24 ? 648  ASP A OD2   1 
ATOM   5023  N  N     . LEU A 1 649 ? -9.909  -38.008 57.013  1.00 57.49 ? 649  LEU A N     1 
ATOM   5024  C  CA    . LEU A 1 649 ? -8.762  -37.215 57.412  1.00 56.88 ? 649  LEU A CA    1 
ATOM   5025  C  C     . LEU A 1 649 ? -9.244  -36.085 58.306  1.00 56.56 ? 649  LEU A C     1 
ATOM   5026  O  O     . LEU A 1 649 ? -10.458 -35.868 58.392  1.00 56.58 ? 649  LEU A O     1 
ATOM   5027  C  CB    . LEU A 1 649 ? -7.895  -36.748 56.268  1.00 58.06 ? 649  LEU A CB    1 
ATOM   5028  C  CG    . LEU A 1 649 ? -8.589  -36.187 55.032  1.00 55.97 ? 649  LEU A CG    1 
ATOM   5029  C  CD1   . LEU A 1 649 ? -9.338  -34.916 55.402  1.00 56.26 ? 649  LEU A CD1   1 
ATOM   5030  C  CD2   . LEU A 1 649 ? -7.586  -35.965 53.919  1.00 53.64 ? 649  LEU A CD2   1 
ATOM   5031  N  N     . ASP A 1 650 ? -8.330  -35.346 58.888  1.00 56.22 ? 650  ASP A N     1 
ATOM   5032  C  CA    . ASP A 1 650 ? -8.692  -34.234 59.785  1.00 55.71 ? 650  ASP A CA    1 
ATOM   5033  C  C     . ASP A 1 650 ? -8.260  -32.877 59.262  1.00 55.16 ? 650  ASP A C     1 
ATOM   5034  O  O     . ASP A 1 650 ? -7.119  -32.419 59.429  1.00 54.17 ? 650  ASP A O     1 
ATOM   5035  C  CB    . ASP A 1 650 ? -8.038  -34.590 61.113  1.00 57.75 ? 650  ASP A CB    1 
ATOM   5036  C  CG    . ASP A 1 650 ? -7.909  -33.461 62.094  1.00 60.93 ? 650  ASP A CG    1 
ATOM   5037  O  OD1   . ASP A 1 650 ? -8.755  -32.547 62.025  1.00 59.38 ? 650  ASP A OD1   1 
ATOM   5038  O  OD2   . ASP A 1 650 ? -6.938  -33.537 62.904  1.00 65.32 ? 650  ASP A OD2   1 
ATOM   5039  N  N     . VAL A 1 651 ? -9.230  -32.151 58.653  1.00 53.94 ? 651  VAL A N     1 
ATOM   5040  C  CA    . VAL A 1 651 ? -8.879  -30.851 58.067  1.00 51.76 ? 651  VAL A CA    1 
ATOM   5041  C  C     . VAL A 1 651 ? -8.625  -29.867 59.198  1.00 51.74 ? 651  VAL A C     1 
ATOM   5042  O  O     . VAL A 1 651 ? -9.535  -29.669 60.011  1.00 52.82 ? 651  VAL A O     1 
ATOM   5043  C  CB    . VAL A 1 651 ? -9.930  -30.261 57.137  1.00 47.06 ? 651  VAL A CB    1 
ATOM   5044  C  CG1   . VAL A 1 651 ? -9.454  -28.973 56.491  1.00 45.39 ? 651  VAL A CG1   1 
ATOM   5045  C  CG2   . VAL A 1 651 ? -10.321 -31.276 56.087  1.00 46.39 ? 651  VAL A CG2   1 
ATOM   5046  N  N     . VAL A 1 652 ? -7.458  -29.240 59.199  1.00 50.43 ? 652  VAL A N     1 
ATOM   5047  C  CA    . VAL A 1 652 ? -7.136  -28.341 60.306  1.00 49.05 ? 652  VAL A CA    1 
ATOM   5048  C  C     . VAL A 1 652 ? -7.031  -26.885 59.911  1.00 48.95 ? 652  VAL A C     1 
ATOM   5049  O  O     . VAL A 1 652 ? -6.908  -26.029 60.805  1.00 49.81 ? 652  VAL A O     1 
ATOM   5050  C  CB    . VAL A 1 652 ? -5.742  -28.817 60.844  1.00 49.15 ? 652  VAL A CB    1 
ATOM   5051  C  CG1   . VAL A 1 652 ? -5.219  -27.845 61.881  1.00 43.12 ? 652  VAL A CG1   1 
ATOM   5052  C  CG2   . VAL A 1 652 ? -5.893  -30.230 61.392  1.00 46.99 ? 652  VAL A CG2   1 
ATOM   5053  N  N     . ALA A 1 653 ? -6.887  -26.587 58.613  1.00 47.04 ? 653  ALA A N     1 
ATOM   5054  C  CA    . ALA A 1 653 ? -6.476  -25.233 58.249  1.00 45.41 ? 653  ALA A CA    1 
ATOM   5055  C  C     . ALA A 1 653 ? -6.822  -24.942 56.799  1.00 43.99 ? 653  ALA A C     1 
ATOM   5056  O  O     . ALA A 1 653 ? -6.881  -25.889 56.052  1.00 43.08 ? 653  ALA A O     1 
ATOM   5057  C  CB    . ALA A 1 653 ? -4.973  -25.078 58.485  1.00 40.84 ? 653  ALA A CB    1 
ATOM   5058  N  N     . VAL A 1 654 ? -7.261  -23.723 56.522  1.00 43.92 ? 654  VAL A N     1 
ATOM   5059  C  CA    . VAL A 1 654 ? -7.619  -23.246 55.221  1.00 43.39 ? 654  VAL A CA    1 
ATOM   5060  C  C     . VAL A 1 654 ? -6.693  -22.024 55.068  1.00 43.63 ? 654  VAL A C     1 
ATOM   5061  O  O     . VAL A 1 654 ? -6.539  -21.310 56.062  1.00 44.37 ? 654  VAL A O     1 
ATOM   5062  C  CB    . VAL A 1 654 ? -9.000  -22.792 54.801  1.00 43.20 ? 654  VAL A CB    1 
ATOM   5063  C  CG1   . VAL A 1 654 ? -8.972  -22.550 53.270  1.00 43.20 ? 654  VAL A CG1   1 
ATOM   5064  C  CG2   . VAL A 1 654 ? -10.113 -23.812 54.982  1.00 45.04 ? 654  VAL A CG2   1 
ATOM   5065  N  N     . VAL A 1 655 ? -5.942  -22.002 53.971  1.00 42.37 ? 655  VAL A N     1 
ATOM   5066  C  CA    . VAL A 1 655 ? -4.934  -20.934 53.912  1.00 40.21 ? 655  VAL A CA    1 
ATOM   5067  C  C     . VAL A 1 655 ? -4.822  -20.293 52.556  1.00 38.44 ? 655  VAL A C     1 
ATOM   5068  O  O     . VAL A 1 655 ? -5.119  -20.912 51.521  1.00 37.44 ? 655  VAL A O     1 
ATOM   5069  C  CB    . VAL A 1 655 ? -3.615  -21.512 54.452  1.00 43.72 ? 655  VAL A CB    1 
ATOM   5070  C  CG1   . VAL A 1 655 ? -2.410  -20.930 53.752  1.00 42.03 ? 655  VAL A CG1   1 
ATOM   5071  C  CG2   . VAL A 1 655 ? -3.550  -21.108 55.947  1.00 45.00 ? 655  VAL A CG2   1 
ATOM   5072  N  N     . ASN A 1 656 ? -4.554  -18.995 52.578  1.00 37.57 ? 656  ASN A N     1 
ATOM   5073  C  CA    . ASN A 1 656 ? -4.375  -18.244 51.324  1.00 37.15 ? 656  ASN A CA    1 
ATOM   5074  C  C     . ASN A 1 656 ? -2.963  -18.516 50.818  1.00 37.68 ? 656  ASN A C     1 
ATOM   5075  O  O     . ASN A 1 656 ? -2.102  -18.627 51.692  1.00 39.43 ? 656  ASN A O     1 
ATOM   5076  C  CB    . ASN A 1 656 ? -4.559  -16.751 51.522  1.00 30.97 ? 656  ASN A CB    1 
ATOM   5077  C  CG    . ASN A 1 656 ? -4.489  -16.004 50.199  1.00 35.54 ? 656  ASN A CG    1 
ATOM   5078  O  OD1   . ASN A 1 656 ? -5.353  -16.161 49.340  1.00 34.97 ? 656  ASN A OD1   1 
ATOM   5079  N  ND2   . ASN A 1 656 ? -3.475  -15.214 49.936  1.00 26.82 ? 656  ASN A ND2   1 
ATOM   5080  N  N     . ASP A 1 657 ? -2.767  -18.685 49.517  1.00 37.88 ? 657  ASP A N     1 
ATOM   5081  C  CA    . ASP A 1 657 ? -1.477  -18.999 48.921  1.00 38.20 ? 657  ASP A CA    1 
ATOM   5082  C  C     . ASP A 1 657 ? -0.395  -18.051 49.429  1.00 37.34 ? 657  ASP A C     1 
ATOM   5083  O  O     . ASP A 1 657 ? 0.811   -18.256 49.419  1.00 35.77 ? 657  ASP A O     1 
ATOM   5084  C  CB    . ASP A 1 657 ? -1.463  -19.062 47.394  1.00 34.47 ? 657  ASP A CB    1 
ATOM   5085  C  CG    . ASP A 1 657 ? -2.008  -17.940 46.554  1.00 40.27 ? 657  ASP A CG    1 
ATOM   5086  O  OD1   . ASP A 1 657 ? -2.708  -17.075 47.131  1.00 36.50 ? 657  ASP A OD1   1 
ATOM   5087  O  OD2   . ASP A 1 657 ? -1.898  -17.957 45.287  1.00 32.91 ? 657  ASP A OD2   1 
ATOM   5088  N  N     . THR A 1 658 ? -0.902  -16.851 49.708  1.00 38.09 ? 658  THR A N     1 
ATOM   5089  C  CA    . THR A 1 658 ? -0.098  -15.714 50.169  1.00 37.58 ? 658  THR A CA    1 
ATOM   5090  C  C     . THR A 1 658 ? 0.503   -16.024 51.520  1.00 37.66 ? 658  THR A C     1 
ATOM   5091  O  O     . THR A 1 658 ? 1.723   -15.844 51.699  1.00 39.29 ? 658  THR A O     1 
ATOM   5092  C  CB    . THR A 1 658 ? -1.036  -14.510 50.154  1.00 30.44 ? 658  THR A CB    1 
ATOM   5093  O  OG1   . THR A 1 658 ? -0.461  -13.505 49.348  1.00 47.02 ? 658  THR A OG1   1 
ATOM   5094  C  CG2   . THR A 1 658 ? -1.648  -14.003 51.404  1.00 32.33 ? 658  THR A CG2   1 
ATOM   5095  N  N     . VAL A 1 659 ? -0.329  -16.442 52.462  1.00 36.07 ? 659  VAL A N     1 
ATOM   5096  C  CA    . VAL A 1 659 ? 0.128   -16.751 53.808  1.00 36.77 ? 659  VAL A CA    1 
ATOM   5097  C  C     . VAL A 1 659 ? 0.999   -18.009 53.771  1.00 37.29 ? 659  VAL A C     1 
ATOM   5098  O  O     . VAL A 1 659 ? 2.028   -18.093 54.422  1.00 38.46 ? 659  VAL A O     1 
ATOM   5099  C  CB    . VAL A 1 659 ? -1.123  -17.018 54.688  1.00 39.67 ? 659  VAL A CB    1 
ATOM   5100  C  CG1   . VAL A 1 659 ? -0.752  -17.534 56.071  1.00 34.91 ? 659  VAL A CG1   1 
ATOM   5101  C  CG2   . VAL A 1 659 ? -2.022  -15.798 54.729  1.00 33.22 ? 659  VAL A CG2   1 
ATOM   5102  N  N     . GLY A 1 660 ? 0.655   -19.003 52.978  1.00 37.32 ? 660  GLY A N     1 
ATOM   5103  C  CA    . GLY A 1 660 ? 1.468   -20.180 52.753  1.00 38.20 ? 660  GLY A CA    1 
ATOM   5104  C  C     . GLY A 1 660 ? 2.847   -19.887 52.186  1.00 38.77 ? 660  GLY A C     1 
ATOM   5105  O  O     . GLY A 1 660 ? 3.822   -20.480 52.668  1.00 40.24 ? 660  GLY A O     1 
ATOM   5106  N  N     . THR A 1 661 ? 3.007   -18.964 51.262  1.00 38.03 ? 661  THR A N     1 
ATOM   5107  C  CA    . THR A 1 661 ? 4.307   -18.573 50.721  1.00 37.96 ? 661  THR A CA    1 
ATOM   5108  C  C     . THR A 1 661 ? 5.172   -17.848 51.739  1.00 38.59 ? 661  THR A C     1 
ATOM   5109  O  O     . THR A 1 661 ? 6.387   -18.066 51.821  1.00 36.70 ? 661  THR A O     1 
ATOM   5110  C  CB    . THR A 1 661 ? 4.092   -17.670 49.482  1.00 35.51 ? 661  THR A CB    1 
ATOM   5111  O  OG1   . THR A 1 661 ? 3.333   -18.446 48.533  1.00 37.09 ? 661  THR A OG1   1 
ATOM   5112  C  CG2   . THR A 1 661 ? 5.381   -17.177 48.859  1.00 34.08 ? 661  THR A CG2   1 
ATOM   5113  N  N     . MET A 1 662 ? 4.580   -16.904 52.470  1.00 39.77 ? 662  MET A N     1 
ATOM   5114  C  CA    . MET A 1 662 ? 5.327   -16.180 53.508  1.00 40.30 ? 662  MET A CA    1 
ATOM   5115  C  C     . MET A 1 662 ? 5.923   -17.167 54.510  1.00 41.46 ? 662  MET A C     1 
ATOM   5116  O  O     . MET A 1 662 ? 7.052   -17.075 54.945  1.00 41.31 ? 662  MET A O     1 
ATOM   5117  C  CB    . MET A 1 662 ? 4.390   -15.198 54.236  1.00 38.82 ? 662  MET A CB    1 
ATOM   5118  C  CG    . MET A 1 662 ? 5.068   -14.410 55.350  1.00 39.72 ? 662  MET A CG    1 
ATOM   5119  S  SD    . MET A 1 662 ? 3.986   -13.680 56.590  1.00 46.68 ? 662  MET A SD    1 
ATOM   5120  C  CE    . MET A 1 662 ? 3.383   -15.180 57.367  1.00 41.60 ? 662  MET A CE    1 
ATOM   5121  N  N     . MET A 1 663 ? 5.097   -18.083 55.006  1.00 43.18 ? 663  MET A N     1 
ATOM   5122  C  CA    . MET A 1 663 ? 5.488   -19.065 56.016  1.00 43.74 ? 663  MET A CA    1 
ATOM   5123  C  C     . MET A 1 663 ? 6.553   -20.010 55.475  1.00 44.68 ? 663  MET A C     1 
ATOM   5124  O  O     . MET A 1 663 ? 7.649   -20.168 56.044  1.00 45.01 ? 663  MET A O     1 
ATOM   5125  C  CB    . MET A 1 663 ? 4.224   -19.761 56.505  1.00 38.94 ? 663  MET A CB    1 
ATOM   5126  C  CG    . MET A 1 663 ? 3.320   -18.914 57.380  1.00 42.40 ? 663  MET A CG    1 
ATOM   5127  S  SD    . MET A 1 663 ? 4.059   -18.357 58.942  1.00 47.02 ? 663  MET A SD    1 
ATOM   5128  C  CE    . MET A 1 663 ? 3.857   -19.861 59.914  1.00 38.76 ? 663  MET A CE    1 
ATOM   5129  N  N     . THR A 1 664 ? 6.353   -20.557 54.278  1.00 44.68 ? 664  THR A N     1 
ATOM   5130  C  CA    . THR A 1 664 ? 7.392   -21.328 53.611  1.00 44.40 ? 664  THR A CA    1 
ATOM   5131  C  C     . THR A 1 664 ? 8.752   -20.649 53.778  1.00 45.22 ? 664  THR A C     1 
ATOM   5132  O  O     . THR A 1 664 ? 9.742   -21.167 54.270  1.00 44.98 ? 664  THR A O     1 
ATOM   5133  C  CB    . THR A 1 664 ? 7.089   -21.298 52.098  1.00 46.05 ? 664  THR A CB    1 
ATOM   5134  O  OG1   . THR A 1 664 ? 5.980   -22.159 51.829  1.00 45.78 ? 664  THR A OG1   1 
ATOM   5135  C  CG2   . THR A 1 664 ? 8.303   -21.735 51.301  1.00 46.89 ? 664  THR A CG2   1 
ATOM   5136  N  N     . CYS A 1 665 ? 8.824   -19.445 53.241  1.00 46.38 ? 665  CYS A N     1 
ATOM   5137  C  CA    . CYS A 1 665 ? 9.996   -18.630 53.106  1.00 46.44 ? 665  CYS A CA    1 
ATOM   5138  C  C     . CYS A 1 665 ? 10.591  -18.243 54.445  1.00 47.75 ? 665  CYS A C     1 
ATOM   5139  O  O     . CYS A 1 665 ? 11.801  -18.020 54.631  1.00 46.63 ? 665  CYS A O     1 
ATOM   5140  C  CB    . CYS A 1 665 ? 9.725   -17.455 52.167  1.00 50.62 ? 665  CYS A CB    1 
ATOM   5141  S  SG    . CYS A 1 665 ? 9.656   -17.826 50.369  1.00 48.65 ? 665  CYS A SG    1 
ATOM   5142  N  N     . ALA A 1 666 ? 9.750   -18.087 55.443  1.00 49.48 ? 666  ALA A N     1 
ATOM   5143  C  CA    . ALA A 1 666 ? 10.175  -17.725 56.791  1.00 50.75 ? 666  ALA A CA    1 
ATOM   5144  C  C     . ALA A 1 666 ? 10.590  -18.980 57.561  1.00 52.11 ? 666  ALA A C     1 
ATOM   5145  O  O     . ALA A 1 666 ? 11.266  -18.850 58.567  1.00 52.38 ? 666  ALA A O     1 
ATOM   5146  C  CB    . ALA A 1 666 ? 9.041   -17.022 57.505  1.00 51.20 ? 666  ALA A CB    1 
ATOM   5147  N  N     . TYR A 1 667 ? 10.271  -20.171 57.086  1.00 52.87 ? 667  TYR A N     1 
ATOM   5148  C  CA    . TYR A 1 667 ? 10.733  -21.396 57.728  1.00 54.21 ? 667  TYR A CA    1 
ATOM   5149  C  C     . TYR A 1 667 ? 12.239  -21.305 57.980  1.00 55.41 ? 667  TYR A C     1 
ATOM   5150  O  O     . TYR A 1 667 ? 12.810  -21.801 58.953  1.00 54.42 ? 667  TYR A O     1 
ATOM   5151  C  CB    . TYR A 1 667 ? 10.441  -22.613 56.866  1.00 53.48 ? 667  TYR A CB    1 
ATOM   5152  C  CG    . TYR A 1 667 ? 11.184  -23.853 57.288  1.00 53.51 ? 667  TYR A CG    1 
ATOM   5153  C  CD1   . TYR A 1 667 ? 10.801  -24.586 58.400  1.00 53.55 ? 667  TYR A CD1   1 
ATOM   5154  C  CD2   . TYR A 1 667 ? 12.264  -24.316 56.553  1.00 54.22 ? 667  TYR A CD2   1 
ATOM   5155  C  CE1   . TYR A 1 667 ? 11.466  -25.743 58.755  1.00 53.54 ? 667  TYR A CE1   1 
ATOM   5156  C  CE2   . TYR A 1 667 ? 12.963  -25.457 56.912  1.00 53.76 ? 667  TYR A CE2   1 
ATOM   5157  C  CZ    . TYR A 1 667 ? 12.549  -26.162 58.021  1.00 54.23 ? 667  TYR A CZ    1 
ATOM   5158  O  OH    . TYR A 1 667 ? 13.239  -27.307 58.387  1.00 55.51 ? 667  TYR A OH    1 
ATOM   5159  N  N     . GLU A 1 668 ? 12.863  -20.462 57.154  1.00 57.39 ? 668  GLU A N     1 
ATOM   5160  C  CA    . GLU A 1 668 ? 14.290  -20.276 57.303  1.00 59.00 ? 668  GLU A CA    1 
ATOM   5161  C  C     . GLU A 1 668 ? 14.735  -18.853 57.523  1.00 59.52 ? 668  GLU A C     1 
ATOM   5162  O  O     . GLU A 1 668 ? 15.905  -18.686 57.869  1.00 59.92 ? 668  GLU A O     1 
ATOM   5163  C  CB    . GLU A 1 668 ? 15.042  -20.880 56.111  1.00 63.11 ? 668  GLU A CB    1 
ATOM   5164  C  CG    . GLU A 1 668 ? 16.316  -21.571 56.634  1.00 66.42 ? 668  GLU A CG    1 
ATOM   5165  C  CD    . GLU A 1 668 ? 16.129  -23.072 56.523  1.00 67.81 ? 668  GLU A CD    1 
ATOM   5166  O  OE1   . GLU A 1 668 ? 15.391  -23.410 55.565  1.00 72.06 ? 668  GLU A OE1   1 
ATOM   5167  O  OE2   . GLU A 1 668 ? 16.725  -23.820 57.312  1.00 68.19 ? 668  GLU A OE2   1 
ATOM   5168  N  N     . GLU A 1 669 ? 13.860  -17.877 57.311  1.00 59.17 ? 669  GLU A N     1 
ATOM   5169  C  CA    . GLU A 1 669 ? 14.290  -16.483 57.351  1.00 58.48 ? 669  GLU A CA    1 
ATOM   5170  C  C     . GLU A 1 669 ? 13.382  -15.709 58.294  1.00 59.15 ? 669  GLU A C     1 
ATOM   5171  O  O     . GLU A 1 669 ? 12.269  -15.328 57.910  1.00 60.13 ? 669  GLU A O     1 
ATOM   5172  C  CB    . GLU A 1 669 ? 14.161  -15.907 55.933  1.00 55.01 ? 669  GLU A CB    1 
ATOM   5173  C  CG    . GLU A 1 669 ? 15.479  -15.791 55.207  1.00 60.33 ? 669  GLU A CG    1 
ATOM   5174  C  CD    . GLU A 1 669 ? 16.332  -14.704 55.835  1.00 63.61 ? 669  GLU A CD    1 
ATOM   5175  O  OE1   . GLU A 1 669 ? 15.936  -13.522 55.761  1.00 65.90 ? 669  GLU A OE1   1 
ATOM   5176  O  OE2   . GLU A 1 669 ? 17.370  -15.050 56.438  1.00 67.08 ? 669  GLU A OE2   1 
ATOM   5177  N  N     . PRO A 1 670 ? 13.877  -15.391 59.473  1.00 58.60 ? 670  PRO A N     1 
ATOM   5178  C  CA    . PRO A 1 670 ? 13.090  -14.745 60.502  1.00 58.31 ? 670  PRO A CA    1 
ATOM   5179  C  C     . PRO A 1 670 ? 12.644  -13.354 60.131  1.00 57.70 ? 670  PRO A C     1 
ATOM   5180  O  O     . PRO A 1 670 ? 11.652  -12.860 60.665  1.00 58.34 ? 670  PRO A O     1 
ATOM   5181  C  CB    . PRO A 1 670 ? 13.992  -14.763 61.740  1.00 58.81 ? 670  PRO A CB    1 
ATOM   5182  C  CG    . PRO A 1 670 ? 14.970  -15.863 61.466  1.00 58.40 ? 670  PRO A CG    1 
ATOM   5183  C  CD    . PRO A 1 670 ? 15.220  -15.783 59.979  1.00 58.77 ? 670  PRO A CD    1 
ATOM   5184  N  N     . THR A 1 671 ? 13.294  -12.721 59.170  1.00 56.95 ? 671  THR A N     1 
ATOM   5185  C  CA    . THR A 1 671 ? 12.949  -11.384 58.695  1.00 55.31 ? 671  THR A CA    1 
ATOM   5186  C  C     . THR A 1 671 ? 11.706  -11.329 57.801  1.00 53.39 ? 671  THR A C     1 
ATOM   5187  O  O     . THR A 1 671 ? 11.259  -10.216 57.473  1.00 53.94 ? 671  THR A O     1 
ATOM   5188  C  CB    . THR A 1 671 ? 14.129  -10.868 57.821  1.00 56.49 ? 671  THR A CB    1 
ATOM   5189  O  OG1   . THR A 1 671 ? 14.894  -12.017 57.385  1.00 57.78 ? 671  THR A OG1   1 
ATOM   5190  C  CG2   . THR A 1 671 ? 15.010  -9.938  58.643  1.00 57.22 ? 671  THR A CG2   1 
ATOM   5191  N  N     . CYS A 1 672 ? 11.277  -12.441 57.240  1.00 50.21 ? 672  CYS A N     1 
ATOM   5192  C  CA    . CYS A 1 672 ? 10.242  -12.474 56.225  1.00 48.76 ? 672  CYS A CA    1 
ATOM   5193  C  C     . CYS A 1 672 ? 8.839   -12.366 56.799  1.00 49.22 ? 672  CYS A C     1 
ATOM   5194  O  O     . CYS A 1 672 ? 8.353   -13.367 57.338  1.00 49.39 ? 672  CYS A O     1 
ATOM   5195  C  CB    . CYS A 1 672 ? 10.372  -13.820 55.520  1.00 45.92 ? 672  CYS A CB    1 
ATOM   5196  S  SG    . CYS A 1 672 ? 9.051   -14.148 54.354  1.00 52.68 ? 672  CYS A SG    1 
ATOM   5197  N  N     . GLU A 1 673 ? 8.252   -11.164 56.801  1.00 48.20 ? 673  GLU A N     1 
ATOM   5198  C  CA    . GLU A 1 673 ? 6.983   -10.920 57.467  1.00 46.05 ? 673  GLU A CA    1 
ATOM   5199  C  C     . GLU A 1 673 ? 5.886   -10.585 56.470  1.00 43.91 ? 673  GLU A C     1 
ATOM   5200  O  O     . GLU A 1 673 ? 4.806   -10.190 56.873  1.00 42.98 ? 673  GLU A O     1 
ATOM   5201  C  CB    . GLU A 1 673 ? 7.050   -9.746  58.448  1.00 42.88 ? 673  GLU A CB    1 
ATOM   5202  C  CG    . GLU A 1 673 ? 8.307   -9.827  59.304  1.00 51.83 ? 673  GLU A CG    1 
ATOM   5203  C  CD    . GLU A 1 673 ? 8.097   -9.261  60.694  1.00 51.85 ? 673  GLU A CD    1 
ATOM   5204  O  OE1   . GLU A 1 673 ? 8.267   -8.037  60.871  1.00 53.61 ? 673  GLU A OE1   1 
ATOM   5205  O  OE2   . GLU A 1 673 ? 7.768   -10.074 61.581  1.00 54.07 ? 673  GLU A OE2   1 
ATOM   5206  N  N     . VAL A 1 674 ? 6.241   -10.724 55.208  1.00 43.11 ? 674  VAL A N     1 
ATOM   5207  C  CA    . VAL A 1 674 ? 5.367   -10.342 54.106  1.00 41.47 ? 674  VAL A CA    1 
ATOM   5208  C  C     . VAL A 1 674 ? 5.296   -11.475 53.094  1.00 39.63 ? 674  VAL A C     1 
ATOM   5209  O  O     . VAL A 1 674 ? 6.308   -12.125 52.868  1.00 39.18 ? 674  VAL A O     1 
ATOM   5210  C  CB    . VAL A 1 674 ? 5.967   -9.135  53.332  1.00 44.82 ? 674  VAL A CB    1 
ATOM   5211  C  CG1   . VAL A 1 674 ? 4.968   -8.694  52.268  1.00 40.80 ? 674  VAL A CG1   1 
ATOM   5212  C  CG2   . VAL A 1 674 ? 6.365   -8.006  54.262  1.00 39.90 ? 674  VAL A CG2   1 
ATOM   5213  N  N     . GLY A 1 675 ? 4.194   -11.643 52.415  1.00 39.84 ? 675  GLY A N     1 
ATOM   5214  C  CA    . GLY A 1 675 ? 4.082   -12.637 51.346  1.00 40.87 ? 675  GLY A CA    1 
ATOM   5215  C  C     . GLY A 1 675 ? 3.456   -11.984 50.118  1.00 42.69 ? 675  GLY A C     1 
ATOM   5216  O  O     . GLY A 1 675 ? 2.585   -11.114 50.246  1.00 45.05 ? 675  GLY A O     1 
ATOM   5217  N  N     . LEU A 1 676 ? 4.027   -12.226 48.949  1.00 41.99 ? 676  LEU A N     1 
ATOM   5218  C  CA    . LEU A 1 676 ? 3.596   -11.667 47.695  1.00 39.27 ? 676  LEU A CA    1 
ATOM   5219  C  C     . LEU A 1 676 ? 3.312   -12.777 46.668  1.00 39.21 ? 676  LEU A C     1 
ATOM   5220  O  O     . LEU A 1 676 ? 4.277   -13.481 46.312  1.00 39.04 ? 676  LEU A O     1 
ATOM   5221  C  CB    . LEU A 1 676 ? 4.718   -10.862 47.025  1.00 33.78 ? 676  LEU A CB    1 
ATOM   5222  C  CG    . LEU A 1 676 ? 4.335   -10.141 45.724  1.00 35.68 ? 676  LEU A CG    1 
ATOM   5223  C  CD1   . LEU A 1 676 ? 2.973   -9.473  45.869  1.00 28.39 ? 676  LEU A CD1   1 
ATOM   5224  C  CD2   . LEU A 1 676 ? 5.435   -9.169  45.281  1.00 24.12 ? 676  LEU A CD2   1 
ATOM   5225  N  N     . ILE A 1 677 ? 2.110   -12.675 46.067  1.00 36.49 ? 677  ILE A N     1 
ATOM   5226  C  CA    . ILE A 1 677 ? 1.861   -13.449 44.871  1.00 35.33 ? 677  ILE A CA    1 
ATOM   5227  C  C     . ILE A 1 677 ? 1.710   -12.627 43.604  1.00 36.52 ? 677  ILE A C     1 
ATOM   5228  O  O     . ILE A 1 677 ? 0.865   -11.725 43.482  1.00 38.33 ? 677  ILE A O     1 
ATOM   5229  C  CB    . ILE A 1 677 ? 0.635   -14.360 45.069  1.00 36.75 ? 677  ILE A CB    1 
ATOM   5230  C  CG1   . ILE A 1 677 ? 0.796   -15.251 46.301  1.00 31.14 ? 677  ILE A CG1   1 
ATOM   5231  C  CG2   . ILE A 1 677 ? 0.406   -15.145 43.782  1.00 33.29 ? 677  ILE A CG2   1 
ATOM   5232  C  CD1   . ILE A 1 677 ? 1.754   -16.420 46.104  1.00 30.11 ? 677  ILE A CD1   1 
ATOM   5233  N  N     . VAL A 1 678 ? 2.482   -12.866 42.554  1.00 34.91 ? 678  VAL A N     1 
ATOM   5234  C  CA    . VAL A 1 678 ? 2.318   -12.387 41.204  1.00 33.95 ? 678  VAL A CA    1 
ATOM   5235  C  C     . VAL A 1 678 ? 2.331   -13.524 40.176  1.00 34.95 ? 678  VAL A C     1 
ATOM   5236  O  O     . VAL A 1 678 ? 3.385   -13.931 39.652  1.00 35.20 ? 678  VAL A O     1 
ATOM   5237  C  CB    . VAL A 1 678 ? 3.385   -11.366 40.769  1.00 36.75 ? 678  VAL A CB    1 
ATOM   5238  C  CG1   . VAL A 1 678 ? 2.958   -10.790 39.425  1.00 31.23 ? 678  VAL A CG1   1 
ATOM   5239  C  CG2   . VAL A 1 678 ? 3.573   -10.280 41.809  1.00 33.93 ? 678  VAL A CG2   1 
ATOM   5240  N  N     . GLY A 1 679 ? 1.164   -14.115 39.889  1.00 33.24 ? 679  GLY A N     1 
ATOM   5241  C  CA    . GLY A 1 679 ? 1.080   -15.238 38.962  1.00 32.41 ? 679  GLY A CA    1 
ATOM   5242  C  C     . GLY A 1 679 ? -0.230  -15.079 38.171  1.00 33.61 ? 679  GLY A C     1 
ATOM   5243  O  O     . GLY A 1 679 ? -0.458  -14.083 37.464  1.00 35.23 ? 679  GLY A O     1 
ATOM   5244  N  N     . THR A 1 680 ? -1.043  -16.114 38.209  1.00 32.36 ? 680  THR A N     1 
ATOM   5245  C  CA    . THR A 1 680 ? -2.358  -15.970 37.604  1.00 32.70 ? 680  THR A CA    1 
ATOM   5246  C  C     . THR A 1 680 ? -3.117  -14.808 38.220  1.00 33.26 ? 680  THR A C     1 
ATOM   5247  O  O     . THR A 1 680 ? -3.598  -13.989 37.465  1.00 31.92 ? 680  THR A O     1 
ATOM   5248  C  CB    . THR A 1 680 ? -3.200  -17.237 37.759  1.00 33.16 ? 680  THR A CB    1 
ATOM   5249  O  OG1   . THR A 1 680 ? -2.541  -18.335 37.118  1.00 36.50 ? 680  THR A OG1   1 
ATOM   5250  C  CG2   . THR A 1 680 ? -4.578  -17.036 37.146  1.00 24.23 ? 680  THR A CG2   1 
ATOM   5251  N  N     . GLY A 1 681 ? -3.124  -14.664 39.552  1.00 33.39 ? 681  GLY A N     1 
ATOM   5252  C  CA    . GLY A 1 681 ? -3.669  -13.449 40.172  1.00 31.21 ? 681  GLY A CA    1 
ATOM   5253  C  C     . GLY A 1 681 ? -2.577  -12.752 40.980  1.00 31.62 ? 681  GLY A C     1 
ATOM   5254  O  O     . GLY A 1 681 ? -1.388  -13.006 40.763  1.00 32.12 ? 681  GLY A O     1 
ATOM   5255  N  N     . SER A 1 682 ? -2.917  -11.650 41.676  1.00 32.06 ? 682  SER A N     1 
ATOM   5256  C  CA    . SER A 1 682 ? -1.911  -10.967 42.479  1.00 32.85 ? 682  SER A CA    1 
ATOM   5257  C  C     . SER A 1 682 ? -2.401  -10.611 43.864  1.00 34.57 ? 682  SER A C     1 
ATOM   5258  O  O     . SER A 1 682 ? -3.578  -10.246 43.975  1.00 35.66 ? 682  SER A O     1 
ATOM   5259  C  CB    . SER A 1 682 ? -1.273  -9.793  41.768  1.00 36.82 ? 682  SER A CB    1 
ATOM   5260  O  OG    . SER A 1 682 ? -0.446  -9.142  42.723  1.00 41.73 ? 682  SER A OG    1 
ATOM   5261  N  N     . ASN A 1 683 ? -1.567  -10.814 44.899  1.00 35.06 ? 683  ASN A N     1 
ATOM   5262  C  CA    . ASN A 1 683 ? -2.074  -10.567 46.262  1.00 34.77 ? 683  ASN A CA    1 
ATOM   5263  C  C     . ASN A 1 683 ? -0.923  -10.470 47.235  1.00 34.37 ? 683  ASN A C     1 
ATOM   5264  O  O     . ASN A 1 683 ? 0.236   -10.716 46.878  1.00 34.26 ? 683  ASN A O     1 
ATOM   5265  C  CB    . ASN A 1 683 ? -3.137  -11.597 46.617  1.00 32.91 ? 683  ASN A CB    1 
ATOM   5266  C  CG    . ASN A 1 683 ? -3.864  -11.419 47.934  1.00 32.03 ? 683  ASN A CG    1 
ATOM   5267  O  OD1   . ASN A 1 683 ? -3.864  -10.324 48.474  1.00 36.82 ? 683  ASN A OD1   1 
ATOM   5268  N  ND2   . ASN A 1 683 ? -4.455  -12.454 48.548  1.00 27.19 ? 683  ASN A ND2   1 
ATOM   5269  N  N     . ALA A 1 684 ? -1.189  -9.979  48.437  1.00 33.56 ? 684  ALA A N     1 
ATOM   5270  C  CA    . ALA A 1 684 ? -0.103  -9.848  49.416  1.00 33.82 ? 684  ALA A CA    1 
ATOM   5271  C  C     . ALA A 1 684 ? -0.641  -10.006 50.840  1.00 34.29 ? 684  ALA A C     1 
ATOM   5272  O  O     . ALA A 1 684 ? -1.846  -9.996  51.080  1.00 35.08 ? 684  ALA A O     1 
ATOM   5273  C  CB    . ALA A 1 684 ? 0.619   -8.527  49.260  1.00 32.44 ? 684  ALA A CB    1 
ATOM   5274  N  N     . CYS A 1 685 ? 0.249   -10.343 51.757  1.00 35.05 ? 685  CYS A N     1 
ATOM   5275  C  CA    . CYS A 1 685 ? -0.067  -10.587 53.156  1.00 34.49 ? 685  CYS A CA    1 
ATOM   5276  C  C     . CYS A 1 685 ? 1.124   -10.075 53.943  1.00 36.07 ? 685  CYS A C     1 
ATOM   5277  O  O     . CYS A 1 685 ? 2.213   -9.937  53.384  1.00 36.08 ? 685  CYS A O     1 
ATOM   5278  C  CB    . CYS A 1 685 ? -0.261  -12.074 53.410  1.00 30.50 ? 685  CYS A CB    1 
ATOM   5279  S  SG    . CYS A 1 685 ? 1.189   -13.161 53.475  1.00 30.55 ? 685  CYS A SG    1 
ATOM   5280  N  N     . TYR A 1 686 ? 0.889   -9.700  55.187  1.00 38.37 ? 686  TYR A N     1 
ATOM   5281  C  CA    . TYR A 1 686 ? 1.966   -9.253  56.061  1.00 39.67 ? 686  TYR A CA    1 
ATOM   5282  C  C     . TYR A 1 686 ? 1.497   -9.542  57.484  1.00 42.47 ? 686  TYR A C     1 
ATOM   5283  O  O     . TYR A 1 686 ? 0.279   -9.598  57.759  1.00 42.58 ? 686  TYR A O     1 
ATOM   5284  C  CB    . TYR A 1 686 ? 2.348   -7.793  55.813  1.00 39.51 ? 686  TYR A CB    1 
ATOM   5285  C  CG    . TYR A 1 686 ? 1.334   -6.792  56.304  1.00 41.18 ? 686  TYR A CG    1 
ATOM   5286  C  CD1   . TYR A 1 686 ? 0.078   -6.723  55.728  1.00 41.84 ? 686  TYR A CD1   1 
ATOM   5287  C  CD2   . TYR A 1 686 ? 1.561   -5.975  57.412  1.00 42.62 ? 686  TYR A CD2   1 
ATOM   5288  C  CE1   . TYR A 1 686 ? -0.944  -5.929  56.240  1.00 42.29 ? 686  TYR A CE1   1 
ATOM   5289  C  CE2   . TYR A 1 686 ? 0.589   -5.133  57.927  1.00 42.57 ? 686  TYR A CE2   1 
ATOM   5290  C  CZ    . TYR A 1 686 ? -0.663  -5.123  57.332  1.00 43.00 ? 686  TYR A CZ    1 
ATOM   5291  O  OH    . TYR A 1 686 ? -1.678  -4.345  57.836  1.00 42.72 ? 686  TYR A OH    1 
ATOM   5292  N  N     . MET A 1 687 ? 2.465   -9.557  58.410  1.00 44.25 ? 687  MET A N     1 
ATOM   5293  C  CA    . MET A 1 687 ? 2.170   -9.663  59.840  1.00 45.11 ? 687  MET A CA    1 
ATOM   5294  C  C     . MET A 1 687 ? 1.687   -8.328  60.392  1.00 46.75 ? 687  MET A C     1 
ATOM   5295  O  O     . MET A 1 687 ? 2.469   -7.380  60.408  1.00 45.92 ? 687  MET A O     1 
ATOM   5296  C  CB    . MET A 1 687 ? 3.471   -10.029 60.570  1.00 44.93 ? 687  MET A CB    1 
ATOM   5297  C  CG    . MET A 1 687 ? 3.956   -11.433 60.257  1.00 41.99 ? 687  MET A CG    1 
ATOM   5298  S  SD    . MET A 1 687 ? 2.747   -12.655 60.762  1.00 49.56 ? 687  MET A SD    1 
ATOM   5299  C  CE    . MET A 1 687 ? 1.985   -13.064 59.218  1.00 51.78 ? 687  MET A CE    1 
ATOM   5300  N  N     . GLU A 1 688 ? 0.412   -8.224  60.789  1.00 48.40 ? 688  GLU A N     1 
ATOM   5301  C  CA    . GLU A 1 688 ? -0.126  -6.983  61.359  1.00 48.66 ? 688  GLU A CA    1 
ATOM   5302  C  C     . GLU A 1 688 ? -0.296  -7.044  62.872  1.00 48.83 ? 688  GLU A C     1 
ATOM   5303  O  O     . GLU A 1 688 ? -0.625  -8.110  63.388  1.00 48.58 ? 688  GLU A O     1 
ATOM   5304  C  CB    . GLU A 1 688 ? -1.519  -6.779  60.728  1.00 51.19 ? 688  GLU A CB    1 
ATOM   5305  C  CG    . GLU A 1 688 ? -2.268  -5.572  61.244  1.00 48.43 ? 688  GLU A CG    1 
ATOM   5306  C  CD    . GLU A 1 688 ? -1.504  -4.284  61.239  1.00 47.53 ? 688  GLU A CD    1 
ATOM   5307  O  OE1   . GLU A 1 688 ? -1.479  -3.552  60.243  1.00 51.02 ? 688  GLU A OE1   1 
ATOM   5308  O  OE2   . GLU A 1 688 ? -0.904  -3.924  62.268  1.00 51.28 ? 688  GLU A OE2   1 
ATOM   5309  N  N     . GLU A 1 689 ? -0.128  -5.953  63.596  1.00 49.90 ? 689  GLU A N     1 
ATOM   5310  C  CA    . GLU A 1 689 ? -0.243  -5.907  65.048  1.00 51.65 ? 689  GLU A CA    1 
ATOM   5311  C  C     . GLU A 1 689 ? -1.717  -6.064  65.412  1.00 52.42 ? 689  GLU A C     1 
ATOM   5312  O  O     . GLU A 1 689 ? -2.553  -5.498  64.704  1.00 53.67 ? 689  GLU A O     1 
ATOM   5313  C  CB    . GLU A 1 689 ? 0.241   -4.598  65.674  1.00 53.48 ? 689  GLU A CB    1 
ATOM   5314  C  CG    . GLU A 1 689 ? 1.699   -4.228  65.418  1.00 55.56 ? 689  GLU A CG    1 
ATOM   5315  C  CD    . GLU A 1 689 ? 2.538   -5.485  65.597  1.00 62.71 ? 689  GLU A CD    1 
ATOM   5316  O  OE1   . GLU A 1 689 ? 2.292   -6.123  66.652  1.00 67.35 ? 689  GLU A OE1   1 
ATOM   5317  O  OE2   . GLU A 1 689 ? 3.314   -5.863  64.693  1.00 62.66 ? 689  GLU A OE2   1 
ATOM   5318  N  N     . MET A 1 690 ? -2.038  -6.808  66.451  1.00 52.60 ? 690  MET A N     1 
ATOM   5319  C  CA    . MET A 1 690 ? -3.450  -7.054  66.744  1.00 53.72 ? 690  MET A CA    1 
ATOM   5320  C  C     . MET A 1 690 ? -4.199  -5.820  67.212  1.00 54.59 ? 690  MET A C     1 
ATOM   5321  O  O     . MET A 1 690 ? -5.359  -5.638  66.803  1.00 54.15 ? 690  MET A O     1 
ATOM   5322  C  CB    . MET A 1 690 ? -3.593  -8.263  67.663  1.00 53.97 ? 690  MET A CB    1 
ATOM   5323  C  CG    . MET A 1 690 ? -3.645  -9.588  66.916  1.00 52.00 ? 690  MET A CG    1 
ATOM   5324  S  SD    . MET A 1 690 ? -5.332  -10.013 66.496  1.00 54.59 ? 690  MET A SD    1 
ATOM   5325  C  CE    . MET A 1 690 ? -5.121  -11.504 65.556  1.00 52.08 ? 690  MET A CE    1 
ATOM   5326  N  N     . LYS A 1 691 ? -3.553  -4.889  67.935  1.00 55.82 ? 691  LYS A N     1 
ATOM   5327  C  CA    . LYS A 1 691 ? -4.271  -3.658  68.262  1.00 57.20 ? 691  LYS A CA    1 
ATOM   5328  C  C     . LYS A 1 691 ? -4.832  -3.006  66.994  1.00 57.38 ? 691  LYS A C     1 
ATOM   5329  O  O     . LYS A 1 691 ? -5.790  -2.224  67.109  1.00 58.44 ? 691  LYS A O     1 
ATOM   5330  C  CB    . LYS A 1 691 ? -3.505  -2.662  69.104  1.00 60.91 ? 691  LYS A CB    1 
ATOM   5331  C  CG    . LYS A 1 691 ? -2.517  -1.755  68.384  1.00 66.44 ? 691  LYS A CG    1 
ATOM   5332  C  CD    . LYS A 1 691 ? -1.143  -1.856  69.039  1.00 68.75 ? 691  LYS A CD    1 
ATOM   5333  C  CE    . LYS A 1 691 ? -0.135  -0.888  68.452  1.00 71.58 ? 691  LYS A CE    1 
ATOM   5334  N  NZ    . LYS A 1 691 ? -0.535  0.536   68.658  1.00 73.03 ? 691  LYS A NZ    1 
ATOM   5335  N  N     . ASN A 1 692 ? -4.311  -3.345  65.822  1.00 55.32 ? 692  ASN A N     1 
ATOM   5336  C  CA    . ASN A 1 692 ? -4.741  -2.766  64.571  1.00 53.48 ? 692  ASN A CA    1 
ATOM   5337  C  C     . ASN A 1 692 ? -5.802  -3.592  63.862  1.00 53.48 ? 692  ASN A C     1 
ATOM   5338  O  O     . ASN A 1 692 ? -6.614  -3.022  63.131  1.00 53.11 ? 692  ASN A O     1 
ATOM   5339  C  CB    . ASN A 1 692 ? -3.542  -2.587  63.643  1.00 51.28 ? 692  ASN A CB    1 
ATOM   5340  C  CG    . ASN A 1 692 ? -2.654  -1.442  64.041  1.00 51.22 ? 692  ASN A CG    1 
ATOM   5341  O  OD1   . ASN A 1 692 ? -3.126  -0.424  64.532  1.00 54.78 ? 692  ASN A OD1   1 
ATOM   5342  N  ND2   . ASN A 1 692 ? -1.343  -1.535  63.830  1.00 53.71 ? 692  ASN A ND2   1 
ATOM   5343  N  N     . VAL A 1 693 ? -5.843  -4.900  64.097  1.00 53.40 ? 693  VAL A N     1 
ATOM   5344  C  CA    . VAL A 1 693 ? -6.864  -5.769  63.520  1.00 53.17 ? 693  VAL A CA    1 
ATOM   5345  C  C     . VAL A 1 693 ? -8.172  -5.690  64.304  1.00 53.78 ? 693  VAL A C     1 
ATOM   5346  O  O     . VAL A 1 693 ? -8.567  -6.576  65.070  1.00 53.78 ? 693  VAL A O     1 
ATOM   5347  C  CB    . VAL A 1 693 ? -6.399  -7.238  63.429  1.00 51.85 ? 693  VAL A CB    1 
ATOM   5348  C  CG1   . VAL A 1 693 ? -7.338  -8.110  62.599  1.00 50.23 ? 693  VAL A CG1   1 
ATOM   5349  C  CG2   . VAL A 1 693 ? -4.989  -7.306  62.870  1.00 53.10 ? 693  VAL A CG2   1 
ATOM   5350  N  N     . GLU A 1 694 ? -8.928  -4.617  64.086  1.00 53.75 ? 694  GLU A N     1 
ATOM   5351  C  CA    . GLU A 1 694 ? -10.163 -4.362  64.794  1.00 54.14 ? 694  GLU A CA    1 
ATOM   5352  C  C     . GLU A 1 694 ? -11.208 -5.448  64.802  1.00 55.16 ? 694  GLU A C     1 
ATOM   5353  O  O     . GLU A 1 694 ? -12.022 -5.501  65.749  1.00 55.06 ? 694  GLU A O     1 
ATOM   5354  C  CB    . GLU A 1 694 ? -10.785 -3.027  64.366  1.00 51.45 ? 694  GLU A CB    1 
ATOM   5355  C  CG    . GLU A 1 694 ? -9.813  -1.904  64.758  1.00 52.22 ? 694  GLU A CG    1 
ATOM   5356  C  CD    . GLU A 1 694 ? -10.494 -0.563  64.860  1.00 50.75 ? 694  GLU A CD    1 
ATOM   5357  O  OE1   . GLU A 1 694 ? -11.704 -0.487  64.566  1.00 53.75 ? 694  GLU A OE1   1 
ATOM   5358  O  OE2   . GLU A 1 694 ? -9.801  0.403   65.210  1.00 53.28 ? 694  GLU A OE2   1 
ATOM   5359  N  N     . MET A 1 695 ? -11.184 -6.327  63.797  1.00 55.63 ? 695  MET A N     1 
ATOM   5360  C  CA    . MET A 1 695 ? -12.257 -7.317  63.713  1.00 55.65 ? 695  MET A CA    1 
ATOM   5361  C  C     . MET A 1 695 ? -11.882 -8.562  64.469  1.00 55.24 ? 695  MET A C     1 
ATOM   5362  O  O     . MET A 1 695 ? -12.570 -9.577  64.389  1.00 55.20 ? 695  MET A O     1 
ATOM   5363  C  CB    . MET A 1 695 ? -12.630 -7.596  62.265  1.00 58.41 ? 695  MET A CB    1 
ATOM   5364  C  CG    . MET A 1 695 ? -12.961 -6.351  61.472  1.00 60.77 ? 695  MET A CG    1 
ATOM   5365  S  SD    . MET A 1 695 ? -14.707 -5.950  61.454  1.00 68.06 ? 695  MET A SD    1 
ATOM   5366  C  CE    . MET A 1 695 ? -15.268 -6.884  60.030  1.00 64.30 ? 695  MET A CE    1 
ATOM   5367  N  N     . VAL A 1 696 ? -10.740 -8.554  65.140  1.00 56.34 ? 696  VAL A N     1 
ATOM   5368  C  CA    . VAL A 1 696 ? -10.418 -9.760  65.926  1.00 57.63 ? 696  VAL A CA    1 
ATOM   5369  C  C     . VAL A 1 696 ? -10.096 -9.364  67.349  1.00 59.73 ? 696  VAL A C     1 
ATOM   5370  O  O     . VAL A 1 696 ? -9.242  -8.494  67.547  1.00 59.59 ? 696  VAL A O     1 
ATOM   5371  C  CB    . VAL A 1 696 ? -9.377  -10.623 65.234  1.00 58.10 ? 696  VAL A CB    1 
ATOM   5372  C  CG1   . VAL A 1 696 ? -9.109  -11.858 66.075  1.00 54.11 ? 696  VAL A CG1   1 
ATOM   5373  C  CG2   . VAL A 1 696 ? -9.836  -11.009 63.810  1.00 53.39 ? 696  VAL A CG2   1 
ATOM   5374  N  N     . GLU A 1 697 ? -10.962 -9.771  68.285  1.00 61.49 ? 697  GLU A N     1 
ATOM   5375  C  CA    . GLU A 1 697 ? -10.830 -9.416  69.695  1.00 62.29 ? 697  GLU A CA    1 
ATOM   5376  C  C     . GLU A 1 697 ? -9.467  -9.882  70.201  1.00 62.01 ? 697  GLU A C     1 
ATOM   5377  O  O     . GLU A 1 697 ? -9.107  -11.018 69.905  1.00 61.44 ? 697  GLU A O     1 
ATOM   5378  C  CB    . GLU A 1 697 ? -11.920 -10.057 70.566  1.00 67.60 ? 697  GLU A CB    1 
ATOM   5379  C  CG    . GLU A 1 697 ? -13.320 -9.499  70.393  1.00 75.60 ? 697  GLU A CG    1 
ATOM   5380  C  CD    . GLU A 1 697 ? -13.911 -8.674  71.517  1.00 77.06 ? 697  GLU A CD    1 
ATOM   5381  O  OE1   . GLU A 1 697 ? -13.651 -7.445  71.579  1.00 76.67 ? 697  GLU A OE1   1 
ATOM   5382  O  OE2   . GLU A 1 697 ? -14.694 -9.211  72.347  1.00 78.60 ? 697  GLU A OE2   1 
ATOM   5383  N  N     . GLY A 1 698 ? -8.749  -9.048  70.931  1.00 62.00 ? 698  GLY A N     1 
ATOM   5384  C  CA    . GLY A 1 698 ? -7.412  -9.437  71.411  1.00 62.59 ? 698  GLY A CA    1 
ATOM   5385  C  C     . GLY A 1 698 ? -6.440  -8.376  70.891  1.00 63.46 ? 698  GLY A C     1 
ATOM   5386  O  O     . GLY A 1 698 ? -6.588  -7.996  69.723  1.00 63.91 ? 698  GLY A O     1 
ATOM   5387  N  N     . ASP A 1 699 ? -5.625  -7.823  71.763  1.00 63.02 ? 699  ASP A N     1 
ATOM   5388  C  CA    . ASP A 1 699 ? -4.815  -6.662  71.422  1.00 63.82 ? 699  ASP A CA    1 
ATOM   5389  C  C     . ASP A 1 699 ? -3.378  -7.068  71.730  1.00 63.94 ? 699  ASP A C     1 
ATOM   5390  O  O     . ASP A 1 699 ? -2.437  -6.292  71.830  1.00 63.35 ? 699  ASP A O     1 
ATOM   5391  C  CB    . ASP A 1 699 ? -5.191  -5.414  72.217  1.00 72.56 ? 699  ASP A CB    1 
ATOM   5392  C  CG    . ASP A 1 699 ? -4.810  -5.362  73.694  1.00 78.15 ? 699  ASP A CG    1 
ATOM   5393  O  OD1   . ASP A 1 699 ? -3.583  -5.341  73.996  1.00 77.45 ? 699  ASP A OD1   1 
ATOM   5394  O  OD2   . ASP A 1 699 ? -5.720  -5.297  74.578  1.00 74.07 ? 699  ASP A OD2   1 
ATOM   5395  N  N     . GLN A 1 700 ? -3.305  -8.393  71.830  1.00 64.53 ? 700  GLN A N     1 
ATOM   5396  C  CA    . GLN A 1 700 ? -2.028  -8.997  72.222  1.00 65.15 ? 700  GLN A CA    1 
ATOM   5397  C  C     . GLN A 1 700 ? -1.444  -9.820  71.085  1.00 64.31 ? 700  GLN A C     1 
ATOM   5398  O  O     . GLN A 1 700 ? -2.063  -10.767 70.618  1.00 63.20 ? 700  GLN A O     1 
ATOM   5399  C  CB    . GLN A 1 700 ? -2.254  -9.820  73.501  1.00 71.27 ? 700  GLN A CB    1 
ATOM   5400  C  CG    . GLN A 1 700 ? -3.274  -10.933 73.371  1.00 75.34 ? 700  GLN A CG    1 
ATOM   5401  C  CD    . GLN A 1 700 ? -3.698  -11.564 74.679  1.00 80.54 ? 700  GLN A CD    1 
ATOM   5402  O  OE1   . GLN A 1 700 ? -3.498  -12.759 74.951  1.00 82.63 ? 700  GLN A OE1   1 
ATOM   5403  N  NE2   . GLN A 1 700 ? -4.352  -10.780 75.538  1.00 82.10 ? 700  GLN A NE2   1 
ATOM   5404  N  N     . GLY A 1 701 ? -0.246  -9.451  70.644  1.00 63.43 ? 701  GLY A N     1 
ATOM   5405  C  CA    . GLY A 1 701 ? 0.498   -10.209 69.679  1.00 62.88 ? 701  GLY A CA    1 
ATOM   5406  C  C     . GLY A 1 701 ? 0.478   -9.756  68.240  1.00 62.45 ? 701  GLY A C     1 
ATOM   5407  O  O     . GLY A 1 701 ? 0.882   -8.646  67.904  1.00 63.34 ? 701  GLY A O     1 
ATOM   5408  N  N     . GLN A 1 702 ? 0.189   -10.708 67.338  1.00 61.20 ? 702  GLN A N     1 
ATOM   5409  C  CA    . GLN A 1 702 ? 0.234   -10.466 65.911  1.00 58.74 ? 702  GLN A CA    1 
ATOM   5410  C  C     . GLN A 1 702 ? -0.694  -11.370 65.126  1.00 57.72 ? 702  GLN A C     1 
ATOM   5411  O  O     . GLN A 1 702 ? -1.348  -12.285 65.628  1.00 59.18 ? 702  GLN A O     1 
ATOM   5412  C  CB    . GLN A 1 702 ? 1.655   -10.658 65.382  1.00 54.78 ? 702  GLN A CB    1 
ATOM   5413  C  CG    . GLN A 1 702 ? 2.621   -9.621  65.963  1.00 54.77 ? 702  GLN A CG    1 
ATOM   5414  C  CD    . GLN A 1 702 ? 3.980   -9.868  65.353  1.00 56.09 ? 702  GLN A CD    1 
ATOM   5415  O  OE1   . GLN A 1 702 ? 5.005   -9.434  65.845  1.00 61.58 ? 702  GLN A OE1   1 
ATOM   5416  N  NE2   . GLN A 1 702 ? 3.969   -10.647 64.283  1.00 61.91 ? 702  GLN A NE2   1 
ATOM   5417  N  N     . MET A 1 703 ? -0.746  -11.065 63.830  1.00 55.03 ? 703  MET A N     1 
ATOM   5418  C  CA    . MET A 1 703 ? -1.639  -11.861 62.986  1.00 52.89 ? 703  MET A CA    1 
ATOM   5419  C  C     . MET A 1 703 ? -1.342  -11.579 61.528  1.00 50.51 ? 703  MET A C     1 
ATOM   5420  O  O     . MET A 1 703 ? -1.066  -10.449 61.128  1.00 51.44 ? 703  MET A O     1 
ATOM   5421  C  CB    . MET A 1 703 ? -3.078  -11.576 63.393  1.00 51.30 ? 703  MET A CB    1 
ATOM   5422  C  CG    . MET A 1 703 ? -4.143  -11.840 62.364  1.00 51.35 ? 703  MET A CG    1 
ATOM   5423  S  SD    . MET A 1 703 ? -5.130  -13.322 62.642  1.00 53.99 ? 703  MET A SD    1 
ATOM   5424  C  CE    . MET A 1 703 ? -6.695  -12.657 63.160  1.00 53.97 ? 703  MET A CE    1 
ATOM   5425  N  N     . CYS A 1 704 ? -1.339  -12.638 60.746  1.00 47.87 ? 704  CYS A N     1 
ATOM   5426  C  CA    . CYS A 1 704 ? -1.146  -12.492 59.312  1.00 45.97 ? 704  CYS A CA    1 
ATOM   5427  C  C     . CYS A 1 704 ? -2.471  -12.047 58.685  1.00 43.40 ? 704  CYS A C     1 
ATOM   5428  O  O     . CYS A 1 704 ? -3.465  -12.715 58.856  1.00 42.10 ? 704  CYS A O     1 
ATOM   5429  C  CB    . CYS A 1 704 ? -0.777  -13.832 58.652  1.00 47.10 ? 704  CYS A CB    1 
ATOM   5430  S  SG    . CYS A 1 704 ? 0.047   -13.506 57.092  1.00 53.64 ? 704  CYS A SG    1 
ATOM   5431  N  N     . ILE A 1 705 ? -2.373  -11.018 57.877  1.00 42.87 ? 705  ILE A N     1 
ATOM   5432  C  CA    . ILE A 1 705 ? -3.533  -10.482 57.173  1.00 41.65 ? 705  ILE A CA    1 
ATOM   5433  C  C     . ILE A 1 705 ? -3.455  -10.787 55.686  1.00 40.53 ? 705  ILE A C     1 
ATOM   5434  O  O     . ILE A 1 705 ? -2.473  -10.379 55.075  1.00 41.17 ? 705  ILE A O     1 
ATOM   5435  C  CB    . ILE A 1 705 ? -3.382  -8.938  57.318  1.00 44.29 ? 705  ILE A CB    1 
ATOM   5436  C  CG1   . ILE A 1 705 ? -3.538  -8.531  58.789  1.00 44.26 ? 705  ILE A CG1   1 
ATOM   5437  C  CG2   . ILE A 1 705 ? -4.391  -8.249  56.439  1.00 43.75 ? 705  ILE A CG2   1 
ATOM   5438  C  CD1   . ILE A 1 705 ? -4.999  -8.663  59.189  1.00 46.69 ? 705  ILE A CD1   1 
ATOM   5439  N  N     . ASN A 1 706 ? -4.414  -11.506 55.129  1.00 39.94 ? 706  ASN A N     1 
ATOM   5440  C  CA    . ASN A 1 706 ? -4.552  -11.698 53.692  1.00 37.65 ? 706  ASN A CA    1 
ATOM   5441  C  C     . ASN A 1 706 ? -5.285  -10.456 53.125  1.00 37.93 ? 706  ASN A C     1 
ATOM   5442  O  O     . ASN A 1 706 ? -6.445  -10.234 53.463  1.00 35.10 ? 706  ASN A O     1 
ATOM   5443  C  CB    . ASN A 1 706 ? -5.455  -12.903 53.443  1.00 31.37 ? 706  ASN A CB    1 
ATOM   5444  C  CG    . ASN A 1 706 ? -5.841  -12.969 51.968  1.00 32.73 ? 706  ASN A CG    1 
ATOM   5445  O  OD1   . ASN A 1 706 ? -5.246  -12.289 51.158  1.00 32.12 ? 706  ASN A OD1   1 
ATOM   5446  N  ND2   . ASN A 1 706 ? -6.806  -13.761 51.520  1.00 33.20 ? 706  ASN A ND2   1 
ATOM   5447  N  N     . MET A 1 707 ? -4.526  -9.596  52.419  1.00 38.64 ? 707  MET A N     1 
ATOM   5448  C  CA    . MET A 1 707 ? -5.019  -8.291  52.029  1.00 38.87 ? 707  MET A CA    1 
ATOM   5449  C  C     . MET A 1 707 ? -6.192  -8.314  51.055  1.00 38.83 ? 707  MET A C     1 
ATOM   5450  O  O     . MET A 1 707 ? -7.029  -7.417  51.126  1.00 37.54 ? 707  MET A O     1 
ATOM   5451  C  CB    . MET A 1 707 ? -3.958  -7.371  51.432  1.00 38.77 ? 707  MET A CB    1 
ATOM   5452  C  CG    . MET A 1 707 ? -3.266  -6.443  52.396  1.00 37.92 ? 707  MET A CG    1 
ATOM   5453  S  SD    . MET A 1 707 ? -1.624  -5.909  51.974  1.00 39.69 ? 707  MET A SD    1 
ATOM   5454  C  CE    . MET A 1 707 ? -1.997  -4.340  51.196  1.00 41.99 ? 707  MET A CE    1 
ATOM   5455  N  N     . GLU A 1 708 ? -6.172  -9.303  50.164  1.00 38.02 ? 708  GLU A N     1 
ATOM   5456  C  CA    . GLU A 1 708 ? -7.131  -9.314  49.070  1.00 37.61 ? 708  GLU A CA    1 
ATOM   5457  C  C     . GLU A 1 708 ? -7.002  -7.974  48.345  1.00 37.33 ? 708  GLU A C     1 
ATOM   5458  O  O     . GLU A 1 708 ? -7.957  -7.374  47.857  1.00 37.17 ? 708  GLU A O     1 
ATOM   5459  C  CB    . GLU A 1 708 ? -8.512  -9.734  49.509  1.00 38.16 ? 708  GLU A CB    1 
ATOM   5460  C  CG    . GLU A 1 708 ? -8.550  -11.227 49.832  1.00 37.68 ? 708  GLU A CG    1 
ATOM   5461  C  CD    . GLU A 1 708 ? -8.082  -12.134 48.692  1.00 42.26 ? 708  GLU A CD    1 
ATOM   5462  O  OE1   . GLU A 1 708 ? -8.286  -11.826 47.490  1.00 33.64 ? 708  GLU A OE1   1 
ATOM   5463  O  OE2   . GLU A 1 708 ? -7.571  -13.244 49.037  1.00 38.63 ? 708  GLU A OE2   1 
ATOM   5464  N  N     . TRP A 1 709 ? -5.710  -7.714  48.041  1.00 36.15 ? 709  TRP A N     1 
ATOM   5465  C  CA    . TRP A 1 709 ? -5.295  -6.466  47.427  1.00 36.19 ? 709  TRP A CA    1 
ATOM   5466  C  C     . TRP A 1 709 ? -5.755  -6.268  45.997  1.00 35.96 ? 709  TRP A C     1 
ATOM   5467  O  O     . TRP A 1 709 ? -5.674  -5.161  45.505  1.00 33.62 ? 709  TRP A O     1 
ATOM   5468  C  CB    . TRP A 1 709 ? -3.816  -6.184  47.618  1.00 33.35 ? 709  TRP A CB    1 
ATOM   5469  C  CG    . TRP A 1 709 ? -2.713  -6.518  46.688  1.00 32.39 ? 709  TRP A CG    1 
ATOM   5470  C  CD1   . TRP A 1 709 ? -2.731  -7.314  45.571  1.00 30.41 ? 709  TRP A CD1   1 
ATOM   5471  C  CD2   . TRP A 1 709 ? -1.330  -6.131  46.851  1.00 30.33 ? 709  TRP A CD2   1 
ATOM   5472  N  NE1   . TRP A 1 709 ? -1.525  -7.303  44.945  1.00 31.55 ? 709  TRP A NE1   1 
ATOM   5473  C  CE2   . TRP A 1 709 ? -0.629  -6.608  45.734  1.00 29.21 ? 709  TRP A CE2   1 
ATOM   5474  C  CE3   . TRP A 1 709 ? -0.657  -5.304  47.767  1.00 29.57 ? 709  TRP A CE3   1 
ATOM   5475  C  CZ2   . TRP A 1 709 ? 0.728   -6.401  45.575  1.00 29.23 ? 709  TRP A CZ2   1 
ATOM   5476  C  CZ3   . TRP A 1 709 ? 0.710   -5.076  47.584  1.00 25.90 ? 709  TRP A CZ3   1 
ATOM   5477  C  CH2   . TRP A 1 709 ? 1.387   -5.595  46.498  1.00 26.29 ? 709  TRP A CH2   1 
ATOM   5478  N  N     . GLY A 1 710 ? -6.141  -7.315  45.269  1.00 37.79 ? 710  GLY A N     1 
ATOM   5479  C  CA    . GLY A 1 710 ? -6.514  -7.136  43.873  1.00 38.63 ? 710  GLY A CA    1 
ATOM   5480  C  C     . GLY A 1 710 ? -7.777  -6.296  43.737  1.00 40.20 ? 710  GLY A C     1 
ATOM   5481  O  O     . GLY A 1 710 ? -8.081  -5.916  42.612  1.00 39.93 ? 710  GLY A O     1 
ATOM   5482  N  N     . ALA A 1 711 ? -8.584  -6.226  44.812  1.00 41.35 ? 711  ALA A N     1 
ATOM   5483  C  CA    . ALA A 1 711 ? -9.868  -5.512  44.696  1.00 40.92 ? 711  ALA A CA    1 
ATOM   5484  C  C     . ALA A 1 711 ? -9.658  -4.004  44.781  1.00 40.43 ? 711  ALA A C     1 
ATOM   5485  O  O     . ALA A 1 711 ? -10.588 -3.245  44.514  1.00 40.93 ? 711  ALA A O     1 
ATOM   5486  C  CB    . ALA A 1 711 ? -10.870 -6.056  45.721  1.00 37.84 ? 711  ALA A CB    1 
ATOM   5487  N  N     . PHE A 1 712 ? -8.430  -3.555  45.010  1.00 38.69 ? 712  PHE A N     1 
ATOM   5488  C  CA    . PHE A 1 712 ? -8.072  -2.131  45.074  1.00 39.31 ? 712  PHE A CA    1 
ATOM   5489  C  C     . PHE A 1 712 ? -8.479  -1.454  43.760  1.00 39.03 ? 712  PHE A C     1 
ATOM   5490  O  O     . PHE A 1 712 ? -8.449  -2.181  42.757  1.00 39.44 ? 712  PHE A O     1 
ATOM   5491  C  CB    . PHE A 1 712 ? -6.580  -2.003  45.323  1.00 35.02 ? 712  PHE A CB    1 
ATOM   5492  C  CG    . PHE A 1 712 ? -5.885  -0.696  45.391  1.00 35.21 ? 712  PHE A CG    1 
ATOM   5493  C  CD1   . PHE A 1 712 ? -6.374  0.374   46.118  1.00 33.92 ? 712  PHE A CD1   1 
ATOM   5494  C  CD2   . PHE A 1 712 ? -4.634  -0.551  44.794  1.00 34.98 ? 712  PHE A CD2   1 
ATOM   5495  C  CE1   . PHE A 1 712 ? -5.663  1.542   46.213  1.00 34.04 ? 712  PHE A CE1   1 
ATOM   5496  C  CE2   . PHE A 1 712 ? -3.928  0.629   44.872  1.00 32.94 ? 712  PHE A CE2   1 
ATOM   5497  C  CZ    . PHE A 1 712 ? -4.420  1.681   45.605  1.00 30.41 ? 712  PHE A CZ    1 
ATOM   5498  N  N     . GLY A 1 713 ? -9.130  -0.310  43.820  1.00 39.00 ? 713  GLY A N     1 
ATOM   5499  C  CA    . GLY A 1 713 ? -9.639  0.317   42.612  1.00 39.14 ? 713  GLY A CA    1 
ATOM   5500  C  C     . GLY A 1 713 ? -11.032 -0.203  42.284  1.00 40.52 ? 713  GLY A C     1 
ATOM   5501  O  O     . GLY A 1 713 ? -11.579 0.240   41.265  1.00 42.21 ? 713  GLY A O     1 
ATOM   5502  N  N     . ASP A 1 714 ? -11.631 -1.022  43.148  1.00 39.22 ? 714  ASP A N     1 
ATOM   5503  C  CA    . ASP A 1 714 ? -13.013 -1.425  42.868  1.00 40.34 ? 714  ASP A CA    1 
ATOM   5504  C  C     . ASP A 1 714 ? -14.066 -0.381  43.211  1.00 40.89 ? 714  ASP A C     1 
ATOM   5505  O  O     . ASP A 1 714 ? -15.216 -0.557  42.795  1.00 41.22 ? 714  ASP A O     1 
ATOM   5506  C  CB    . ASP A 1 714 ? -13.379 -2.804  43.443  1.00 37.52 ? 714  ASP A CB    1 
ATOM   5507  C  CG    . ASP A 1 714 ? -12.537 -3.909  42.817  1.00 42.96 ? 714  ASP A CG    1 
ATOM   5508  O  OD1   . ASP A 1 714 ? -11.695 -3.586  41.947  1.00 43.55 ? 714  ASP A OD1   1 
ATOM   5509  O  OD2   . ASP A 1 714 ? -12.674 -5.111  43.173  1.00 44.76 ? 714  ASP A OD2   1 
ATOM   5510  N  N     . ASN A 1 715 ? -13.740 0.637   43.974  1.00 40.57 ? 715  ASN A N     1 
ATOM   5511  C  CA    . ASN A 1 715 ? -14.679 1.701   44.294  1.00 42.08 ? 715  ASN A CA    1 
ATOM   5512  C  C     . ASN A 1 715 ? -14.435 2.916   43.412  1.00 42.83 ? 715  ASN A C     1 
ATOM   5513  O  O     . ASN A 1 715 ? -15.227 3.867   43.414  1.00 44.32 ? 715  ASN A O     1 
ATOM   5514  C  CB    . ASN A 1 715 ? -14.485 2.101   45.756  1.00 42.36 ? 715  ASN A CB    1 
ATOM   5515  C  CG    . ASN A 1 715 ? -13.023 2.343   46.106  1.00 44.13 ? 715  ASN A CG    1 
ATOM   5516  O  OD1   . ASN A 1 715 ? -12.762 2.659   47.284  1.00 45.28 ? 715  ASN A OD1   1 
ATOM   5517  N  ND2   . ASN A 1 715 ? -12.102 2.183   45.167  1.00 34.71 ? 715  ASN A ND2   1 
ATOM   5518  N  N     . GLY A 1 716 ? -13.298 3.014   42.730  1.00 42.80 ? 716  GLY A N     1 
ATOM   5519  C  CA    . GLY A 1 716 ? -13.043 4.100   41.799  1.00 41.06 ? 716  GLY A CA    1 
ATOM   5520  C  C     . GLY A 1 716 ? -11.666 4.713   41.939  1.00 41.45 ? 716  GLY A C     1 
ATOM   5521  O  O     . GLY A 1 716 ? -11.159 5.334   41.001  1.00 42.62 ? 716  GLY A O     1 
ATOM   5522  N  N     . CYS A 1 717 ? -11.045 4.554   43.099  1.00 41.87 ? 717  CYS A N     1 
ATOM   5523  C  CA    . CYS A 1 717 ? -9.815  5.267   43.425  1.00 42.16 ? 717  CYS A CA    1 
ATOM   5524  C  C     . CYS A 1 717 ? -8.648  4.899   42.531  1.00 40.95 ? 717  CYS A C     1 
ATOM   5525  O  O     . CYS A 1 717 ? -7.543  5.410   42.793  1.00 42.75 ? 717  CYS A O     1 
ATOM   5526  C  CB    . CYS A 1 717 ? -9.532  5.155   44.927  1.00 49.15 ? 717  CYS A CB    1 
ATOM   5527  S  SG    . CYS A 1 717 ? -10.372 6.470   45.911  1.00 71.78 ? 717  CYS A SG    1 
ATOM   5528  N  N     . LEU A 1 718 ? -8.812  4.112   41.449  1.00 38.19 ? 718  LEU A N     1 
ATOM   5529  C  CA    . LEU A 1 718 ? -7.741  4.135   40.440  1.00 36.88 ? 718  LEU A CA    1 
ATOM   5530  C  C     . LEU A 1 718 ? -8.221  4.628   39.084  1.00 36.88 ? 718  LEU A C     1 
ATOM   5531  O  O     . LEU A 1 718 ? -7.529  4.497   38.057  1.00 35.63 ? 718  LEU A O     1 
ATOM   5532  C  CB    . LEU A 1 718 ? -7.038  2.807   40.388  1.00 37.68 ? 718  LEU A CB    1 
ATOM   5533  C  CG    . LEU A 1 718 ? -6.362  2.278   41.653  1.00 41.73 ? 718  LEU A CG    1 
ATOM   5534  C  CD1   . LEU A 1 718 ? -6.474  0.766   41.733  1.00 41.21 ? 718  LEU A CD1   1 
ATOM   5535  C  CD2   . LEU A 1 718 ? -4.903  2.710   41.702  1.00 41.90 ? 718  LEU A CD2   1 
ATOM   5536  N  N     . ASP A 1 719 ? -9.505  4.988   38.961  1.00 37.23 ? 719  ASP A N     1 
ATOM   5537  C  CA    . ASP A 1 719 ? -10.173 5.352   37.741  1.00 39.03 ? 719  ASP A CA    1 
ATOM   5538  C  C     . ASP A 1 719 ? -9.362  6.243   36.818  1.00 41.55 ? 719  ASP A C     1 
ATOM   5539  O  O     . ASP A 1 719 ? -9.367  6.253   35.595  1.00 41.45 ? 719  ASP A O     1 
ATOM   5540  C  CB    . ASP A 1 719 ? -11.493 6.070   38.052  1.00 41.43 ? 719  ASP A CB    1 
ATOM   5541  C  CG    . ASP A 1 719 ? -12.557 4.986   38.240  1.00 48.51 ? 719  ASP A CG    1 
ATOM   5542  O  OD1   . ASP A 1 719 ? -12.334 3.812   37.825  1.00 51.29 ? 719  ASP A OD1   1 
ATOM   5543  O  OD2   . ASP A 1 719 ? -13.583 5.300   38.861  1.00 51.62 ? 719  ASP A OD2   1 
ATOM   5544  N  N     . ASP A 1 720 ? -8.598  7.058   37.501  1.00 42.63 ? 720  ASP A N     1 
ATOM   5545  C  CA    . ASP A 1 720 ? -7.547  7.935   37.205  1.00 43.41 ? 720  ASP A CA    1 
ATOM   5546  C  C     . ASP A 1 720 ? -6.438  7.452   36.289  1.00 42.96 ? 720  ASP A C     1 
ATOM   5547  O  O     . ASP A 1 720 ? -5.817  8.238   35.569  1.00 43.45 ? 720  ASP A O     1 
ATOM   5548  C  CB    . ASP A 1 720 ? -6.764  8.099   38.614  1.00 49.97 ? 720  ASP A CB    1 
ATOM   5549  C  CG    . ASP A 1 720 ? -6.626  9.619   38.573  1.00 54.47 ? 720  ASP A CG    1 
ATOM   5550  O  OD1   . ASP A 1 720 ? -7.276  10.015  37.543  1.00 56.37 ? 720  ASP A OD1   1 
ATOM   5551  O  OD2   . ASP A 1 720 ? -6.033  10.257  39.432  1.00 56.29 ? 720  ASP A OD2   1 
ATOM   5552  N  N     . ILE A 1 721 ? -6.028  6.213   36.542  1.00 40.80 ? 721  ILE A N     1 
ATOM   5553  C  CA    . ILE A 1 721 ? -4.938  5.619   35.782  1.00 38.73 ? 721  ILE A CA    1 
ATOM   5554  C  C     . ILE A 1 721 ? -5.434  4.465   34.920  1.00 36.39 ? 721  ILE A C     1 
ATOM   5555  O  O     . ILE A 1 721 ? -4.769  4.173   33.951  1.00 36.14 ? 721  ILE A O     1 
ATOM   5556  C  CB    . ILE A 1 721 ? -3.829  5.162   36.731  1.00 41.64 ? 721  ILE A CB    1 
ATOM   5557  C  CG1   . ILE A 1 721 ? -4.252  3.884   37.446  1.00 37.27 ? 721  ILE A CG1   1 
ATOM   5558  C  CG2   . ILE A 1 721 ? -3.579  6.308   37.710  1.00 42.40 ? 721  ILE A CG2   1 
ATOM   5559  C  CD1   . ILE A 1 721 ? -3.179  3.403   38.404  1.00 43.58 ? 721  ILE A CD1   1 
ATOM   5560  N  N     . ARG A 1 722 ? -6.677  4.073   35.047  1.00 34.92 ? 722  ARG A N     1 
ATOM   5561  C  CA    . ARG A 1 722 ? -7.232  3.031   34.193  1.00 34.18 ? 722  ARG A CA    1 
ATOM   5562  C  C     . ARG A 1 722 ? -7.511  3.567   32.803  1.00 33.75 ? 722  ARG A C     1 
ATOM   5563  O  O     . ARG A 1 722 ? -7.876  4.732   32.601  1.00 32.96 ? 722  ARG A O     1 
ATOM   5564  C  CB    . ARG A 1 722 ? -8.481  2.450   34.899  1.00 34.50 ? 722  ARG A CB    1 
ATOM   5565  C  CG    . ARG A 1 722 ? -7.977  1.596   36.105  1.00 30.87 ? 722  ARG A CG    1 
ATOM   5566  C  CD    . ARG A 1 722 ? -9.210  1.014   36.793  1.00 33.01 ? 722  ARG A CD    1 
ATOM   5567  N  NE    . ARG A 1 722 ? -9.556  -0.171  35.996  1.00 41.19 ? 722  ARG A NE    1 
ATOM   5568  C  CZ    . ARG A 1 722 ? -10.758 -0.478  35.530  1.00 38.92 ? 722  ARG A CZ    1 
ATOM   5569  N  NH1   . ARG A 1 722 ? -11.831 0.245   35.807  1.00 41.92 ? 722  ARG A NH1   1 
ATOM   5570  N  NH2   . ARG A 1 722 ? -10.845 -1.570  34.783  1.00 39.94 ? 722  ARG A NH2   1 
ATOM   5571  N  N     . THR A 1 723 ? -7.187  2.777   31.789  1.00 33.43 ? 723  THR A N     1 
ATOM   5572  C  CA    . THR A 1 723 ? -7.292  3.173   30.419  1.00 32.33 ? 723  THR A CA    1 
ATOM   5573  C  C     . THR A 1 723 ? -8.463  2.485   29.735  1.00 33.20 ? 723  THR A C     1 
ATOM   5574  O  O     . THR A 1 723 ? -9.026  1.531   30.225  1.00 34.53 ? 723  THR A O     1 
ATOM   5575  C  CB    . THR A 1 723 ? -6.038  2.807   29.613  1.00 32.01 ? 723  THR A CB    1 
ATOM   5576  O  OG1   . THR A 1 723 ? -6.018  1.415   29.312  1.00 33.25 ? 723  THR A OG1   1 
ATOM   5577  C  CG2   . THR A 1 723 ? -4.794  3.281   30.329  1.00 33.76 ? 723  THR A CG2   1 
ATOM   5578  N  N     . HIS A 1 724 ? -8.738  2.947   28.513  1.00 33.88 ? 724  HIS A N     1 
ATOM   5579  C  CA    . HIS A 1 724 ? -9.713  2.287   27.656  1.00 32.53 ? 724  HIS A CA    1 
ATOM   5580  C  C     . HIS A 1 724 ? -9.480  0.784   27.674  1.00 31.46 ? 724  HIS A C     1 
ATOM   5581  O  O     . HIS A 1 724 ? -10.456 0.050   27.674  1.00 32.54 ? 724  HIS A O     1 
ATOM   5582  C  CB    . HIS A 1 724 ? -9.410  2.757   26.211  1.00 33.61 ? 724  HIS A CB    1 
ATOM   5583  C  CG    . HIS A 1 724 ? -10.451 2.242   25.250  1.00 32.67 ? 724  HIS A CG    1 
ATOM   5584  N  ND1   . HIS A 1 724 ? -10.102 1.620   24.066  1.00 32.25 ? 724  HIS A ND1   1 
ATOM   5585  C  CD2   . HIS A 1 724 ? -11.789 2.360   25.275  1.00 26.42 ? 724  HIS A CD2   1 
ATOM   5586  C  CE1   . HIS A 1 724 ? -11.206 1.331   23.392  1.00 27.89 ? 724  HIS A CE1   1 
ATOM   5587  N  NE2   . HIS A 1 724 ? -12.222 1.768   24.097  1.00 34.48 ? 724  HIS A NE2   1 
ATOM   5588  N  N     . TYR A 1 725 ? -8.238  0.339   27.471  1.00 30.60 ? 725  TYR A N     1 
ATOM   5589  C  CA    . TYR A 1 725 ? -7.905  -1.064  27.402  1.00 30.45 ? 725  TYR A CA    1 
ATOM   5590  C  C     . TYR A 1 725 ? -8.129  -1.873  28.669  1.00 31.05 ? 725  TYR A C     1 
ATOM   5591  O  O     . TYR A 1 725 ? -8.635  -3.001  28.536  1.00 31.75 ? 725  TYR A O     1 
ATOM   5592  C  CB    . TYR A 1 725 ? -6.467  -1.206  26.893  1.00 30.26 ? 725  TYR A CB    1 
ATOM   5593  C  CG    . TYR A 1 725 ? -6.246  -0.245  25.738  1.00 30.14 ? 725  TYR A CG    1 
ATOM   5594  C  CD1   . TYR A 1 725 ? -6.648  -0.612  24.459  1.00 29.77 ? 725  TYR A CD1   1 
ATOM   5595  C  CD2   . TYR A 1 725 ? -5.701  1.014   25.956  1.00 29.70 ? 725  TYR A CD2   1 
ATOM   5596  C  CE1   . TYR A 1 725 ? -6.435  0.248   23.397  1.00 30.10 ? 725  TYR A CE1   1 
ATOM   5597  C  CE2   . TYR A 1 725 ? -5.545  1.903   24.910  1.00 28.71 ? 725  TYR A CE2   1 
ATOM   5598  C  CZ    . TYR A 1 725 ? -5.883  1.492   23.637  1.00 30.20 ? 725  TYR A CZ    1 
ATOM   5599  O  OH    . TYR A 1 725 ? -5.806  2.383   22.602  1.00 32.01 ? 725  TYR A OH    1 
ATOM   5600  N  N     . ASP A 1 726 ? -7.916  -1.310  29.853  1.00 30.22 ? 726  ASP A N     1 
ATOM   5601  C  CA    . ASP A 1 726 ? -8.200  -1.892  31.135  1.00 29.58 ? 726  ASP A CA    1 
ATOM   5602  C  C     . ASP A 1 726 ? -9.708  -2.039  31.362  1.00 31.74 ? 726  ASP A C     1 
ATOM   5603  O  O     . ASP A 1 726 ? -10.143 -3.000  31.985  1.00 31.42 ? 726  ASP A O     1 
ATOM   5604  C  CB    . ASP A 1 726 ? -7.665  -0.989  32.276  1.00 22.72 ? 726  ASP A CB    1 
ATOM   5605  C  CG    . ASP A 1 726 ? -6.173  -0.778  32.216  1.00 28.15 ? 726  ASP A CG    1 
ATOM   5606  O  OD1   . ASP A 1 726 ? -5.387  -1.762  32.158  1.00 27.20 ? 726  ASP A OD1   1 
ATOM   5607  O  OD2   . ASP A 1 726 ? -5.698  0.388   32.193  1.00 28.24 ? 726  ASP A OD2   1 
ATOM   5608  N  N     . ARG A 1 727 ? -10.499 -1.026  30.974  1.00 31.56 ? 727  ARG A N     1 
ATOM   5609  C  CA    . ARG A 1 727 ? -11.956 -1.150  31.133  1.00 31.80 ? 727  ARG A CA    1 
ATOM   5610  C  C     . ARG A 1 727 ? -12.520 -2.203  30.187  1.00 33.33 ? 727  ARG A C     1 
ATOM   5611  O  O     . ARG A 1 727 ? -13.392 -3.040  30.494  1.00 32.70 ? 727  ARG A O     1 
ATOM   5612  C  CB    . ARG A 1 727 ? -12.521 0.280   30.922  1.00 28.62 ? 727  ARG A CB    1 
ATOM   5613  C  CG    . ARG A 1 727 ? -12.129 1.167   32.100  1.00 27.94 ? 727  ARG A CG    1 
ATOM   5614  C  CD    . ARG A 1 727 ? -12.729 2.557   32.115  1.00 33.75 ? 727  ARG A CD    1 
ATOM   5615  N  NE    . ARG A 1 727 ? -12.754 3.157   30.789  1.00 33.03 ? 727  ARG A NE    1 
ATOM   5616  C  CZ    . ARG A 1 727 ? -11.992 4.145   30.370  1.00 33.43 ? 727  ARG A CZ    1 
ATOM   5617  N  NH1   . ARG A 1 727 ? -11.039 4.700   31.123  1.00 38.35 ? 727  ARG A NH1   1 
ATOM   5618  N  NH2   . ARG A 1 727 ? -12.118 4.518   29.103  1.00 39.50 ? 727  ARG A NH2   1 
ATOM   5619  N  N     . LEU A 1 728 ? -11.944 -2.297  28.957  1.00 34.05 ? 728  LEU A N     1 
ATOM   5620  C  CA    . LEU A 1 728 ? -12.403 -3.347  28.061  1.00 34.43 ? 728  LEU A CA    1 
ATOM   5621  C  C     . LEU A 1 728 ? -12.076 -4.708  28.690  1.00 36.19 ? 728  LEU A C     1 
ATOM   5622  O  O     . LEU A 1 728 ? -12.947 -5.587  28.558  1.00 37.50 ? 728  LEU A O     1 
ATOM   5623  C  CB    . LEU A 1 728 ? -11.832 -3.285  26.666  1.00 31.98 ? 728  LEU A CB    1 
ATOM   5624  C  CG    . LEU A 1 728 ? -12.231 -2.055  25.811  1.00 35.04 ? 728  LEU A CG    1 
ATOM   5625  C  CD1   . LEU A 1 728 ? -11.459 -2.155  24.485  1.00 33.42 ? 728  LEU A CD1   1 
ATOM   5626  C  CD2   . LEU A 1 728 ? -13.728 -2.093  25.513  1.00 32.47 ? 728  LEU A CD2   1 
ATOM   5627  N  N     . VAL A 1 729 ? -10.877 -4.892  29.266  1.00 34.08 ? 729  VAL A N     1 
ATOM   5628  C  CA    . VAL A 1 729 ? -10.515 -6.232  29.761  1.00 33.13 ? 729  VAL A CA    1 
ATOM   5629  C  C     . VAL A 1 729 ? -11.463 -6.650  30.885  1.00 32.35 ? 729  VAL A C     1 
ATOM   5630  O  O     . VAL A 1 729 ? -11.919 -7.780  31.091  1.00 29.22 ? 729  VAL A O     1 
ATOM   5631  C  CB    . VAL A 1 729 ? -9.054  -6.281  30.263  1.00 38.46 ? 729  VAL A CB    1 
ATOM   5632  C  CG1   . VAL A 1 729 ? -8.754  -7.520  31.077  1.00 36.75 ? 729  VAL A CG1   1 
ATOM   5633  C  CG2   . VAL A 1 729 ? -8.007  -6.196  29.151  1.00 34.84 ? 729  VAL A CG2   1 
ATOM   5634  N  N     . ASN A 1 730 ? -11.691 -5.644  31.738  1.00 32.60 ? 730  ASN A N     1 
ATOM   5635  C  CA    . ASN A 1 730 ? -12.592 -5.816  32.864  1.00 33.35 ? 730  ASN A CA    1 
ATOM   5636  C  C     . ASN A 1 730 ? -14.020 -6.078  32.422  1.00 35.52 ? 730  ASN A C     1 
ATOM   5637  O  O     . ASN A 1 730 ? -14.662 -7.061  32.856  1.00 37.22 ? 730  ASN A O     1 
ATOM   5638  C  CB    . ASN A 1 730 ? -12.464 -4.541  33.688  1.00 33.38 ? 730  ASN A CB    1 
ATOM   5639  C  CG    . ASN A 1 730 ? -13.325 -4.581  34.943  1.00 38.80 ? 730  ASN A CG    1 
ATOM   5640  O  OD1   . ASN A 1 730 ? -13.331 -5.662  35.571  1.00 35.38 ? 730  ASN A OD1   1 
ATOM   5641  N  ND2   . ASN A 1 730 ? -13.951 -3.536  35.238  1.00 35.86 ? 730  ASN A ND2   1 
ATOM   5642  N  N     . GLU A 1 731 ? -14.559 -5.316  31.458  1.00 35.59 ? 731  GLU A N     1 
ATOM   5643  C  CA    . GLU A 1 731 ? -15.986 -5.522  31.120  1.00 36.09 ? 731  GLU A CA    1 
ATOM   5644  C  C     . GLU A 1 731 ? -16.254 -6.914  30.594  1.00 35.70 ? 731  GLU A C     1 
ATOM   5645  O  O     . GLU A 1 731 ? -17.339 -7.477  30.653  1.00 35.24 ? 731  GLU A O     1 
ATOM   5646  C  CB    . GLU A 1 731 ? -16.403 -4.516  30.034  1.00 36.04 ? 731  GLU A CB    1 
ATOM   5647  C  CG    . GLU A 1 731 ? -17.813 -3.966  30.214  1.00 41.43 ? 731  GLU A CG    1 
ATOM   5648  C  CD    . GLU A 1 731 ? -18.041 -3.640  31.677  1.00 37.35 ? 731  GLU A CD    1 
ATOM   5649  O  OE1   . GLU A 1 731 ? -17.252 -2.828  32.124  1.00 38.64 ? 731  GLU A OE1   1 
ATOM   5650  O  OE2   . GLU A 1 731 ? -18.876 -4.245  32.351  1.00 38.20 ? 731  GLU A OE2   1 
ATOM   5651  N  N     . TYR A 1 732 ? -15.234 -7.469  29.929  1.00 35.66 ? 732  TYR A N     1 
ATOM   5652  C  CA    . TYR A 1 732 ? -15.372 -8.727  29.249  1.00 36.48 ? 732  TYR A CA    1 
ATOM   5653  C  C     . TYR A 1 732 ? -14.983 -9.902  30.133  1.00 37.31 ? 732  TYR A C     1 
ATOM   5654  O  O     . TYR A 1 732 ? -14.868 -11.018 29.625  1.00 37.43 ? 732  TYR A O     1 
ATOM   5655  C  CB    . TYR A 1 732 ? -14.587 -8.684  27.941  1.00 38.96 ? 732  TYR A CB    1 
ATOM   5656  C  CG    . TYR A 1 732 ? -15.390 -8.147  26.768  1.00 40.86 ? 732  TYR A CG    1 
ATOM   5657  C  CD1   . TYR A 1 732 ? -16.623 -8.719  26.461  1.00 42.86 ? 732  TYR A CD1   1 
ATOM   5658  C  CD2   . TYR A 1 732 ? -15.020 -6.993  26.106  1.00 41.00 ? 732  TYR A CD2   1 
ATOM   5659  C  CE1   . TYR A 1 732 ? -17.428 -8.197  25.452  1.00 44.22 ? 732  TYR A CE1   1 
ATOM   5660  C  CE2   . TYR A 1 732 ? -15.794 -6.480  25.078  1.00 42.49 ? 732  TYR A CE2   1 
ATOM   5661  C  CZ    . TYR A 1 732 ? -16.970 -7.101  24.732  1.00 44.04 ? 732  TYR A CZ    1 
ATOM   5662  O  OH    . TYR A 1 732 ? -17.740 -6.613  23.710  1.00 45.27 ? 732  TYR A OH    1 
ATOM   5663  N  N     . SER A 1 733 ? -14.805 -9.655  31.436  1.00 36.76 ? 733  SER A N     1 
ATOM   5664  C  CA    . SER A 1 733 ? -14.300 -10.697 32.312  1.00 37.56 ? 733  SER A CA    1 
ATOM   5665  C  C     . SER A 1 733 ? -15.356 -11.431 33.118  1.00 37.05 ? 733  SER A C     1 
ATOM   5666  O  O     . SER A 1 733 ? -16.520 -11.077 33.180  1.00 36.84 ? 733  SER A O     1 
ATOM   5667  C  CB    . SER A 1 733 ? -13.212 -10.123 33.240  1.00 35.02 ? 733  SER A CB    1 
ATOM   5668  O  OG    . SER A 1 733 ? -13.805 -9.355  34.262  1.00 38.20 ? 733  SER A OG    1 
ATOM   5669  N  N     . LEU A 1 734 ? -14.976 -12.569 33.688  1.00 37.32 ? 734  LEU A N     1 
ATOM   5670  C  CA    . LEU A 1 734 ? -15.863 -13.409 34.481  1.00 35.71 ? 734  LEU A CA    1 
ATOM   5671  C  C     . LEU A 1 734 ? -16.311 -12.579 35.658  1.00 34.65 ? 734  LEU A C     1 
ATOM   5672  O  O     . LEU A 1 734 ? -17.405 -12.771 36.154  1.00 36.87 ? 734  LEU A O     1 
ATOM   5673  C  CB    . LEU A 1 734 ? -15.134 -14.674 34.942  1.00 32.54 ? 734  LEU A CB    1 
ATOM   5674  C  CG    . LEU A 1 734 ? -14.817 -15.711 33.867  1.00 33.48 ? 734  LEU A CG    1 
ATOM   5675  C  CD1   . LEU A 1 734 ? -13.849 -16.793 34.327  1.00 28.95 ? 734  LEU A CD1   1 
ATOM   5676  C  CD2   . LEU A 1 734 ? -16.147 -16.300 33.371  1.00 29.97 ? 734  LEU A CD2   1 
ATOM   5677  N  N     . ASN A 1 735 ? -15.540 -11.602 36.080  1.00 34.24 ? 735  ASN A N     1 
ATOM   5678  C  CA    . ASN A 1 735 ? -15.965 -10.792 37.232  1.00 33.30 ? 735  ASN A CA    1 
ATOM   5679  C  C     . ASN A 1 735 ? -15.890 -9.285  37.036  1.00 32.84 ? 735  ASN A C     1 
ATOM   5680  O  O     . ASN A 1 735 ? -15.227 -8.571  37.790  1.00 31.99 ? 735  ASN A O     1 
ATOM   5681  C  CB    . ASN A 1 735 ? -15.045 -11.234 38.387  1.00 31.07 ? 735  ASN A CB    1 
ATOM   5682  C  CG    . ASN A 1 735 ? -13.578 -11.219 37.959  1.00 32.61 ? 735  ASN A CG    1 
ATOM   5683  O  OD1   . ASN A 1 735 ? -12.717 -11.214 38.863  1.00 36.44 ? 735  ASN A OD1   1 
ATOM   5684  N  ND2   . ASN A 1 735 ? -13.242 -11.213 36.689  1.00 29.65 ? 735  ASN A ND2   1 
ATOM   5685  N  N     . ALA A 1 736 ? -16.653 -8.750  36.101  1.00 32.62 ? 736  ALA A N     1 
ATOM   5686  C  CA    . ALA A 1 736 ? -16.763 -7.345  35.799  1.00 33.92 ? 736  ALA A CA    1 
ATOM   5687  C  C     . ALA A 1 736 ? -16.877 -6.486  37.051  1.00 35.86 ? 736  ALA A C     1 
ATOM   5688  O  O     . ALA A 1 736 ? -17.759 -6.720  37.892  1.00 37.42 ? 736  ALA A O     1 
ATOM   5689  C  CB    . ALA A 1 736 ? -17.988 -7.061  34.935  1.00 26.33 ? 736  ALA A CB    1 
ATOM   5690  N  N     . GLY A 1 737 ? -16.062 -5.440  37.121  1.00 35.67 ? 737  GLY A N     1 
ATOM   5691  C  CA    . GLY A 1 737 ? -16.094 -4.543  38.238  1.00 35.67 ? 737  GLY A CA    1 
ATOM   5692  C  C     . GLY A 1 737 ? -15.122 -4.874  39.342  1.00 37.69 ? 737  GLY A C     1 
ATOM   5693  O  O     . GLY A 1 737 ? -14.878 -3.967  40.159  1.00 39.27 ? 737  GLY A O     1 
ATOM   5694  N  N     . LYS A 1 738 ? -14.584 -6.098  39.424  1.00 37.32 ? 738  LYS A N     1 
ATOM   5695  C  CA    . LYS A 1 738 ? -13.742 -6.388  40.583  1.00 38.16 ? 738  LYS A CA    1 
ATOM   5696  C  C     . LYS A 1 738 ? -12.288 -6.629  40.264  1.00 36.99 ? 738  LYS A C     1 
ATOM   5697  O  O     . LYS A 1 738 ? -11.994 -7.118  39.167  1.00 36.70 ? 738  LYS A O     1 
ATOM   5698  C  CB    . LYS A 1 738 ? -14.359 -7.570  41.383  1.00 45.62 ? 738  LYS A CB    1 
ATOM   5699  C  CG    . LYS A 1 738 ? -15.132 -6.905  42.541  1.00 56.37 ? 738  LYS A CG    1 
ATOM   5700  C  CD    . LYS A 1 738 ? -16.563 -7.405  42.614  1.00 58.17 ? 738  LYS A CD    1 
ATOM   5701  C  CE    . LYS A 1 738 ? -17.115 -7.250  44.027  1.00 68.33 ? 738  LYS A CE    1 
ATOM   5702  N  NZ    . LYS A 1 738 ? -17.614 -8.522  44.646  1.00 67.17 ? 738  LYS A NZ    1 
ATOM   5703  N  N     . GLN A 1 739 ? -11.452 -6.753  41.293  1.00 37.45 ? 739  GLN A N     1 
ATOM   5704  C  CA    . GLN A 1 739 ? -10.051 -7.114  41.153  1.00 35.73 ? 739  GLN A CA    1 
ATOM   5705  C  C     . GLN A 1 739 ? -9.358  -6.265  40.089  1.00 35.44 ? 739  GLN A C     1 
ATOM   5706  O  O     . GLN A 1 739 ? -8.456  -6.720  39.374  1.00 35.76 ? 739  GLN A O     1 
ATOM   5707  C  CB    . GLN A 1 739 ? -9.836  -8.564  40.800  1.00 32.92 ? 739  GLN A CB    1 
ATOM   5708  C  CG    . GLN A 1 739 ? -10.573 -9.528  41.699  1.00 32.41 ? 739  GLN A CG    1 
ATOM   5709  C  CD    . GLN A 1 739 ? -10.064 -9.602  43.119  1.00 35.72 ? 739  GLN A CD    1 
ATOM   5710  O  OE1   . GLN A 1 739 ? -10.830 -9.283  44.028  1.00 30.72 ? 739  GLN A OE1   1 
ATOM   5711  N  NE2   . GLN A 1 739 ? -8.847  -10.108 43.342  1.00 27.79 ? 739  GLN A NE2   1 
ATOM   5712  N  N     . ARG A 1 740 ? -9.754  -4.998  40.072  1.00 35.61 ? 740  ARG A N     1 
ATOM   5713  C  CA    . ARG A 1 740 ? -9.244  -4.035  39.118  1.00 36.16 ? 740  ARG A CA    1 
ATOM   5714  C  C     . ARG A 1 740 ? -7.746  -3.839  39.171  1.00 36.07 ? 740  ARG A C     1 
ATOM   5715  O  O     . ARG A 1 740 ? -7.133  -3.744  38.122  1.00 36.17 ? 740  ARG A O     1 
ATOM   5716  C  CB    . ARG A 1 740 ? -10.019 -2.710  39.244  1.00 40.85 ? 740  ARG A CB    1 
ATOM   5717  C  CG    . ARG A 1 740 ? -11.390 -2.869  38.603  1.00 43.56 ? 740  ARG A CG    1 
ATOM   5718  C  CD    . ARG A 1 740 ? -11.979 -1.524  38.239  1.00 49.06 ? 740  ARG A CD    1 
ATOM   5719  N  NE    . ARG A 1 740 ? -13.407 -1.569  38.455  1.00 50.85 ? 740  ARG A NE    1 
ATOM   5720  C  CZ    . ARG A 1 740 ? -14.253 -0.552  38.581  1.00 51.84 ? 740  ARG A CZ    1 
ATOM   5721  N  NH1   . ARG A 1 740 ? -13.889 0.702   38.503  1.00 44.00 ? 740  ARG A NH1   1 
ATOM   5722  N  NH2   . ARG A 1 740 ? -15.544 -0.833  38.827  1.00 53.32 ? 740  ARG A NH2   1 
ATOM   5723  N  N     . TYR A 1 741 ? -7.188  -3.673  40.361  1.00 36.02 ? 741  TYR A N     1 
ATOM   5724  C  CA    . TYR A 1 741 ? -5.729  -3.543  40.509  1.00 34.63 ? 741  TYR A CA    1 
ATOM   5725  C  C     . TYR A 1 741 ? -5.093  -4.855  40.060  1.00 35.26 ? 741  TYR A C     1 
ATOM   5726  O  O     . TYR A 1 741 ? -4.046  -4.887  39.397  1.00 35.97 ? 741  TYR A O     1 
ATOM   5727  C  CB    . TYR A 1 741 ? -5.438  -3.233  41.961  1.00 33.56 ? 741  TYR A CB    1 
ATOM   5728  C  CG    . TYR A 1 741 ? -4.045  -3.078  42.492  1.00 30.97 ? 741  TYR A CG    1 
ATOM   5729  C  CD1   . TYR A 1 741 ? -3.201  -2.089  42.033  1.00 29.08 ? 741  TYR A CD1   1 
ATOM   5730  C  CD2   . TYR A 1 741 ? -3.555  -3.935  43.478  1.00 29.91 ? 741  TYR A CD2   1 
ATOM   5731  C  CE1   . TYR A 1 741 ? -1.936  -1.867  42.542  1.00 30.31 ? 741  TYR A CE1   1 
ATOM   5732  C  CE2   . TYR A 1 741 ? -2.299  -3.734  44.014  1.00 31.34 ? 741  TYR A CE2   1 
ATOM   5733  C  CZ    . TYR A 1 741 ? -1.466  -2.751  43.510  1.00 31.98 ? 741  TYR A CZ    1 
ATOM   5734  O  OH    . TYR A 1 741 ? -0.203  -2.596  44.056  1.00 31.06 ? 741  TYR A OH    1 
ATOM   5735  N  N     . GLU A 1 742 ? -5.688  -5.984  40.453  1.00 35.25 ? 742  GLU A N     1 
ATOM   5736  C  CA    . GLU A 1 742 ? -5.126  -7.261  40.022  1.00 33.11 ? 742  GLU A CA    1 
ATOM   5737  C  C     . GLU A 1 742 ? -5.127  -7.337  38.502  1.00 32.46 ? 742  GLU A C     1 
ATOM   5738  O  O     . GLU A 1 742 ? -4.192  -7.862  37.886  1.00 30.81 ? 742  GLU A O     1 
ATOM   5739  C  CB    . GLU A 1 742 ? -5.933  -8.411  40.607  1.00 37.46 ? 742  GLU A CB    1 
ATOM   5740  C  CG    . GLU A 1 742 ? -5.793  -9.670  39.749  1.00 34.64 ? 742  GLU A CG    1 
ATOM   5741  C  CD    . GLU A 1 742 ? -6.454  -10.808 40.486  1.00 41.99 ? 742  GLU A CD    1 
ATOM   5742  O  OE1   . GLU A 1 742 ? -5.819  -11.405 41.390  1.00 43.75 ? 742  GLU A OE1   1 
ATOM   5743  O  OE2   . GLU A 1 742 ? -7.586  -11.209 40.144  1.00 42.80 ? 742  GLU A OE2   1 
ATOM   5744  N  N     . LYS A 1 743 ? -6.174  -6.777  37.876  1.00 31.95 ? 743  LYS A N     1 
ATOM   5745  C  CA    . LYS A 1 743 ? -6.270  -6.727  36.436  1.00 28.88 ? 743  LYS A CA    1 
ATOM   5746  C  C     . LYS A 1 743 ? -5.278  -5.882  35.708  1.00 29.37 ? 743  LYS A C     1 
ATOM   5747  O  O     . LYS A 1 743 ? -5.024  -6.170  34.535  1.00 30.46 ? 743  LYS A O     1 
ATOM   5748  C  CB    . LYS A 1 743 ? -7.695  -6.539  35.963  1.00 28.28 ? 743  LYS A CB    1 
ATOM   5749  C  CG    . LYS A 1 743 ? -8.606  -7.641  36.516  1.00 32.59 ? 743  LYS A CG    1 
ATOM   5750  C  CD    . LYS A 1 743 ? -10.066 -7.300  36.225  1.00 33.41 ? 743  LYS A CD    1 
ATOM   5751  C  CE    . LYS A 1 743 ? -10.933 -8.554  36.295  1.00 31.62 ? 743  LYS A CE    1 
ATOM   5752  N  NZ    . LYS A 1 743 ? -12.300 -8.206  36.855  1.00 37.87 ? 743  LYS A NZ    1 
ATOM   5753  N  N     . MET A 1 744 ? -4.553  -4.955  36.305  1.00 29.17 ? 744  MET A N     1 
ATOM   5754  C  CA    . MET A 1 744 ? -3.422  -4.314  35.677  1.00 29.99 ? 744  MET A CA    1 
ATOM   5755  C  C     . MET A 1 744 ? -2.067  -4.937  36.042  1.00 31.54 ? 744  MET A C     1 
ATOM   5756  O  O     . MET A 1 744 ? -1.053  -4.448  35.498  1.00 31.87 ? 744  MET A O     1 
ATOM   5757  C  CB    . MET A 1 744 ? -3.419  -2.828  36.080  1.00 31.41 ? 744  MET A CB    1 
ATOM   5758  C  CG    . MET A 1 744 ? -4.839  -2.248  35.920  1.00 25.97 ? 744  MET A CG    1 
ATOM   5759  S  SD    . MET A 1 744 ? -4.871  -0.494  36.172  1.00 35.16 ? 744  MET A SD    1 
ATOM   5760  C  CE    . MET A 1 744 ? -5.102  -0.440  37.944  1.00 21.93 ? 744  MET A CE    1 
ATOM   5761  N  N     . ILE A 1 745 ? -2.033  -6.036  36.801  1.00 30.14 ? 745  ILE A N     1 
ATOM   5762  C  CA    . ILE A 1 745 ? -0.822  -6.700  37.187  1.00 31.25 ? 745  ILE A CA    1 
ATOM   5763  C  C     . ILE A 1 745 ? -0.559  -8.141  36.758  1.00 30.57 ? 745  ILE A C     1 
ATOM   5764  O  O     . ILE A 1 745 ? 0.583   -8.399  36.439  1.00 29.57 ? 745  ILE A O     1 
ATOM   5765  C  CB    . ILE A 1 745 ? -0.655  -6.685  38.729  1.00 30.87 ? 745  ILE A CB    1 
ATOM   5766  C  CG1   . ILE A 1 745 ? -0.554  -5.221  39.154  1.00 34.62 ? 745  ILE A CG1   1 
ATOM   5767  C  CG2   . ILE A 1 745 ? 0.527   -7.491  39.231  1.00 28.72 ? 745  ILE A CG2   1 
ATOM   5768  C  CD1   . ILE A 1 745 ? -0.530  -5.043  40.659  1.00 28.29 ? 745  ILE A CD1   1 
ATOM   5769  N  N     . SER A 1 746 ? -1.387  -9.106  37.076  1.00 30.92 ? 746  SER A N     1 
ATOM   5770  C  CA    . SER A 1 746 ? -1.233  -10.529 36.971  1.00 31.06 ? 746  SER A CA    1 
ATOM   5771  C  C     . SER A 1 746 ? -1.119  -11.007 35.520  1.00 31.43 ? 746  SER A C     1 
ATOM   5772  O  O     . SER A 1 746 ? -1.693  -10.383 34.644  1.00 30.04 ? 746  SER A O     1 
ATOM   5773  C  CB    . SER A 1 746 ? -2.603  -11.196 37.358  1.00 33.85 ? 746  SER A CB    1 
ATOM   5774  O  OG    . SER A 1 746 ? -2.754  -11.006 38.743  1.00 47.87 ? 746  SER A OG    1 
ATOM   5775  N  N     . GLY A 1 747 ? -0.743  -12.261 35.409  1.00 32.59 ? 747  GLY A N     1 
ATOM   5776  C  CA    . GLY A 1 747 ? -0.552  -12.989 34.195  1.00 32.26 ? 747  GLY A CA    1 
ATOM   5777  C  C     . GLY A 1 747 ? -1.764  -13.546 33.532  1.00 32.18 ? 747  GLY A C     1 
ATOM   5778  O  O     . GLY A 1 747 ? -1.722  -13.759 32.306  1.00 32.10 ? 747  GLY A O     1 
ATOM   5779  N  N     . MET A 1 748 ? -2.899  -13.619 34.221  1.00 33.31 ? 748  MET A N     1 
ATOM   5780  C  CA    . MET A 1 748 ? -4.151  -13.906 33.464  1.00 33.26 ? 748  MET A CA    1 
ATOM   5781  C  C     . MET A 1 748 ? -4.583  -12.702 32.636  1.00 34.30 ? 748  MET A C     1 
ATOM   5782  O  O     . MET A 1 748 ? -5.385  -12.881 31.712  1.00 36.34 ? 748  MET A O     1 
ATOM   5783  C  CB    . MET A 1 748 ? -5.278  -14.235 34.411  1.00 29.08 ? 748  MET A CB    1 
ATOM   5784  C  CG    . MET A 1 748 ? -6.577  -14.773 33.885  1.00 37.04 ? 748  MET A CG    1 
ATOM   5785  S  SD    . MET A 1 748 ? -7.613  -15.378 35.275  1.00 36.49 ? 748  MET A SD    1 
ATOM   5786  C  CE    . MET A 1 748 ? -9.214  -15.378 34.464  1.00 39.33 ? 748  MET A CE    1 
ATOM   5787  N  N     . TYR A 1 749 ? -4.263  -11.467 33.007  1.00 33.48 ? 749  TYR A N     1 
ATOM   5788  C  CA    . TYR A 1 749 ? -4.828  -10.277 32.408  1.00 31.33 ? 749  TYR A CA    1 
ATOM   5789  C  C     . TYR A 1 749 ? -3.880  -9.434  31.579  1.00 32.77 ? 749  TYR A C     1 
ATOM   5790  O  O     . TYR A 1 749 ? -4.343  -8.766  30.645  1.00 33.48 ? 749  TYR A O     1 
ATOM   5791  C  CB    . TYR A 1 749 ? -5.365  -9.335  33.531  1.00 29.62 ? 749  TYR A CB    1 
ATOM   5792  C  CG    . TYR A 1 749 ? -6.364  -10.053 34.385  1.00 26.93 ? 749  TYR A CG    1 
ATOM   5793  C  CD1   . TYR A 1 749 ? -7.572  -10.458 33.804  1.00 27.07 ? 749  TYR A CD1   1 
ATOM   5794  C  CD2   . TYR A 1 749 ? -6.062  -10.459 35.671  1.00 26.61 ? 749  TYR A CD2   1 
ATOM   5795  C  CE1   . TYR A 1 749 ? -8.499  -11.208 34.503  1.00 25.74 ? 749  TYR A CE1   1 
ATOM   5796  C  CE2   . TYR A 1 749 ? -6.995  -11.179 36.424  1.00 27.32 ? 749  TYR A CE2   1 
ATOM   5797  C  CZ    . TYR A 1 749 ? -8.211  -11.516 35.811  1.00 27.13 ? 749  TYR A CZ    1 
ATOM   5798  O  OH    . TYR A 1 749 ? -9.122  -12.191 36.535  1.00 26.58 ? 749  TYR A OH    1 
ATOM   5799  N  N     . LEU A 1 750 ? -2.580  -9.447  31.860  1.00 32.26 ? 750  LEU A N     1 
ATOM   5800  C  CA    . LEU A 1 750 ? -1.651  -8.627  31.092  1.00 32.24 ? 750  LEU A CA    1 
ATOM   5801  C  C     . LEU A 1 750 ? -1.800  -8.731  29.589  1.00 31.28 ? 750  LEU A C     1 
ATOM   5802  O  O     . LEU A 1 750 ? -1.709  -7.693  28.911  1.00 30.89 ? 750  LEU A O     1 
ATOM   5803  C  CB    . LEU A 1 750 ? -0.190  -8.882  31.484  1.00 33.63 ? 750  LEU A CB    1 
ATOM   5804  C  CG    . LEU A 1 750 ? 0.280   -8.377  32.866  1.00 33.25 ? 750  LEU A CG    1 
ATOM   5805  C  CD1   . LEU A 1 750 ? 1.805   -8.206  32.810  1.00 33.07 ? 750  LEU A CD1   1 
ATOM   5806  C  CD2   . LEU A 1 750 ? -0.326  -7.031  33.211  1.00 30.21 ? 750  LEU A CD2   1 
ATOM   5807  N  N     . GLY A 1 751 ? -1.827  -9.930  29.042  1.00 31.13 ? 751  GLY A N     1 
ATOM   5808  C  CA    . GLY A 1 751 ? -1.849  -10.160 27.602  1.00 31.56 ? 751  GLY A CA    1 
ATOM   5809  C  C     . GLY A 1 751 ? -3.203  -9.809  26.965  1.00 32.84 ? 751  GLY A C     1 
ATOM   5810  O  O     . GLY A 1 751 ? -3.282  -9.436  25.792  1.00 31.95 ? 751  GLY A O     1 
ATOM   5811  N  N     . GLU A 1 752 ? -4.259  -9.803  27.810  1.00 33.36 ? 752  GLU A N     1 
ATOM   5812  C  CA    . GLU A 1 752 ? -5.551  -9.285  27.350  1.00 33.76 ? 752  GLU A CA    1 
ATOM   5813  C  C     . GLU A 1 752 ? -5.493  -7.777  27.201  1.00 33.80 ? 752  GLU A C     1 
ATOM   5814  O  O     . GLU A 1 752 ? -5.886  -7.284  26.138  1.00 35.30 ? 752  GLU A O     1 
ATOM   5815  C  CB    . GLU A 1 752 ? -6.658  -9.771  28.270  1.00 33.43 ? 752  GLU A CB    1 
ATOM   5816  C  CG    . GLU A 1 752 ? -6.837  -11.288 28.081  1.00 35.41 ? 752  GLU A CG    1 
ATOM   5817  C  CD    . GLU A 1 752 ? -7.379  -11.604 26.701  1.00 36.28 ? 752  GLU A CD    1 
ATOM   5818  O  OE1   . GLU A 1 752 ? -8.584  -11.328 26.487  1.00 38.18 ? 752  GLU A OE1   1 
ATOM   5819  O  OE2   . GLU A 1 752 ? -6.662  -12.142 25.835  1.00 38.42 ? 752  GLU A OE2   1 
ATOM   5820  N  N     . ILE A 1 753 ? -4.746  -7.054  28.036  1.00 32.27 ? 753  ILE A N     1 
ATOM   5821  C  CA    . ILE A 1 753 ? -4.600  -5.618  27.783  1.00 33.02 ? 753  ILE A CA    1 
ATOM   5822  C  C     . ILE A 1 753 ? -3.889  -5.393  26.445  1.00 35.06 ? 753  ILE A C     1 
ATOM   5823  O  O     . ILE A 1 753 ? -4.183  -4.478  25.671  1.00 34.98 ? 753  ILE A O     1 
ATOM   5824  C  CB    . ILE A 1 753 ? -3.802  -4.977  28.922  1.00 29.83 ? 753  ILE A CB    1 
ATOM   5825  C  CG1   . ILE A 1 753 ? -4.476  -5.168  30.288  1.00 27.17 ? 753  ILE A CG1   1 
ATOM   5826  C  CG2   . ILE A 1 753 ? -3.538  -3.506  28.703  1.00 28.86 ? 753  ILE A CG2   1 
ATOM   5827  C  CD1   . ILE A 1 753 ? -3.492  -4.727  31.400  1.00 18.78 ? 753  ILE A CD1   1 
ATOM   5828  N  N     . VAL A 1 754 ? -2.769  -6.113  26.233  1.00 36.41 ? 754  VAL A N     1 
ATOM   5829  C  CA    . VAL A 1 754 ? -1.926  -5.975  25.052  1.00 35.41 ? 754  VAL A CA    1 
ATOM   5830  C  C     . VAL A 1 754 ? -2.757  -6.323  23.817  1.00 35.50 ? 754  VAL A C     1 
ATOM   5831  O  O     . VAL A 1 754 ? -2.645  -5.685  22.794  1.00 35.08 ? 754  VAL A O     1 
ATOM   5832  C  CB    . VAL A 1 754 ? -0.706  -6.920  25.100  1.00 36.38 ? 754  VAL A CB    1 
ATOM   5833  C  CG1   . VAL A 1 754 ? -0.079  -7.096  23.726  1.00 31.58 ? 754  VAL A CG1   1 
ATOM   5834  C  CG2   . VAL A 1 754 ? 0.382   -6.496  26.096  1.00 33.39 ? 754  VAL A CG2   1 
ATOM   5835  N  N     . ARG A 1 755 ? -3.517  -7.416  23.915  1.00 35.94 ? 755  ARG A N     1 
ATOM   5836  C  CA    . ARG A 1 755 ? -4.349  -7.855  22.803  1.00 35.82 ? 755  ARG A CA    1 
ATOM   5837  C  C     . ARG A 1 755 ? -5.283  -6.717  22.411  1.00 35.62 ? 755  ARG A C     1 
ATOM   5838  O  O     . ARG A 1 755 ? -5.390  -6.414  21.226  1.00 35.80 ? 755  ARG A O     1 
ATOM   5839  C  CB    . ARG A 1 755 ? -5.105  -9.155  23.117  1.00 33.36 ? 755  ARG A CB    1 
ATOM   5840  C  CG    . ARG A 1 755 ? -5.344  -10.053 21.921  1.00 30.60 ? 755  ARG A CG    1 
ATOM   5841  C  CD    . ARG A 1 755 ? -6.244  -11.243 22.155  1.00 27.14 ? 755  ARG A CD    1 
ATOM   5842  N  NE    . ARG A 1 755 ? -7.343  -11.005 23.080  1.00 33.53 ? 755  ARG A NE    1 
ATOM   5843  C  CZ    . ARG A 1 755 ? -8.600  -10.797 22.663  1.00 38.05 ? 755  ARG A CZ    1 
ATOM   5844  N  NH1   . ARG A 1 755 ? -8.886  -10.796 21.358  1.00 37.27 ? 755  ARG A NH1   1 
ATOM   5845  N  NH2   . ARG A 1 755 ? -9.583  -10.544 23.505  1.00 31.01 ? 755  ARG A NH2   1 
ATOM   5846  N  N     . ASN A 1 756 ? -5.869  -6.044  23.394  1.00 35.95 ? 756  ASN A N     1 
ATOM   5847  C  CA    . ASN A 1 756 ? -6.787  -4.954  23.124  1.00 37.04 ? 756  ASN A CA    1 
ATOM   5848  C  C     . ASN A 1 756 ? -6.067  -3.766  22.536  1.00 36.82 ? 756  ASN A C     1 
ATOM   5849  O  O     . ASN A 1 756 ? -6.535  -3.215  21.546  1.00 37.65 ? 756  ASN A O     1 
ATOM   5850  C  CB    . ASN A 1 756 ? -7.719  -4.586  24.288  1.00 34.53 ? 756  ASN A CB    1 
ATOM   5851  C  CG    . ASN A 1 756 ? -8.879  -5.568  24.311  1.00 33.79 ? 756  ASN A CG    1 
ATOM   5852  O  OD1   . ASN A 1 756 ? -9.917  -5.420  23.696  1.00 37.05 ? 756  ASN A OD1   1 
ATOM   5853  N  ND2   . ASN A 1 756 ? -8.786  -6.674  25.029  1.00 38.58 ? 756  ASN A ND2   1 
ATOM   5854  N  N     . ILE A 1 757 ? -4.867  -3.451  23.029  1.00 36.24 ? 757  ILE A N     1 
ATOM   5855  C  CA    . ILE A 1 757 ? -4.054  -2.433  22.407  1.00 34.64 ? 757  ILE A CA    1 
ATOM   5856  C  C     . ILE A 1 757 ? -3.815  -2.746  20.940  1.00 35.83 ? 757  ILE A C     1 
ATOM   5857  O  O     . ILE A 1 757 ? -3.888  -1.844  20.091  1.00 37.35 ? 757  ILE A O     1 
ATOM   5858  C  CB    . ILE A 1 757 ? -2.756  -2.155  23.159  1.00 29.33 ? 757  ILE A CB    1 
ATOM   5859  C  CG1   . ILE A 1 757 ? -3.164  -1.654  24.563  1.00 28.68 ? 757  ILE A CG1   1 
ATOM   5860  C  CG2   . ILE A 1 757 ? -1.957  -1.021  22.520  1.00 28.05 ? 757  ILE A CG2   1 
ATOM   5861  C  CD1   . ILE A 1 757 ? -1.940  -1.412  25.415  1.00 26.79 ? 757  ILE A CD1   1 
ATOM   5862  N  N     . LEU A 1 758 ? -3.456  -3.974  20.621  1.00 35.26 ? 758  LEU A N     1 
ATOM   5863  C  CA    . LEU A 1 758 ? -3.165  -4.361  19.256  1.00 36.51 ? 758  LEU A CA    1 
ATOM   5864  C  C     . LEU A 1 758 ? -4.389  -4.328  18.331  1.00 37.20 ? 758  LEU A C     1 
ATOM   5865  O  O     . LEU A 1 758 ? -4.254  -3.844  17.194  1.00 37.43 ? 758  LEU A O     1 
ATOM   5866  C  CB    . LEU A 1 758 ? -2.466  -5.722  19.240  1.00 33.05 ? 758  LEU A CB    1 
ATOM   5867  C  CG    . LEU A 1 758 ? -1.173  -5.911  20.010  1.00 28.75 ? 758  LEU A CG    1 
ATOM   5868  C  CD1   . LEU A 1 758 ? -0.668  -7.322  19.788  1.00 25.80 ? 758  LEU A CD1   1 
ATOM   5869  C  CD2   . LEU A 1 758 ? -0.124  -4.856  19.719  1.00 26.21 ? 758  LEU A CD2   1 
ATOM   5870  N  N     . ILE A 1 759 ? -5.547  -4.770  18.792  1.00 37.79 ? 759  ILE A N     1 
ATOM   5871  C  CA    . ILE A 1 759 ? -6.799  -4.677  18.067  1.00 38.34 ? 759  ILE A CA    1 
ATOM   5872  C  C     . ILE A 1 759 ? -7.002  -3.234  17.594  1.00 39.09 ? 759  ILE A C     1 
ATOM   5873  O  O     . ILE A 1 759 ? -7.053  -2.975  16.389  1.00 39.73 ? 759  ILE A O     1 
ATOM   5874  C  CB    . ILE A 1 759 ? -8.060  -5.025  18.875  1.00 41.22 ? 759  ILE A CB    1 
ATOM   5875  C  CG1   . ILE A 1 759 ? -8.189  -6.553  18.993  1.00 41.06 ? 759  ILE A CG1   1 
ATOM   5876  C  CG2   . ILE A 1 759 ? -9.314  -4.544  18.165  1.00 41.25 ? 759  ILE A CG2   1 
ATOM   5877  C  CD1   . ILE A 1 759 ? -7.268  -7.078  17.882  1.00 49.45 ? 759  ILE A CD1   1 
ATOM   5878  N  N     . ASP A 1 760 ? -6.957  -2.300  18.535  1.00 37.99 ? 760  ASP A N     1 
ATOM   5879  C  CA    . ASP A 1 760 ? -7.012  -0.896  18.186  1.00 36.83 ? 760  ASP A CA    1 
ATOM   5880  C  C     . ASP A 1 760 ? -6.038  -0.439  17.115  1.00 37.69 ? 760  ASP A C     1 
ATOM   5881  O  O     . ASP A 1 760 ? -6.357  0.390   16.227  1.00 38.59 ? 760  ASP A O     1 
ATOM   5882  C  CB    . ASP A 1 760 ? -6.691  -0.030  19.410  1.00 39.05 ? 760  ASP A CB    1 
ATOM   5883  C  CG    . ASP A 1 760 ? -7.571  1.204   19.373  1.00 39.44 ? 760  ASP A CG    1 
ATOM   5884  O  OD1   . ASP A 1 760 ? -8.744  1.034   18.979  1.00 51.55 ? 760  ASP A OD1   1 
ATOM   5885  O  OD2   . ASP A 1 760 ? -7.116  2.300   19.706  1.00 44.56 ? 760  ASP A OD2   1 
ATOM   5886  N  N     . PHE A 1 761 ? -4.748  -0.657  17.405  1.00 37.51 ? 761  PHE A N     1 
ATOM   5887  C  CA    . PHE A 1 761 ? -3.712  -0.188  16.480  1.00 36.78 ? 761  PHE A CA    1 
ATOM   5888  C  C     . PHE A 1 761 ? -3.931  -0.838  15.105  1.00 37.81 ? 761  PHE A C     1 
ATOM   5889  O  O     . PHE A 1 761 ? -3.693  -0.152  14.089  1.00 37.45 ? 761  PHE A O     1 
ATOM   5890  C  CB    . PHE A 1 761 ? -2.342  -0.495  17.019  1.00 33.26 ? 761  PHE A CB    1 
ATOM   5891  C  CG    . PHE A 1 761 ? -1.826  0.376   18.115  1.00 37.42 ? 761  PHE A CG    1 
ATOM   5892  C  CD1   . PHE A 1 761 ? -2.419  1.600   18.415  1.00 35.78 ? 761  PHE A CD1   1 
ATOM   5893  C  CD2   . PHE A 1 761 ? -0.699  -0.031  18.827  1.00 34.73 ? 761  PHE A CD2   1 
ATOM   5894  C  CE1   . PHE A 1 761 ? -1.895  2.425   19.392  1.00 33.97 ? 761  PHE A CE1   1 
ATOM   5895  C  CE2   . PHE A 1 761 ? -0.180  0.796   19.807  1.00 30.11 ? 761  PHE A CE2   1 
ATOM   5896  C  CZ    . PHE A 1 761 ? -0.782  2.005   20.095  1.00 35.88 ? 761  PHE A CZ    1 
ATOM   5897  N  N     . THR A 1 762 ? -4.463  -2.079  15.100  1.00 38.91 ? 762  THR A N     1 
ATOM   5898  C  CA    . THR A 1 762 ? -4.759  -2.678  13.811  1.00 41.19 ? 762  THR A CA    1 
ATOM   5899  C  C     . THR A 1 762 ? -5.949  -2.078  13.079  1.00 42.08 ? 762  THR A C     1 
ATOM   5900  O  O     . THR A 1 762 ? -5.786  -1.868  11.877  1.00 40.79 ? 762  THR A O     1 
ATOM   5901  C  CB    . THR A 1 762 ? -4.515  -4.143  13.578  1.00 42.14 ? 762  THR A CB    1 
ATOM   5902  O  OG1   . THR A 1 762 ? -5.483  -4.830  12.777  1.00 44.65 ? 762  THR A OG1   1 
ATOM   5903  C  CG2   . THR A 1 762 ? -4.220  -4.902  14.835  1.00 44.95 ? 762  THR A CG2   1 
ATOM   5904  N  N     . LYS A 1 763 ? -6.982  -1.602  13.751  1.00 43.26 ? 763  LYS A N     1 
ATOM   5905  C  CA    . LYS A 1 763 ? -8.119  -0.924  13.174  1.00 44.93 ? 763  LYS A CA    1 
ATOM   5906  C  C     . LYS A 1 763 ? -7.615  0.431   12.604  1.00 45.11 ? 763  LYS A C     1 
ATOM   5907  O  O     . LYS A 1 763 ? -8.174  0.961   11.656  1.00 44.84 ? 763  LYS A O     1 
ATOM   5908  C  CB    . LYS A 1 763 ? -9.159  -0.481  14.184  1.00 50.12 ? 763  LYS A CB    1 
ATOM   5909  C  CG    . LYS A 1 763 ? -10.322 -1.278  14.689  1.00 57.87 ? 763  LYS A CG    1 
ATOM   5910  C  CD    . LYS A 1 763 ? -11.091 -0.427  15.717  1.00 62.74 ? 763  LYS A CD    1 
ATOM   5911  C  CE    . LYS A 1 763 ? -12.253 -1.154  16.361  1.00 68.28 ? 763  LYS A CE    1 
ATOM   5912  N  NZ    . LYS A 1 763 ? -12.104 -1.374  17.838  1.00 67.48 ? 763  LYS A NZ    1 
ATOM   5913  N  N     . LYS A 1 764 ? -6.731  1.060   13.379  1.00 44.80 ? 764  LYS A N     1 
ATOM   5914  C  CA    . LYS A 1 764 ? -6.199  2.363   12.973  1.00 43.50 ? 764  LYS A CA    1 
ATOM   5915  C  C     . LYS A 1 764 ? -5.223  2.217   11.814  1.00 42.00 ? 764  LYS A C     1 
ATOM   5916  O  O     . LYS A 1 764 ? -4.655  3.216   11.400  1.00 41.25 ? 764  LYS A O     1 
ATOM   5917  C  CB    . LYS A 1 764 ? -5.509  3.101   14.115  1.00 43.76 ? 764  LYS A CB    1 
ATOM   5918  C  CG    . LYS A 1 764 ? -6.479  3.454   15.227  1.00 49.51 ? 764  LYS A CG    1 
ATOM   5919  C  CD    . LYS A 1 764 ? -5.843  4.275   16.333  1.00 47.41 ? 764  LYS A CD    1 
ATOM   5920  C  CE    . LYS A 1 764 ? -6.935  4.974   17.146  1.00 46.08 ? 764  LYS A CE    1 
ATOM   5921  N  NZ    . LYS A 1 764 ? -6.791  4.669   18.597  1.00 49.49 ? 764  LYS A NZ    1 
ATOM   5922  N  N     . GLY A 1 765 ? -5.004  0.996   11.357  1.00 42.06 ? 765  GLY A N     1 
ATOM   5923  C  CA    . GLY A 1 765 ? -4.011  0.759   10.323  1.00 43.02 ? 765  GLY A CA    1 
ATOM   5924  C  C     . GLY A 1 765 ? -2.553  0.778   10.713  1.00 42.77 ? 765  GLY A C     1 
ATOM   5925  O  O     . GLY A 1 765 ? -1.743  0.763   9.778   1.00 43.05 ? 765  GLY A O     1 
ATOM   5926  N  N     . PHE A 1 766 ? -2.112  0.725   11.966  1.00 43.01 ? 766  PHE A N     1 
ATOM   5927  C  CA    . PHE A 1 766 ? -0.688  0.877   12.252  1.00 42.90 ? 766  PHE A CA    1 
ATOM   5928  C  C     . PHE A 1 766 ? 0.092   -0.425  12.263  1.00 43.69 ? 766  PHE A C     1 
ATOM   5929  O  O     . PHE A 1 766 ? 1.309   -0.419  12.485  1.00 45.06 ? 766  PHE A O     1 
ATOM   5930  C  CB    . PHE A 1 766 ? -0.460  1.514   13.616  1.00 41.35 ? 766  PHE A CB    1 
ATOM   5931  C  CG    . PHE A 1 766 ? -1.206  2.771   13.940  1.00 41.24 ? 766  PHE A CG    1 
ATOM   5932  C  CD1   . PHE A 1 766 ? -1.285  3.817   13.055  1.00 42.84 ? 766  PHE A CD1   1 
ATOM   5933  C  CD2   . PHE A 1 766 ? -1.775  2.949   15.196  1.00 42.10 ? 766  PHE A CD2   1 
ATOM   5934  C  CE1   . PHE A 1 766 ? -1.947  4.998   13.359  1.00 40.91 ? 766  PHE A CE1   1 
ATOM   5935  C  CE2   . PHE A 1 766 ? -2.429  4.117   15.525  1.00 46.86 ? 766  PHE A CE2   1 
ATOM   5936  C  CZ    . PHE A 1 766 ? -2.524  5.148   14.603  1.00 45.20 ? 766  PHE A CZ    1 
ATOM   5937  N  N     . LEU A 1 767 ? -0.536  -1.548  11.993  1.00 43.40 ? 767  LEU A N     1 
ATOM   5938  C  CA    . LEU A 1 767 ? -0.015  -2.865  12.397  1.00 42.96 ? 767  LEU A CA    1 
ATOM   5939  C  C     . LEU A 1 767 ? -0.851  -3.956  11.752  1.00 42.95 ? 767  LEU A C     1 
ATOM   5940  O  O     . LEU A 1 767 ? -2.025  -3.705  11.445  1.00 42.89 ? 767  LEU A O     1 
ATOM   5941  C  CB    . LEU A 1 767 ? -0.239  -2.715  13.905  1.00 41.47 ? 767  LEU A CB    1 
ATOM   5942  C  CG    . LEU A 1 767 ? 0.075   -3.657  15.012  1.00 45.57 ? 767  LEU A CG    1 
ATOM   5943  C  CD1   . LEU A 1 767 ? -0.969  -4.750  15.054  1.00 46.55 ? 767  LEU A CD1   1 
ATOM   5944  C  CD2   . LEU A 1 767 ? 1.502   -4.214  14.982  1.00 43.89 ? 767  LEU A CD2   1 
ATOM   5945  N  N     . PHE A 1 768 ? -0.295  -5.103  11.382  1.00 42.37 ? 768  PHE A N     1 
ATOM   5946  C  CA    . PHE A 1 768 ? -1.006  -6.181  10.741  1.00 43.46 ? 768  PHE A CA    1 
ATOM   5947  C  C     . PHE A 1 768 ? -1.745  -5.803  9.472   1.00 45.49 ? 768  PHE A C     1 
ATOM   5948  O  O     . PHE A 1 768 ? -2.909  -6.120  9.174   1.00 45.02 ? 768  PHE A O     1 
ATOM   5949  C  CB    . PHE A 1 768 ? -1.862  -6.955  11.748  1.00 40.60 ? 768  PHE A CB    1 
ATOM   5950  C  CG    . PHE A 1 768 ? -1.158  -7.449  12.979  1.00 40.47 ? 768  PHE A CG    1 
ATOM   5951  C  CD1   . PHE A 1 768 ? 0.163   -7.884  12.931  1.00 38.27 ? 768  PHE A CD1   1 
ATOM   5952  C  CD2   . PHE A 1 768 ? -1.794  -7.468  14.208  1.00 36.62 ? 768  PHE A CD2   1 
ATOM   5953  C  CE1   . PHE A 1 768 ? 0.816   -8.363  14.056  1.00 36.00 ? 768  PHE A CE1   1 
ATOM   5954  C  CE2   . PHE A 1 768 ? -1.147  -7.920  15.339  1.00 41.32 ? 768  PHE A CE2   1 
ATOM   5955  C  CZ    . PHE A 1 768 ? 0.161   -8.412  15.269  1.00 37.66 ? 768  PHE A CZ    1 
ATOM   5956  N  N     . ARG A 1 769 ? -1.094  -5.045  8.587   1.00 47.94 ? 769  ARG A N     1 
ATOM   5957  C  CA    . ARG A 1 769 ? -1.620  -4.658  7.281   1.00 49.61 ? 769  ARG A CA    1 
ATOM   5958  C  C     . ARG A 1 769 ? -3.073  -4.200  7.378   1.00 50.48 ? 769  ARG A C     1 
ATOM   5959  O  O     . ARG A 1 769 ? -3.749  -4.018  6.372   1.00 49.91 ? 769  ARG A O     1 
ATOM   5960  C  CB    . ARG A 1 769 ? -1.490  -5.804  6.270   1.00 53.92 ? 769  ARG A CB    1 
ATOM   5961  C  CG    . ARG A 1 769 ? -0.298  -5.662  5.336   1.00 57.23 ? 769  ARG A CG    1 
ATOM   5962  C  CD    . ARG A 1 769 ? 0.685   -6.809  5.436   1.00 63.69 ? 769  ARG A CD    1 
ATOM   5963  N  NE    . ARG A 1 769 ? 2.016   -6.526  4.847   1.00 62.90 ? 769  ARG A NE    1 
ATOM   5964  C  CZ    . ARG A 1 769 ? 2.814   -7.544  4.500   1.00 63.23 ? 769  ARG A CZ    1 
ATOM   5965  N  NH1   . ARG A 1 769 ? 2.399   -8.801  4.695   1.00 62.30 ? 769  ARG A NH1   1 
ATOM   5966  N  NH2   . ARG A 1 769 ? 3.984   -7.323  3.934   1.00 60.54 ? 769  ARG A NH2   1 
ATOM   5967  N  N     . GLY A 1 770 ? -3.564  -4.028  8.598   1.00 50.45 ? 770  GLY A N     1 
ATOM   5968  C  CA    . GLY A 1 770 ? -4.803  -3.427  8.948   1.00 49.49 ? 770  GLY A CA    1 
ATOM   5969  C  C     . GLY A 1 770 ? -5.952  -4.387  9.109   1.00 50.13 ? 770  GLY A C     1 
ATOM   5970  O  O     . GLY A 1 770 ? -7.063  -3.972  9.406   1.00 50.65 ? 770  GLY A O     1 
ATOM   5971  N  N     . GLN A 1 771 ? -5.713  -5.659  8.937   1.00 51.10 ? 771  GLN A N     1 
ATOM   5972  C  CA    . GLN A 1 771 ? -6.686  -6.717  9.080   1.00 51.94 ? 771  GLN A CA    1 
ATOM   5973  C  C     . GLN A 1 771 ? -6.686  -7.289  10.495  1.00 52.91 ? 771  GLN A C     1 
ATOM   5974  O  O     . GLN A 1 771 ? -5.625  -7.634  11.013  1.00 52.98 ? 771  GLN A O     1 
ATOM   5975  C  CB    . GLN A 1 771 ? -6.234  -7.853  8.133   1.00 60.27 ? 771  GLN A CB    1 
ATOM   5976  C  CG    . GLN A 1 771 ? -5.662  -7.279  6.830   1.00 62.72 ? 771  GLN A CG    1 
ATOM   5977  C  CD    . GLN A 1 771 ? -6.731  -6.492  6.089   1.00 65.27 ? 771  GLN A CD    1 
ATOM   5978  O  OE1   . GLN A 1 771 ? -7.632  -7.092  5.478   1.00 65.62 ? 771  GLN A OE1   1 
ATOM   5979  N  NE2   . GLN A 1 771 ? -6.613  -5.167  6.204   1.00 64.03 ? 771  GLN A NE2   1 
ATOM   5980  N  N     . ILE A 1 772 ? -7.853  -7.396  11.115  1.00 52.09 ? 772  ILE A N     1 
ATOM   5981  C  CA    . ILE A 1 772 ? -7.988  -7.964  12.436  1.00 51.69 ? 772  ILE A CA    1 
ATOM   5982  C  C     . ILE A 1 772 ? -8.392  -9.414  12.208  1.00 52.61 ? 772  ILE A C     1 
ATOM   5983  O  O     . ILE A 1 772 ? -9.462  -9.640  11.663  1.00 54.33 ? 772  ILE A O     1 
ATOM   5984  C  CB    . ILE A 1 772 ? -9.061  -7.316  13.305  1.00 48.87 ? 772  ILE A CB    1 
ATOM   5985  C  CG1   . ILE A 1 772 ? -8.782  -5.814  13.415  1.00 49.72 ? 772  ILE A CG1   1 
ATOM   5986  C  CG2   . ILE A 1 772 ? -9.059  -7.958  14.685  1.00 51.96 ? 772  ILE A CG2   1 
ATOM   5987  C  CD1   . ILE A 1 772 ? -9.794  -5.095  14.266  1.00 51.39 ? 772  ILE A CD1   1 
ATOM   5988  N  N     . SER A 1 773 ? -7.486  -10.303 12.531  1.00 52.56 ? 773  SER A N     1 
ATOM   5989  C  CA    . SER A 1 773 ? -7.634  -11.704 12.166  1.00 52.65 ? 773  SER A CA    1 
ATOM   5990  C  C     . SER A 1 773 ? -8.261  -12.515 13.275  1.00 52.11 ? 773  SER A C     1 
ATOM   5991  O  O     . SER A 1 773 ? -8.638  -11.978 14.316  1.00 52.67 ? 773  SER A O     1 
ATOM   5992  C  CB    . SER A 1 773 ? -6.253  -12.209 11.740  1.00 49.97 ? 773  SER A CB    1 
ATOM   5993  O  OG    . SER A 1 773 ? -5.579  -12.787 12.829  1.00 56.40 ? 773  SER A OG    1 
ATOM   5994  N  N     . GLU A 1 774 ? -8.510  -13.783 13.009  1.00 52.05 ? 774  GLU A N     1 
ATOM   5995  C  CA    . GLU A 1 774 ? -9.203  -14.616 13.986  1.00 52.58 ? 774  GLU A CA    1 
ATOM   5996  C  C     . GLU A 1 774 ? -8.284  -14.931 15.151  1.00 52.21 ? 774  GLU A C     1 
ATOM   5997  O  O     . GLU A 1 774 ? -8.747  -15.086 16.292  1.00 54.00 ? 774  GLU A O     1 
ATOM   5998  C  CB    . GLU A 1 774 ? -9.872  -15.826 13.341  1.00 54.33 ? 774  GLU A CB    1 
ATOM   5999  C  CG    . GLU A 1 774 ? -11.034 -15.445 12.440  1.00 60.53 ? 774  GLU A CG    1 
ATOM   6000  C  CD    . GLU A 1 774 ? -12.291 -14.887 13.053  1.00 63.17 ? 774  GLU A CD    1 
ATOM   6001  O  OE1   . GLU A 1 774 ? -12.927 -15.559 13.896  1.00 66.03 ? 774  GLU A OE1   1 
ATOM   6002  O  OE2   . GLU A 1 774 ? -12.753 -13.770 12.686  1.00 63.19 ? 774  GLU A OE2   1 
ATOM   6003  N  N     . THR A 1 775 ? -6.981  -14.847 14.948  1.00 49.77 ? 775  THR A N     1 
ATOM   6004  C  CA    . THR A 1 775 ? -6.009  -15.072 15.997  1.00 47.33 ? 775  THR A CA    1 
ATOM   6005  C  C     . THR A 1 775 ? -5.965  -13.906 16.975  1.00 44.80 ? 775  THR A C     1 
ATOM   6006  O  O     . THR A 1 775 ? -6.204  -14.085 18.166  1.00 42.58 ? 775  THR A O     1 
ATOM   6007  C  CB    . THR A 1 775 ? -4.622  -15.398 15.420  1.00 46.93 ? 775  THR A CB    1 
ATOM   6008  O  OG1   . THR A 1 775 ? -4.732  -16.704 14.828  1.00 49.28 ? 775  THR A OG1   1 
ATOM   6009  C  CG2   . THR A 1 775 ? -3.594  -15.463 16.550  1.00 48.56 ? 775  THR A CG2   1 
ATOM   6010  N  N     . LEU A 1 776 ? -5.759  -12.698 16.454  1.00 43.91 ? 776  LEU A N     1 
ATOM   6011  C  CA    . LEU A 1 776 ? -5.796  -11.517 17.314  1.00 43.64 ? 776  LEU A CA    1 
ATOM   6012  C  C     . LEU A 1 776 ? -7.106  -11.378 18.069  1.00 43.98 ? 776  LEU A C     1 
ATOM   6013  O  O     . LEU A 1 776 ? -7.068  -10.936 19.233  1.00 44.59 ? 776  LEU A O     1 
ATOM   6014  C  CB    . LEU A 1 776 ? -5.375  -10.298 16.514  1.00 38.21 ? 776  LEU A CB    1 
ATOM   6015  C  CG    . LEU A 1 776 ? -5.126  -9.005  17.290  1.00 40.28 ? 776  LEU A CG    1 
ATOM   6016  C  CD1   . LEU A 1 776 ? -3.943  -9.228  18.246  1.00 36.86 ? 776  LEU A CD1   1 
ATOM   6017  C  CD2   . LEU A 1 776 ? -4.942  -7.820  16.354  1.00 33.22 ? 776  LEU A CD2   1 
ATOM   6018  N  N     . LYS A 1 777 ? -8.241  -11.898 17.584  1.00 43.90 ? 777  LYS A N     1 
ATOM   6019  C  CA    . LYS A 1 777 ? -9.481  -11.867 18.336  1.00 43.98 ? 777  LYS A CA    1 
ATOM   6020  C  C     . LYS A 1 777 ? -9.783  -13.035 19.244  1.00 43.84 ? 777  LYS A C     1 
ATOM   6021  O  O     . LYS A 1 777 ? -10.884 -13.191 19.758  1.00 43.39 ? 777  LYS A O     1 
ATOM   6022  C  CB    . LYS A 1 777 ? -10.703 -11.435 17.560  1.00 46.21 ? 777  LYS A CB    1 
ATOM   6023  C  CG    . LYS A 1 777 ? -10.886 -11.819 16.122  1.00 54.45 ? 777  LYS A CG    1 
ATOM   6024  C  CD    . LYS A 1 777 ? -11.723 -10.835 15.314  1.00 58.47 ? 777  LYS A CD    1 
ATOM   6025  C  CE    . LYS A 1 777 ? -12.928 -11.510 14.675  1.00 64.38 ? 777  LYS A CE    1 
ATOM   6026  N  NZ    . LYS A 1 777 ? -13.515 -10.754 13.532  1.00 64.30 ? 777  LYS A NZ    1 
ATOM   6027  N  N     . THR A 1 778 ? -8.803  -13.851 19.598  1.00 44.45 ? 778  THR A N     1 
ATOM   6028  C  CA    . THR A 1 778 ? -8.882  -14.944 20.526  1.00 43.19 ? 778  THR A CA    1 
ATOM   6029  C  C     . THR A 1 778 ? -8.308  -14.596 21.901  1.00 41.63 ? 778  THR A C     1 
ATOM   6030  O  O     . THR A 1 778 ? -7.114  -14.350 22.107  1.00 40.33 ? 778  THR A O     1 
ATOM   6031  C  CB    . THR A 1 778 ? -8.107  -16.187 20.027  1.00 47.59 ? 778  THR A CB    1 
ATOM   6032  O  OG1   . THR A 1 778 ? -8.371  -16.499 18.664  1.00 50.29 ? 778  THR A OG1   1 
ATOM   6033  C  CG2   . THR A 1 778 ? -8.481  -17.392 20.872  1.00 46.78 ? 778  THR A CG2   1 
ATOM   6034  N  N     . ARG A 1 779 ? -9.170  -14.686 22.905  1.00 41.68 ? 779  ARG A N     1 
ATOM   6035  C  CA    . ARG A 1 779 ? -8.766  -14.464 24.276  1.00 42.54 ? 779  ARG A CA    1 
ATOM   6036  C  C     . ARG A 1 779 ? -7.622  -15.405 24.670  1.00 42.53 ? 779  ARG A C     1 
ATOM   6037  O  O     . ARG A 1 779 ? -7.771  -16.618 24.529  1.00 42.62 ? 779  ARG A O     1 
ATOM   6038  C  CB    . ARG A 1 779 ? -9.871  -14.655 25.287  1.00 44.53 ? 779  ARG A CB    1 
ATOM   6039  C  CG    . ARG A 1 779 ? -11.219 -14.013 25.139  1.00 50.74 ? 779  ARG A CG    1 
ATOM   6040  C  CD    . ARG A 1 779 ? -12.198 -14.656 26.137  1.00 54.41 ? 779  ARG A CD    1 
ATOM   6041  N  NE    . ARG A 1 779 ? -11.845 -14.186 27.498  1.00 60.97 ? 779  ARG A NE    1 
ATOM   6042  C  CZ    . ARG A 1 779 ? -12.482 -13.126 28.010  1.00 58.75 ? 779  ARG A CZ    1 
ATOM   6043  N  NH1   . ARG A 1 779 ? -13.458 -12.564 27.305  1.00 61.45 ? 779  ARG A NH1   1 
ATOM   6044  N  NH2   . ARG A 1 779 ? -12.149 -12.704 29.200  1.00 56.66 ? 779  ARG A NH2   1 
ATOM   6045  N  N     . GLY A 1 780 ? -6.610  -14.898 25.366  1.00 42.04 ? 780  GLY A N     1 
ATOM   6046  C  CA    . GLY A 1 780 ? -5.647  -15.846 25.957  1.00 41.69 ? 780  GLY A CA    1 
ATOM   6047  C  C     . GLY A 1 780 ? -4.412  -16.026 25.116  1.00 42.29 ? 780  GLY A C     1 
ATOM   6048  O  O     . GLY A 1 780 ? -3.373  -16.492 25.601  1.00 43.53 ? 780  GLY A O     1 
ATOM   6049  N  N     . ILE A 1 781 ? -4.439  -15.571 23.871  1.00 42.35 ? 781  ILE A N     1 
ATOM   6050  C  CA    . ILE A 1 781 ? -3.282  -15.711 22.970  1.00 40.69 ? 781  ILE A CA    1 
ATOM   6051  C  C     . ILE A 1 781 ? -1.986  -15.336 23.613  1.00 40.61 ? 781  ILE A C     1 
ATOM   6052  O  O     . ILE A 1 781 ? -0.972  -16.022 23.507  1.00 42.12 ? 781  ILE A O     1 
ATOM   6053  C  CB    . ILE A 1 781 ? -3.670  -15.005 21.695  1.00 41.71 ? 781  ILE A CB    1 
ATOM   6054  C  CG1   . ILE A 1 781 ? -3.879  -16.066 20.615  1.00 46.91 ? 781  ILE A CG1   1 
ATOM   6055  C  CG2   . ILE A 1 781 ? -2.905  -13.817 21.192  1.00 42.63 ? 781  ILE A CG2   1 
ATOM   6056  C  CD1   . ILE A 1 781 ? -5.201  -16.784 20.766  1.00 43.54 ? 781  ILE A CD1   1 
ATOM   6057  N  N     . PHE A 1 782 ? -1.899  -14.247 24.340  1.00 40.81 ? 782  PHE A N     1 
ATOM   6058  C  CA    . PHE A 1 782 ? -0.702  -13.746 24.998  1.00 39.58 ? 782  PHE A CA    1 
ATOM   6059  C  C     . PHE A 1 782 ? -0.569  -14.114 26.480  1.00 38.22 ? 782  PHE A C     1 
ATOM   6060  O  O     . PHE A 1 782 ? -0.516  -13.333 27.429  1.00 37.66 ? 782  PHE A O     1 
ATOM   6061  C  CB    . PHE A 1 782 ? -0.646  -12.232 24.807  1.00 38.36 ? 782  PHE A CB    1 
ATOM   6062  C  CG    . PHE A 1 782 ? -0.485  -11.739 23.413  1.00 37.31 ? 782  PHE A CG    1 
ATOM   6063  C  CD1   . PHE A 1 782 ? 0.732   -11.840 22.760  1.00 42.32 ? 782  PHE A CD1   1 
ATOM   6064  C  CD2   . PHE A 1 782 ? -1.476  -11.017 22.786  1.00 41.85 ? 782  PHE A CD2   1 
ATOM   6065  C  CE1   . PHE A 1 782 ? 0.950   -11.294 21.513  1.00 40.46 ? 782  PHE A CE1   1 
ATOM   6066  C  CE2   . PHE A 1 782 ? -1.329  -10.514 21.510  1.00 35.37 ? 782  PHE A CE2   1 
ATOM   6067  C  CZ    . PHE A 1 782 ? -0.126  -10.688 20.883  1.00 44.89 ? 782  PHE A CZ    1 
ATOM   6068  N  N     . GLU A 1 783 ? -0.241  -15.363 26.676  1.00 37.71 ? 783  GLU A N     1 
ATOM   6069  C  CA    . GLU A 1 783 ? 0.097   -16.081 27.890  1.00 37.17 ? 783  GLU A CA    1 
ATOM   6070  C  C     . GLU A 1 783 ? 1.377   -15.521 28.521  1.00 35.52 ? 783  GLU A C     1 
ATOM   6071  O  O     . GLU A 1 783 ? 2.261   -15.050 27.807  1.00 33.67 ? 783  GLU A O     1 
ATOM   6072  C  CB    . GLU A 1 783 ? 0.477   -17.495 27.412  1.00 41.25 ? 783  GLU A CB    1 
ATOM   6073  C  CG    . GLU A 1 783 ? -0.466  -18.642 27.583  1.00 52.52 ? 783  GLU A CG    1 
ATOM   6074  C  CD    . GLU A 1 783 ? 0.102   -19.972 27.073  1.00 58.09 ? 783  GLU A CD    1 
ATOM   6075  O  OE1   . GLU A 1 783 ? 1.238   -20.411 27.380  1.00 55.92 ? 783  GLU A OE1   1 
ATOM   6076  O  OE2   . GLU A 1 783 ? -0.635  -20.614 26.273  1.00 61.14 ? 783  GLU A OE2   1 
ATOM   6077  N  N     . THR A 1 784 ? 1.560   -15.765 29.807  1.00 35.19 ? 784  THR A N     1 
ATOM   6078  C  CA    . THR A 1 784 ? 2.747   -15.353 30.541  1.00 36.27 ? 784  THR A CA    1 
ATOM   6079  C  C     . THR A 1 784 ? 4.010   -15.931 29.924  1.00 37.58 ? 784  THR A C     1 
ATOM   6080  O  O     . THR A 1 784 ? 5.013   -15.207 29.809  1.00 38.04 ? 784  THR A O     1 
ATOM   6081  C  CB    . THR A 1 784 ? 2.614   -15.756 32.029  1.00 36.82 ? 784  THR A CB    1 
ATOM   6082  O  OG1   . THR A 1 784 ? 1.390   -15.126 32.518  1.00 36.37 ? 784  THR A OG1   1 
ATOM   6083  C  CG2   . THR A 1 784 ? 3.825   -15.353 32.837  1.00 31.49 ? 784  THR A CG2   1 
ATOM   6084  N  N     . LYS A 1 785 ? 3.900   -17.128 29.306  1.00 38.02 ? 785  LYS A N     1 
ATOM   6085  C  CA    . LYS A 1 785 ? 5.075   -17.638 28.642  1.00 37.93 ? 785  LYS A CA    1 
ATOM   6086  C  C     . LYS A 1 785 ? 5.449   -16.872 27.389  1.00 37.74 ? 785  LYS A C     1 
ATOM   6087  O  O     . LYS A 1 785 ? 6.660   -16.796 27.175  1.00 38.18 ? 785  LYS A O     1 
ATOM   6088  C  CB    . LYS A 1 785 ? 5.244   -19.108 28.475  1.00 40.67 ? 785  LYS A CB    1 
ATOM   6089  C  CG    . LYS A 1 785 ? 4.205   -20.064 28.007  1.00 47.68 ? 785  LYS A CG    1 
ATOM   6090  C  CD    . LYS A 1 785 ? 4.021   -21.276 28.928  1.00 54.18 ? 785  LYS A CD    1 
ATOM   6091  C  CE    . LYS A 1 785 ? 4.645   -21.137 30.308  1.00 57.22 ? 785  LYS A CE    1 
ATOM   6092  N  NZ    . LYS A 1 785 ? 3.684   -20.973 31.432  1.00 50.60 ? 785  LYS A NZ    1 
ATOM   6093  N  N     . PHE A 1 786 ? 4.584   -16.414 26.504  1.00 37.17 ? 786  PHE A N     1 
ATOM   6094  C  CA    . PHE A 1 786 ? 5.071   -15.667 25.352  1.00 37.26 ? 786  PHE A CA    1 
ATOM   6095  C  C     . PHE A 1 786 ? 5.428   -14.216 25.642  1.00 36.70 ? 786  PHE A C     1 
ATOM   6096  O  O     . PHE A 1 786 ? 6.226   -13.646 24.893  1.00 34.70 ? 786  PHE A O     1 
ATOM   6097  C  CB    . PHE A 1 786 ? 4.014   -15.775 24.238  1.00 42.49 ? 786  PHE A CB    1 
ATOM   6098  C  CG    . PHE A 1 786 ? 3.531   -17.202 24.170  1.00 48.41 ? 786  PHE A CG    1 
ATOM   6099  C  CD1   . PHE A 1 786 ? 4.414   -18.250 24.121  1.00 48.80 ? 786  PHE A CD1   1 
ATOM   6100  C  CD2   . PHE A 1 786 ? 2.173   -17.491 24.159  1.00 53.70 ? 786  PHE A CD2   1 
ATOM   6101  C  CE1   . PHE A 1 786 ? 3.979   -19.560 24.049  1.00 53.30 ? 786  PHE A CE1   1 
ATOM   6102  C  CE2   . PHE A 1 786 ? 1.726   -18.789 24.073  1.00 54.19 ? 786  PHE A CE2   1 
ATOM   6103  C  CZ    . PHE A 1 786 ? 2.628   -19.825 24.015  1.00 54.25 ? 786  PHE A CZ    1 
ATOM   6104  N  N     . LEU A 1 787 ? 4.762   -13.597 26.626  1.00 37.03 ? 787  LEU A N     1 
ATOM   6105  C  CA    . LEU A 1 787 ? 5.102   -12.221 26.979  1.00 39.14 ? 787  LEU A CA    1 
ATOM   6106  C  C     . LEU A 1 787 ? 6.513   -12.199 27.578  1.00 38.59 ? 787  LEU A C     1 
ATOM   6107  O  O     . LEU A 1 787 ? 7.311   -11.330 27.298  1.00 39.30 ? 787  LEU A O     1 
ATOM   6108  C  CB    . LEU A 1 787 ? 4.176   -11.534 27.987  1.00 41.15 ? 787  LEU A CB    1 
ATOM   6109  C  CG    . LEU A 1 787 ? 2.733   -11.315 27.625  1.00 39.23 ? 787  LEU A CG    1 
ATOM   6110  C  CD1   . LEU A 1 787 ? 1.897   -11.219 28.889  1.00 43.52 ? 787  LEU A CD1   1 
ATOM   6111  C  CD2   . LEU A 1 787 ? 2.520   -10.132 26.688  1.00 34.87 ? 787  LEU A CD2   1 
ATOM   6112  N  N     . SER A 1 788 ? 6.815   -13.246 28.322  1.00 39.87 ? 788  SER A N     1 
ATOM   6113  C  CA    . SER A 1 788 ? 8.167   -13.424 28.876  1.00 39.65 ? 788  SER A CA    1 
ATOM   6114  C  C     . SER A 1 788 ? 9.175   -13.610 27.770  1.00 38.98 ? 788  SER A C     1 
ATOM   6115  O  O     . SER A 1 788 ? 10.096  -12.819 27.698  1.00 38.54 ? 788  SER A O     1 
ATOM   6116  C  CB    . SER A 1 788 ? 8.075   -14.566 29.894  1.00 39.30 ? 788  SER A CB    1 
ATOM   6117  O  OG    . SER A 1 788 ? 7.546   -13.982 31.082  1.00 42.87 ? 788  SER A OG    1 
ATOM   6118  N  N     . GLN A 1 789 ? 8.960   -14.491 26.786  1.00 38.98 ? 789  GLN A N     1 
ATOM   6119  C  CA    . GLN A 1 789 ? 9.877   -14.631 25.661  1.00 39.10 ? 789  GLN A CA    1 
ATOM   6120  C  C     . GLN A 1 789 ? 9.978   -13.360 24.813  1.00 39.44 ? 789  GLN A C     1 
ATOM   6121  O  O     . GLN A 1 789 ? 11.040  -13.043 24.293  1.00 37.74 ? 789  GLN A O     1 
ATOM   6122  C  CB    . GLN A 1 789 ? 9.384   -15.773 24.765  1.00 41.26 ? 789  GLN A CB    1 
ATOM   6123  C  CG    . GLN A 1 789 ? 9.298   -17.139 25.430  1.00 46.18 ? 789  GLN A CG    1 
ATOM   6124  C  CD    . GLN A 1 789 ? 8.860   -18.213 24.454  1.00 52.15 ? 789  GLN A CD    1 
ATOM   6125  O  OE1   . GLN A 1 789 ? 8.486   -17.880 23.317  1.00 55.21 ? 789  GLN A OE1   1 
ATOM   6126  N  NE2   . GLN A 1 789 ? 8.877   -19.483 24.841  1.00 48.17 ? 789  GLN A NE2   1 
ATOM   6127  N  N     . ILE A 1 790 ? 8.826   -12.728 24.521  1.00 39.07 ? 790  ILE A N     1 
ATOM   6128  C  CA    . ILE A 1 790 ? 8.831   -11.624 23.598  1.00 40.95 ? 790  ILE A CA    1 
ATOM   6129  C  C     . ILE A 1 790 ? 9.718   -10.496 24.109  1.00 41.69 ? 790  ILE A C     1 
ATOM   6130  O  O     . ILE A 1 790 ? 10.481  -9.930  23.331  1.00 41.82 ? 790  ILE A O     1 
ATOM   6131  C  CB    . ILE A 1 790 ? 7.451   -11.048 23.258  1.00 44.51 ? 790  ILE A CB    1 
ATOM   6132  C  CG1   . ILE A 1 790 ? 6.730   -11.875 22.203  1.00 45.99 ? 790  ILE A CG1   1 
ATOM   6133  C  CG2   . ILE A 1 790 ? 7.594   -9.635  22.691  1.00 47.17 ? 790  ILE A CG2   1 
ATOM   6134  C  CD1   . ILE A 1 790 ? 5.224   -11.910 22.503  1.00 52.41 ? 790  ILE A CD1   1 
ATOM   6135  N  N     . GLU A 1 791 ? 9.616   -10.223 25.404  1.00 42.18 ? 791  GLU A N     1 
ATOM   6136  C  CA    . GLU A 1 791 ? 10.389  -9.168  26.019  1.00 42.70 ? 791  GLU A CA    1 
ATOM   6137  C  C     . GLU A 1 791 ? 11.782  -9.514  26.488  1.00 44.31 ? 791  GLU A C     1 
ATOM   6138  O  O     . GLU A 1 791 ? 12.339  -8.639  27.176  1.00 44.61 ? 791  GLU A O     1 
ATOM   6139  C  CB    . GLU A 1 791 ? 9.648   -8.636  27.270  1.00 42.99 ? 791  GLU A CB    1 
ATOM   6140  C  CG    . GLU A 1 791 ? 8.374   -7.887  26.911  1.00 45.49 ? 791  GLU A CG    1 
ATOM   6141  C  CD    . GLU A 1 791 ? 7.796   -7.186  28.116  1.00 47.38 ? 791  GLU A CD    1 
ATOM   6142  O  OE1   . GLU A 1 791 ? 8.478   -6.225  28.554  1.00 57.25 ? 791  GLU A OE1   1 
ATOM   6143  O  OE2   . GLU A 1 791 ? 6.757   -7.627  28.624  1.00 51.26 ? 791  GLU A OE2   1 
ATOM   6144  N  N     . SER A 1 792 ? 12.302  -10.712 26.298  1.00 45.73 ? 792  SER A N     1 
ATOM   6145  C  CA    . SER A 1 792 ? 13.644  -10.996 26.778  1.00 49.05 ? 792  SER A CA    1 
ATOM   6146  C  C     . SER A 1 792 ? 14.733  -10.186 26.063  1.00 50.76 ? 792  SER A C     1 
ATOM   6147  O  O     . SER A 1 792 ? 14.709  -9.952  24.856  1.00 48.99 ? 792  SER A O     1 
ATOM   6148  C  CB    . SER A 1 792 ? 13.964  -12.479 26.570  1.00 50.58 ? 792  SER A CB    1 
ATOM   6149  O  OG    . SER A 1 792 ? 14.647  -12.582 25.320  1.00 62.11 ? 792  SER A OG    1 
ATOM   6150  N  N     . ASP A 1 793 ? 15.765  -9.854  26.835  1.00 53.35 ? 793  ASP A N     1 
ATOM   6151  C  CA    . ASP A 1 793 ? 16.847  -9.036  26.327  1.00 56.29 ? 793  ASP A CA    1 
ATOM   6152  C  C     . ASP A 1 793 ? 17.809  -9.758  25.401  1.00 57.14 ? 793  ASP A C     1 
ATOM   6153  O  O     . ASP A 1 793 ? 18.605  -9.088  24.729  1.00 58.44 ? 793  ASP A O     1 
ATOM   6154  C  CB    . ASP A 1 793 ? 17.572  -8.286  27.432  1.00 64.43 ? 793  ASP A CB    1 
ATOM   6155  C  CG    . ASP A 1 793 ? 16.838  -7.716  28.619  1.00 69.47 ? 793  ASP A CG    1 
ATOM   6156  O  OD1   . ASP A 1 793 ? 15.865  -6.927  28.469  1.00 71.13 ? 793  ASP A OD1   1 
ATOM   6157  O  OD2   . ASP A 1 793 ? 17.261  -7.995  29.784  1.00 71.07 ? 793  ASP A OD2   1 
ATOM   6158  N  N     . ARG A 1 794 ? 17.804  -11.067 25.262  1.00 57.80 ? 794  ARG A N     1 
ATOM   6159  C  CA    . ARG A 1 794 ? 18.739  -11.732 24.357  1.00 58.77 ? 794  ARG A CA    1 
ATOM   6160  C  C     . ARG A 1 794 ? 18.092  -11.975 22.993  1.00 59.01 ? 794  ARG A C     1 
ATOM   6161  O  O     . ARG A 1 794 ? 18.629  -12.723 22.156  1.00 60.19 ? 794  ARG A O     1 
ATOM   6162  C  CB    . ARG A 1 794 ? 19.268  -13.041 24.952  1.00 63.87 ? 794  ARG A CB    1 
ATOM   6163  C  CG    . ARG A 1 794 ? 20.614  -12.949 25.672  1.00 67.32 ? 794  ARG A CG    1 
ATOM   6164  C  CD    . ARG A 1 794 ? 21.669  -13.953 25.280  1.00 67.98 ? 794  ARG A CD    1 
ATOM   6165  N  NE    . ARG A 1 794 ? 21.850  -15.141 26.109  1.00 69.50 ? 794  ARG A NE    1 
ATOM   6166  C  CZ    . ARG A 1 794 ? 22.533  -16.250 25.778  1.00 69.68 ? 794  ARG A CZ    1 
ATOM   6167  N  NH1   . ARG A 1 794 ? 23.148  -16.347 24.599  1.00 67.92 ? 794  ARG A NH1   1 
ATOM   6168  N  NH2   . ARG A 1 794 ? 22.637  -17.324 26.564  1.00 64.29 ? 794  ARG A NH2   1 
ATOM   6169  N  N     . LEU A 1 795 ? 16.981  -11.289 22.707  1.00 56.95 ? 795  LEU A N     1 
ATOM   6170  C  CA    . LEU A 1 795 ? 16.211  -11.553 21.515  1.00 54.00 ? 795  LEU A CA    1 
ATOM   6171  C  C     . LEU A 1 795 ? 16.511  -10.753 20.274  1.00 51.27 ? 795  LEU A C     1 
ATOM   6172  O  O     . LEU A 1 795 ? 16.242  -9.573  20.128  1.00 52.03 ? 795  LEU A O     1 
ATOM   6173  C  CB    . LEU A 1 795 ? 14.708  -11.595 21.788  1.00 53.43 ? 795  LEU A CB    1 
ATOM   6174  C  CG    . LEU A 1 795 ? 14.149  -12.928 22.244  1.00 56.58 ? 795  LEU A CG    1 
ATOM   6175  C  CD1   . LEU A 1 795 ? 13.781  -13.822 21.074  1.00 57.42 ? 795  LEU A CD1   1 
ATOM   6176  C  CD2   . LEU A 1 795 ? 15.183  -13.664 23.097  1.00 60.80 ? 795  LEU A CD2   1 
ATOM   6177  N  N     . ALA A 1 796 ? 16.953  -11.457 19.233  1.00 49.00 ? 796  ALA A N     1 
ATOM   6178  C  CA    . ALA A 1 796 ? 17.072  -10.855 17.905  1.00 45.87 ? 796  ALA A CA    1 
ATOM   6179  C  C     . ALA A 1 796 ? 15.610  -10.580 17.484  1.00 42.91 ? 796  ALA A C     1 
ATOM   6180  O  O     . ALA A 1 796 ? 14.783  -11.475 17.643  1.00 42.24 ? 796  ALA A O     1 
ATOM   6181  C  CB    . ALA A 1 796 ? 17.622  -11.859 16.901  1.00 42.02 ? 796  ALA A CB    1 
ATOM   6182  N  N     . LEU A 1 797 ? 15.440  -9.557  16.679  1.00 41.53 ? 797  LEU A N     1 
ATOM   6183  C  CA    . LEU A 1 797 ? 14.138  -9.192  16.171  1.00 40.74 ? 797  LEU A CA    1 
ATOM   6184  C  C     . LEU A 1 797 ? 13.609  -10.262 15.261  1.00 40.00 ? 797  LEU A C     1 
ATOM   6185  O  O     . LEU A 1 797 ? 12.427  -10.528 15.340  1.00 40.50 ? 797  LEU A O     1 
ATOM   6186  C  CB    . LEU A 1 797 ? 14.159  -7.781  15.591  1.00 40.60 ? 797  LEU A CB    1 
ATOM   6187  C  CG    . LEU A 1 797 ? 12.953  -7.364  14.754  1.00 41.04 ? 797  LEU A CG    1 
ATOM   6188  C  CD1   . LEU A 1 797 ? 11.665  -7.374  15.546  1.00 37.60 ? 797  LEU A CD1   1 
ATOM   6189  C  CD2   . LEU A 1 797 ? 13.183  -6.009  14.100  1.00 44.29 ? 797  LEU A CD2   1 
ATOM   6190  N  N     . LEU A 1 798 ? 14.427  -10.982 14.532  1.00 39.99 ? 798  LEU A N     1 
ATOM   6191  C  CA    . LEU A 1 798 ? 13.960  -12.132 13.734  1.00 41.42 ? 798  LEU A CA    1 
ATOM   6192  C  C     . LEU A 1 798 ? 13.201  -13.143 14.595  1.00 41.80 ? 798  LEU A C     1 
ATOM   6193  O  O     . LEU A 1 798 ? 12.201  -13.782 14.216  1.00 40.71 ? 798  LEU A O     1 
ATOM   6194  C  CB    . LEU A 1 798 ? 15.271  -12.749 13.211  1.00 42.23 ? 798  LEU A CB    1 
ATOM   6195  C  CG    . LEU A 1 798 ? 15.322  -13.712 12.067  1.00 43.72 ? 798  LEU A CG    1 
ATOM   6196  C  CD1   . LEU A 1 798 ? 14.995  -15.143 12.483  1.00 43.81 ? 798  LEU A CD1   1 
ATOM   6197  C  CD2   . LEU A 1 798 ? 14.368  -13.293 10.967  1.00 46.05 ? 798  LEU A CD2   1 
ATOM   6198  N  N     . GLN A 1 799 ? 13.671  -13.372 15.824  1.00 42.71 ? 799  GLN A N     1 
ATOM   6199  C  CA    . GLN A 1 799 ? 13.005  -14.284 16.715  1.00 44.20 ? 799  GLN A CA    1 
ATOM   6200  C  C     . GLN A 1 799 ? 11.704  -13.793 17.316  1.00 43.69 ? 799  GLN A C     1 
ATOM   6201  O  O     . GLN A 1 799 ? 10.767  -14.569 17.543  1.00 43.86 ? 799  GLN A O     1 
ATOM   6202  C  CB    . GLN A 1 799 ? 13.903  -14.977 17.735  1.00 49.77 ? 799  GLN A CB    1 
ATOM   6203  C  CG    . GLN A 1 799 ? 12.988  -15.769 18.679  1.00 61.24 ? 799  GLN A CG    1 
ATOM   6204  C  CD    . GLN A 1 799 ? 13.288  -17.243 18.707  1.00 63.14 ? 799  GLN A CD    1 
ATOM   6205  O  OE1   . GLN A 1 799 ? 14.018  -17.664 19.605  1.00 67.27 ? 799  GLN A OE1   1 
ATOM   6206  N  NE2   . GLN A 1 799 ? 12.767  -17.978 17.724  1.00 66.91 ? 799  GLN A NE2   1 
ATOM   6207  N  N     . VAL A 1 800 ? 11.601  -12.491 17.568  1.00 43.25 ? 800  VAL A N     1 
ATOM   6208  C  CA    . VAL A 1 800 ? 10.354  -11.901 18.067  1.00 40.69 ? 800  VAL A CA    1 
ATOM   6209  C  C     . VAL A 1 800 ? 9.304   -12.170 16.995  1.00 38.84 ? 800  VAL A C     1 
ATOM   6210  O  O     . VAL A 1 800 ? 8.168   -12.556 17.233  1.00 40.60 ? 800  VAL A O     1 
ATOM   6211  C  CB    . VAL A 1 800 ? 10.480  -10.403 18.355  1.00 40.77 ? 800  VAL A CB    1 
ATOM   6212  C  CG1   . VAL A 1 800 ? 9.115   -9.760  18.595  1.00 35.27 ? 800  VAL A CG1   1 
ATOM   6213  C  CG2   . VAL A 1 800 ? 11.359  -10.096 19.567  1.00 41.10 ? 800  VAL A CG2   1 
ATOM   6214  N  N     . ARG A 1 801 ? 9.690   -12.054 15.749  1.00 36.87 ? 801  ARG A N     1 
ATOM   6215  C  CA    . ARG A 1 801 ? 8.767   -12.275 14.639  1.00 37.86 ? 801  ARG A CA    1 
ATOM   6216  C  C     . ARG A 1 801 ? 8.282   -13.707 14.487  1.00 38.06 ? 801  ARG A C     1 
ATOM   6217  O  O     . ARG A 1 801 ? 7.099   -14.053 14.378  1.00 36.60 ? 801  ARG A O     1 
ATOM   6218  C  CB    . ARG A 1 801 ? 9.519   -11.723 13.438  1.00 35.76 ? 801  ARG A CB    1 
ATOM   6219  C  CG    . ARG A 1 801 ? 8.649   -11.621 12.190  1.00 40.99 ? 801  ARG A CG    1 
ATOM   6220  C  CD    . ARG A 1 801 ? 9.264   -12.537 11.143  1.00 46.38 ? 801  ARG A CD    1 
ATOM   6221  N  NE    . ARG A 1 801 ? 9.786   -11.804 10.042  1.00 47.62 ? 801  ARG A NE    1 
ATOM   6222  C  CZ    . ARG A 1 801 ? 10.693  -12.017 9.119   1.00 43.89 ? 801  ARG A CZ    1 
ATOM   6223  N  NH1   . ARG A 1 801 ? 11.467  -13.085 9.126   1.00 39.77 ? 801  ARG A NH1   1 
ATOM   6224  N  NH2   . ARG A 1 801 ? 10.748  -11.068 8.180   1.00 36.77 ? 801  ARG A NH2   1 
ATOM   6225  N  N     . ALA A 1 802 ? 9.196   -14.663 14.639  1.00 38.15 ? 802  ALA A N     1 
ATOM   6226  C  CA    . ALA A 1 802 ? 8.966   -16.089 14.544  1.00 38.87 ? 802  ALA A CA    1 
ATOM   6227  C  C     . ALA A 1 802 ? 7.915   -16.558 15.552  1.00 41.44 ? 802  ALA A C     1 
ATOM   6228  O  O     . ALA A 1 802 ? 6.945   -17.289 15.260  1.00 41.84 ? 802  ALA A O     1 
ATOM   6229  C  CB    . ALA A 1 802 ? 10.300  -16.768 14.867  1.00 36.47 ? 802  ALA A CB    1 
ATOM   6230  N  N     . ILE A 1 803 ? 8.131   -16.090 16.781  1.00 42.59 ? 803  ILE A N     1 
ATOM   6231  C  CA    . ILE A 1 803 ? 7.204   -16.418 17.859  1.00 43.94 ? 803  ILE A CA    1 
ATOM   6232  C  C     . ILE A 1 803 ? 5.793   -15.963 17.500  1.00 45.86 ? 803  ILE A C     1 
ATOM   6233  O  O     . ILE A 1 803 ? 4.788   -16.651 17.608  1.00 47.40 ? 803  ILE A O     1 
ATOM   6234  C  CB    . ILE A 1 803 ? 7.624   -15.562 19.067  1.00 45.18 ? 803  ILE A CB    1 
ATOM   6235  C  CG1   . ILE A 1 803 ? 8.806   -16.200 19.782  1.00 42.01 ? 803  ILE A CG1   1 
ATOM   6236  C  CG2   . ILE A 1 803 ? 6.409   -15.370 19.971  1.00 46.64 ? 803  ILE A CG2   1 
ATOM   6237  C  CD1   . ILE A 1 803 ? 9.260   -15.308 20.939  1.00 44.97 ? 803  ILE A CD1   1 
ATOM   6238  N  N     . LEU A 1 804 ? 5.677   -14.678 17.204  1.00 46.85 ? 804  LEU A N     1 
ATOM   6239  C  CA    . LEU A 1 804 ? 4.391   -14.076 16.813  1.00 46.47 ? 804  LEU A CA    1 
ATOM   6240  C  C     . LEU A 1 804 ? 3.752   -14.841 15.674  1.00 47.30 ? 804  LEU A C     1 
ATOM   6241  O  O     . LEU A 1 804 ? 2.542   -15.139 15.616  1.00 47.12 ? 804  LEU A O     1 
ATOM   6242  C  CB    . LEU A 1 804 ? 4.790   -12.648 16.475  1.00 40.95 ? 804  LEU A CB    1 
ATOM   6243  C  CG    . LEU A 1 804 ? 4.393   -11.477 17.345  1.00 42.97 ? 804  LEU A CG    1 
ATOM   6244  C  CD1   . LEU A 1 804 ? 4.261   -11.762 18.823  1.00 37.90 ? 804  LEU A CD1   1 
ATOM   6245  C  CD2   . LEU A 1 804 ? 5.254   -10.259 17.026  1.00 38.84 ? 804  LEU A CD2   1 
ATOM   6246  N  N     . GLN A 1 805 ? 4.573   -15.247 14.694  1.00 49.14 ? 805  GLN A N     1 
ATOM   6247  C  CA    . GLN A 1 805 ? 4.028   -16.046 13.571  1.00 50.55 ? 805  GLN A CA    1 
ATOM   6248  C  C     . GLN A 1 805 ? 3.615   -17.435 14.026  1.00 50.27 ? 805  GLN A C     1 
ATOM   6249  O  O     . GLN A 1 805 ? 2.694   -18.100 13.557  1.00 48.50 ? 805  GLN A O     1 
ATOM   6250  C  CB    . GLN A 1 805 ? 5.033   -16.053 12.412  1.00 53.00 ? 805  GLN A CB    1 
ATOM   6251  C  CG    . GLN A 1 805 ? 5.248   -14.657 11.844  1.00 58.87 ? 805  GLN A CG    1 
ATOM   6252  C  CD    . GLN A 1 805 ? 4.982   -14.519 10.362  1.00 63.27 ? 805  GLN A CD    1 
ATOM   6253  O  OE1   . GLN A 1 805 ? 3.950   -14.985 9.849   1.00 67.44 ? 805  GLN A OE1   1 
ATOM   6254  N  NE2   . GLN A 1 805 ? 5.880   -13.848 9.635   1.00 61.12 ? 805  GLN A NE2   1 
ATOM   6255  N  N     . GLN A 1 806 ? 4.352   -17.912 15.043  1.00 51.64 ? 806  GLN A N     1 
ATOM   6256  C  CA    . GLN A 1 806 ? 4.009   -19.207 15.658  1.00 52.43 ? 806  GLN A CA    1 
ATOM   6257  C  C     . GLN A 1 806 ? 2.591   -19.065 16.231  1.00 50.84 ? 806  GLN A C     1 
ATOM   6258  O  O     . GLN A 1 806 ? 1.726   -19.884 15.969  1.00 49.98 ? 806  GLN A O     1 
ATOM   6259  C  CB    . GLN A 1 806 ? 5.018   -19.513 16.754  1.00 54.93 ? 806  GLN A CB    1 
ATOM   6260  C  CG    . GLN A 1 806 ? 5.676   -20.856 16.784  1.00 61.49 ? 806  GLN A CG    1 
ATOM   6261  C  CD    . GLN A 1 806 ? 4.924   -21.949 16.053  1.00 67.78 ? 806  GLN A CD    1 
ATOM   6262  O  OE1   . GLN A 1 806 ? 4.248   -22.786 16.673  1.00 68.34 ? 806  GLN A OE1   1 
ATOM   6263  N  NE2   . GLN A 1 806 ? 5.074   -21.932 14.724  1.00 69.19 ? 806  GLN A NE2   1 
ATOM   6264  N  N     . LEU A 1 807 ? 2.362   -17.969 16.968  1.00 49.12 ? 807  LEU A N     1 
ATOM   6265  C  CA    . LEU A 1 807 ? 1.054   -17.744 17.554  1.00 47.43 ? 807  LEU A CA    1 
ATOM   6266  C  C     . LEU A 1 807 ? -0.004  -17.729 16.474  1.00 46.27 ? 807  LEU A C     1 
ATOM   6267  O  O     . LEU A 1 807 ? -1.158  -17.871 16.852  1.00 47.60 ? 807  LEU A O     1 
ATOM   6268  C  CB    . LEU A 1 807 ? 0.912   -16.493 18.435  1.00 40.21 ? 807  LEU A CB    1 
ATOM   6269  C  CG    . LEU A 1 807 ? 1.848   -16.414 19.636  1.00 40.77 ? 807  LEU A CG    1 
ATOM   6270  C  CD1   . LEU A 1 807 ? 1.983   -15.017 20.217  1.00 40.42 ? 807  LEU A CD1   1 
ATOM   6271  C  CD2   . LEU A 1 807 ? 1.410   -17.379 20.729  1.00 40.06 ? 807  LEU A CD2   1 
ATOM   6272  N  N     . GLY A 1 808 ? 0.320   -17.400 15.241  1.00 46.21 ? 808  GLY A N     1 
ATOM   6273  C  CA    . GLY A 1 808 ? -0.728  -17.293 14.213  1.00 45.89 ? 808  GLY A CA    1 
ATOM   6274  C  C     . GLY A 1 808 ? -0.875  -15.866 13.720  1.00 47.00 ? 808  GLY A C     1 
ATOM   6275  O  O     . GLY A 1 808 ? -1.784  -15.512 12.964  1.00 47.81 ? 808  GLY A O     1 
ATOM   6276  N  N     . LEU A 1 809 ? 0.079   -14.995 14.059  1.00 47.83 ? 809  LEU A N     1 
ATOM   6277  C  CA    . LEU A 1 809 ? -0.020  -13.599 13.652  1.00 48.88 ? 809  LEU A CA    1 
ATOM   6278  C  C     . LEU A 1 809 ? 0.844   -13.373 12.421  1.00 49.84 ? 809  LEU A C     1 
ATOM   6279  O  O     . LEU A 1 809 ? 1.993   -13.816 12.399  1.00 49.22 ? 809  LEU A O     1 
ATOM   6280  C  CB    . LEU A 1 809 ? 0.350   -12.707 14.838  1.00 46.05 ? 809  LEU A CB    1 
ATOM   6281  C  CG    . LEU A 1 809 ? -0.694  -12.586 15.942  1.00 46.67 ? 809  LEU A CG    1 
ATOM   6282  C  CD1   . LEU A 1 809 ? -0.130  -11.919 17.198  1.00 44.76 ? 809  LEU A CD1   1 
ATOM   6283  C  CD2   . LEU A 1 809 ? -1.861  -11.767 15.401  1.00 45.27 ? 809  LEU A CD2   1 
ATOM   6284  N  N     . ASN A 1 810 ? 0.287   -12.706 11.405  1.00 51.13 ? 810  ASN A N     1 
ATOM   6285  C  CA    . ASN A 1 810 ? 1.116   -12.410 10.210  1.00 51.62 ? 810  ASN A CA    1 
ATOM   6286  C  C     . ASN A 1 810 ? 1.954   -11.151 10.435  1.00 49.89 ? 810  ASN A C     1 
ATOM   6287  O  O     . ASN A 1 810 ? 1.628   -10.056 9.961   1.00 50.42 ? 810  ASN A O     1 
ATOM   6288  C  CB    . ASN A 1 810 ? 0.225   -12.360 8.984   1.00 57.94 ? 810  ASN A CB    1 
ATOM   6289  C  CG    . ASN A 1 810 ? 0.870   -11.980 7.675   1.00 63.25 ? 810  ASN A CG    1 
ATOM   6290  O  OD1   . ASN A 1 810 ? 0.707   -10.854 7.170   1.00 66.80 ? 810  ASN A OD1   1 
ATOM   6291  N  ND2   . ASN A 1 810 ? 1.598   -12.913 7.067   1.00 66.09 ? 810  ASN A ND2   1 
ATOM   6292  N  N     . SER A 1 811 ? 2.968   -11.234 11.270  1.00 47.82 ? 811  SER A N     1 
ATOM   6293  C  CA    . SER A 1 811 ? 3.764   -10.092 11.682  1.00 47.91 ? 811  SER A CA    1 
ATOM   6294  C  C     . SER A 1 811 ? 4.942   -9.893  10.731  1.00 48.02 ? 811  SER A C     1 
ATOM   6295  O  O     . SER A 1 811 ? 5.625   -10.849 10.375  1.00 49.00 ? 811  SER A O     1 
ATOM   6296  C  CB    . SER A 1 811 ? 4.359   -10.311 13.071  1.00 52.33 ? 811  SER A CB    1 
ATOM   6297  O  OG    . SER A 1 811 ? 4.815   -9.149  13.753  1.00 57.86 ? 811  SER A OG    1 
ATOM   6298  N  N     . THR A 1 812 ? 5.183   -8.639  10.379  1.00 46.20 ? 812  THR A N     1 
ATOM   6299  C  CA    . THR A 1 812 ? 6.387   -8.255  9.642   1.00 42.18 ? 812  THR A CA    1 
ATOM   6300  C  C     . THR A 1 812 ? 7.400   -7.742  10.663  1.00 40.37 ? 812  THR A C     1 
ATOM   6301  O  O     . THR A 1 812 ? 7.002   -7.605  11.825  1.00 40.75 ? 812  THR A O     1 
ATOM   6302  C  CB    . THR A 1 812 ? 6.054   -7.121  8.667   1.00 39.70 ? 812  THR A CB    1 
ATOM   6303  O  OG1   . THR A 1 812 ? 5.658   -5.941  9.354   1.00 37.53 ? 812  THR A OG1   1 
ATOM   6304  C  CG2   . THR A 1 812 ? 4.914   -7.621  7.769   1.00 38.69 ? 812  THR A CG2   1 
ATOM   6305  N  N     . CYS A 1 813 ? 8.627   -7.486  10.269  1.00 39.10 ? 813  CYS A N     1 
ATOM   6306  C  CA    . CYS A 1 813 ? 9.632   -6.929  11.145  1.00 38.53 ? 813  CYS A CA    1 
ATOM   6307  C  C     . CYS A 1 813 ? 9.140   -5.731  11.939  1.00 37.14 ? 813  CYS A C     1 
ATOM   6308  O  O     . CYS A 1 813 ? 9.133   -5.755  13.183  1.00 36.50 ? 813  CYS A O     1 
ATOM   6309  C  CB    . CYS A 1 813 ? 10.915  -6.578  10.372  1.00 37.11 ? 813  CYS A CB    1 
ATOM   6310  S  SG    . CYS A 1 813 ? 11.656  -8.053  9.651   1.00 43.90 ? 813  CYS A SG    1 
ATOM   6311  N  N     . ASP A 1 814 ? 8.680   -4.704  11.249  1.00 36.88 ? 814  ASP A N     1 
ATOM   6312  C  CA    . ASP A 1 814 ? 8.167   -3.516  11.959  1.00 37.98 ? 814  ASP A CA    1 
ATOM   6313  C  C     . ASP A 1 814 ? 6.926   -3.812  12.807  1.00 37.18 ? 814  ASP A C     1 
ATOM   6314  O  O     . ASP A 1 814 ? 6.757   -3.105  13.800  1.00 38.20 ? 814  ASP A O     1 
ATOM   6315  C  CB    . ASP A 1 814 ? 7.805   -2.413  10.971  1.00 44.94 ? 814  ASP A CB    1 
ATOM   6316  C  CG    . ASP A 1 814 ? 8.895   -1.592  10.369  1.00 44.40 ? 814  ASP A CG    1 
ATOM   6317  O  OD1   . ASP A 1 814 ? 10.091  -1.757  10.669  1.00 54.72 ? 814  ASP A OD1   1 
ATOM   6318  O  OD2   . ASP A 1 814 ? 8.592   -0.700  9.528   1.00 53.88 ? 814  ASP A OD2   1 
ATOM   6319  N  N     . ASP A 1 815 ? 5.981   -4.660  12.483  1.00 35.99 ? 815  ASP A N     1 
ATOM   6320  C  CA    . ASP A 1 815 ? 4.907   -5.007  13.411  1.00 36.83 ? 815  ASP A CA    1 
ATOM   6321  C  C     . ASP A 1 815 ? 5.517   -5.586  14.724  1.00 36.49 ? 815  ASP A C     1 
ATOM   6322  O  O     . ASP A 1 815 ? 5.079   -5.394  15.857  1.00 33.92 ? 815  ASP A O     1 
ATOM   6323  C  CB    . ASP A 1 815 ? 4.017   -6.106  12.858  1.00 36.52 ? 815  ASP A CB    1 
ATOM   6324  C  CG    . ASP A 1 815 ? 3.040   -5.835  11.762  1.00 44.17 ? 815  ASP A CG    1 
ATOM   6325  O  OD1   . ASP A 1 815 ? 2.513   -4.724  11.543  1.00 44.54 ? 815  ASP A OD1   1 
ATOM   6326  O  OD2   . ASP A 1 815 ? 2.695   -6.819  11.043  1.00 46.65 ? 815  ASP A OD2   1 
ATOM   6327  N  N     . SER A 1 816 ? 6.593   -6.374  14.493  1.00 37.73 ? 816  SER A N     1 
ATOM   6328  C  CA    . SER A 1 816 ? 7.175   -7.164  15.566  1.00 36.90 ? 816  SER A CA    1 
ATOM   6329  C  C     . SER A 1 816 ? 7.806   -6.192  16.526  1.00 36.61 ? 816  SER A C     1 
ATOM   6330  O  O     . SER A 1 816 ? 7.722   -6.416  17.719  1.00 37.74 ? 816  SER A O     1 
ATOM   6331  C  CB    . SER A 1 816 ? 8.154   -8.224  15.079  1.00 38.37 ? 816  SER A CB    1 
ATOM   6332  O  OG    . SER A 1 816 ? 7.436   -9.235  14.365  1.00 37.51 ? 816  SER A OG    1 
ATOM   6333  N  N     . ILE A 1 817 ? 8.308   -5.096  15.983  1.00 37.01 ? 817  ILE A N     1 
ATOM   6334  C  CA    . ILE A 1 817 ? 8.880   -4.029  16.793  1.00 36.28 ? 817  ILE A CA    1 
ATOM   6335  C  C     . ILE A 1 817 ? 7.854   -3.314  17.650  1.00 36.10 ? 817  ILE A C     1 
ATOM   6336  O  O     . ILE A 1 817 ? 8.168   -3.001  18.792  1.00 35.74 ? 817  ILE A O     1 
ATOM   6337  C  CB    . ILE A 1 817 ? 9.554   -2.917  15.975  1.00 35.50 ? 817  ILE A CB    1 
ATOM   6338  C  CG1   . ILE A 1 817 ? 10.886  -3.532  15.448  1.00 34.91 ? 817  ILE A CG1   1 
ATOM   6339  C  CG2   . ILE A 1 817 ? 9.904   -1.730  16.890  1.00 28.93 ? 817  ILE A CG2   1 
ATOM   6340  C  CD1   . ILE A 1 817 ? 11.349  -2.679  14.268  1.00 37.53 ? 817  ILE A CD1   1 
ATOM   6341  N  N     . LEU A 1 818 ? 6.665   -3.073  17.094  1.00 36.44 ? 818  LEU A N     1 
ATOM   6342  C  CA    . LEU A 1 818 ? 5.679   -2.354  17.927  1.00 34.86 ? 818  LEU A CA    1 
ATOM   6343  C  C     . LEU A 1 818 ? 4.959   -3.301  18.857  1.00 34.32 ? 818  LEU A C     1 
ATOM   6344  O  O     . LEU A 1 818 ? 4.566   -2.900  19.967  1.00 32.90 ? 818  LEU A O     1 
ATOM   6345  C  CB    . LEU A 1 818 ? 4.969   -1.419  17.004  1.00 35.58 ? 818  LEU A CB    1 
ATOM   6346  C  CG    . LEU A 1 818 ? 3.615   -0.786  17.350  1.00 36.37 ? 818  LEU A CG    1 
ATOM   6347  C  CD1   . LEU A 1 818 ? 2.557   -1.852  17.306  1.00 33.81 ? 818  LEU A CD1   1 
ATOM   6348  C  CD2   . LEU A 1 818 ? 3.720   -0.104  18.706  1.00 36.87 ? 818  LEU A CD2   1 
ATOM   6349  N  N     . VAL A 1 819 ? 4.825   -4.591  18.494  1.00 33.29 ? 819  VAL A N     1 
ATOM   6350  C  CA    . VAL A 1 819 ? 4.193   -5.541  19.452  1.00 34.05 ? 819  VAL A CA    1 
ATOM   6351  C  C     . VAL A 1 819 ? 5.036   -5.676  20.716  1.00 34.61 ? 819  VAL A C     1 
ATOM   6352  O  O     . VAL A 1 819 ? 4.612   -5.527  21.874  1.00 35.26 ? 819  VAL A O     1 
ATOM   6353  C  CB    . VAL A 1 819 ? 3.930   -6.889  18.768  1.00 32.95 ? 819  VAL A CB    1 
ATOM   6354  C  CG1   . VAL A 1 819 ? 3.518   -7.985  19.723  1.00 27.74 ? 819  VAL A CG1   1 
ATOM   6355  C  CG2   . VAL A 1 819 ? 2.871   -6.778  17.664  1.00 28.29 ? 819  VAL A CG2   1 
ATOM   6356  N  N     . LYS A 1 820 ? 6.351   -5.788  20.549  1.00 34.22 ? 820  LYS A N     1 
ATOM   6357  C  CA    . LYS A 1 820 ? 7.318   -5.814  21.648  1.00 33.88 ? 820  LYS A CA    1 
ATOM   6358  C  C     . LYS A 1 820 ? 7.353   -4.529  22.432  1.00 34.81 ? 820  LYS A C     1 
ATOM   6359  O  O     . LYS A 1 820 ? 7.323   -4.580  23.691  1.00 37.19 ? 820  LYS A O     1 
ATOM   6360  C  CB    . LYS A 1 820 ? 8.663   -6.266  21.058  1.00 30.73 ? 820  LYS A CB    1 
ATOM   6361  C  CG    . LYS A 1 820 ? 9.863   -6.053  21.961  1.00 35.97 ? 820  LYS A CG    1 
ATOM   6362  C  CD    . LYS A 1 820 ? 11.111  -6.747  21.380  1.00 28.38 ? 820  LYS A CD    1 
ATOM   6363  C  CE    . LYS A 1 820 ? 12.333  -6.156  22.052  1.00 40.39 ? 820  LYS A CE    1 
ATOM   6364  N  NZ    . LYS A 1 820 ? 12.320  -6.292  23.555  1.00 38.03 ? 820  LYS A NZ    1 
ATOM   6365  N  N     . THR A 1 821 ? 7.293   -3.325  21.869  1.00 33.85 ? 821  THR A N     1 
ATOM   6366  C  CA    . THR A 1 821 ? 7.123   -2.095  22.592  1.00 33.39 ? 821  THR A CA    1 
ATOM   6367  C  C     . THR A 1 821 ? 5.808   -2.002  23.350  1.00 34.37 ? 821  THR A C     1 
ATOM   6368  O  O     . THR A 1 821 ? 5.804   -1.718  24.581  1.00 35.10 ? 821  THR A O     1 
ATOM   6369  C  CB    . THR A 1 821 ? 7.599   -0.785  21.983  1.00 40.79 ? 821  THR A CB    1 
ATOM   6370  O  OG1   . THR A 1 821 ? 6.845   0.404   22.297  1.00 37.30 ? 821  THR A OG1   1 
ATOM   6371  C  CG2   . THR A 1 821 ? 8.020   -0.755  20.539  1.00 34.09 ? 821  THR A CG2   1 
ATOM   6372  N  N     . VAL A 1 822 ? 4.690   -2.474  22.775  1.00 32.66 ? 822  VAL A N     1 
ATOM   6373  C  CA    . VAL A 1 822 ? 3.452   -2.548  23.514  1.00 31.06 ? 822  VAL A CA    1 
ATOM   6374  C  C     . VAL A 1 822 ? 3.534   -3.484  24.725  1.00 30.68 ? 822  VAL A C     1 
ATOM   6375  O  O     . VAL A 1 822 ? 3.156   -3.064  25.837  1.00 28.42 ? 822  VAL A O     1 
ATOM   6376  C  CB    . VAL A 1 822 ? 2.229   -2.843  22.590  1.00 33.38 ? 822  VAL A CB    1 
ATOM   6377  C  CG1   . VAL A 1 822 ? 1.006   -3.140  23.446  1.00 24.12 ? 822  VAL A CG1   1 
ATOM   6378  C  CG2   . VAL A 1 822 ? 1.909   -1.632  21.712  1.00 27.86 ? 822  VAL A CG2   1 
ATOM   6379  N  N     . CYS A 1 823 ? 4.100   -4.698  24.590  1.00 29.92 ? 823  CYS A N     1 
ATOM   6380  C  CA    . CYS A 1 823 ? 4.306   -5.576  25.725  1.00 30.30 ? 823  CYS A CA    1 
ATOM   6381  C  C     . CYS A 1 823 ? 5.123   -5.005  26.880  1.00 29.97 ? 823  CYS A C     1 
ATOM   6382  O  O     . CYS A 1 823 ? 4.797   -5.286  28.027  1.00 28.78 ? 823  CYS A O     1 
ATOM   6383  C  CB    . CYS A 1 823 ? 4.846   -6.971  25.382  1.00 27.05 ? 823  CYS A CB    1 
ATOM   6384  S  SG    . CYS A 1 823 ? 3.931   -7.931  24.134  1.00 33.51 ? 823  CYS A SG    1 
ATOM   6385  N  N     . GLY A 1 824 ? 6.213   -4.263  26.603  1.00 31.61 ? 824  GLY A N     1 
ATOM   6386  C  CA    . GLY A 1 824 ? 7.061   -3.742  27.670  1.00 30.74 ? 824  GLY A CA    1 
ATOM   6387  C  C     . GLY A 1 824 ? 6.340   -2.615  28.394  1.00 32.12 ? 824  GLY A C     1 
ATOM   6388  O  O     . GLY A 1 824 ? 6.492   -2.369  29.599  1.00 31.16 ? 824  GLY A O     1 
ATOM   6389  N  N     . VAL A 1 825 ? 5.591   -1.808  27.588  1.00 32.26 ? 825  VAL A N     1 
ATOM   6390  C  CA    . VAL A 1 825 ? 4.885   -0.734  28.271  1.00 31.69 ? 825  VAL A CA    1 
ATOM   6391  C  C     . VAL A 1 825 ? 3.902   -1.271  29.295  1.00 32.59 ? 825  VAL A C     1 
ATOM   6392  O  O     . VAL A 1 825 ? 3.798   -0.759  30.407  1.00 32.33 ? 825  VAL A O     1 
ATOM   6393  C  CB    . VAL A 1 825 ? 4.212   0.145   27.215  1.00 36.04 ? 825  VAL A CB    1 
ATOM   6394  C  CG1   . VAL A 1 825 ? 3.236   1.083   27.890  1.00 35.06 ? 825  VAL A CG1   1 
ATOM   6395  C  CG2   . VAL A 1 825 ? 5.277   0.867   26.434  1.00 29.97 ? 825  VAL A CG2   1 
ATOM   6396  N  N     . VAL A 1 826 ? 3.137   -2.318  28.975  1.00 33.47 ? 826  VAL A N     1 
ATOM   6397  C  CA    . VAL A 1 826 ? 2.138   -2.883  29.879  1.00 32.21 ? 826  VAL A CA    1 
ATOM   6398  C  C     . VAL A 1 826 ? 2.802   -3.582  31.079  1.00 32.37 ? 826  VAL A C     1 
ATOM   6399  O  O     . VAL A 1 826 ? 2.420   -3.411  32.241  1.00 30.74 ? 826  VAL A O     1 
ATOM   6400  C  CB    . VAL A 1 826 ? 1.336   -3.943  29.091  1.00 31.85 ? 826  VAL A CB    1 
ATOM   6401  C  CG1   . VAL A 1 826 ? 0.456   -4.814  29.985  1.00 25.32 ? 826  VAL A CG1   1 
ATOM   6402  C  CG2   . VAL A 1 826 ? 0.478   -3.243  28.041  1.00 29.92 ? 826  VAL A CG2   1 
ATOM   6403  N  N     . SER A 1 827 ? 3.770   -4.437  30.739  1.00 32.69 ? 827  SER A N     1 
ATOM   6404  C  CA    . SER A 1 827 ? 4.463   -5.205  31.779  1.00 33.99 ? 827  SER A CA    1 
ATOM   6405  C  C     . SER A 1 827 ? 5.290   -4.338  32.711  1.00 34.42 ? 827  SER A C     1 
ATOM   6406  O  O     . SER A 1 827 ? 5.267   -4.447  33.969  1.00 36.49 ? 827  SER A O     1 
ATOM   6407  C  CB    . SER A 1 827 ? 5.133   -6.423  31.190  1.00 31.01 ? 827  SER A CB    1 
ATOM   6408  O  OG    . SER A 1 827 ? 6.385   -6.107  30.598  1.00 37.46 ? 827  SER A OG    1 
ATOM   6409  N  N     . ARG A 1 828 ? 5.801   -3.236  32.217  1.00 32.83 ? 828  ARG A N     1 
ATOM   6410  C  CA    . ARG A 1 828 ? 6.432   -2.219  33.043  1.00 33.54 ? 828  ARG A CA    1 
ATOM   6411  C  C     . ARG A 1 828 ? 5.462   -1.505  33.962  1.00 33.04 ? 828  ARG A C     1 
ATOM   6412  O  O     . ARG A 1 828 ? 5.871   -1.278  35.094  1.00 33.31 ? 828  ARG A O     1 
ATOM   6413  C  CB    . ARG A 1 828 ? 7.169   -1.231  32.123  1.00 31.63 ? 828  ARG A CB    1 
ATOM   6414  C  CG    . ARG A 1 828 ? 7.627   0.010   32.858  1.00 36.83 ? 828  ARG A CG    1 
ATOM   6415  C  CD    . ARG A 1 828 ? 8.845   0.627   32.138  1.00 42.07 ? 828  ARG A CD    1 
ATOM   6416  N  NE    . ARG A 1 828 ? 9.208   1.812   32.908  1.00 47.48 ? 828  ARG A NE    1 
ATOM   6417  C  CZ    . ARG A 1 828 ? 10.292  1.890   33.697  1.00 52.18 ? 828  ARG A CZ    1 
ATOM   6418  N  NH1   . ARG A 1 828 ? 11.190  0.924   33.834  1.00 47.50 ? 828  ARG A NH1   1 
ATOM   6419  N  NH2   . ARG A 1 828 ? 10.463  3.032   34.374  1.00 54.80 ? 828  ARG A NH2   1 
ATOM   6420  N  N     . ARG A 1 829 ? 4.265   -1.097  33.526  1.00 31.61 ? 829  ARG A N     1 
ATOM   6421  C  CA    . ARG A 1 829 ? 3.307   -0.444  34.400  1.00 31.20 ? 829  ARG A CA    1 
ATOM   6422  C  C     . ARG A 1 829 ? 2.875   -1.465  35.475  1.00 30.98 ? 829  ARG A C     1 
ATOM   6423  O  O     . ARG A 1 829 ? 2.778   -1.061  36.642  1.00 30.72 ? 829  ARG A O     1 
ATOM   6424  C  CB    . ARG A 1 829 ? 2.063   0.120   33.700  1.00 28.92 ? 829  ARG A CB    1 
ATOM   6425  C  CG    . ARG A 1 829 ? 1.081   0.955   34.471  1.00 28.15 ? 829  ARG A CG    1 
ATOM   6426  C  CD    . ARG A 1 829 ? -0.301  1.116   33.842  1.00 33.05 ? 829  ARG A CD    1 
ATOM   6427  N  NE    . ARG A 1 829 ? -1.016  -0.151  33.590  1.00 32.76 ? 829  ARG A NE    1 
ATOM   6428  C  CZ    . ARG A 1 829 ? -2.244  -0.247  33.084  1.00 28.28 ? 829  ARG A CZ    1 
ATOM   6429  N  NH1   . ARG A 1 829 ? -2.933  0.821   32.696  1.00 31.01 ? 829  ARG A NH1   1 
ATOM   6430  N  NH2   . ARG A 1 829 ? -2.805  -1.407  32.829  1.00 29.71 ? 829  ARG A NH2   1 
ATOM   6431  N  N     . ALA A 1 830 ? 2.715   -2.718  35.086  1.00 29.63 ? 830  ALA A N     1 
ATOM   6432  C  CA    . ALA A 1 830 ? 2.318   -3.748  36.037  1.00 31.57 ? 830  ALA A CA    1 
ATOM   6433  C  C     . ALA A 1 830 ? 3.329   -3.867  37.182  1.00 32.61 ? 830  ALA A C     1 
ATOM   6434  O  O     . ALA A 1 830 ? 2.854   -3.972  38.308  1.00 34.21 ? 830  ALA A O     1 
ATOM   6435  C  CB    . ALA A 1 830 ? 2.189   -5.135  35.384  1.00 28.88 ? 830  ALA A CB    1 
ATOM   6436  N  N     . ALA A 1 831 ? 4.628   -3.896  36.962  1.00 31.95 ? 831  ALA A N     1 
ATOM   6437  C  CA    . ALA A 1 831 ? 5.601   -4.044  38.033  1.00 34.02 ? 831  ALA A CA    1 
ATOM   6438  C  C     . ALA A 1 831 ? 5.707   -2.797  38.916  1.00 35.67 ? 831  ALA A C     1 
ATOM   6439  O  O     . ALA A 1 831 ? 6.030   -2.939  40.106  1.00 36.79 ? 831  ALA A O     1 
ATOM   6440  C  CB    . ALA A 1 831 ? 7.023   -4.260  37.505  1.00 25.04 ? 831  ALA A CB    1 
ATOM   6441  N  N     . GLN A 1 832 ? 5.462   -1.625  38.334  1.00 34.99 ? 832  GLN A N     1 
ATOM   6442  C  CA    . GLN A 1 832 ? 5.524   -0.399  39.116  1.00 35.28 ? 832  GLN A CA    1 
ATOM   6443  C  C     . GLN A 1 832 ? 4.345   -0.261  40.076  1.00 34.96 ? 832  GLN A C     1 
ATOM   6444  O  O     . GLN A 1 832 ? 4.455   0.246   41.190  1.00 34.29 ? 832  GLN A O     1 
ATOM   6445  C  CB    . GLN A 1 832 ? 5.621   0.830   38.200  1.00 37.37 ? 832  GLN A CB    1 
ATOM   6446  C  CG    . GLN A 1 832 ? 6.992   1.189   37.680  1.00 34.51 ? 832  GLN A CG    1 
ATOM   6447  C  CD    . GLN A 1 832 ? 6.944   2.311   36.661  1.00 47.00 ? 832  GLN A CD    1 
ATOM   6448  O  OE1   . GLN A 1 832 ? 6.014   2.502   35.877  1.00 44.56 ? 832  GLN A OE1   1 
ATOM   6449  N  NE2   . GLN A 1 832 ? 8.000   3.122   36.528  1.00 49.08 ? 832  GLN A NE2   1 
ATOM   6450  N  N     . LEU A 1 833 ? 3.187   -0.665  39.603  1.00 36.34 ? 833  LEU A N     1 
ATOM   6451  C  CA    . LEU A 1 833 ? 1.917   -0.609  40.313  1.00 36.69 ? 833  LEU A CA    1 
ATOM   6452  C  C     . LEU A 1 833 ? 1.977   -1.575  41.493  1.00 36.48 ? 833  LEU A C     1 
ATOM   6453  O  O     . LEU A 1 833 ? 1.454   -1.317  42.575  1.00 37.54 ? 833  LEU A O     1 
ATOM   6454  C  CB    . LEU A 1 833 ? 0.710   -0.911  39.404  1.00 32.85 ? 833  LEU A CB    1 
ATOM   6455  C  CG    . LEU A 1 833 ? 0.179   0.271   38.579  1.00 37.58 ? 833  LEU A CG    1 
ATOM   6456  C  CD1   . LEU A 1 833 ? -0.913  -0.138  37.580  1.00 35.48 ? 833  LEU A CD1   1 
ATOM   6457  C  CD2   . LEU A 1 833 ? -0.369  1.376   39.478  1.00 30.16 ? 833  LEU A CD2   1 
ATOM   6458  N  N     . CYS A 1 834 ? 2.575   -2.753  41.250  1.00 36.76 ? 834  CYS A N     1 
ATOM   6459  C  CA    . CYS A 1 834 ? 2.847   -3.762  42.263  1.00 35.19 ? 834  CYS A CA    1 
ATOM   6460  C  C     . CYS A 1 834 ? 3.775   -3.154  43.331  1.00 35.49 ? 834  CYS A C     1 
ATOM   6461  O  O     . CYS A 1 834 ? 3.587   -3.442  44.507  1.00 35.79 ? 834  CYS A O     1 
ATOM   6462  C  CB    . CYS A 1 834 ? 3.548   -4.975  41.660  1.00 35.22 ? 834  CYS A CB    1 
ATOM   6463  S  SG    . CYS A 1 834 ? 3.547   -6.499  42.657  1.00 36.83 ? 834  CYS A SG    1 
ATOM   6464  N  N     . GLY A 1 835 ? 4.848   -2.525  42.918  1.00 34.36 ? 835  GLY A N     1 
ATOM   6465  C  CA    . GLY A 1 835 ? 5.793   -1.910  43.809  1.00 36.42 ? 835  GLY A CA    1 
ATOM   6466  C  C     . GLY A 1 835 ? 5.176   -0.731  44.557  1.00 38.47 ? 835  GLY A C     1 
ATOM   6467  O  O     . GLY A 1 835 ? 5.597   -0.538  45.719  1.00 40.07 ? 835  GLY A O     1 
ATOM   6468  N  N     . ALA A 1 836 ? 4.212   0.004   43.987  1.00 37.88 ? 836  ALA A N     1 
ATOM   6469  C  CA    . ALA A 1 836 ? 3.574   1.038   44.799  1.00 39.36 ? 836  ALA A CA    1 
ATOM   6470  C  C     . ALA A 1 836 ? 2.856   0.312   45.948  1.00 40.26 ? 836  ALA A C     1 
ATOM   6471  O  O     . ALA A 1 836 ? 2.860   0.816   47.074  1.00 42.00 ? 836  ALA A O     1 
ATOM   6472  C  CB    . ALA A 1 836 ? 2.603   1.975   44.099  1.00 31.16 ? 836  ALA A CB    1 
ATOM   6473  N  N     . GLY A 1 837 ? 2.314   -0.856  45.651  1.00 39.76 ? 837  GLY A N     1 
ATOM   6474  C  CA    . GLY A 1 837 ? 1.469   -1.559  46.608  1.00 39.81 ? 837  GLY A CA    1 
ATOM   6475  C  C     . GLY A 1 837 ? 2.339   -2.075  47.748  1.00 40.66 ? 837  GLY A C     1 
ATOM   6476  O  O     . GLY A 1 837 ? 2.036   -1.788  48.904  1.00 41.65 ? 837  GLY A O     1 
ATOM   6477  N  N     . MET A 1 838 ? 3.429   -2.736  47.395  1.00 39.01 ? 838  MET A N     1 
ATOM   6478  C  CA    . MET A 1 838 ? 4.390   -3.241  48.336  1.00 37.88 ? 838  MET A CA    1 
ATOM   6479  C  C     . MET A 1 838 ? 5.064   -2.075  49.049  1.00 38.68 ? 838  MET A C     1 
ATOM   6480  O  O     . MET A 1 838 ? 5.404   -2.350  50.194  1.00 40.03 ? 838  MET A O     1 
ATOM   6481  C  CB    . MET A 1 838 ? 5.502   -4.050  47.680  1.00 39.48 ? 838  MET A CB    1 
ATOM   6482  C  CG    . MET A 1 838 ? 6.356   -4.874  48.647  1.00 35.75 ? 838  MET A CG    1 
ATOM   6483  S  SD    . MET A 1 838 ? 5.379   -5.877  49.728  1.00 35.48 ? 838  MET A SD    1 
ATOM   6484  C  CE    . MET A 1 838 ? 4.656   -7.134  48.707  1.00 31.02 ? 838  MET A CE    1 
ATOM   6485  N  N     . ALA A 1 839 ? 5.272   -0.930  48.392  1.00 37.47 ? 839  ALA A N     1 
ATOM   6486  C  CA    . ALA A 1 839 ? 5.857   0.178   49.151  1.00 37.80 ? 839  ALA A CA    1 
ATOM   6487  C  C     . ALA A 1 839 ? 4.959   0.561   50.311  1.00 37.03 ? 839  ALA A C     1 
ATOM   6488  O  O     . ALA A 1 839 ? 5.461   1.141   51.266  1.00 37.86 ? 839  ALA A O     1 
ATOM   6489  C  CB    . ALA A 1 839 ? 6.221   1.445   48.393  1.00 30.21 ? 839  ALA A CB    1 
ATOM   6490  N  N     . ALA A 1 840 ? 3.657   0.421   50.173  1.00 37.80 ? 840  ALA A N     1 
ATOM   6491  C  CA    . ALA A 1 840 ? 2.733   0.807   51.230  1.00 39.07 ? 840  ALA A CA    1 
ATOM   6492  C  C     . ALA A 1 840 ? 2.792   -0.208  52.380  1.00 39.94 ? 840  ALA A C     1 
ATOM   6493  O  O     . ALA A 1 840 ? 2.892   0.132   53.552  1.00 40.35 ? 840  ALA A O     1 
ATOM   6494  C  CB    . ALA A 1 840 ? 1.307   0.903   50.709  1.00 37.94 ? 840  ALA A CB    1 
ATOM   6495  N  N     . VAL A 1 841 ? 2.646   -1.482  52.034  1.00 40.02 ? 841  VAL A N     1 
ATOM   6496  C  CA    . VAL A 1 841 ? 2.751   -2.540  53.039  1.00 40.53 ? 841  VAL A CA    1 
ATOM   6497  C  C     . VAL A 1 841 ? 4.023   -2.339  53.860  1.00 40.60 ? 841  VAL A C     1 
ATOM   6498  O  O     . VAL A 1 841 ? 3.941   -2.160  55.072  1.00 40.40 ? 841  VAL A O     1 
ATOM   6499  C  CB    . VAL A 1 841 ? 2.734   -3.906  52.328  1.00 38.58 ? 841  VAL A CB    1 
ATOM   6500  C  CG1   . VAL A 1 841 ? 3.149   -5.045  53.249  1.00 36.60 ? 841  VAL A CG1   1 
ATOM   6501  C  CG2   . VAL A 1 841 ? 1.321   -4.034  51.816  1.00 35.00 ? 841  VAL A CG2   1 
ATOM   6502  N  N     . VAL A 1 842 ? 5.200   -2.332  53.239  1.00 40.37 ? 842  VAL A N     1 
ATOM   6503  C  CA    . VAL A 1 842 ? 6.412   -2.160  54.011  1.00 40.35 ? 842  VAL A CA    1 
ATOM   6504  C  C     . VAL A 1 842 ? 6.517   -0.797  54.676  1.00 41.64 ? 842  VAL A C     1 
ATOM   6505  O  O     . VAL A 1 842 ? 7.088   -0.757  55.777  1.00 41.08 ? 842  VAL A O     1 
ATOM   6506  C  CB    . VAL A 1 842 ? 7.686   -2.588  53.294  1.00 38.10 ? 842  VAL A CB    1 
ATOM   6507  C  CG1   . VAL A 1 842 ? 7.579   -3.992  52.680  1.00 33.90 ? 842  VAL A CG1   1 
ATOM   6508  C  CG2   . VAL A 1 842 ? 8.093   -1.545  52.280  1.00 36.18 ? 842  VAL A CG2   1 
ATOM   6509  N  N     . ASP A 1 843 ? 5.845   0.283   54.268  1.00 42.50 ? 843  ASP A N     1 
ATOM   6510  C  CA    . ASP A 1 843 ? 5.970   1.510   55.062  1.00 43.44 ? 843  ASP A CA    1 
ATOM   6511  C  C     . ASP A 1 843 ? 5.003   1.471   56.243  1.00 44.98 ? 843  ASP A C     1 
ATOM   6512  O  O     . ASP A 1 843 ? 5.215   2.123   57.276  1.00 45.00 ? 843  ASP A O     1 
ATOM   6513  C  CB    . ASP A 1 843 ? 5.871   2.778   54.267  1.00 43.59 ? 843  ASP A CB    1 
ATOM   6514  C  CG    . ASP A 1 843 ? 6.963   3.790   54.499  1.00 47.44 ? 843  ASP A CG    1 
ATOM   6515  O  OD1   . ASP A 1 843 ? 8.119   3.452   54.825  1.00 51.13 ? 843  ASP A OD1   1 
ATOM   6516  O  OD2   . ASP A 1 843 ? 6.666   5.001   54.382  1.00 52.20 ? 843  ASP A OD2   1 
ATOM   6517  N  N     . LYS A 1 844 ? 3.904   0.726   56.085  1.00 45.20 ? 844  LYS A N     1 
ATOM   6518  C  CA    . LYS A 1 844 ? 2.958   0.528   57.154  1.00 46.54 ? 844  LYS A CA    1 
ATOM   6519  C  C     . LYS A 1 844 ? 3.552   -0.338  58.289  1.00 47.87 ? 844  LYS A C     1 
ATOM   6520  O  O     . LYS A 1 844 ? 3.247   -0.024  59.447  1.00 47.90 ? 844  LYS A O     1 
ATOM   6521  C  CB    . LYS A 1 844 ? 1.666   -0.144  56.716  1.00 39.63 ? 844  LYS A CB    1 
ATOM   6522  C  CG    . LYS A 1 844 ? 0.688   -0.281  57.874  1.00 39.13 ? 844  LYS A CG    1 
ATOM   6523  C  CD    . LYS A 1 844 ? -0.742  -0.162  57.360  1.00 39.72 ? 844  LYS A CD    1 
ATOM   6524  C  CE    . LYS A 1 844 ? -1.692  -0.940  58.234  1.00 42.71 ? 844  LYS A CE    1 
ATOM   6525  N  NZ    . LYS A 1 844 ? -1.587  -0.540  59.660  1.00 45.34 ? 844  LYS A NZ    1 
ATOM   6526  N  N     . ILE A 1 845 ? 4.226   -1.433  57.933  1.00 48.03 ? 845  ILE A N     1 
ATOM   6527  C  CA    . ILE A 1 845 ? 4.806   -2.256  58.955  1.00 49.57 ? 845  ILE A CA    1 
ATOM   6528  C  C     . ILE A 1 845 ? 5.839   -1.467  59.750  1.00 51.13 ? 845  ILE A C     1 
ATOM   6529  O  O     . ILE A 1 845 ? 5.767   -1.436  60.980  1.00 51.29 ? 845  ILE A O     1 
ATOM   6530  C  CB    . ILE A 1 845 ? 5.101   -3.716  58.797  1.00 47.32 ? 845  ILE A CB    1 
ATOM   6531  C  CG1   . ILE A 1 845 ? 6.278   -4.185  59.626  1.00 43.70 ? 845  ILE A CG1   1 
ATOM   6532  C  CG2   . ILE A 1 845 ? 4.922   -4.384  57.467  1.00 46.01 ? 845  ILE A CG2   1 
ATOM   6533  C  CD1   . ILE A 1 845 ? 7.668   -3.895  59.165  1.00 51.28 ? 845  ILE A CD1   1 
ATOM   6534  N  N     . ARG A 1 846 ? 6.666   -0.689  59.082  1.00 52.87 ? 846  ARG A N     1 
ATOM   6535  C  CA    . ARG A 1 846 ? 7.640   0.189   59.732  1.00 53.79 ? 846  ARG A CA    1 
ATOM   6536  C  C     . ARG A 1 846 ? 6.907   1.159   60.660  1.00 54.34 ? 846  ARG A C     1 
ATOM   6537  O  O     . ARG A 1 846 ? 7.109   1.130   61.877  1.00 54.42 ? 846  ARG A O     1 
ATOM   6538  C  CB    . ARG A 1 846 ? 8.474   0.895   58.666  1.00 51.66 ? 846  ARG A CB    1 
ATOM   6539  C  CG    . ARG A 1 846 ? 9.506   1.883   59.136  1.00 52.30 ? 846  ARG A CG    1 
ATOM   6540  C  CD    . ARG A 1 846 ? 10.394  2.450   58.034  1.00 54.90 ? 846  ARG A CD    1 
ATOM   6541  N  NE    . ARG A 1 846 ? 9.783   3.507   57.245  1.00 54.47 ? 846  ARG A NE    1 
ATOM   6542  C  CZ    . ARG A 1 846 ? 9.193   4.599   57.709  1.00 56.30 ? 846  ARG A CZ    1 
ATOM   6543  N  NH1   . ARG A 1 846 ? 9.142   4.835   59.008  1.00 52.88 ? 846  ARG A NH1   1 
ATOM   6544  N  NH2   . ARG A 1 846 ? 8.661   5.514   56.899  1.00 58.21 ? 846  ARG A NH2   1 
ATOM   6545  N  N     . GLU A 1 847 ? 5.995   1.936   60.118  1.00 54.99 ? 847  GLU A N     1 
ATOM   6546  C  CA    . GLU A 1 847 ? 5.193   2.904   60.860  1.00 56.28 ? 847  GLU A CA    1 
ATOM   6547  C  C     . GLU A 1 847 ? 4.562   2.211   62.060  1.00 56.67 ? 847  GLU A C     1 
ATOM   6548  O  O     . GLU A 1 847 ? 4.945   2.502   63.194  1.00 57.87 ? 847  GLU A O     1 
ATOM   6549  C  CB    . GLU A 1 847 ? 4.142   3.543   59.960  1.00 59.02 ? 847  GLU A CB    1 
ATOM   6550  C  CG    . GLU A 1 847 ? 4.526   4.800   59.208  1.00 63.77 ? 847  GLU A CG    1 
ATOM   6551  C  CD    . GLU A 1 847 ? 3.412   5.443   58.396  1.00 67.04 ? 847  GLU A CD    1 
ATOM   6552  O  OE1   . GLU A 1 847 ? 2.860   4.862   57.424  1.00 69.97 ? 847  GLU A OE1   1 
ATOM   6553  O  OE2   . GLU A 1 847 ? 3.047   6.606   58.675  1.00 66.08 ? 847  GLU A OE2   1 
ATOM   6554  N  N     . ASN A 1 848 ? 3.733   1.193   61.878  1.00 56.34 ? 848  ASN A N     1 
ATOM   6555  C  CA    . ASN A 1 848 ? 3.168   0.389   62.955  1.00 55.23 ? 848  ASN A CA    1 
ATOM   6556  C  C     . ASN A 1 848 ? 4.168   0.228   64.114  1.00 54.79 ? 848  ASN A C     1 
ATOM   6557  O  O     . ASN A 1 848 ? 3.768   0.205   65.275  1.00 56.30 ? 848  ASN A O     1 
ATOM   6558  C  CB    . ASN A 1 848 ? 2.898   -1.052  62.487  1.00 54.40 ? 848  ASN A CB    1 
ATOM   6559  C  CG    . ASN A 1 848 ? 1.667   -1.269  61.634  1.00 54.99 ? 848  ASN A CG    1 
ATOM   6560  O  OD1   . ASN A 1 848 ? 0.959   -0.336  61.239  1.00 49.38 ? 848  ASN A OD1   1 
ATOM   6561  N  ND2   . ASN A 1 848 ? 1.386   -2.561  61.409  1.00 51.86 ? 848  ASN A ND2   1 
ATOM   6562  N  N     . ARG A 1 849 ? 5.427   -0.048  63.798  1.00 52.29 ? 849  ARG A N     1 
ATOM   6563  C  CA    . ARG A 1 849 ? 6.427   -0.346  64.801  1.00 49.55 ? 849  ARG A CA    1 
ATOM   6564  C  C     . ARG A 1 849 ? 7.217   0.881   65.210  1.00 48.86 ? 849  ARG A C     1 
ATOM   6565  O  O     . ARG A 1 849 ? 8.245   0.794   65.877  1.00 48.80 ? 849  ARG A O     1 
ATOM   6566  C  CB    . ARG A 1 849 ? 7.327   -1.458  64.284  1.00 47.27 ? 849  ARG A CB    1 
ATOM   6567  C  CG    . ARG A 1 849 ? 6.536   -2.683  63.833  1.00 45.72 ? 849  ARG A CG    1 
ATOM   6568  C  CD    . ARG A 1 849 ? 7.448   -3.741  63.242  1.00 47.32 ? 849  ARG A CD    1 
ATOM   6569  N  NE    . ARG A 1 849 ? 6.741   -4.969  62.924  1.00 52.60 ? 849  ARG A NE    1 
ATOM   6570  C  CZ    . ARG A 1 849 ? 7.270   -6.078  62.421  1.00 52.95 ? 849  ARG A CZ    1 
ATOM   6571  N  NH1   . ARG A 1 849 ? 8.557   -6.161  62.108  1.00 50.11 ? 849  ARG A NH1   1 
ATOM   6572  N  NH2   . ARG A 1 849 ? 6.458   -7.116  62.205  1.00 54.25 ? 849  ARG A NH2   1 
ATOM   6573  N  N     . GLY A 1 850 ? 6.735   2.056   64.834  1.00 47.87 ? 850  GLY A N     1 
ATOM   6574  C  CA    . GLY A 1 850 ? 7.434   3.274   65.223  1.00 48.48 ? 850  GLY A CA    1 
ATOM   6575  C  C     . GLY A 1 850 ? 8.916   3.131   64.912  1.00 49.63 ? 850  GLY A C     1 
ATOM   6576  O  O     . GLY A 1 850 ? 9.720   3.848   65.502  1.00 49.38 ? 850  GLY A O     1 
ATOM   6577  N  N     . LEU A 1 851 ? 9.280   2.415   63.852  1.00 50.89 ? 851  LEU A N     1 
ATOM   6578  C  CA    . LEU A 1 851 ? 10.677  2.367   63.427  1.00 52.32 ? 851  LEU A CA    1 
ATOM   6579  C  C     . LEU A 1 851 ? 11.086  3.489   62.478  1.00 53.02 ? 851  LEU A C     1 
ATOM   6580  O  O     . LEU A 1 851 ? 10.264  4.038   61.734  1.00 52.37 ? 851  LEU A O     1 
ATOM   6581  C  CB    . LEU A 1 851 ? 10.973  0.976   62.834  1.00 47.73 ? 851  LEU A CB    1 
ATOM   6582  C  CG    . LEU A 1 851 ? 10.913  -0.165  63.854  1.00 46.21 ? 851  LEU A CG    1 
ATOM   6583  C  CD1   . LEU A 1 851 ? 10.954  -1.540  63.184  1.00 42.26 ? 851  LEU A CD1   1 
ATOM   6584  C  CD2   . LEU A 1 851 ? 12.086  -0.035  64.827  1.00 43.49 ? 851  LEU A CD2   1 
ATOM   6585  N  N     . ASP A 1 852 ? 12.371  3.863   62.495  1.00 53.31 ? 852  ASP A N     1 
ATOM   6586  C  CA    . ASP A 1 852 ? 12.889  4.942   61.651  1.00 53.57 ? 852  ASP A CA    1 
ATOM   6587  C  C     . ASP A 1 852 ? 13.386  4.313   60.327  1.00 53.70 ? 852  ASP A C     1 
ATOM   6588  O  O     . ASP A 1 852 ? 13.556  4.959   59.290  1.00 52.64 ? 852  ASP A O     1 
ATOM   6589  C  CB    . ASP A 1 852 ? 14.124  5.564   62.290  1.00 56.32 ? 852  ASP A CB    1 
ATOM   6590  C  CG    . ASP A 1 852 ? 13.959  6.811   63.105  1.00 61.09 ? 852  ASP A CG    1 
ATOM   6591  O  OD1   . ASP A 1 852 ? 12.847  7.345   63.274  1.00 63.73 ? 852  ASP A OD1   1 
ATOM   6592  O  OD2   . ASP A 1 852 ? 14.980  7.350   63.624  1.00 66.93 ? 852  ASP A OD2   1 
ATOM   6593  N  N     . ARG A 1 853 ? 13.740  3.037   60.494  1.00 52.62 ? 853  ARG A N     1 
ATOM   6594  C  CA    . ARG A 1 853 ? 14.296  2.276   59.365  1.00 52.90 ? 853  ARG A CA    1 
ATOM   6595  C  C     . ARG A 1 853 ? 13.853  0.826   59.526  1.00 51.81 ? 853  ARG A C     1 
ATOM   6596  O  O     . ARG A 1 853 ? 13.712  0.371   60.680  1.00 52.01 ? 853  ARG A O     1 
ATOM   6597  C  CB    . ARG A 1 853 ? 15.795  2.499   59.341  1.00 56.57 ? 853  ARG A CB    1 
ATOM   6598  C  CG    . ARG A 1 853 ? 16.672  1.514   58.613  1.00 65.37 ? 853  ARG A CG    1 
ATOM   6599  C  CD    . ARG A 1 853 ? 17.963  2.151   58.108  1.00 68.42 ? 853  ARG A CD    1 
ATOM   6600  N  NE    . ARG A 1 853 ? 19.046  1.186   57.897  1.00 73.69 ? 853  ARG A NE    1 
ATOM   6601  C  CZ    . ARG A 1 853 ? 20.295  1.579   57.615  1.00 77.56 ? 853  ARG A CZ    1 
ATOM   6602  N  NH1   . ARG A 1 853 ? 20.622  2.865   57.525  1.00 75.15 ? 853  ARG A NH1   1 
ATOM   6603  N  NH2   . ARG A 1 853 ? 21.261  0.686   57.420  1.00 79.50 ? 853  ARG A NH2   1 
ATOM   6604  N  N     . LEU A 1 854 ? 13.399  0.191   58.445  1.00 50.19 ? 854  LEU A N     1 
ATOM   6605  C  CA    . LEU A 1 854 ? 12.928  -1.184  58.553  1.00 49.77 ? 854  LEU A CA    1 
ATOM   6606  C  C     . LEU A 1 854 ? 13.662  -2.172  57.671  1.00 49.72 ? 854  LEU A C     1 
ATOM   6607  O  O     . LEU A 1 854 ? 13.479  -2.048  56.447  1.00 52.24 ? 854  LEU A O     1 
ATOM   6608  C  CB    . LEU A 1 854 ? 11.446  -1.263  58.147  1.00 45.89 ? 854  LEU A CB    1 
ATOM   6609  C  CG    . LEU A 1 854 ? 10.934  -2.697  58.008  1.00 49.05 ? 854  LEU A CG    1 
ATOM   6610  C  CD1   . LEU A 1 854 ? 11.048  -3.385  59.361  1.00 49.53 ? 854  LEU A CD1   1 
ATOM   6611  C  CD2   . LEU A 1 854 ? 9.500   -2.768  57.529  1.00 48.50 ? 854  LEU A CD2   1 
ATOM   6612  N  N     . ASN A 1 855 ? 14.158  -3.288  58.140  1.00 48.66 ? 855  ASN A N     1 
ATOM   6613  C  CA    . ASN A 1 855 ? 14.707  -4.321  57.238  1.00 47.97 ? 855  ASN A CA    1 
ATOM   6614  C  C     . ASN A 1 855 ? 13.697  -5.453  57.127  1.00 46.81 ? 855  ASN A C     1 
ATOM   6615  O  O     . ASN A 1 855 ? 13.276  -5.985  58.159  1.00 46.69 ? 855  ASN A O     1 
ATOM   6616  C  CB    . ASN A 1 855 ? 16.081  -4.827  57.673  1.00 43.70 ? 855  ASN A CB    1 
ATOM   6617  C  CG    . ASN A 1 855 ? 17.098  -3.709  57.599  1.00 47.88 ? 855  ASN A CG    1 
ATOM   6618  O  OD1   . ASN A 1 855 ? 17.383  -3.117  56.556  1.00 50.58 ? 855  ASN A OD1   1 
ATOM   6619  N  ND2   . ASN A 1 855 ? 17.673  -3.310  58.717  1.00 47.75 ? 855  ASN A ND2   1 
ATOM   6620  N  N     . VAL A 1 856 ? 13.175  -5.714  55.924  1.00 45.50 ? 856  VAL A N     1 
ATOM   6621  C  CA    . VAL A 1 856 ? 12.157  -6.768  55.847  1.00 43.41 ? 856  VAL A CA    1 
ATOM   6622  C  C     . VAL A 1 856 ? 12.306  -7.625  54.607  1.00 42.34 ? 856  VAL A C     1 
ATOM   6623  O  O     . VAL A 1 856 ? 12.950  -7.220  53.632  1.00 42.30 ? 856  VAL A O     1 
ATOM   6624  C  CB    . VAL A 1 856 ? 10.763  -6.209  56.071  1.00 43.25 ? 856  VAL A CB    1 
ATOM   6625  C  CG1   . VAL A 1 856 ? 10.320  -5.299  54.919  1.00 41.41 ? 856  VAL A CG1   1 
ATOM   6626  C  CG2   . VAL A 1 856 ? 9.755   -7.295  56.360  1.00 33.69 ? 856  VAL A CG2   1 
ATOM   6627  N  N     . THR A 1 857 ? 11.831  -8.868  54.666  1.00 41.75 ? 857  THR A N     1 
ATOM   6628  C  CA    . THR A 1 857 ? 11.957  -9.778  53.531  1.00 40.80 ? 857  THR A CA    1 
ATOM   6629  C  C     . THR A 1 857 ? 10.613  -10.296 53.085  1.00 39.85 ? 857  THR A C     1 
ATOM   6630  O  O     . THR A 1 857 ? 9.716   -10.597 53.861  1.00 40.04 ? 857  THR A O     1 
ATOM   6631  C  CB    . THR A 1 857 ? 13.033  -10.851 53.676  1.00 43.89 ? 857  THR A CB    1 
ATOM   6632  O  OG1   . THR A 1 857 ? 12.632  -12.212 53.555  1.00 42.79 ? 857  THR A OG1   1 
ATOM   6633  C  CG2   . THR A 1 857 ? 13.890  -10.725 54.912  1.00 41.42 ? 857  THR A CG2   1 
ATOM   6634  N  N     . VAL A 1 858 ? 10.352  -10.247 51.788  1.00 40.13 ? 858  VAL A N     1 
ATOM   6635  C  CA    . VAL A 1 858 ? 9.064   -10.695 51.227  1.00 38.66 ? 858  VAL A CA    1 
ATOM   6636  C  C     . VAL A 1 858 ? 9.312   -12.060 50.591  1.00 38.28 ? 858  VAL A C     1 
ATOM   6637  O  O     . VAL A 1 858 ? 10.261  -12.205 49.800  1.00 37.48 ? 858  VAL A O     1 
ATOM   6638  C  CB    . VAL A 1 858 ? 8.644   -9.669  50.144  1.00 37.98 ? 858  VAL A CB    1 
ATOM   6639  C  CG1   . VAL A 1 858 ? 7.354   -10.019 49.430  1.00 30.79 ? 858  VAL A CG1   1 
ATOM   6640  C  CG2   . VAL A 1 858 ? 8.567   -8.279  50.770  1.00 31.94 ? 858  VAL A CG2   1 
ATOM   6641  N  N     . GLY A 1 859 ? 8.482   -13.022 50.958  1.00 37.06 ? 859  GLY A N     1 
ATOM   6642  C  CA    . GLY A 1 859 ? 8.485   -14.295 50.220  1.00 36.41 ? 859  GLY A CA    1 
ATOM   6643  C  C     . GLY A 1 859 ? 7.494   -14.171 49.073  1.00 37.88 ? 859  GLY A C     1 
ATOM   6644  O  O     . GLY A 1 859 ? 6.340   -13.773 49.262  1.00 38.00 ? 859  GLY A O     1 
ATOM   6645  N  N     . VAL A 1 860 ? 7.904   -14.481 47.853  1.00 40.13 ? 860  VAL A N     1 
ATOM   6646  C  CA    . VAL A 1 860 ? 7.085   -14.259 46.647  1.00 39.89 ? 860  VAL A CA    1 
ATOM   6647  C  C     . VAL A 1 860 ? 7.053   -15.530 45.798  1.00 39.50 ? 860  VAL A C     1 
ATOM   6648  O  O     . VAL A 1 860 ? 8.064   -16.205 45.677  1.00 39.27 ? 860  VAL A O     1 
ATOM   6649  C  CB    . VAL A 1 860 ? 7.900   -13.328 45.699  1.00 45.19 ? 860  VAL A CB    1 
ATOM   6650  C  CG1   . VAL A 1 860 ? 7.104   -12.606 44.629  1.00 42.31 ? 860  VAL A CG1   1 
ATOM   6651  C  CG2   . VAL A 1 860 ? 8.837   -12.486 46.498  1.00 38.80 ? 860  VAL A CG2   1 
ATOM   6652  N  N     . ASP A 1 861 ? 5.951   -15.731 45.116  1.00 38.72 ? 861  ASP A N     1 
ATOM   6653  C  CA    . ASP A 1 861 ? 5.828   -16.824 44.162  1.00 37.37 ? 861  ASP A CA    1 
ATOM   6654  C  C     . ASP A 1 861 ? 5.026   -16.375 42.952  1.00 35.94 ? 861  ASP A C     1 
ATOM   6655  O  O     . ASP A 1 861 ? 4.422   -15.291 43.009  1.00 36.52 ? 861  ASP A O     1 
ATOM   6656  C  CB    . ASP A 1 861 ? 5.083   -18.010 44.802  1.00 37.32 ? 861  ASP A CB    1 
ATOM   6657  C  CG    . ASP A 1 861 ? 5.525   -19.272 44.076  1.00 38.74 ? 861  ASP A CG    1 
ATOM   6658  O  OD1   . ASP A 1 861 ? 5.926   -19.144 42.906  1.00 40.62 ? 861  ASP A OD1   1 
ATOM   6659  O  OD2   . ASP A 1 861 ? 5.469   -20.366 44.688  1.00 42.56 ? 861  ASP A OD2   1 
ATOM   6660  N  N     . GLY A 1 862 ? 4.869   -17.173 41.922  1.00 34.93 ? 862  GLY A N     1 
ATOM   6661  C  CA    . GLY A 1 862 ? 4.012   -16.787 40.805  1.00 33.60 ? 862  GLY A CA    1 
ATOM   6662  C  C     . GLY A 1 862 ? 4.747   -16.972 39.492  1.00 33.29 ? 862  GLY A C     1 
ATOM   6663  O  O     . GLY A 1 862 ? 5.927   -16.648 39.331  1.00 34.35 ? 862  GLY A O     1 
ATOM   6664  N  N     . THR A 1 863 ? 4.061   -17.523 38.518  1.00 33.71 ? 863  THR A N     1 
ATOM   6665  C  CA    . THR A 1 863 ? 4.690   -17.793 37.237  1.00 35.41 ? 863  THR A CA    1 
ATOM   6666  C  C     . THR A 1 863 ? 5.171   -16.531 36.553  1.00 34.92 ? 863  THR A C     1 
ATOM   6667  O  O     . THR A 1 863 ? 6.233   -16.548 35.927  1.00 36.14 ? 863  THR A O     1 
ATOM   6668  C  CB    . THR A 1 863 ? 3.759   -18.603 36.301  1.00 39.83 ? 863  THR A CB    1 
ATOM   6669  O  OG1   . THR A 1 863 ? 3.423   -19.790 37.057  1.00 45.10 ? 863  THR A OG1   1 
ATOM   6670  C  CG2   . THR A 1 863 ? 4.655   -19.037 35.144  1.00 39.32 ? 863  THR A CG2   1 
ATOM   6671  N  N     . LEU A 1 864 ? 4.472   -15.436 36.707  1.00 34.80 ? 864  LEU A N     1 
ATOM   6672  C  CA    . LEU A 1 864 ? 4.801   -14.185 36.038  1.00 36.70 ? 864  LEU A CA    1 
ATOM   6673  C  C     . LEU A 1 864 ? 6.050   -13.588 36.699  1.00 37.30 ? 864  LEU A C     1 
ATOM   6674  O  O     . LEU A 1 864 ? 6.997   -13.202 36.011  1.00 36.57 ? 864  LEU A O     1 
ATOM   6675  C  CB    . LEU A 1 864 ? 3.637   -13.213 35.938  1.00 32.51 ? 864  LEU A CB    1 
ATOM   6676  C  CG    . LEU A 1 864 ? 3.912   -11.842 35.288  1.00 34.29 ? 864  LEU A CG    1 
ATOM   6677  C  CD1   . LEU A 1 864 ? 4.282   -11.981 33.822  1.00 36.50 ? 864  LEU A CD1   1 
ATOM   6678  C  CD2   . LEU A 1 864 ? 2.720   -10.917 35.403  1.00 36.62 ? 864  LEU A CD2   1 
ATOM   6679  N  N     . TYR A 1 865 ? 6.040   -13.634 38.031  1.00 36.96 ? 865  TYR A N     1 
ATOM   6680  C  CA    . TYR A 1 865 ? 7.172   -13.155 38.792  1.00 37.08 ? 865  TYR A CA    1 
ATOM   6681  C  C     . TYR A 1 865 ? 8.358   -14.045 38.417  1.00 38.03 ? 865  TYR A C     1 
ATOM   6682  O  O     . TYR A 1 865 ? 9.421   -13.526 38.134  1.00 37.74 ? 865  TYR A O     1 
ATOM   6683  C  CB    . TYR A 1 865 ? 6.811   -13.203 40.273  1.00 37.47 ? 865  TYR A CB    1 
ATOM   6684  C  CG    . TYR A 1 865 ? 7.891   -12.575 41.129  1.00 37.71 ? 865  TYR A CG    1 
ATOM   6685  C  CD1   . TYR A 1 865 ? 8.947   -13.392 41.540  1.00 38.43 ? 865  TYR A CD1   1 
ATOM   6686  C  CD2   . TYR A 1 865 ? 7.865   -11.252 41.498  1.00 37.36 ? 865  TYR A CD2   1 
ATOM   6687  C  CE1   . TYR A 1 865 ? 9.961   -12.818 42.291  1.00 36.56 ? 865  TYR A CE1   1 
ATOM   6688  C  CE2   . TYR A 1 865 ? 8.883   -10.692 42.256  1.00 36.37 ? 865  TYR A CE2   1 
ATOM   6689  C  CZ    . TYR A 1 865 ? 9.905   -11.526 42.682  1.00 36.21 ? 865  TYR A CZ    1 
ATOM   6690  O  OH    . TYR A 1 865 ? 10.945  -11.049 43.429  1.00 35.73 ? 865  TYR A OH    1 
ATOM   6691  N  N     . LYS A 1 866 ? 8.169   -15.364 38.306  1.00 38.92 ? 866  LYS A N     1 
ATOM   6692  C  CA    . LYS A 1 866 ? 9.269   -16.215 37.929  1.00 39.57 ? 866  LYS A CA    1 
ATOM   6693  C  C     . LYS A 1 866 ? 9.742   -16.070 36.493  1.00 40.47 ? 866  LYS A C     1 
ATOM   6694  O  O     . LYS A 1 866 ? 10.949  -16.194 36.326  1.00 39.00 ? 866  LYS A O     1 
ATOM   6695  C  CB    . LYS A 1 866 ? 9.259   -17.667 38.333  1.00 36.59 ? 866  LYS A CB    1 
ATOM   6696  C  CG    . LYS A 1 866 ? 8.097   -18.239 39.081  1.00 42.69 ? 866  LYS A CG    1 
ATOM   6697  C  CD    . LYS A 1 866 ? 8.399   -19.609 39.651  1.00 41.41 ? 866  LYS A CD    1 
ATOM   6698  C  CE    . LYS A 1 866 ? 8.079   -19.686 41.132  1.00 46.07 ? 866  LYS A CE    1 
ATOM   6699  N  NZ    . LYS A 1 866 ? 9.116   -20.450 41.877  1.00 51.19 ? 866  LYS A NZ    1 
ATOM   6700  N  N     . LEU A 1 867 ? 8.891   -16.048 35.478  1.00 41.91 ? 867  LEU A N     1 
ATOM   6701  C  CA    . LEU A 1 867 ? 9.268   -16.051 34.079  1.00 40.68 ? 867  LEU A CA    1 
ATOM   6702  C  C     . LEU A 1 867 ? 9.574   -14.703 33.475  1.00 39.86 ? 867  LEU A C     1 
ATOM   6703  O  O     . LEU A 1 867 ? 10.234  -14.667 32.436  1.00 41.66 ? 867  LEU A O     1 
ATOM   6704  C  CB    . LEU A 1 867 ? 8.186   -16.737 33.205  1.00 36.55 ? 867  LEU A CB    1 
ATOM   6705  C  CG    . LEU A 1 867 ? 7.917   -18.215 33.606  1.00 42.33 ? 867  LEU A CG    1 
ATOM   6706  C  CD1   . LEU A 1 867 ? 6.785   -18.801 32.744  1.00 41.37 ? 867  LEU A CD1   1 
ATOM   6707  C  CD2   . LEU A 1 867 ? 9.108   -19.125 33.320  1.00 37.46 ? 867  LEU A CD2   1 
ATOM   6708  N  N     . HIS A 1 868 ? 8.971   -13.608 33.883  1.00 38.46 ? 868  HIS A N     1 
ATOM   6709  C  CA    . HIS A 1 868 ? 9.153   -12.342 33.190  1.00 35.79 ? 868  HIS A CA    1 
ATOM   6710  C  C     . HIS A 1 868 ? 10.567  -11.830 33.431  1.00 35.82 ? 868  HIS A C     1 
ATOM   6711  O  O     . HIS A 1 868 ? 10.988  -11.583 34.557  1.00 34.54 ? 868  HIS A O     1 
ATOM   6712  C  CB    . HIS A 1 868 ? 8.126   -11.281 33.538  1.00 29.65 ? 868  HIS A CB    1 
ATOM   6713  C  CG    . HIS A 1 868 ? 8.013   -10.141 32.574  1.00 33.30 ? 868  HIS A CG    1 
ATOM   6714  N  ND1   . HIS A 1 868 ? 8.790   -8.994  32.666  1.00 36.53 ? 868  HIS A ND1   1 
ATOM   6715  C  CD2   . HIS A 1 868 ? 7.223   -9.988  31.473  1.00 29.21 ? 868  HIS A CD2   1 
ATOM   6716  C  CE1   . HIS A 1 868 ? 8.470   -8.178  31.657  1.00 37.29 ? 868  HIS A CE1   1 
ATOM   6717  N  NE2   . HIS A 1 868 ? 7.545   -8.789  30.899  1.00 33.63 ? 868  HIS A NE2   1 
ATOM   6718  N  N     . PRO A 1 869 ? 11.253  -11.518 32.341  1.00 35.33 ? 869  PRO A N     1 
ATOM   6719  C  CA    . PRO A 1 869 ? 12.518  -10.868 32.288  1.00 35.12 ? 869  PRO A CA    1 
ATOM   6720  C  C     . PRO A 1 869 ? 12.723  -9.582  33.045  1.00 35.34 ? 869  PRO A C     1 
ATOM   6721  O  O     . PRO A 1 869 ? 13.889  -9.281  33.313  1.00 36.36 ? 869  PRO A O     1 
ATOM   6722  C  CB    . PRO A 1 869 ? 12.627  -10.440 30.795  1.00 36.52 ? 869  PRO A CB    1 
ATOM   6723  C  CG    . PRO A 1 869 ? 11.163  -10.445 30.379  1.00 36.19 ? 869  PRO A CG    1 
ATOM   6724  C  CD    . PRO A 1 869 ? 10.753  -11.791 30.951  1.00 34.95 ? 869  PRO A CD    1 
ATOM   6725  N  N     . HIS A 1 870 ? 11.744  -8.695  33.144  1.00 34.04 ? 870  HIS A N     1 
ATOM   6726  C  CA    . HIS A 1 870 ? 11.919  -7.405  33.705  1.00 31.42 ? 870  HIS A CA    1 
ATOM   6727  C  C     . HIS A 1 870 ? 11.064  -7.200  34.921  1.00 32.13 ? 870  HIS A C     1 
ATOM   6728  O  O     . HIS A 1 870 ? 11.472  -6.337  35.709  1.00 32.34 ? 870  HIS A O     1 
ATOM   6729  C  CB    . HIS A 1 870 ? 11.647  -6.252  32.717  1.00 30.48 ? 870  HIS A CB    1 
ATOM   6730  C  CG    . HIS A 1 870 ? 12.492  -6.408  31.485  1.00 37.17 ? 870  HIS A CG    1 
ATOM   6731  N  ND1   . HIS A 1 870 ? 11.972  -6.466  30.217  1.00 43.68 ? 870  HIS A ND1   1 
ATOM   6732  C  CD2   . HIS A 1 870 ? 13.825  -6.592  31.329  1.00 38.58 ? 870  HIS A CD2   1 
ATOM   6733  C  CE1   . HIS A 1 870 ? 12.939  -6.645  29.323  1.00 41.87 ? 870  HIS A CE1   1 
ATOM   6734  N  NE2   . HIS A 1 870 ? 14.074  -6.737  29.987  1.00 39.48 ? 870  HIS A NE2   1 
ATOM   6735  N  N     . PHE A 1 871 ? 9.939   -7.941  35.022  1.00 32.09 ? 871  PHE A N     1 
ATOM   6736  C  CA    . PHE A 1 871 ? 9.002   -7.586  36.092  1.00 31.16 ? 871  PHE A CA    1 
ATOM   6737  C  C     . PHE A 1 871 ? 9.654   -7.418  37.458  1.00 30.99 ? 871  PHE A C     1 
ATOM   6738  O  O     . PHE A 1 871 ? 9.532   -6.366  38.089  1.00 30.63 ? 871  PHE A O     1 
ATOM   6739  C  CB    . PHE A 1 871 ? 7.829   -8.573  36.147  1.00 29.72 ? 871  PHE A CB    1 
ATOM   6740  C  CG    . PHE A 1 871 ? 6.791   -8.178  37.176  1.00 31.03 ? 871  PHE A CG    1 
ATOM   6741  C  CD1   . PHE A 1 871 ? 7.040   -8.336  38.530  1.00 31.48 ? 871  PHE A CD1   1 
ATOM   6742  C  CD2   . PHE A 1 871 ? 5.571   -7.647  36.795  1.00 31.42 ? 871  PHE A CD2   1 
ATOM   6743  C  CE1   . PHE A 1 871 ? 6.102   -8.019  39.495  1.00 31.53 ? 871  PHE A CE1   1 
ATOM   6744  C  CE2   . PHE A 1 871 ? 4.610   -7.329  37.739  1.00 28.49 ? 871  PHE A CE2   1 
ATOM   6745  C  CZ    . PHE A 1 871 ? 4.868   -7.496  39.096  1.00 29.87 ? 871  PHE A CZ    1 
ATOM   6746  N  N     . SER A 1 872 ? 10.257  -8.487  37.970  1.00 31.22 ? 872  SER A N     1 
ATOM   6747  C  CA    . SER A 1 872 ? 10.820  -8.487  39.306  1.00 33.48 ? 872  SER A CA    1 
ATOM   6748  C  C     . SER A 1 872 ? 11.889  -7.406  39.465  1.00 35.37 ? 872  SER A C     1 
ATOM   6749  O  O     . SER A 1 872 ? 11.772  -6.576  40.385  1.00 35.54 ? 872  SER A O     1 
ATOM   6750  C  CB    . SER A 1 872 ? 11.331  -9.878  39.683  1.00 31.97 ? 872  SER A CB    1 
ATOM   6751  O  OG    . SER A 1 872 ? 12.462  -10.253 38.928  1.00 29.61 ? 872  SER A OG    1 
ATOM   6752  N  N     . ARG A 1 873 ? 12.712  -7.191  38.438  1.00 37.55 ? 873  ARG A N     1 
ATOM   6753  C  CA    . ARG A 1 873 ? 13.691  -6.093  38.525  1.00 39.90 ? 873  ARG A CA    1 
ATOM   6754  C  C     . ARG A 1 873 ? 12.972  -4.751  38.570  1.00 39.34 ? 873  ARG A C     1 
ATOM   6755  O  O     . ARG A 1 873 ? 13.462  -3.911  39.341  1.00 41.38 ? 873  ARG A O     1 
ATOM   6756  C  CB    . ARG A 1 873 ? 14.760  -6.046  37.427  1.00 41.04 ? 873  ARG A CB    1 
ATOM   6757  C  CG    . ARG A 1 873 ? 15.432  -7.378  37.167  1.00 55.51 ? 873  ARG A CG    1 
ATOM   6758  C  CD    . ARG A 1 873 ? 16.033  -7.521  35.767  1.00 62.49 ? 873  ARG A CD    1 
ATOM   6759  N  NE    . ARG A 1 873 ? 16.965  -8.646  35.672  1.00 63.06 ? 873  ARG A NE    1 
ATOM   6760  C  CZ    . ARG A 1 873 ? 16.661  -9.925  35.515  1.00 69.20 ? 873  ARG A CZ    1 
ATOM   6761  N  NH1   . ARG A 1 873 ? 15.409  -10.371 35.419  1.00 70.01 ? 873  ARG A NH1   1 
ATOM   6762  N  NH2   . ARG A 1 873 ? 17.625  -10.851 35.480  1.00 71.29 ? 873  ARG A NH2   1 
ATOM   6763  N  N     . ILE A 1 874 ? 11.853  -4.507  37.863  1.00 38.05 ? 874  ILE A N     1 
ATOM   6764  C  CA    . ILE A 1 874 ? 11.318  -3.151  38.052  1.00 37.08 ? 874  ILE A CA    1 
ATOM   6765  C  C     . ILE A 1 874 ? 10.530  -2.981  39.317  1.00 36.69 ? 874  ILE A C     1 
ATOM   6766  O  O     . ILE A 1 874 ? 10.515  -1.902  39.898  1.00 36.77 ? 874  ILE A O     1 
ATOM   6767  C  CB    . ILE A 1 874 ? 10.825  -2.419  36.841  1.00 39.51 ? 874  ILE A CB    1 
ATOM   6768  C  CG1   . ILE A 1 874 ? 9.386   -1.963  36.880  1.00 33.59 ? 874  ILE A CG1   1 
ATOM   6769  C  CG2   . ILE A 1 874 ? 11.122  -3.213  35.561  1.00 38.52 ? 874  ILE A CG2   1 
ATOM   6770  C  CD1   . ILE A 1 874 ? 8.974   -1.012  37.952  1.00 40.57 ? 874  ILE A CD1   1 
ATOM   6771  N  N     . MET A 1 875 ? 9.923   -4.060  39.817  1.00 37.66 ? 875  MET A N     1 
ATOM   6772  C  CA    . MET A 1 875 ? 9.090   -3.902  41.023  1.00 38.51 ? 875  MET A CA    1 
ATOM   6773  C  C     . MET A 1 875 ? 10.020  -3.500  42.165  1.00 38.95 ? 875  MET A C     1 
ATOM   6774  O  O     . MET A 1 875 ? 9.702   -2.675  42.998  1.00 38.96 ? 875  MET A O     1 
ATOM   6775  C  CB    . MET A 1 875 ? 8.313   -5.164  41.220  1.00 35.68 ? 875  MET A CB    1 
ATOM   6776  C  CG    . MET A 1 875 ? 7.258   -5.299  42.276  1.00 41.01 ? 875  MET A CG    1 
ATOM   6777  S  SD    . MET A 1 875 ? 7.912   -5.803  43.870  1.00 42.82 ? 875  MET A SD    1 
ATOM   6778  C  CE    . MET A 1 875 ? 8.769   -7.320  43.460  1.00 42.85 ? 875  MET A CE    1 
ATOM   6779  N  N     . HIS A 1 876 ? 11.077  -4.332  42.287  1.00 40.42 ? 876  HIS A N     1 
ATOM   6780  C  CA    . HIS A 1 876 ? 12.082  -4.087  43.327  1.00 40.43 ? 876  HIS A CA    1 
ATOM   6781  C  C     . HIS A 1 876 ? 12.603  -2.670  43.314  1.00 40.24 ? 876  HIS A C     1 
ATOM   6782  O  O     . HIS A 1 876 ? 12.747  -2.048  44.364  1.00 39.34 ? 876  HIS A O     1 
ATOM   6783  C  CB    . HIS A 1 876 ? 13.222  -5.103  43.216  1.00 38.34 ? 876  HIS A CB    1 
ATOM   6784  C  CG    . HIS A 1 876 ? 12.785  -6.547  43.302  1.00 37.70 ? 876  HIS A CG    1 
ATOM   6785  N  ND1   . HIS A 1 876 ? 13.647  -7.542  42.891  1.00 31.34 ? 876  HIS A ND1   1 
ATOM   6786  C  CD2   . HIS A 1 876 ? 11.650  -7.174  43.680  1.00 32.80 ? 876  HIS A CD2   1 
ATOM   6787  C  CE1   . HIS A 1 876 ? 13.060  -8.738  43.024  1.00 38.35 ? 876  HIS A CE1   1 
ATOM   6788  N  NE2   . HIS A 1 876 ? 11.834  -8.550  43.501  1.00 37.62 ? 876  HIS A NE2   1 
ATOM   6789  N  N     . GLN A 1 877 ? 12.905  -2.124  42.142  1.00 42.05 ? 877  GLN A N     1 
ATOM   6790  C  CA    . GLN A 1 877 ? 13.359  -0.733  41.964  1.00 40.66 ? 877  GLN A CA    1 
ATOM   6791  C  C     . GLN A 1 877 ? 12.291  0.206   42.512  1.00 40.10 ? 877  GLN A C     1 
ATOM   6792  O  O     . GLN A 1 877 ? 12.568  1.272   43.082  1.00 39.04 ? 877  GLN A O     1 
ATOM   6793  C  CB    . GLN A 1 877 ? 13.500  -0.494  40.448  1.00 50.32 ? 877  GLN A CB    1 
ATOM   6794  C  CG    . GLN A 1 877 ? 14.873  -0.259  39.877  1.00 56.59 ? 877  GLN A CG    1 
ATOM   6795  C  CD    . GLN A 1 877 ? 15.096  -0.723  38.439  1.00 63.60 ? 877  GLN A CD    1 
ATOM   6796  O  OE1   . GLN A 1 877 ? 14.385  -0.347  37.493  1.00 63.22 ? 877  GLN A OE1   1 
ATOM   6797  N  NE2   . GLN A 1 877 ? 16.181  -1.500  38.211  1.00 61.62 ? 877  GLN A NE2   1 
ATOM   6798  N  N     . THR A 1 878 ? 11.036  -0.132  42.197  1.00 38.49 ? 878  THR A N     1 
ATOM   6799  C  CA    . THR A 1 878 ? 9.949   0.777   42.534  1.00 39.83 ? 878  THR A CA    1 
ATOM   6800  C  C     . THR A 1 878 ? 9.832   0.907   44.051  1.00 40.19 ? 878  THR A C     1 
ATOM   6801  O  O     . THR A 1 878 ? 9.515   1.993   44.530  1.00 39.35 ? 878  THR A O     1 
ATOM   6802  C  CB    . THR A 1 878 ? 8.609   0.418   41.908  1.00 37.53 ? 878  THR A CB    1 
ATOM   6803  O  OG1   . THR A 1 878 ? 8.712   0.302   40.486  1.00 36.37 ? 878  THR A OG1   1 
ATOM   6804  C  CG2   . THR A 1 878 ? 7.466   1.319   42.300  1.00 33.58 ? 878  THR A CG2   1 
ATOM   6805  N  N     . VAL A 1 879 ? 9.986   -0.239  44.699  1.00 40.50 ? 879  VAL A N     1 
ATOM   6806  C  CA    . VAL A 1 879 ? 9.795   -0.335  46.152  1.00 41.29 ? 879  VAL A CA    1 
ATOM   6807  C  C     . VAL A 1 879 ? 10.927  0.374   46.885  1.00 42.21 ? 879  VAL A C     1 
ATOM   6808  O  O     . VAL A 1 879 ? 10.749  1.161   47.805  1.00 42.83 ? 879  VAL A O     1 
ATOM   6809  C  CB    . VAL A 1 879 ? 9.847   -1.828  46.571  1.00 40.61 ? 879  VAL A CB    1 
ATOM   6810  C  CG1   . VAL A 1 879 ? 9.734   -1.991  48.086  1.00 33.47 ? 879  VAL A CG1   1 
ATOM   6811  C  CG2   . VAL A 1 879 ? 8.739   -2.546  45.812  1.00 31.08 ? 879  VAL A CG2   1 
ATOM   6812  N  N     . LYS A 1 880 ? 12.105  0.234   46.301  1.00 43.36 ? 880  LYS A N     1 
ATOM   6813  C  CA    . LYS A 1 880 ? 13.265  0.927   46.845  1.00 44.86 ? 880  LYS A CA    1 
ATOM   6814  C  C     . LYS A 1 880 ? 13.106  2.409   46.581  1.00 45.22 ? 880  LYS A C     1 
ATOM   6815  O  O     . LYS A 1 880 ? 13.208  3.117   47.602  1.00 47.08 ? 880  LYS A O     1 
ATOM   6816  C  CB    . LYS A 1 880 ? 14.552  0.270   46.416  1.00 48.12 ? 880  LYS A CB    1 
ATOM   6817  C  CG    . LYS A 1 880 ? 15.784  1.146   46.455  1.00 48.84 ? 880  LYS A CG    1 
ATOM   6818  C  CD    . LYS A 1 880 ? 16.928  0.406   45.771  1.00 56.60 ? 880  LYS A CD    1 
ATOM   6819  C  CE    . LYS A 1 880 ? 18.209  0.475   46.592  1.00 57.40 ? 880  LYS A CE    1 
ATOM   6820  N  NZ    . LYS A 1 880 ? 19.411  0.520   45.704  1.00 59.42 ? 880  LYS A NZ    1 
ATOM   6821  N  N     . GLU A 1 881 ? 12.602  2.891   45.444  1.00 44.15 ? 881  GLU A N     1 
ATOM   6822  C  CA    . GLU A 1 881 ? 12.398  4.321   45.355  1.00 42.97 ? 881  GLU A CA    1 
ATOM   6823  C  C     . GLU A 1 881 ? 11.222  4.889   46.112  1.00 40.92 ? 881  GLU A C     1 
ATOM   6824  O  O     . GLU A 1 881 ? 11.308  6.091   46.357  1.00 40.58 ? 881  GLU A O     1 
ATOM   6825  C  CB    . GLU A 1 881 ? 12.537  5.011   44.030  1.00 48.64 ? 881  GLU A CB    1 
ATOM   6826  C  CG    . GLU A 1 881 ? 12.173  4.347   42.740  1.00 60.69 ? 881  GLU A CG    1 
ATOM   6827  C  CD    . GLU A 1 881 ? 13.349  4.191   41.792  1.00 64.99 ? 881  GLU A CD    1 
ATOM   6828  O  OE1   . GLU A 1 881 ? 14.295  3.448   42.109  1.00 65.17 ? 881  GLU A OE1   1 
ATOM   6829  O  OE2   . GLU A 1 881 ? 13.335  4.859   40.734  1.00 69.10 ? 881  GLU A OE2   1 
ATOM   6830  N  N     . LEU A 1 882 ? 10.202  4.170   46.521  1.00 39.57 ? 882  LEU A N     1 
ATOM   6831  C  CA    . LEU A 1 882 ? 9.035   4.809   47.119  1.00 40.04 ? 882  LEU A CA    1 
ATOM   6832  C  C     . LEU A 1 882 ? 9.002   4.596   48.629  1.00 40.64 ? 882  LEU A C     1 
ATOM   6833  O  O     . LEU A 1 882 ? 8.408   5.407   49.357  1.00 40.01 ? 882  LEU A O     1 
ATOM   6834  C  CB    . LEU A 1 882 ? 7.721   4.401   46.447  1.00 37.10 ? 882  LEU A CB    1 
ATOM   6835  C  CG    . LEU A 1 882 ? 7.602   4.341   44.927  1.00 36.79 ? 882  LEU A CG    1 
ATOM   6836  C  CD1   . LEU A 1 882 ? 6.272   3.748   44.440  1.00 33.70 ? 882  LEU A CD1   1 
ATOM   6837  C  CD2   . LEU A 1 882 ? 7.684   5.751   44.351  1.00 33.46 ? 882  LEU A CD2   1 
ATOM   6838  N  N     . SER A 1 883 ? 9.623   3.541   49.149  1.00 40.94 ? 883  SER A N     1 
ATOM   6839  C  CA    . SER A 1 883 ? 9.766   3.436   50.606  1.00 43.35 ? 883  SER A CA    1 
ATOM   6840  C  C     . SER A 1 883 ? 11.247  3.409   50.976  1.00 43.74 ? 883  SER A C     1 
ATOM   6841  O  O     . SER A 1 883 ? 11.793  2.352   51.261  1.00 45.56 ? 883  SER A O     1 
ATOM   6842  C  CB    . SER A 1 883 ? 9.018   2.262   51.202  1.00 44.44 ? 883  SER A CB    1 
ATOM   6843  O  OG    . SER A 1 883 ? 7.637   2.340   50.906  1.00 52.06 ? 883  SER A OG    1 
ATOM   6844  N  N     . PRO A 1 884 ? 11.906  4.547   50.899  1.00 44.34 ? 884  PRO A N     1 
ATOM   6845  C  CA    . PRO A 1 884 ? 13.345  4.659   50.997  1.00 43.76 ? 884  PRO A CA    1 
ATOM   6846  C  C     . PRO A 1 884 ? 13.865  4.403   52.390  1.00 43.97 ? 884  PRO A C     1 
ATOM   6847  O  O     . PRO A 1 884 ? 15.076  4.214   52.540  1.00 45.45 ? 884  PRO A O     1 
ATOM   6848  C  CB    . PRO A 1 884 ? 13.651  6.078   50.537  1.00 43.54 ? 884  PRO A CB    1 
ATOM   6849  C  CG    . PRO A 1 884 ? 12.390  6.854   50.751  1.00 43.41 ? 884  PRO A CG    1 
ATOM   6850  C  CD    . PRO A 1 884 ? 11.268  5.872   50.616  1.00 44.23 ? 884  PRO A CD    1 
ATOM   6851  N  N     . LYS A 1 885 ? 12.964  4.261   53.358  1.00 42.97 ? 885  LYS A N     1 
ATOM   6852  C  CA    . LYS A 1 885 ? 13.415  3.998   54.719  1.00 41.87 ? 885  LYS A CA    1 
ATOM   6853  C  C     . LYS A 1 885 ? 13.323  2.512   55.037  1.00 41.81 ? 885  LYS A C     1 
ATOM   6854  O  O     . LYS A 1 885 ? 13.313  2.234   56.241  1.00 40.82 ? 885  LYS A O     1 
ATOM   6855  C  CB    . LYS A 1 885 ? 12.539  4.707   55.758  1.00 39.84 ? 885  LYS A CB    1 
ATOM   6856  C  CG    . LYS A 1 885 ? 12.658  6.213   55.645  1.00 41.88 ? 885  LYS A CG    1 
ATOM   6857  C  CD    . LYS A 1 885 ? 11.452  6.955   56.194  1.00 44.36 ? 885  LYS A CD    1 
ATOM   6858  C  CE    . LYS A 1 885 ? 11.843  8.414   56.433  1.00 44.89 ? 885  LYS A CE    1 
ATOM   6859  N  NZ    . LYS A 1 885 ? 13.194  8.674   55.837  1.00 50.49 ? 885  LYS A NZ    1 
ATOM   6860  N  N     . CYS A 1 886 ? 12.932  1.709   54.040  1.00 41.35 ? 886  CYS A N     1 
ATOM   6861  C  CA    . CYS A 1 886 ? 12.817  0.282   54.266  1.00 39.72 ? 886  CYS A CA    1 
ATOM   6862  C  C     . CYS A 1 886 ? 13.876  -0.335  53.356  1.00 39.27 ? 886  CYS A C     1 
ATOM   6863  O  O     . CYS A 1 886 ? 14.235  0.321   52.377  1.00 39.98 ? 886  CYS A O     1 
ATOM   6864  C  CB    . CYS A 1 886 ? 11.494  -0.365  53.851  1.00 40.69 ? 886  CYS A CB    1 
ATOM   6865  S  SG    . CYS A 1 886 ? 10.115  0.196   54.814  1.00 45.76 ? 886  CYS A SG    1 
ATOM   6866  N  N     . ASN A 1 887 ? 14.302  -1.503  53.754  1.00 39.58 ? 887  ASN A N     1 
ATOM   6867  C  CA    . ASN A 1 887 ? 15.370  -2.207  53.048  1.00 40.67 ? 887  ASN A CA    1 
ATOM   6868  C  C     . ASN A 1 887 ? 14.744  -3.595  52.858  1.00 40.24 ? 887  ASN A C     1 
ATOM   6869  O  O     . ASN A 1 887 ? 14.467  -4.278  53.827  1.00 39.53 ? 887  ASN A O     1 
ATOM   6870  C  CB    . ASN A 1 887 ? 16.672  -2.236  53.835  1.00 47.71 ? 887  ASN A CB    1 
ATOM   6871  C  CG    . ASN A 1 887 ? 17.806  -3.043  53.227  1.00 55.14 ? 887  ASN A CG    1 
ATOM   6872  O  OD1   . ASN A 1 887 ? 18.500  -3.835  53.905  1.00 59.78 ? 887  ASN A OD1   1 
ATOM   6873  N  ND2   . ASN A 1 887 ? 18.039  -2.918  51.922  1.00 52.03 ? 887  ASN A ND2   1 
ATOM   6874  N  N     . VAL A 1 888 ? 14.173  -3.783  51.670  1.00 40.97 ? 888  VAL A N     1 
ATOM   6875  C  CA    . VAL A 1 888 ? 13.414  -4.987  51.401  1.00 41.37 ? 888  VAL A CA    1 
ATOM   6876  C  C     . VAL A 1 888 ? 14.132  -5.888  50.419  1.00 42.64 ? 888  VAL A C     1 
ATOM   6877  O  O     . VAL A 1 888 ? 14.817  -5.423  49.510  1.00 42.70 ? 888  VAL A O     1 
ATOM   6878  C  CB    . VAL A 1 888 ? 11.942  -4.806  51.136  1.00 39.19 ? 888  VAL A CB    1 
ATOM   6879  C  CG1   . VAL A 1 888 ? 11.566  -3.361  50.958  1.00 35.41 ? 888  VAL A CG1   1 
ATOM   6880  C  CG2   . VAL A 1 888 ? 11.380  -5.768  50.145  1.00 41.70 ? 888  VAL A CG2   1 
ATOM   6881  N  N     . SER A 1 889 ? 14.308  -7.106  50.921  1.00 42.22 ? 889  SER A N     1 
ATOM   6882  C  CA    . SER A 1 889 ? 14.850  -8.222  50.198  1.00 42.22 ? 889  SER A CA    1 
ATOM   6883  C  C     . SER A 1 889 ? 13.648  -9.088  49.783  1.00 43.07 ? 889  SER A C     1 
ATOM   6884  O  O     . SER A 1 889 ? 12.704  -9.258  50.566  1.00 43.42 ? 889  SER A O     1 
ATOM   6885  C  CB    . SER A 1 889 ? 15.667  -9.057  51.203  1.00 42.66 ? 889  SER A CB    1 
ATOM   6886  O  OG    . SER A 1 889 ? 16.902  -8.449  51.530  1.00 49.65 ? 889  SER A OG    1 
ATOM   6887  N  N     . PHE A 1 890 ? 13.741  -9.709  48.623  1.00 43.05 ? 890  PHE A N     1 
ATOM   6888  C  CA    . PHE A 1 890 ? 12.663  -10.575 48.134  1.00 42.27 ? 890  PHE A CA    1 
ATOM   6889  C  C     . PHE A 1 890 ? 13.238  -11.967 47.964  1.00 42.89 ? 890  PHE A C     1 
ATOM   6890  O  O     . PHE A 1 890 ? 14.348  -12.116 47.460  1.00 43.82 ? 890  PHE A O     1 
ATOM   6891  C  CB    . PHE A 1 890 ? 12.238  -10.064 46.733  1.00 39.92 ? 890  PHE A CB    1 
ATOM   6892  C  CG    . PHE A 1 890 ? 11.475  -8.764  46.829  1.00 36.03 ? 890  PHE A CG    1 
ATOM   6893  C  CD1   . PHE A 1 890 ? 12.138  -7.561  46.947  1.00 31.36 ? 890  PHE A CD1   1 
ATOM   6894  C  CD2   . PHE A 1 890 ? 10.092  -8.760  46.789  1.00 34.62 ? 890  PHE A CD2   1 
ATOM   6895  C  CE1   . PHE A 1 890 ? 11.440  -6.385  47.032  1.00 26.33 ? 890  PHE A CE1   1 
ATOM   6896  C  CE2   . PHE A 1 890 ? 9.381   -7.576  46.844  1.00 31.64 ? 890  PHE A CE2   1 
ATOM   6897  C  CZ    . PHE A 1 890 ? 10.061  -6.388  46.994  1.00 32.28 ? 890  PHE A CZ    1 
ATOM   6898  N  N     . LEU A 1 891 ? 12.571  -12.984 48.437  1.00 43.18 ? 891  LEU A N     1 
ATOM   6899  C  CA    . LEU A 1 891 ? 13.097  -14.334 48.322  1.00 42.95 ? 891  LEU A CA    1 
ATOM   6900  C  C     . LEU A 1 891 ? 12.109  -15.145 47.497  1.00 42.63 ? 891  LEU A C     1 
ATOM   6901  O  O     . LEU A 1 891 ? 10.992  -15.329 47.957  1.00 41.84 ? 891  LEU A O     1 
ATOM   6902  C  CB    . LEU A 1 891 ? 13.166  -14.924 49.740  1.00 49.05 ? 891  LEU A CB    1 
ATOM   6903  C  CG    . LEU A 1 891 ? 13.826  -14.018 50.785  1.00 58.47 ? 891  LEU A CG    1 
ATOM   6904  C  CD1   . LEU A 1 891 ? 15.229  -13.548 50.424  1.00 58.29 ? 891  LEU A CD1   1 
ATOM   6905  C  CD2   . LEU A 1 891 ? 12.964  -12.810 51.151  1.00 60.06 ? 891  LEU A CD2   1 
ATOM   6906  N  N     . LEU A 1 892 ? 12.573  -15.782 46.434  1.00 43.67 ? 892  LEU A N     1 
ATOM   6907  C  CA    . LEU A 1 892 ? 11.707  -16.624 45.629  1.00 44.62 ? 892  LEU A CA    1 
ATOM   6908  C  C     . LEU A 1 892 ? 11.361  -17.897 46.373  1.00 45.51 ? 892  LEU A C     1 
ATOM   6909  O  O     . LEU A 1 892 ? 12.281  -18.564 46.867  1.00 46.66 ? 892  LEU A O     1 
ATOM   6910  C  CB    . LEU A 1 892 ? 12.344  -16.960 44.287  1.00 46.26 ? 892  LEU A CB    1 
ATOM   6911  C  CG    . LEU A 1 892 ? 11.425  -17.322 43.124  1.00 49.42 ? 892  LEU A CG    1 
ATOM   6912  C  CD1   . LEU A 1 892 ? 10.832  -18.729 43.287  1.00 53.64 ? 892  LEU A CD1   1 
ATOM   6913  C  CD2   . LEU A 1 892 ? 10.307  -16.332 42.878  1.00 49.59 ? 892  LEU A CD2   1 
ATOM   6914  N  N     . SER A 1 893 ? 10.110  -18.309 46.337  1.00 44.98 ? 893  SER A N     1 
ATOM   6915  C  CA    . SER A 1 893 ? 9.771   -19.643 46.858  1.00 45.28 ? 893  SER A CA    1 
ATOM   6916  C  C     . SER A 1 893 ? 10.012  -20.648 45.727  1.00 46.33 ? 893  SER A C     1 
ATOM   6917  O  O     . SER A 1 893 ? 9.179   -20.772 44.824  1.00 48.11 ? 893  SER A O     1 
ATOM   6918  C  CB    . SER A 1 893 ? 8.280   -19.621 47.166  1.00 45.51 ? 893  SER A CB    1 
ATOM   6919  O  OG    . SER A 1 893 ? 7.819   -20.898 47.552  1.00 51.66 ? 893  SER A OG    1 
ATOM   6920  N  N     . GLU A 1 894 ? 11.048  -21.457 45.782  1.00 46.18 ? 894  GLU A N     1 
ATOM   6921  C  CA    . GLU A 1 894 ? 11.372  -22.388 44.729  1.00 46.09 ? 894  GLU A CA    1 
ATOM   6922  C  C     . GLU A 1 894 ? 10.527  -23.638 44.680  1.00 45.97 ? 894  GLU A C     1 
ATOM   6923  O  O     . GLU A 1 894 ? 10.427  -24.091 43.542  1.00 46.28 ? 894  GLU A O     1 
ATOM   6924  C  CB    . GLU A 1 894 ? 12.847  -22.786 44.639  1.00 43.13 ? 894  GLU A CB    1 
ATOM   6925  C  CG    . GLU A 1 894 ? 13.701  -21.554 44.398  1.00 39.64 ? 894  GLU A CG    1 
ATOM   6926  C  CD    . GLU A 1 894 ? 15.149  -21.945 44.315  1.00 43.66 ? 894  GLU A CD    1 
ATOM   6927  O  OE1   . GLU A 1 894 ? 15.415  -22.781 43.434  1.00 51.84 ? 894  GLU A OE1   1 
ATOM   6928  O  OE2   . GLU A 1 894 ? 15.989  -21.413 45.044  1.00 46.97 ? 894  GLU A OE2   1 
ATOM   6929  N  N     . ASP A 1 895 ? 9.892   -24.048 45.763  1.00 45.79 ? 895  ASP A N     1 
ATOM   6930  C  CA    . ASP A 1 895 ? 9.092   -25.232 45.737  1.00 45.61 ? 895  ASP A CA    1 
ATOM   6931  C  C     . ASP A 1 895 ? 7.652   -25.093 46.160  1.00 46.90 ? 895  ASP A C     1 
ATOM   6932  O  O     . ASP A 1 895 ? 7.085   -26.071 46.688  1.00 46.58 ? 895  ASP A O     1 
ATOM   6933  C  CB    . ASP A 1 895 ? 9.784   -26.350 46.521  1.00 59.83 ? 895  ASP A CB    1 
ATOM   6934  C  CG    . ASP A 1 895 ? 8.788   -26.981 47.484  1.00 69.96 ? 895  ASP A CG    1 
ATOM   6935  O  OD1   . ASP A 1 895 ? 8.472   -26.256 48.460  1.00 72.20 ? 895  ASP A OD1   1 
ATOM   6936  O  OD2   . ASP A 1 895 ? 8.259   -28.096 47.201  1.00 76.92 ? 895  ASP A OD2   1 
ATOM   6937  N  N     . GLY A 1 896 ? 6.939   -23.996 45.804  1.00 44.96 ? 896  GLY A N     1 
ATOM   6938  C  CA    . GLY A 1 896 ? 5.495   -24.019 46.080  1.00 44.55 ? 896  GLY A CA    1 
ATOM   6939  C  C     . GLY A 1 896 ? 5.244   -23.746 47.560  1.00 43.81 ? 896  GLY A C     1 
ATOM   6940  O  O     . GLY A 1 896 ? 6.212   -23.650 48.295  1.00 43.77 ? 896  GLY A O     1 
ATOM   6941  N  N     . SER A 1 897 ? 4.028   -23.410 47.957  1.00 43.58 ? 897  SER A N     1 
ATOM   6942  C  CA    . SER A 1 897 ? 3.787   -22.983 49.336  1.00 44.20 ? 897  SER A CA    1 
ATOM   6943  C  C     . SER A 1 897 ? 3.329   -24.089 50.277  1.00 45.01 ? 897  SER A C     1 
ATOM   6944  O  O     . SER A 1 897 ? 2.684   -23.789 51.286  1.00 44.49 ? 897  SER A O     1 
ATOM   6945  C  CB    . SER A 1 897 ? 2.664   -21.934 49.196  1.00 43.89 ? 897  SER A CB    1 
ATOM   6946  O  OG    . SER A 1 897 ? 1.568   -22.507 48.480  1.00 39.57 ? 897  SER A OG    1 
ATOM   6947  N  N     . GLY A 1 898 ? 3.562   -25.360 49.954  1.00 44.93 ? 898  GLY A N     1 
ATOM   6948  C  CA    . GLY A 1 898 ? 3.129   -26.536 50.674  1.00 42.79 ? 898  GLY A CA    1 
ATOM   6949  C  C     . GLY A 1 898 ? 3.839   -26.751 51.993  1.00 41.70 ? 898  GLY A C     1 
ATOM   6950  O  O     . GLY A 1 898 ? 3.287   -27.179 53.013  1.00 41.77 ? 898  GLY A O     1 
ATOM   6951  N  N     . LYS A 1 899 ? 5.117   -26.423 51.974  1.00 42.00 ? 899  LYS A N     1 
ATOM   6952  C  CA    . LYS A 1 899 ? 5.948   -26.544 53.172  1.00 42.32 ? 899  LYS A CA    1 
ATOM   6953  C  C     . LYS A 1 899 ? 5.261   -25.638 54.199  1.00 43.80 ? 899  LYS A C     1 
ATOM   6954  O  O     . LYS A 1 899 ? 4.951   -25.990 55.337  1.00 45.25 ? 899  LYS A O     1 
ATOM   6955  C  CB    . LYS A 1 899 ? 7.334   -25.977 52.823  1.00 45.10 ? 899  LYS A CB    1 
ATOM   6956  C  CG    . LYS A 1 899 ? 8.416   -26.329 53.827  1.00 43.36 ? 899  LYS A CG    1 
ATOM   6957  C  CD    . LYS A 1 899 ? 9.343   -25.200 54.157  1.00 46.53 ? 899  LYS A CD    1 
ATOM   6958  C  CE    . LYS A 1 899 ? 10.719  -25.344 53.529  1.00 48.59 ? 899  LYS A CE    1 
ATOM   6959  N  NZ    . LYS A 1 899 ? 11.282  -23.965 53.280  1.00 55.85 ? 899  LYS A NZ    1 
ATOM   6960  N  N     . GLY A 1 900 ? 5.024   -24.413 53.744  1.00 43.20 ? 900  GLY A N     1 
ATOM   6961  C  CA    . GLY A 1 900 ? 4.391   -23.364 54.514  1.00 42.25 ? 900  GLY A CA    1 
ATOM   6962  C  C     . GLY A 1 900 ? 3.002   -23.763 54.988  1.00 41.99 ? 900  GLY A C     1 
ATOM   6963  O  O     . GLY A 1 900 ? 2.677   -23.425 56.129  1.00 41.28 ? 900  GLY A O     1 
ATOM   6964  N  N     . ALA A 1 901 ? 2.217   -24.460 54.195  1.00 41.46 ? 901  ALA A N     1 
ATOM   6965  C  CA    . ALA A 1 901 ? 0.846   -24.730 54.644  1.00 43.65 ? 901  ALA A CA    1 
ATOM   6966  C  C     . ALA A 1 901 ? 0.899   -25.783 55.753  1.00 44.95 ? 901  ALA A C     1 
ATOM   6967  O  O     . ALA A 1 901 ? 0.094   -25.889 56.664  1.00 44.99 ? 901  ALA A O     1 
ATOM   6968  C  CB    . ALA A 1 901 ? 0.053   -25.318 53.474  1.00 46.60 ? 901  ALA A CB    1 
ATOM   6969  N  N     . ALA A 1 902 ? 1.834   -26.693 55.537  1.00 45.42 ? 902  ALA A N     1 
ATOM   6970  C  CA    . ALA A 1 902 ? 2.136   -27.787 56.427  1.00 46.65 ? 902  ALA A CA    1 
ATOM   6971  C  C     . ALA A 1 902 ? 2.568   -27.260 57.804  1.00 47.12 ? 902  ALA A C     1 
ATOM   6972  O  O     . ALA A 1 902 ? 2.267   -27.810 58.855  1.00 48.16 ? 902  ALA A O     1 
ATOM   6973  C  CB    . ALA A 1 902 ? 3.399   -28.431 55.786  1.00 51.09 ? 902  ALA A CB    1 
ATOM   6974  N  N     . LEU A 1 903 ? 3.426   -26.257 57.768  1.00 46.50 ? 903  LEU A N     1 
ATOM   6975  C  CA    . LEU A 1 903 ? 3.935   -25.643 58.983  1.00 47.61 ? 903  LEU A CA    1 
ATOM   6976  C  C     . LEU A 1 903 ? 2.733   -25.073 59.732  1.00 49.35 ? 903  LEU A C     1 
ATOM   6977  O  O     . LEU A 1 903 ? 2.707   -25.045 60.964  1.00 49.94 ? 903  LEU A O     1 
ATOM   6978  C  CB    . LEU A 1 903 ? 4.961   -24.574 58.604  1.00 43.95 ? 903  LEU A CB    1 
ATOM   6979  C  CG    . LEU A 1 903 ? 6.400   -25.026 58.345  1.00 43.24 ? 903  LEU A CG    1 
ATOM   6980  C  CD1   . LEU A 1 903 ? 7.268   -23.862 57.870  1.00 40.85 ? 903  LEU A CD1   1 
ATOM   6981  C  CD2   . LEU A 1 903 ? 7.043   -25.567 59.622  1.00 44.79 ? 903  LEU A CD2   1 
ATOM   6982  N  N     . ILE A 1 904 ? 1.754   -24.576 58.970  1.00 49.23 ? 904  ILE A N     1 
ATOM   6983  C  CA    . ILE A 1 904 ? 0.580   -23.975 59.559  1.00 49.42 ? 904  ILE A CA    1 
ATOM   6984  C  C     . ILE A 1 904 ? -0.323  -25.094 60.065  1.00 49.60 ? 904  ILE A C     1 
ATOM   6985  O  O     . ILE A 1 904 ? -0.914  -24.948 61.135  1.00 50.61 ? 904  ILE A O     1 
ATOM   6986  C  CB    . ILE A 1 904 ? -0.184  -23.038 58.628  1.00 50.49 ? 904  ILE A CB    1 
ATOM   6987  C  CG1   . ILE A 1 904 ? 0.534   -21.680 58.459  1.00 46.05 ? 904  ILE A CG1   1 
ATOM   6988  C  CG2   . ILE A 1 904 ? -1.618  -22.782 59.084  1.00 48.41 ? 904  ILE A CG2   1 
ATOM   6989  C  CD1   . ILE A 1 904 ? 0.209   -21.129 57.073  1.00 37.86 ? 904  ILE A CD1   1 
ATOM   6990  N  N     . THR A 1 905 ? -0.425  -26.163 59.307  1.00 49.49 ? 905  THR A N     1 
ATOM   6991  C  CA    . THR A 1 905 ? -1.135  -27.351 59.798  1.00 50.99 ? 905  THR A CA    1 
ATOM   6992  C  C     . THR A 1 905 ? -0.468  -27.829 61.095  1.00 52.10 ? 905  THR A C     1 
ATOM   6993  O  O     . THR A 1 905 ? -1.220  -28.208 61.994  1.00 52.65 ? 905  THR A O     1 
ATOM   6994  C  CB    . THR A 1 905 ? -1.037  -28.469 58.750  1.00 47.06 ? 905  THR A CB    1 
ATOM   6995  O  OG1   . THR A 1 905 ? -1.312  -27.844 57.493  1.00 52.57 ? 905  THR A OG1   1 
ATOM   6996  C  CG2   . THR A 1 905 ? -2.002  -29.600 58.934  1.00 40.24 ? 905  THR A CG2   1 
ATOM   6997  N  N     . ALA A 1 906 ? 0.828   -27.694 61.282  1.00 52.77 ? 906  ALA A N     1 
ATOM   6998  C  CA    . ALA A 1 906 ? 1.447   -28.129 62.533  1.00 55.96 ? 906  ALA A CA    1 
ATOM   6999  C  C     . ALA A 1 906 ? 0.942   -27.370 63.746  1.00 57.90 ? 906  ALA A C     1 
ATOM   7000  O  O     . ALA A 1 906 ? 0.495   -27.917 64.753  1.00 58.64 ? 906  ALA A O     1 
ATOM   7001  C  CB    . ALA A 1 906 ? 2.955   -28.169 62.462  1.00 50.70 ? 906  ALA A CB    1 
ATOM   7002  N  N     . VAL A 1 907 ? 0.872   -26.063 63.636  1.00 60.23 ? 907  VAL A N     1 
ATOM   7003  C  CA    . VAL A 1 907 ? 0.267   -25.142 64.585  1.00 61.37 ? 907  VAL A CA    1 
ATOM   7004  C  C     . VAL A 1 907 ? -1.215  -25.453 64.765  1.00 61.86 ? 907  VAL A C     1 
ATOM   7005  O  O     . VAL A 1 907 ? -1.730  -25.507 65.880  1.00 61.90 ? 907  VAL A O     1 
ATOM   7006  C  CB    . VAL A 1 907 ? 0.402   -23.735 63.950  1.00 64.65 ? 907  VAL A CB    1 
ATOM   7007  C  CG1   . VAL A 1 907 ? -0.719  -22.802 64.374  1.00 62.70 ? 907  VAL A CG1   1 
ATOM   7008  C  CG2   . VAL A 1 907 ? 1.807   -23.248 64.264  1.00 60.02 ? 907  VAL A CG2   1 
ATOM   7009  N  N     . GLY A 1 908 ? -1.903  -25.635 63.643  1.00 62.37 ? 908  GLY A N     1 
ATOM   7010  C  CA    . GLY A 1 908 ? -3.291  -26.109 63.729  1.00 62.52 ? 908  GLY A CA    1 
ATOM   7011  C  C     . GLY A 1 908 ? -3.299  -27.181 64.835  1.00 63.89 ? 908  GLY A C     1 
ATOM   7012  O  O     . GLY A 1 908 ? -3.466  -26.863 66.016  1.00 64.53 ? 908  GLY A O     1 
ATOM   7013  N  N     . VAL A 1 909 ? -2.961  -28.417 64.474  1.00 63.22 ? 909  VAL A N     1 
ATOM   7014  C  CA    . VAL A 1 909 ? -2.994  -29.541 65.378  1.00 62.95 ? 909  VAL A CA    1 
ATOM   7015  C  C     . VAL A 1 909 ? -2.635  -29.188 66.807  1.00 63.43 ? 909  VAL A C     1 
ATOM   7016  O  O     . VAL A 1 909 ? -3.322  -29.648 67.714  1.00 62.64 ? 909  VAL A O     1 
ATOM   7017  C  CB    . VAL A 1 909 ? -2.201  -30.754 64.870  1.00 61.73 ? 909  VAL A CB    1 
ATOM   7018  C  CG1   . VAL A 1 909 ? -1.991  -31.789 65.946  1.00 54.82 ? 909  VAL A CG1   1 
ATOM   7019  C  CG2   . VAL A 1 909 ? -2.924  -31.367 63.678  1.00 61.65 ? 909  VAL A CG2   1 
ATOM   7020  N  N     . ARG A 1 910 ? -1.616  -28.368 67.007  1.00 65.03 ? 910  ARG A N     1 
ATOM   7021  C  CA    . ARG A 1 910 ? -1.290  -27.895 68.354  1.00 67.54 ? 910  ARG A CA    1 
ATOM   7022  C  C     . ARG A 1 910 ? -2.571  -27.180 68.827  1.00 69.81 ? 910  ARG A C     1 
ATOM   7023  O  O     . ARG A 1 910 ? -3.560  -27.790 69.244  1.00 69.12 ? 910  ARG A O     1 
ATOM   7024  C  CB    . ARG A 1 910 ? -0.134  -26.921 68.305  1.00 69.55 ? 910  ARG A CB    1 
ATOM   7025  C  CG    . ARG A 1 910 ? 1.064   -27.120 69.199  1.00 74.06 ? 910  ARG A CG    1 
ATOM   7026  C  CD    . ARG A 1 910 ? 2.355   -27.195 68.403  1.00 79.61 ? 910  ARG A CD    1 
ATOM   7027  N  NE    . ARG A 1 910 ? 3.336   -26.144 68.580  1.00 82.19 ? 910  ARG A NE    1 
ATOM   7028  C  CZ    . ARG A 1 910 ? 3.161   -24.831 68.673  1.00 82.91 ? 910  ARG A CZ    1 
ATOM   7029  N  NH1   . ARG A 1 910 ? 1.931   -24.326 68.628  1.00 81.09 ? 910  ARG A NH1   1 
ATOM   7030  N  NH2   . ARG A 1 910 ? 4.209   -24.017 68.816  1.00 81.75 ? 910  ARG A NH2   1 
ATOM   7031  N  N     . LEU A 1 911 ? -2.567  -25.868 68.584  1.00 71.47 ? 911  LEU A N     1 
ATOM   7032  C  CA    . LEU A 1 911 ? -3.760  -25.071 68.863  1.00 72.83 ? 911  LEU A CA    1 
ATOM   7033  C  C     . LEU A 1 911 ? -4.946  -25.901 68.363  1.00 73.24 ? 911  LEU A C     1 
ATOM   7034  O  O     . LEU A 1 911 ? -5.287  -25.828 67.185  1.00 73.94 ? 911  LEU A O     1 
ATOM   7035  C  CB    . LEU A 1 911 ? -3.694  -23.752 68.078  1.00 74.80 ? 911  LEU A CB    1 
ATOM   7036  C  CG    . LEU A 1 911 ? -2.331  -23.048 68.122  1.00 75.24 ? 911  LEU A CG    1 
ATOM   7037  C  CD1   . LEU A 1 911 ? -2.512  -21.560 67.860  1.00 74.40 ? 911  LEU A CD1   1 
ATOM   7038  C  CD2   . LEU A 1 911 ? -1.640  -23.283 69.464  1.00 74.92 ? 911  LEU A CD2   1 
ATOM   7039  N  N     . ARG A 1 912 ? -5.426  -26.771 69.231  1.00 72.64 ? 912  ARG A N     1 
ATOM   7040  C  CA    . ARG A 1 912 ? -6.538  -27.662 68.941  1.00 72.33 ? 912  ARG A CA    1 
ATOM   7041  C  C     . ARG A 1 912 ? -6.931  -28.409 70.225  1.00 73.06 ? 912  ARG A C     1 
ATOM   7042  O  O     . ARG A 1 912 ? -6.716  -27.933 71.351  1.00 73.10 ? 912  ARG A O     1 
ATOM   7043  C  CB    . ARG A 1 912 ? -6.190  -28.648 67.832  1.00 66.10 ? 912  ARG A CB    1 
ATOM   7044  C  CG    . ARG A 1 912 ? -7.346  -29.044 66.943  1.00 66.36 ? 912  ARG A CG    1 
ATOM   7045  C  CD    . ARG A 1 912 ? -7.389  -30.520 66.616  1.00 62.22 ? 912  ARG A CD    1 
ATOM   7046  N  NE    . ARG A 1 912 ? -8.079  -31.869 66.201  0.00 30.00 ? 912  ARG A NE    1 
ATOM   7047  C  CZ    . ARG A 1 912 ? -8.488  -33.071 66.601  0.00 30.00 ? 912  ARG A CZ    1 
ATOM   7048  N  NH1   . ARG A 1 912 ? -8.103  -33.651 67.733  0.00 30.00 ? 912  ARG A NH1   1 
ATOM   7049  N  NH2   . ARG A 1 912 ? -9.349  -33.732 65.819  0.00 30.00 ? 912  ARG A NH2   1 
ATOM   7050  N  N     . THR A 1 913 ? -5.975  -29.998 69.387  0.00 30.00 ? 913  THR A N     1 
ATOM   7051  C  CA    . THR A 1 913 ? -5.746  -31.062 70.364  0.00 30.00 ? 913  THR A CA    1 
ATOM   7052  C  C     . THR A 1 913 ? -4.570  -30.647 71.256  0.00 30.00 ? 913  THR A C     1 
ATOM   7053  O  O     . THR A 1 913 ? -3.441  -31.143 71.255  0.00 30.00 ? 913  THR A O     1 
ATOM   7054  C  CB    . THR A 1 913 ? -5.465  -32.393 69.649  0.00 30.00 ? 913  THR A CB    1 
ATOM   7055  O  OG1   . THR A 1 913 ? -6.700  -33.021 69.254  0.00 30.00 ? 913  THR A OG1   1 
ATOM   7056  C  CG2   . THR A 1 913 ? -4.640  -33.347 70.502  0.00 30.00 ? 913  THR A CG2   1 
ATOM   7057  N  N     . GLU A 1 914 ? -4.878  -29.583 71.998  0.00 30.00 ? 914  GLU A N     1 
ATOM   7058  C  CA    . GLU A 1 914 ? -3.976  -28.868 72.874  0.00 30.00 ? 914  GLU A CA    1 
ATOM   7059  C  C     . GLU A 1 914 ? -3.321  -29.740 73.931  0.00 30.00 ? 914  GLU A C     1 
ATOM   7060  O  O     . GLU A 1 914 ? -3.977  -30.192 74.896  0.00 30.00 ? 914  GLU A O     1 
ATOM   7061  C  CB    . GLU A 1 914 ? -4.729  -27.695 73.519  0.00 30.00 ? 914  GLU A CB    1 
ATOM   7062  C  CG    . GLU A 1 914 ? -6.024  -27.290 72.840  0.00 30.00 ? 914  GLU A CG    1 
ATOM   7063  C  CD    . GLU A 1 914 ? -7.229  -27.169 73.747  0.00 30.00 ? 914  GLU A CD    1 
ATOM   7064  O  OE1   . GLU A 1 914 ? -7.101  -27.050 74.987  0.00 30.00 ? 914  GLU A OE1   1 
ATOM   7065  O  OE2   . GLU A 1 914 ? -8.384  -27.184 73.247  0.00 30.00 ? 914  GLU A OE2   1 
ATOM   7066  N  N     . ASP B 1 16  ? -4.983  -65.869 19.321  0.00 30.00 ? 16   ASP B N     1 
ATOM   7067  C  CA    . ASP B 1 16  ? -5.670  -65.289 20.513  0.00 30.00 ? 16   ASP B CA    1 
ATOM   7068  C  C     . ASP B 1 16  ? -4.729  -64.971 21.675  0.00 30.00 ? 16   ASP B C     1 
ATOM   7069  O  O     . ASP B 1 16  ? -5.153  -64.523 22.763  0.00 30.00 ? 16   ASP B O     1 
ATOM   7070  C  CB    . ASP B 1 16  ? -6.917  -66.050 20.924  0.00 30.00 ? 16   ASP B CB    1 
ATOM   7071  C  CG    . ASP B 1 16  ? -6.822  -67.494 21.347  0.00 30.00 ? 16   ASP B CG    1 
ATOM   7072  O  OD1   . ASP B 1 16  ? -5.752  -68.146 21.258  0.00 30.00 ? 16   ASP B OD1   1 
ATOM   7073  O  OD2   . ASP B 1 16  ? -7.873  -68.029 21.796  0.00 30.00 ? 16   ASP B OD2   1 
ATOM   7074  N  N     . ASP B 1 17  ? -2.897  -63.997 20.808  1.00 66.42 ? 17   ASP B N     1 
ATOM   7075  C  CA    . ASP B 1 17  ? -2.231  -64.444 22.046  1.00 64.93 ? 17   ASP B CA    1 
ATOM   7076  C  C     . ASP B 1 17  ? -2.367  -63.320 23.070  1.00 63.31 ? 17   ASP B C     1 
ATOM   7077  O  O     . ASP B 1 17  ? -3.002  -62.277 22.794  1.00 62.73 ? 17   ASP B O     1 
ATOM   7078  C  CB    . ASP B 1 17  ? -0.783  -64.812 21.723  1.00 69.18 ? 17   ASP B CB    1 
ATOM   7079  C  CG    . ASP B 1 17  ? -0.019  -63.714 21.013  1.00 71.80 ? 17   ASP B CG    1 
ATOM   7080  O  OD1   . ASP B 1 17  ? -0.381  -62.534 21.224  1.00 76.64 ? 17   ASP B OD1   1 
ATOM   7081  O  OD2   . ASP B 1 17  ? 0.949   -63.946 20.254  1.00 74.26 ? 17   ASP B OD2   1 
ATOM   7082  N  N     . GLN B 1 18  ? -1.796  -63.521 24.268  1.00 60.96 ? 18   GLN B N     1 
ATOM   7083  C  CA    . GLN B 1 18  ? -1.858  -62.384 25.190  1.00 58.08 ? 18   GLN B CA    1 
ATOM   7084  C  C     . GLN B 1 18  ? -0.892  -61.295 24.728  1.00 55.37 ? 18   GLN B C     1 
ATOM   7085  O  O     . GLN B 1 18  ? -1.161  -60.110 24.897  1.00 54.39 ? 18   GLN B O     1 
ATOM   7086  C  CB    . GLN B 1 18  ? -1.752  -62.811 26.637  1.00 57.96 ? 18   GLN B CB    1 
ATOM   7087  C  CG    . GLN B 1 18  ? -2.881  -62.206 27.478  1.00 57.02 ? 18   GLN B CG    1 
ATOM   7088  C  CD    . GLN B 1 18  ? -4.231  -62.777 27.090  1.00 55.94 ? 18   GLN B CD    1 
ATOM   7089  O  OE1   . GLN B 1 18  ? -4.962  -61.465 26.954  0.00 30.00 ? 18   GLN B OE1   1 
ATOM   7090  N  NE2   . GLN B 1 18  ? -4.356  -63.439 26.037  0.00 30.00 ? 18   GLN B NE2   1 
ATOM   7091  N  N     . VAL B 1 19  ? 0.119   -61.689 23.969  1.00 53.54 ? 19   VAL B N     1 
ATOM   7092  C  CA    . VAL B 1 19  ? 1.173   -60.813 23.500  1.00 52.22 ? 19   VAL B CA    1 
ATOM   7093  C  C     . VAL B 1 19  ? 0.671   -59.896 22.396  1.00 51.38 ? 19   VAL B C     1 
ATOM   7094  O  O     . VAL B 1 19  ? 1.083   -58.743 22.296  1.00 50.52 ? 19   VAL B O     1 
ATOM   7095  C  CB    . VAL B 1 19  ? 2.440   -61.582 23.081  1.00 49.95 ? 19   VAL B CB    1 
ATOM   7096  C  CG1   . VAL B 1 19  ? 3.329   -60.769 22.158  1.00 45.80 ? 19   VAL B CG1   1 
ATOM   7097  C  CG2   . VAL B 1 19  ? 3.263   -61.993 24.310  1.00 45.85 ? 19   VAL B CG2   1 
ATOM   7098  N  N     . LYS B 1 20  ? -0.256  -60.418 21.598  1.00 51.42 ? 20   LYS B N     1 
ATOM   7099  C  CA    . LYS B 1 20  ? -0.849  -59.660 20.508  1.00 51.35 ? 20   LYS B CA    1 
ATOM   7100  C  C     . LYS B 1 20  ? -1.818  -58.626 21.076  1.00 50.13 ? 20   LYS B C     1 
ATOM   7101  O  O     . LYS B 1 20  ? -1.903  -57.495 20.595  1.00 48.66 ? 20   LYS B O     1 
ATOM   7102  C  CB    . LYS B 1 20  ? -1.547  -60.568 19.497  1.00 57.07 ? 20   LYS B CB    1 
ATOM   7103  C  CG    . LYS B 1 20  ? -0.599  -61.346 18.593  1.00 63.05 ? 20   LYS B CG    1 
ATOM   7104  C  CD    . LYS B 1 20  ? 0.604   -60.512 18.163  1.00 68.77 ? 20   LYS B CD    1 
ATOM   7105  C  CE    . LYS B 1 20  ? 1.717   -61.386 17.590  1.00 70.45 ? 20   LYS B CE    1 
ATOM   7106  N  NZ    . LYS B 1 20  ? 2.281   -60.840 16.318  1.00 71.57 ? 20   LYS B NZ    1 
ATOM   7107  N  N     . LYS B 1 21  ? -2.474  -59.003 22.172  1.00 50.05 ? 21   LYS B N     1 
ATOM   7108  C  CA    . LYS B 1 21  ? -3.397  -58.055 22.807  1.00 50.33 ? 21   LYS B CA    1 
ATOM   7109  C  C     . LYS B 1 21  ? -2.642  -56.852 23.344  1.00 50.67 ? 21   LYS B C     1 
ATOM   7110  O  O     . LYS B 1 21  ? -2.949  -55.704 23.005  1.00 52.85 ? 21   LYS B O     1 
ATOM   7111  C  CB    . LYS B 1 21  ? -4.214  -58.753 23.884  1.00 52.82 ? 21   LYS B CB    1 
ATOM   7112  C  CG    . LYS B 1 21  ? -5.605  -59.190 23.473  1.00 53.77 ? 21   LYS B CG    1 
ATOM   7113  C  CD    . LYS B 1 21  ? -5.836  -60.663 23.760  1.00 56.95 ? 21   LYS B CD    1 
ATOM   7114  C  CE    . LYS B 1 21  ? -7.099  -61.173 23.082  1.00 60.25 ? 21   LYS B CE    1 
ATOM   7115  N  NZ    . LYS B 1 21  ? -8.323  -60.473 23.584  1.00 62.73 ? 21   LYS B NZ    1 
ATOM   7116  N  N     . ILE B 1 22  ? -1.600  -57.098 24.124  1.00 48.63 ? 22   ILE B N     1 
ATOM   7117  C  CA    . ILE B 1 22  ? -0.759  -56.062 24.720  1.00 45.83 ? 22   ILE B CA    1 
ATOM   7118  C  C     . ILE B 1 22  ? -0.168  -55.147 23.653  1.00 43.82 ? 22   ILE B C     1 
ATOM   7119  O  O     . ILE B 1 22  ? -0.154  -53.914 23.759  1.00 41.95 ? 22   ILE B O     1 
ATOM   7120  C  CB    . ILE B 1 22  ? 0.318   -56.796 25.539  1.00 42.66 ? 22   ILE B CB    1 
ATOM   7121  C  CG1   . ILE B 1 22  ? -0.311  -57.408 26.813  1.00 41.72 ? 22   ILE B CG1   1 
ATOM   7122  C  CG2   . ILE B 1 22  ? 1.486   -55.926 25.952  1.00 44.23 ? 22   ILE B CG2   1 
ATOM   7123  C  CD1   . ILE B 1 22  ? 0.437   -58.713 27.127  1.00 42.62 ? 22   ILE B CD1   1 
ATOM   7124  N  N     . ASP B 1 23  ? 0.268   -55.757 22.549  1.00 42.94 ? 23   ASP B N     1 
ATOM   7125  C  CA    . ASP B 1 23  ? 0.885   -55.025 21.453  1.00 43.49 ? 23   ASP B CA    1 
ATOM   7126  C  C     . ASP B 1 23  ? -0.050  -53.960 20.936  1.00 44.76 ? 23   ASP B C     1 
ATOM   7127  O  O     . ASP B 1 23  ? 0.380   -52.915 20.478  1.00 45.50 ? 23   ASP B O     1 
ATOM   7128  C  CB    . ASP B 1 23  ? 1.256   -55.963 20.306  1.00 42.99 ? 23   ASP B CB    1 
ATOM   7129  C  CG    . ASP B 1 23  ? 2.673   -56.498 20.444  1.00 45.12 ? 23   ASP B CG    1 
ATOM   7130  O  OD1   . ASP B 1 23  ? 3.484   -56.034 21.276  1.00 39.49 ? 23   ASP B OD1   1 
ATOM   7131  O  OD2   . ASP B 1 23  ? 3.003   -57.424 19.671  1.00 48.35 ? 23   ASP B OD2   1 
ATOM   7132  N  N     . LYS B 1 24  ? -1.339  -54.322 20.961  1.00 45.87 ? 24   LYS B N     1 
ATOM   7133  C  CA    . LYS B 1 24  ? -2.439  -53.478 20.530  1.00 43.85 ? 24   LYS B CA    1 
ATOM   7134  C  C     . LYS B 1 24  ? -2.743  -52.480 21.639  1.00 42.01 ? 24   LYS B C     1 
ATOM   7135  O  O     . LYS B 1 24  ? -2.760  -51.276 21.408  1.00 41.48 ? 24   LYS B O     1 
ATOM   7136  C  CB    . LYS B 1 24  ? -3.671  -54.354 20.256  1.00 51.83 ? 24   LYS B CB    1 
ATOM   7137  C  CG    . LYS B 1 24  ? -3.814  -54.889 18.842  1.00 56.53 ? 24   LYS B CG    1 
ATOM   7138  C  CD    . LYS B 1 24  ? -4.770  -56.086 18.749  1.00 61.53 ? 24   LYS B CD    1 
ATOM   7139  C  CE    . LYS B 1 24  ? -4.961  -56.532 17.307  1.00 61.81 ? 24   LYS B CE    1 
ATOM   7140  N  NZ    . LYS B 1 24  ? -6.172  -57.380 17.105  1.00 66.84 ? 24   LYS B NZ    1 
ATOM   7141  N  N     . TYR B 1 25  ? -2.858  -52.967 22.871  1.00 40.29 ? 25   TYR B N     1 
ATOM   7142  C  CA    . TYR B 1 25  ? -3.002  -52.035 24.003  1.00 39.38 ? 25   TYR B CA    1 
ATOM   7143  C  C     . TYR B 1 25  ? -1.901  -50.970 24.028  1.00 39.97 ? 25   TYR B C     1 
ATOM   7144  O  O     . TYR B 1 25  ? -2.135  -49.807 24.366  1.00 39.92 ? 25   TYR B O     1 
ATOM   7145  C  CB    . TYR B 1 25  ? -2.997  -52.850 25.293  1.00 37.44 ? 25   TYR B CB    1 
ATOM   7146  C  CG    . TYR B 1 25  ? -3.514  -52.118 26.505  1.00 37.93 ? 25   TYR B CG    1 
ATOM   7147  C  CD1   . TYR B 1 25  ? -2.739  -51.290 27.274  1.00 37.20 ? 25   TYR B CD1   1 
ATOM   7148  C  CD2   . TYR B 1 25  ? -4.824  -52.355 26.947  1.00 38.31 ? 25   TYR B CD2   1 
ATOM   7149  C  CE1   . TYR B 1 25  ? -3.230  -50.637 28.397  1.00 37.79 ? 25   TYR B CE1   1 
ATOM   7150  C  CE2   . TYR B 1 25  ? -5.309  -51.745 28.087  1.00 37.72 ? 25   TYR B CE2   1 
ATOM   7151  C  CZ    . TYR B 1 25  ? -4.534  -50.855 28.777  1.00 38.87 ? 25   TYR B CZ    1 
ATOM   7152  O  OH    . TYR B 1 25  ? -5.060  -50.237 29.894  1.00 40.72 ? 25   TYR B OH    1 
ATOM   7153  N  N     . LEU B 1 26  ? -0.648  -51.356 23.762  1.00 40.11 ? 26   LEU B N     1 
ATOM   7154  C  CA    . LEU B 1 26  ? 0.482   -50.432 23.853  1.00 40.66 ? 26   LEU B CA    1 
ATOM   7155  C  C     . LEU B 1 26  ? 0.995   -50.020 22.488  1.00 40.93 ? 26   LEU B C     1 
ATOM   7156  O  O     . LEU B 1 26  ? 2.168   -49.750 22.284  1.00 41.12 ? 26   LEU B O     1 
ATOM   7157  C  CB    . LEU B 1 26  ? 1.630   -51.073 24.658  1.00 37.28 ? 26   LEU B CB    1 
ATOM   7158  C  CG    . LEU B 1 26  ? 1.258   -51.250 26.145  1.00 40.32 ? 26   LEU B CG    1 
ATOM   7159  C  CD1   . LEU B 1 26  ? 2.392   -51.840 26.930  1.00 33.79 ? 26   LEU B CD1   1 
ATOM   7160  C  CD2   . LEU B 1 26  ? 0.727   -49.936 26.723  1.00 36.41 ? 26   LEU B CD2   1 
ATOM   7161  N  N     . TYR B 1 27  ? 0.123   -50.127 21.496  1.00 42.07 ? 27   TYR B N     1 
ATOM   7162  C  CA    . TYR B 1 27  ? 0.457   -49.741 20.128  1.00 42.29 ? 27   TYR B CA    1 
ATOM   7163  C  C     . TYR B 1 27  ? 1.241   -48.439 20.013  1.00 39.89 ? 27   TYR B C     1 
ATOM   7164  O  O     . TYR B 1 27  ? 1.998   -48.337 19.053  1.00 39.53 ? 27   TYR B O     1 
ATOM   7165  C  CB    . TYR B 1 27  ? -0.880  -49.434 19.381  1.00 45.14 ? 27   TYR B CB    1 
ATOM   7166  C  CG    . TYR B 1 27  ? -0.583  -49.436 17.904  1.00 48.82 ? 27   TYR B CG    1 
ATOM   7167  C  CD1   . TYR B 1 27  ? -0.117  -50.589 17.251  1.00 51.09 ? 27   TYR B CD1   1 
ATOM   7168  C  CD2   . TYR B 1 27  ? -0.714  -48.255 17.191  1.00 49.56 ? 27   TYR B CD2   1 
ATOM   7169  C  CE1   . TYR B 1 27  ? 0.141   -50.552 15.880  1.00 51.97 ? 27   TYR B CE1   1 
ATOM   7170  C  CE2   . TYR B 1 27  ? -0.441  -48.216 15.836  1.00 50.59 ? 27   TYR B CE2   1 
ATOM   7171  C  CZ    . TYR B 1 27  ? -0.024  -49.360 15.193  1.00 52.62 ? 27   TYR B CZ    1 
ATOM   7172  O  OH    . TYR B 1 27  ? 0.231   -49.261 13.832  1.00 55.22 ? 27   TYR B OH    1 
ATOM   7173  N  N     . ALA B 1 28  ? 0.886   -47.392 20.741  1.00 37.92 ? 28   ALA B N     1 
ATOM   7174  C  CA    . ALA B 1 28  ? 1.568   -46.119 20.578  1.00 39.22 ? 28   ALA B CA    1 
ATOM   7175  C  C     . ALA B 1 28  ? 2.999   -46.060 21.148  1.00 38.59 ? 28   ALA B C     1 
ATOM   7176  O  O     . ALA B 1 28  ? 3.699   -45.083 20.898  1.00 36.96 ? 28   ALA B O     1 
ATOM   7177  C  CB    . ALA B 1 28  ? 0.810   -44.930 21.143  1.00 34.64 ? 28   ALA B CB    1 
ATOM   7178  N  N     . MET B 1 29  ? 3.429   -47.101 21.845  1.00 38.03 ? 29   MET B N     1 
ATOM   7179  C  CA    . MET B 1 29  ? 4.786   -47.159 22.355  1.00 38.46 ? 29   MET B CA    1 
ATOM   7180  C  C     . MET B 1 29  ? 5.652   -47.920 21.351  1.00 38.53 ? 29   MET B C     1 
ATOM   7181  O  O     . MET B 1 29  ? 6.872   -47.842 21.483  1.00 38.21 ? 29   MET B O     1 
ATOM   7182  C  CB    . MET B 1 29  ? 4.821   -47.807 23.757  1.00 32.89 ? 29   MET B CB    1 
ATOM   7183  C  CG    . MET B 1 29  ? 4.371   -46.865 24.823  1.00 32.33 ? 29   MET B CG    1 
ATOM   7184  S  SD    . MET B 1 29  ? 4.467   -47.340 26.546  1.00 41.76 ? 29   MET B SD    1 
ATOM   7185  C  CE    . MET B 1 29  ? 4.905   -45.762 27.262  1.00 36.88 ? 29   MET B CE    1 
ATOM   7186  N  N     . ARG B 1 30  ? 5.018   -48.665 20.441  1.00 37.59 ? 30   ARG B N     1 
ATOM   7187  C  CA    . ARG B 1 30  ? 5.823   -49.459 19.506  1.00 38.38 ? 30   ARG B CA    1 
ATOM   7188  C  C     . ARG B 1 30  ? 6.189   -48.600 18.304  1.00 39.29 ? 30   ARG B C     1 
ATOM   7189  O  O     . ARG B 1 30  ? 5.370   -48.428 17.399  1.00 39.77 ? 30   ARG B O     1 
ATOM   7190  C  CB    . ARG B 1 30  ? 5.193   -50.760 19.056  1.00 37.93 ? 30   ARG B CB    1 
ATOM   7191  C  CG    . ARG B 1 30  ? 4.710   -51.756 20.081  1.00 34.58 ? 30   ARG B CG    1 
ATOM   7192  C  CD    . ARG B 1 30  ? 3.883   -52.882 19.447  1.00 36.83 ? 30   ARG B CD    1 
ATOM   7193  N  NE    . ARG B 1 30  ? 4.740   -54.073 19.272  1.00 43.18 ? 30   ARG B NE    1 
ATOM   7194  C  CZ    . ARG B 1 30  ? 5.375   -54.259 18.121  1.00 40.94 ? 30   ARG B CZ    1 
ATOM   7195  N  NH1   . ARG B 1 30  ? 5.091   -53.349 17.192  1.00 47.40 ? 30   ARG B NH1   1 
ATOM   7196  N  NH2   . ARG B 1 30  ? 6.222   -55.246 17.916  1.00 42.15 ? 30   ARG B NH2   1 
ATOM   7197  N  N     . LEU B 1 31  ? 7.335   -47.929 18.362  1.00 39.02 ? 31   LEU B N     1 
ATOM   7198  C  CA    . LEU B 1 31  ? 7.662   -46.943 17.337  1.00 38.52 ? 31   LEU B CA    1 
ATOM   7199  C  C     . LEU B 1 31  ? 8.155   -47.564 16.057  1.00 38.17 ? 31   LEU B C     1 
ATOM   7200  O  O     . LEU B 1 31  ? 9.164   -48.281 16.110  1.00 38.82 ? 31   LEU B O     1 
ATOM   7201  C  CB    . LEU B 1 31  ? 8.724   -46.005 17.961  1.00 35.25 ? 31   LEU B CB    1 
ATOM   7202  C  CG    . LEU B 1 31  ? 8.207   -45.255 19.195  1.00 35.09 ? 31   LEU B CG    1 
ATOM   7203  C  CD1   . LEU B 1 31  ? 9.233   -44.217 19.661  1.00 32.81 ? 31   LEU B CD1   1 
ATOM   7204  C  CD2   . LEU B 1 31  ? 6.899   -44.526 18.951  1.00 26.54 ? 31   LEU B CD2   1 
ATOM   7205  N  N     . SER B 1 32  ? 7.658   -47.167 14.883  1.00 37.89 ? 32   SER B N     1 
ATOM   7206  C  CA    . SER B 1 32  ? 8.255   -47.740 13.652  1.00 38.11 ? 32   SER B CA    1 
ATOM   7207  C  C     . SER B 1 32  ? 9.507   -47.022 13.193  1.00 37.24 ? 32   SER B C     1 
ATOM   7208  O  O     . SER B 1 32  ? 9.849   -45.963 13.729  1.00 37.22 ? 32   SER B O     1 
ATOM   7209  C  CB    . SER B 1 32  ? 7.263   -47.810 12.499  1.00 34.40 ? 32   SER B CB    1 
ATOM   7210  O  OG    . SER B 1 32  ? 6.867   -46.499 12.138  1.00 45.54 ? 32   SER B OG    1 
ATOM   7211  N  N     . ASP B 1 33  ? 10.219  -47.585 12.208  1.00 37.59 ? 33   ASP B N     1 
ATOM   7212  C  CA    . ASP B 1 33  ? 11.408  -46.960 11.658  1.00 37.56 ? 33   ASP B CA    1 
ATOM   7213  C  C     . ASP B 1 33  ? 11.093  -45.614 11.017  1.00 39.66 ? 33   ASP B C     1 
ATOM   7214  O  O     . ASP B 1 33  ? 11.818  -44.601 11.138  1.00 41.02 ? 33   ASP B O     1 
ATOM   7215  C  CB    . ASP B 1 33  ? 12.091  -47.900 10.683  1.00 37.43 ? 33   ASP B CB    1 
ATOM   7216  C  CG    . ASP B 1 33  ? 12.955  -48.946 11.370  1.00 40.34 ? 33   ASP B CG    1 
ATOM   7217  O  OD1   . ASP B 1 33  ? 12.906  -49.008 12.621  1.00 37.92 ? 33   ASP B OD1   1 
ATOM   7218  O  OD2   . ASP B 1 33  ? 13.672  -49.741 10.707  1.00 37.32 ? 33   ASP B OD2   1 
ATOM   7219  N  N     . GLU B 1 34  ? 9.899   -45.509 10.437  1.00 39.21 ? 34   GLU B N     1 
ATOM   7220  C  CA    . GLU B 1 34  ? 9.452   -44.267 9.814   1.00 40.20 ? 34   GLU B CA    1 
ATOM   7221  C  C     . GLU B 1 34  ? 9.216   -43.191 10.862  1.00 38.10 ? 34   GLU B C     1 
ATOM   7222  O  O     . GLU B 1 34  ? 9.640   -42.044 10.692  1.00 37.66 ? 34   GLU B O     1 
ATOM   7223  C  CB    . GLU B 1 34  ? 8.235   -44.568 8.892   1.00 40.16 ? 34   GLU B CB    1 
ATOM   7224  C  CG    . GLU B 1 34  ? 8.500   -45.855 8.125   1.00 51.50 ? 34   GLU B CG    1 
ATOM   7225  C  CD    . GLU B 1 34  ? 8.085   -47.200 8.656   1.00 50.21 ? 34   GLU B CD    1 
ATOM   7226  O  OE1   . GLU B 1 34  ? 6.880   -47.443 8.928   1.00 56.32 ? 34   GLU B OE1   1 
ATOM   7227  O  OE2   . GLU B 1 34  ? 8.905   -48.150 8.757   1.00 53.34 ? 34   GLU B OE2   1 
ATOM   7228  N  N     . THR B 1 35  ? 8.521   -43.529 11.950  1.00 36.57 ? 35   THR B N     1 
ATOM   7229  C  CA    . THR B 1 35  ? 8.414   -42.605 13.070  1.00 34.42 ? 35   THR B CA    1 
ATOM   7230  C  C     . THR B 1 35  ? 9.794   -42.287 13.653  1.00 32.15 ? 35   THR B C     1 
ATOM   7231  O  O     . THR B 1 35  ? 10.090  -41.101 13.764  1.00 31.92 ? 35   THR B O     1 
ATOM   7232  C  CB    . THR B 1 35  ? 7.556   -43.211 14.176  1.00 40.37 ? 35   THR B CB    1 
ATOM   7233  O  OG1   . THR B 1 35  ? 6.365   -43.750 13.573  1.00 37.92 ? 35   THR B OG1   1 
ATOM   7234  C  CG2   . THR B 1 35  ? 7.282   -42.198 15.276  1.00 38.82 ? 35   THR B CG2   1 
ATOM   7235  N  N     . LEU B 1 36  ? 10.735  -43.205 13.704  1.00 30.92 ? 36   LEU B N     1 
ATOM   7236  C  CA    . LEU B 1 36  ? 12.041  -42.898 14.303  1.00 31.73 ? 36   LEU B CA    1 
ATOM   7237  C  C     . LEU B 1 36  ? 12.843  -42.004 13.371  1.00 33.66 ? 36   LEU B C     1 
ATOM   7238  O  O     . LEU B 1 36  ? 13.409  -40.997 13.808  1.00 32.26 ? 36   LEU B O     1 
ATOM   7239  C  CB    . LEU B 1 36  ? 12.851  -44.125 14.708  1.00 29.83 ? 36   LEU B CB    1 
ATOM   7240  C  CG    . LEU B 1 36  ? 12.196  -45.094 15.717  1.00 29.15 ? 36   LEU B CG    1 
ATOM   7241  C  CD1   . LEU B 1 36  ? 12.936  -46.406 15.890  1.00 27.76 ? 36   LEU B CD1   1 
ATOM   7242  C  CD2   . LEU B 1 36  ? 12.036  -44.356 17.029  1.00 28.23 ? 36   LEU B CD2   1 
ATOM   7243  N  N     . ILE B 1 37  ? 12.697  -42.256 12.050  1.00 35.53 ? 37   ILE B N     1 
ATOM   7244  C  CA    . ILE B 1 37  ? 13.340  -41.348 11.084  1.00 36.36 ? 37   ILE B CA    1 
ATOM   7245  C  C     . ILE B 1 37  ? 12.729  -39.945 11.235  1.00 38.28 ? 37   ILE B C     1 
ATOM   7246  O  O     . ILE B 1 37  ? 13.363  -38.918 10.988  1.00 38.57 ? 37   ILE B O     1 
ATOM   7247  C  CB    . ILE B 1 37  ? 13.122  -41.797 9.631   1.00 38.40 ? 37   ILE B CB    1 
ATOM   7248  C  CG1   . ILE B 1 37  ? 13.874  -43.067 9.285   1.00 37.85 ? 37   ILE B CG1   1 
ATOM   7249  C  CG2   . ILE B 1 37  ? 13.393  -40.684 8.622   1.00 31.89 ? 37   ILE B CG2   1 
ATOM   7250  C  CD1   . ILE B 1 37  ? 15.354  -43.103 9.613   1.00 44.98 ? 37   ILE B CD1   1 
ATOM   7251  N  N     . ASP B 1 38  ? 11.449  -39.909 11.619  1.00 38.64 ? 38   ASP B N     1 
ATOM   7252  C  CA    . ASP B 1 38  ? 10.823  -38.590 11.798  1.00 38.93 ? 38   ASP B CA    1 
ATOM   7253  C  C     . ASP B 1 38  ? 11.392  -37.986 13.084  1.00 38.57 ? 38   ASP B C     1 
ATOM   7254  O  O     . ASP B 1 38  ? 11.754  -36.812 13.046  1.00 38.17 ? 38   ASP B O     1 
ATOM   7255  C  CB    . ASP B 1 38  ? 9.304   -38.733 11.747  1.00 41.61 ? 38   ASP B CB    1 
ATOM   7256  C  CG    . ASP B 1 38  ? 8.446   -37.552 12.087  1.00 37.88 ? 38   ASP B CG    1 
ATOM   7257  O  OD1   . ASP B 1 38  ? 8.864   -36.437 12.424  1.00 40.24 ? 38   ASP B OD1   1 
ATOM   7258  O  OD2   . ASP B 1 38  ? 7.197   -37.673 12.101  1.00 48.09 ? 38   ASP B OD2   1 
ATOM   7259  N  N     . ILE B 1 39  ? 11.516  -38.738 14.180  1.00 37.79 ? 39   ILE B N     1 
ATOM   7260  C  CA    . ILE B 1 39  ? 12.046  -38.170 15.420  1.00 37.68 ? 39   ILE B CA    1 
ATOM   7261  C  C     . ILE B 1 39  ? 13.425  -37.547 15.148  1.00 37.34 ? 39   ILE B C     1 
ATOM   7262  O  O     . ILE B 1 39  ? 13.781  -36.460 15.599  1.00 37.85 ? 39   ILE B O     1 
ATOM   7263  C  CB    . ILE B 1 39  ? 12.191  -39.177 16.585  1.00 39.26 ? 39   ILE B CB    1 
ATOM   7264  C  CG1   . ILE B 1 39  ? 10.911  -39.979 16.942  1.00 31.59 ? 39   ILE B CG1   1 
ATOM   7265  C  CG2   . ILE B 1 39  ? 12.623  -38.430 17.848  1.00 34.88 ? 39   ILE B CG2   1 
ATOM   7266  C  CD1   . ILE B 1 39  ? 9.727   -39.108 16.691  1.00 42.44 ? 39   ILE B CD1   1 
ATOM   7267  N  N     . MET B 1 40  ? 14.244  -38.230 14.394  1.00 36.84 ? 40   MET B N     1 
ATOM   7268  C  CA    . MET B 1 40  ? 15.634  -37.915 14.098  1.00 38.02 ? 40   MET B CA    1 
ATOM   7269  C  C     . MET B 1 40  ? 15.792  -36.614 13.336  1.00 38.89 ? 40   MET B C     1 
ATOM   7270  O  O     . MET B 1 40  ? 16.548  -35.703 13.731  1.00 39.40 ? 40   MET B O     1 
ATOM   7271  C  CB    . MET B 1 40  ? 16.303  -39.110 13.391  1.00 32.59 ? 40   MET B CB    1 
ATOM   7272  C  CG    . MET B 1 40  ? 17.701  -38.884 12.896  1.00 34.78 ? 40   MET B CG    1 
ATOM   7273  S  SD    . MET B 1 40  ? 18.478  -40.226 12.028  1.00 37.29 ? 40   MET B SD    1 
ATOM   7274  C  CE    . MET B 1 40  ? 17.434  -40.408 10.581  1.00 43.75 ? 40   MET B CE    1 
ATOM   7275  N  N     . THR B 1 41  ? 14.906  -36.401 12.361  1.00 39.36 ? 41   THR B N     1 
ATOM   7276  C  CA    . THR B 1 41  ? 14.888  -35.156 11.590  1.00 37.79 ? 41   THR B CA    1 
ATOM   7277  C  C     . THR B 1 41  ? 14.573  -34.007 12.541  1.00 38.08 ? 41   THR B C     1 
ATOM   7278  O  O     . THR B 1 41  ? 15.255  -32.981 12.487  1.00 37.55 ? 41   THR B O     1 
ATOM   7279  C  CB    . THR B 1 41  ? 13.852  -35.309 10.464  1.00 40.03 ? 41   THR B CB    1 
ATOM   7280  O  OG1   . THR B 1 41  ? 14.274  -36.331 9.558   1.00 40.08 ? 41   THR B OG1   1 
ATOM   7281  C  CG2   . THR B 1 41  ? 13.590  -34.066 9.629   1.00 36.55 ? 41   THR B CG2   1 
ATOM   7282  N  N     . ARG B 1 42  ? 13.527  -34.122 13.350  1.00 38.15 ? 42   ARG B N     1 
ATOM   7283  C  CA    . ARG B 1 42  ? 13.208  -33.085 14.352  1.00 39.57 ? 42   ARG B CA    1 
ATOM   7284  C  C     . ARG B 1 42  ? 14.404  -32.802 15.281  1.00 40.52 ? 42   ARG B C     1 
ATOM   7285  O  O     . ARG B 1 42  ? 14.815  -31.637 15.477  1.00 40.87 ? 42   ARG B O     1 
ATOM   7286  C  CB    . ARG B 1 42  ? 12.011  -33.566 15.191  1.00 38.76 ? 42   ARG B CB    1 
ATOM   7287  C  CG    . ARG B 1 42  ? 10.645  -33.553 14.567  1.00 37.38 ? 42   ARG B CG    1 
ATOM   7288  C  CD    . ARG B 1 42  ? 9.759   -34.762 14.608  1.00 40.61 ? 42   ARG B CD    1 
ATOM   7289  N  NE    . ARG B 1 42  ? 8.759   -34.877 15.613  1.00 42.75 ? 42   ARG B NE    1 
ATOM   7290  C  CZ    . ARG B 1 42  ? 7.596   -35.406 15.858  1.00 40.96 ? 42   ARG B CZ    1 
ATOM   7291  N  NH1   . ARG B 1 42  ? 6.863   -36.089 14.982  1.00 45.98 ? 42   ARG B NH1   1 
ATOM   7292  N  NH2   . ARG B 1 42  ? 7.002   -35.233 17.036  1.00 38.48 ? 42   ARG B NH2   1 
ATOM   7293  N  N     . PHE B 1 43  ? 15.095  -33.868 15.761  1.00 39.77 ? 43   PHE B N     1 
ATOM   7294  C  CA    . PHE B 1 43  ? 16.241  -33.643 16.648  1.00 38.68 ? 43   PHE B CA    1 
ATOM   7295  C  C     . PHE B 1 43  ? 17.318  -32.915 15.862  1.00 38.67 ? 43   PHE B C     1 
ATOM   7296  O  O     . PHE B 1 43  ? 18.006  -32.030 16.373  1.00 40.67 ? 43   PHE B O     1 
ATOM   7297  C  CB    . PHE B 1 43  ? 16.787  -34.949 17.264  1.00 35.17 ? 43   PHE B CB    1 
ATOM   7298  C  CG    . PHE B 1 43  ? 17.802  -34.654 18.340  1.00 29.52 ? 43   PHE B CG    1 
ATOM   7299  C  CD1   . PHE B 1 43  ? 17.390  -34.015 19.523  1.00 30.02 ? 43   PHE B CD1   1 
ATOM   7300  C  CD2   . PHE B 1 43  ? 19.143  -34.901 18.143  1.00 24.73 ? 43   PHE B CD2   1 
ATOM   7301  C  CE1   . PHE B 1 43  ? 18.315  -33.697 20.504  1.00 23.43 ? 43   PHE B CE1   1 
ATOM   7302  C  CE2   . PHE B 1 43  ? 20.075  -34.601 19.132  1.00 20.70 ? 43   PHE B CE2   1 
ATOM   7303  C  CZ    . PHE B 1 43  ? 19.657  -33.982 20.276  1.00 21.74 ? 43   PHE B CZ    1 
ATOM   7304  N  N     . ARG B 1 44  ? 17.408  -33.198 14.569  1.00 39.28 ? 44   ARG B N     1 
ATOM   7305  C  CA    . ARG B 1 44  ? 18.327  -32.567 13.655  1.00 39.01 ? 44   ARG B CA    1 
ATOM   7306  C  C     . ARG B 1 44  ? 18.072  -31.053 13.521  1.00 39.46 ? 44   ARG B C     1 
ATOM   7307  O  O     . ARG B 1 44  ? 19.067  -30.298 13.536  1.00 39.79 ? 44   ARG B O     1 
ATOM   7308  C  CB    . ARG B 1 44  ? 18.345  -33.195 12.245  1.00 39.25 ? 44   ARG B CB    1 
ATOM   7309  C  CG    . ARG B 1 44  ? 19.539  -32.688 11.402  1.00 35.41 ? 44   ARG B CG    1 
ATOM   7310  C  CD    . ARG B 1 44  ? 20.847  -33.261 12.021  1.00 45.23 ? 44   ARG B CD    1 
ATOM   7311  N  NE    . ARG B 1 44  ? 22.033  -32.822 11.249  1.00 42.80 ? 44   ARG B NE    1 
ATOM   7312  C  CZ    . ARG B 1 44  ? 22.222  -33.335 10.030  1.00 43.87 ? 44   ARG B CZ    1 
ATOM   7313  N  NH1   . ARG B 1 44  ? 21.428  -34.250 9.458   1.00 45.33 ? 44   ARG B NH1   1 
ATOM   7314  N  NH2   . ARG B 1 44  ? 23.256  -32.924 9.326   1.00 46.48 ? 44   ARG B NH2   1 
ATOM   7315  N  N     . LYS B 1 45  ? 16.820  -30.626 13.552  1.00 37.99 ? 45   LYS B N     1 
ATOM   7316  C  CA    . LYS B 1 45  ? 16.442  -29.235 13.541  1.00 38.45 ? 45   LYS B CA    1 
ATOM   7317  C  C     . LYS B 1 45  ? 16.604  -28.549 14.905  1.00 38.89 ? 45   LYS B C     1 
ATOM   7318  O  O     . LYS B 1 45  ? 17.075  -27.397 14.937  1.00 38.71 ? 45   LYS B O     1 
ATOM   7319  C  CB    . LYS B 1 45  ? 15.007  -29.014 13.031  1.00 39.80 ? 45   LYS B CB    1 
ATOM   7320  C  CG    . LYS B 1 45  ? 14.709  -29.759 11.746  1.00 51.57 ? 45   LYS B CG    1 
ATOM   7321  C  CD    . LYS B 1 45  ? 13.395  -29.386 11.073  1.00 59.06 ? 45   LYS B CD    1 
ATOM   7322  C  CE    . LYS B 1 45  ? 13.347  -29.957 9.646   1.00 61.60 ? 45   LYS B CE    1 
ATOM   7323  N  NZ    . LYS B 1 45  ? 11.945  -30.368 9.300   1.00 67.08 ? 45   LYS B NZ    1 
ATOM   7324  N  N     . GLU B 1 46  ? 16.295  -29.268 15.997  1.00 37.33 ? 46   GLU B N     1 
ATOM   7325  C  CA    . GLU B 1 46  ? 16.571  -28.697 17.314  1.00 36.64 ? 46   GLU B CA    1 
ATOM   7326  C  C     . GLU B 1 46  ? 18.019  -28.342 17.585  1.00 35.61 ? 46   GLU B C     1 
ATOM   7327  O  O     . GLU B 1 46  ? 18.356  -27.309 18.160  1.00 35.63 ? 46   GLU B O     1 
ATOM   7328  C  CB    . GLU B 1 46  ? 15.982  -29.571 18.416  1.00 36.51 ? 46   GLU B CB    1 
ATOM   7329  C  CG    . GLU B 1 46  ? 14.512  -29.891 18.221  1.00 35.40 ? 46   GLU B CG    1 
ATOM   7330  C  CD    . GLU B 1 46  ? 13.624  -28.774 18.716  1.00 39.01 ? 46   GLU B CD    1 
ATOM   7331  O  OE1   . GLU B 1 46  ? 14.157  -27.721 19.105  1.00 43.20 ? 46   GLU B OE1   1 
ATOM   7332  O  OE2   . GLU B 1 46  ? 12.378  -28.947 18.752  1.00 45.37 ? 46   GLU B OE2   1 
ATOM   7333  N  N     . MET B 1 47  ? 18.958  -29.141 17.127  1.00 37.18 ? 47   MET B N     1 
ATOM   7334  C  CA    . MET B 1 47  ? 20.408  -28.932 17.249  1.00 37.08 ? 47   MET B CA    1 
ATOM   7335  C  C     . MET B 1 47  ? 20.815  -27.664 16.503  1.00 36.34 ? 47   MET B C     1 
ATOM   7336  O  O     . MET B 1 47  ? 21.432  -26.747 17.032  1.00 36.36 ? 47   MET B O     1 
ATOM   7337  C  CB    . MET B 1 47  ? 21.198  -30.118 16.621  1.00 35.26 ? 47   MET B CB    1 
ATOM   7338  C  CG    . MET B 1 47  ? 21.023  -31.438 17.358  1.00 34.60 ? 47   MET B CG    1 
ATOM   7339  S  SD    . MET B 1 47  ? 22.333  -32.613 16.921  1.00 38.90 ? 47   MET B SD    1 
ATOM   7340  C  CE    . MET B 1 47  ? 21.661  -33.523 15.616  1.00 31.57 ? 47   MET B CE    1 
ATOM   7341  N  N     . LYS B 1 48  ? 20.322  -27.584 15.273  1.00 36.82 ? 48   LYS B N     1 
ATOM   7342  C  CA    . LYS B 1 48  ? 20.435  -26.372 14.457  1.00 37.97 ? 48   LYS B CA    1 
ATOM   7343  C  C     . LYS B 1 48  ? 19.879  -25.178 15.237  1.00 37.37 ? 48   LYS B C     1 
ATOM   7344  O  O     . LYS B 1 48  ? 20.579  -24.188 15.446  1.00 37.34 ? 48   LYS B O     1 
ATOM   7345  C  CB    . LYS B 1 48  ? 19.669  -26.565 13.157  1.00 40.07 ? 48   LYS B CB    1 
ATOM   7346  C  CG    . LYS B 1 48  ? 20.220  -25.810 11.967  1.00 47.40 ? 48   LYS B CG    1 
ATOM   7347  C  CD    . LYS B 1 48  ? 19.100  -25.044 11.262  1.00 51.06 ? 48   LYS B CD    1 
ATOM   7348  C  CE    . LYS B 1 48  ? 18.275  -24.302 12.324  1.00 56.88 ? 48   LYS B CE    1 
ATOM   7349  N  NZ    . LYS B 1 48  ? 16.876  -24.045 11.849  1.00 63.12 ? 48   LYS B NZ    1 
ATOM   7350  N  N     . ASN B 1 49  ? 18.658  -25.315 15.767  1.00 37.24 ? 49   ASN B N     1 
ATOM   7351  C  CA    . ASN B 1 49  ? 18.097  -24.228 16.541  1.00 36.96 ? 49   ASN B CA    1 
ATOM   7352  C  C     . ASN B 1 49  ? 18.988  -23.859 17.709  1.00 37.34 ? 49   ASN B C     1 
ATOM   7353  O  O     . ASN B 1 49  ? 19.116  -22.676 18.008  1.00 37.25 ? 49   ASN B O     1 
ATOM   7354  C  CB    . ASN B 1 49  ? 16.726  -24.569 17.113  1.00 38.12 ? 49   ASN B CB    1 
ATOM   7355  C  CG    . ASN B 1 49  ? 15.686  -24.546 15.986  1.00 43.64 ? 49   ASN B CG    1 
ATOM   7356  O  OD1   . ASN B 1 49  ? 14.606  -25.134 16.162  1.00 43.39 ? 49   ASN B OD1   1 
ATOM   7357  N  ND2   . ASN B 1 49  ? 16.098  -23.918 14.904  1.00 34.83 ? 49   ASN B ND2   1 
ATOM   7358  N  N     . GLY B 1 50  ? 19.512  -24.869 18.420  1.00 37.22 ? 50   GLY B N     1 
ATOM   7359  C  CA    . GLY B 1 50  ? 20.272  -24.527 19.628  1.00 35.85 ? 50   GLY B CA    1 
ATOM   7360  C  C     . GLY B 1 50  ? 21.645  -23.948 19.365  1.00 35.10 ? 50   GLY B C     1 
ATOM   7361  O  O     . GLY B 1 50  ? 22.136  -23.195 20.217  1.00 35.90 ? 50   GLY B O     1 
ATOM   7362  N  N     . LEU B 1 51  ? 22.266  -24.231 18.247  1.00 33.87 ? 51   LEU B N     1 
ATOM   7363  C  CA    . LEU B 1 51  ? 23.550  -23.640 17.915  1.00 35.64 ? 51   LEU B CA    1 
ATOM   7364  C  C     . LEU B 1 51  ? 23.446  -22.213 17.352  1.00 38.07 ? 51   LEU B C     1 
ATOM   7365  O  O     . LEU B 1 51  ? 24.431  -21.474 17.290  1.00 36.88 ? 51   LEU B O     1 
ATOM   7366  C  CB    . LEU B 1 51  ? 24.237  -24.512 16.843  1.00 28.50 ? 51   LEU B CB    1 
ATOM   7367  C  CG    . LEU B 1 51  ? 24.835  -25.798 17.402  1.00 30.18 ? 51   LEU B CG    1 
ATOM   7368  C  CD1   . LEU B 1 51  ? 25.001  -26.876 16.356  1.00 24.91 ? 51   LEU B CD1   1 
ATOM   7369  C  CD2   . LEU B 1 51  ? 26.110  -25.510 18.178  1.00 30.10 ? 51   LEU B CD2   1 
ATOM   7370  N  N     . SER B 1 52  ? 22.260  -21.827 16.875  1.00 40.75 ? 52   SER B N     1 
ATOM   7371  C  CA    . SER B 1 52  ? 22.066  -20.550 16.188  1.00 41.34 ? 52   SER B CA    1 
ATOM   7372  C  C     . SER B 1 52  ? 21.917  -19.376 17.145  1.00 40.15 ? 52   SER B C     1 
ATOM   7373  O  O     . SER B 1 52  ? 21.073  -19.403 18.027  1.00 38.91 ? 52   SER B O     1 
ATOM   7374  C  CB    . SER B 1 52  ? 20.775  -20.628 15.359  1.00 45.43 ? 52   SER B CB    1 
ATOM   7375  O  OG    . SER B 1 52  ? 19.977  -19.467 15.505  1.00 52.76 ? 52   SER B OG    1 
ATOM   7376  N  N     . ARG B 1 53  ? 22.581  -18.280 16.843  1.00 40.82 ? 53   ARG B N     1 
ATOM   7377  C  CA    . ARG B 1 53  ? 22.391  -17.067 17.651  1.00 42.37 ? 53   ARG B CA    1 
ATOM   7378  C  C     . ARG B 1 53  ? 20.932  -16.599 17.480  1.00 42.15 ? 53   ARG B C     1 
ATOM   7379  O  O     . ARG B 1 53  ? 20.311  -16.147 18.437  1.00 40.78 ? 53   ARG B O     1 
ATOM   7380  C  CB    . ARG B 1 53  ? 23.255  -15.935 17.089  1.00 43.70 ? 53   ARG B CB    1 
ATOM   7381  C  CG    . ARG B 1 53  ? 22.816  -15.663 15.643  1.00 43.99 ? 53   ARG B CG    1 
ATOM   7382  C  CD    . ARG B 1 53  ? 23.793  -14.613 15.101  1.00 46.57 ? 53   ARG B CD    1 
ATOM   7383  N  NE    . ARG B 1 53  ? 25.137  -14.852 15.637  1.00 53.13 ? 53   ARG B NE    1 
ATOM   7384  C  CZ    . ARG B 1 53  ? 26.173  -15.162 14.860  1.00 52.18 ? 53   ARG B CZ    1 
ATOM   7385  N  NH1   . ARG B 1 53  ? 25.913  -15.277 13.557  1.00 56.13 ? 53   ARG B NH1   1 
ATOM   7386  N  NH2   . ARG B 1 53  ? 27.375  -15.389 15.355  1.00 51.18 ? 53   ARG B NH2   1 
ATOM   7387  N  N     . ASP B 1 54  ? 20.373  -16.793 16.303  1.00 42.92 ? 54   ASP B N     1 
ATOM   7388  C  CA    . ASP B 1 54  ? 18.965  -16.414 16.204  1.00 45.69 ? 54   ASP B CA    1 
ATOM   7389  C  C     . ASP B 1 54  ? 18.087  -17.227 17.118  1.00 47.33 ? 54   ASP B C     1 
ATOM   7390  O  O     . ASP B 1 54  ? 17.439  -16.659 18.020  1.00 48.88 ? 54   ASP B O     1 
ATOM   7391  C  CB    . ASP B 1 54  ? 18.535  -16.209 14.759  1.00 49.35 ? 54   ASP B CB    1 
ATOM   7392  C  CG    . ASP B 1 54  ? 19.419  -15.144 14.095  1.00 52.61 ? 54   ASP B CG    1 
ATOM   7393  O  OD1   . ASP B 1 54  ? 19.597  -14.033 14.663  1.00 48.61 ? 54   ASP B OD1   1 
ATOM   7394  O  OD2   . ASP B 1 54  ? 20.030  -15.432 13.034  1.00 53.18 ? 54   ASP B OD2   1 
ATOM   7395  N  N     . PHE B 1 55  ? 18.008  -18.543 17.000  1.00 46.98 ? 55   PHE B N     1 
ATOM   7396  C  CA    . PHE B 1 55  ? 17.060  -19.368 17.694  1.00 46.08 ? 55   PHE B CA    1 
ATOM   7397  C  C     . PHE B 1 55  ? 17.344  -19.953 19.036  1.00 44.78 ? 55   PHE B C     1 
ATOM   7398  O  O     . PHE B 1 55  ? 16.402  -20.539 19.599  1.00 46.41 ? 55   PHE B O     1 
ATOM   7399  C  CB    . PHE B 1 55  ? 16.572  -20.518 16.758  1.00 47.95 ? 55   PHE B CB    1 
ATOM   7400  C  CG    . PHE B 1 55  ? 16.032  -19.860 15.510  1.00 51.82 ? 55   PHE B CG    1 
ATOM   7401  C  CD1   . PHE B 1 55  ? 15.014  -18.922 15.643  1.00 55.90 ? 55   PHE B CD1   1 
ATOM   7402  C  CD2   . PHE B 1 55  ? 16.590  -20.081 14.273  1.00 53.43 ? 55   PHE B CD2   1 
ATOM   7403  C  CE1   . PHE B 1 55  ? 14.535  -18.232 14.540  1.00 55.90 ? 55   PHE B CE1   1 
ATOM   7404  C  CE2   . PHE B 1 55  ? 16.121  -19.401 13.158  1.00 55.45 ? 55   PHE B CE2   1 
ATOM   7405  C  CZ    . PHE B 1 55  ? 15.101  -18.482 13.298  1.00 57.48 ? 55   PHE B CZ    1 
ATOM   7406  N  N     . ASN B 1 56  ? 18.496  -19.821 19.633  1.00 43.87 ? 56   ASN B N     1 
ATOM   7407  C  CA    . ASN B 1 56  ? 18.836  -20.436 20.907  1.00 42.60 ? 56   ASN B CA    1 
ATOM   7408  C  C     . ASN B 1 56  ? 17.991  -19.993 22.077  1.00 42.45 ? 56   ASN B C     1 
ATOM   7409  O  O     . ASN B 1 56  ? 17.581  -20.794 22.912  1.00 43.56 ? 56   ASN B O     1 
ATOM   7410  C  CB    . ASN B 1 56  ? 20.313  -20.142 21.219  1.00 41.90 ? 56   ASN B CB    1 
ATOM   7411  C  CG    . ASN B 1 56  ? 20.692  -20.463 22.642  1.00 46.16 ? 56   ASN B CG    1 
ATOM   7412  O  OD1   . ASN B 1 56  ? 21.274  -21.523 22.905  1.00 52.91 ? 56   ASN B OD1   1 
ATOM   7413  N  ND2   . ASN B 1 56  ? 20.438  -19.650 23.652  1.00 47.39 ? 56   ASN B ND2   1 
ATOM   7414  N  N     . PRO B 1 57  ? 17.667  -18.708 22.195  1.00 42.17 ? 57   PRO B N     1 
ATOM   7415  C  CA    . PRO B 1 57  ? 16.925  -18.206 23.339  1.00 41.62 ? 57   PRO B CA    1 
ATOM   7416  C  C     . PRO B 1 57  ? 15.638  -18.960 23.531  1.00 40.54 ? 57   PRO B C     1 
ATOM   7417  O  O     . PRO B 1 57  ? 15.328  -19.257 24.680  1.00 40.58 ? 57   PRO B O     1 
ATOM   7418  C  CB    . PRO B 1 57  ? 16.750  -16.722 23.070  1.00 42.54 ? 57   PRO B CB    1 
ATOM   7419  C  CG    . PRO B 1 57  ? 17.681  -16.391 21.965  1.00 41.95 ? 57   PRO B CG    1 
ATOM   7420  C  CD    . PRO B 1 57  ? 18.034  -17.641 21.227  1.00 41.23 ? 57   PRO B CD    1 
ATOM   7421  N  N     . THR B 1 58  ? 14.980  -19.435 22.486  1.00 40.75 ? 58   THR B N     1 
ATOM   7422  C  CA    . THR B 1 58  ? 13.815  -20.315 22.594  1.00 40.84 ? 58   THR B CA    1 
ATOM   7423  C  C     . THR B 1 58  ? 14.076  -21.800 22.357  1.00 40.49 ? 58   THR B C     1 
ATOM   7424  O  O     . THR B 1 58  ? 13.204  -22.651 22.608  1.00 42.04 ? 58   THR B O     1 
ATOM   7425  C  CB    . THR B 1 58  ? 12.749  -19.861 21.563  1.00 39.65 ? 58   THR B CB    1 
ATOM   7426  O  OG1   . THR B 1 58  ? 12.586  -18.446 21.841  1.00 48.68 ? 58   THR B OG1   1 
ATOM   7427  C  CG2   . THR B 1 58  ? 11.387  -20.416 21.956  1.00 49.82 ? 58   THR B CG2   1 
ATOM   7428  N  N     . ALA B 1 59  ? 15.237  -22.204 21.862  1.00 38.06 ? 59   ALA B N     1 
ATOM   7429  C  CA    . ALA B 1 59  ? 15.472  -23.625 21.541  1.00 36.46 ? 59   ALA B CA    1 
ATOM   7430  C  C     . ALA B 1 59  ? 15.371  -24.486 22.791  1.00 35.25 ? 59   ALA B C     1 
ATOM   7431  O  O     . ALA B 1 59  ? 15.840  -24.110 23.871  1.00 35.53 ? 59   ALA B O     1 
ATOM   7432  C  CB    . ALA B 1 59  ? 16.850  -23.671 20.881  1.00 24.87 ? 59   ALA B CB    1 
ATOM   7433  N  N     . THR B 1 60  ? 14.731  -25.643 22.755  1.00 34.65 ? 60   THR B N     1 
ATOM   7434  C  CA    . THR B 1 60  ? 14.691  -26.507 23.933  1.00 35.58 ? 60   THR B CA    1 
ATOM   7435  C  C     . THR B 1 60  ? 15.959  -27.352 24.117  1.00 35.28 ? 60   THR B C     1 
ATOM   7436  O  O     . THR B 1 60  ? 16.200  -27.847 25.219  1.00 33.68 ? 60   THR B O     1 
ATOM   7437  C  CB    . THR B 1 60  ? 13.459  -27.415 23.892  1.00 32.22 ? 60   THR B CB    1 
ATOM   7438  O  OG1   . THR B 1 60  ? 13.514  -28.275 22.762  1.00 40.51 ? 60   THR B OG1   1 
ATOM   7439  C  CG2   . THR B 1 60  ? 12.250  -26.504 23.686  1.00 41.25 ? 60   THR B CG2   1 
ATOM   7440  N  N     . VAL B 1 61  ? 16.731  -27.493 23.032  1.00 33.88 ? 61   VAL B N     1 
ATOM   7441  C  CA    . VAL B 1 61  ? 17.931  -28.330 23.047  1.00 33.10 ? 61   VAL B CA    1 
ATOM   7442  C  C     . VAL B 1 61  ? 19.111  -27.394 23.090  1.00 33.03 ? 61   VAL B C     1 
ATOM   7443  O  O     . VAL B 1 61  ? 19.402  -26.780 22.068  1.00 33.70 ? 61   VAL B O     1 
ATOM   7444  C  CB    . VAL B 1 61  ? 17.990  -29.274 21.833  1.00 32.07 ? 61   VAL B CB    1 
ATOM   7445  C  CG1   . VAL B 1 61  ? 19.266  -30.102 21.792  1.00 30.23 ? 61   VAL B CG1   1 
ATOM   7446  C  CG2   . VAL B 1 61  ? 16.815  -30.262 21.961  1.00 29.66 ? 61   VAL B CG2   1 
ATOM   7447  N  N     . LYS B 1 62  ? 19.577  -27.090 24.288  1.00 33.63 ? 62   LYS B N     1 
ATOM   7448  C  CA    . LYS B 1 62  ? 20.464  -25.972 24.545  1.00 31.93 ? 62   LYS B CA    1 
ATOM   7449  C  C     . LYS B 1 62  ? 21.798  -26.013 23.881  1.00 33.18 ? 62   LYS B C     1 
ATOM   7450  O  O     . LYS B 1 62  ? 22.418  -24.939 23.745  1.00 35.64 ? 62   LYS B O     1 
ATOM   7451  C  CB    . LYS B 1 62  ? 20.527  -25.680 26.059  1.00 29.94 ? 62   LYS B CB    1 
ATOM   7452  C  CG    . LYS B 1 62  ? 19.253  -24.994 26.597  1.00 27.73 ? 62   LYS B CG    1 
ATOM   7453  C  CD    . LYS B 1 62  ? 18.694  -24.117 26.395  0.00 30.00 ? 62   LYS B CD    1 
ATOM   7454  C  CE    . LYS B 1 62  ? 17.376  -23.884 27.115  0.00 30.00 ? 62   LYS B CE    1 
ATOM   7455  N  NZ    . LYS B 1 62  ? 16.798  -22.550 26.798  0.00 30.00 ? 62   LYS B NZ    1 
ATOM   7456  N  N     . MET B 1 63  ? 22.324  -27.134 23.422  1.00 32.44 ? 63   MET B N     1 
ATOM   7457  C  CA    . MET B 1 63  ? 23.563  -27.129 22.638  1.00 31.55 ? 63   MET B CA    1 
ATOM   7458  C  C     . MET B 1 63  ? 24.638  -26.278 23.243  1.00 32.29 ? 63   MET B C     1 
ATOM   7459  O  O     . MET B 1 63  ? 25.333  -25.460 22.666  1.00 33.29 ? 63   MET B O     1 
ATOM   7460  C  CB    . MET B 1 63  ? 23.194  -26.727 21.199  1.00 36.44 ? 63   MET B CB    1 
ATOM   7461  C  CG    . MET B 1 63  ? 22.132  -27.611 20.503  1.00 28.15 ? 63   MET B CG    1 
ATOM   7462  S  SD    . MET B 1 63  ? 22.726  -29.331 20.308  1.00 28.11 ? 63   MET B SD    1 
ATOM   7463  C  CE    . MET B 1 63  ? 23.777  -29.220 18.902  1.00 29.47 ? 63   MET B CE    1 
ATOM   7464  N  N     . LEU B 1 64  ? 24.918  -26.439 24.526  1.00 32.38 ? 64   LEU B N     1 
ATOM   7465  C  CA    . LEU B 1 64  ? 25.865  -25.858 25.384  1.00 30.56 ? 64   LEU B CA    1 
ATOM   7466  C  C     . LEU B 1 64  ? 27.341  -26.049 25.161  1.00 31.12 ? 64   LEU B C     1 
ATOM   7467  O  O     . LEU B 1 64  ? 27.893  -27.127 25.220  1.00 31.47 ? 64   LEU B O     1 
ATOM   7468  C  CB    . LEU B 1 64  ? 25.545  -26.266 26.853  1.00 31.33 ? 64   LEU B CB    1 
ATOM   7469  C  CG    . LEU B 1 64  ? 24.124  -25.908 27.299  1.00 38.32 ? 64   LEU B CG    1 
ATOM   7470  C  CD1   . LEU B 1 64  ? 23.751  -26.643 28.589  1.00 32.49 ? 64   LEU B CD1   1 
ATOM   7471  C  CD2   . LEU B 1 64  ? 23.956  -24.366 27.461  1.00 29.07 ? 64   LEU B CD2   1 
ATOM   7472  N  N     . PRO B 1 65  ? 28.070  -24.964 25.003  1.00 31.54 ? 65   PRO B N     1 
ATOM   7473  C  CA    . PRO B 1 65  ? 29.516  -24.966 24.878  1.00 32.97 ? 65   PRO B CA    1 
ATOM   7474  C  C     . PRO B 1 65  ? 30.188  -25.505 26.124  1.00 32.80 ? 65   PRO B C     1 
ATOM   7475  O  O     . PRO B 1 65  ? 29.843  -25.087 27.247  1.00 34.32 ? 65   PRO B O     1 
ATOM   7476  C  CB    . PRO B 1 65  ? 29.816  -23.452 24.817  1.00 33.36 ? 65   PRO B CB    1 
ATOM   7477  C  CG    . PRO B 1 65  ? 28.577  -22.919 24.137  1.00 33.57 ? 65   PRO B CG    1 
ATOM   7478  C  CD    . PRO B 1 65  ? 27.452  -23.598 24.843  1.00 31.27 ? 65   PRO B CD    1 
ATOM   7479  N  N     . THR B 1 66  ? 31.218  -26.306 26.006  1.00 31.60 ? 66   THR B N     1 
ATOM   7480  C  CA    . THR B 1 66  ? 31.852  -26.947 27.168  1.00 31.41 ? 66   THR B CA    1 
ATOM   7481  C  C     . THR B 1 66  ? 33.280  -26.479 27.411  1.00 32.04 ? 66   THR B C     1 
ATOM   7482  O  O     . THR B 1 66  ? 33.915  -26.669 28.467  1.00 31.46 ? 66   THR B O     1 
ATOM   7483  C  CB    . THR B 1 66  ? 31.814  -28.481 26.938  1.00 28.77 ? 66   THR B CB    1 
ATOM   7484  O  OG1   . THR B 1 66  ? 32.741  -28.847 25.934  1.00 28.15 ? 66   THR B OG1   1 
ATOM   7485  C  CG2   . THR B 1 66  ? 30.486  -29.033 26.508  1.00 22.23 ? 66   THR B CG2   1 
ATOM   7486  N  N     . PHE B 1 67  ? 33.811  -25.660 26.518  1.00 32.58 ? 67   PHE B N     1 
ATOM   7487  C  CA    . PHE B 1 67  ? 35.187  -25.203 26.562  1.00 33.92 ? 67   PHE B CA    1 
ATOM   7488  C  C     . PHE B 1 67  ? 36.107  -26.402 26.529  1.00 35.54 ? 67   PHE B C     1 
ATOM   7489  O  O     . PHE B 1 67  ? 37.295  -26.303 26.808  1.00 37.10 ? 67   PHE B O     1 
ATOM   7490  C  CB    . PHE B 1 67  ? 35.520  -24.102 27.571  1.00 33.82 ? 67   PHE B CB    1 
ATOM   7491  C  CG    . PHE B 1 67  ? 34.775  -22.842 27.173  1.00 37.33 ? 67   PHE B CG    1 
ATOM   7492  C  CD1   . PHE B 1 67  ? 33.419  -22.721 27.446  1.00 35.36 ? 67   PHE B CD1   1 
ATOM   7493  C  CD2   . PHE B 1 67  ? 35.388  -21.875 26.395  1.00 34.34 ? 67   PHE B CD2   1 
ATOM   7494  C  CE1   . PHE B 1 67  ? 32.701  -21.643 26.969  1.00 36.68 ? 67   PHE B CE1   1 
ATOM   7495  C  CE2   . PHE B 1 67  ? 34.647  -20.820 25.882  1.00 36.67 ? 67   PHE B CE2   1 
ATOM   7496  C  CZ    . PHE B 1 67  ? 33.287  -20.689 26.151  1.00 33.40 ? 67   PHE B CZ    1 
ATOM   7497  N  N     . VAL B 1 68  ? 35.661  -27.578 26.051  1.00 35.96 ? 68   VAL B N     1 
ATOM   7498  C  CA    . VAL B 1 68  ? 36.669  -28.651 25.853  1.00 36.20 ? 68   VAL B CA    1 
ATOM   7499  C  C     . VAL B 1 68  ? 36.981  -28.750 24.372  1.00 37.05 ? 68   VAL B C     1 
ATOM   7500  O  O     . VAL B 1 68  ? 36.013  -28.928 23.603  1.00 37.10 ? 68   VAL B O     1 
ATOM   7501  C  CB    . VAL B 1 68  ? 36.172  -29.941 26.496  1.00 37.42 ? 68   VAL B CB    1 
ATOM   7502  C  CG1   . VAL B 1 68  ? 36.966  -31.167 26.085  1.00 28.28 ? 68   VAL B CG1   1 
ATOM   7503  C  CG2   . VAL B 1 68  ? 36.156  -29.717 28.007  1.00 27.37 ? 68   VAL B CG2   1 
ATOM   7504  N  N     . ARG B 1 69  ? 38.230  -28.591 23.942  1.00 35.43 ? 69   ARG B N     1 
ATOM   7505  C  CA    . ARG B 1 69  ? 38.531  -28.532 22.521  1.00 37.59 ? 69   ARG B CA    1 
ATOM   7506  C  C     . ARG B 1 69  ? 39.082  -29.765 21.828  1.00 38.61 ? 69   ARG B C     1 
ATOM   7507  O  O     . ARG B 1 69  ? 39.363  -29.778 20.639  1.00 37.06 ? 69   ARG B O     1 
ATOM   7508  C  CB    . ARG B 1 69  ? 39.406  -27.308 22.213  1.00 38.90 ? 69   ARG B CB    1 
ATOM   7509  C  CG    . ARG B 1 69  ? 38.803  -25.999 22.776  1.00 45.69 ? 69   ARG B CG    1 
ATOM   7510  C  CD    . ARG B 1 69  ? 39.575  -24.754 22.302  1.00 41.66 ? 69   ARG B CD    1 
ATOM   7511  N  NE    . ARG B 1 69  ? 39.020  -23.491 22.762  1.00 49.02 ? 69   ARG B NE    1 
ATOM   7512  C  CZ    . ARG B 1 69  ? 38.300  -22.603 22.065  1.00 49.14 ? 69   ARG B CZ    1 
ATOM   7513  N  NH1   . ARG B 1 69  ? 37.975  -22.937 20.818  1.00 49.07 ? 69   ARG B NH1   1 
ATOM   7514  N  NH2   . ARG B 1 69  ? 37.892  -21.401 22.501  1.00 45.10 ? 69   ARG B NH2   1 
ATOM   7515  N  N     . SER B 1 70  ? 39.366  -30.855 22.524  1.00 40.45 ? 70   SER B N     1 
ATOM   7516  C  CA    . SER B 1 70  ? 39.759  -32.127 21.980  1.00 41.06 ? 70   SER B CA    1 
ATOM   7517  C  C     . SER B 1 70  ? 39.898  -33.160 23.107  1.00 41.33 ? 70   SER B C     1 
ATOM   7518  O  O     . SER B 1 70  ? 40.170  -32.781 24.250  1.00 41.90 ? 70   SER B O     1 
ATOM   7519  C  CB    . SER B 1 70  ? 41.142  -32.171 21.322  1.00 37.88 ? 70   SER B CB    1 
ATOM   7520  O  OG    . SER B 1 70  ? 42.076  -31.890 22.356  1.00 41.03 ? 70   SER B OG    1 
ATOM   7521  N  N     . ILE B 1 71  ? 39.926  -34.383 22.604  1.00 40.28 ? 71   ILE B N     1 
ATOM   7522  C  CA    . ILE B 1 71  ? 40.048  -35.550 23.490  1.00 39.56 ? 71   ILE B CA    1 
ATOM   7523  C  C     . ILE B 1 71  ? 41.503  -35.632 23.871  1.00 39.50 ? 71   ILE B C     1 
ATOM   7524  O  O     . ILE B 1 71  ? 42.285  -34.929 23.267  1.00 37.57 ? 71   ILE B O     1 
ATOM   7525  C  CB    . ILE B 1 71  ? 39.598  -36.769 22.665  1.00 40.77 ? 71   ILE B CB    1 
ATOM   7526  C  CG1   . ILE B 1 71  ? 40.296  -36.732 21.294  1.00 40.31 ? 71   ILE B CG1   1 
ATOM   7527  C  CG2   . ILE B 1 71  ? 38.085  -36.699 22.468  1.00 35.24 ? 71   ILE B CG2   1 
ATOM   7528  C  CD1   . ILE B 1 71  ? 40.126  -38.023 20.499  1.00 42.47 ? 71   ILE B CD1   1 
ATOM   7529  N  N     . PRO B 1 72  ? 41.831  -36.322 24.931  1.00 42.05 ? 72   PRO B N     1 
ATOM   7530  C  CA    . PRO B 1 72  ? 43.195  -36.303 25.486  1.00 43.90 ? 72   PRO B CA    1 
ATOM   7531  C  C     . PRO B 1 72  ? 44.244  -36.611 24.446  1.00 47.33 ? 72   PRO B C     1 
ATOM   7532  O  O     . PRO B 1 72  ? 43.924  -37.244 23.448  1.00 47.33 ? 72   PRO B O     1 
ATOM   7533  C  CB    . PRO B 1 72  ? 43.087  -37.319 26.607  1.00 41.27 ? 72   PRO B CB    1 
ATOM   7534  C  CG    . PRO B 1 72  ? 41.676  -37.119 27.080  1.00 39.45 ? 72   PRO B CG    1 
ATOM   7535  C  CD    . PRO B 1 72  ? 40.921  -37.150 25.771  1.00 39.72 ? 72   PRO B CD    1 
ATOM   7536  N  N     . ASP B 1 73  ? 45.419  -35.981 24.534  1.00 51.20 ? 73   ASP B N     1 
ATOM   7537  C  CA    . ASP B 1 73  ? 46.451  -36.178 23.506  1.00 53.78 ? 73   ASP B CA    1 
ATOM   7538  C  C     . ASP B 1 73  ? 47.689  -36.858 24.066  1.00 55.19 ? 73   ASP B C     1 
ATOM   7539  O  O     . ASP B 1 73  ? 48.743  -36.740 23.443  1.00 55.41 ? 73   ASP B O     1 
ATOM   7540  C  CB    . ASP B 1 73  ? 46.884  -34.858 22.854  1.00 57.29 ? 73   ASP B CB    1 
ATOM   7541  C  CG    . ASP B 1 73  ? 47.530  -33.851 23.788  1.00 59.99 ? 73   ASP B CG    1 
ATOM   7542  O  OD1   . ASP B 1 73  ? 47.917  -34.229 24.917  1.00 60.65 ? 73   ASP B OD1   1 
ATOM   7543  O  OD2   . ASP B 1 73  ? 47.647  -32.642 23.453  1.00 59.03 ? 73   ASP B OD2   1 
ATOM   7544  N  N     . GLY B 1 74  ? 47.604  -37.563 25.188  1.00 56.73 ? 74   GLY B N     1 
ATOM   7545  C  CA    . GLY B 1 74  ? 48.762  -38.250 25.749  1.00 57.95 ? 74   GLY B CA    1 
ATOM   7546  C  C     . GLY B 1 74  ? 49.750  -37.373 26.497  1.00 58.56 ? 74   GLY B C     1 
ATOM   7547  O  O     . GLY B 1 74  ? 50.561  -37.908 27.264  1.00 58.58 ? 74   GLY B O     1 
ATOM   7548  N  N     . SER B 1 75  ? 49.675  -36.056 26.399  1.00 58.76 ? 75   SER B N     1 
ATOM   7549  C  CA    . SER B 1 75  ? 50.592  -35.138 27.053  1.00 59.49 ? 75   SER B CA    1 
ATOM   7550  C  C     . SER B 1 75  ? 50.216  -34.649 28.444  1.00 60.44 ? 75   SER B C     1 
ATOM   7551  O  O     . SER B 1 75  ? 50.979  -33.892 29.073  1.00 60.87 ? 75   SER B O     1 
ATOM   7552  C  CB    . SER B 1 75  ? 50.752  -33.916 26.126  1.00 58.94 ? 75   SER B CB    1 
ATOM   7553  O  OG    . SER B 1 75  ? 49.685  -33.008 26.368  1.00 62.43 ? 75   SER B OG    1 
ATOM   7554  N  N     . GLU B 1 76  ? 49.034  -34.993 28.979  1.00 59.49 ? 76   GLU B N     1 
ATOM   7555  C  CA    . GLU B 1 76  ? 48.691  -34.644 30.351  1.00 57.50 ? 76   GLU B CA    1 
ATOM   7556  C  C     . GLU B 1 76  ? 49.490  -35.433 31.393  1.00 56.27 ? 76   GLU B C     1 
ATOM   7557  O  O     . GLU B 1 76  ? 49.737  -36.629 31.322  1.00 55.78 ? 76   GLU B O     1 
ATOM   7558  C  CB    . GLU B 1 76  ? 47.209  -34.952 30.590  1.00 56.94 ? 76   GLU B CB    1 
ATOM   7559  C  CG    . GLU B 1 76  ? 46.792  -36.102 29.672  1.00 58.77 ? 76   GLU B CG    1 
ATOM   7560  C  CD    . GLU B 1 76  ? 46.389  -35.521 28.316  1.00 55.60 ? 76   GLU B CD    1 
ATOM   7561  O  OE1   . GLU B 1 76  ? 45.774  -34.441 28.374  1.00 50.45 ? 76   GLU B OE1   1 
ATOM   7562  O  OE2   . GLU B 1 76  ? 46.709  -36.181 27.312  1.00 53.75 ? 76   GLU B OE2   1 
ATOM   7563  N  N     . LYS B 1 77  ? 49.809  -34.744 32.483  1.00 55.25 ? 77   LYS B N     1 
ATOM   7564  C  CA    . LYS B 1 77  ? 50.523  -35.310 33.613  1.00 53.98 ? 77   LYS B CA    1 
ATOM   7565  C  C     . LYS B 1 77  ? 50.177  -34.482 34.853  1.00 53.39 ? 77   LYS B C     1 
ATOM   7566  O  O     . LYS B 1 77  ? 49.915  -33.265 34.783  1.00 52.77 ? 77   LYS B O     1 
ATOM   7567  C  CB    . LYS B 1 77  ? 52.033  -35.215 33.325  1.00 55.93 ? 77   LYS B CB    1 
ATOM   7568  C  CG    . LYS B 1 77  ? 52.440  -33.795 32.923  1.00 64.31 ? 77   LYS B CG    1 
ATOM   7569  C  CD    . LYS B 1 77  ? 53.933  -33.600 32.742  1.00 65.42 ? 77   LYS B CD    1 
ATOM   7570  C  CE    . LYS B 1 77  ? 54.386  -33.812 31.301  1.00 70.22 ? 77   LYS B CE    1 
ATOM   7571  N  NZ    . LYS B 1 77  ? 55.881  -33.949 31.220  1.00 70.05 ? 77   LYS B NZ    1 
ATOM   7572  N  N     . GLY B 1 78  ? 50.091  -35.200 35.973  1.00 52.43 ? 78   GLY B N     1 
ATOM   7573  C  CA    . GLY B 1 78  ? 49.744  -34.569 37.239  1.00 51.62 ? 78   GLY B CA    1 
ATOM   7574  C  C     . GLY B 1 78  ? 48.922  -35.515 38.111  1.00 51.46 ? 78   GLY B C     1 
ATOM   7575  O  O     . GLY B 1 78  ? 48.814  -36.701 37.797  1.00 51.42 ? 78   GLY B O     1 
ATOM   7576  N  N     . ASP B 1 79  ? 48.426  -34.995 39.213  1.00 51.51 ? 79   ASP B N     1 
ATOM   7577  C  CA    . ASP B 1 79  ? 47.728  -35.720 40.267  1.00 51.83 ? 79   ASP B CA    1 
ATOM   7578  C  C     . ASP B 1 79  ? 46.474  -34.938 40.649  1.00 51.50 ? 79   ASP B C     1 
ATOM   7579  O  O     . ASP B 1 79  ? 46.543  -33.853 41.210  1.00 51.33 ? 79   ASP B O     1 
ATOM   7580  C  CB    . ASP B 1 79  ? 48.659  -36.020 41.408  1.00 52.62 ? 79   ASP B CB    1 
ATOM   7581  C  CG    . ASP B 1 79  ? 48.285  -36.603 42.731  1.00 53.25 ? 79   ASP B CG    1 
ATOM   7582  O  OD1   . ASP B 1 79  ? 47.118  -36.746 43.142  1.00 53.87 ? 79   ASP B OD1   1 
ATOM   7583  O  OD2   . ASP B 1 79  ? 49.260  -36.890 43.490  1.00 56.92 ? 79   ASP B OD2   1 
ATOM   7584  N  N     . PHE B 1 80  ? 45.326  -35.506 40.266  1.00 51.21 ? 80   PHE B N     1 
ATOM   7585  C  CA    . PHE B 1 80  ? 44.080  -34.748 40.313  1.00 50.39 ? 80   PHE B CA    1 
ATOM   7586  C  C     . PHE B 1 80  ? 42.979  -35.305 41.186  1.00 50.80 ? 80   PHE B C     1 
ATOM   7587  O  O     . PHE B 1 80  ? 42.643  -36.501 41.085  1.00 52.64 ? 80   PHE B O     1 
ATOM   7588  C  CB    . PHE B 1 80  ? 43.565  -34.690 38.851  1.00 41.87 ? 80   PHE B CB    1 
ATOM   7589  C  CG    . PHE B 1 80  ? 44.597  -34.100 37.918  1.00 39.78 ? 80   PHE B CG    1 
ATOM   7590  C  CD1   . PHE B 1 80  ? 44.862  -32.747 37.910  1.00 35.26 ? 80   PHE B CD1   1 
ATOM   7591  C  CD2   . PHE B 1 80  ? 45.311  -34.925 37.062  1.00 42.87 ? 80   PHE B CD2   1 
ATOM   7592  C  CE1   . PHE B 1 80  ? 45.789  -32.208 37.048  1.00 37.40 ? 80   PHE B CE1   1 
ATOM   7593  C  CE2   . PHE B 1 80  ? 46.261  -34.404 36.192  1.00 43.37 ? 80   PHE B CE2   1 
ATOM   7594  C  CZ    . PHE B 1 80  ? 46.500  -33.046 36.203  1.00 42.26 ? 80   PHE B CZ    1 
ATOM   7595  N  N     . ILE B 1 81  ? 42.397  -34.491 42.050  1.00 50.40 ? 81   ILE B N     1 
ATOM   7596  C  CA    . ILE B 1 81  ? 41.196  -34.843 42.799  1.00 50.22 ? 81   ILE B CA    1 
ATOM   7597  C  C     . ILE B 1 81  ? 40.010  -34.599 41.855  1.00 50.53 ? 81   ILE B C     1 
ATOM   7598  O  O     . ILE B 1 81  ? 39.972  -33.510 41.254  1.00 51.25 ? 81   ILE B O     1 
ATOM   7599  C  CB    . ILE B 1 81  ? 40.986  -33.911 44.007  1.00 49.76 ? 81   ILE B CB    1 
ATOM   7600  C  CG1   . ILE B 1 81  ? 42.165  -33.997 44.977  1.00 48.70 ? 81   ILE B CG1   1 
ATOM   7601  C  CG2   . ILE B 1 81  ? 39.675  -34.257 44.710  1.00 45.46 ? 81   ILE B CG2   1 
ATOM   7602  C  CD1   . ILE B 1 81  ? 42.625  -35.407 45.232  1.00 49.15 ? 81   ILE B CD1   1 
ATOM   7603  N  N     . ALA B 1 82  ? 39.025  -35.466 41.820  1.00 49.36 ? 82   ALA B N     1 
ATOM   7604  C  CA    . ALA B 1 82  ? 37.885  -35.310 40.944  1.00 48.22 ? 82   ALA B CA    1 
ATOM   7605  C  C     . ALA B 1 82  ? 36.551  -35.630 41.629  1.00 46.88 ? 82   ALA B C     1 
ATOM   7606  O  O     . ALA B 1 82  ? 36.358  -36.770 42.071  1.00 47.82 ? 82   ALA B O     1 
ATOM   7607  C  CB    . ALA B 1 82  ? 37.962  -36.254 39.744  1.00 52.60 ? 82   ALA B CB    1 
ATOM   7608  N  N     . LEU B 1 83  ? 35.643  -34.642 41.511  1.00 43.37 ? 83   LEU B N     1 
ATOM   7609  C  CA    . LEU B 1 83  ? 34.294  -34.968 41.974  1.00 40.01 ? 83   LEU B CA    1 
ATOM   7610  C  C     . LEU B 1 83  ? 33.367  -35.310 40.803  1.00 39.03 ? 83   LEU B C     1 
ATOM   7611  O  O     . LEU B 1 83  ? 33.453  -34.780 39.692  1.00 37.74 ? 83   LEU B O     1 
ATOM   7612  C  CB    . LEU B 1 83  ? 33.691  -33.849 42.791  1.00 39.58 ? 83   LEU B CB    1 
ATOM   7613  C  CG    . LEU B 1 83  ? 34.594  -32.924 43.608  1.00 43.32 ? 83   LEU B CG    1 
ATOM   7614  C  CD1   . LEU B 1 83  ? 33.836  -31.613 43.785  1.00 44.05 ? 83   LEU B CD1   1 
ATOM   7615  C  CD2   . LEU B 1 83  ? 34.864  -33.463 45.002  1.00 43.79 ? 83   LEU B CD2   1 
ATOM   7616  N  N     . ASP B 1 84  ? 32.463  -36.226 41.137  1.00 37.65 ? 84   ASP B N     1 
ATOM   7617  C  CA    . ASP B 1 84  ? 31.385  -36.659 40.256  1.00 36.25 ? 84   ASP B CA    1 
ATOM   7618  C  C     . ASP B 1 84  ? 30.061  -36.571 41.016  1.00 36.46 ? 84   ASP B C     1 
ATOM   7619  O  O     . ASP B 1 84  ? 29.754  -37.623 41.629  1.00 36.92 ? 84   ASP B O     1 
ATOM   7620  C  CB    . ASP B 1 84  ? 31.682  -38.160 39.999  1.00 33.68 ? 84   ASP B CB    1 
ATOM   7621  C  CG    . ASP B 1 84  ? 30.827  -38.824 38.962  1.00 35.62 ? 84   ASP B CG    1 
ATOM   7622  O  OD1   . ASP B 1 84  ? 29.789  -38.277 38.538  1.00 41.62 ? 84   ASP B OD1   1 
ATOM   7623  O  OD2   . ASP B 1 84  ? 31.178  -39.940 38.527  1.00 42.26 ? 84   ASP B OD2   1 
ATOM   7624  N  N     . LEU B 1 85  ? 29.237  -35.559 40.927  1.00 35.06 ? 85   LEU B N     1 
ATOM   7625  C  CA    . LEU B 1 85  ? 27.935  -35.587 41.629  1.00 32.92 ? 85   LEU B CA    1 
ATOM   7626  C  C     . LEU B 1 85  ? 26.848  -35.531 40.549  1.00 32.20 ? 85   LEU B C     1 
ATOM   7627  O  O     . LEU B 1 85  ? 27.065  -34.729 39.621  1.00 31.27 ? 85   LEU B O     1 
ATOM   7628  C  CB    . LEU B 1 85  ? 27.888  -34.170 42.346  1.00 33.78 ? 85   LEU B CB    1 
ATOM   7629  C  CG    . LEU B 1 85  ? 26.673  -33.952 43.243  1.00 32.64 ? 85   LEU B CG    1 
ATOM   7630  C  CD1   . LEU B 1 85  ? 26.466  -35.055 44.239  1.00 29.55 ? 85   LEU B CD1   1 
ATOM   7631  C  CD2   . LEU B 1 85  ? 26.752  -32.600 43.966  1.00 27.88 ? 85   LEU B CD2   1 
ATOM   7632  N  N     . GLY B 1 86  ? 25.681  -36.120 40.729  1.00 30.84 ? 86   GLY B N     1 
ATOM   7633  C  CA    . GLY B 1 86  ? 24.583  -36.050 39.801  1.00 30.14 ? 86   GLY B CA    1 
ATOM   7634  C  C     . GLY B 1 86  ? 23.936  -37.296 39.249  1.00 32.08 ? 86   GLY B C     1 
ATOM   7635  O  O     . GLY B 1 86  ? 22.762  -37.383 38.890  1.00 31.25 ? 86   GLY B O     1 
ATOM   7636  N  N     . GLY B 1 87  ? 24.665  -38.393 39.082  1.00 33.66 ? 87   GLY B N     1 
ATOM   7637  C  CA    . GLY B 1 87  ? 24.179  -39.699 38.740  1.00 34.37 ? 87   GLY B CA    1 
ATOM   7638  C  C     . GLY B 1 87  ? 23.855  -40.587 39.938  1.00 35.71 ? 87   GLY B C     1 
ATOM   7639  O  O     . GLY B 1 87  ? 23.289  -40.103 40.926  1.00 36.28 ? 87   GLY B O     1 
ATOM   7640  N  N     . SER B 1 88  ? 23.952  -41.916 39.826  1.00 35.08 ? 88   SER B N     1 
ATOM   7641  C  CA    . SER B 1 88  ? 23.414  -42.785 40.879  1.00 36.07 ? 88   SER B CA    1 
ATOM   7642  C  C     . SER B 1 88  ? 24.224  -42.770 42.159  1.00 36.70 ? 88   SER B C     1 
ATOM   7643  O  O     . SER B 1 88  ? 23.743  -43.013 43.266  1.00 37.98 ? 88   SER B O     1 
ATOM   7644  C  CB    . SER B 1 88  ? 23.232  -44.216 40.371  1.00 28.05 ? 88   SER B CB    1 
ATOM   7645  O  OG    . SER B 1 88  ? 24.355  -44.521 39.567  1.00 32.52 ? 88   SER B OG    1 
ATOM   7646  N  N     . SER B 1 89  ? 25.467  -42.311 42.066  1.00 35.48 ? 89   SER B N     1 
ATOM   7647  C  CA    . SER B 1 89  ? 26.321  -42.177 43.219  1.00 35.65 ? 89   SER B CA    1 
ATOM   7648  C  C     . SER B 1 89  ? 27.254  -40.988 43.169  1.00 35.99 ? 89   SER B C     1 
ATOM   7649  O  O     . SER B 1 89  ? 27.993  -40.807 42.201  1.00 38.40 ? 89   SER B O     1 
ATOM   7650  C  CB    . SER B 1 89  ? 27.266  -43.417 43.288  1.00 39.22 ? 89   SER B CB    1 
ATOM   7651  O  OG    . SER B 1 89  ? 26.548  -44.646 43.147  1.00 50.41 ? 89   SER B OG    1 
ATOM   7652  N  N     . PHE B 1 90  ? 27.458  -40.370 44.309  1.00 35.35 ? 90   PHE B N     1 
ATOM   7653  C  CA    . PHE B 1 90  ? 28.429  -39.309 44.500  1.00 35.82 ? 90   PHE B CA    1 
ATOM   7654  C  C     . PHE B 1 90  ? 29.806  -39.854 44.839  1.00 37.51 ? 90   PHE B C     1 
ATOM   7655  O  O     . PHE B 1 90  ? 30.074  -40.527 45.849  1.00 36.74 ? 90   PHE B O     1 
ATOM   7656  C  CB    . PHE B 1 90  ? 27.904  -38.300 45.526  1.00 34.13 ? 90   PHE B CB    1 
ATOM   7657  C  CG    . PHE B 1 90  ? 28.907  -37.279 45.976  1.00 38.95 ? 90   PHE B CG    1 
ATOM   7658  C  CD1   . PHE B 1 90  ? 29.803  -36.706 45.090  1.00 37.63 ? 90   PHE B CD1   1 
ATOM   7659  C  CD2   . PHE B 1 90  ? 28.972  -36.917 47.313  1.00 36.97 ? 90   PHE B CD2   1 
ATOM   7660  C  CE1   . PHE B 1 90  ? 30.767  -35.804 45.506  1.00 38.13 ? 90   PHE B CE1   1 
ATOM   7661  C  CE2   . PHE B 1 90  ? 29.894  -35.993 47.745  1.00 34.24 ? 90   PHE B CE2   1 
ATOM   7662  C  CZ    . PHE B 1 90  ? 30.771  -35.433 46.832  1.00 41.78 ? 90   PHE B CZ    1 
ATOM   7663  N  N     . ARG B 1 91  ? 30.749  -39.612 43.908  1.00 38.62 ? 91   ARG B N     1 
ATOM   7664  C  CA    . ARG B 1 91  ? 32.074  -40.126 44.048  1.00 40.64 ? 91   ARG B CA    1 
ATOM   7665  C  C     . ARG B 1 91  ? 33.134  -39.058 43.863  1.00 42.42 ? 91   ARG B C     1 
ATOM   7666  O  O     . ARG B 1 91  ? 32.997  -38.024 43.199  1.00 44.70 ? 91   ARG B O     1 
ATOM   7667  C  CB    . ARG B 1 91  ? 32.386  -41.409 43.317  1.00 47.93 ? 91   ARG B CB    1 
ATOM   7668  C  CG    . ARG B 1 91  ? 31.694  -41.682 41.998  1.00 57.14 ? 91   ARG B CG    1 
ATOM   7669  C  CD    . ARG B 1 91  ? 31.359  -43.170 41.881  1.00 62.99 ? 91   ARG B CD    1 
ATOM   7670  N  NE    . ARG B 1 91  ? 32.109  -43.902 40.875  1.00 66.85 ? 91   ARG B NE    1 
ATOM   7671  C  CZ    . ARG B 1 91  ? 33.003  -44.848 41.129  1.00 69.50 ? 91   ARG B CZ    1 
ATOM   7672  N  NH1   . ARG B 1 91  ? 33.282  -45.192 42.381  1.00 66.54 ? 91   ARG B NH1   1 
ATOM   7673  N  NH2   . ARG B 1 91  ? 33.621  -45.498 40.148  1.00 72.28 ? 91   ARG B NH2   1 
ATOM   7674  N  N     . ILE B 1 92  ? 34.223  -39.330 44.563  1.00 42.21 ? 92   ILE B N     1 
ATOM   7675  C  CA    . ILE B 1 92  ? 35.437  -38.575 44.702  1.00 42.37 ? 92   ILE B CA    1 
ATOM   7676  C  C     . ILE B 1 92  ? 36.636  -39.461 44.391  1.00 42.36 ? 92   ILE B C     1 
ATOM   7677  O  O     . ILE B 1 92  ? 36.821  -40.521 44.983  1.00 41.99 ? 92   ILE B O     1 
ATOM   7678  C  CB    . ILE B 1 92  ? 35.584  -38.038 46.155  1.00 39.13 ? 92   ILE B CB    1 
ATOM   7679  C  CG1   . ILE B 1 92  ? 34.289  -37.256 46.480  1.00 37.60 ? 92   ILE B CG1   1 
ATOM   7680  C  CG2   . ILE B 1 92  ? 36.799  -37.146 46.241  1.00 34.83 ? 92   ILE B CG2   1 
ATOM   7681  C  CD1   . ILE B 1 92  ? 34.449  -36.465 47.784  1.00 41.24 ? 92   ILE B CD1   1 
ATOM   7682  N  N     . LEU B 1 93  ? 37.345  -39.127 43.324  1.00 42.69 ? 93   LEU B N     1 
ATOM   7683  C  CA    . LEU B 1 93  ? 38.432  -39.972 42.847  1.00 43.88 ? 93   LEU B CA    1 
ATOM   7684  C  C     . LEU B 1 93  ? 39.763  -39.251 42.982  1.00 45.73 ? 93   LEU B C     1 
ATOM   7685  O  O     . LEU B 1 93  ? 39.795  -38.020 42.935  1.00 46.04 ? 93   LEU B O     1 
ATOM   7686  C  CB    . LEU B 1 93  ? 38.182  -40.284 41.360  1.00 44.76 ? 93   LEU B CB    1 
ATOM   7687  C  CG    . LEU B 1 93  ? 36.832  -40.948 41.034  1.00 45.20 ? 93   LEU B CG    1 
ATOM   7688  C  CD1   . LEU B 1 93  ? 35.801  -39.826 40.855  1.00 42.27 ? 93   LEU B CD1   1 
ATOM   7689  C  CD2   . LEU B 1 93  ? 36.908  -41.798 39.778  1.00 38.58 ? 93   LEU B CD2   1 
ATOM   7690  N  N     . ARG B 1 94  ? 40.854  -40.003 43.063  1.00 46.25 ? 94   ARG B N     1 
ATOM   7691  C  CA    . ARG B 1 94  ? 42.170  -39.355 42.989  1.00 46.98 ? 94   ARG B CA    1 
ATOM   7692  C  C     . ARG B 1 94  ? 42.877  -39.977 41.786  1.00 48.06 ? 94   ARG B C     1 
ATOM   7693  O  O     . ARG B 1 94  ? 43.041  -41.228 41.730  1.00 49.83 ? 94   ARG B O     1 
ATOM   7694  C  CB    . ARG B 1 94  ? 43.035  -39.433 44.236  1.00 44.82 ? 94   ARG B CB    1 
ATOM   7695  C  CG    . ARG B 1 94  ? 44.508  -39.217 43.909  1.00 44.82 ? 94   ARG B CG    1 
ATOM   7696  C  CD    . ARG B 1 94  ? 45.344  -39.181 45.189  1.00 49.41 ? 94   ARG B CD    1 
ATOM   7697  N  NE    . ARG B 1 94  ? 46.666  -38.635 44.857  1.00 53.95 ? 94   ARG B NE    1 
ATOM   7698  C  CZ    . ARG B 1 94  ? 47.681  -38.771 45.712  1.00 57.79 ? 94   ARG B CZ    1 
ATOM   7699  N  NH1   . ARG B 1 94  ? 47.406  -39.404 46.850  1.00 57.76 ? 94   ARG B NH1   1 
ATOM   7700  N  NH2   . ARG B 1 94  ? 48.889  -38.294 45.455  1.00 54.34 ? 94   ARG B NH2   1 
ATOM   7701  N  N     . VAL B 1 95  ? 43.013  -39.206 40.732  1.00 48.13 ? 95   VAL B N     1 
ATOM   7702  C  CA    . VAL B 1 95  ? 43.550  -39.716 39.489  1.00 49.40 ? 95   VAL B CA    1 
ATOM   7703  C  C     . VAL B 1 95  ? 45.004  -39.336 39.282  1.00 51.86 ? 95   VAL B C     1 
ATOM   7704  O  O     . VAL B 1 95  ? 45.331  -38.149 39.308  1.00 51.91 ? 95   VAL B O     1 
ATOM   7705  C  CB    . VAL B 1 95  ? 42.744  -39.162 38.291  1.00 49.48 ? 95   VAL B CB    1 
ATOM   7706  C  CG1   . VAL B 1 95  ? 43.482  -39.553 37.014  1.00 45.60 ? 95   VAL B CG1   1 
ATOM   7707  C  CG2   . VAL B 1 95  ? 41.335  -39.752 38.353  1.00 46.03 ? 95   VAL B CG2   1 
ATOM   7708  N  N     . GLN B 1 96  ? 45.856  -40.335 39.074  1.00 54.22 ? 96   GLN B N     1 
ATOM   7709  C  CA    . GLN B 1 96  ? 47.273  -39.993 38.866  1.00 57.78 ? 96   GLN B CA    1 
ATOM   7710  C  C     . GLN B 1 96  ? 47.655  -40.472 37.476  1.00 59.47 ? 96   GLN B C     1 
ATOM   7711  O  O     . GLN B 1 96  ? 47.151  -41.499 37.024  1.00 59.78 ? 96   GLN B O     1 
ATOM   7712  C  CB    . GLN B 1 96  ? 48.179  -40.524 39.944  1.00 60.22 ? 96   GLN B CB    1 
ATOM   7713  C  CG    . GLN B 1 96  ? 48.422  -39.604 41.142  1.00 62.07 ? 96   GLN B CG    1 
ATOM   7714  C  CD    . GLN B 1 96  ? 48.834  -40.472 42.328  1.00 65.41 ? 96   GLN B CD    1 
ATOM   7715  O  OE1   . GLN B 1 96  ? 48.229  -41.523 42.577  1.00 64.02 ? 96   GLN B OE1   1 
ATOM   7716  N  NE2   . GLN B 1 96  ? 49.871  -40.054 43.042  1.00 64.23 ? 96   GLN B NE2   1 
ATOM   7717  N  N     . VAL B 1 97  ? 48.360  -39.628 36.761  1.00 61.63 ? 97   VAL B N     1 
ATOM   7718  C  CA    . VAL B 1 97  ? 48.647  -39.901 35.347  1.00 64.08 ? 97   VAL B CA    1 
ATOM   7719  C  C     . VAL B 1 97  ? 50.083  -39.494 35.036  1.00 65.84 ? 97   VAL B C     1 
ATOM   7720  O  O     . VAL B 1 97  ? 50.450  -38.360 35.332  1.00 65.15 ? 97   VAL B O     1 
ATOM   7721  C  CB    . VAL B 1 97  ? 47.718  -38.956 34.544  1.00 64.48 ? 97   VAL B CB    1 
ATOM   7722  C  CG1   . VAL B 1 97  ? 48.130  -38.879 33.085  1.00 64.57 ? 97   VAL B CG1   1 
ATOM   7723  C  CG2   . VAL B 1 97  ? 46.256  -39.289 34.736  1.00 63.30 ? 97   VAL B CG2   1 
ATOM   7724  N  N     . ASN B 1 98  ? 50.893  -40.385 34.498  1.00 69.05 ? 98   ASN B N     1 
ATOM   7725  C  CA    . ASN B 1 98  ? 52.222  -40.004 34.034  1.00 71.74 ? 98   ASN B CA    1 
ATOM   7726  C  C     . ASN B 1 98  ? 52.586  -40.721 32.744  1.00 73.34 ? 98   ASN B C     1 
ATOM   7727  O  O     . ASN B 1 98  ? 51.933  -41.707 32.358  1.00 73.41 ? 98   ASN B O     1 
ATOM   7728  C  CB    . ASN B 1 98  ? 53.244  -39.878 35.112  1.00 75.26 ? 98   ASN B CB    1 
ATOM   7729  C  CG    . ASN B 1 98  ? 53.883  -41.063 35.765  1.00 79.29 ? 98   ASN B CG    1 
ATOM   7730  O  OD1   . ASN B 1 98  ? 54.274  -42.048 35.128  1.00 82.90 ? 98   ASN B OD1   1 
ATOM   7731  N  ND2   . ASN B 1 98  ? 54.098  -40.984 37.082  1.00 79.11 ? 98   ASN B ND2   1 
ATOM   7732  N  N     . HIS B 1 99  ? 53.470  -40.125 31.939  1.00 73.89 ? 99   HIS B N     1 
ATOM   7733  C  CA    . HIS B 1 99  ? 53.803  -40.685 30.634  1.00 75.03 ? 99   HIS B CA    1 
ATOM   7734  C  C     . HIS B 1 99  ? 55.131  -41.440 30.640  1.00 75.97 ? 99   HIS B C     1 
ATOM   7735  O  O     . HIS B 1 99  ? 55.218  -42.653 30.866  1.00 75.91 ? 99   HIS B O     1 
ATOM   7736  C  CB    . HIS B 1 99  ? 53.564  -39.152 29.849  0.00 30.00 ? 99   HIS B CB    1 
ATOM   7737  C  CG    . HIS B 1 99  ? 54.871  -38.544 29.302  0.00 30.00 ? 99   HIS B CG    1 
ATOM   7738  N  ND1   . HIS B 1 99  ? 54.887  -37.290 28.802  0.00 30.00 ? 99   HIS B ND1   1 
ATOM   7739  C  CD2   . HIS B 1 99  ? 56.143  -39.030 29.185  0.00 30.00 ? 99   HIS B CD2   1 
ATOM   7740  C  CE1   . HIS B 1 99  ? 56.088  -36.999 28.377  0.00 30.00 ? 99   HIS B CE1   1 
ATOM   7741  N  NE2   . HIS B 1 99  ? 56.870  -38.029 28.587  0.00 30.00 ? 99   HIS B NE2   1 
ATOM   7742  N  N     . GLU B 1 100 ? 55.825  -39.991 30.159  0.00 30.00 ? 100  GLU B N     1 
ATOM   7743  C  CA    . GLU B 1 100 ? 57.212  -40.266 29.803  0.00 30.00 ? 100  GLU B CA    1 
ATOM   7744  C  C     . GLU B 1 100 ? 58.122  -40.283 31.029  0.00 30.00 ? 100  GLU B C     1 
ATOM   7745  O  O     . GLU B 1 100 ? 59.282  -39.888 30.840  0.00 30.00 ? 100  GLU B O     1 
ATOM   7746  C  CB    . GLU B 1 100 ? 58.373  -39.136 29.959  0.00 30.00 ? 100  GLU B CB    1 
ATOM   7747  C  CG    . GLU B 1 100 ? 59.401  -38.805 28.880  0.00 30.00 ? 100  GLU B CG    1 
ATOM   7748  C  CD    . GLU B 1 100 ? 60.258  -40.004 28.487  0.00 30.00 ? 100  GLU B CD    1 
ATOM   7749  O  OE1   . GLU B 1 100 ? 60.523  -40.843 29.362  0.00 30.00 ? 100  GLU B OE1   1 
ATOM   7750  O  OE2   . GLU B 1 100 ? 60.652  -40.106 27.308  0.00 30.00 ? 100  GLU B OE2   1 
ATOM   7751  N  N     . LYS B 1 101 ? 58.046  -42.652 29.779  0.00 30.00 ? 101  LYS B N     1 
ATOM   7752  C  CA    . LYS B 1 101 ? 58.583  -43.805 30.467  0.00 30.00 ? 101  LYS B CA    1 
ATOM   7753  C  C     . LYS B 1 101 ? 57.698  -45.041 30.516  0.00 30.00 ? 101  LYS B C     1 
ATOM   7754  O  O     . LYS B 1 101 ? 57.377  -45.737 29.550  0.00 30.00 ? 101  LYS B O     1 
ATOM   7755  C  CB    . LYS B 1 101 ? 58.947  -43.431 31.936  0.00 30.00 ? 101  LYS B CB    1 
ATOM   7756  C  CG    . LYS B 1 101 ? 59.785  -42.166 32.115  0.00 30.00 ? 101  LYS B CG    1 
ATOM   7757  C  CD    . LYS B 1 101 ? 60.222  -41.954 33.557  0.00 30.00 ? 101  LYS B CD    1 
ATOM   7758  C  CE    . LYS B 1 101 ? 61.179  -40.778 33.671  0.00 30.00 ? 101  LYS B CE    1 
ATOM   7759  N  NZ    . LYS B 1 101 ? 61.591  -40.530 35.079  0.00 30.00 ? 101  LYS B NZ    1 
ATOM   7760  N  N     . ASN B 1 102 ? 56.931  -45.198 33.270  0.00 30.00 ? 102  ASN B N     1 
ATOM   7761  C  CA    . ASN B 1 102 ? 56.471  -46.089 32.211  0.00 30.00 ? 102  ASN B CA    1 
ATOM   7762  C  C     . ASN B 1 102 ? 54.983  -46.390 32.350  0.00 30.00 ? 102  ASN B C     1 
ATOM   7763  O  O     . ASN B 1 102 ? 54.438  -46.455 33.450  0.00 30.00 ? 102  ASN B O     1 
ATOM   7764  C  CB    . ASN B 1 102 ? 57.338  -46.114 33.822  0.00 30.00 ? 102  ASN B CB    1 
ATOM   7765  C  CG    . ASN B 1 102 ? 58.620  -45.289 33.523  0.00 30.00 ? 102  ASN B CG    1 
ATOM   7766  O  OD1   . ASN B 1 102 ? 59.518  -45.758 32.827  0.00 30.00 ? 102  ASN B OD1   1 
ATOM   7767  N  ND2   . ASN B 1 102 ? 58.670  -44.069 34.049  0.00 30.00 ? 102  ASN B ND2   1 
ATOM   7768  N  N     . GLN B 1 103 ? 54.295  -46.556 31.237  0.00 30.00 ? 103  GLN B N     1 
ATOM   7769  C  CA    . GLN B 1 103 ? 52.891  -46.840 31.054  0.00 30.00 ? 103  GLN B CA    1 
ATOM   7770  C  C     . GLN B 1 103 ? 51.942  -46.913 32.234  0.00 30.00 ? 103  GLN B C     1 
ATOM   7771  O  O     . GLN B 1 103 ? 51.938  -47.864 33.021  0.00 30.00 ? 103  GLN B O     1 
ATOM   7772  C  CB    . GLN B 1 103 ? 52.743  -48.083 30.149  0.00 30.00 ? 103  GLN B CB    1 
ATOM   7773  C  CG    . GLN B 1 103 ? 53.197  -47.855 28.715  0.00 30.00 ? 103  GLN B CG    1 
ATOM   7774  C  CD    . GLN B 1 103 ? 54.190  -48.852 28.168  0.00 30.00 ? 103  GLN B CD    1 
ATOM   7775  O  OE1   . GLN B 1 103 ? 53.956  -50.062 28.141  0.00 30.00 ? 103  GLN B OE1   1 
ATOM   7776  N  NE2   . GLN B 1 103 ? 55.340  -48.358 27.709  0.00 30.00 ? 103  GLN B NE2   1 
ATOM   7777  N  N     . ASN B 1 104 ? 50.086  -45.732 31.852  1.00 73.34 ? 104  ASN B N     1 
ATOM   7778  C  CA    . ASN B 1 104 ? 49.810  -45.651 33.285  1.00 72.38 ? 104  ASN B CA    1 
ATOM   7779  C  C     . ASN B 1 104 ? 48.840  -44.503 33.536  1.00 71.32 ? 104  ASN B C     1 
ATOM   7780  O  O     . ASN B 1 104 ? 48.763  -43.529 32.802  1.00 71.58 ? 104  ASN B O     1 
ATOM   7781  C  CB    . ASN B 1 104 ? 51.128  -45.500 34.039  1.00 75.34 ? 104  ASN B CB    1 
ATOM   7782  C  CG    . ASN B 1 104 ? 51.977  -44.373 33.485  1.00 79.06 ? 104  ASN B CG    1 
ATOM   7783  O  OD1   . ASN B 1 104 ? 51.960  -44.099 32.280  1.00 81.56 ? 104  ASN B OD1   1 
ATOM   7784  N  ND2   . ASN B 1 104 ? 52.722  -43.688 34.351  1.00 80.04 ? 104  ASN B ND2   1 
ATOM   7785  N  N     . VAL B 1 105 ? 47.885  -44.710 34.407  1.00 69.69 ? 105  VAL B N     1 
ATOM   7786  C  CA    . VAL B 1 105 ? 46.865  -43.826 34.914  1.00 67.51 ? 105  VAL B CA    1 
ATOM   7787  C  C     . VAL B 1 105 ? 46.311  -44.572 36.156  1.00 66.20 ? 105  VAL B C     1 
ATOM   7788  O  O     . VAL B 1 105 ? 45.815  -45.687 35.919  1.00 66.50 ? 105  VAL B O     1 
ATOM   7789  C  CB    . VAL B 1 105 ? 45.613  -43.660 34.029  1.00 65.03 ? 105  VAL B CB    1 
ATOM   7790  C  CG1   . VAL B 1 105 ? 44.560  -42.906 34.841  1.00 62.49 ? 105  VAL B CG1   1 
ATOM   7791  C  CG2   . VAL B 1 105 ? 45.901  -42.977 32.721  1.00 62.15 ? 105  VAL B CG2   1 
ATOM   7792  N  N     . HIS B 1 106 ? 46.506  -44.066 37.359  1.00 64.28 ? 106  HIS B N     1 
ATOM   7793  C  CA    . HIS B 1 106 ? 46.006  -44.838 38.501  1.00 63.23 ? 106  HIS B CA    1 
ATOM   7794  C  C     . HIS B 1 106 ? 44.820  -44.131 39.152  1.00 61.80 ? 106  HIS B C     1 
ATOM   7795  O  O     . HIS B 1 106 ? 44.909  -42.923 39.395  1.00 61.13 ? 106  HIS B O     1 
ATOM   7796  C  CB    . HIS B 1 106 ? 47.106  -45.076 39.535  1.00 64.73 ? 106  HIS B CB    1 
ATOM   7797  C  CG    . HIS B 1 106 ? 46.567  -45.489 40.871  1.00 66.28 ? 106  HIS B CG    1 
ATOM   7798  N  ND1   . HIS B 1 106 ? 46.123  -46.771 41.132  1.00 69.51 ? 106  HIS B ND1   1 
ATOM   7799  C  CD2   . HIS B 1 106 ? 46.393  -44.801 42.018  1.00 68.38 ? 106  HIS B CD2   1 
ATOM   7800  C  CE1   . HIS B 1 106 ? 45.698  -46.828 42.381  1.00 71.13 ? 106  HIS B CE1   1 
ATOM   7801  N  NE2   . HIS B 1 106 ? 45.848  -45.646 42.947  1.00 66.96 ? 106  HIS B NE2   1 
ATOM   7802  N  N     . MET B 1 107 ? 43.766  -44.887 39.473  1.00 60.84 ? 107  MET B N     1 
ATOM   7803  C  CA    . MET B 1 107 ? 42.639  -44.251 40.147  1.00 60.88 ? 107  MET B CA    1 
ATOM   7804  C  C     . MET B 1 107 ? 42.165  -44.971 41.405  1.00 60.58 ? 107  MET B C     1 
ATOM   7805  O  O     . MET B 1 107 ? 42.020  -46.190 41.439  1.00 61.54 ? 107  MET B O     1 
ATOM   7806  C  CB    . MET B 1 107 ? 41.447  -44.019 39.238  1.00 58.64 ? 107  MET B CB    1 
ATOM   7807  C  CG    . MET B 1 107 ? 41.700  -43.766 37.766  1.00 57.22 ? 107  MET B CG    1 
ATOM   7808  S  SD    . MET B 1 107 ? 40.103  -43.926 36.914  1.00 61.28 ? 107  MET B SD    1 
ATOM   7809  C  CE    . MET B 1 107 ? 40.253  -45.618 36.316  1.00 60.60 ? 107  MET B CE    1 
ATOM   7810  N  N     . GLU B 1 108 ? 41.831  -44.169 42.419  1.00 59.56 ? 108  GLU B N     1 
ATOM   7811  C  CA    . GLU B 1 108 ? 41.235  -44.715 43.641  1.00 57.84 ? 108  GLU B CA    1 
ATOM   7812  C  C     . GLU B 1 108 ? 40.024  -43.836 43.923  1.00 56.03 ? 108  GLU B C     1 
ATOM   7813  O  O     . GLU B 1 108 ? 40.111  -42.647 43.607  1.00 55.90 ? 108  GLU B O     1 
ATOM   7814  C  CB    . GLU B 1 108 ? 42.167  -44.770 44.843  1.00 62.86 ? 108  GLU B CB    1 
ATOM   7815  C  CG    . GLU B 1 108 ? 43.257  -43.725 44.994  1.00 66.49 ? 108  GLU B CG    1 
ATOM   7816  C  CD    . GLU B 1 108 ? 43.441  -43.273 46.430  1.00 68.68 ? 108  GLU B CD    1 
ATOM   7817  O  OE1   . GLU B 1 108 ? 42.417  -43.311 47.151  1.00 71.34 ? 108  GLU B OE1   1 
ATOM   7818  O  OE2   . GLU B 1 108 ? 44.542  -42.866 46.869  1.00 70.31 ? 108  GLU B OE2   1 
ATOM   7819  N  N     . SER B 1 109 ? 38.913  -44.366 44.385  1.00 54.69 ? 109  SER B N     1 
ATOM   7820  C  CA    . SER B 1 109 ? 37.775  -43.481 44.634  1.00 54.34 ? 109  SER B CA    1 
ATOM   7821  C  C     . SER B 1 109 ? 36.906  -43.971 45.782  1.00 53.92 ? 109  SER B C     1 
ATOM   7822  O  O     . SER B 1 109 ? 37.054  -45.118 46.237  1.00 54.01 ? 109  SER B O     1 
ATOM   7823  C  CB    . SER B 1 109 ? 36.998  -43.317 43.340  1.00 55.39 ? 109  SER B CB    1 
ATOM   7824  O  OG    . SER B 1 109 ? 36.407  -44.533 42.943  1.00 55.61 ? 109  SER B OG    1 
ATOM   7825  N  N     . GLU B 1 110 ? 36.000  -43.110 46.252  1.00 52.05 ? 110  GLU B N     1 
ATOM   7826  C  CA    . GLU B 1 110 ? 35.129  -43.539 47.352  1.00 51.23 ? 110  GLU B CA    1 
ATOM   7827  C  C     . GLU B 1 110 ? 33.700  -43.098 47.068  1.00 49.00 ? 110  GLU B C     1 
ATOM   7828  O  O     . GLU B 1 110 ? 33.552  -41.957 46.629  1.00 49.41 ? 110  GLU B O     1 
ATOM   7829  C  CB    . GLU B 1 110 ? 35.587  -42.919 48.679  1.00 55.57 ? 110  GLU B CB    1 
ATOM   7830  C  CG    . GLU B 1 110 ? 36.591  -43.749 49.453  1.00 66.60 ? 110  GLU B CG    1 
ATOM   7831  C  CD    . GLU B 1 110 ? 37.007  -43.091 50.759  1.00 72.96 ? 110  GLU B CD    1 
ATOM   7832  O  OE1   . GLU B 1 110 ? 37.818  -42.124 50.736  1.00 75.87 ? 110  GLU B OE1   1 
ATOM   7833  O  OE2   . GLU B 1 110 ? 36.507  -43.542 51.820  1.00 74.61 ? 110  GLU B OE2   1 
ATOM   7834  N  N     . VAL B 1 111 ? 32.717  -43.949 47.279  1.00 47.03 ? 111  VAL B N     1 
ATOM   7835  C  CA    . VAL B 1 111 ? 31.329  -43.506 47.183  1.00 46.06 ? 111  VAL B CA    1 
ATOM   7836  C  C     . VAL B 1 111 ? 30.983  -42.875 48.527  1.00 46.65 ? 111  VAL B C     1 
ATOM   7837  O  O     . VAL B 1 111 ? 31.567  -43.268 49.551  1.00 48.88 ? 111  VAL B O     1 
ATOM   7838  C  CB    . VAL B 1 111 ? 30.374  -44.587 46.684  1.00 43.19 ? 111  VAL B CB    1 
ATOM   7839  C  CG1   . VAL B 1 111 ? 30.623  -45.923 47.360  1.00 47.10 ? 111  VAL B CG1   1 
ATOM   7840  C  CG2   . VAL B 1 111 ? 28.886  -44.256 46.850  1.00 35.02 ? 111  VAL B CG2   1 
ATOM   7841  N  N     . TYR B 1 112 ? 30.233  -41.781 48.567  1.00 45.25 ? 112  TYR B N     1 
ATOM   7842  C  CA    . TYR B 1 112 ? 29.806  -41.124 49.805  1.00 43.08 ? 112  TYR B CA    1 
ATOM   7843  C  C     . TYR B 1 112 ? 28.286  -41.015 49.745  1.00 41.72 ? 112  TYR B C     1 
ATOM   7844  O  O     . TYR B 1 112 ? 27.817  -40.653 48.655  1.00 40.47 ? 112  TYR B O     1 
ATOM   7845  C  CB    . TYR B 1 112 ? 30.380  -39.687 49.836  1.00 42.58 ? 112  TYR B CB    1 
ATOM   7846  C  CG    . TYR B 1 112 ? 31.820  -39.636 50.296  1.00 42.10 ? 112  TYR B CG    1 
ATOM   7847  C  CD1   . TYR B 1 112 ? 32.148  -39.556 51.648  1.00 41.69 ? 112  TYR B CD1   1 
ATOM   7848  C  CD2   . TYR B 1 112 ? 32.857  -39.648 49.388  1.00 42.46 ? 112  TYR B CD2   1 
ATOM   7849  C  CE1   . TYR B 1 112 ? 33.453  -39.456 52.084  1.00 40.54 ? 112  TYR B CE1   1 
ATOM   7850  C  CE2   . TYR B 1 112 ? 34.173  -39.584 49.812  1.00 42.91 ? 112  TYR B CE2   1 
ATOM   7851  C  CZ    . TYR B 1 112 ? 34.468  -39.493 51.167  1.00 42.07 ? 112  TYR B CZ    1 
ATOM   7852  O  OH    . TYR B 1 112 ? 35.802  -39.416 51.541  1.00 42.78 ? 112  TYR B OH    1 
ATOM   7853  N  N     . ASP B 1 113 ? 27.554  -41.340 50.800  1.00 42.22 ? 113  ASP B N     1 
ATOM   7854  C  CA    . ASP B 1 113 ? 26.109  -41.236 50.615  1.00 44.76 ? 113  ASP B CA    1 
ATOM   7855  C  C     . ASP B 1 113 ? 25.647  -39.781 50.661  1.00 44.85 ? 113  ASP B C     1 
ATOM   7856  O  O     . ASP B 1 113 ? 26.238  -38.994 51.391  1.00 45.59 ? 113  ASP B O     1 
ATOM   7857  C  CB    . ASP B 1 113 ? 25.233  -42.011 51.595  1.00 47.73 ? 113  ASP B CB    1 
ATOM   7858  C  CG    . ASP B 1 113 ? 25.419  -43.513 51.438  1.00 47.59 ? 113  ASP B CG    1 
ATOM   7859  O  OD1   . ASP B 1 113 ? 25.551  -44.010 50.297  1.00 47.94 ? 113  ASP B OD1   1 
ATOM   7860  O  OD2   . ASP B 1 113 ? 25.447  -44.127 52.514  1.00 49.32 ? 113  ASP B OD2   1 
ATOM   7861  N  N     . THR B 1 114 ? 24.530  -39.542 50.018  1.00 44.08 ? 114  THR B N     1 
ATOM   7862  C  CA    . THR B 1 114 ? 23.846  -38.276 50.019  1.00 44.68 ? 114  THR B CA    1 
ATOM   7863  C  C     . THR B 1 114 ? 22.351  -38.512 50.207  1.00 44.71 ? 114  THR B C     1 
ATOM   7864  O  O     . THR B 1 114 ? 21.652  -38.763 49.248  1.00 45.48 ? 114  THR B O     1 
ATOM   7865  C  CB    . THR B 1 114 ? 23.990  -37.407 48.751  1.00 44.78 ? 114  THR B CB    1 
ATOM   7866  O  OG1   . THR B 1 114 ? 25.366  -37.417 48.334  1.00 47.50 ? 114  THR B OG1   1 
ATOM   7867  C  CG2   . THR B 1 114 ? 23.754  -35.945 49.213  1.00 51.27 ? 114  THR B CG2   1 
ATOM   7868  N  N     . PRO B 1 115 ? 21.853  -38.358 51.406  1.00 44.60 ? 115  PRO B N     1 
ATOM   7869  C  CA    . PRO B 1 115 ? 20.450  -38.582 51.704  1.00 44.21 ? 115  PRO B CA    1 
ATOM   7870  C  C     . PRO B 1 115 ? 19.453  -37.656 51.048  1.00 43.50 ? 115  PRO B C     1 
ATOM   7871  O  O     . PRO B 1 115 ? 19.734  -36.656 50.400  1.00 41.92 ? 115  PRO B O     1 
ATOM   7872  C  CB    . PRO B 1 115 ? 20.401  -38.499 53.228  1.00 44.28 ? 115  PRO B CB    1 
ATOM   7873  C  CG    . PRO B 1 115 ? 21.817  -38.786 53.642  1.00 45.23 ? 115  PRO B CG    1 
ATOM   7874  C  CD    . PRO B 1 115 ? 22.684  -38.082 52.624  1.00 44.09 ? 115  PRO B CD    1 
ATOM   7875  N  N     . GLU B 1 116 ? 18.168  -38.009 51.196  1.00 44.56 ? 116  GLU B N     1 
ATOM   7876  C  CA    . GLU B 1 116 ? 17.073  -37.210 50.682  1.00 46.39 ? 116  GLU B CA    1 
ATOM   7877  C  C     . GLU B 1 116 ? 17.094  -35.762 51.135  1.00 45.67 ? 116  GLU B C     1 
ATOM   7878  O  O     . GLU B 1 116 ? 16.916  -34.891 50.299  1.00 45.18 ? 116  GLU B O     1 
ATOM   7879  C  CB    . GLU B 1 116 ? 15.705  -37.822 50.947  1.00 53.81 ? 116  GLU B CB    1 
ATOM   7880  C  CG    . GLU B 1 116 ? 14.840  -37.879 49.689  1.00 63.70 ? 116  GLU B CG    1 
ATOM   7881  C  CD    . GLU B 1 116 ? 15.219  -39.072 48.823  1.00 65.02 ? 116  GLU B CD    1 
ATOM   7882  O  OE1   . GLU B 1 116 ? 16.103  -38.912 47.959  1.00 68.67 ? 116  GLU B OE1   1 
ATOM   7883  O  OE2   . GLU B 1 116 ? 14.626  -40.156 49.015  1.00 69.02 ? 116  GLU B OE2   1 
ATOM   7884  N  N     . ASN B 1 117 ? 17.385  -35.458 52.378  1.00 46.34 ? 117  ASN B N     1 
ATOM   7885  C  CA    . ASN B 1 117 ? 17.477  -34.108 52.900  1.00 46.48 ? 117  ASN B CA    1 
ATOM   7886  C  C     . ASN B 1 117 ? 18.562  -33.278 52.231  1.00 46.21 ? 117  ASN B C     1 
ATOM   7887  O  O     . ASN B 1 117 ? 18.458  -32.037 52.140  1.00 46.23 ? 117  ASN B O     1 
ATOM   7888  C  CB    . ASN B 1 117 ? 17.430  -34.082 54.411  1.00 48.54 ? 117  ASN B CB    1 
ATOM   7889  C  CG    . ASN B 1 117 ? 18.459  -33.398 55.257  1.00 54.59 ? 117  ASN B CG    1 
ATOM   7890  O  OD1   . ASN B 1 117 ? 18.368  -32.208 55.621  1.00 57.17 ? 117  ASN B OD1   1 
ATOM   7891  N  ND2   . ASN B 1 117 ? 19.505  -34.115 55.670  1.00 53.25 ? 117  ASN B ND2   1 
ATOM   7892  N  N     . ILE B 1 118 ? 19.599  -33.904 51.701  1.00 44.87 ? 118  ILE B N     1 
ATOM   7893  C  CA    . ILE B 1 118 ? 20.684  -33.194 51.056  1.00 43.78 ? 118  ILE B CA    1 
ATOM   7894  C  C     . ILE B 1 118 ? 20.334  -32.837 49.611  1.00 44.81 ? 118  ILE B C     1 
ATOM   7895  O  O     . ILE B 1 118 ? 20.373  -31.683 49.199  1.00 44.88 ? 118  ILE B O     1 
ATOM   7896  C  CB    . ILE B 1 118 ? 21.916  -34.108 51.043  1.00 39.67 ? 118  ILE B CB    1 
ATOM   7897  C  CG1   . ILE B 1 118 ? 22.380  -34.450 52.438  1.00 42.97 ? 118  ILE B CG1   1 
ATOM   7898  C  CG2   . ILE B 1 118 ? 23.032  -33.382 50.297  1.00 47.50 ? 118  ILE B CG2   1 
ATOM   7899  C  CD1   . ILE B 1 118 ? 22.404  -33.393 53.508  1.00 35.64 ? 118  ILE B CD1   1 
ATOM   7900  N  N     . VAL B 1 119 ? 19.842  -33.807 48.836  1.00 43.74 ? 119  VAL B N     1 
ATOM   7901  C  CA    . VAL B 1 119 ? 19.591  -33.627 47.421  1.00 43.09 ? 119  VAL B CA    1 
ATOM   7902  C  C     . VAL B 1 119 ? 18.410  -32.705 47.158  1.00 43.06 ? 119  VAL B C     1 
ATOM   7903  O  O     . VAL B 1 119 ? 18.291  -31.971 46.189  1.00 39.90 ? 119  VAL B O     1 
ATOM   7904  C  CB    . VAL B 1 119 ? 19.409  -35.012 46.777  1.00 43.43 ? 119  VAL B CB    1 
ATOM   7905  C  CG1   . VAL B 1 119 ? 18.049  -35.228 46.179  1.00 44.09 ? 119  VAL B CG1   1 
ATOM   7906  C  CG2   . VAL B 1 119 ? 20.494  -35.223 45.732  1.00 47.88 ? 119  VAL B CG2   1 
ATOM   7907  N  N     . HIS B 1 120 ? 17.530  -32.698 48.155  1.00 44.07 ? 120  HIS B N     1 
ATOM   7908  C  CA    . HIS B 1 120 ? 16.336  -31.884 48.146  1.00 44.33 ? 120  HIS B CA    1 
ATOM   7909  C  C     . HIS B 1 120 ? 16.402  -30.706 49.088  1.00 44.44 ? 120  HIS B C     1 
ATOM   7910  O  O     . HIS B 1 120 ? 15.420  -29.946 49.113  1.00 45.93 ? 120  HIS B O     1 
ATOM   7911  C  CB    . HIS B 1 120 ? 15.088  -32.710 48.439  1.00 40.70 ? 120  HIS B CB    1 
ATOM   7912  C  CG    . HIS B 1 120 ? 14.841  -33.732 47.379  1.00 46.49 ? 120  HIS B CG    1 
ATOM   7913  N  ND1   . HIS B 1 120 ? 14.100  -34.869 47.584  1.00 46.98 ? 120  HIS B ND1   1 
ATOM   7914  C  CD2   . HIS B 1 120 ? 15.270  -33.793 46.097  1.00 48.28 ? 120  HIS B CD2   1 
ATOM   7915  C  CE1   . HIS B 1 120 ? 14.067  -35.583 46.468  1.00 51.02 ? 120  HIS B CE1   1 
ATOM   7916  N  NE2   . HIS B 1 120 ? 14.794  -34.959 45.549  1.00 51.03 ? 120  HIS B NE2   1 
ATOM   7917  N  N     . GLY B 1 121 ? 17.510  -30.418 49.742  1.00 44.48 ? 121  GLY B N     1 
ATOM   7918  C  CA    . GLY B 1 121 ? 17.514  -29.296 50.684  1.00 44.47 ? 121  GLY B CA    1 
ATOM   7919  C  C     . GLY B 1 121 ? 17.946  -27.968 50.110  1.00 45.37 ? 121  GLY B C     1 
ATOM   7920  O  O     . GLY B 1 121 ? 17.661  -27.605 48.964  1.00 44.97 ? 121  GLY B O     1 
ATOM   7921  N  N     . SER B 1 122 ? 18.636  -27.182 50.972  1.00 45.59 ? 122  SER B N     1 
ATOM   7922  C  CA    . SER B 1 122 ? 19.140  -25.892 50.477  1.00 45.27 ? 122  SER B CA    1 
ATOM   7923  C  C     . SER B 1 122 ? 20.432  -26.172 49.717  1.00 44.76 ? 122  SER B C     1 
ATOM   7924  O  O     . SER B 1 122 ? 21.087  -27.181 50.031  1.00 44.65 ? 122  SER B O     1 
ATOM   7925  C  CB    . SER B 1 122 ? 19.437  -24.984 51.673  1.00 47.05 ? 122  SER B CB    1 
ATOM   7926  O  OG    . SER B 1 122 ? 20.585  -25.463 52.353  1.00 50.85 ? 122  SER B OG    1 
ATOM   7927  N  N     . GLY B 1 123 ? 20.780  -25.274 48.806  1.00 43.55 ? 123  GLY B N     1 
ATOM   7928  C  CA    . GLY B 1 123 ? 22.012  -25.409 48.038  1.00 43.21 ? 123  GLY B CA    1 
ATOM   7929  C  C     . GLY B 1 123 ? 23.250  -25.403 48.931  1.00 43.79 ? 123  GLY B C     1 
ATOM   7930  O  O     . GLY B 1 123 ? 24.243  -26.061 48.675  1.00 44.24 ? 123  GLY B O     1 
ATOM   7931  N  N     . SER B 1 124 ? 23.202  -24.645 50.010  1.00 43.76 ? 124  SER B N     1 
ATOM   7932  C  CA    . SER B 1 124 ? 24.202  -24.535 51.042  1.00 43.33 ? 124  SER B CA    1 
ATOM   7933  C  C     . SER B 1 124 ? 24.462  -25.897 51.699  1.00 43.07 ? 124  SER B C     1 
ATOM   7934  O  O     . SER B 1 124 ? 25.585  -26.301 51.962  1.00 42.78 ? 124  SER B O     1 
ATOM   7935  C  CB    . SER B 1 124 ? 23.511  -23.734 52.200  1.00 45.92 ? 124  SER B CB    1 
ATOM   7936  O  OG    . SER B 1 124 ? 23.969  -22.413 52.126  1.00 49.14 ? 124  SER B OG    1 
ATOM   7937  N  N     . GLN B 1 125 ? 23.335  -26.429 52.171  1.00 42.24 ? 125  GLN B N     1 
ATOM   7938  C  CA    . GLN B 1 125 ? 23.376  -27.766 52.779  1.00 43.76 ? 125  GLN B CA    1 
ATOM   7939  C  C     . GLN B 1 125 ? 24.003  -28.763 51.814  1.00 44.19 ? 125  GLN B C     1 
ATOM   7940  O  O     . GLN B 1 125 ? 24.903  -29.542 52.165  1.00 44.88 ? 125  GLN B O     1 
ATOM   7941  C  CB    . GLN B 1 125 ? 21.933  -27.997 53.163  1.00 49.82 ? 125  GLN B CB    1 
ATOM   7942  C  CG    . GLN B 1 125 ? 21.400  -29.280 53.714  1.00 57.29 ? 125  GLN B CG    1 
ATOM   7943  C  CD    . GLN B 1 125 ? 20.220  -28.984 54.627  1.00 62.94 ? 125  GLN B CD    1 
ATOM   7944  O  OE1   . GLN B 1 125 ? 19.302  -28.215 54.315  1.00 65.65 ? 125  GLN B OE1   1 
ATOM   7945  N  NE2   . GLN B 1 125 ? 20.305  -29.628 55.791  1.00 69.81 ? 125  GLN B NE2   1 
ATOM   7946  N  N     . LEU B 1 126 ? 23.831  -28.594 50.491  1.00 43.05 ? 126  LEU B N     1 
ATOM   7947  C  CA    . LEU B 1 126 ? 24.323  -29.581 49.541  1.00 40.79 ? 126  LEU B CA    1 
ATOM   7948  C  C     . LEU B 1 126 ? 25.820  -29.424 49.397  1.00 40.25 ? 126  LEU B C     1 
ATOM   7949  O  O     . LEU B 1 126 ? 26.588  -30.381 49.390  1.00 39.79 ? 126  LEU B O     1 
ATOM   7950  C  CB    . LEU B 1 126 ? 23.552  -29.527 48.209  1.00 38.90 ? 126  LEU B CB    1 
ATOM   7951  C  CG    . LEU B 1 126 ? 24.187  -30.276 47.020  1.00 39.55 ? 126  LEU B CG    1 
ATOM   7952  C  CD1   . LEU B 1 126 ? 24.213  -31.789 47.203  1.00 37.43 ? 126  LEU B CD1   1 
ATOM   7953  C  CD2   . LEU B 1 126 ? 23.447  -29.938 45.750  1.00 41.38 ? 126  LEU B CD2   1 
ATOM   7954  N  N     . PHE B 1 127 ? 26.245  -28.167 49.222  1.00 40.16 ? 127  PHE B N     1 
ATOM   7955  C  CA    . PHE B 1 127 ? 27.653  -27.892 48.995  1.00 39.48 ? 127  PHE B CA    1 
ATOM   7956  C  C     . PHE B 1 127 ? 28.426  -28.020 50.298  1.00 39.27 ? 127  PHE B C     1 
ATOM   7957  O  O     . PHE B 1 127 ? 29.610  -28.416 50.299  1.00 39.22 ? 127  PHE B O     1 
ATOM   7958  C  CB    . PHE B 1 127 ? 27.830  -26.600 48.221  1.00 42.61 ? 127  PHE B CB    1 
ATOM   7959  C  CG    . PHE B 1 127 ? 27.301  -26.646 46.817  1.00 44.52 ? 127  PHE B CG    1 
ATOM   7960  C  CD1   . PHE B 1 127 ? 28.016  -27.278 45.814  1.00 49.37 ? 127  PHE B CD1   1 
ATOM   7961  C  CD2   . PHE B 1 127 ? 26.110  -26.066 46.468  1.00 42.03 ? 127  PHE B CD2   1 
ATOM   7962  C  CE1   . PHE B 1 127 ? 27.538  -27.366 44.516  1.00 48.19 ? 127  PHE B CE1   1 
ATOM   7963  C  CE2   . PHE B 1 127 ? 25.620  -26.108 45.192  1.00 44.06 ? 127  PHE B CE2   1 
ATOM   7964  C  CZ    . PHE B 1 127 ? 26.332  -26.762 44.214  1.00 48.41 ? 127  PHE B CZ    1 
ATOM   7965  N  N     . ASP B 1 128 ? 27.778  -27.761 51.426  1.00 38.56 ? 128  ASP B N     1 
ATOM   7966  C  CA    . ASP B 1 128 ? 28.453  -28.008 52.721  1.00 39.58 ? 128  ASP B CA    1 
ATOM   7967  C  C     . ASP B 1 128 ? 28.747  -29.509 52.781  1.00 39.21 ? 128  ASP B C     1 
ATOM   7968  O  O     . ASP B 1 128 ? 29.884  -29.964 52.784  1.00 38.32 ? 128  ASP B O     1 
ATOM   7969  C  CB    . ASP B 1 128 ? 27.521  -27.593 53.878  1.00 40.78 ? 128  ASP B CB    1 
ATOM   7970  C  CG    . ASP B 1 128 ? 27.769  -26.129 54.223  1.00 42.43 ? 128  ASP B CG    1 
ATOM   7971  O  OD1   . ASP B 1 128 ? 28.888  -25.658 53.950  1.00 48.48 ? 128  ASP B OD1   1 
ATOM   7972  O  OD2   . ASP B 1 128 ? 26.917  -25.401 54.740  1.00 44.17 ? 128  ASP B OD2   1 
ATOM   7973  N  N     . HIS B 1 129 ? 27.712  -30.263 52.386  1.00 41.07 ? 129  HIS B N     1 
ATOM   7974  C  CA    . HIS B 1 129 ? 27.802  -31.713 52.249  1.00 41.51 ? 129  HIS B CA    1 
ATOM   7975  C  C     . HIS B 1 129 ? 28.926  -32.154 51.354  1.00 41.51 ? 129  HIS B C     1 
ATOM   7976  O  O     . HIS B 1 129 ? 29.816  -32.866 51.852  1.00 42.12 ? 129  HIS B O     1 
ATOM   7977  C  CB    . HIS B 1 129 ? 26.470  -32.351 51.856  1.00 43.59 ? 129  HIS B CB    1 
ATOM   7978  C  CG    . HIS B 1 129 ? 26.655  -33.825 51.691  1.00 44.25 ? 129  HIS B CG    1 
ATOM   7979  N  ND1   . HIS B 1 129 ? 26.507  -34.702 52.743  1.00 48.10 ? 129  HIS B ND1   1 
ATOM   7980  C  CD2   . HIS B 1 129 ? 27.013  -34.569 50.623  1.00 42.34 ? 129  HIS B CD2   1 
ATOM   7981  C  CE1   . HIS B 1 129 ? 26.727  -35.934 52.340  1.00 42.55 ? 129  HIS B CE1   1 
ATOM   7982  N  NE2   . HIS B 1 129 ? 27.043  -35.871 51.065  1.00 42.43 ? 129  HIS B NE2   1 
ATOM   7983  N  N     . VAL B 1 130 ? 29.023  -31.581 50.164  1.00 41.97 ? 130  VAL B N     1 
ATOM   7984  C  CA    . VAL B 1 130 ? 30.126  -31.881 49.256  1.00 42.96 ? 130  VAL B CA    1 
ATOM   7985  C  C     . VAL B 1 130 ? 31.491  -31.553 49.826  1.00 45.59 ? 130  VAL B C     1 
ATOM   7986  O  O     . VAL B 1 130 ? 32.440  -32.321 49.594  1.00 46.19 ? 130  VAL B O     1 
ATOM   7987  C  CB    . VAL B 1 130 ? 29.930  -31.253 47.860  1.00 40.69 ? 130  VAL B CB    1 
ATOM   7988  C  CG1   . VAL B 1 130 ? 31.166  -31.282 46.994  1.00 33.98 ? 130  VAL B CG1   1 
ATOM   7989  C  CG2   . VAL B 1 130 ? 28.752  -31.917 47.137  1.00 37.33 ? 130  VAL B CG2   1 
ATOM   7990  N  N     . ALA B 1 131 ? 31.652  -30.410 50.511  1.00 46.67 ? 131  ALA B N     1 
ATOM   7991  C  CA    . ALA B 1 131 ? 32.974  -29.994 50.973  1.00 46.90 ? 131  ALA B CA    1 
ATOM   7992  C  C     . ALA B 1 131 ? 33.382  -30.864 52.165  1.00 47.53 ? 131  ALA B C     1 
ATOM   7993  O  O     . ALA B 1 131 ? 34.579  -31.103 52.359  1.00 47.52 ? 131  ALA B O     1 
ATOM   7994  C  CB    . ALA B 1 131 ? 32.987  -28.536 51.416  1.00 48.53 ? 131  ALA B CB    1 
ATOM   7995  N  N     . GLU B 1 132 ? 32.361  -31.385 52.846  1.00 47.48 ? 132  GLU B N     1 
ATOM   7996  C  CA    . GLU B 1 132 ? 32.657  -32.290 53.967  1.00 48.45 ? 132  GLU B CA    1 
ATOM   7997  C  C     . GLU B 1 132 ? 33.104  -33.651 53.468  1.00 48.26 ? 132  GLU B C     1 
ATOM   7998  O  O     . GLU B 1 132 ? 34.137  -34.146 53.958  1.00 50.06 ? 132  GLU B O     1 
ATOM   7999  C  CB    . GLU B 1 132 ? 31.535  -32.282 54.967  1.00 51.92 ? 132  GLU B CB    1 
ATOM   8000  C  CG    . GLU B 1 132 ? 31.640  -33.070 56.258  1.00 57.55 ? 132  GLU B CG    1 
ATOM   8001  C  CD    . GLU B 1 132 ? 30.284  -33.032 56.949  1.00 60.91 ? 132  GLU B CD    1 
ATOM   8002  O  OE1   . GLU B 1 132 ? 29.410  -33.841 56.567  1.00 66.37 ? 132  GLU B OE1   1 
ATOM   8003  O  OE2   . GLU B 1 132 ? 30.033  -32.164 57.812  1.00 66.52 ? 132  GLU B OE2   1 
ATOM   8004  N  N     . CYS B 1 133 ? 32.599  -34.165 52.351  1.00 47.01 ? 133  CYS B N     1 
ATOM   8005  C  CA    . CYS B 1 133 ? 33.112  -35.434 51.832  1.00 46.07 ? 133  CYS B CA    1 
ATOM   8006  C  C     . CYS B 1 133 ? 34.466  -35.219 51.173  1.00 46.86 ? 133  CYS B C     1 
ATOM   8007  O  O     . CYS B 1 133 ? 35.329  -36.106 51.123  1.00 47.51 ? 133  CYS B O     1 
ATOM   8008  C  CB    . CYS B 1 133 ? 32.157  -36.201 50.933  1.00 33.33 ? 133  CYS B CB    1 
ATOM   8009  S  SG    . CYS B 1 133 ? 30.536  -36.530 51.657  1.00 38.90 ? 133  CYS B SG    1 
ATOM   8010  N  N     . LEU B 1 134 ? 34.678  -34.016 50.623  1.00 47.69 ? 134  LEU B N     1 
ATOM   8011  C  CA    . LEU B 1 134 ? 35.991  -33.775 50.007  1.00 47.78 ? 134  LEU B CA    1 
ATOM   8012  C  C     . LEU B 1 134 ? 37.042  -33.734 51.113  1.00 48.73 ? 134  LEU B C     1 
ATOM   8013  O  O     . LEU B 1 134 ? 38.169  -34.157 50.931  1.00 47.75 ? 134  LEU B O     1 
ATOM   8014  C  CB    . LEU B 1 134 ? 35.988  -32.521 49.159  1.00 43.15 ? 134  LEU B CB    1 
ATOM   8015  C  CG    . LEU B 1 134 ? 37.289  -32.130 48.460  1.00 44.35 ? 134  LEU B CG    1 
ATOM   8016  C  CD1   . LEU B 1 134 ? 37.821  -33.244 47.581  1.00 40.42 ? 134  LEU B CD1   1 
ATOM   8017  C  CD2   . LEU B 1 134 ? 37.116  -30.822 47.699  1.00 44.96 ? 134  LEU B CD2   1 
ATOM   8018  N  N     . GLY B 1 135 ? 36.664  -33.156 52.256  1.00 51.53 ? 135  GLY B N     1 
ATOM   8019  C  CA    . GLY B 1 135 ? 37.618  -32.937 53.346  1.00 52.78 ? 135  GLY B CA    1 
ATOM   8020  C  C     . GLY B 1 135 ? 38.043  -34.310 53.880  1.00 53.88 ? 135  GLY B C     1 
ATOM   8021  O  O     . GLY B 1 135 ? 39.227  -34.648 53.949  1.00 54.26 ? 135  GLY B O     1 
ATOM   8022  N  N     . ASP B 1 136 ? 37.024  -35.113 54.154  1.00 54.02 ? 136  ASP B N     1 
ATOM   8023  C  CA    . ASP B 1 136 ? 37.260  -36.490 54.578  1.00 54.41 ? 136  ASP B CA    1 
ATOM   8024  C  C     . ASP B 1 136 ? 38.142  -37.247 53.605  1.00 55.02 ? 136  ASP B C     1 
ATOM   8025  O  O     . ASP B 1 136 ? 39.106  -37.919 53.982  1.00 55.90 ? 136  ASP B O     1 
ATOM   8026  C  CB    . ASP B 1 136 ? 35.896  -37.174 54.660  1.00 56.99 ? 136  ASP B CB    1 
ATOM   8027  C  CG    . ASP B 1 136 ? 36.061  -38.584 55.186  1.00 57.21 ? 136  ASP B CG    1 
ATOM   8028  O  OD1   . ASP B 1 136 ? 36.537  -39.411 54.386  1.00 59.37 ? 136  ASP B OD1   1 
ATOM   8029  O  OD2   . ASP B 1 136 ? 35.701  -38.805 56.354  1.00 62.18 ? 136  ASP B OD2   1 
ATOM   8030  N  N     . PHE B 1 137 ? 37.827  -37.132 52.320  1.00 55.29 ? 137  PHE B N     1 
ATOM   8031  C  CA    . PHE B 1 137 ? 38.565  -37.815 51.275  1.00 55.08 ? 137  PHE B CA    1 
ATOM   8032  C  C     . PHE B 1 137 ? 40.052  -37.545 51.364  1.00 56.75 ? 137  PHE B C     1 
ATOM   8033  O  O     . PHE B 1 137 ? 40.825  -38.499 51.391  1.00 56.52 ? 137  PHE B O     1 
ATOM   8034  C  CB    . PHE B 1 137 ? 38.014  -37.474 49.884  1.00 47.51 ? 137  PHE B CB    1 
ATOM   8035  C  CG    . PHE B 1 137 ? 38.709  -38.271 48.808  1.00 39.39 ? 137  PHE B CG    1 
ATOM   8036  C  CD1   . PHE B 1 137 ? 39.849  -37.833 48.214  1.00 38.53 ? 137  PHE B CD1   1 
ATOM   8037  C  CD2   . PHE B 1 137 ? 38.208  -39.498 48.425  1.00 44.53 ? 137  PHE B CD2   1 
ATOM   8038  C  CE1   . PHE B 1 137 ? 40.508  -38.556 47.253  1.00 38.95 ? 137  PHE B CE1   1 
ATOM   8039  C  CE2   . PHE B 1 137 ? 38.847  -40.265 47.471  1.00 43.28 ? 137  PHE B CE2   1 
ATOM   8040  C  CZ    . PHE B 1 137 ? 40.002  -39.783 46.882  1.00 42.94 ? 137  PHE B CZ    1 
ATOM   8041  N  N     . MET B 1 138 ? 40.468  -36.280 51.328  1.00 59.01 ? 138  MET B N     1 
ATOM   8042  C  CA    . MET B 1 138 ? 41.867  -35.893 51.299  1.00 60.88 ? 138  MET B CA    1 
ATOM   8043  C  C     . MET B 1 138 ? 42.558  -36.178 52.646  1.00 62.51 ? 138  MET B C     1 
ATOM   8044  O  O     . MET B 1 138 ? 43.770  -36.350 52.731  1.00 62.30 ? 138  MET B O     1 
ATOM   8045  C  CB    . MET B 1 138 ? 42.057  -34.391 51.056  1.00 60.15 ? 138  MET B CB    1 
ATOM   8046  C  CG    . MET B 1 138 ? 41.358  -33.816 49.840  1.00 57.69 ? 138  MET B CG    1 
ATOM   8047  S  SD    . MET B 1 138 ? 41.535  -32.000 49.829  1.00 53.85 ? 138  MET B SD    1 
ATOM   8048  C  CE    . MET B 1 138 ? 43.213  -31.966 49.194  1.00 49.62 ? 138  MET B CE    1 
ATOM   8049  N  N     . GLU B 1 139 ? 41.753  -36.014 53.684  1.00 63.54 ? 139  GLU B N     1 
ATOM   8050  C  CA    . GLU B 1 139 ? 42.114  -36.293 55.056  1.00 64.10 ? 139  GLU B CA    1 
ATOM   8051  C  C     . GLU B 1 139 ? 42.659  -37.714 55.195  1.00 64.44 ? 139  GLU B C     1 
ATOM   8052  O  O     . GLU B 1 139 ? 43.820  -37.916 55.564  1.00 64.79 ? 139  GLU B O     1 
ATOM   8053  C  CB    . GLU B 1 139 ? 40.813  -36.202 55.890  1.00 68.04 ? 139  GLU B CB    1 
ATOM   8054  C  CG    . GLU B 1 139 ? 40.956  -36.862 57.260  1.00 70.07 ? 139  GLU B CG    1 
ATOM   8055  C  CD    . GLU B 1 139 ? 42.019  -36.096 58.034  1.00 74.44 ? 139  GLU B CD    1 
ATOM   8056  O  OE1   . GLU B 1 139 ? 43.134  -35.925 57.490  1.00 75.78 ? 139  GLU B OE1   1 
ATOM   8057  O  OE2   . GLU B 1 139 ? 41.708  -35.636 59.148  1.00 76.85 ? 139  GLU B OE2   1 
ATOM   8058  N  N     . LYS B 1 140 ? 41.851  -38.708 54.834  1.00 63.56 ? 140  LYS B N     1 
ATOM   8059  C  CA    . LYS B 1 140 ? 42.252  -40.095 54.970  1.00 63.02 ? 140  LYS B CA    1 
ATOM   8060  C  C     . LYS B 1 140 ? 43.402  -40.524 54.072  1.00 62.49 ? 140  LYS B C     1 
ATOM   8061  O  O     . LYS B 1 140 ? 44.000  -41.591 54.343  1.00 62.59 ? 140  LYS B O     1 
ATOM   8062  C  CB    . LYS B 1 140 ? 41.093  -41.069 54.776  1.00 66.21 ? 140  LYS B CB    1 
ATOM   8063  C  CG    . LYS B 1 140 ? 40.165  -41.196 55.977  1.00 69.35 ? 140  LYS B CG    1 
ATOM   8064  C  CD    . LYS B 1 140 ? 38.731  -41.415 55.491  1.00 71.01 ? 140  LYS B CD    1 
ATOM   8065  C  CE    . LYS B 1 140 ? 38.575  -40.888 54.069  1.00 71.08 ? 140  LYS B CE    1 
ATOM   8066  N  NZ    . LYS B 1 140 ? 37.334  -41.387 53.414  1.00 71.14 ? 140  LYS B NZ    1 
ATOM   8067  N  N     . ARG B 1 141 ? 43.683  -39.764 53.024  1.00 61.24 ? 141  ARG B N     1 
ATOM   8068  C  CA    . ARG B 1 141 ? 44.804  -40.093 52.154  1.00 61.26 ? 141  ARG B CA    1 
ATOM   8069  C  C     . ARG B 1 141 ? 45.983  -39.170 52.456  1.00 61.37 ? 141  ARG B C     1 
ATOM   8070  O  O     . ARG B 1 141 ? 47.006  -39.257 51.783  1.00 61.53 ? 141  ARG B O     1 
ATOM   8071  C  CB    . ARG B 1 141 ? 44.462  -39.975 50.670  1.00 58.93 ? 141  ARG B CB    1 
ATOM   8072  C  CG    . ARG B 1 141 ? 43.831  -41.208 50.053  1.00 55.62 ? 141  ARG B CG    1 
ATOM   8073  C  CD    . ARG B 1 141 ? 42.747  -40.840 49.032  1.00 56.34 ? 141  ARG B CD    1 
ATOM   8074  N  NE    . ARG B 1 141 ? 41.652  -41.801 49.105  1.00 53.34 ? 141  ARG B NE    1 
ATOM   8075  C  CZ    . ARG B 1 141 ? 40.580  -41.649 49.876  1.00 57.03 ? 141  ARG B CZ    1 
ATOM   8076  N  NH1   . ARG B 1 141 ? 40.409  -40.524 50.555  1.00 57.08 ? 141  ARG B NH1   1 
ATOM   8077  N  NH2   . ARG B 1 141 ? 39.673  -42.613 49.943  1.00 54.41 ? 141  ARG B NH2   1 
ATOM   8078  N  N     . LYS B 1 142 ? 45.735  -38.182 53.295  1.00 61.99 ? 142  LYS B N     1 
ATOM   8079  C  CA    . LYS B 1 142 ? 46.723  -37.176 53.627  1.00 63.28 ? 142  LYS B CA    1 
ATOM   8080  C  C     . LYS B 1 142 ? 47.222  -36.350 52.445  1.00 63.50 ? 142  LYS B C     1 
ATOM   8081  O  O     . LYS B 1 142 ? 48.433  -36.101 52.313  1.00 63.72 ? 142  LYS B O     1 
ATOM   8082  C  CB    . LYS B 1 142 ? 47.873  -37.822 54.414  1.00 66.39 ? 142  LYS B CB    1 
ATOM   8083  C  CG    . LYS B 1 142 ? 47.570  -37.957 55.895  1.00 67.87 ? 142  LYS B CG    1 
ATOM   8084  C  CD    . LYS B 1 142 ? 47.108  -39.330 56.313  1.00 70.23 ? 142  LYS B CD    1 
ATOM   8085  C  CE    . LYS B 1 142 ? 48.230  -40.240 56.779  1.00 75.09 ? 142  LYS B CE    1 
ATOM   8086  N  NZ    . LYS B 1 142 ? 48.460  -40.228 58.259  1.00 75.39 ? 142  LYS B NZ    1 
ATOM   8087  N  N     . ILE B 1 143 ? 46.305  -35.726 51.699  1.00 62.26 ? 143  ILE B N     1 
ATOM   8088  C  CA    . ILE B 1 143 ? 46.691  -34.916 50.550  1.00 61.45 ? 143  ILE B CA    1 
ATOM   8089  C  C     . ILE B 1 143 ? 46.198  -33.484 50.623  1.00 61.51 ? 143  ILE B C     1 
ATOM   8090  O  O     . ILE B 1 143 ? 46.328  -32.653 49.725  1.00 61.41 ? 143  ILE B O     1 
ATOM   8091  C  CB    . ILE B 1 143 ? 46.266  -35.616 49.248  1.00 58.64 ? 143  ILE B CB    1 
ATOM   8092  C  CG1   . ILE B 1 143 ? 44.916  -36.326 49.448  1.00 55.91 ? 143  ILE B CG1   1 
ATOM   8093  C  CG2   . ILE B 1 143 ? 47.297  -36.646 48.818  1.00 58.58 ? 143  ILE B CG2   1 
ATOM   8094  C  CD1   . ILE B 1 143 ? 43.942  -36.052 48.330  1.00 53.95 ? 143  ILE B CD1   1 
ATOM   8095  N  N     . LYS B 1 144 ? 45.649  -33.098 51.753  1.00 62.02 ? 144  LYS B N     1 
ATOM   8096  C  CA    . LYS B 1 144 ? 45.204  -31.760 52.070  1.00 63.07 ? 144  LYS B CA    1 
ATOM   8097  C  C     . LYS B 1 144 ? 46.191  -30.675 51.657  1.00 64.77 ? 144  LYS B C     1 
ATOM   8098  O  O     . LYS B 1 144 ? 45.790  -29.558 51.268  1.00 65.28 ? 144  LYS B O     1 
ATOM   8099  C  CB    . LYS B 1 144 ? 44.988  -31.674 53.594  1.00 60.60 ? 144  LYS B CB    1 
ATOM   8100  C  CG    . LYS B 1 144 ? 43.754  -32.372 54.105  1.00 59.43 ? 144  LYS B CG    1 
ATOM   8101  C  CD    . LYS B 1 144 ? 43.128  -31.666 55.294  1.00 63.17 ? 144  LYS B CD    1 
ATOM   8102  C  CE    . LYS B 1 144 ? 41.612  -31.578 55.162  1.00 61.97 ? 144  LYS B CE    1 
ATOM   8103  N  NZ    . LYS B 1 144 ? 40.924  -32.160 56.349  1.00 63.15 ? 144  LYS B NZ    1 
ATOM   8104  N  N     . ASP B 1 145 ? 47.484  -30.926 51.819  1.00 65.54 ? 145  ASP B N     1 
ATOM   8105  C  CA    . ASP B 1 145 ? 48.490  -29.897 51.564  1.00 67.43 ? 145  ASP B CA    1 
ATOM   8106  C  C     . ASP B 1 145 ? 49.223  -30.151 50.255  1.00 67.41 ? 145  ASP B C     1 
ATOM   8107  O  O     . ASP B 1 145 ? 50.052  -29.335 49.844  1.00 68.19 ? 145  ASP B O     1 
ATOM   8108  C  CB    . ASP B 1 145 ? 49.539  -29.931 52.703  1.00 74.71 ? 145  ASP B CB    1 
ATOM   8109  C  CG    . ASP B 1 145 ? 50.197  -31.311 52.701  1.00 80.48 ? 145  ASP B CG    1 
ATOM   8110  O  OD1   . ASP B 1 145 ? 51.037  -31.536 51.795  1.00 83.19 ? 145  ASP B OD1   1 
ATOM   8111  O  OD2   . ASP B 1 145 ? 49.848  -32.156 53.564  1.00 80.98 ? 145  ASP B OD2   1 
ATOM   8112  N  N     . LYS B 1 146 ? 48.952  -31.301 49.652  1.00 66.41 ? 146  LYS B N     1 
ATOM   8113  C  CA    . LYS B 1 146 ? 49.563  -31.665 48.382  1.00 65.34 ? 146  LYS B CA    1 
ATOM   8114  C  C     . LYS B 1 146 ? 48.990  -30.794 47.266  1.00 64.73 ? 146  LYS B C     1 
ATOM   8115  O  O     . LYS B 1 146 ? 49.398  -30.849 46.111  1.00 64.27 ? 146  LYS B O     1 
ATOM   8116  C  CB    . LYS B 1 146 ? 49.339  -33.142 48.098  1.00 67.93 ? 146  LYS B CB    1 
ATOM   8117  C  CG    . LYS B 1 146 ? 50.127  -34.100 48.976  1.00 68.48 ? 146  LYS B CG    1 
ATOM   8118  C  CD    . LYS B 1 146 ? 50.557  -35.311 48.163  1.00 72.00 ? 146  LYS B CD    1 
ATOM   8119  C  CE    . LYS B 1 146 ? 50.423  -36.607 48.950  1.00 73.91 ? 146  LYS B CE    1 
ATOM   8120  N  NZ    . LYS B 1 146 ? 50.567  -37.813 48.069  1.00 75.30 ? 146  LYS B NZ    1 
ATOM   8121  N  N     . LYS B 1 147 ? 48.112  -29.884 47.662  1.00 63.99 ? 147  LYS B N     1 
ATOM   8122  C  CA    . LYS B 1 147 ? 47.398  -28.950 46.847  1.00 63.62 ? 147  LYS B CA    1 
ATOM   8123  C  C     . LYS B 1 147 ? 47.138  -29.348 45.397  1.00 62.41 ? 147  LYS B C     1 
ATOM   8124  O  O     . LYS B 1 147 ? 47.587  -28.746 44.422  1.00 61.73 ? 147  LYS B O     1 
ATOM   8125  C  CB    . LYS B 1 147 ? 47.847  -27.520 47.036  1.00 66.68 ? 147  LYS B CB    1 
ATOM   8126  C  CG    . LYS B 1 147 ? 49.173  -27.139 46.397  1.00 70.96 ? 147  LYS B CG    1 
ATOM   8127  C  CD    . LYS B 1 147 ? 49.092  -25.729 45.822  1.00 73.64 ? 147  LYS B CD    1 
ATOM   8128  C  CE    . LYS B 1 147 ? 50.422  -25.272 45.238  1.00 76.44 ? 147  LYS B CE    1 
ATOM   8129  N  NZ    . LYS B 1 147 ? 50.573  -25.635 43.796  1.00 76.00 ? 147  LYS B NZ    1 
ATOM   8130  N  N     . LEU B 1 148 ? 46.215  -30.306 45.241  1.00 60.42 ? 148  LEU B N     1 
ATOM   8131  C  CA    . LEU B 1 148 ? 45.851  -30.827 43.929  1.00 58.58 ? 148  LEU B CA    1 
ATOM   8132  C  C     . LEU B 1 148 ? 44.646  -30.136 43.301  1.00 56.42 ? 148  LEU B C     1 
ATOM   8133  O  O     . LEU B 1 148 ? 43.715  -29.657 43.965  1.00 56.14 ? 148  LEU B O     1 
ATOM   8134  C  CB    . LEU B 1 148 ? 45.782  -32.346 44.031  1.00 57.85 ? 148  LEU B CB    1 
ATOM   8135  C  CG    . LEU B 1 148 ? 47.013  -33.038 44.633  1.00 56.35 ? 148  LEU B CG    1 
ATOM   8136  C  CD1   . LEU B 1 148 ? 46.730  -34.523 44.843  1.00 59.20 ? 148  LEU B CD1   1 
ATOM   8137  C  CD2   . LEU B 1 148 ? 48.227  -32.910 43.722  1.00 52.36 ? 148  LEU B CD2   1 
ATOM   8138  N  N     . PRO B 1 149 ? 44.792  -29.790 42.014  1.00 54.16 ? 149  PRO B N     1 
ATOM   8139  C  CA    . PRO B 1 149 ? 43.751  -29.101 41.255  1.00 53.42 ? 149  PRO B CA    1 
ATOM   8140  C  C     . PRO B 1 149 ? 42.517  -30.018 41.322  1.00 52.70 ? 149  PRO B C     1 
ATOM   8141  O  O     . PRO B 1 149 ? 42.653  -31.256 41.323  1.00 52.34 ? 149  PRO B O     1 
ATOM   8142  C  CB    . PRO B 1 149 ? 44.288  -29.100 39.825  1.00 52.74 ? 149  PRO B CB    1 
ATOM   8143  C  CG    . PRO B 1 149 ? 45.716  -29.501 39.909  1.00 53.22 ? 149  PRO B CG    1 
ATOM   8144  C  CD    . PRO B 1 149 ? 45.836  -30.375 41.125  1.00 53.26 ? 149  PRO B CD    1 
ATOM   8145  N  N     . VAL B 1 150 ? 41.342  -29.401 41.424  1.00 50.94 ? 150  VAL B N     1 
ATOM   8146  C  CA    . VAL B 1 150 ? 40.121  -30.197 41.509  1.00 49.12 ? 150  VAL B CA    1 
ATOM   8147  C  C     . VAL B 1 150 ? 39.292  -30.133 40.240  1.00 49.01 ? 150  VAL B C     1 
ATOM   8148  O  O     . VAL B 1 150 ? 39.162  -29.079 39.592  1.00 49.17 ? 150  VAL B O     1 
ATOM   8149  C  CB    . VAL B 1 150 ? 39.308  -29.883 42.770  1.00 46.80 ? 150  VAL B CB    1 
ATOM   8150  C  CG1   . VAL B 1 150 ? 37.993  -30.649 42.790  1.00 45.12 ? 150  VAL B CG1   1 
ATOM   8151  C  CG2   . VAL B 1 150 ? 40.106  -30.166 44.044  1.00 43.96 ? 150  VAL B CG2   1 
ATOM   8152  N  N     . GLY B 1 151 ? 38.742  -31.256 39.810  1.00 47.84 ? 151  GLY B N     1 
ATOM   8153  C  CA    . GLY B 1 151 ? 37.881  -31.319 38.637  1.00 46.08 ? 151  GLY B CA    1 
ATOM   8154  C  C     . GLY B 1 151 ? 36.494  -31.730 39.110  1.00 46.26 ? 151  GLY B C     1 
ATOM   8155  O  O     . GLY B 1 151 ? 36.371  -32.635 39.941  1.00 48.54 ? 151  GLY B O     1 
ATOM   8156  N  N     . PHE B 1 152 ? 35.454  -31.058 38.645  1.00 44.77 ? 152  PHE B N     1 
ATOM   8157  C  CA    . PHE B 1 152 ? 34.098  -31.274 39.121  1.00 43.19 ? 152  PHE B CA    1 
ATOM   8158  C  C     . PHE B 1 152 ? 33.175  -31.776 38.005  1.00 42.13 ? 152  PHE B C     1 
ATOM   8159  O  O     . PHE B 1 152 ? 32.784  -30.929 37.186  1.00 42.28 ? 152  PHE B O     1 
ATOM   8160  C  CB    . PHE B 1 152 ? 33.546  -29.938 39.608  1.00 44.18 ? 152  PHE B CB    1 
ATOM   8161  C  CG    . PHE B 1 152 ? 32.263  -29.911 40.367  1.00 46.17 ? 152  PHE B CG    1 
ATOM   8162  C  CD1   . PHE B 1 152 ? 32.003  -30.842 41.353  1.00 49.01 ? 152  PHE B CD1   1 
ATOM   8163  C  CD2   . PHE B 1 152 ? 31.335  -28.893 40.150  1.00 50.79 ? 152  PHE B CD2   1 
ATOM   8164  C  CE1   . PHE B 1 152 ? 30.835  -30.786 42.083  1.00 54.04 ? 152  PHE B CE1   1 
ATOM   8165  C  CE2   . PHE B 1 152 ? 30.153  -28.847 40.870  1.00 54.36 ? 152  PHE B CE2   1 
ATOM   8166  C  CZ    . PHE B 1 152 ? 29.888  -29.841 41.806  1.00 48.76 ? 152  PHE B CZ    1 
ATOM   8167  N  N     . THR B 1 153 ? 32.847  -33.064 38.025  1.00 38.63 ? 153  THR B N     1 
ATOM   8168  C  CA    . THR B 1 153 ? 31.814  -33.572 37.125  1.00 36.84 ? 153  THR B CA    1 
ATOM   8169  C  C     . THR B 1 153 ? 30.437  -33.321 37.716  1.00 34.41 ? 153  THR B C     1 
ATOM   8170  O  O     . THR B 1 153 ? 30.079  -34.004 38.663  1.00 34.03 ? 153  THR B O     1 
ATOM   8171  C  CB    . THR B 1 153 ? 31.950  -35.125 36.937  1.00 30.76 ? 153  THR B CB    1 
ATOM   8172  O  OG1   . THR B 1 153 ? 33.232  -35.215 36.279  1.00 40.71 ? 153  THR B OG1   1 
ATOM   8173  C  CG2   . THR B 1 153 ? 30.938  -35.643 35.937  1.00 32.26 ? 153  THR B CG2   1 
ATOM   8174  N  N     . PHE B 1 154 ? 29.723  -32.309 37.287  1.00 34.89 ? 154  PHE B N     1 
ATOM   8175  C  CA    . PHE B 1 154 ? 28.419  -31.951 37.890  1.00 34.62 ? 154  PHE B CA    1 
ATOM   8176  C  C     . PHE B 1 154 ? 27.390  -32.201 36.802  1.00 35.53 ? 154  PHE B C     1 
ATOM   8177  O  O     . PHE B 1 154 ? 27.539  -31.528 35.784  1.00 36.68 ? 154  PHE B O     1 
ATOM   8178  C  CB    . PHE B 1 154 ? 28.556  -30.510 38.333  1.00 28.77 ? 154  PHE B CB    1 
ATOM   8179  C  CG    . PHE B 1 154 ? 27.320  -29.865 38.886  1.00 33.50 ? 154  PHE B CG    1 
ATOM   8180  C  CD1   . PHE B 1 154 ? 26.823  -30.304 40.091  1.00 30.37 ? 154  PHE B CD1   1 
ATOM   8181  C  CD2   . PHE B 1 154 ? 26.649  -28.823 38.255  1.00 29.36 ? 154  PHE B CD2   1 
ATOM   8182  C  CE1   . PHE B 1 154 ? 25.671  -29.778 40.646  1.00 32.65 ? 154  PHE B CE1   1 
ATOM   8183  C  CE2   . PHE B 1 154 ? 25.510  -28.279 38.798  1.00 29.12 ? 154  PHE B CE2   1 
ATOM   8184  C  CZ    . PHE B 1 154 ? 25.007  -28.741 40.008  1.00 31.87 ? 154  PHE B CZ    1 
ATOM   8185  N  N     . SER B 1 155 ? 26.620  -33.272 36.803  1.00 34.82 ? 155  SER B N     1 
ATOM   8186  C  CA    . SER B 1 155 ? 25.837  -33.630 35.617  1.00 36.03 ? 155  SER B CA    1 
ATOM   8187  C  C     . SER B 1 155 ? 24.487  -32.973 35.440  1.00 36.21 ? 155  SER B C     1 
ATOM   8188  O  O     . SER B 1 155 ? 23.399  -33.535 35.531  1.00 36.37 ? 155  SER B O     1 
ATOM   8189  C  CB    . SER B 1 155 ? 25.750  -35.145 35.495  1.00 34.75 ? 155  SER B CB    1 
ATOM   8190  O  OG    . SER B 1 155 ? 25.346  -35.744 36.713  1.00 37.99 ? 155  SER B OG    1 
ATOM   8191  N  N     . PHE B 1 156 ? 24.519  -31.671 35.161  1.00 35.13 ? 156  PHE B N     1 
ATOM   8192  C  CA    . PHE B 1 156 ? 23.336  -30.830 35.030  1.00 32.93 ? 156  PHE B CA    1 
ATOM   8193  C  C     . PHE B 1 156 ? 23.693  -29.756 34.005  1.00 32.07 ? 156  PHE B C     1 
ATOM   8194  O  O     . PHE B 1 156 ? 24.875  -29.512 33.762  1.00 29.82 ? 156  PHE B O     1 
ATOM   8195  C  CB    . PHE B 1 156 ? 22.925  -30.228 36.378  1.00 26.89 ? 156  PHE B CB    1 
ATOM   8196  C  CG    . PHE B 1 156 ? 22.619  -31.260 37.438  1.00 23.68 ? 156  PHE B CG    1 
ATOM   8197  C  CD1   . PHE B 1 156 ? 21.356  -31.811 37.550  1.00 24.71 ? 156  PHE B CD1   1 
ATOM   8198  C  CD2   . PHE B 1 156 ? 23.589  -31.623 38.351  1.00 21.91 ? 156  PHE B CD2   1 
ATOM   8199  C  CE1   . PHE B 1 156 ? 21.103  -32.776 38.512  1.00 26.69 ? 156  PHE B CE1   1 
ATOM   8200  C  CE2   . PHE B 1 156 ? 23.337  -32.562 39.351  1.00 25.06 ? 156  PHE B CE2   1 
ATOM   8201  C  CZ    . PHE B 1 156 ? 22.092  -33.149 39.401  1.00 26.67 ? 156  PHE B CZ    1 
ATOM   8202  N  N     . PRO B 1 157 ? 22.679  -29.245 33.299  1.00 32.02 ? 157  PRO B N     1 
ATOM   8203  C  CA    . PRO B 1 157 ? 22.947  -28.210 32.294  1.00 31.97 ? 157  PRO B CA    1 
ATOM   8204  C  C     . PRO B 1 157 ? 23.402  -26.947 33.003  1.00 32.72 ? 157  PRO B C     1 
ATOM   8205  O  O     . PRO B 1 157 ? 22.641  -26.369 33.761  1.00 32.08 ? 157  PRO B O     1 
ATOM   8206  C  CB    . PRO B 1 157 ? 21.540  -27.948 31.726  1.00 31.99 ? 157  PRO B CB    1 
ATOM   8207  C  CG    . PRO B 1 157 ? 20.617  -28.305 32.810  1.00 32.18 ? 157  PRO B CG    1 
ATOM   8208  C  CD    . PRO B 1 157 ? 21.254  -29.522 33.500  1.00 31.03 ? 157  PRO B CD    1 
ATOM   8209  N  N     . CYS B 1 158 ? 24.519  -26.391 32.627  1.00 35.14 ? 158  CYS B N     1 
ATOM   8210  C  CA    . CYS B 1 158 ? 25.146  -25.192 33.179  1.00 35.58 ? 158  CYS B CA    1 
ATOM   8211  C  C     . CYS B 1 158 ? 25.584  -24.309 31.999  1.00 35.63 ? 158  CYS B C     1 
ATOM   8212  O  O     . CYS B 1 158 ? 26.087  -24.871 31.038  1.00 33.04 ? 158  CYS B O     1 
ATOM   8213  C  CB    . CYS B 1 158 ? 26.516  -25.664 33.833  1.00 34.47 ? 158  CYS B CB    1 
ATOM   8214  S  SG    . CYS B 1 158 ? 26.067  -26.521 35.359  1.00 35.75 ? 158  CYS B SG    1 
ATOM   8215  N  N     . GLN B 1 159 ? 25.482  -22.999 32.172  1.00 36.86 ? 159  GLN B N     1 
ATOM   8216  C  CA    . GLN B 1 159 ? 25.908  -22.073 31.117  1.00 37.23 ? 159  GLN B CA    1 
ATOM   8217  C  C     . GLN B 1 159 ? 27.328  -21.655 31.483  1.00 37.43 ? 159  GLN B C     1 
ATOM   8218  O  O     . GLN B 1 159 ? 27.526  -21.359 32.667  1.00 38.97 ? 159  GLN B O     1 
ATOM   8219  C  CB    . GLN B 1 159 ? 24.977  -20.850 31.140  1.00 41.54 ? 159  GLN B CB    1 
ATOM   8220  C  CG    . GLN B 1 159 ? 25.192  -19.940 29.944  1.00 51.75 ? 159  GLN B CG    1 
ATOM   8221  C  CD    . GLN B 1 159 ? 25.028  -20.634 28.578  1.00 59.17 ? 159  GLN B CD    1 
ATOM   8222  O  OE1   . GLN B 1 159 ? 23.885  -20.899 28.141  1.00 55.24 ? 159  GLN B OE1   1 
ATOM   8223  N  NE2   . GLN B 1 159 ? 26.146  -20.881 27.867  1.00 48.12 ? 159  GLN B NE2   1 
ATOM   8224  N  N     . GLN B 1 160 ? 28.336  -21.925 30.683  1.00 36.00 ? 160  GLN B N     1 
ATOM   8225  C  CA    . GLN B 1 160 ? 29.722  -21.686 30.925  1.00 34.63 ? 160  GLN B CA    1 
ATOM   8226  C  C     . GLN B 1 160 ? 30.314  -20.753 29.862  1.00 36.66 ? 160  GLN B C     1 
ATOM   8227  O  O     . GLN B 1 160 ? 30.174  -20.988 28.661  1.00 35.89 ? 160  GLN B O     1 
ATOM   8228  C  CB    . GLN B 1 160 ? 30.554  -22.952 30.881  1.00 29.32 ? 160  GLN B CB    1 
ATOM   8229  C  CG    . GLN B 1 160 ? 29.916  -24.180 31.493  1.00 39.16 ? 160  GLN B CG    1 
ATOM   8230  C  CD    . GLN B 1 160 ? 30.756  -25.425 31.606  1.00 37.15 ? 160  GLN B CD    1 
ATOM   8231  O  OE1   . GLN B 1 160 ? 30.399  -26.436 31.011  1.00 40.16 ? 160  GLN B OE1   1 
ATOM   8232  N  NE2   . GLN B 1 160 ? 31.846  -25.448 32.369  1.00 35.85 ? 160  GLN B NE2   1 
ATOM   8233  N  N     . SER B 1 161 ? 31.122  -19.793 30.311  1.00 38.04 ? 161  SER B N     1 
ATOM   8234  C  CA    . SER B 1 161 ? 31.785  -18.945 29.320  1.00 40.32 ? 161  SER B CA    1 
ATOM   8235  C  C     . SER B 1 161 ? 33.258  -19.289 29.371  1.00 41.21 ? 161  SER B C     1 
ATOM   8236  O  O     . SER B 1 161 ? 34.078  -18.819 28.604  1.00 41.77 ? 161  SER B O     1 
ATOM   8237  C  CB    . SER B 1 161 ? 31.542  -17.476 29.708  1.00 43.58 ? 161  SER B CB    1 
ATOM   8238  O  OG    . SER B 1 161 ? 32.323  -17.219 30.871  1.00 49.89 ? 161  SER B OG    1 
ATOM   8239  N  N     . LYS B 1 162 ? 33.562  -20.214 30.279  1.00 41.51 ? 162  LYS B N     1 
ATOM   8240  C  CA    . LYS B 1 162 ? 34.941  -20.681 30.420  1.00 41.07 ? 162  LYS B CA    1 
ATOM   8241  C  C     . LYS B 1 162 ? 34.927  -21.985 31.234  1.00 40.04 ? 162  LYS B C     1 
ATOM   8242  O  O     . LYS B 1 162 ? 33.958  -22.271 31.926  1.00 38.89 ? 162  LYS B O     1 
ATOM   8243  C  CB    . LYS B 1 162 ? 35.797  -19.572 31.065  1.00 43.75 ? 162  LYS B CB    1 
ATOM   8244  C  CG    . LYS B 1 162 ? 35.168  -18.873 32.250  1.00 41.71 ? 162  LYS B CG    1 
ATOM   8245  C  CD    . LYS B 1 162 ? 36.154  -18.177 33.171  1.00 48.69 ? 162  LYS B CD    1 
ATOM   8246  C  CE    . LYS B 1 162 ? 35.525  -17.734 34.489  1.00 48.82 ? 162  LYS B CE    1 
ATOM   8247  N  NZ    . LYS B 1 162 ? 36.422  -16.885 35.330  1.00 51.36 ? 162  LYS B NZ    1 
ATOM   8248  N  N     . ILE B 1 163 ? 36.012  -22.738 31.211  1.00 40.00 ? 163  ILE B N     1 
ATOM   8249  C  CA    . ILE B 1 163 ? 36.083  -24.040 31.825  1.00 42.00 ? 163  ILE B CA    1 
ATOM   8250  C  C     . ILE B 1 163 ? 35.907  -24.061 33.329  1.00 43.46 ? 163  ILE B C     1 
ATOM   8251  O  O     . ILE B 1 163 ? 35.282  -24.994 33.856  1.00 43.12 ? 163  ILE B O     1 
ATOM   8252  C  CB    . ILE B 1 163 ? 37.292  -24.845 31.354  1.00 42.02 ? 163  ILE B CB    1 
ATOM   8253  C  CG1   . ILE B 1 163 ? 37.096  -26.331 31.650  1.00 45.69 ? 163  ILE B CG1   1 
ATOM   8254  C  CG2   . ILE B 1 163 ? 38.590  -24.365 31.999  1.00 40.25 ? 163  ILE B CG2   1 
ATOM   8255  C  CD1   . ILE B 1 163 ? 36.051  -27.052 30.866  1.00 39.58 ? 163  ILE B CD1   1 
ATOM   8256  N  N     . ASP B 1 164 ? 36.107  -22.933 34.012  1.00 44.74 ? 164  ASP B N     1 
ATOM   8257  C  CA    . ASP B 1 164 ? 36.035  -22.896 35.467  1.00 44.64 ? 164  ASP B CA    1 
ATOM   8258  C  C     . ASP B 1 164 ? 34.902  -22.046 36.000  1.00 44.97 ? 164  ASP B C     1 
ATOM   8259  O  O     . ASP B 1 164 ? 34.881  -21.675 37.177  1.00 44.70 ? 164  ASP B O     1 
ATOM   8260  C  CB    . ASP B 1 164 ? 37.355  -22.492 36.077  1.00 45.89 ? 164  ASP B CB    1 
ATOM   8261  C  CG    . ASP B 1 164 ? 37.749  -21.081 35.664  1.00 50.30 ? 164  ASP B CG    1 
ATOM   8262  O  OD1   . ASP B 1 164 ? 38.012  -20.836 34.461  1.00 54.34 ? 164  ASP B OD1   1 
ATOM   8263  O  OD2   . ASP B 1 164 ? 37.897  -20.231 36.562  1.00 52.34 ? 164  ASP B OD2   1 
ATOM   8264  N  N     . GLU B 1 165 ? 33.869  -21.936 35.164  1.00 44.86 ? 165  GLU B N     1 
ATOM   8265  C  CA    . GLU B 1 165 ? 32.605  -21.380 35.697  1.00 45.63 ? 165  GLU B CA    1 
ATOM   8266  C  C     . GLU B 1 165 ? 31.526  -22.412 35.351  1.00 44.15 ? 165  GLU B C     1 
ATOM   8267  O  O     . GLU B 1 165 ? 31.691  -23.105 34.336  1.00 45.24 ? 165  GLU B O     1 
ATOM   8268  C  CB    . GLU B 1 165 ? 32.353  -20.005 35.142  1.00 45.13 ? 165  GLU B CB    1 
ATOM   8269  C  CG    . GLU B 1 165 ? 30.983  -19.469 34.900  1.00 50.91 ? 165  GLU B CG    1 
ATOM   8270  C  CD    . GLU B 1 165 ? 30.939  -18.396 33.818  1.00 53.94 ? 165  GLU B CD    1 
ATOM   8271  O  OE1   . GLU B 1 165 ? 30.865  -18.715 32.602  1.00 54.12 ? 165  GLU B OE1   1 
ATOM   8272  O  OE2   . GLU B 1 165 ? 30.968  -17.199 34.203  1.00 59.27 ? 165  GLU B OE2   1 
ATOM   8273  N  N     . ALA B 1 166 ? 30.542  -22.584 36.216  1.00 41.17 ? 166  ALA B N     1 
ATOM   8274  C  CA    . ALA B 1 166 ? 29.432  -23.444 35.835  1.00 40.49 ? 166  ALA B CA    1 
ATOM   8275  C  C     . ALA B 1 166 ? 28.160  -22.837 36.390  1.00 40.00 ? 166  ALA B C     1 
ATOM   8276  O  O     . ALA B 1 166 ? 27.900  -23.065 37.575  1.00 40.25 ? 166  ALA B O     1 
ATOM   8277  C  CB    . ALA B 1 166 ? 29.661  -24.861 36.327  1.00 39.80 ? 166  ALA B CB    1 
ATOM   8278  N  N     . ILE B 1 167 ? 27.390  -22.117 35.577  1.00 39.70 ? 167  ILE B N     1 
ATOM   8279  C  CA    . ILE B 1 167 ? 26.151  -21.528 36.103  1.00 38.98 ? 167  ILE B CA    1 
ATOM   8280  C  C     . ILE B 1 167 ? 24.984  -22.472 35.900  1.00 38.08 ? 167  ILE B C     1 
ATOM   8281  O  O     . ILE B 1 167 ? 24.663  -22.816 34.756  1.00 39.48 ? 167  ILE B O     1 
ATOM   8282  C  CB    . ILE B 1 167 ? 25.842  -20.098 35.608  1.00 41.29 ? 167  ILE B CB    1 
ATOM   8283  C  CG1   . ILE B 1 167 ? 26.837  -19.147 36.319  1.00 45.30 ? 167  ILE B CG1   1 
ATOM   8284  C  CG2   . ILE B 1 167 ? 24.431  -19.634 35.967  1.00 34.86 ? 167  ILE B CG2   1 
ATOM   8285  C  CD1   . ILE B 1 167 ? 27.310  -17.967 35.512  1.00 47.14 ? 167  ILE B CD1   1 
ATOM   8286  N  N     . LEU B 1 168 ? 24.356  -22.898 36.988  1.00 35.87 ? 168  LEU B N     1 
ATOM   8287  C  CA    . LEU B 1 168 ? 23.261  -23.823 36.887  1.00 36.36 ? 168  LEU B CA    1 
ATOM   8288  C  C     . LEU B 1 168 ? 22.040  -23.227 36.197  1.00 37.35 ? 168  LEU B C     1 
ATOM   8289  O  O     . LEU B 1 168 ? 21.317  -22.351 36.724  1.00 36.74 ? 168  LEU B O     1 
ATOM   8290  C  CB    . LEU B 1 168 ? 22.881  -24.503 38.216  1.00 32.56 ? 168  LEU B CB    1 
ATOM   8291  C  CG    . LEU B 1 168 ? 21.673  -25.441 38.059  1.00 36.82 ? 168  LEU B CG    1 
ATOM   8292  C  CD1   . LEU B 1 168 ? 22.067  -26.659 37.199  1.00 34.18 ? 168  LEU B CD1   1 
ATOM   8293  C  CD2   . LEU B 1 168 ? 21.168  -25.943 39.413  1.00 35.04 ? 168  LEU B CD2   1 
ATOM   8294  N  N     . ILE B 1 169 ? 21.718  -23.836 35.040  1.00 35.79 ? 169  ILE B N     1 
ATOM   8295  C  CA    . ILE B 1 169 ? 20.479  -23.481 34.372  1.00 34.30 ? 169  ILE B CA    1 
ATOM   8296  C  C     . ILE B 1 169 ? 19.267  -24.111 35.026  1.00 35.94 ? 169  ILE B C     1 
ATOM   8297  O  O     . ILE B 1 169 ? 18.298  -23.401 35.336  1.00 36.78 ? 169  ILE B O     1 
ATOM   8298  C  CB    . ILE B 1 169 ? 20.561  -23.843 32.881  1.00 34.28 ? 169  ILE B CB    1 
ATOM   8299  C  CG1   . ILE B 1 169 ? 21.818  -23.311 32.204  1.00 33.84 ? 169  ILE B CG1   1 
ATOM   8300  C  CG2   . ILE B 1 169 ? 19.250  -23.412 32.200  1.00 34.37 ? 169  ILE B CG2   1 
ATOM   8301  C  CD1   . ILE B 1 169 ? 22.115  -23.924 30.826  1.00 24.05 ? 169  ILE B CD1   1 
ATOM   8302  N  N     . THR B 1 170 ? 19.178  -25.435 35.236  1.00 35.91 ? 170  THR B N     1 
ATOM   8303  C  CA    . THR B 1 170 ? 17.973  -26.021 35.846  1.00 35.49 ? 170  THR B CA    1 
ATOM   8304  C  C     . THR B 1 170 ? 18.271  -27.385 36.450  1.00 35.84 ? 170  THR B C     1 
ATOM   8305  O  O     . THR B 1 170 ? 19.134  -28.086 35.898  1.00 34.89 ? 170  THR B O     1 
ATOM   8306  C  CB    . THR B 1 170 ? 16.796  -26.028 34.863  1.00 36.70 ? 170  THR B CB    1 
ATOM   8307  O  OG1   . THR B 1 170 ? 15.634  -26.762 35.334  1.00 41.50 ? 170  THR B OG1   1 
ATOM   8308  C  CG2   . THR B 1 170 ? 17.158  -26.626 33.534  1.00 34.14 ? 170  THR B CG2   1 
ATOM   8309  N  N     . TRP B 1 171 ? 17.712  -27.715 37.630  1.00 34.89 ? 171  TRP B N     1 
ATOM   8310  C  CA    . TRP B 1 171 ? 17.892  -29.063 38.132  1.00 35.05 ? 171  TRP B CA    1 
ATOM   8311  C  C     . TRP B 1 171 ? 17.219  -30.032 37.138  1.00 35.03 ? 171  TRP B C     1 
ATOM   8312  O  O     . TRP B 1 171 ? 16.140  -29.721 36.641  1.00 33.76 ? 171  TRP B O     1 
ATOM   8313  C  CB    . TRP B 1 171 ? 17.204  -29.402 39.458  1.00 33.76 ? 171  TRP B CB    1 
ATOM   8314  C  CG    . TRP B 1 171 ? 17.752  -28.609 40.593  1.00 35.86 ? 171  TRP B CG    1 
ATOM   8315  C  CD1   . TRP B 1 171 ? 17.128  -27.516 41.134  1.00 43.33 ? 171  TRP B CD1   1 
ATOM   8316  C  CD2   . TRP B 1 171 ? 19.055  -28.594 41.181  1.00 35.82 ? 171  TRP B CD2   1 
ATOM   8317  N  NE1   . TRP B 1 171 ? 17.929  -26.931 42.086  1.00 41.81 ? 171  TRP B NE1   1 
ATOM   8318  C  CE2   . TRP B 1 171 ? 19.113  -27.609 42.168  1.00 36.41 ? 171  TRP B CE2   1 
ATOM   8319  C  CE3   . TRP B 1 171 ? 20.084  -29.558 41.070  1.00 40.40 ? 171  TRP B CE3   1 
ATOM   8320  C  CZ2   . TRP B 1 171 ? 20.230  -27.477 42.979  1.00 42.06 ? 171  TRP B CZ2   1 
ATOM   8321  C  CZ3   . TRP B 1 171 ? 21.194  -29.450 41.886  1.00 43.17 ? 171  TRP B CZ3   1 
ATOM   8322  C  CH2   . TRP B 1 171 ? 21.271  -28.342 42.783  1.00 42.33 ? 171  TRP B CH2   1 
ATOM   8323  N  N     . THR B 1 172 ? 17.716  -31.285 37.230  1.00 35.41 ? 172  THR B N     1 
ATOM   8324  C  CA    . THR B 1 172 ? 17.026  -32.381 36.544  1.00 34.23 ? 172  THR B CA    1 
ATOM   8325  C  C     . THR B 1 172 ? 17.142  -33.629 37.404  1.00 34.16 ? 172  THR B C     1 
ATOM   8326  O  O     . THR B 1 172 ? 17.737  -33.589 38.475  1.00 33.50 ? 172  THR B O     1 
ATOM   8327  C  CB    . THR B 1 172 ? 17.621  -32.643 35.164  1.00 33.13 ? 172  THR B CB    1 
ATOM   8328  O  OG1   . THR B 1 172 ? 19.003  -32.889 35.304  1.00 33.68 ? 172  THR B OG1   1 
ATOM   8329  C  CG2   . THR B 1 172 ? 17.439  -31.486 34.204  1.00 34.05 ? 172  THR B CG2   1 
ATOM   8330  N  N     . LYS B 1 173 ? 16.546  -34.737 36.965  1.00 34.02 ? 173  LYS B N     1 
ATOM   8331  C  CA    . LYS B 1 173 ? 16.578  -35.978 37.693  1.00 33.30 ? 173  LYS B CA    1 
ATOM   8332  C  C     . LYS B 1 173 ? 16.064  -35.861 39.114  1.00 34.33 ? 173  LYS B C     1 
ATOM   8333  O  O     . LYS B 1 173 ? 14.983  -35.337 39.398  1.00 33.08 ? 173  LYS B O     1 
ATOM   8334  C  CB    . LYS B 1 173 ? 18.017  -36.532 37.722  1.00 29.23 ? 173  LYS B CB    1 
ATOM   8335  C  CG    . LYS B 1 173 ? 18.553  -36.818 36.356  1.00 18.59 ? 173  LYS B CG    1 
ATOM   8336  C  CD    . LYS B 1 173 ? 20.035  -37.079 36.177  1.00 17.10 ? 173  LYS B CD    1 
ATOM   8337  C  CE    . LYS B 1 173 ? 20.946  -35.890 36.398  1.00 20.35 ? 173  LYS B CE    1 
ATOM   8338  N  NZ    . LYS B 1 173 ? 22.392  -36.314 36.204  1.00 21.61 ? 173  LYS B NZ    1 
ATOM   8339  N  N     . ARG B 1 174 ? 16.958  -36.253 40.023  1.00 35.58 ? 174  ARG B N     1 
ATOM   8340  C  CA    . ARG B 1 174 ? 16.629  -36.341 41.447  1.00 36.36 ? 174  ARG B CA    1 
ATOM   8341  C  C     . ARG B 1 174 ? 16.968  -35.122 42.306  1.00 35.28 ? 174  ARG B C     1 
ATOM   8342  O  O     . ARG B 1 174 ? 16.482  -35.084 43.460  1.00 35.99 ? 174  ARG B O     1 
ATOM   8343  C  CB    . ARG B 1 174 ? 17.075  -37.731 41.981  1.00 36.28 ? 174  ARG B CB    1 
ATOM   8344  C  CG    . ARG B 1 174 ? 16.487  -38.999 41.389  1.00 45.68 ? 174  ARG B CG    1 
ATOM   8345  C  CD    . ARG B 1 174 ? 17.007  -40.334 41.900  1.00 48.81 ? 174  ARG B CD    1 
ATOM   8346  N  NE    . ARG B 1 174 ? 16.319  -41.638 41.579  1.00 53.66 ? 174  ARG B NE    1 
ATOM   8347  C  CZ    . ARG B 1 174 ? 15.021  -41.656 41.926  1.00 58.21 ? 174  ARG B CZ    1 
ATOM   8348  N  NH1   . ARG B 1 174 ? 14.502  -40.585 42.541  1.00 63.45 ? 174  ARG B NH1   1 
ATOM   8349  N  NH2   . ARG B 1 174 ? 14.240  -42.678 41.673  1.00 66.42 ? 174  ARG B NH2   1 
ATOM   8350  N  N     . PHE B 1 175 ? 17.914  -34.276 41.938  1.00 33.80 ? 175  PHE B N     1 
ATOM   8351  C  CA    . PHE B 1 175 ? 18.329  -33.164 42.787  1.00 35.10 ? 175  PHE B CA    1 
ATOM   8352  C  C     . PHE B 1 175 ? 17.353  -31.986 42.705  1.00 35.65 ? 175  PHE B C     1 
ATOM   8353  O  O     . PHE B 1 175 ? 16.840  -31.723 41.612  1.00 35.01 ? 175  PHE B O     1 
ATOM   8354  C  CB    . PHE B 1 175 ? 19.693  -32.615 42.277  1.00 34.60 ? 175  PHE B CB    1 
ATOM   8355  C  CG    . PHE B 1 175 ? 20.828  -33.453 42.818  1.00 37.94 ? 175  PHE B CG    1 
ATOM   8356  C  CD1   . PHE B 1 175 ? 20.892  -34.842 42.583  1.00 36.63 ? 175  PHE B CD1   1 
ATOM   8357  C  CD2   . PHE B 1 175 ? 21.785  -32.863 43.639  1.00 36.24 ? 175  PHE B CD2   1 
ATOM   8358  C  CE1   . PHE B 1 175 ? 21.921  -35.587 43.130  1.00 37.43 ? 175  PHE B CE1   1 
ATOM   8359  C  CE2   . PHE B 1 175 ? 22.783  -33.618 44.198  1.00 40.75 ? 175  PHE B CE2   1 
ATOM   8360  C  CZ    . PHE B 1 175 ? 22.852  -34.983 43.946  1.00 40.21 ? 175  PHE B CZ    1 
ATOM   8361  N  N     . LYS B 1 176 ? 17.098  -31.278 43.792  1.00 35.26 ? 176  LYS B N     1 
ATOM   8362  C  CA    . LYS B 1 176 ? 16.302  -30.068 43.762  1.00 36.58 ? 176  LYS B CA    1 
ATOM   8363  C  C     . LYS B 1 176 ? 16.618  -29.111 44.919  1.00 37.63 ? 176  LYS B C     1 
ATOM   8364  O  O     . LYS B 1 176 ? 15.893  -29.196 45.930  1.00 37.44 ? 176  LYS B O     1 
ATOM   8365  C  CB    . LYS B 1 176 ? 14.792  -30.342 43.784  1.00 35.31 ? 176  LYS B CB    1 
ATOM   8366  C  CG    . LYS B 1 176 ? 14.108  -29.071 43.239  1.00 34.52 ? 176  LYS B CG    1 
ATOM   8367  C  CD    . LYS B 1 176 ? 12.622  -29.265 43.033  1.00 36.80 ? 176  LYS B CD    1 
ATOM   8368  C  CE    . LYS B 1 176 ? 11.839  -28.093 43.626  1.00 42.64 ? 176  LYS B CE    1 
ATOM   8369  N  NZ    . LYS B 1 176 ? 12.025  -26.844 42.817  1.00 40.37 ? 176  LYS B NZ    1 
ATOM   8370  N  N     . ALA B 1 177 ? 17.821  -28.540 44.922  1.00 37.82 ? 177  ALA B N     1 
ATOM   8371  C  CA    . ALA B 1 177 ? 18.259  -27.703 46.009  1.00 39.87 ? 177  ALA B CA    1 
ATOM   8372  C  C     . ALA B 1 177 ? 18.106  -26.209 45.734  1.00 40.32 ? 177  ALA B C     1 
ATOM   8373  O  O     . ALA B 1 177 ? 18.240  -25.715 44.622  1.00 39.78 ? 177  ALA B O     1 
ATOM   8374  C  CB    . ALA B 1 177 ? 19.681  -28.044 46.444  1.00 35.03 ? 177  ALA B CB    1 
ATOM   8375  N  N     . SER B 1 178 ? 17.571  -25.510 46.730  1.00 41.69 ? 178  SER B N     1 
ATOM   8376  C  CA    . SER B 1 178 ? 17.310  -24.065 46.672  1.00 41.29 ? 178  SER B CA    1 
ATOM   8377  C  C     . SER B 1 178 ? 18.611  -23.267 46.660  1.00 40.09 ? 178  SER B C     1 
ATOM   8378  O  O     . SER B 1 178 ? 19.596  -23.734 47.214  1.00 40.14 ? 178  SER B O     1 
ATOM   8379  C  CB    . SER B 1 178 ? 16.759  -23.659 48.077  1.00 45.71 ? 178  SER B CB    1 
ATOM   8380  O  OG    . SER B 1 178 ? 15.389  -23.964 48.093  1.00 46.79 ? 178  SER B OG    1 
ATOM   8381  N  N     . GLY B 1 179 ? 18.590  -22.113 46.025  1.00 39.66 ? 179  GLY B N     1 
ATOM   8382  C  CA    . GLY B 1 179 ? 19.730  -21.213 46.000  1.00 37.60 ? 179  GLY B CA    1 
ATOM   8383  C  C     . GLY B 1 179 ? 20.803  -21.550 45.014  1.00 36.86 ? 179  GLY B C     1 
ATOM   8384  O  O     . GLY B 1 179 ? 21.914  -20.999 45.112  1.00 37.46 ? 179  GLY B O     1 
ATOM   8385  N  N     . VAL B 1 180 ? 20.551  -22.512 44.144  1.00 36.46 ? 180  VAL B N     1 
ATOM   8386  C  CA    . VAL B 1 180 ? 21.626  -22.956 43.245  1.00 36.63 ? 180  VAL B CA    1 
ATOM   8387  C  C     . VAL B 1 180 ? 21.320  -22.526 41.824  1.00 36.73 ? 180  VAL B C     1 
ATOM   8388  O  O     . VAL B 1 180 ? 22.190  -22.010 41.123  1.00 37.01 ? 180  VAL B O     1 
ATOM   8389  C  CB    . VAL B 1 180 ? 21.931  -24.468 43.408  1.00 29.97 ? 180  VAL B CB    1 
ATOM   8390  C  CG1   . VAL B 1 180 ? 23.240  -24.722 42.664  1.00 28.63 ? 180  VAL B CG1   1 
ATOM   8391  C  CG2   . VAL B 1 180 ? 22.198  -24.772 44.883  1.00 31.48 ? 180  VAL B CG2   1 
ATOM   8392  N  N     . GLU B 1 181 ? 20.084  -22.774 41.385  1.00 36.51 ? 181  GLU B N     1 
ATOM   8393  C  CA    . GLU B 1 181 ? 19.664  -22.342 40.056  1.00 38.23 ? 181  GLU B CA    1 
ATOM   8394  C  C     . GLU B 1 181 ? 19.888  -20.852 39.846  1.00 39.93 ? 181  GLU B C     1 
ATOM   8395  O  O     . GLU B 1 181 ? 19.384  -19.980 40.563  1.00 41.17 ? 181  GLU B O     1 
ATOM   8396  C  CB    . GLU B 1 181 ? 18.246  -22.737 39.729  1.00 40.94 ? 181  GLU B CB    1 
ATOM   8397  C  CG    . GLU B 1 181 ? 17.998  -24.214 39.440  1.00 45.16 ? 181  GLU B CG    1 
ATOM   8398  C  CD    . GLU B 1 181 ? 16.561  -24.586 39.175  1.00 43.21 ? 181  GLU B CD    1 
ATOM   8399  O  OE1   . GLU B 1 181 ? 15.607  -23.773 39.235  1.00 49.22 ? 181  GLU B OE1   1 
ATOM   8400  O  OE2   . GLU B 1 181 ? 16.297  -25.784 38.957  1.00 45.32 ? 181  GLU B OE2   1 
ATOM   8401  N  N     . GLY B 1 182 ? 20.666  -20.535 38.818  1.00 40.74 ? 182  GLY B N     1 
ATOM   8402  C  CA    . GLY B 1 182 ? 20.989  -19.158 38.475  1.00 40.20 ? 182  GLY B CA    1 
ATOM   8403  C  C     . GLY B 1 182 ? 22.370  -18.780 38.986  1.00 41.40 ? 182  GLY B C     1 
ATOM   8404  O  O     . GLY B 1 182 ? 22.836  -17.696 38.655  1.00 41.88 ? 182  GLY B O     1 
ATOM   8405  N  N     . ALA B 1 183 ? 22.970  -19.599 39.841  1.00 41.12 ? 183  ALA B N     1 
ATOM   8406  C  CA    . ALA B 1 183 ? 24.249  -19.278 40.465  1.00 40.66 ? 183  ALA B CA    1 
ATOM   8407  C  C     . ALA B 1 183 ? 25.371  -20.147 39.867  1.00 40.72 ? 183  ALA B C     1 
ATOM   8408  O  O     . ALA B 1 183 ? 25.103  -21.241 39.374  1.00 40.18 ? 183  ALA B O     1 
ATOM   8409  C  CB    . ALA B 1 183 ? 24.156  -19.678 41.945  1.00 27.78 ? 183  ALA B CB    1 
ATOM   8410  N  N     . ASP B 1 184 ? 26.596  -19.706 40.095  1.00 41.13 ? 184  ASP B N     1 
ATOM   8411  C  CA    . ASP B 1 184 ? 27.768  -20.411 39.606  1.00 44.39 ? 184  ASP B CA    1 
ATOM   8412  C  C     . ASP B 1 184 ? 28.130  -21.430 40.701  1.00 46.89 ? 184  ASP B C     1 
ATOM   8413  O  O     . ASP B 1 184 ? 28.408  -20.923 41.801  1.00 47.65 ? 184  ASP B O     1 
ATOM   8414  C  CB    . ASP B 1 184 ? 28.926  -19.416 39.416  1.00 40.36 ? 184  ASP B CB    1 
ATOM   8415  C  CG    . ASP B 1 184 ? 30.190  -20.137 38.966  1.00 45.75 ? 184  ASP B CG    1 
ATOM   8416  O  OD1   . ASP B 1 184 ? 30.078  -21.366 38.629  1.00 43.31 ? 184  ASP B OD1   1 
ATOM   8417  O  OD2   . ASP B 1 184 ? 31.255  -19.489 38.924  1.00 43.01 ? 184  ASP B OD2   1 
ATOM   8418  N  N     . VAL B 1 185 ? 27.995  -22.734 40.490  1.00 47.52 ? 185  VAL B N     1 
ATOM   8419  C  CA    . VAL B 1 185 ? 28.165  -23.637 41.615  1.00 48.08 ? 185  VAL B CA    1 
ATOM   8420  C  C     . VAL B 1 185 ? 29.581  -23.872 42.081  1.00 46.25 ? 185  VAL B C     1 
ATOM   8421  O  O     . VAL B 1 185 ? 29.784  -24.344 43.205  1.00 45.26 ? 185  VAL B O     1 
ATOM   8422  C  CB    . VAL B 1 185 ? 27.346  -24.913 41.491  1.00 52.93 ? 185  VAL B CB    1 
ATOM   8423  C  CG1   . VAL B 1 185 ? 26.706  -25.076 40.124  1.00 54.83 ? 185  VAL B CG1   1 
ATOM   8424  C  CG2   . VAL B 1 185 ? 28.237  -26.109 41.803  1.00 59.82 ? 185  VAL B CG2   1 
ATOM   8425  N  N     . VAL B 1 186 ? 30.589  -23.451 41.335  1.00 46.93 ? 186  VAL B N     1 
ATOM   8426  C  CA    . VAL B 1 186 ? 31.962  -23.368 41.800  1.00 47.28 ? 186  VAL B CA    1 
ATOM   8427  C  C     . VAL B 1 186 ? 32.214  -22.256 42.803  1.00 47.64 ? 186  VAL B C     1 
ATOM   8428  O  O     . VAL B 1 186 ? 33.056  -22.405 43.704  1.00 48.46 ? 186  VAL B O     1 
ATOM   8429  C  CB    . VAL B 1 186 ? 32.992  -23.455 40.689  1.00 47.07 ? 186  VAL B CB    1 
ATOM   8430  C  CG1   . VAL B 1 186 ? 32.383  -23.470 39.305  1.00 41.23 ? 186  VAL B CG1   1 
ATOM   8431  C  CG2   . VAL B 1 186 ? 34.240  -22.647 40.845  1.00 43.89 ? 186  VAL B CG2   1 
ATOM   8432  N  N     . LYS B 1 187 ? 31.443  -21.184 42.740  1.00 47.31 ? 187  LYS B N     1 
ATOM   8433  C  CA    . LYS B 1 187 ? 31.543  -20.149 43.768  1.00 47.18 ? 187  LYS B CA    1 
ATOM   8434  C  C     . LYS B 1 187 ? 30.742  -20.688 44.965  1.00 45.57 ? 187  LYS B C     1 
ATOM   8435  O  O     . LYS B 1 187 ? 30.969  -20.343 46.130  1.00 46.22 ? 187  LYS B O     1 
ATOM   8436  C  CB    . LYS B 1 187 ? 30.920  -18.844 43.260  1.00 48.51 ? 187  LYS B CB    1 
ATOM   8437  C  CG    . LYS B 1 187 ? 31.740  -18.120 42.209  1.00 54.54 ? 187  LYS B CG    1 
ATOM   8438  C  CD    . LYS B 1 187 ? 31.513  -16.611 42.226  1.00 57.53 ? 187  LYS B CD    1 
ATOM   8439  C  CE    . LYS B 1 187 ? 31.839  -15.978 40.884  1.00 60.78 ? 187  LYS B CE    1 
ATOM   8440  N  NZ    . LYS B 1 187 ? 32.949  -16.684 40.188  1.00 62.88 ? 187  LYS B NZ    1 
ATOM   8441  N  N     . LEU B 1 188 ? 29.708  -21.461 44.669  1.00 42.87 ? 188  LEU B N     1 
ATOM   8442  C  CA    . LEU B 1 188 ? 28.922  -21.974 45.783  1.00 43.16 ? 188  LEU B CA    1 
ATOM   8443  C  C     . LEU B 1 188 ? 29.780  -23.004 46.528  1.00 43.35 ? 188  LEU B C     1 
ATOM   8444  O  O     . LEU B 1 188 ? 29.598  -23.184 47.722  1.00 42.96 ? 188  LEU B O     1 
ATOM   8445  C  CB    . LEU B 1 188 ? 27.573  -22.519 45.365  1.00 41.21 ? 188  LEU B CB    1 
ATOM   8446  C  CG    . LEU B 1 188 ? 26.553  -21.548 44.802  1.00 42.28 ? 188  LEU B CG    1 
ATOM   8447  C  CD1   . LEU B 1 188 ? 25.284  -22.262 44.349  1.00 41.85 ? 188  LEU B CD1   1 
ATOM   8448  C  CD2   . LEU B 1 188 ? 26.093  -20.471 45.779  1.00 44.75 ? 188  LEU B CD2   1 
ATOM   8449  N  N     . LEU B 1 189 ? 30.631  -23.718 45.801  1.00 44.14 ? 189  LEU B N     1 
ATOM   8450  C  CA    . LEU B 1 189 ? 31.456  -24.776 46.321  1.00 45.28 ? 189  LEU B CA    1 
ATOM   8451  C  C     . LEU B 1 189 ? 32.591  -24.157 47.136  1.00 46.83 ? 189  LEU B C     1 
ATOM   8452  O  O     . LEU B 1 189 ? 32.670  -24.415 48.325  1.00 46.92 ? 189  LEU B O     1 
ATOM   8453  C  CB    . LEU B 1 189 ? 32.087  -25.665 45.256  1.00 46.66 ? 189  LEU B CB    1 
ATOM   8454  C  CG    . LEU B 1 189 ? 32.118  -27.169 45.479  1.00 46.06 ? 189  LEU B CG    1 
ATOM   8455  C  CD1   . LEU B 1 189 ? 33.258  -27.848 44.736  1.00 45.90 ? 189  LEU B CD1   1 
ATOM   8456  C  CD2   . LEU B 1 189 ? 32.134  -27.576 46.947  1.00 46.47 ? 189  LEU B CD2   1 
ATOM   8457  N  N     . ASN B 1 190 ? 33.396  -23.327 46.485  1.00 48.27 ? 190  ASN B N     1 
ATOM   8458  C  CA    . ASN B 1 190 ? 34.343  -22.448 47.189  1.00 48.73 ? 190  ASN B CA    1 
ATOM   8459  C  C     . ASN B 1 190 ? 33.730  -21.847 48.460  1.00 48.09 ? 190  ASN B C     1 
ATOM   8460  O  O     . ASN B 1 190 ? 34.427  -21.665 49.439  1.00 48.35 ? 190  ASN B O     1 
ATOM   8461  C  CB    . ASN B 1 190 ? 34.728  -21.209 46.362  1.00 42.76 ? 190  ASN B CB    1 
ATOM   8462  C  CG    . ASN B 1 190 ? 35.617  -21.525 45.184  1.00 46.95 ? 190  ASN B CG    1 
ATOM   8463  O  OD1   . ASN B 1 190 ? 36.273  -22.573 45.166  1.00 47.19 ? 190  ASN B OD1   1 
ATOM   8464  N  ND2   . ASN B 1 190 ? 35.641  -20.621 44.195  1.00 48.60 ? 190  ASN B ND2   1 
ATOM   8465  N  N     . LYS B 1 191 ? 32.505  -21.370 48.389  1.00 48.11 ? 191  LYS B N     1 
ATOM   8466  C  CA    . LYS B 1 191 ? 31.937  -20.710 49.564  1.00 49.56 ? 191  LYS B CA    1 
ATOM   8467  C  C     . LYS B 1 191 ? 31.901  -21.761 50.667  1.00 51.69 ? 191  LYS B C     1 
ATOM   8468  O  O     . LYS B 1 191 ? 32.209  -21.508 51.839  1.00 53.15 ? 191  LYS B O     1 
ATOM   8469  C  CB    . LYS B 1 191 ? 30.559  -20.137 49.251  1.00 48.94 ? 191  LYS B CB    1 
ATOM   8470  C  CG    . LYS B 1 191 ? 30.016  -19.154 50.269  1.00 49.34 ? 191  LYS B CG    1 
ATOM   8471  C  CD    . LYS B 1 191 ? 28.521  -19.287 50.506  1.00 48.23 ? 191  LYS B CD    1 
ATOM   8472  C  CE    . LYS B 1 191 ? 27.730  -19.055 49.241  1.00 49.98 ? 191  LYS B CE    1 
ATOM   8473  N  NZ    . LYS B 1 191 ? 26.277  -18.852 49.491  1.00 52.11 ? 191  LYS B NZ    1 
ATOM   8474  N  N     . ALA B 1 192 ? 31.464  -22.966 50.271  1.00 51.41 ? 192  ALA B N     1 
ATOM   8475  C  CA    . ALA B 1 192 ? 31.277  -24.037 51.242  1.00 51.28 ? 192  ALA B CA    1 
ATOM   8476  C  C     . ALA B 1 192 ? 32.603  -24.482 51.858  1.00 49.93 ? 192  ALA B C     1 
ATOM   8477  O  O     . ALA B 1 192 ? 32.723  -24.701 53.056  1.00 48.00 ? 192  ALA B O     1 
ATOM   8478  C  CB    . ALA B 1 192 ? 30.428  -25.166 50.677  1.00 49.76 ? 192  ALA B CB    1 
ATOM   8479  N  N     . ILE B 1 193 ? 33.610  -24.588 51.025  1.00 50.83 ? 193  ILE B N     1 
ATOM   8480  C  CA    . ILE B 1 193 ? 34.931  -25.026 51.455  1.00 53.23 ? 193  ILE B CA    1 
ATOM   8481  C  C     . ILE B 1 193 ? 35.511  -23.927 52.350  1.00 56.14 ? 193  ILE B C     1 
ATOM   8482  O  O     . ILE B 1 193 ? 35.992  -24.154 53.469  1.00 56.16 ? 193  ILE B O     1 
ATOM   8483  C  CB    . ILE B 1 193 ? 35.817  -25.218 50.217  1.00 49.24 ? 193  ILE B CB    1 
ATOM   8484  C  CG1   . ILE B 1 193 ? 35.501  -26.507 49.467  1.00 48.67 ? 193  ILE B CG1   1 
ATOM   8485  C  CG2   . ILE B 1 193 ? 37.265  -25.093 50.581  1.00 46.39 ? 193  ILE B CG2   1 
ATOM   8486  C  CD1   . ILE B 1 193 ? 36.238  -26.689 48.154  1.00 37.22 ? 193  ILE B CD1   1 
ATOM   8487  N  N     . LYS B 1 194 ? 35.378  -22.686 51.871  1.00 57.98 ? 194  LYS B N     1 
ATOM   8488  C  CA    . LYS B 1 194 ? 35.887  -21.543 52.631  1.00 59.11 ? 194  LYS B CA    1 
ATOM   8489  C  C     . LYS B 1 194 ? 35.235  -21.638 54.012  1.00 60.21 ? 194  LYS B C     1 
ATOM   8490  O  O     . LYS B 1 194 ? 35.906  -21.525 55.027  1.00 60.81 ? 194  LYS B O     1 
ATOM   8491  C  CB    . LYS B 1 194 ? 35.493  -20.216 51.990  1.00 61.38 ? 194  LYS B CB    1 
ATOM   8492  C  CG    . LYS B 1 194 ? 36.501  -19.098 52.031  1.00 63.19 ? 194  LYS B CG    1 
ATOM   8493  C  CD    . LYS B 1 194 ? 36.551  -18.350 53.354  1.00 63.49 ? 194  LYS B CD    1 
ATOM   8494  C  CE    . LYS B 1 194 ? 36.566  -16.841 53.173  1.00 61.33 ? 194  LYS B CE    1 
ATOM   8495  N  NZ    . LYS B 1 194 ? 37.834  -16.353 52.562  1.00 60.01 ? 194  LYS B NZ    1 
ATOM   8496  N  N     . LYS B 1 195 ? 33.931  -21.910 54.005  1.00 61.30 ? 195  LYS B N     1 
ATOM   8497  C  CA    . LYS B 1 195 ? 33.209  -21.965 55.259  1.00 61.97 ? 195  LYS B CA    1 
ATOM   8498  C  C     . LYS B 1 195 ? 33.789  -22.986 56.219  1.00 63.53 ? 195  LYS B C     1 
ATOM   8499  O  O     . LYS B 1 195 ? 33.647  -22.809 57.430  1.00 64.14 ? 195  LYS B O     1 
ATOM   8500  C  CB    . LYS B 1 195 ? 31.713  -22.241 55.145  1.00 59.50 ? 195  LYS B CB    1 
ATOM   8501  C  CG    . LYS B 1 195 ? 31.153  -22.316 56.572  1.00 58.93 ? 195  LYS B CG    1 
ATOM   8502  C  CD    . LYS B 1 195 ? 29.668  -22.040 56.569  1.00 58.98 ? 195  LYS B CD    1 
ATOM   8503  C  CE    . LYS B 1 195 ? 28.950  -22.977 55.607  1.00 54.95 ? 195  LYS B CE    1 
ATOM   8504  N  NZ    . LYS B 1 195 ? 27.611  -23.273 56.172  1.00 59.26 ? 195  LYS B NZ    1 
ATOM   8505  N  N     . ARG B 1 196 ? 34.344  -24.081 55.713  1.00 64.76 ? 196  ARG B N     1 
ATOM   8506  C  CA    . ARG B 1 196 ? 35.008  -25.020 56.626  1.00 65.95 ? 196  ARG B CA    1 
ATOM   8507  C  C     . ARG B 1 196 ? 36.495  -24.799 56.398  1.00 67.93 ? 196  ARG B C     1 
ATOM   8508  O  O     . ARG B 1 196 ? 36.999  -25.081 55.302  1.00 69.99 ? 196  ARG B O     1 
ATOM   8509  C  CB    . ARG B 1 196 ? 34.599  -26.459 56.397  1.00 63.98 ? 196  ARG B CB    1 
ATOM   8510  C  CG    . ARG B 1 196 ? 34.868  -27.027 55.036  1.00 61.16 ? 196  ARG B CG    1 
ATOM   8511  C  CD    . ARG B 1 196 ? 35.378  -28.461 55.073  1.00 63.23 ? 196  ARG B CD    1 
ATOM   8512  N  NE    . ARG B 1 196 ? 34.879  -29.213 56.200  1.00 64.82 ? 196  ARG B NE    1 
ATOM   8513  C  CZ    . ARG B 1 196 ? 33.606  -29.449 56.493  1.00 64.79 ? 196  ARG B CZ    1 
ATOM   8514  N  NH1   . ARG B 1 196 ? 32.665  -28.986 55.660  1.00 66.85 ? 196  ARG B NH1   1 
ATOM   8515  N  NH2   . ARG B 1 196 ? 33.324  -30.125 57.597  1.00 58.74 ? 196  ARG B NH2   1 
ATOM   8516  N  N     . GLY B 1 197 ? 37.178  -24.222 57.365  1.00 68.21 ? 197  GLY B N     1 
ATOM   8517  C  CA    . GLY B 1 197 ? 38.578  -23.866 57.200  1.00 67.72 ? 197  GLY B CA    1 
ATOM   8518  C  C     . GLY B 1 197 ? 39.465  -25.056 56.956  1.00 68.16 ? 197  GLY B C     1 
ATOM   8519  O  O     . GLY B 1 197 ? 40.673  -24.883 56.735  1.00 69.39 ? 197  GLY B O     1 
ATOM   8520  N  N     . ASP B 1 198 ? 38.935  -26.273 56.995  1.00 67.76 ? 198  ASP B N     1 
ATOM   8521  C  CA    . ASP B 1 198 ? 39.796  -27.449 56.982  1.00 67.09 ? 198  ASP B CA    1 
ATOM   8522  C  C     . ASP B 1 198 ? 40.952  -27.470 56.018  1.00 65.61 ? 198  ASP B C     1 
ATOM   8523  O  O     . ASP B 1 198 ? 42.050  -27.928 56.351  1.00 66.49 ? 198  ASP B O     1 
ATOM   8524  C  CB    . ASP B 1 198 ? 38.956  -28.718 56.954  1.00 71.63 ? 198  ASP B CB    1 
ATOM   8525  C  CG    . ASP B 1 198 ? 38.749  -29.217 58.380  1.00 77.25 ? 198  ASP B CG    1 
ATOM   8526  O  OD1   . ASP B 1 198 ? 38.156  -28.479 59.200  1.00 77.61 ? 198  ASP B OD1   1 
ATOM   8527  O  OD2   . ASP B 1 198 ? 39.200  -30.350 58.672  1.00 80.46 ? 198  ASP B OD2   1 
ATOM   8528  N  N     . TYR B 1 199 ? 40.753  -27.112 54.769  1.00 63.88 ? 199  TYR B N     1 
ATOM   8529  C  CA    . TYR B 1 199 ? 41.729  -27.227 53.698  1.00 62.07 ? 199  TYR B CA    1 
ATOM   8530  C  C     . TYR B 1 199 ? 41.436  -26.178 52.625  1.00 62.33 ? 199  TYR B C     1 
ATOM   8531  O  O     . TYR B 1 199 ? 40.465  -25.425 52.776  1.00 62.01 ? 199  TYR B O     1 
ATOM   8532  C  CB    . TYR B 1 199 ? 41.568  -28.611 53.036  1.00 60.76 ? 199  TYR B CB    1 
ATOM   8533  C  CG    . TYR B 1 199 ? 40.199  -28.916 52.471  1.00 58.44 ? 199  TYR B CG    1 
ATOM   8534  C  CD1   . TYR B 1 199 ? 39.147  -29.258 53.302  1.00 57.61 ? 199  TYR B CD1   1 
ATOM   8535  C  CD2   . TYR B 1 199 ? 39.949  -28.846 51.107  1.00 57.67 ? 199  TYR B CD2   1 
ATOM   8536  C  CE1   . TYR B 1 199 ? 37.883  -29.523 52.806  1.00 57.29 ? 199  TYR B CE1   1 
ATOM   8537  C  CE2   . TYR B 1 199 ? 38.694  -29.114 50.598  1.00 57.43 ? 199  TYR B CE2   1 
ATOM   8538  C  CZ    . TYR B 1 199 ? 37.660  -29.451 51.449  1.00 57.00 ? 199  TYR B CZ    1 
ATOM   8539  O  OH    . TYR B 1 199 ? 36.410  -29.723 50.952  1.00 56.65 ? 199  TYR B OH    1 
ATOM   8540  N  N     . ASP B 1 200 ? 42.282  -26.087 51.595  1.00 62.69 ? 200  ASP B N     1 
ATOM   8541  C  CA    . ASP B 1 200 ? 41.874  -25.387 50.415  1.00 62.68 ? 200  ASP B CA    1 
ATOM   8542  C  C     . ASP B 1 200 ? 41.925  -26.337 49.207  1.00 61.77 ? 200  ASP B C     1 
ATOM   8543  O  O     . ASP B 1 200 ? 42.659  -27.322 49.167  1.00 62.09 ? 200  ASP B O     1 
ATOM   8544  C  CB    . ASP B 1 200 ? 42.291  -24.010 49.968  1.00 69.99 ? 200  ASP B CB    1 
ATOM   8545  C  CG    . ASP B 1 200 ? 41.301  -23.573 48.870  1.00 74.16 ? 200  ASP B CG    1 
ATOM   8546  O  OD1   . ASP B 1 200 ? 40.182  -24.146 48.859  1.00 75.81 ? 200  ASP B OD1   1 
ATOM   8547  O  OD2   . ASP B 1 200 ? 41.592  -22.727 48.003  1.00 76.06 ? 200  ASP B OD2   1 
ATOM   8548  N  N     . ALA B 1 201 ? 41.025  -26.004 48.294  1.00 59.81 ? 201  ALA B N     1 
ATOM   8549  C  CA    . ALA B 1 201 ? 40.858  -26.769 47.060  1.00 57.67 ? 201  ALA B CA    1 
ATOM   8550  C  C     . ALA B 1 201 ? 40.877  -25.829 45.859  1.00 55.26 ? 201  ALA B C     1 
ATOM   8551  O  O     . ALA B 1 201 ? 40.185  -24.803 45.841  1.00 54.43 ? 201  ALA B O     1 
ATOM   8552  C  CB    . ALA B 1 201 ? 39.529  -27.502 47.199  1.00 57.16 ? 201  ALA B CB    1 
ATOM   8553  N  N     . ASN B 1 202 ? 41.781  -26.103 44.931  1.00 53.33 ? 202  ASN B N     1 
ATOM   8554  C  CA    . ASN B 1 202 ? 41.809  -25.359 43.673  1.00 52.29 ? 202  ASN B CA    1 
ATOM   8555  C  C     . ASN B 1 202 ? 40.875  -26.030 42.650  1.00 51.42 ? 202  ASN B C     1 
ATOM   8556  O  O     . ASN B 1 202 ? 41.270  -26.917 41.891  1.00 51.57 ? 202  ASN B O     1 
ATOM   8557  C  CB    . ASN B 1 202 ? 43.216  -25.329 43.083  1.00 54.64 ? 202  ASN B CB    1 
ATOM   8558  C  CG    . ASN B 1 202 ? 43.313  -24.401 41.888  1.00 58.62 ? 202  ASN B CG    1 
ATOM   8559  O  OD1   . ASN B 1 202 ? 42.424  -23.584 41.636  1.00 62.40 ? 202  ASN B OD1   1 
ATOM   8560  N  ND2   . ASN B 1 202 ? 44.404  -24.492 41.137  1.00 59.69 ? 202  ASN B ND2   1 
ATOM   8561  N  N     . ILE B 1 203 ? 39.613  -25.616 42.648  1.00 49.42 ? 203  ILE B N     1 
ATOM   8562  C  CA    . ILE B 1 203 ? 38.636  -26.051 41.667  1.00 48.62 ? 203  ILE B CA    1 
ATOM   8563  C  C     . ILE B 1 203 ? 38.915  -25.500 40.287  1.00 47.17 ? 203  ILE B C     1 
ATOM   8564  O  O     . ILE B 1 203 ? 38.550  -24.338 40.096  1.00 48.76 ? 203  ILE B O     1 
ATOM   8565  C  CB    . ILE B 1 203 ? 37.201  -25.642 42.075  1.00 50.31 ? 203  ILE B CB    1 
ATOM   8566  C  CG1   . ILE B 1 203 ? 36.714  -26.619 43.176  1.00 53.15 ? 203  ILE B CG1   1 
ATOM   8567  C  CG2   . ILE B 1 203 ? 36.261  -25.775 40.881  1.00 50.39 ? 203  ILE B CG2   1 
ATOM   8568  C  CD1   . ILE B 1 203 ? 35.631  -25.966 44.030  1.00 51.71 ? 203  ILE B CD1   1 
ATOM   8569  N  N     . VAL B 1 204 ? 39.521  -26.131 39.310  1.00 44.85 ? 204  VAL B N     1 
ATOM   8570  C  CA    . VAL B 1 204 ? 39.826  -25.528 38.038  1.00 41.97 ? 204  VAL B CA    1 
ATOM   8571  C  C     . VAL B 1 204 ? 38.965  -25.901 36.857  1.00 40.49 ? 204  VAL B C     1 
ATOM   8572  O  O     . VAL B 1 204 ? 39.180  -25.338 35.785  1.00 40.74 ? 204  VAL B O     1 
ATOM   8573  C  CB    . VAL B 1 204 ? 41.304  -25.706 37.618  1.00 45.46 ? 204  VAL B CB    1 
ATOM   8574  C  CG1   . VAL B 1 204 ? 42.246  -25.331 38.760  1.00 50.04 ? 204  VAL B CG1   1 
ATOM   8575  C  CG2   . VAL B 1 204 ? 41.649  -27.070 37.095  1.00 42.67 ? 204  VAL B CG2   1 
ATOM   8576  N  N     . ALA B 1 205 ? 37.968  -26.774 36.927  1.00 39.55 ? 205  ALA B N     1 
ATOM   8577  C  CA    . ALA B 1 205 ? 37.217  -27.166 35.736  1.00 38.02 ? 205  ALA B CA    1 
ATOM   8578  C  C     . ALA B 1 205 ? 35.865  -27.708 36.168  1.00 37.59 ? 205  ALA B C     1 
ATOM   8579  O  O     . ALA B 1 205 ? 35.896  -28.522 37.082  1.00 37.93 ? 205  ALA B O     1 
ATOM   8580  C  CB    . ALA B 1 205 ? 37.909  -28.354 35.056  1.00 33.14 ? 205  ALA B CB    1 
ATOM   8581  N  N     . VAL B 1 206 ? 34.839  -27.470 35.398  1.00 37.41 ? 206  VAL B N     1 
ATOM   8582  C  CA    . VAL B 1 206 ? 33.569  -28.165 35.579  1.00 37.51 ? 206  VAL B CA    1 
ATOM   8583  C  C     . VAL B 1 206 ? 33.277  -28.844 34.238  1.00 37.36 ? 206  VAL B C     1 
ATOM   8584  O  O     . VAL B 1 206 ? 33.520  -28.258 33.200  1.00 37.53 ? 206  VAL B O     1 
ATOM   8585  C  CB    . VAL B 1 206 ? 32.416  -27.240 35.933  1.00 37.81 ? 206  VAL B CB    1 
ATOM   8586  C  CG1   . VAL B 1 206 ? 31.189  -28.022 36.367  1.00 37.63 ? 206  VAL B CG1   1 
ATOM   8587  C  CG2   . VAL B 1 206 ? 32.875  -26.409 37.144  1.00 45.86 ? 206  VAL B CG2   1 
ATOM   8588  N  N     . VAL B 1 207 ? 32.728  -30.045 34.306  1.00 36.64 ? 207  VAL B N     1 
ATOM   8589  C  CA    . VAL B 1 207 ? 32.442  -30.828 33.072  1.00 35.01 ? 207  VAL B CA    1 
ATOM   8590  C  C     . VAL B 1 207 ? 31.150  -31.584 33.257  1.00 33.72 ? 207  VAL B C     1 
ATOM   8591  O  O     . VAL B 1 207 ? 30.705  -31.969 34.354  1.00 34.41 ? 207  VAL B O     1 
ATOM   8592  C  CB    . VAL B 1 207 ? 33.745  -31.620 32.905  1.00 39.65 ? 207  VAL B CB    1 
ATOM   8593  C  CG1   . VAL B 1 207 ? 33.801  -33.063 33.326  1.00 34.50 ? 207  VAL B CG1   1 
ATOM   8594  C  CG2   . VAL B 1 207 ? 34.579  -31.321 31.693  1.00 39.00 ? 207  VAL B CG2   1 
ATOM   8595  N  N     . ASN B 1 208 ? 30.331  -31.792 32.251  1.00 31.62 ? 208  ASN B N     1 
ATOM   8596  C  CA    . ASN B 1 208 ? 29.158  -32.647 32.307  1.00 29.92 ? 208  ASN B CA    1 
ATOM   8597  C  C     . ASN B 1 208 ? 29.629  -34.118 32.258  1.00 29.91 ? 208  ASN B C     1 
ATOM   8598  O  O     . ASN B 1 208 ? 30.765  -34.384 31.814  1.00 27.30 ? 208  ASN B O     1 
ATOM   8599  C  CB    . ASN B 1 208 ? 28.301  -32.278 31.106  1.00 30.96 ? 208  ASN B CB    1 
ATOM   8600  C  CG    . ASN B 1 208 ? 26.953  -32.941 31.063  1.00 28.87 ? 208  ASN B CG    1 
ATOM   8601  O  OD1   . ASN B 1 208 ? 26.781  -33.849 30.249  1.00 32.77 ? 208  ASN B OD1   1 
ATOM   8602  N  ND2   . ASN B 1 208 ? 26.052  -32.641 31.960  1.00 27.34 ? 208  ASN B ND2   1 
ATOM   8603  N  N     . ASP B 1 209 ? 28.768  -35.059 32.674  1.00 29.07 ? 209  ASP B N     1 
ATOM   8604  C  CA    . ASP B 1 209 ? 29.124  -36.473 32.653  1.00 29.28 ? 209  ASP B CA    1 
ATOM   8605  C  C     . ASP B 1 209 ? 29.292  -36.976 31.242  1.00 28.45 ? 209  ASP B C     1 
ATOM   8606  O  O     . ASP B 1 209 ? 30.080  -37.900 31.126  1.00 30.91 ? 209  ASP B O     1 
ATOM   8607  C  CB    . ASP B 1 209 ? 28.242  -37.496 33.375  1.00 25.25 ? 209  ASP B CB    1 
ATOM   8608  C  CG    . ASP B 1 209 ? 26.772  -37.291 33.127  1.00 31.72 ? 209  ASP B CG    1 
ATOM   8609  O  OD1   . ASP B 1 209 ? 26.570  -36.326 32.337  1.00 30.67 ? 209  ASP B OD1   1 
ATOM   8610  O  OD2   . ASP B 1 209 ? 25.950  -38.061 33.672  1.00 29.21 ? 209  ASP B OD2   1 
ATOM   8611  N  N     . THR B 1 210 ? 28.634  -36.440 30.251  1.00 28.23 ? 210  THR B N     1 
ATOM   8612  C  CA    . THR B 1 210 ? 28.859  -36.842 28.872  1.00 28.55 ? 210  THR B CA    1 
ATOM   8613  C  C     . THR B 1 210 ? 30.246  -36.553 28.356  1.00 29.75 ? 210  THR B C     1 
ATOM   8614  O  O     . THR B 1 210 ? 30.883  -37.438 27.757  1.00 28.93 ? 210  THR B O     1 
ATOM   8615  C  CB    . THR B 1 210 ? 27.841  -36.184 27.911  1.00 27.84 ? 210  THR B CB    1 
ATOM   8616  O  OG1   . THR B 1 210 ? 27.982  -34.774 28.058  1.00 29.21 ? 210  THR B OG1   1 
ATOM   8617  C  CG2   . THR B 1 210 ? 26.406  -36.560 28.275  1.00 24.17 ? 210  THR B CG2   1 
ATOM   8618  N  N     . VAL B 1 211 ? 30.755  -35.341 28.612  1.00 29.75 ? 211  VAL B N     1 
ATOM   8619  C  CA    . VAL B 1 211 ? 32.107  -34.952 28.190  1.00 29.69 ? 211  VAL B CA    1 
ATOM   8620  C  C     . VAL B 1 211 ? 33.258  -35.745 28.816  1.00 30.08 ? 211  VAL B C     1 
ATOM   8621  O  O     . VAL B 1 211 ? 34.235  -36.214 28.198  1.00 28.87 ? 211  VAL B O     1 
ATOM   8622  C  CB    . VAL B 1 211 ? 32.203  -33.442 28.499  1.00 25.72 ? 211  VAL B CB    1 
ATOM   8623  C  CG1   . VAL B 1 211 ? 33.568  -32.885 28.172  1.00 29.70 ? 211  VAL B CG1   1 
ATOM   8624  C  CG2   . VAL B 1 211 ? 31.137  -32.653 27.760  1.00 24.47 ? 211  VAL B CG2   1 
ATOM   8625  N  N     . GLY B 1 212 ? 33.199  -35.984 30.124  1.00 31.40 ? 212  GLY B N     1 
ATOM   8626  C  CA    . GLY B 1 212 ? 34.159  -36.845 30.829  1.00 33.54 ? 212  GLY B CA    1 
ATOM   8627  C  C     . GLY B 1 212 ? 34.118  -38.291 30.300  1.00 33.04 ? 212  GLY B C     1 
ATOM   8628  O  O     . GLY B 1 212 ? 35.140  -38.860 29.905  1.00 32.16 ? 212  GLY B O     1 
ATOM   8629  N  N     . THR B 1 213 ? 32.896  -38.803 30.079  1.00 32.56 ? 213  THR B N     1 
ATOM   8630  C  CA    . THR B 1 213 ? 32.751  -40.083 29.430  1.00 31.90 ? 213  THR B CA    1 
ATOM   8631  C  C     . THR B 1 213 ? 33.508  -40.118 28.114  1.00 33.08 ? 213  THR B C     1 
ATOM   8632  O  O     . THR B 1 213 ? 34.253  -41.061 27.776  1.00 33.53 ? 213  THR B O     1 
ATOM   8633  C  CB    . THR B 1 213 ? 31.263  -40.433 29.260  1.00 29.06 ? 213  THR B CB    1 
ATOM   8634  O  OG1   . THR B 1 213 ? 30.742  -40.572 30.575  1.00 30.96 ? 213  THR B OG1   1 
ATOM   8635  C  CG2   . THR B 1 213 ? 31.085  -41.743 28.496  1.00 25.07 ? 213  THR B CG2   1 
ATOM   8636  N  N     . MET B 1 214 ? 33.236  -39.094 27.293  1.00 32.63 ? 214  MET B N     1 
ATOM   8637  C  CA    . MET B 1 214 ? 33.876  -39.031 25.982  1.00 32.90 ? 214  MET B CA    1 
ATOM   8638  C  C     . MET B 1 214 ? 35.378  -38.928 26.232  1.00 34.36 ? 214  MET B C     1 
ATOM   8639  O  O     . MET B 1 214 ? 36.148  -39.398 25.410  1.00 34.86 ? 214  MET B O     1 
ATOM   8640  C  CB    . MET B 1 214 ? 33.403  -37.805 25.174  1.00 27.40 ? 214  MET B CB    1 
ATOM   8641  C  CG    . MET B 1 214 ? 34.065  -37.636 23.813  1.00 26.62 ? 214  MET B CG    1 
ATOM   8642  S  SD    . MET B 1 214 ? 33.694  -36.066 22.981  1.00 33.70 ? 214  MET B SD    1 
ATOM   8643  C  CE    . MET B 1 214 ? 34.811  -35.033 24.021  1.00 27.95 ? 214  MET B CE    1 
ATOM   8644  N  N     . MET B 1 215 ? 35.767  -38.149 27.252  1.00 35.94 ? 215  MET B N     1 
ATOM   8645  C  CA    . MET B 1 215 ? 37.227  -37.927 27.425  1.00 36.81 ? 215  MET B CA    1 
ATOM   8646  C  C     . MET B 1 215 ? 37.871  -39.209 27.924  1.00 38.13 ? 215  MET B C     1 
ATOM   8647  O  O     . MET B 1 215 ? 38.994  -39.563 27.524  1.00 39.05 ? 215  MET B O     1 
ATOM   8648  C  CB    . MET B 1 215 ? 37.497  -36.657 28.209  1.00 36.17 ? 215  MET B CB    1 
ATOM   8649  C  CG    . MET B 1 215 ? 36.929  -35.337 27.604  1.00 30.96 ? 215  MET B CG    1 
ATOM   8650  S  SD    . MET B 1 215 ? 38.091  -34.756 26.316  1.00 30.65 ? 215  MET B SD    1 
ATOM   8651  C  CE    . MET B 1 215 ? 37.882  -36.145 25.221  1.00 38.46 ? 215  MET B CE    1 
ATOM   8652  N  N     . THR B 1 216 ? 37.144  -39.995 28.728  1.00 37.38 ? 216  THR B N     1 
ATOM   8653  C  CA    . THR B 1 216 ? 37.647  -41.251 29.232  1.00 37.24 ? 216  THR B CA    1 
ATOM   8654  C  C     . THR B 1 216 ? 37.828  -42.208 28.058  1.00 39.00 ? 216  THR B C     1 
ATOM   8655  O  O     . THR B 1 216 ? 38.904  -42.745 27.835  1.00 39.41 ? 216  THR B O     1 
ATOM   8656  C  CB    . THR B 1 216 ? 36.674  -41.940 30.205  1.00 37.09 ? 216  THR B CB    1 
ATOM   8657  O  OG1   . THR B 1 216 ? 36.505  -41.106 31.343  1.00 33.55 ? 216  THR B OG1   1 
ATOM   8658  C  CG2   . THR B 1 216 ? 37.161  -43.306 30.636  1.00 26.65 ? 216  THR B CG2   1 
ATOM   8659  N  N     . CYS B 1 217 ? 36.743  -42.371 27.313  1.00 40.10 ? 217  CYS B N     1 
ATOM   8660  C  CA    . CYS B 1 217 ? 36.833  -43.263 26.147  1.00 40.59 ? 217  CYS B CA    1 
ATOM   8661  C  C     . CYS B 1 217 ? 37.849  -42.742 25.157  1.00 40.52 ? 217  CYS B C     1 
ATOM   8662  O  O     . CYS B 1 217 ? 38.514  -43.510 24.433  1.00 40.73 ? 217  CYS B O     1 
ATOM   8663  C  CB    . CYS B 1 217 ? 35.438  -43.674 25.682  1.00 37.16 ? 217  CYS B CB    1 
ATOM   8664  S  SG    . CYS B 1 217 ? 34.401  -44.560 26.944  1.00 40.53 ? 217  CYS B SG    1 
ATOM   8665  N  N     . GLY B 1 218 ? 38.120  -41.435 25.092  1.00 41.12 ? 218  GLY B N     1 
ATOM   8666  C  CA    . GLY B 1 218 ? 38.959  -40.851 24.037  1.00 40.46 ? 218  GLY B CA    1 
ATOM   8667  C  C     . GLY B 1 218 ? 40.442  -40.953 24.364  1.00 42.92 ? 218  GLY B C     1 
ATOM   8668  O  O     . GLY B 1 218 ? 41.327  -40.932 23.490  1.00 41.23 ? 218  GLY B O     1 
ATOM   8669  N  N     . TYR B 1 219 ? 40.717  -41.202 25.644  1.00 44.38 ? 219  TYR B N     1 
ATOM   8670  C  CA    . TYR B 1 219 ? 42.088  -41.443 26.078  1.00 46.58 ? 219  TYR B CA    1 
ATOM   8671  C  C     . TYR B 1 219 ? 42.583  -42.714 25.390  1.00 47.16 ? 219  TYR B C     1 
ATOM   8672  O  O     . TYR B 1 219 ? 43.764  -42.847 25.089  1.00 46.89 ? 219  TYR B O     1 
ATOM   8673  C  CB    . TYR B 1 219 ? 42.106  -41.639 27.598  1.00 49.61 ? 219  TYR B CB    1 
ATOM   8674  C  CG    . TYR B 1 219 ? 43.487  -41.737 28.197  1.00 53.58 ? 219  TYR B CG    1 
ATOM   8675  C  CD1   . TYR B 1 219 ? 44.195  -42.913 28.340  1.00 55.48 ? 219  TYR B CD1   1 
ATOM   8676  C  CD2   . TYR B 1 219 ? 44.098  -40.566 28.642  1.00 56.15 ? 219  TYR B CD2   1 
ATOM   8677  C  CE1   . TYR B 1 219 ? 45.471  -42.923 28.899  1.00 56.77 ? 219  TYR B CE1   1 
ATOM   8678  C  CE2   . TYR B 1 219 ? 45.357  -40.543 29.194  1.00 57.11 ? 219  TYR B CE2   1 
ATOM   8679  C  CZ    . TYR B 1 219 ? 46.037  -41.742 29.324  1.00 58.09 ? 219  TYR B CZ    1 
ATOM   8680  O  OH    . TYR B 1 219 ? 47.306  -41.694 29.874  1.00 59.26 ? 219  TYR B OH    1 
ATOM   8681  N  N     . ASP B 1 220 ? 41.654  -43.643 25.133  1.00 48.28 ? 220  ASP B N     1 
ATOM   8682  C  CA    . ASP B 1 220 ? 42.033  -44.924 24.553  1.00 49.46 ? 220  ASP B CA    1 
ATOM   8683  C  C     . ASP B 1 220 ? 41.677  -45.041 23.075  1.00 49.58 ? 220  ASP B C     1 
ATOM   8684  O  O     . ASP B 1 220 ? 42.140  -46.043 22.492  1.00 49.58 ? 220  ASP B O     1 
ATOM   8685  C  CB    . ASP B 1 220 ? 41.331  -46.115 25.250  1.00 50.29 ? 220  ASP B CB    1 
ATOM   8686  C  CG    . ASP B 1 220 ? 41.853  -46.282 26.663  1.00 53.92 ? 220  ASP B CG    1 
ATOM   8687  O  OD1   . ASP B 1 220 ? 43.042  -45.940 26.871  1.00 56.41 ? 220  ASP B OD1   1 
ATOM   8688  O  OD2   . ASP B 1 220 ? 41.111  -46.716 27.568  1.00 57.71 ? 220  ASP B OD2   1 
ATOM   8689  N  N     . ASP B 1 221 ? 40.729  -44.245 22.596  1.00 47.80 ? 221  ASP B N     1 
ATOM   8690  C  CA    . ASP B 1 221 ? 40.313  -44.400 21.200  1.00 47.95 ? 221  ASP B CA    1 
ATOM   8691  C  C     . ASP B 1 221 ? 40.221  -43.033 20.508  1.00 48.10 ? 221  ASP B C     1 
ATOM   8692  O  O     . ASP B 1 221 ? 39.312  -42.242 20.761  1.00 47.38 ? 221  ASP B O     1 
ATOM   8693  C  CB    . ASP B 1 221 ? 39.010  -45.152 21.047  1.00 47.73 ? 221  ASP B CB    1 
ATOM   8694  C  CG    . ASP B 1 221 ? 38.529  -45.380 19.638  1.00 47.16 ? 221  ASP B CG    1 
ATOM   8695  O  OD1   . ASP B 1 221 ? 39.022  -44.731 18.698  1.00 46.87 ? 221  ASP B OD1   1 
ATOM   8696  O  OD2   . ASP B 1 221 ? 37.613  -46.219 19.480  1.00 47.82 ? 221  ASP B OD2   1 
ATOM   8697  N  N     . GLN B 1 222 ? 41.225  -42.792 19.674  1.00 46.45 ? 222  GLN B N     1 
ATOM   8698  C  CA    . GLN B 1 222 ? 41.346  -41.556 18.968  1.00 45.88 ? 222  GLN B CA    1 
ATOM   8699  C  C     . GLN B 1 222 ? 40.200  -41.219 18.053  1.00 44.95 ? 222  GLN B C     1 
ATOM   8700  O  O     . GLN B 1 222 ? 40.217  -40.102 17.498  1.00 45.66 ? 222  GLN B O     1 
ATOM   8701  C  CB    . GLN B 1 222 ? 42.730  -41.370 18.347  1.00 45.91 ? 222  GLN B CB    1 
ATOM   8702  C  CG    . GLN B 1 222 ? 43.823  -41.250 19.387  1.00 51.74 ? 222  GLN B CG    1 
ATOM   8703  C  CD    . GLN B 1 222 ? 43.737  -40.121 20.386  1.00 57.66 ? 222  GLN B CD    1 
ATOM   8704  O  OE1   . GLN B 1 222 ? 43.982  -38.931 20.102  1.00 59.59 ? 222  GLN B OE1   1 
ATOM   8705  N  NE2   . GLN B 1 222 ? 43.507  -40.432 21.668  1.00 56.18 ? 222  GLN B NE2   1 
ATOM   8706  N  N     . HIS B 1 223 ? 39.212  -42.071 17.781  1.00 43.19 ? 223  HIS B N     1 
ATOM   8707  C  CA    . HIS B 1 223 ? 38.104  -41.560 17.002  1.00 41.39 ? 223  HIS B CA    1 
ATOM   8708  C  C     . HIS B 1 223 ? 36.872  -41.386 17.883  1.00 38.80 ? 223  HIS B C     1 
ATOM   8709  O  O     . HIS B 1 223 ? 35.781  -41.254 17.299  1.00 38.03 ? 223  HIS B O     1 
ATOM   8710  C  CB    . HIS B 1 223 ? 37.689  -42.176 15.697  1.00 50.85 ? 223  HIS B CB    1 
ATOM   8711  C  CG    . HIS B 1 223 ? 38.750  -42.898 14.943  1.00 55.52 ? 223  HIS B CG    1 
ATOM   8712  N  ND1   . HIS B 1 223 ? 38.455  -43.902 14.039  1.00 57.71 ? 223  HIS B ND1   1 
ATOM   8713  C  CD2   . HIS B 1 223 ? 40.093  -42.797 14.985  1.00 57.32 ? 223  HIS B CD2   1 
ATOM   8714  C  CE1   . HIS B 1 223 ? 39.562  -44.413 13.565  1.00 56.31 ? 223  HIS B CE1   1 
ATOM   8715  N  NE2   . HIS B 1 223 ? 40.567  -43.768 14.133  1.00 60.95 ? 223  HIS B NE2   1 
ATOM   8716  N  N     . CYS B 1 224 ? 37.080  -41.336 19.196  1.00 35.28 ? 224  CYS B N     1 
ATOM   8717  C  CA    . CYS B 1 224 ? 35.908  -41.067 20.021  1.00 34.26 ? 224  CYS B CA    1 
ATOM   8718  C  C     . CYS B 1 224 ? 35.472  -39.605 19.864  1.00 32.83 ? 224  CYS B C     1 
ATOM   8719  O  O     . CYS B 1 224 ? 36.222  -38.729 20.246  1.00 31.85 ? 224  CYS B O     1 
ATOM   8720  C  CB    . CYS B 1 224 ? 36.185  -41.380 21.488  1.00 28.71 ? 224  CYS B CB    1 
ATOM   8721  S  SG    . CYS B 1 224 ? 34.629  -41.220 22.391  1.00 31.13 ? 224  CYS B SG    1 
ATOM   8722  N  N     . GLU B 1 225 ? 34.276  -39.305 19.416  1.00 32.56 ? 225  GLU B N     1 
ATOM   8723  C  CA    . GLU B 1 225 ? 33.875  -37.903 19.268  1.00 32.77 ? 225  GLU B CA    1 
ATOM   8724  C  C     . GLU B 1 225 ? 32.495  -37.641 19.912  1.00 30.93 ? 225  GLU B C     1 
ATOM   8725  O  O     . GLU B 1 225 ? 31.971  -36.572 19.707  1.00 28.13 ? 225  GLU B O     1 
ATOM   8726  C  CB    . GLU B 1 225 ? 33.767  -37.495 17.804  1.00 38.27 ? 225  GLU B CB    1 
ATOM   8727  C  CG    . GLU B 1 225 ? 35.018  -37.744 16.954  1.00 44.42 ? 225  GLU B CG    1 
ATOM   8728  C  CD    . GLU B 1 225 ? 34.598  -37.770 15.484  1.00 48.02 ? 225  GLU B CD    1 
ATOM   8729  O  OE1   . GLU B 1 225 ? 33.870  -38.721 15.105  1.00 47.04 ? 225  GLU B OE1   1 
ATOM   8730  O  OE2   . GLU B 1 225 ? 34.927  -36.794 14.772  1.00 49.62 ? 225  GLU B OE2   1 
ATOM   8731  N  N     . VAL B 1 226 ? 31.939  -38.689 20.524  1.00 31.49 ? 226  VAL B N     1 
ATOM   8732  C  CA    . VAL B 1 226 ? 30.658  -38.617 21.170  1.00 31.18 ? 226  VAL B CA    1 
ATOM   8733  C  C     . VAL B 1 226 ? 30.778  -39.185 22.581  1.00 31.98 ? 226  VAL B C     1 
ATOM   8734  O  O     . VAL B 1 226 ? 31.559  -40.110 22.788  1.00 32.60 ? 226  VAL B O     1 
ATOM   8735  C  CB    . VAL B 1 226 ? 29.566  -39.419 20.435  1.00 31.57 ? 226  VAL B CB    1 
ATOM   8736  C  CG1   . VAL B 1 226 ? 28.271  -39.351 21.229  1.00 31.13 ? 226  VAL B CG1   1 
ATOM   8737  C  CG2   . VAL B 1 226 ? 29.316  -38.940 19.023  1.00 32.77 ? 226  VAL B CG2   1 
ATOM   8738  N  N     . GLY B 1 227 ? 30.036  -38.649 23.538  1.00 30.99 ? 227  GLY B N     1 
ATOM   8739  C  CA    . GLY B 1 227 ? 29.958  -39.182 24.894  1.00 30.19 ? 227  GLY B CA    1 
ATOM   8740  C  C     . GLY B 1 227 ? 28.459  -39.320 25.185  1.00 30.56 ? 227  GLY B C     1 
ATOM   8741  O  O     . GLY B 1 227 ? 27.685  -38.440 24.781  1.00 30.28 ? 227  GLY B O     1 
ATOM   8742  N  N     . LEU B 1 228 ? 28.013  -40.454 25.708  1.00 30.73 ? 228  LEU B N     1 
ATOM   8743  C  CA    . LEU B 1 228 ? 26.565  -40.722 25.718  1.00 29.51 ? 228  LEU B CA    1 
ATOM   8744  C  C     . LEU B 1 228 ? 26.241  -41.267 27.096  1.00 30.05 ? 228  LEU B C     1 
ATOM   8745  O  O     . LEU B 1 228 ? 26.973  -42.177 27.478  1.00 31.26 ? 228  LEU B O     1 
ATOM   8746  C  CB    . LEU B 1 228 ? 26.306  -41.850 24.695  1.00 28.54 ? 228  LEU B CB    1 
ATOM   8747  C  CG    . LEU B 1 228 ? 24.935  -42.512 24.696  1.00 30.04 ? 228  LEU B CG    1 
ATOM   8748  C  CD1   . LEU B 1 228 ? 23.821  -41.528 24.419  1.00 25.24 ? 228  LEU B CD1   1 
ATOM   8749  C  CD2   . LEU B 1 228 ? 24.821  -43.704 23.746  1.00 29.97 ? 228  LEU B CD2   1 
ATOM   8750  N  N     . ILE B 1 229 ? 25.212  -40.764 27.769  1.00 29.47 ? 229  ILE B N     1 
ATOM   8751  C  CA    . ILE B 1 229 ? 24.887  -41.326 29.077  1.00 29.26 ? 229  ILE B CA    1 
ATOM   8752  C  C     . ILE B 1 229 ? 23.452  -41.883 28.979  1.00 30.04 ? 229  ILE B C     1 
ATOM   8753  O  O     . ILE B 1 229 ? 22.509  -41.223 28.534  1.00 28.61 ? 229  ILE B O     1 
ATOM   8754  C  CB    . ILE B 1 229 ? 25.000  -40.317 30.237  1.00 30.82 ? 229  ILE B CB    1 
ATOM   8755  C  CG1   . ILE B 1 229 ? 26.353  -39.736 30.602  1.00 26.00 ? 229  ILE B CG1   1 
ATOM   8756  C  CG2   . ILE B 1 229 ? 24.337  -40.893 31.492  1.00 26.42 ? 229  ILE B CG2   1 
ATOM   8757  C  CD1   . ILE B 1 229 ? 27.549  -40.564 30.925  1.00 26.87 ? 229  ILE B CD1   1 
ATOM   8758  N  N     . ILE B 1 230 ? 23.268  -43.163 29.337  1.00 30.45 ? 230  ILE B N     1 
ATOM   8759  C  CA    . ILE B 1 230 ? 21.961  -43.769 29.415  1.00 30.14 ? 230  ILE B CA    1 
ATOM   8760  C  C     . ILE B 1 230 ? 21.828  -44.465 30.769  1.00 30.33 ? 230  ILE B C     1 
ATOM   8761  O  O     . ILE B 1 230 ? 21.840  -45.663 30.960  1.00 30.18 ? 230  ILE B O     1 
ATOM   8762  C  CB    . ILE B 1 230 ? 21.509  -44.647 28.255  1.00 27.02 ? 230  ILE B CB    1 
ATOM   8763  C  CG1   . ILE B 1 230 ? 21.222  -43.939 26.924  1.00 28.26 ? 230  ILE B CG1   1 
ATOM   8764  C  CG2   . ILE B 1 230 ? 20.174  -45.255 28.589  1.00 26.70 ? 230  ILE B CG2   1 
ATOM   8765  C  CD1   . ILE B 1 230 ? 21.549  -44.902 25.772  1.00 23.47 ? 230  ILE B CD1   1 
ATOM   8766  N  N     . GLY B 1 231 ? 21.623  -43.655 31.805  1.00 30.75 ? 231  GLY B N     1 
ATOM   8767  C  CA    . GLY B 1 231 ? 21.611  -44.060 33.210  1.00 27.91 ? 231  GLY B CA    1 
ATOM   8768  C  C     . GLY B 1 231 ? 20.465  -43.480 33.983  1.00 27.47 ? 231  GLY B C     1 
ATOM   8769  O  O     . GLY B 1 231 ? 19.312  -43.601 33.585  1.00 28.95 ? 231  GLY B O     1 
ATOM   8770  N  N     . THR B 1 232 ? 20.677  -42.816 35.091  1.00 28.86 ? 232  THR B N     1 
ATOM   8771  C  CA    . THR B 1 232 ? 19.625  -42.105 35.814  1.00 28.49 ? 232  THR B CA    1 
ATOM   8772  C  C     . THR B 1 232 ? 18.969  -41.061 34.902  1.00 28.10 ? 232  THR B C     1 
ATOM   8773  O  O     . THR B 1 232 ? 17.761  -41.037 34.807  1.00 27.31 ? 232  THR B O     1 
ATOM   8774  C  CB    . THR B 1 232 ? 20.102  -41.318 37.035  1.00 32.16 ? 232  THR B CB    1 
ATOM   8775  O  OG1   . THR B 1 232 ? 20.860  -42.168 37.866  1.00 35.17 ? 232  THR B OG1   1 
ATOM   8776  C  CG2   . THR B 1 232 ? 18.914  -40.681 37.767  1.00 29.36 ? 232  THR B CG2   1 
ATOM   8777  N  N     . GLY B 1 233 ? 19.749  -40.256 34.217  1.00 28.32 ? 233  GLY B N     1 
ATOM   8778  C  CA    . GLY B 1 233 ? 19.217  -39.332 33.223  1.00 27.61 ? 233  GLY B CA    1 
ATOM   8779  C  C     . GLY B 1 233 ? 19.747  -39.761 31.857  1.00 28.60 ? 233  GLY B C     1 
ATOM   8780  O  O     . GLY B 1 233 ? 20.640  -40.596 31.742  1.00 28.80 ? 233  GLY B O     1 
ATOM   8781  N  N     . THR B 1 234 ? 19.436  -39.018 30.796  1.00 30.22 ? 234  THR B N     1 
ATOM   8782  C  CA    . THR B 1 234 ? 20.055  -39.313 29.501  1.00 30.55 ? 234  THR B CA    1 
ATOM   8783  C  C     . THR B 1 234 ? 20.667  -38.081 28.903  1.00 31.45 ? 234  THR B C     1 
ATOM   8784  O  O     . THR B 1 234 ? 19.949  -37.059 28.885  1.00 34.95 ? 234  THR B O     1 
ATOM   8785  C  CB    . THR B 1 234 ? 19.083  -40.050 28.572  1.00 33.64 ? 234  THR B CB    1 
ATOM   8786  O  OG1   . THR B 1 234 ? 19.762  -40.426 27.366  1.00 26.28 ? 234  THR B OG1   1 
ATOM   8787  C  CG2   . THR B 1 234 ? 17.814  -39.310 28.200  1.00 22.76 ? 234  THR B CG2   1 
ATOM   8788  N  N     . ASN B 1 235 ? 21.791  -38.141 28.229  1.00 30.08 ? 235  ASN B N     1 
ATOM   8789  C  CA    . ASN B 1 235 ? 22.250  -36.970 27.477  1.00 31.25 ? 235  ASN B CA    1 
ATOM   8790  C  C     . ASN B 1 235 ? 23.329  -37.439 26.495  1.00 31.63 ? 235  ASN B C     1 
ATOM   8791  O  O     . ASN B 1 235 ? 23.812  -38.554 26.661  1.00 33.28 ? 235  ASN B O     1 
ATOM   8792  C  CB    . ASN B 1 235 ? 22.843  -35.969 28.473  1.00 36.08 ? 235  ASN B CB    1 
ATOM   8793  C  CG    . ASN B 1 235 ? 23.205  -34.589 27.987  1.00 30.28 ? 235  ASN B CG    1 
ATOM   8794  O  OD1   . ASN B 1 235 ? 23.887  -33.782 28.652  1.00 28.44 ? 235  ASN B OD1   1 
ATOM   8795  N  ND2   . ASN B 1 235 ? 22.681  -34.295 26.805  1.00 31.19 ? 235  ASN B ND2   1 
ATOM   8796  N  N     . ALA B 1 236 ? 23.860  -36.562 25.662  1.00 30.98 ? 236  ALA B N     1 
ATOM   8797  C  CA    . ALA B 1 236 ? 24.980  -36.845 24.798  1.00 30.26 ? 236  ALA B CA    1 
ATOM   8798  C  C     . ALA B 1 236 ? 25.763  -35.568 24.517  1.00 28.80 ? 236  ALA B C     1 
ATOM   8799  O  O     . ALA B 1 236 ? 25.132  -34.502 24.434  1.00 29.93 ? 236  ALA B O     1 
ATOM   8800  C  CB    . ALA B 1 236 ? 24.564  -37.476 23.462  1.00 28.88 ? 236  ALA B CB    1 
ATOM   8801  N  N     . CYS B 1 237 ? 27.047  -35.714 24.207  1.00 27.38 ? 237  CYS B N     1 
ATOM   8802  C  CA    . CYS B 1 237 ? 27.836  -34.516 23.821  1.00 28.51 ? 237  CYS B CA    1 
ATOM   8803  C  C     . CYS B 1 237 ? 28.645  -34.875 22.574  1.00 29.13 ? 237  CYS B C     1 
ATOM   8804  O  O     . CYS B 1 237 ? 28.635  -36.086 22.233  1.00 30.08 ? 237  CYS B O     1 
ATOM   8805  C  CB    . CYS B 1 237 ? 28.697  -34.062 25.009  1.00 28.27 ? 237  CYS B CB    1 
ATOM   8806  S  SG    . CYS B 1 237 ? 30.085  -35.263 25.270  1.00 31.78 ? 237  CYS B SG    1 
ATOM   8807  N  N     . TYR B 1 238 ? 29.105  -33.965 21.735  1.00 28.51 ? 238  TYR B N     1 
ATOM   8808  C  CA    . TYR B 1 238 ? 29.763  -34.354 20.488  1.00 30.41 ? 238  TYR B CA    1 
ATOM   8809  C  C     . TYR B 1 238 ? 30.705  -33.239 20.051  1.00 32.23 ? 238  TYR B C     1 
ATOM   8810  O  O     . TYR B 1 238 ? 30.550  -32.131 20.561  1.00 34.19 ? 238  TYR B O     1 
ATOM   8811  C  CB    . TYR B 1 238 ? 28.834  -34.744 19.319  1.00 28.11 ? 238  TYR B CB    1 
ATOM   8812  C  CG    . TYR B 1 238 ? 28.098  -33.565 18.736  1.00 27.06 ? 238  TYR B CG    1 
ATOM   8813  C  CD1   . TYR B 1 238 ? 26.928  -33.056 19.305  1.00 28.64 ? 238  TYR B CD1   1 
ATOM   8814  C  CD2   . TYR B 1 238 ? 28.563  -32.929 17.610  1.00 25.87 ? 238  TYR B CD2   1 
ATOM   8815  C  CE1   . TYR B 1 238 ? 26.365  -31.874 18.831  1.00 29.07 ? 238  TYR B CE1   1 
ATOM   8816  C  CE2   . TYR B 1 238 ? 27.970  -31.841 17.053  1.00 25.16 ? 238  TYR B CE2   1 
ATOM   8817  C  CZ    . TYR B 1 238 ? 26.869  -31.309 17.678  1.00 28.43 ? 238  TYR B CZ    1 
ATOM   8818  O  OH    . TYR B 1 238 ? 26.279  -30.163 17.120  1.00 29.88 ? 238  TYR B OH    1 
ATOM   8819  N  N     . MET B 1 239 ? 31.750  -33.565 19.312  1.00 32.54 ? 239  MET B N     1 
ATOM   8820  C  CA    . MET B 1 239 ? 32.679  -32.563 18.842  1.00 33.77 ? 239  MET B CA    1 
ATOM   8821  C  C     . MET B 1 239 ? 32.074  -31.767 17.686  1.00 35.50 ? 239  MET B C     1 
ATOM   8822  O  O     . MET B 1 239 ? 32.015  -32.292 16.574  1.00 36.43 ? 239  MET B O     1 
ATOM   8823  C  CB    . MET B 1 239 ? 33.989  -33.186 18.388  1.00 31.20 ? 239  MET B CB    1 
ATOM   8824  C  CG    . MET B 1 239 ? 34.838  -33.867 19.465  1.00 31.36 ? 239  MET B CG    1 
ATOM   8825  S  SD    . MET B 1 239 ? 34.999  -32.847 20.991  1.00 36.08 ? 239  MET B SD    1 
ATOM   8826  C  CE    . MET B 1 239 ? 36.020  -31.600 20.210  1.00 29.67 ? 239  MET B CE    1 
ATOM   8827  N  N     . GLU B 1 240 ? 31.834  -30.473 17.859  1.00 35.76 ? 240  GLU B N     1 
ATOM   8828  C  CA    . GLU B 1 240 ? 31.256  -29.647 16.801  1.00 36.51 ? 240  GLU B CA    1 
ATOM   8829  C  C     . GLU B 1 240 ? 32.250  -28.613 16.267  1.00 37.97 ? 240  GLU B C     1 
ATOM   8830  O  O     . GLU B 1 240 ? 33.277  -28.379 16.920  1.00 38.93 ? 240  GLU B O     1 
ATOM   8831  C  CB    . GLU B 1 240 ? 29.981  -28.942 17.292  1.00 27.67 ? 240  GLU B CB    1 
ATOM   8832  C  CG    . GLU B 1 240 ? 29.483  -27.946 16.249  1.00 33.83 ? 240  GLU B CG    1 
ATOM   8833  C  CD    . GLU B 1 240 ? 28.816  -28.620 15.069  1.00 30.74 ? 240  GLU B CD    1 
ATOM   8834  O  OE1   . GLU B 1 240 ? 27.699  -29.151 15.271  1.00 32.70 ? 240  GLU B OE1   1 
ATOM   8835  O  OE2   . GLU B 1 240 ? 29.430  -28.635 13.993  1.00 33.69 ? 240  GLU B OE2   1 
ATOM   8836  N  N     . GLU B 1 241 ? 32.091  -28.202 15.005  1.00 38.67 ? 241  GLU B N     1 
ATOM   8837  C  CA    . GLU B 1 241 ? 32.968  -27.172 14.455  1.00 39.21 ? 241  GLU B CA    1 
ATOM   8838  C  C     . GLU B 1 241 ? 32.791  -25.813 15.130  1.00 39.03 ? 241  GLU B C     1 
ATOM   8839  O  O     . GLU B 1 241 ? 31.654  -25.312 15.170  1.00 39.51 ? 241  GLU B O     1 
ATOM   8840  C  CB    . GLU B 1 241 ? 32.752  -26.940 12.970  1.00 38.52 ? 241  GLU B CB    1 
ATOM   8841  C  CG    . GLU B 1 241 ? 33.066  -28.071 12.030  1.00 41.34 ? 241  GLU B CG    1 
ATOM   8842  C  CD    . GLU B 1 241 ? 34.160  -28.987 12.476  1.00 42.54 ? 241  GLU B CD    1 
ATOM   8843  O  OE1   . GLU B 1 241 ? 35.355  -28.749 12.241  1.00 48.17 ? 241  GLU B OE1   1 
ATOM   8844  O  OE2   . GLU B 1 241 ? 33.819  -30.045 13.071  1.00 54.60 ? 241  GLU B OE2   1 
ATOM   8845  N  N     . LEU B 1 242 ? 33.898  -25.152 15.486  1.00 38.45 ? 242  LEU B N     1 
ATOM   8846  C  CA    . LEU B 1 242 ? 33.769  -23.810 16.060  1.00 38.37 ? 242  LEU B CA    1 
ATOM   8847  C  C     . LEU B 1 242 ? 32.949  -22.907 15.137  1.00 38.47 ? 242  LEU B C     1 
ATOM   8848  O  O     . LEU B 1 242 ? 32.188  -22.082 15.644  1.00 39.23 ? 242  LEU B O     1 
ATOM   8849  C  CB    . LEU B 1 242 ? 35.124  -23.113 16.238  1.00 41.76 ? 242  LEU B CB    1 
ATOM   8850  C  CG    . LEU B 1 242 ? 35.624  -22.794 17.641  1.00 40.00 ? 242  LEU B CG    1 
ATOM   8851  C  CD1   . LEU B 1 242 ? 34.695  -21.855 18.402  1.00 39.50 ? 242  LEU B CD1   1 
ATOM   8852  C  CD2   . LEU B 1 242 ? 35.741  -24.103 18.412  1.00 42.77 ? 242  LEU B CD2   1 
ATOM   8853  N  N     . ARG B 1 243 ? 33.118  -22.954 13.829  1.00 38.19 ? 243  ARG B N     1 
ATOM   8854  C  CA    . ARG B 1 243 ? 32.375  -22.046 12.963  1.00 39.50 ? 243  ARG B CA    1 
ATOM   8855  C  C     . ARG B 1 243 ? 30.881  -22.337 12.849  1.00 40.89 ? 243  ARG B C     1 
ATOM   8856  O  O     . ARG B 1 243 ? 30.166  -21.606 12.145  1.00 41.21 ? 243  ARG B O     1 
ATOM   8857  C  CB    . ARG B 1 243 ? 32.966  -22.068 11.558  1.00 42.25 ? 243  ARG B CB    1 
ATOM   8858  C  CG    . ARG B 1 243 ? 32.558  -23.252 10.707  1.00 45.30 ? 243  ARG B CG    1 
ATOM   8859  C  CD    . ARG B 1 243 ? 33.655  -23.400 9.623   1.00 44.03 ? 243  ARG B CD    1 
ATOM   8860  N  NE    . ARG B 1 243 ? 33.852  -24.824 9.406   1.00 56.33 ? 243  ARG B NE    1 
ATOM   8861  C  CZ    . ARG B 1 243 ? 32.970  -25.647 8.860   1.00 53.14 ? 243  ARG B CZ    1 
ATOM   8862  N  NH1   . ARG B 1 243 ? 31.804  -25.198 8.434   1.00 57.71 ? 243  ARG B NH1   1 
ATOM   8863  N  NH2   . ARG B 1 243 ? 33.297  -26.927 8.759   1.00 58.25 ? 243  ARG B NH2   1 
ATOM   8864  N  N     . HIS B 1 244 ? 30.388  -23.361 13.545  1.00 40.07 ? 244  HIS B N     1 
ATOM   8865  C  CA    . HIS B 1 244 ? 28.953  -23.565 13.600  1.00 40.01 ? 244  HIS B CA    1 
ATOM   8866  C  C     . HIS B 1 244 ? 28.457  -23.175 15.001  1.00 38.28 ? 244  HIS B C     1 
ATOM   8867  O  O     . HIS B 1 244 ? 27.272  -23.448 15.244  1.00 39.09 ? 244  HIS B O     1 
ATOM   8868  C  CB    . HIS B 1 244 ? 28.518  -25.000 13.346  1.00 41.77 ? 244  HIS B CB    1 
ATOM   8869  C  CG    . HIS B 1 244 ? 28.809  -25.545 11.984  1.00 47.26 ? 244  HIS B CG    1 
ATOM   8870  N  ND1   . HIS B 1 244 ? 29.111  -24.753 10.902  1.00 49.14 ? 244  HIS B ND1   1 
ATOM   8871  C  CD2   . HIS B 1 244 ? 28.754  -26.831 11.511  1.00 45.69 ? 244  HIS B CD2   1 
ATOM   8872  C  CE1   . HIS B 1 244 ? 29.263  -25.506 9.824   1.00 46.14 ? 244  HIS B CE1   1 
ATOM   8873  N  NE2   . HIS B 1 244 ? 29.052  -26.759 10.167  1.00 47.82 ? 244  HIS B NE2   1 
ATOM   8874  N  N     . ILE B 1 245 ? 29.345  -22.852 15.929  1.00 35.94 ? 245  ILE B N     1 
ATOM   8875  C  CA    . ILE B 1 245 ? 28.746  -22.597 17.279  1.00 36.22 ? 245  ILE B CA    1 
ATOM   8876  C  C     . ILE B 1 245 ? 28.605  -21.077 17.441  1.00 36.56 ? 245  ILE B C     1 
ATOM   8877  O  O     . ILE B 1 245 ? 29.628  -20.417 17.758  1.00 35.42 ? 245  ILE B O     1 
ATOM   8878  C  CB    . ILE B 1 245 ? 29.678  -23.172 18.361  1.00 34.26 ? 245  ILE B CB    1 
ATOM   8879  C  CG1   . ILE B 1 245 ? 29.976  -24.650 18.151  1.00 36.41 ? 245  ILE B CG1   1 
ATOM   8880  C  CG2   . ILE B 1 245 ? 29.193  -22.853 19.756  1.00 30.85 ? 245  ILE B CG2   1 
ATOM   8881  C  CD1   . ILE B 1 245 ? 31.146  -25.203 18.984  1.00 28.76 ? 245  ILE B CD1   1 
ATOM   8882  N  N     . ASP B 1 246 ? 27.470  -20.484 17.055  1.00 36.34 ? 246  ASP B N     1 
ATOM   8883  C  CA    . ASP B 1 246 ? 27.363  -19.035 17.012  1.00 38.75 ? 246  ASP B CA    1 
ATOM   8884  C  C     . ASP B 1 246 ? 27.683  -18.413 18.382  1.00 40.09 ? 246  ASP B C     1 
ATOM   8885  O  O     . ASP B 1 246 ? 28.216  -17.298 18.372  1.00 39.89 ? 246  ASP B O     1 
ATOM   8886  C  CB    . ASP B 1 246 ? 26.078  -18.373 16.547  1.00 34.82 ? 246  ASP B CB    1 
ATOM   8887  C  CG    . ASP B 1 246 ? 25.564  -18.714 15.174  1.00 37.85 ? 246  ASP B CG    1 
ATOM   8888  O  OD1   . ASP B 1 246 ? 26.317  -19.147 14.284  1.00 42.49 ? 246  ASP B OD1   1 
ATOM   8889  O  OD2   . ASP B 1 246 ? 24.343  -18.628 14.907  1.00 41.16 ? 246  ASP B OD2   1 
ATOM   8890  N  N     . LEU B 1 247 ? 27.313  -19.081 19.484  1.00 40.16 ? 247  LEU B N     1 
ATOM   8891  C  CA    . LEU B 1 247 ? 27.494  -18.415 20.759  1.00 40.38 ? 247  LEU B CA    1 
ATOM   8892  C  C     . LEU B 1 247 ? 28.927  -18.349 21.207  1.00 40.06 ? 247  LEU B C     1 
ATOM   8893  O  O     . LEU B 1 247 ? 29.177  -17.830 22.318  1.00 42.34 ? 247  LEU B O     1 
ATOM   8894  C  CB    . LEU B 1 247 ? 26.563  -18.833 21.870  1.00 41.94 ? 247  LEU B CB    1 
ATOM   8895  C  CG    . LEU B 1 247 ? 25.086  -19.109 21.653  1.00 48.51 ? 247  LEU B CG    1 
ATOM   8896  C  CD1   . LEU B 1 247 ? 24.399  -19.450 22.974  1.00 46.16 ? 247  LEU B CD1   1 
ATOM   8897  C  CD2   . LEU B 1 247 ? 24.302  -18.012 20.977  1.00 45.72 ? 247  LEU B CD2   1 
ATOM   8898  N  N     . VAL B 1 248 ? 29.908  -18.828 20.472  1.00 38.94 ? 248  VAL B N     1 
ATOM   8899  C  CA    . VAL B 1 248 ? 31.315  -18.689 20.911  1.00 38.71 ? 248  VAL B CA    1 
ATOM   8900  C  C     . VAL B 1 248 ? 32.089  -17.967 19.794  1.00 39.93 ? 248  VAL B C     1 
ATOM   8901  O  O     . VAL B 1 248 ? 31.990  -18.313 18.610  1.00 38.27 ? 248  VAL B O     1 
ATOM   8902  C  CB    . VAL B 1 248 ? 31.984  -20.058 21.147  1.00 36.15 ? 248  VAL B CB    1 
ATOM   8903  C  CG1   . VAL B 1 248 ? 33.496  -19.973 21.201  1.00 34.65 ? 248  VAL B CG1   1 
ATOM   8904  C  CG2   . VAL B 1 248 ? 31.511  -20.826 22.350  1.00 32.82 ? 248  VAL B CG2   1 
ATOM   8905  N  N     . GLU B 1 249 ? 32.975  -17.041 20.170  1.00 41.68 ? 249  GLU B N     1 
ATOM   8906  C  CA    . GLU B 1 249 ? 33.791  -16.359 19.215  1.00 41.81 ? 249  GLU B CA    1 
ATOM   8907  C  C     . GLU B 1 249 ? 34.995  -17.169 18.800  1.00 42.36 ? 249  GLU B C     1 
ATOM   8908  O  O     . GLU B 1 249 ? 35.964  -17.459 19.486  1.00 43.97 ? 249  GLU B O     1 
ATOM   8909  C  CB    . GLU B 1 249 ? 34.115  -14.904 19.541  1.00 47.95 ? 249  GLU B CB    1 
ATOM   8910  C  CG    . GLU B 1 249 ? 33.095  -13.904 19.026  1.00 49.70 ? 249  GLU B CG    1 
ATOM   8911  C  CD    . GLU B 1 249 ? 33.582  -12.483 18.903  1.00 56.45 ? 249  GLU B CD    1 
ATOM   8912  O  OE1   . GLU B 1 249 ? 33.956  -11.923 19.954  1.00 55.34 ? 249  GLU B OE1   1 
ATOM   8913  O  OE2   . GLU B 1 249 ? 33.572  -11.905 17.777  1.00 56.60 ? 249  GLU B OE2   1 
ATOM   8914  N  N     . GLY B 1 250 ? 34.967  -17.554 17.522  1.00 41.02 ? 250  GLY B N     1 
ATOM   8915  C  CA    . GLY B 1 250 ? 36.108  -18.203 16.898  1.00 39.82 ? 250  GLY B CA    1 
ATOM   8916  C  C     . GLY B 1 250 ? 35.544  -19.063 15.768  1.00 38.86 ? 250  GLY B C     1 
ATOM   8917  O  O     . GLY B 1 250 ? 34.345  -19.278 15.806  1.00 38.42 ? 250  GLY B O     1 
ATOM   8918  N  N     . ASP B 1 251 ? 36.425  -19.539 14.926  1.00 38.88 ? 251  ASP B N     1 
ATOM   8919  C  CA    . ASP B 1 251 ? 35.987  -20.394 13.823  1.00 40.38 ? 251  ASP B CA    1 
ATOM   8920  C  C     . ASP B 1 251 ? 37.080  -21.428 13.526  1.00 40.36 ? 251  ASP B C     1 
ATOM   8921  O  O     . ASP B 1 251 ? 37.156  -21.997 12.436  1.00 40.28 ? 251  ASP B O     1 
ATOM   8922  C  CB    . ASP B 1 251 ? 35.822  -19.489 12.592  1.00 38.78 ? 251  ASP B CB    1 
ATOM   8923  C  CG    . ASP B 1 251 ? 37.119  -18.724 12.346  1.00 43.48 ? 251  ASP B CG    1 
ATOM   8924  O  OD1   . ASP B 1 251 ? 38.093  -18.794 13.130  1.00 40.23 ? 251  ASP B OD1   1 
ATOM   8925  O  OD2   . ASP B 1 251 ? 37.138  -18.031 11.312  1.00 46.38 ? 251  ASP B OD2   1 
ATOM   8926  N  N     . GLU B 1 252 ? 38.024  -21.553 14.451  1.00 40.26 ? 252  GLU B N     1 
ATOM   8927  C  CA    . GLU B 1 252 ? 39.142  -22.475 14.150  1.00 40.88 ? 252  GLU B CA    1 
ATOM   8928  C  C     . GLU B 1 252 ? 38.894  -23.771 14.896  1.00 38.59 ? 252  GLU B C     1 
ATOM   8929  O  O     . GLU B 1 252 ? 38.404  -23.661 16.007  1.00 38.69 ? 252  GLU B O     1 
ATOM   8930  C  CB    . GLU B 1 252 ? 40.462  -21.802 14.579  1.00 44.46 ? 252  GLU B CB    1 
ATOM   8931  C  CG    . GLU B 1 252 ? 40.146  -20.419 15.179  1.00 53.94 ? 252  GLU B CG    1 
ATOM   8932  C  CD    . GLU B 1 252 ? 41.343  -19.618 15.644  1.00 52.51 ? 252  GLU B CD    1 
ATOM   8933  O  OE1   . GLU B 1 252 ? 41.946  -18.958 14.761  1.00 51.11 ? 252  GLU B OE1   1 
ATOM   8934  O  OE2   . GLU B 1 252 ? 41.632  -19.682 16.875  1.00 56.32 ? 252  GLU B OE2   1 
ATOM   8935  N  N     . GLY B 1 253 ? 39.081  -24.919 14.279  1.00 37.64 ? 253  GLY B N     1 
ATOM   8936  C  CA    . GLY B 1 253 ? 38.896  -26.164 15.021  1.00 37.89 ? 253  GLY B CA    1 
ATOM   8937  C  C     . GLY B 1 253 ? 37.484  -26.432 15.544  1.00 37.34 ? 253  GLY B C     1 
ATOM   8938  O  O     . GLY B 1 253 ? 36.460  -25.917 15.086  1.00 37.73 ? 253  GLY B O     1 
ATOM   8939  N  N     . ARG B 1 254 ? 37.449  -27.219 16.615  1.00 35.87 ? 254  ARG B N     1 
ATOM   8940  C  CA    . ARG B 1 254 ? 36.245  -27.792 17.163  1.00 35.08 ? 254  ARG B CA    1 
ATOM   8941  C  C     . ARG B 1 254 ? 36.093  -27.590 18.662  1.00 33.30 ? 254  ARG B C     1 
ATOM   8942  O  O     . ARG B 1 254 ? 37.042  -27.277 19.332  1.00 32.38 ? 254  ARG B O     1 
ATOM   8943  C  CB    . ARG B 1 254 ? 36.341  -29.321 16.878  1.00 37.40 ? 254  ARG B CB    1 
ATOM   8944  C  CG    . ARG B 1 254 ? 35.401  -29.775 15.776  1.00 40.52 ? 254  ARG B CG    1 
ATOM   8945  C  CD    . ARG B 1 254 ? 36.029  -30.803 14.861  1.00 38.43 ? 254  ARG B CD    1 
ATOM   8946  N  NE    . ARG B 1 254 ? 36.422  -32.031 15.495  1.00 40.09 ? 254  ARG B NE    1 
ATOM   8947  C  CZ    . ARG B 1 254 ? 36.030  -33.281 15.431  1.00 42.51 ? 254  ARG B CZ    1 
ATOM   8948  N  NH1   . ARG B 1 254 ? 34.996  -33.641 14.681  1.00 46.00 ? 254  ARG B NH1   1 
ATOM   8949  N  NH2   . ARG B 1 254 ? 36.592  -34.234 16.189  1.00 41.91 ? 254  ARG B NH2   1 
ATOM   8950  N  N     . MET B 1 255 ? 34.892  -27.726 19.193  1.00 31.07 ? 255  MET B N     1 
ATOM   8951  C  CA    . MET B 1 255 ? 34.669  -27.695 20.615  1.00 31.46 ? 255  MET B CA    1 
ATOM   8952  C  C     . MET B 1 255 ? 33.543  -28.729 20.836  1.00 32.77 ? 255  MET B C     1 
ATOM   8953  O  O     . MET B 1 255 ? 32.676  -28.976 19.987  1.00 32.10 ? 255  MET B O     1 
ATOM   8954  C  CB    . MET B 1 255 ? 34.303  -26.326 21.177  1.00 30.49 ? 255  MET B CB    1 
ATOM   8955  C  CG    . MET B 1 255 ? 33.910  -26.208 22.638  1.00 30.38 ? 255  MET B CG    1 
ATOM   8956  S  SD    . MET B 1 255 ? 33.325  -24.539 23.119  1.00 32.47 ? 255  MET B SD    1 
ATOM   8957  C  CE    . MET B 1 255 ? 34.839  -23.588 22.968  1.00 25.47 ? 255  MET B CE    1 
ATOM   8958  N  N     . CYS B 1 256 ? 33.585  -29.327 22.009  1.00 32.26 ? 256  CYS B N     1 
ATOM   8959  C  CA    . CYS B 1 256 ? 32.591  -30.268 22.433  1.00 32.84 ? 256  CYS B CA    1 
ATOM   8960  C  C     . CYS B 1 256 ? 31.324  -29.512 22.796  1.00 34.09 ? 256  CYS B C     1 
ATOM   8961  O  O     . CYS B 1 256 ? 31.474  -28.584 23.613  1.00 35.82 ? 256  CYS B O     1 
ATOM   8962  C  CB    . CYS B 1 256 ? 33.149  -31.038 23.660  1.00 31.49 ? 256  CYS B CB    1 
ATOM   8963  S  SG    . CYS B 1 256 ? 32.010  -32.324 24.201  1.00 32.80 ? 256  CYS B SG    1 
ATOM   8964  N  N     . ILE B 1 257 ? 30.168  -30.048 22.450  1.00 33.48 ? 257  ILE B N     1 
ATOM   8965  C  CA    . ILE B 1 257 ? 28.908  -29.427 22.821  1.00 32.60 ? 257  ILE B CA    1 
ATOM   8966  C  C     . ILE B 1 257 ? 28.112  -30.356 23.710  1.00 32.37 ? 257  ILE B C     1 
ATOM   8967  O  O     . ILE B 1 257 ? 27.898  -31.491 23.354  1.00 31.82 ? 257  ILE B O     1 
ATOM   8968  C  CB    . ILE B 1 257 ? 28.058  -29.185 21.544  1.00 33.79 ? 257  ILE B CB    1 
ATOM   8969  C  CG1   . ILE B 1 257 ? 28.641  -28.001 20.779  1.00 34.20 ? 257  ILE B CG1   1 
ATOM   8970  C  CG2   . ILE B 1 257 ? 26.595  -28.888 21.831  1.00 29.70 ? 257  ILE B CG2   1 
ATOM   8971  C  CD1   . ILE B 1 257 ? 28.259  -26.654 21.314  1.00 37.82 ? 257  ILE B CD1   1 
ATOM   8972  N  N     . ASN B 1 258 ? 27.498  -29.874 24.779  1.00 32.97 ? 258  ASN B N     1 
ATOM   8973  C  CA    . ASN B 1 258 ? 26.617  -30.716 25.578  1.00 33.25 ? 258  ASN B CA    1 
ATOM   8974  C  C     . ASN B 1 258 ? 25.227  -30.545 25.026  1.00 35.18 ? 258  ASN B C     1 
ATOM   8975  O  O     . ASN B 1 258 ? 24.653  -29.449 25.156  1.00 35.99 ? 258  ASN B O     1 
ATOM   8976  C  CB    . ASN B 1 258 ? 26.807  -30.247 27.026  1.00 34.48 ? 258  ASN B CB    1 
ATOM   8977  C  CG    . ASN B 1 258 ? 25.759  -30.814 27.941  1.00 31.12 ? 258  ASN B CG    1 
ATOM   8978  O  OD1   . ASN B 1 258 ? 25.103  -31.773 27.493  1.00 33.76 ? 258  ASN B OD1   1 
ATOM   8979  N  ND2   . ASN B 1 258 ? 25.609  -30.305 29.156  1.00 29.97 ? 258  ASN B ND2   1 
ATOM   8980  N  N     . THR B 1 259 ? 24.652  -31.509 24.293  1.00 35.97 ? 259  THR B N     1 
ATOM   8981  C  CA    . THR B 1 259 ? 23.337  -31.205 23.687  1.00 34.37 ? 259  THR B CA    1 
ATOM   8982  C  C     . THR B 1 259 ? 22.273  -30.884 24.736  1.00 33.19 ? 259  THR B C     1 
ATOM   8983  O  O     . THR B 1 259 ? 21.320  -30.126 24.444  1.00 30.95 ? 259  THR B O     1 
ATOM   8984  C  CB    . THR B 1 259 ? 22.834  -32.345 22.767  1.00 31.16 ? 259  THR B CB    1 
ATOM   8985  O  OG1   . THR B 1 259 ? 22.415  -33.440 23.624  1.00 30.97 ? 259  THR B OG1   1 
ATOM   8986  C  CG2   . THR B 1 259 ? 23.964  -32.813 21.870  1.00 30.21 ? 259  THR B CG2   1 
ATOM   8987  N  N     . GLU B 1 260 ? 22.262  -31.621 25.847  1.00 32.93 ? 260  GLU B N     1 
ATOM   8988  C  CA    . GLU B 1 260 ? 21.131  -31.556 26.770  1.00 34.52 ? 260  GLU B CA    1 
ATOM   8989  C  C     . GLU B 1 260 ? 19.840  -32.000 26.075  1.00 34.89 ? 260  GLU B C     1 
ATOM   8990  O  O     . GLU B 1 260 ? 18.740  -31.488 26.291  1.00 36.14 ? 260  GLU B O     1 
ATOM   8991  C  CB    . GLU B 1 260 ? 20.911  -30.253 27.545  1.00 35.97 ? 260  GLU B CB    1 
ATOM   8992  C  CG    . GLU B 1 260 ? 21.931  -29.953 28.629  1.00 30.65 ? 260  GLU B CG    1 
ATOM   8993  C  CD    . GLU B 1 260 ? 21.937  -30.857 29.829  1.00 31.29 ? 260  GLU B CD    1 
ATOM   8994  O  OE1   . GLU B 1 260 ? 20.941  -31.494 30.241  1.00 36.18 ? 260  GLU B OE1   1 
ATOM   8995  O  OE2   . GLU B 1 260 ? 22.991  -31.013 30.466  1.00 31.49 ? 260  GLU B OE2   1 
ATOM   8996  N  N     . TRP B 1 261 ? 19.953  -33.125 25.376  1.00 32.83 ? 261  TRP B N     1 
ATOM   8997  C  CA    . TRP B 1 261 ? 18.858  -33.668 24.614  1.00 32.71 ? 261  TRP B CA    1 
ATOM   8998  C  C     . TRP B 1 261 ? 17.724  -34.074 25.500  1.00 32.84 ? 261  TRP B C     1 
ATOM   8999  O  O     . TRP B 1 261 ? 16.622  -34.323 25.025  1.00 33.53 ? 261  TRP B O     1 
ATOM   9000  C  CB    . TRP B 1 261 ? 19.336  -34.737 23.640  1.00 34.45 ? 261  TRP B CB    1 
ATOM   9001  C  CG    . TRP B 1 261 ? 19.662  -36.145 24.079  1.00 30.74 ? 261  TRP B CG    1 
ATOM   9002  C  CD1   . TRP B 1 261 ? 19.414  -36.738 25.271  1.00 25.03 ? 261  TRP B CD1   1 
ATOM   9003  C  CD2   . TRP B 1 261 ? 20.378  -37.116 23.284  1.00 28.42 ? 261  TRP B CD2   1 
ATOM   9004  N  NE1   . TRP B 1 261 ? 19.904  -38.051 25.244  1.00 30.07 ? 261  TRP B NE1   1 
ATOM   9005  C  CE2   . TRP B 1 261 ? 20.451  -38.309 24.025  1.00 25.34 ? 261  TRP B CE2   1 
ATOM   9006  C  CE3   . TRP B 1 261 ? 20.902  -37.101 21.981  1.00 29.95 ? 261  TRP B CE3   1 
ATOM   9007  C  CZ2   . TRP B 1 261 ? 21.053  -39.461 23.536  1.00 25.26 ? 261  TRP B CZ2   1 
ATOM   9008  C  CZ3   . TRP B 1 261 ? 21.488  -38.275 21.476  1.00 27.77 ? 261  TRP B CZ3   1 
ATOM   9009  C  CH2   . TRP B 1 261 ? 21.613  -39.405 22.291  1.00 24.66 ? 261  TRP B CH2   1 
ATOM   9010  N  N     . GLY B 1 262 ? 17.917  -34.204 26.811  1.00 33.07 ? 262  GLY B N     1 
ATOM   9011  C  CA    . GLY B 1 262 ? 16.837  -34.682 27.681  1.00 30.55 ? 262  GLY B CA    1 
ATOM   9012  C  C     . GLY B 1 262 ? 15.650  -33.741 27.495  1.00 33.11 ? 262  GLY B C     1 
ATOM   9013  O  O     . GLY B 1 262 ? 14.482  -34.124 27.652  1.00 32.91 ? 262  GLY B O     1 
ATOM   9014  N  N     . ALA B 1 263 ? 15.978  -32.475 27.214  1.00 33.32 ? 263  ALA B N     1 
ATOM   9015  C  CA    . ALA B 1 263 ? 14.953  -31.461 27.145  1.00 35.51 ? 263  ALA B CA    1 
ATOM   9016  C  C     . ALA B 1 263 ? 14.157  -31.493 25.851  1.00 35.52 ? 263  ALA B C     1 
ATOM   9017  O  O     . ALA B 1 263 ? 13.216  -30.692 25.726  1.00 37.81 ? 263  ALA B O     1 
ATOM   9018  C  CB    . ALA B 1 263 ? 15.536  -30.092 27.469  1.00 29.92 ? 263  ALA B CB    1 
ATOM   9019  N  N     . PHE B 1 264 ? 14.560  -32.260 24.871  1.00 34.21 ? 264  PHE B N     1 
ATOM   9020  C  CA    . PHE B 1 264 ? 13.849  -32.376 23.592  1.00 33.60 ? 264  PHE B CA    1 
ATOM   9021  C  C     . PHE B 1 264 ? 12.363  -32.650 23.759  1.00 33.08 ? 264  PHE B C     1 
ATOM   9022  O  O     . PHE B 1 264 ? 11.987  -33.399 24.647  1.00 32.22 ? 264  PHE B O     1 
ATOM   9023  C  CB    . PHE B 1 264 ? 14.584  -33.451 22.816  1.00 30.31 ? 264  PHE B CB    1 
ATOM   9024  C  CG    . PHE B 1 264 ? 14.022  -33.926 21.523  1.00 29.08 ? 264  PHE B CG    1 
ATOM   9025  C  CD1   . PHE B 1 264 ? 13.519  -33.035 20.591  1.00 29.43 ? 264  PHE B CD1   1 
ATOM   9026  C  CD2   . PHE B 1 264 ? 14.170  -35.252 21.161  1.00 32.65 ? 264  PHE B CD2   1 
ATOM   9027  C  CE1   . PHE B 1 264 ? 13.137  -33.472 19.335  1.00 23.96 ? 264  PHE B CE1   1 
ATOM   9028  C  CE2   . PHE B 1 264 ? 13.783  -35.732 19.921  1.00 28.75 ? 264  PHE B CE2   1 
ATOM   9029  C  CZ    . PHE B 1 264 ? 13.218  -34.820 19.045  1.00 31.55 ? 264  PHE B CZ    1 
ATOM   9030  N  N     . GLY B 1 265 ? 11.443  -31.839 23.186  1.00 33.28 ? 265  GLY B N     1 
ATOM   9031  C  CA    . GLY B 1 265 ? 10.018  -31.913 23.413  1.00 31.56 ? 265  GLY B CA    1 
ATOM   9032  C  C     . GLY B 1 265 ? 9.437   -31.062 24.516  1.00 32.23 ? 265  GLY B C     1 
ATOM   9033  O  O     . GLY B 1 265 ? 8.214   -31.126 24.839  1.00 32.86 ? 265  GLY B O     1 
ATOM   9034  N  N     . ASP B 1 266 ? 10.279  -30.332 25.225  1.00 33.11 ? 266  ASP B N     1 
ATOM   9035  C  CA    . ASP B 1 266 ? 9.776   -29.496 26.333  1.00 36.77 ? 266  ASP B CA    1 
ATOM   9036  C  C     . ASP B 1 266 ? 8.877   -28.360 25.846  1.00 37.61 ? 266  ASP B C     1 
ATOM   9037  O  O     . ASP B 1 266 ? 8.164   -27.734 26.639  1.00 38.31 ? 266  ASP B O     1 
ATOM   9038  C  CB    . ASP B 1 266 ? 10.924  -28.966 27.194  1.00 35.00 ? 266  ASP B CB    1 
ATOM   9039  C  CG    . ASP B 1 266 ? 11.474  -29.961 28.190  1.00 37.12 ? 266  ASP B CG    1 
ATOM   9040  O  OD1   . ASP B 1 266 ? 11.094  -31.151 28.043  1.00 37.08 ? 266  ASP B OD1   1 
ATOM   9041  O  OD2   . ASP B 1 266 ? 12.274  -29.568 29.093  1.00 34.20 ? 266  ASP B OD2   1 
ATOM   9042  N  N     . ASP B 1 267 ? 8.895   -28.020 24.573  1.00 37.96 ? 267  ASP B N     1 
ATOM   9043  C  CA    . ASP B 1 267 ? 8.040   -26.989 23.992  1.00 38.64 ? 267  ASP B CA    1 
ATOM   9044  C  C     . ASP B 1 267 ? 6.820   -27.634 23.331  1.00 40.22 ? 267  ASP B C     1 
ATOM   9045  O  O     . ASP B 1 267 ? 6.093   -26.958 22.609  1.00 41.20 ? 267  ASP B O     1 
ATOM   9046  C  CB    . ASP B 1 267 ? 8.799   -26.215 22.922  1.00 39.74 ? 267  ASP B CB    1 
ATOM   9047  C  CG    . ASP B 1 267 ? 9.363   -27.154 21.862  1.00 40.00 ? 267  ASP B CG    1 
ATOM   9048  O  OD1   . ASP B 1 267 ? 9.246   -28.387 22.079  1.00 42.31 ? 267  ASP B OD1   1 
ATOM   9049  O  OD2   . ASP B 1 267 ? 9.862   -26.656 20.829  1.00 37.80 ? 267  ASP B OD2   1 
ATOM   9050  N  N     . GLY B 1 268 ? 6.649   -28.937 23.532  1.00 38.70 ? 268  GLY B N     1 
ATOM   9051  C  CA    . GLY B 1 268 ? 5.476   -29.602 23.029  1.00 38.88 ? 268  GLY B CA    1 
ATOM   9052  C  C     . GLY B 1 268 ? 5.722   -30.248 21.688  1.00 39.18 ? 268  GLY B C     1 
ATOM   9053  O  O     . GLY B 1 268 ? 4.815   -30.895 21.161  1.00 40.00 ? 268  GLY B O     1 
ATOM   9054  N  N     . SER B 1 269 ? 6.918   -30.259 21.149  1.00 39.33 ? 269  SER B N     1 
ATOM   9055  C  CA    . SER B 1 269 ? 7.105   -30.914 19.840  1.00 40.01 ? 269  SER B CA    1 
ATOM   9056  C  C     . SER B 1 269 ? 7.068   -32.430 19.779  1.00 40.00 ? 269  SER B C     1 
ATOM   9057  O  O     . SER B 1 269 ? 7.227   -33.018 18.687  1.00 39.89 ? 269  SER B O     1 
ATOM   9058  C  CB    . SER B 1 269 ? 8.435   -30.343 19.312  1.00 39.15 ? 269  SER B CB    1 
ATOM   9059  O  OG    . SER B 1 269 ? 9.475   -31.213 19.757  1.00 41.28 ? 269  SER B OG    1 
ATOM   9060  N  N     . LEU B 1 270 ? 6.961   -33.190 20.865  1.00 39.28 ? 270  LEU B N     1 
ATOM   9061  C  CA    . LEU B 1 270 ? 6.869   -34.641 20.760  1.00 40.26 ? 270  LEU B CA    1 
ATOM   9062  C  C     . LEU B 1 270 ? 5.476   -35.120 21.215  1.00 40.87 ? 270  LEU B C     1 
ATOM   9063  O  O     . LEU B 1 270 ? 5.287   -36.274 21.593  1.00 41.34 ? 270  LEU B O     1 
ATOM   9064  C  CB    . LEU B 1 270 ? 7.892   -35.436 21.582  1.00 33.09 ? 270  LEU B CB    1 
ATOM   9065  C  CG    . LEU B 1 270 ? 9.349   -35.129 21.248  1.00 33.42 ? 270  LEU B CG    1 
ATOM   9066  C  CD1   . LEU B 1 270 ? 10.248  -35.635 22.346  1.00 28.52 ? 270  LEU B CD1   1 
ATOM   9067  C  CD2   . LEU B 1 270 ? 9.634   -35.735 19.874  1.00 37.84 ? 270  LEU B CD2   1 
ATOM   9068  N  N     . GLU B 1 271 ? 4.540   -34.192 21.282  1.00 41.81 ? 271  GLU B N     1 
ATOM   9069  C  CA    . GLU B 1 271 ? 3.223   -34.483 21.824  1.00 42.80 ? 271  GLU B CA    1 
ATOM   9070  C  C     . GLU B 1 271 ? 2.556   -35.634 21.099  1.00 42.80 ? 271  GLU B C     1 
ATOM   9071  O  O     . GLU B 1 271 ? 1.705   -36.319 21.672  1.00 43.23 ? 271  GLU B O     1 
ATOM   9072  C  CB    . GLU B 1 271 ? 2.398   -33.200 21.900  1.00 38.77 ? 271  GLU B CB    1 
ATOM   9073  C  CG    . GLU B 1 271 ? 2.515   -32.485 23.223  1.00 41.87 ? 271  GLU B CG    1 
ATOM   9074  C  CD    . GLU B 1 271 ? 2.823   -33.335 24.442  1.00 44.27 ? 271  GLU B CD    1 
ATOM   9075  O  OE1   . GLU B 1 271 ? 1.914   -34.091 24.893  1.00 43.37 ? 271  GLU B OE1   1 
ATOM   9076  O  OE2   . GLU B 1 271 ? 3.961   -33.184 24.955  1.00 40.56 ? 271  GLU B OE2   1 
ATOM   9077  N  N     . ASP B 1 272 ? 2.961   -35.907 19.853  1.00 43.65 ? 272  ASP B N     1 
ATOM   9078  C  CA    . ASP B 1 272 ? 2.354   -37.010 19.088  1.00 42.57 ? 272  ASP B CA    1 
ATOM   9079  C  C     . ASP B 1 272 ? 2.971   -38.350 19.476  1.00 42.23 ? 272  ASP B C     1 
ATOM   9080  O  O     . ASP B 1 272 ? 2.421   -39.383 19.080  1.00 41.18 ? 272  ASP B O     1 
ATOM   9081  C  CB    . ASP B 1 272 ? 2.484   -36.831 17.585  1.00 36.71 ? 272  ASP B CB    1 
ATOM   9082  C  CG    . ASP B 1 272 ? 3.885   -36.549 17.082  1.00 46.33 ? 272  ASP B CG    1 
ATOM   9083  O  OD1   . ASP B 1 272 ? 4.770   -35.973 17.755  1.00 37.24 ? 272  ASP B OD1   1 
ATOM   9084  O  OD2   . ASP B 1 272 ? 4.157   -36.965 15.911  1.00 48.11 ? 272  ASP B OD2   1 
ATOM   9085  N  N     . ILE B 1 273 ? 4.123   -38.296 20.172  1.00 42.19 ? 273  ILE B N     1 
ATOM   9086  C  CA    . ILE B 1 273 ? 4.823   -39.523 20.573  1.00 40.51 ? 273  ILE B CA    1 
ATOM   9087  C  C     . ILE B 1 273 ? 4.455   -39.843 22.025  1.00 39.07 ? 273  ILE B C     1 
ATOM   9088  O  O     . ILE B 1 273 ? 4.312   -41.002 22.406  1.00 38.15 ? 273  ILE B O     1 
ATOM   9089  C  CB    . ILE B 1 273 ? 6.359   -39.337 20.486  1.00 40.09 ? 273  ILE B CB    1 
ATOM   9090  C  CG1   . ILE B 1 273 ? 6.908   -38.979 19.115  1.00 43.91 ? 273  ILE B CG1   1 
ATOM   9091  C  CG2   . ILE B 1 273 ? 7.093   -40.598 20.931  1.00 42.99 ? 273  ILE B CG2   1 
ATOM   9092  C  CD1   . ILE B 1 273 ? 6.111   -39.481 17.924  1.00 45.41 ? 273  ILE B CD1   1 
ATOM   9093  N  N     . ARG B 1 274 ? 4.428   -38.852 22.900  1.00 38.61 ? 274  ARG B N     1 
ATOM   9094  C  CA    . ARG B 1 274 ? 4.218   -39.114 24.327  1.00 39.53 ? 274  ARG B CA    1 
ATOM   9095  C  C     . ARG B 1 274 ? 2.838   -39.699 24.627  1.00 39.21 ? 274  ARG B C     1 
ATOM   9096  O  O     . ARG B 1 274 ? 1.877   -39.263 24.010  1.00 38.83 ? 274  ARG B O     1 
ATOM   9097  C  CB    . ARG B 1 274 ? 4.399   -37.793 25.110  1.00 36.27 ? 274  ARG B CB    1 
ATOM   9098  C  CG    . ARG B 1 274 ? 5.813   -37.257 25.011  1.00 34.66 ? 274  ARG B CG    1 
ATOM   9099  C  CD    . ARG B 1 274 ? 6.019   -35.956 25.794  1.00 31.00 ? 274  ARG B CD    1 
ATOM   9100  N  NE    . ARG B 1 274 ? 5.770   -36.191 27.213  1.00 36.13 ? 274  ARG B NE    1 
ATOM   9101  C  CZ    . ARG B 1 274 ? 4.794   -35.588 27.877  1.00 38.85 ? 274  ARG B CZ    1 
ATOM   9102  N  NH1   . ARG B 1 274 ? 3.989   -34.671 27.349  1.00 41.58 ? 274  ARG B NH1   1 
ATOM   9103  N  NH2   . ARG B 1 274 ? 4.697   -35.882 29.156  1.00 41.91 ? 274  ARG B NH2   1 
ATOM   9104  N  N     . THR B 1 275 ? 2.701   -40.720 25.470  1.00 38.02 ? 275  THR B N     1 
ATOM   9105  C  CA    . THR B 1 275 ? 1.387   -41.293 25.736  1.00 37.67 ? 275  THR B CA    1 
ATOM   9106  C  C     . THR B 1 275 ? 0.853   -40.750 27.074  1.00 38.09 ? 275  THR B C     1 
ATOM   9107  O  O     . THR B 1 275 ? 1.518   -39.954 27.739  1.00 37.28 ? 275  THR B O     1 
ATOM   9108  C  CB    . THR B 1 275 ? 1.490   -42.829 25.866  1.00 38.21 ? 275  THR B CB    1 
ATOM   9109  O  OG1   . THR B 1 275 ? 2.238   -43.086 27.078  1.00 42.92 ? 275  THR B OG1   1 
ATOM   9110  C  CG2   . THR B 1 275 ? 2.249   -43.481 24.726  1.00 32.75 ? 275  THR B CG2   1 
ATOM   9111  N  N     . GLU B 1 276 ? -0.343  -41.171 27.446  1.00 38.76 ? 276  GLU B N     1 
ATOM   9112  C  CA    . GLU B 1 276 ? -1.012  -40.917 28.689  1.00 39.16 ? 276  GLU B CA    1 
ATOM   9113  C  C     . GLU B 1 276 ? -0.161  -41.436 29.843  1.00 39.84 ? 276  GLU B C     1 
ATOM   9114  O  O     . GLU B 1 276 ? -0.149  -40.769 30.893  1.00 41.34 ? 276  GLU B O     1 
ATOM   9115  C  CB    . GLU B 1 276 ? -2.375  -41.647 28.791  1.00 42.23 ? 276  GLU B CB    1 
ATOM   9116  C  CG    . GLU B 1 276 ? -2.276  -43.154 28.595  1.00 49.17 ? 276  GLU B CG    1 
ATOM   9117  C  CD    . GLU B 1 276 ? -3.529  -44.010 28.537  1.00 51.49 ? 276  GLU B CD    1 
ATOM   9118  O  OE1   . GLU B 1 276 ? -4.472  -43.859 29.363  1.00 52.26 ? 276  GLU B OE1   1 
ATOM   9119  O  OE2   . GLU B 1 276 ? -3.633  -44.948 27.694  1.00 47.01 ? 276  GLU B OE2   1 
ATOM   9120  N  N     . PHE B 1 277 ? 0.582   -42.533 29.671  1.00 38.76 ? 277  PHE B N     1 
ATOM   9121  C  CA    . PHE B 1 277 ? 1.466   -42.948 30.788  1.00 36.85 ? 277  PHE B CA    1 
ATOM   9122  C  C     . PHE B 1 277 ? 2.580   -41.930 30.980  1.00 36.60 ? 277  PHE B C     1 
ATOM   9123  O  O     . PHE B 1 277 ? 3.004   -41.601 32.112  1.00 36.18 ? 277  PHE B O     1 
ATOM   9124  C  CB    . PHE B 1 277 ? 1.992   -44.336 30.450  1.00 35.00 ? 277  PHE B CB    1 
ATOM   9125  C  CG    . PHE B 1 277 ? 0.817   -45.298 30.347  1.00 38.19 ? 277  PHE B CG    1 
ATOM   9126  C  CD1   . PHE B 1 277 ? 0.086   -45.606 31.492  1.00 29.88 ? 277  PHE B CD1   1 
ATOM   9127  C  CD2   . PHE B 1 277 ? 0.522   -45.894 29.127  1.00 32.12 ? 277  PHE B CD2   1 
ATOM   9128  C  CE1   . PHE B 1 277 ? -0.984  -46.485 31.387  1.00 34.55 ? 277  PHE B CE1   1 
ATOM   9129  C  CE2   . PHE B 1 277 ? -0.540  -46.770 29.030  1.00 33.98 ? 277  PHE B CE2   1 
ATOM   9130  C  CZ    . PHE B 1 277 ? -1.282  -47.059 30.165  1.00 35.26 ? 277  PHE B CZ    1 
ATOM   9131  N  N     . ASP B 1 278 ? 3.048   -41.359 29.857  1.00 35.08 ? 278  ASP B N     1 
ATOM   9132  C  CA    . ASP B 1 278 ? 4.096   -40.336 30.004  1.00 35.75 ? 278  ASP B CA    1 
ATOM   9133  C  C     . ASP B 1 278 ? 3.559   -39.070 30.637  1.00 37.55 ? 278  ASP B C     1 
ATOM   9134  O  O     . ASP B 1 278 ? 4.252   -38.434 31.437  1.00 38.43 ? 278  ASP B O     1 
ATOM   9135  C  CB    . ASP B 1 278 ? 4.731   -40.033 28.655  1.00 35.20 ? 278  ASP B CB    1 
ATOM   9136  C  CG    . ASP B 1 278 ? 5.361   -41.266 28.045  1.00 38.18 ? 278  ASP B CG    1 
ATOM   9137  O  OD1   . ASP B 1 278 ? 6.314   -41.807 28.658  1.00 35.74 ? 278  ASP B OD1   1 
ATOM   9138  O  OD2   . ASP B 1 278 ? 4.884   -41.661 26.952  1.00 41.05 ? 278  ASP B OD2   1 
ATOM   9139  N  N     . ARG B 1 279 ? 2.318   -38.655 30.292  1.00 37.26 ? 279  ARG B N     1 
ATOM   9140  C  CA    . ARG B 1 279 ? 1.750   -37.464 30.913  1.00 35.32 ? 279  ARG B CA    1 
ATOM   9141  C  C     . ARG B 1 279 ? 1.522   -37.726 32.397  1.00 34.13 ? 279  ARG B C     1 
ATOM   9142  O  O     . ARG B 1 279 ? 1.623   -36.834 33.228  1.00 35.28 ? 279  ARG B O     1 
ATOM   9143  C  CB    . ARG B 1 279 ? 0.376   -37.166 30.267  1.00 36.34 ? 279  ARG B CB    1 
ATOM   9144  C  CG    . ARG B 1 279 ? 0.527   -36.698 28.851  1.00 35.48 ? 279  ARG B CG    1 
ATOM   9145  C  CD    . ARG B 1 279 ? -0.766  -36.577 28.016  1.00 36.26 ? 279  ARG B CD    1 
ATOM   9146  N  NE    . ARG B 1 279 ? -0.196  -35.958 26.787  1.00 33.13 ? 279  ARG B NE    1 
ATOM   9147  C  CZ    . ARG B 1 279 ? 0.012   -36.721 25.713  1.00 36.07 ? 279  ARG B CZ    1 
ATOM   9148  N  NH1   . ARG B 1 279 ? -0.450  -37.966 25.561  1.00 27.33 ? 279  ARG B NH1   1 
ATOM   9149  N  NH2   . ARG B 1 279 ? 0.687   -36.072 24.758  1.00 35.62 ? 279  ARG B NH2   1 
ATOM   9150  N  N     . GLU B 1 280 ? 1.209   -38.954 32.755  1.00 32.91 ? 280  GLU B N     1 
ATOM   9151  C  CA    . GLU B 1 280 ? 0.930   -39.219 34.164  1.00 34.67 ? 280  GLU B CA    1 
ATOM   9152  C  C     . GLU B 1 280 ? 2.233   -39.230 34.958  1.00 35.47 ? 280  GLU B C     1 
ATOM   9153  O  O     . GLU B 1 280 ? 2.313   -38.730 36.090  1.00 36.40 ? 280  GLU B O     1 
ATOM   9154  C  CB    . GLU B 1 280 ? 0.154   -40.541 34.336  1.00 30.61 ? 280  GLU B CB    1 
ATOM   9155  C  CG    . GLU B 1 280 ? -0.177  -40.729 35.796  1.00 35.51 ? 280  GLU B CG    1 
ATOM   9156  C  CD    . GLU B 1 280 ? -1.359  -41.590 36.120  1.00 39.06 ? 280  GLU B CD    1 
ATOM   9157  O  OE1   . GLU B 1 280 ? -2.259  -41.939 35.320  1.00 43.83 ? 280  GLU B OE1   1 
ATOM   9158  O  OE2   . GLU B 1 280 ? -1.474  -41.967 37.307  1.00 43.20 ? 280  GLU B OE2   1 
ATOM   9159  N  N     . ILE B 1 281 ? 3.311   -39.715 34.330  1.00 34.80 ? 281  ILE B N     1 
ATOM   9160  C  CA    . ILE B 1 281 ? 4.579   -39.746 35.072  1.00 34.69 ? 281  ILE B CA    1 
ATOM   9161  C  C     . ILE B 1 281 ? 5.036   -38.324 35.293  1.00 34.42 ? 281  ILE B C     1 
ATOM   9162  O  O     . ILE B 1 281 ? 5.451   -37.951 36.395  1.00 33.72 ? 281  ILE B O     1 
ATOM   9163  C  CB    . ILE B 1 281 ? 5.632   -40.636 34.422  1.00 36.32 ? 281  ILE B CB    1 
ATOM   9164  C  CG1   . ILE B 1 281 ? 6.244   -41.615 35.431  1.00 37.03 ? 281  ILE B CG1   1 
ATOM   9165  C  CG2   . ILE B 1 281 ? 6.723   -39.832 33.747  1.00 32.66 ? 281  ILE B CG2   1 
ATOM   9166  C  CD1   . ILE B 1 281 ? 7.572   -42.177 34.970  1.00 34.03 ? 281  ILE B CD1   1 
ATOM   9167  N  N     . ASP B 1 282 ? 4.942   -37.502 34.234  1.00 34.39 ? 282  ASP B N     1 
ATOM   9168  C  CA    . ASP B 1 282 ? 5.352   -36.102 34.373  1.00 33.89 ? 282  ASP B CA    1 
ATOM   9169  C  C     . ASP B 1 282 ? 4.706   -35.373 35.548  1.00 34.30 ? 282  ASP B C     1 
ATOM   9170  O  O     . ASP B 1 282 ? 5.334   -34.494 36.124  1.00 35.73 ? 282  ASP B O     1 
ATOM   9171  C  CB    . ASP B 1 282 ? 4.937   -35.307 33.137  1.00 36.99 ? 282  ASP B CB    1 
ATOM   9172  C  CG    . ASP B 1 282 ? 5.640   -33.966 33.150  1.00 38.70 ? 282  ASP B CG    1 
ATOM   9173  O  OD1   . ASP B 1 282 ? 6.794   -33.953 33.620  1.00 40.82 ? 282  ASP B OD1   1 
ATOM   9174  O  OD2   . ASP B 1 282 ? 5.010   -32.984 32.707  1.00 42.41 ? 282  ASP B OD2   1 
ATOM   9175  N  N     . ARG B 1 283 ? 3.461   -35.622 35.846  1.00 33.01 ? 283  ARG B N     1 
ATOM   9176  C  CA    . ARG B 1 283 ? 2.724   -34.968 36.887  1.00 34.73 ? 283  ARG B CA    1 
ATOM   9177  C  C     . ARG B 1 283 ? 3.127   -35.359 38.297  1.00 34.88 ? 283  ARG B C     1 
ATOM   9178  O  O     . ARG B 1 283 ? 2.812   -34.587 39.218  1.00 37.58 ? 283  ARG B O     1 
ATOM   9179  C  CB    . ARG B 1 283 ? 1.224   -35.407 36.787  1.00 36.50 ? 283  ARG B CB    1 
ATOM   9180  C  CG    . ARG B 1 283 ? 0.628   -34.574 35.612  1.00 37.26 ? 283  ARG B CG    1 
ATOM   9181  C  CD    . ARG B 1 283 ? -0.884  -34.827 35.749  1.00 38.98 ? 283  ARG B CD    1 
ATOM   9182  N  NE    . ARG B 1 283 ? -1.262  -35.684 34.666  1.00 39.70 ? 283  ARG B NE    1 
ATOM   9183  C  CZ    . ARG B 1 283 ? -1.884  -36.839 34.709  1.00 41.62 ? 283  ARG B CZ    1 
ATOM   9184  N  NH1   . ARG B 1 283 ? -2.240  -37.302 35.898  1.00 42.27 ? 283  ARG B NH1   1 
ATOM   9185  N  NH2   . ARG B 1 283 ? -2.183  -37.382 33.524  1.00 42.50 ? 283  ARG B NH2   1 
ATOM   9186  N  N     . GLY B 1 284 ? 3.653   -36.555 38.451  1.00 32.09 ? 284  GLY B N     1 
ATOM   9187  C  CA    . GLY B 1 284 ? 4.157   -36.990 39.732  1.00 31.36 ? 284  GLY B CA    1 
ATOM   9188  C  C     . GLY B 1 284 ? 5.630   -36.622 39.868  1.00 31.36 ? 284  GLY B C     1 
ATOM   9189  O  O     . GLY B 1 284 ? 6.244   -36.991 40.874  1.00 32.35 ? 284  GLY B O     1 
ATOM   9190  N  N     . SER B 1 285 ? 6.194   -35.977 38.854  1.00 30.58 ? 285  SER B N     1 
ATOM   9191  C  CA    . SER B 1 285 ? 7.599   -35.677 38.883  1.00 33.23 ? 285  SER B CA    1 
ATOM   9192  C  C     . SER B 1 285 ? 8.029   -34.407 39.605  1.00 34.79 ? 285  SER B C     1 
ATOM   9193  O  O     . SER B 1 285 ? 7.316   -33.459 39.937  1.00 35.01 ? 285  SER B O     1 
ATOM   9194  C  CB    . SER B 1 285 ? 8.210   -35.771 37.485  1.00 31.95 ? 285  SER B CB    1 
ATOM   9195  O  OG    . SER B 1 285 ? 7.861   -34.530 36.858  1.00 37.54 ? 285  SER B OG    1 
ATOM   9196  N  N     . LEU B 1 286 ? 9.342   -34.362 39.852  1.00 34.59 ? 286  LEU B N     1 
ATOM   9197  C  CA    . LEU B 1 286 ? 9.919   -33.312 40.688  1.00 37.77 ? 286  LEU B CA    1 
ATOM   9198  C  C     . LEU B 1 286 ? 10.269  -32.139 39.786  1.00 40.27 ? 286  LEU B C     1 
ATOM   9199  O  O     . LEU B 1 286 ? 11.345  -31.633 40.118  1.00 46.81 ? 286  LEU B O     1 
ATOM   9200  C  CB    . LEU B 1 286 ? 11.199  -33.905 41.267  1.00 36.56 ? 286  LEU B CB    1 
ATOM   9201  C  CG    . LEU B 1 286 ? 12.054  -33.185 42.294  1.00 38.54 ? 286  LEU B CG    1 
ATOM   9202  C  CD1   . LEU B 1 286 ? 11.407  -33.256 43.670  1.00 32.83 ? 286  LEU B CD1   1 
ATOM   9203  C  CD2   . LEU B 1 286 ? 13.426  -33.868 42.324  1.00 34.86 ? 286  LEU B CD2   1 
ATOM   9204  N  N     . ASN B 1 287 ? 9.895   -32.139 38.534  1.00 38.88 ? 287  ASN B N     1 
ATOM   9205  C  CA    . ASN B 1 287 ? 10.199  -31.153 37.525  1.00 36.69 ? 287  ASN B CA    1 
ATOM   9206  C  C     . ASN B 1 287 ? 9.163   -31.176 36.405  1.00 36.17 ? 287  ASN B C     1 
ATOM   9207  O  O     . ASN B 1 287 ? 9.490   -31.500 35.261  1.00 36.42 ? 287  ASN B O     1 
ATOM   9208  C  CB    . ASN B 1 287 ? 11.571  -31.370 36.908  1.00 34.73 ? 287  ASN B CB    1 
ATOM   9209  C  CG    . ASN B 1 287 ? 11.971  -32.669 36.248  1.00 43.03 ? 287  ASN B CG    1 
ATOM   9210  O  OD1   . ASN B 1 287 ? 11.514  -33.803 36.500  1.00 37.95 ? 287  ASN B OD1   1 
ATOM   9211  N  ND2   . ASN B 1 287 ? 12.970  -32.555 35.338  1.00 31.88 ? 287  ASN B ND2   1 
ATOM   9212  N  N     . PRO B 1 288 ? 7.891   -31.040 36.701  1.00 36.54 ? 288  PRO B N     1 
ATOM   9213  C  CA    . PRO B 1 288 ? 6.819   -31.309 35.743  1.00 37.30 ? 288  PRO B CA    1 
ATOM   9214  C  C     . PRO B 1 288 ? 6.887   -30.387 34.547  1.00 38.95 ? 288  PRO B C     1 
ATOM   9215  O  O     . PRO B 1 288 ? 7.318   -29.222 34.693  1.00 41.25 ? 288  PRO B O     1 
ATOM   9216  C  CB    . PRO B 1 288 ? 5.566   -31.170 36.562  1.00 37.21 ? 288  PRO B CB    1 
ATOM   9217  C  CG    . PRO B 1 288 ? 5.929   -30.364 37.750  1.00 36.38 ? 288  PRO B CG    1 
ATOM   9218  C  CD    . PRO B 1 288 ? 7.349   -30.795 38.064  1.00 36.65 ? 288  PRO B CD    1 
ATOM   9219  N  N     . GLY B 1 289 ? 6.590   -30.894 33.345  1.00 37.37 ? 289  GLY B N     1 
ATOM   9220  C  CA    . GLY B 1 289 ? 6.860   -30.115 32.163  1.00 35.64 ? 289  GLY B CA    1 
ATOM   9221  C  C     . GLY B 1 289 ? 8.252   -30.200 31.575  1.00 36.25 ? 289  GLY B C     1 
ATOM   9222  O  O     . GLY B 1 289 ? 8.383   -29.863 30.379  1.00 35.05 ? 289  GLY B O     1 
ATOM   9223  N  N     . LYS B 1 290 ? 9.299   -30.599 32.313  1.00 35.65 ? 290  LYS B N     1 
ATOM   9224  C  CA    . LYS B 1 290 ? 10.655  -30.523 31.806  1.00 34.18 ? 290  LYS B CA    1 
ATOM   9225  C  C     . LYS B 1 290 ? 11.298  -31.871 31.557  1.00 34.30 ? 290  LYS B C     1 
ATOM   9226  O  O     . LYS B 1 290 ? 10.764  -32.876 31.971  1.00 34.80 ? 290  LYS B O     1 
ATOM   9227  C  CB    . LYS B 1 290 ? 11.598  -29.796 32.751  1.00 37.41 ? 290  LYS B CB    1 
ATOM   9228  C  CG    . LYS B 1 290 ? 11.025  -28.544 33.381  1.00 44.82 ? 290  LYS B CG    1 
ATOM   9229  C  CD    . LYS B 1 290 ? 11.357  -27.287 32.592  1.00 47.35 ? 290  LYS B CD    1 
ATOM   9230  C  CE    . LYS B 1 290 ? 11.108  -26.054 33.456  1.00 54.26 ? 290  LYS B CE    1 
ATOM   9231  N  NZ    . LYS B 1 290 ? 12.242  -25.762 34.396  1.00 53.23 ? 290  LYS B NZ    1 
ATOM   9232  N  N     . GLN B 1 291 ? 12.306  -31.917 30.699  1.00 34.80 ? 291  GLN B N     1 
ATOM   9233  C  CA    . GLN B 1 291 ? 13.034  -33.145 30.430  1.00 34.59 ? 291  GLN B CA    1 
ATOM   9234  C  C     . GLN B 1 291 ? 12.122  -34.247 29.901  1.00 34.05 ? 291  GLN B C     1 
ATOM   9235  O  O     . GLN B 1 291 ? 12.267  -35.395 30.299  1.00 33.45 ? 291  GLN B O     1 
ATOM   9236  C  CB    . GLN B 1 291 ? 13.636  -33.666 31.762  1.00 38.00 ? 291  GLN B CB    1 
ATOM   9237  C  CG    . GLN B 1 291 ? 14.765  -32.856 32.379  1.00 30.86 ? 291  GLN B CG    1 
ATOM   9238  C  CD    . GLN B 1 291 ? 15.923  -32.589 31.481  1.00 33.04 ? 291  GLN B CD    1 
ATOM   9239  O  OE1   . GLN B 1 291 ? 16.017  -31.493 30.926  1.00 34.53 ? 291  GLN B OE1   1 
ATOM   9240  N  NE2   . GLN B 1 291 ? 16.880  -33.500 31.320  1.00 33.62 ? 291  GLN B NE2   1 
ATOM   9241  N  N     . LEU B 1 292 ? 11.212  -33.945 28.995  1.00 34.20 ? 292  LEU B N     1 
ATOM   9242  C  CA    . LEU B 1 292 ? 10.251  -34.935 28.556  1.00 32.80 ? 292  LEU B CA    1 
ATOM   9243  C  C     . LEU B 1 292 ? 10.843  -36.035 27.718  1.00 32.41 ? 292  LEU B C     1 
ATOM   9244  O  O     . LEU B 1 292 ? 10.225  -37.125 27.711  1.00 33.45 ? 292  LEU B O     1 
ATOM   9245  C  CB    . LEU B 1 292 ? 9.032   -34.220 27.941  1.00 28.16 ? 292  LEU B CB    1 
ATOM   9246  C  CG    . LEU B 1 292 ? 8.313   -33.223 28.821  1.00 32.58 ? 292  LEU B CG    1 
ATOM   9247  C  CD1   . LEU B 1 292 ? 7.190   -32.481 28.055  1.00 29.99 ? 292  LEU B CD1   1 
ATOM   9248  C  CD2   . LEU B 1 292 ? 7.631   -33.918 30.016  1.00 29.88 ? 292  LEU B CD2   1 
ATOM   9249  N  N     . PHE B 1 293 ? 11.909  -35.837 26.932  1.00 31.63 ? 293  PHE B N     1 
ATOM   9250  C  CA    . PHE B 1 293 ? 12.424  -36.990 26.153  1.00 31.53 ? 293  PHE B CA    1 
ATOM   9251  C  C     . PHE B 1 293 ? 13.043  -38.013 27.106  1.00 31.73 ? 293  PHE B C     1 
ATOM   9252  O  O     . PHE B 1 293 ? 12.874  -39.236 26.992  1.00 31.76 ? 293  PHE B O     1 
ATOM   9253  C  CB    . PHE B 1 293 ? 13.381  -36.508 25.087  1.00 29.78 ? 293  PHE B CB    1 
ATOM   9254  C  CG    . PHE B 1 293 ? 14.177  -37.504 24.303  1.00 27.83 ? 293  PHE B CG    1 
ATOM   9255  C  CD1   . PHE B 1 293 ? 13.591  -38.196 23.245  1.00 29.23 ? 293  PHE B CD1   1 
ATOM   9256  C  CD2   . PHE B 1 293 ? 15.528  -37.694 24.545  1.00 30.71 ? 293  PHE B CD2   1 
ATOM   9257  C  CE1   . PHE B 1 293 ? 14.320  -39.075 22.471  1.00 24.75 ? 293  PHE B CE1   1 
ATOM   9258  C  CE2   . PHE B 1 293 ? 16.274  -38.628 23.820  1.00 30.26 ? 293  PHE B CE2   1 
ATOM   9259  C  CZ    . PHE B 1 293 ? 15.655  -39.322 22.779  1.00 34.04 ? 293  PHE B CZ    1 
ATOM   9260  N  N     . GLU B 1 294 ? 13.701  -37.502 28.127  1.00 31.49 ? 294  GLU B N     1 
ATOM   9261  C  CA    . GLU B 1 294 ? 14.412  -38.171 29.191  1.00 31.30 ? 294  GLU B CA    1 
ATOM   9262  C  C     . GLU B 1 294 ? 13.470  -39.056 29.975  1.00 30.14 ? 294  GLU B C     1 
ATOM   9263  O  O     . GLU B 1 294 ? 13.810  -40.180 30.288  1.00 31.31 ? 294  GLU B O     1 
ATOM   9264  C  CB    . GLU B 1 294 ? 15.063  -37.148 30.160  1.00 37.19 ? 294  GLU B CB    1 
ATOM   9265  C  CG    . GLU B 1 294 ? 15.686  -37.671 31.434  1.00 35.39 ? 294  GLU B CG    1 
ATOM   9266  C  CD    . GLU B 1 294 ? 16.718  -36.758 32.045  1.00 38.73 ? 294  GLU B CD    1 
ATOM   9267  O  OE1   . GLU B 1 294 ? 16.385  -35.874 32.861  1.00 36.74 ? 294  GLU B OE1   1 
ATOM   9268  O  OE2   . GLU B 1 294 ? 17.920  -36.901 31.682  1.00 38.42 ? 294  GLU B OE2   1 
ATOM   9269  N  N     . LYS B 1 295 ? 12.264  -38.612 30.148  1.00 29.32 ? 295  LYS B N     1 
ATOM   9270  C  CA    . LYS B 1 295 ? 11.225  -39.318 30.836  1.00 30.27 ? 295  LYS B CA    1 
ATOM   9271  C  C     . LYS B 1 295 ? 10.685  -40.490 30.045  1.00 29.99 ? 295  LYS B C     1 
ATOM   9272  O  O     . LYS B 1 295 ? 9.924   -41.281 30.583  1.00 28.66 ? 295  LYS B O     1 
ATOM   9273  C  CB    . LYS B 1 295 ? 10.093  -38.359 31.275  1.00 27.14 ? 295  LYS B CB    1 
ATOM   9274  C  CG    . LYS B 1 295 ? 10.585  -37.445 32.392  1.00 32.42 ? 295  LYS B CG    1 
ATOM   9275  C  CD    . LYS B 1 295 ? 9.596   -36.335 32.756  1.00 30.57 ? 295  LYS B CD    1 
ATOM   9276  C  CE    . LYS B 1 295 ? 10.105  -35.570 33.951  1.00 32.14 ? 295  LYS B CE    1 
ATOM   9277  N  NZ    . LYS B 1 295 ? 9.544   -34.178 34.057  1.00 34.21 ? 295  LYS B NZ    1 
ATOM   9278  N  N     . MET B 1 296 ? 11.021  -40.571 28.753  1.00 29.64 ? 296  MET B N     1 
ATOM   9279  C  CA    . MET B 1 296 ? 10.575  -41.770 28.026  1.00 29.32 ? 296  MET B CA    1 
ATOM   9280  C  C     . MET B 1 296 ? 11.715  -42.751 27.886  1.00 29.46 ? 296  MET B C     1 
ATOM   9281  O  O     . MET B 1 296 ? 11.537  -43.841 27.351  1.00 31.37 ? 296  MET B O     1 
ATOM   9282  C  CB    . MET B 1 296 ? 10.092  -41.335 26.628  1.00 31.62 ? 296  MET B CB    1 
ATOM   9283  C  CG    . MET B 1 296 ? 8.799   -40.547 26.593  1.00 29.42 ? 296  MET B CG    1 
ATOM   9284  S  SD    . MET B 1 296 ? 8.220   -40.294 24.900  1.00 34.01 ? 296  MET B SD    1 
ATOM   9285  C  CE    . MET B 1 296 ? 9.281   -38.954 24.385  1.00 23.26 ? 296  MET B CE    1 
ATOM   9286  N  N     . VAL B 1 297 ? 12.945  -42.379 28.248  1.00 29.57 ? 297  VAL B N     1 
ATOM   9287  C  CA    . VAL B 1 297 ? 14.152  -43.108 28.000  1.00 28.24 ? 297  VAL B CA    1 
ATOM   9288  C  C     . VAL B 1 297 ? 14.871  -43.632 29.237  1.00 29.42 ? 297  VAL B C     1 
ATOM   9289  O  O     . VAL B 1 297 ? 15.229  -44.782 29.326  1.00 29.48 ? 297  VAL B O     1 
ATOM   9290  C  CB    . VAL B 1 297 ? 15.194  -42.159 27.345  1.00 27.86 ? 297  VAL B CB    1 
ATOM   9291  C  CG1   . VAL B 1 297 ? 16.514  -42.942 27.253  1.00 21.33 ? 297  VAL B CG1   1 
ATOM   9292  C  CG2   . VAL B 1 297 ? 14.799  -41.784 25.911  1.00 28.54 ? 297  VAL B CG2   1 
ATOM   9293  N  N     . SER B 1 298 ? 15.172  -42.814 30.220  1.00 30.75 ? 298  SER B N     1 
ATOM   9294  C  CA    . SER B 1 298 ? 16.143  -43.084 31.266  1.00 29.82 ? 298  SER B CA    1 
ATOM   9295  C  C     . SER B 1 298 ? 15.751  -43.911 32.455  1.00 29.03 ? 298  SER B C     1 
ATOM   9296  O  O     . SER B 1 298 ? 14.617  -44.272 32.714  1.00 30.00 ? 298  SER B O     1 
ATOM   9297  C  CB    . SER B 1 298 ? 16.886  -41.812 31.636  1.00 27.14 ? 298  SER B CB    1 
ATOM   9298  O  OG    . SER B 1 298 ? 16.165  -41.098 32.597  1.00 26.97 ? 298  SER B OG    1 
ATOM   9299  N  N     . GLY B 1 299 ? 16.757  -44.446 33.160  1.00 28.21 ? 299  GLY B N     1 
ATOM   9300  C  CA    . GLY B 1 299 ? 16.507  -45.459 34.172  1.00 26.43 ? 299  GLY B CA    1 
ATOM   9301  C  C     . GLY B 1 299 ? 15.607  -45.086 35.293  1.00 26.08 ? 299  GLY B C     1 
ATOM   9302  O  O     . GLY B 1 299 ? 14.995  -45.914 35.950  1.00 24.86 ? 299  GLY B O     1 
ATOM   9303  N  N     . MET B 1 300 ? 15.626  -43.816 35.654  1.00 29.29 ? 300  MET B N     1 
ATOM   9304  C  CA    . MET B 1 300 ? 14.848  -43.265 36.757  1.00 30.22 ? 300  MET B CA    1 
ATOM   9305  C  C     . MET B 1 300 ? 13.352  -43.298 36.482  1.00 30.41 ? 300  MET B C     1 
ATOM   9306  O  O     . MET B 1 300 ? 12.563  -43.297 37.439  1.00 30.78 ? 300  MET B O     1 
ATOM   9307  C  CB    . MET B 1 300 ? 15.319  -41.845 37.067  1.00 31.77 ? 300  MET B CB    1 
ATOM   9308  C  CG    . MET B 1 300 ? 14.306  -40.911 37.647  1.00 29.25 ? 300  MET B CG    1 
ATOM   9309  S  SD    . MET B 1 300 ? 15.021  -39.337 38.206  1.00 33.27 ? 300  MET B SD    1 
ATOM   9310  C  CE    . MET B 1 300 ? 13.742  -38.889 39.369  1.00 29.73 ? 300  MET B CE    1 
ATOM   9311  N  N     . TYR B 1 301 ? 13.011  -43.441 35.205  1.00 30.14 ? 301  TYR B N     1 
ATOM   9312  C  CA    . TYR B 1 301 ? 11.615  -43.460 34.801  1.00 29.32 ? 301  TYR B CA    1 
ATOM   9313  C  C     . TYR B 1 301 ? 11.066  -44.774 34.329  1.00 30.55 ? 301  TYR B C     1 
ATOM   9314  O  O     . TYR B 1 301 ? 9.820   -44.999 34.453  1.00 31.06 ? 301  TYR B O     1 
ATOM   9315  C  CB    . TYR B 1 301 ? 11.389  -42.302 33.798  1.00 28.77 ? 301  TYR B CB    1 
ATOM   9316  C  CG    . TYR B 1 301 ? 11.879  -40.954 34.285  1.00 29.81 ? 301  TYR B CG    1 
ATOM   9317  C  CD1   . TYR B 1 301 ? 11.229  -40.247 35.290  1.00 29.98 ? 301  TYR B CD1   1 
ATOM   9318  C  CD2   . TYR B 1 301 ? 13.033  -40.366 33.780  1.00 29.99 ? 301  TYR B CD2   1 
ATOM   9319  C  CE1   . TYR B 1 301 ? 11.696  -39.046 35.764  1.00 30.75 ? 301  TYR B CE1   1 
ATOM   9320  C  CE2   . TYR B 1 301 ? 13.501  -39.153 34.207  1.00 29.44 ? 301  TYR B CE2   1 
ATOM   9321  C  CZ    . TYR B 1 301 ? 12.846  -38.501 35.237  1.00 31.03 ? 301  TYR B CZ    1 
ATOM   9322  O  OH    . TYR B 1 301 ? 13.329  -37.286 35.717  1.00 30.83 ? 301  TYR B OH    1 
ATOM   9323  N  N     . LEU B 1 302 ? 11.849  -45.662 33.657  1.00 30.81 ? 302  LEU B N     1 
ATOM   9324  C  CA    . LEU B 1 302 ? 11.198  -46.780 32.956  1.00 30.12 ? 302  LEU B CA    1 
ATOM   9325  C  C     . LEU B 1 302 ? 10.388  -47.684 33.854  1.00 32.32 ? 302  LEU B C     1 
ATOM   9326  O  O     . LEU B 1 302 ? 9.263   -48.116 33.546  1.00 32.96 ? 302  LEU B O     1 
ATOM   9327  C  CB    . LEU B 1 302 ? 12.231  -47.534 32.174  1.00 32.32 ? 302  LEU B CB    1 
ATOM   9328  C  CG    . LEU B 1 302 ? 12.980  -46.854 31.022  1.00 34.02 ? 302  LEU B CG    1 
ATOM   9329  C  CD1   . LEU B 1 302 ? 13.589  -47.968 30.169  1.00 33.85 ? 302  LEU B CD1   1 
ATOM   9330  C  CD2   . LEU B 1 302 ? 12.054  -46.009 30.141  1.00 30.49 ? 302  LEU B CD2   1 
ATOM   9331  N  N     . GLY B 1 303 ? 10.908  -48.000 35.045  1.00 31.75 ? 303  GLY B N     1 
ATOM   9332  C  CA    . GLY B 1 303 ? 10.262  -48.847 36.020  1.00 31.56 ? 303  GLY B CA    1 
ATOM   9333  C  C     . GLY B 1 303 ? 8.876   -48.391 36.387  1.00 32.58 ? 303  GLY B C     1 
ATOM   9334  O  O     . GLY B 1 303 ? 7.913   -49.143 36.351  1.00 36.05 ? 303  GLY B O     1 
ATOM   9335  N  N     . GLU B 1 304 ? 8.650   -47.138 36.639  1.00 34.06 ? 304  GLU B N     1 
ATOM   9336  C  CA    . GLU B 1 304 ? 7.445   -46.402 37.015  1.00 32.84 ? 304  GLU B CA    1 
ATOM   9337  C  C     . GLU B 1 304 ? 6.491   -46.268 35.847  1.00 30.68 ? 304  GLU B C     1 
ATOM   9338  O  O     . GLU B 1 304 ? 5.264   -46.407 35.958  1.00 31.16 ? 304  GLU B O     1 
ATOM   9339  C  CB    . GLU B 1 304 ? 7.927   -45.053 37.585  1.00 37.32 ? 304  GLU B CB    1 
ATOM   9340  C  CG    . GLU B 1 304 ? 6.928   -44.064 38.113  1.00 38.21 ? 304  GLU B CG    1 
ATOM   9341  C  CD    . GLU B 1 304 ? 6.086   -44.533 39.280  1.00 40.04 ? 304  GLU B CD    1 
ATOM   9342  O  OE1   . GLU B 1 304 ? 6.527   -45.408 40.051  1.00 40.84 ? 304  GLU B OE1   1 
ATOM   9343  O  OE2   . GLU B 1 304 ? 4.972   -44.012 39.495  1.00 38.79 ? 304  GLU B OE2   1 
ATOM   9344  N  N     . LEU B 1 305 ? 7.051   -46.169 34.657  1.00 31.36 ? 305  LEU B N     1 
ATOM   9345  C  CA    . LEU B 1 305 ? 6.283   -46.259 33.426  1.00 33.99 ? 305  LEU B CA    1 
ATOM   9346  C  C     . LEU B 1 305 ? 5.602   -47.625 33.383  1.00 35.57 ? 305  LEU B C     1 
ATOM   9347  O  O     . LEU B 1 305 ? 4.392   -47.665 33.093  1.00 35.85 ? 305  LEU B O     1 
ATOM   9348  C  CB    . LEU B 1 305 ? 7.149   -46.084 32.191  1.00 32.96 ? 305  LEU B CB    1 
ATOM   9349  C  CG    . LEU B 1 305 ? 7.017   -44.931 31.241  1.00 36.70 ? 305  LEU B CG    1 
ATOM   9350  C  CD1   . LEU B 1 305 ? 6.040   -43.804 31.539  1.00 28.13 ? 305  LEU B CD1   1 
ATOM   9351  C  CD2   . LEU B 1 305 ? 8.386   -44.449 30.797  1.00 30.14 ? 305  LEU B CD2   1 
ATOM   9352  N  N     . VAL B 1 306 ? 6.347   -48.742 33.552  1.00 35.96 ? 306  VAL B N     1 
ATOM   9353  C  CA    . VAL B 1 306 ? 5.657   -50.046 33.437  1.00 34.10 ? 306  VAL B CA    1 
ATOM   9354  C  C     . VAL B 1 306 ? 4.668   -50.217 34.569  1.00 33.16 ? 306  VAL B C     1 
ATOM   9355  O  O     . VAL B 1 306 ? 3.614   -50.811 34.426  1.00 33.72 ? 306  VAL B O     1 
ATOM   9356  C  CB    . VAL B 1 306 ? 6.508   -51.253 33.096  1.00 36.61 ? 306  VAL B CB    1 
ATOM   9357  C  CG1   . VAL B 1 306 ? 7.953   -51.012 32.738  1.00 26.85 ? 306  VAL B CG1   1 
ATOM   9358  C  CG2   . VAL B 1 306 ? 6.418   -52.491 33.956  1.00 29.81 ? 306  VAL B CG2   1 
ATOM   9359  N  N     . ARG B 1 307 ? 4.986   -49.665 35.731  1.00 33.83 ? 307  ARG B N     1 
ATOM   9360  C  CA    . ARG B 1 307 ? 4.142   -49.787 36.907  1.00 34.99 ? 307  ARG B CA    1 
ATOM   9361  C  C     . ARG B 1 307 ? 2.807   -49.121 36.563  1.00 35.79 ? 307  ARG B C     1 
ATOM   9362  O  O     . ARG B 1 307 ? 1.784   -49.705 36.900  1.00 36.87 ? 307  ARG B O     1 
ATOM   9363  C  CB    . ARG B 1 307 ? 4.738   -49.132 38.178  1.00 33.47 ? 307  ARG B CB    1 
ATOM   9364  C  CG    . ARG B 1 307 ? 3.942   -49.462 39.436  1.00 29.01 ? 307  ARG B CG    1 
ATOM   9365  C  CD    . ARG B 1 307 ? 4.365   -48.624 40.626  1.00 34.64 ? 307  ARG B CD    1 
ATOM   9366  N  NE    . ARG B 1 307 ? 3.961   -47.253 40.521  1.00 38.76 ? 307  ARG B NE    1 
ATOM   9367  C  CZ    . ARG B 1 307 ? 2.780   -46.691 40.350  1.00 40.15 ? 307  ARG B CZ    1 
ATOM   9368  N  NH1   . ARG B 1 307 ? 1.684   -47.427 40.240  1.00 46.34 ? 307  ARG B NH1   1 
ATOM   9369  N  NH2   . ARG B 1 307 ? 2.684   -45.354 40.288  1.00 41.78 ? 307  ARG B NH2   1 
ATOM   9370  N  N     . LEU B 1 308 ? 2.876   -47.918 35.970  1.00 36.39 ? 308  LEU B N     1 
ATOM   9371  C  CA    . LEU B 1 308 ? 1.669   -47.196 35.642  1.00 35.85 ? 308  LEU B CA    1 
ATOM   9372  C  C     . LEU B 1 308 ? 0.794   -47.962 34.669  1.00 36.84 ? 308  LEU B C     1 
ATOM   9373  O  O     . LEU B 1 308 ? -0.413  -48.019 34.905  1.00 38.12 ? 308  LEU B O     1 
ATOM   9374  C  CB    . LEU B 1 308 ? 1.785   -45.754 35.237  1.00 36.98 ? 308  LEU B CB    1 
ATOM   9375  C  CG    . LEU B 1 308 ? 2.300   -44.748 36.262  1.00 39.75 ? 308  LEU B CG    1 
ATOM   9376  C  CD1   . LEU B 1 308 ? 2.753   -43.492 35.534  1.00 40.11 ? 308  LEU B CD1   1 
ATOM   9377  C  CD2   . LEU B 1 308 ? 1.303   -44.408 37.349  1.00 39.66 ? 308  LEU B CD2   1 
ATOM   9378  N  N     . ILE B 1 309 ? 1.396   -48.660 33.713  1.00 35.78 ? 309  ILE B N     1 
ATOM   9379  C  CA    . ILE B 1 309 ? 0.677   -49.486 32.781  1.00 34.50 ? 309  ILE B CA    1 
ATOM   9380  C  C     . ILE B 1 309 ? 0.088   -50.709 33.464  1.00 36.32 ? 309  ILE B C     1 
ATOM   9381  O  O     . ILE B 1 309 ? -0.965  -51.177 33.025  1.00 36.06 ? 309  ILE B O     1 
ATOM   9382  C  CB    . ILE B 1 309 ? 1.604   -49.861 31.635  1.00 34.69 ? 309  ILE B CB    1 
ATOM   9383  C  CG1   . ILE B 1 309 ? 2.022   -48.653 30.798  1.00 32.74 ? 309  ILE B CG1   1 
ATOM   9384  C  CG2   . ILE B 1 309 ? 1.129   -50.984 30.733  1.00 29.91 ? 309  ILE B CG2   1 
ATOM   9385  C  CD1   . ILE B 1 309 ? 3.230   -49.015 29.937  1.00 32.26 ? 309  ILE B CD1   1 
ATOM   9386  N  N     . LEU B 1 310 ? 0.789   -51.282 34.460  1.00 36.92 ? 310  LEU B N     1 
ATOM   9387  C  CA    . LEU B 1 310 ? 0.283   -52.497 35.126  1.00 35.22 ? 310  LEU B CA    1 
ATOM   9388  C  C     . LEU B 1 310 ? -0.961  -52.160 35.966  1.00 35.78 ? 310  LEU B C     1 
ATOM   9389  O  O     . LEU B 1 310 ? -1.965  -52.851 36.040  1.00 35.30 ? 310  LEU B O     1 
ATOM   9390  C  CB    . LEU B 1 310 ? 1.412   -53.063 36.012  1.00 32.09 ? 310  LEU B CB    1 
ATOM   9391  C  CG    . LEU B 1 310 ? 2.727   -53.535 35.369  1.00 31.28 ? 310  LEU B CG    1 
ATOM   9392  C  CD1   . LEU B 1 310 ? 3.527   -54.484 36.270  1.00 29.31 ? 310  LEU B CD1   1 
ATOM   9393  C  CD2   . LEU B 1 310 ? 2.451   -54.271 34.057  1.00 30.91 ? 310  LEU B CD2   1 
ATOM   9394  N  N     . VAL B 1 311 ? -0.969  -51.014 36.638  1.00 36.00 ? 311  VAL B N     1 
ATOM   9395  C  CA    . VAL B 1 311 ? -2.110  -50.559 37.428  1.00 36.93 ? 311  VAL B CA    1 
ATOM   9396  C  C     . VAL B 1 311 ? -3.299  -50.391 36.505  1.00 37.65 ? 311  VAL B C     1 
ATOM   9397  O  O     . VAL B 1 311 ? -4.373  -50.900 36.801  1.00 39.47 ? 311  VAL B O     1 
ATOM   9398  C  CB    . VAL B 1 311 ? -1.736  -49.180 38.042  1.00 40.07 ? 311  VAL B CB    1 
ATOM   9399  C  CG1   . VAL B 1 311 ? -2.933  -48.374 38.463  1.00 35.04 ? 311  VAL B CG1   1 
ATOM   9400  C  CG2   . VAL B 1 311 ? -0.651  -49.375 39.081  1.00 29.01 ? 311  VAL B CG2   1 
ATOM   9401  N  N     . LYS B 1 312 ? -3.112  -49.785 35.337  1.00 38.53 ? 312  LYS B N     1 
ATOM   9402  C  CA    . LYS B 1 312 ? -4.196  -49.612 34.391  1.00 38.54 ? 312  LYS B CA    1 
ATOM   9403  C  C     . LYS B 1 312 ? -4.756  -50.911 33.841  1.00 39.69 ? 312  LYS B C     1 
ATOM   9404  O  O     . LYS B 1 312 ? -5.972  -50.970 33.584  1.00 39.10 ? 312  LYS B O     1 
ATOM   9405  C  CB    . LYS B 1 312 ? -3.809  -48.711 33.223  1.00 41.60 ? 312  LYS B CB    1 
ATOM   9406  C  CG    . LYS B 1 312 ? -4.970  -48.472 32.260  1.00 35.88 ? 312  LYS B CG    1 
ATOM   9407  C  CD    . LYS B 1 312 ? -4.979  -47.045 31.773  1.00 40.10 ? 312  LYS B CD    1 
ATOM   9408  C  CE    . LYS B 1 312 ? -5.728  -47.023 30.430  1.00 46.10 ? 312  LYS B CE    1 
ATOM   9409  N  NZ    . LYS B 1 312 ? -6.599  -45.827 30.385  1.00 45.34 ? 312  LYS B NZ    1 
ATOM   9410  N  N     . MET B 1 313 ? -3.872  -51.830 33.448  1.00 39.52 ? 313  MET B N     1 
ATOM   9411  C  CA    . MET B 1 313 ? -4.327  -53.117 32.925  1.00 39.46 ? 313  MET B CA    1 
ATOM   9412  C  C     . MET B 1 313 ? -5.029  -53.881 34.052  1.00 41.48 ? 313  MET B C     1 
ATOM   9413  O  O     . MET B 1 313 ? -5.964  -54.684 33.865  1.00 40.72 ? 313  MET B O     1 
ATOM   9414  C  CB    . MET B 1 313 ? -3.133  -53.880 32.345  1.00 37.66 ? 313  MET B CB    1 
ATOM   9415  C  CG    . MET B 1 313 ? -2.651  -53.338 31.004  1.00 44.67 ? 313  MET B CG    1 
ATOM   9416  S  SD    . MET B 1 313 ? -1.166  -54.202 30.380  1.00 41.21 ? 313  MET B SD    1 
ATOM   9417  C  CE    . MET B 1 313 ? -0.606  -54.789 31.964  1.00 51.35 ? 313  MET B CE    1 
ATOM   9418  N  N     . ALA B 1 314 ? -4.478  -53.686 35.282  1.00 41.89 ? 314  ALA B N     1 
ATOM   9419  C  CA    . ALA B 1 314 ? -5.031  -54.326 36.458  1.00 42.58 ? 314  ALA B CA    1 
ATOM   9420  C  C     . ALA B 1 314 ? -6.453  -53.797 36.712  1.00 43.44 ? 314  ALA B C     1 
ATOM   9421  O  O     . ALA B 1 314 ? -7.351  -54.622 36.888  1.00 44.39 ? 314  ALA B O     1 
ATOM   9422  C  CB    . ALA B 1 314 ? -4.180  -54.214 37.704  1.00 38.23 ? 314  ALA B CB    1 
ATOM   9423  N  N     . LYS B 1 315 ? -6.633  -52.488 36.722  1.00 44.54 ? 315  LYS B N     1 
ATOM   9424  C  CA    . LYS B 1 315 ? -7.939  -51.876 36.903  1.00 46.99 ? 315  LYS B CA    1 
ATOM   9425  C  C     . LYS B 1 315 ? -8.919  -52.342 35.824  1.00 48.35 ? 315  LYS B C     1 
ATOM   9426  O  O     . LYS B 1 315 ? -10.098 -52.547 36.158  1.00 49.78 ? 315  LYS B O     1 
ATOM   9427  C  CB    . LYS B 1 315 ? -7.991  -50.364 36.994  1.00 42.91 ? 315  LYS B CB    1 
ATOM   9428  C  CG    . LYS B 1 315 ? -7.274  -49.724 38.156  1.00 49.25 ? 315  LYS B CG    1 
ATOM   9429  C  CD    . LYS B 1 315 ? -6.945  -48.242 37.903  1.00 47.50 ? 315  LYS B CD    1 
ATOM   9430  C  CE    . LYS B 1 315 ? -6.435  -47.571 39.165  1.00 53.23 ? 315  LYS B CE    1 
ATOM   9431  N  NZ    . LYS B 1 315 ? -5.895  -46.186 39.005  1.00 51.11 ? 315  LYS B NZ    1 
ATOM   9432  N  N     . GLU B 1 316 ? -8.463  -52.668 34.629  1.00 48.77 ? 316  GLU B N     1 
ATOM   9433  C  CA    . GLU B 1 316 ? -9.397  -53.103 33.592  1.00 49.54 ? 316  GLU B CA    1 
ATOM   9434  C  C     . GLU B 1 316 ? -9.543  -54.614 33.525  1.00 50.07 ? 316  GLU B C     1 
ATOM   9435  O  O     . GLU B 1 316 ? -9.827  -55.130 32.439  1.00 50.18 ? 316  GLU B O     1 
ATOM   9436  C  CB    . GLU B 1 316 ? -8.900  -52.555 32.242  1.00 52.17 ? 316  GLU B CB    1 
ATOM   9437  C  CG    . GLU B 1 316 ? -9.234  -51.085 32.043  1.00 52.50 ? 316  GLU B CG    1 
ATOM   9438  C  CD    . GLU B 1 316 ? -8.215  -50.343 31.216  1.00 55.94 ? 316  GLU B CD    1 
ATOM   9439  O  OE1   . GLU B 1 316 ? -8.078  -50.575 30.006  1.00 58.53 ? 316  GLU B OE1   1 
ATOM   9440  O  OE2   . GLU B 1 316 ? -7.538  -49.437 31.753  1.00 60.82 ? 316  GLU B OE2   1 
ATOM   9441  N  N     . GLY B 1 317 ? -9.101  -55.333 34.556  1.00 50.02 ? 317  GLY B N     1 
ATOM   9442  C  CA    . GLY B 1 317 ? -9.120  -56.782 34.569  1.00 49.90 ? 317  GLY B CA    1 
ATOM   9443  C  C     . GLY B 1 317 ? -8.260  -57.478 33.532  1.00 50.68 ? 317  GLY B C     1 
ATOM   9444  O  O     . GLY B 1 317 ? -8.558  -58.646 33.201  1.00 53.03 ? 317  GLY B O     1 
ATOM   9445  N  N     . LEU B 1 318 ? -7.188  -56.873 33.024  1.00 48.41 ? 318  LEU B N     1 
ATOM   9446  C  CA    . LEU B 1 318 ? -6.368  -57.557 32.034  1.00 46.96 ? 318  LEU B CA    1 
ATOM   9447  C  C     . LEU B 1 318 ? -5.131  -58.215 32.659  1.00 45.58 ? 318  LEU B C     1 
ATOM   9448  O  O     . LEU B 1 318 ? -4.351  -58.902 31.981  1.00 45.14 ? 318  LEU B O     1 
ATOM   9449  C  CB    . LEU B 1 318 ? -5.930  -56.592 30.938  1.00 47.65 ? 318  LEU B CB    1 
ATOM   9450  C  CG    . LEU B 1 318 ? -7.028  -55.819 30.203  1.00 48.87 ? 318  LEU B CG    1 
ATOM   9451  C  CD1   . LEU B 1 318 ? -6.773  -54.328 30.272  1.00 47.99 ? 318  LEU B CD1   1 
ATOM   9452  C  CD2   . LEU B 1 318 ? -7.060  -56.247 28.739  1.00 48.11 ? 318  LEU B CD2   1 
ATOM   9453  N  N     . LEU B 1 319 ? -4.954  -58.009 33.963  1.00 43.65 ? 319  LEU B N     1 
ATOM   9454  C  CA    . LEU B 1 319 ? -3.847  -58.650 34.664  1.00 41.69 ? 319  LEU B CA    1 
ATOM   9455  C  C     . LEU B 1 319 ? -4.346  -59.121 36.039  1.00 39.66 ? 319  LEU B C     1 
ATOM   9456  O  O     . LEU B 1 319 ? -5.045  -58.305 36.648  1.00 38.28 ? 319  LEU B O     1 
ATOM   9457  C  CB    . LEU B 1 319 ? -2.747  -57.627 34.983  1.00 36.72 ? 319  LEU B CB    1 
ATOM   9458  C  CG    . LEU B 1 319 ? -1.758  -57.280 33.899  1.00 38.97 ? 319  LEU B CG    1 
ATOM   9459  C  CD1   . LEU B 1 319 ? -0.848  -56.164 34.356  1.00 31.85 ? 319  LEU B CD1   1 
ATOM   9460  C  CD2   . LEU B 1 319 ? -0.960  -58.504 33.470  1.00 38.77 ? 319  LEU B CD2   1 
ATOM   9461  N  N     . PHE B 1 320 ? -3.731  -60.192 36.544  1.00 39.02 ? 320  PHE B N     1 
ATOM   9462  C  CA    . PHE B 1 320 ? -3.976  -60.613 37.923  1.00 40.30 ? 320  PHE B CA    1 
ATOM   9463  C  C     . PHE B 1 320 ? -5.480  -60.790 38.175  1.00 40.95 ? 320  PHE B C     1 
ATOM   9464  O  O     . PHE B 1 320 ? -6.018  -60.543 39.249  1.00 40.94 ? 320  PHE B O     1 
ATOM   9465  C  CB    . PHE B 1 320 ? -3.374  -59.689 38.980  1.00 36.47 ? 320  PHE B CB    1 
ATOM   9466  C  CG    . PHE B 1 320 ? -2.154  -58.907 38.543  1.00 41.18 ? 320  PHE B CG    1 
ATOM   9467  C  CD1   . PHE B 1 320 ? -1.058  -59.569 38.006  1.00 34.03 ? 320  PHE B CD1   1 
ATOM   9468  C  CD2   . PHE B 1 320 ? -2.110  -57.522 38.670  1.00 33.05 ? 320  PHE B CD2   1 
ATOM   9469  C  CE1   . PHE B 1 320 ? 0.036   -58.863 37.547  1.00 40.61 ? 320  PHE B CE1   1 
ATOM   9470  C  CE2   . PHE B 1 320 ? -1.007  -56.833 38.225  1.00 38.85 ? 320  PHE B CE2   1 
ATOM   9471  C  CZ    . PHE B 1 320 ? 0.082   -57.484 37.689  1.00 37.06 ? 320  PHE B CZ    1 
ATOM   9472  N  N     . GLU B 1 321 ? -6.175  -61.140 37.108  1.00 42.12 ? 321  GLU B N     1 
ATOM   9473  C  CA    . GLU B 1 321 ? -7.619  -61.230 37.095  1.00 44.34 ? 321  GLU B CA    1 
ATOM   9474  C  C     . GLU B 1 321 ? -8.235  -60.107 37.905  1.00 44.39 ? 321  GLU B C     1 
ATOM   9475  O  O     . GLU B 1 321 ? -9.194  -60.218 38.664  1.00 45.31 ? 321  GLU B O     1 
ATOM   9476  C  CB    . GLU B 1 321 ? -8.117  -62.641 37.272  1.00 49.01 ? 321  GLU B CB    1 
ATOM   9477  C  CG    . GLU B 1 321 ? -8.176  -63.251 38.642  1.00 55.53 ? 321  GLU B CG    1 
ATOM   9478  C  CD    . GLU B 1 321 ? -8.201  -64.771 38.654  1.00 55.98 ? 321  GLU B CD    1 
ATOM   9479  O  OE1   . GLU B 1 321 ? -7.106  -65.357 38.694  1.00 58.47 ? 321  GLU B OE1   1 
ATOM   9480  O  OE2   . GLU B 1 321 ? -9.266  -65.422 38.699  1.00 57.46 ? 321  GLU B OE2   1 
ATOM   9481  N  N     . GLY B 1 322 ? -7.661  -58.929 37.744  1.00 43.21 ? 322  GLY B N     1 
ATOM   9482  C  CA    . GLY B 1 322 ? -8.051  -57.670 38.269  1.00 42.96 ? 322  GLY B CA    1 
ATOM   9483  C  C     . GLY B 1 322 ? -7.756  -57.364 39.718  1.00 43.92 ? 322  GLY B C     1 
ATOM   9484  O  O     . GLY B 1 322 ? -8.377  -56.412 40.231  1.00 44.38 ? 322  GLY B O     1 
ATOM   9485  N  N     . ARG B 1 323 ? -6.789  -58.012 40.349  1.00 45.73 ? 323  ARG B N     1 
ATOM   9486  C  CA    . ARG B 1 323 ? -6.507  -57.680 41.741  1.00 46.10 ? 323  ARG B CA    1 
ATOM   9487  C  C     . ARG B 1 323 ? -5.433  -56.619 41.899  1.00 45.90 ? 323  ARG B C     1 
ATOM   9488  O  O     . ARG B 1 323 ? -4.290  -56.724 41.471  1.00 47.35 ? 323  ARG B O     1 
ATOM   9489  C  CB    . ARG B 1 323 ? -6.068  -58.904 42.516  1.00 48.44 ? 323  ARG B CB    1 
ATOM   9490  C  CG    . ARG B 1 323 ? -6.806  -60.243 42.342  1.00 45.14 ? 323  ARG B CG    1 
ATOM   9491  C  CD    . ARG B 1 323 ? -6.324  -61.150 43.479  1.00 41.11 ? 323  ARG B CD    1 
ATOM   9492  N  NE    . ARG B 1 323 ? -4.940  -61.533 43.090  1.00 50.42 ? 323  ARG B NE    1 
ATOM   9493  C  CZ    . ARG B 1 323 ? -4.878  -62.486 42.156  1.00 53.77 ? 323  ARG B CZ    1 
ATOM   9494  N  NH1   . ARG B 1 323 ? -6.035  -62.982 41.708  1.00 56.23 ? 323  ARG B NH1   1 
ATOM   9495  N  NH2   . ARG B 1 323 ? -3.759  -63.023 41.712  1.00 57.48 ? 323  ARG B NH2   1 
ATOM   9496  N  N     . ILE B 1 324 ? -5.851  -55.538 42.551  1.00 45.89 ? 324  ILE B N     1 
ATOM   9497  C  CA    . ILE B 1 324 ? -4.969  -54.442 42.926  1.00 43.24 ? 324  ILE B CA    1 
ATOM   9498  C  C     . ILE B 1 324 ? -4.549  -54.583 44.379  1.00 42.23 ? 324  ILE B C     1 
ATOM   9499  O  O     . ILE B 1 324 ? -5.280  -54.948 45.290  1.00 40.32 ? 324  ILE B O     1 
ATOM   9500  C  CB    . ILE B 1 324 ? -5.717  -53.114 42.745  1.00 41.09 ? 324  ILE B CB    1 
ATOM   9501  C  CG1   . ILE B 1 324 ? -6.355  -53.083 41.353  1.00 40.97 ? 324  ILE B CG1   1 
ATOM   9502  C  CG2   . ILE B 1 324 ? -4.743  -51.957 42.927  1.00 41.03 ? 324  ILE B CG2   1 
ATOM   9503  C  CD1   . ILE B 1 324 ? -7.380  -51.990 41.160  1.00 45.22 ? 324  ILE B CD1   1 
ATOM   9504  N  N     . THR B 1 325 ? -3.278  -54.287 44.648  1.00 43.01 ? 325  THR B N     1 
ATOM   9505  C  CA    . THR B 1 325 ? -2.902  -54.217 46.072  1.00 42.52 ? 325  THR B CA    1 
ATOM   9506  C  C     . THR B 1 325 ? -2.320  -52.812 46.229  1.00 43.93 ? 325  THR B C     1 
ATOM   9507  O  O     . THR B 1 325 ? -1.989  -52.152 45.243  1.00 44.70 ? 325  THR B O     1 
ATOM   9508  C  CB    . THR B 1 325 ? -1.879  -55.273 46.479  1.00 40.41 ? 325  THR B CB    1 
ATOM   9509  O  OG1   . THR B 1 325 ? -0.693  -55.038 45.693  1.00 43.89 ? 325  THR B OG1   1 
ATOM   9510  C  CG2   . THR B 1 325 ? -2.329  -56.691 46.266  1.00 28.31 ? 325  THR B CG2   1 
ATOM   9511  N  N     . PRO B 1 326 ? -2.244  -52.367 47.464  1.00 44.36 ? 326  PRO B N     1 
ATOM   9512  C  CA    . PRO B 1 326 ? -1.680  -51.083 47.802  1.00 43.34 ? 326  PRO B CA    1 
ATOM   9513  C  C     . PRO B 1 326 ? -0.277  -50.945 47.231  1.00 42.92 ? 326  PRO B C     1 
ATOM   9514  O  O     . PRO B 1 326 ? 0.121   -49.827 46.903  1.00 43.21 ? 326  PRO B O     1 
ATOM   9515  C  CB    . PRO B 1 326 ? -1.544  -51.153 49.339  1.00 42.85 ? 326  PRO B CB    1 
ATOM   9516  C  CG    . PRO B 1 326 ? -2.716  -51.983 49.699  1.00 43.95 ? 326  PRO B CG    1 
ATOM   9517  C  CD    . PRO B 1 326 ? -2.770  -53.081 48.660  1.00 44.24 ? 326  PRO B CD    1 
ATOM   9518  N  N     . GLU B 1 327 ? 0.475   -52.037 47.341  1.00 42.43 ? 327  GLU B N     1 
ATOM   9519  C  CA    . GLU B 1 327 ? 1.869   -52.023 46.948  1.00 41.90 ? 327  GLU B CA    1 
ATOM   9520  C  C     . GLU B 1 327 ? 1.943   -51.652 45.467  1.00 41.03 ? 327  GLU B C     1 
ATOM   9521  O  O     . GLU B 1 327 ? 2.695   -50.818 45.024  1.00 40.35 ? 327  GLU B O     1 
ATOM   9522  C  CB    . GLU B 1 327 ? 2.484   -53.397 47.167  1.00 47.26 ? 327  GLU B CB    1 
ATOM   9523  C  CG    . GLU B 1 327 ? 2.853   -53.810 48.553  1.00 53.78 ? 327  GLU B CG    1 
ATOM   9524  C  CD    . GLU B 1 327 ? 1.725   -54.098 49.524  1.00 60.19 ? 327  GLU B CD    1 
ATOM   9525  O  OE1   . GLU B 1 327 ? 0.756   -54.816 49.211  1.00 56.17 ? 327  GLU B OE1   1 
ATOM   9526  O  OE2   . GLU B 1 327 ? 1.836   -53.594 50.679  1.00 64.22 ? 327  GLU B OE2   1 
ATOM   9527  N  N     . LEU B 1 328 ? 1.162   -52.366 44.687  1.00 40.70 ? 328  LEU B N     1 
ATOM   9528  C  CA    . LEU B 1 328 ? 1.077   -52.204 43.244  1.00 41.19 ? 328  LEU B CA    1 
ATOM   9529  C  C     . LEU B 1 328 ? 0.881   -50.716 42.916  1.00 40.90 ? 328  LEU B C     1 
ATOM   9530  O  O     . LEU B 1 328 ? 1.566   -50.123 42.087  1.00 41.06 ? 328  LEU B O     1 
ATOM   9531  C  CB    . LEU B 1 328 ? -0.139  -53.046 42.793  1.00 42.48 ? 328  LEU B CB    1 
ATOM   9532  C  CG    . LEU B 1 328 ? -0.475  -52.986 41.313  1.00 43.51 ? 328  LEU B CG    1 
ATOM   9533  C  CD1   . LEU B 1 328 ? 0.601   -53.491 40.396  1.00 45.73 ? 328  LEU B CD1   1 
ATOM   9534  C  CD2   . LEU B 1 328 ? -1.883  -53.394 40.979  1.00 45.12 ? 328  LEU B CD2   1 
ATOM   9535  N  N     . LEU B 1 329 ? -0.025  -50.101 43.678  1.00 40.54 ? 329  LEU B N     1 
ATOM   9536  C  CA    . LEU B 1 329 ? -0.396  -48.722 43.476  1.00 39.14 ? 329  LEU B CA    1 
ATOM   9537  C  C     . LEU B 1 329 ? 0.626   -47.753 44.025  1.00 38.76 ? 329  LEU B C     1 
ATOM   9538  O  O     . LEU B 1 329 ? 0.308   -46.563 44.029  1.00 37.92 ? 329  LEU B O     1 
ATOM   9539  C  CB    . LEU B 1 329 ? -1.744  -48.371 44.134  1.00 37.77 ? 329  LEU B CB    1 
ATOM   9540  C  CG    . LEU B 1 329 ? -2.952  -49.043 43.487  1.00 39.65 ? 329  LEU B CG    1 
ATOM   9541  C  CD1   . LEU B 1 329 ? -4.211  -48.920 44.329  1.00 41.52 ? 329  LEU B CD1   1 
ATOM   9542  C  CD2   . LEU B 1 329 ? -3.175  -48.540 42.072  1.00 37.22 ? 329  LEU B CD2   1 
ATOM   9543  N  N     . THR B 1 330 ? 1.773   -48.230 44.514  1.00 38.07 ? 330  THR B N     1 
ATOM   9544  C  CA    . THR B 1 330 ? 2.639   -47.260 45.193  1.00 38.51 ? 330  THR B CA    1 
ATOM   9545  C  C     . THR B 1 330 ? 3.794   -46.708 44.397  1.00 38.53 ? 330  THR B C     1 
ATOM   9546  O  O     . THR B 1 330 ? 4.395   -47.468 43.651  1.00 40.38 ? 330  THR B O     1 
ATOM   9547  C  CB    . THR B 1 330 ? 3.182   -47.861 46.498  1.00 37.92 ? 330  THR B CB    1 
ATOM   9548  O  OG1   . THR B 1 330 ? 2.030   -48.085 47.314  1.00 35.83 ? 330  THR B OG1   1 
ATOM   9549  C  CG2   . THR B 1 330 ? 4.203   -46.926 47.087  1.00 33.88 ? 330  THR B CG2   1 
ATOM   9550  N  N     . ARG B 1 331 ? 3.945   -45.383 44.378  1.00 37.50 ? 331  ARG B N     1 
ATOM   9551  C  CA    . ARG B 1 331 ? 4.990   -44.783 43.558  1.00 36.36 ? 331  ARG B CA    1 
ATOM   9552  C  C     . ARG B 1 331 ? 6.337   -45.431 43.850  1.00 36.97 ? 331  ARG B C     1 
ATOM   9553  O  O     . ARG B 1 331 ? 6.793   -45.515 45.012  1.00 37.20 ? 331  ARG B O     1 
ATOM   9554  C  CB    . ARG B 1 331 ? 5.025   -43.267 43.806  1.00 28.31 ? 331  ARG B CB    1 
ATOM   9555  C  CG    . ARG B 1 331 ? 6.381   -42.686 43.479  1.00 29.10 ? 331  ARG B CG    1 
ATOM   9556  C  CD    . ARG B 1 331 ? 6.513   -41.194 43.881  1.00 28.63 ? 331  ARG B CD    1 
ATOM   9557  N  NE    . ARG B 1 331 ? 6.749   -40.397 42.651  1.00 39.28 ? 331  ARG B NE    1 
ATOM   9558  C  CZ    . ARG B 1 331 ? 7.991   -39.968 42.430  1.00 33.28 ? 331  ARG B CZ    1 
ATOM   9559  N  NH1   . ARG B 1 331 ? 8.832   -40.098 43.443  1.00 33.19 ? 331  ARG B NH1   1 
ATOM   9560  N  NH2   . ARG B 1 331 ? 8.305   -39.360 41.310  1.00 43.71 ? 331  ARG B NH2   1 
ATOM   9561  N  N     . GLY B 1 332 ? 7.092   -45.809 42.808  1.00 36.47 ? 332  GLY B N     1 
ATOM   9562  C  CA    . GLY B 1 332 ? 8.472   -46.231 43.020  1.00 36.52 ? 332  GLY B CA    1 
ATOM   9563  C  C     . GLY B 1 332 ? 8.565   -47.726 43.382  1.00 38.52 ? 332  GLY B C     1 
ATOM   9564  O  O     . GLY B 1 332 ? 9.669   -48.180 43.606  1.00 38.37 ? 332  GLY B O     1 
ATOM   9565  N  N     . LYS B 1 333 ? 7.479   -48.470 43.518  1.00 38.10 ? 333  LYS B N     1 
ATOM   9566  C  CA    . LYS B 1 333 ? 7.482   -49.829 43.910  1.00 40.64 ? 333  LYS B CA    1 
ATOM   9567  C  C     . LYS B 1 333 ? 7.911   -50.829 42.836  1.00 40.69 ? 333  LYS B C     1 
ATOM   9568  O  O     . LYS B 1 333 ? 8.324   -51.919 43.172  1.00 39.55 ? 333  LYS B O     1 
ATOM   9569  C  CB    . LYS B 1 333 ? 6.220   -50.231 44.673  1.00 38.82 ? 333  LYS B CB    1 
ATOM   9570  C  CG    . LYS B 1 333 ? 6.575   -50.217 46.170  1.00 43.47 ? 333  LYS B CG    1 
ATOM   9571  C  CD    . LYS B 1 333 ? 5.570   -51.027 46.974  1.00 48.33 ? 333  LYS B CD    1 
ATOM   9572  C  CE    . LYS B 1 333 ? 6.136   -51.327 48.366  1.00 45.90 ? 333  LYS B CE    1 
ATOM   9573  N  NZ    . LYS B 1 333 ? 6.796   -50.102 48.883  1.00 47.48 ? 333  LYS B NZ    1 
ATOM   9574  N  N     . PHE B 1 334 ? 8.092   -50.348 41.613  1.00 40.21 ? 334  PHE B N     1 
ATOM   9575  C  CA    . PHE B 1 334 ? 8.650   -51.135 40.522  1.00 39.50 ? 334  PHE B CA    1 
ATOM   9576  C  C     . PHE B 1 334 ? 9.830   -50.403 39.900  1.00 38.57 ? 334  PHE B C     1 
ATOM   9577  O  O     . PHE B 1 334 ? 9.681   -49.451 39.159  1.00 40.61 ? 334  PHE B O     1 
ATOM   9578  C  CB    . PHE B 1 334 ? 7.572   -51.436 39.489  1.00 39.89 ? 334  PHE B CB    1 
ATOM   9579  C  CG    . PHE B 1 334 ? 7.796   -52.595 38.574  1.00 40.75 ? 334  PHE B CG    1 
ATOM   9580  C  CD1   . PHE B 1 334 ? 8.444   -52.447 37.364  1.00 39.28 ? 334  PHE B CD1   1 
ATOM   9581  C  CD2   . PHE B 1 334 ? 7.337   -53.858 38.936  1.00 41.93 ? 334  PHE B CD2   1 
ATOM   9582  C  CE1   . PHE B 1 334 ? 8.587   -53.551 36.528  1.00 44.00 ? 334  PHE B CE1   1 
ATOM   9583  C  CE2   . PHE B 1 334 ? 7.499   -54.959 38.116  1.00 41.26 ? 334  PHE B CE2   1 
ATOM   9584  C  CZ    . PHE B 1 334 ? 8.113   -54.810 36.892  1.00 39.00 ? 334  PHE B CZ    1 
ATOM   9585  N  N     . ASN B 1 335 ? 11.039  -50.840 40.082  1.00 37.26 ? 335  ASN B N     1 
ATOM   9586  C  CA    . ASN B 1 335 ? 12.283  -50.317 39.616  1.00 36.69 ? 335  ASN B CA    1 
ATOM   9587  C  C     . ASN B 1 335 ? 12.710  -50.674 38.212  1.00 35.64 ? 335  ASN B C     1 
ATOM   9588  O  O     . ASN B 1 335 ? 12.447  -51.775 37.762  1.00 36.51 ? 335  ASN B O     1 
ATOM   9589  C  CB    . ASN B 1 335 ? 13.326  -50.984 40.592  1.00 42.58 ? 335  ASN B CB    1 
ATOM   9590  C  CG    . ASN B 1 335 ? 13.361  -50.147 41.858  1.00 44.53 ? 335  ASN B CG    1 
ATOM   9591  O  OD1   . ASN B 1 335 ? 14.300  -49.361 42.069  1.00 54.60 ? 335  ASN B OD1   1 
ATOM   9592  N  ND2   . ASN B 1 335 ? 12.293  -50.142 42.652  1.00 50.16 ? 335  ASN B ND2   1 
ATOM   9593  N  N     . THR B 1 336 ? 13.587  -49.900 37.572  1.00 35.22 ? 336  THR B N     1 
ATOM   9594  C  CA    . THR B 1 336 ? 14.205  -50.295 36.317  1.00 34.39 ? 336  THR B CA    1 
ATOM   9595  C  C     . THR B 1 336 ? 15.015  -51.579 36.436  1.00 34.55 ? 336  THR B C     1 
ATOM   9596  O  O     . THR B 1 336 ? 15.022  -52.414 35.516  1.00 35.43 ? 336  THR B O     1 
ATOM   9597  C  CB    . THR B 1 336 ? 15.063  -49.157 35.778  1.00 31.67 ? 336  THR B CB    1 
ATOM   9598  O  OG1   . THR B 1 336 ? 14.173  -48.076 35.423  1.00 34.62 ? 336  THR B OG1   1 
ATOM   9599  C  CG2   . THR B 1 336 ? 15.840  -49.612 34.563  1.00 31.83 ? 336  THR B CG2   1 
ATOM   9600  N  N     . SER B 1 337 ? 15.518  -51.858 37.632  1.00 33.85 ? 337  SER B N     1 
ATOM   9601  C  CA    . SER B 1 337 ? 16.273  -53.083 37.907  1.00 35.05 ? 337  SER B CA    1 
ATOM   9602  C  C     . SER B 1 337 ? 15.362  -54.289 37.932  1.00 35.43 ? 337  SER B C     1 
ATOM   9603  O  O     . SER B 1 337 ? 15.790  -55.357 37.504  1.00 37.75 ? 337  SER B O     1 
ATOM   9604  C  CB    . SER B 1 337 ? 17.143  -52.917 39.156  1.00 32.36 ? 337  SER B CB    1 
ATOM   9605  O  OG    . SER B 1 337 ? 16.366  -53.013 40.336  1.00 37.00 ? 337  SER B OG    1 
ATOM   9606  N  N     . ASP B 1 338 ? 14.050  -54.116 38.109  1.00 34.98 ? 338  ASP B N     1 
ATOM   9607  C  CA    . ASP B 1 338 ? 13.078  -55.176 37.997  1.00 34.41 ? 338  ASP B CA    1 
ATOM   9608  C  C     . ASP B 1 338 ? 12.733  -55.356 36.509  1.00 33.72 ? 338  ASP B C     1 
ATOM   9609  O  O     . ASP B 1 338 ? 12.584  -56.491 36.051  1.00 33.63 ? 338  ASP B O     1 
ATOM   9610  C  CB    . ASP B 1 338 ? 11.816  -54.960 38.843  1.00 36.15 ? 338  ASP B CB    1 
ATOM   9611  C  CG    . ASP B 1 338 ? 12.100  -54.954 40.332  1.00 36.37 ? 338  ASP B CG    1 
ATOM   9612  O  OD1   . ASP B 1 338 ? 12.704  -55.909 40.856  1.00 51.85 ? 338  ASP B OD1   1 
ATOM   9613  O  OD2   . ASP B 1 338 ? 11.729  -53.952 40.988  1.00 43.47 ? 338  ASP B OD2   1 
ATOM   9614  N  N     . VAL B 1 339 ? 12.779  -54.294 35.715  1.00 32.62 ? 339  VAL B N     1 
ATOM   9615  C  CA    . VAL B 1 339 ? 12.482  -54.393 34.279  1.00 31.53 ? 339  VAL B CA    1 
ATOM   9616  C  C     . VAL B 1 339 ? 13.608  -55.147 33.561  1.00 30.85 ? 339  VAL B C     1 
ATOM   9617  O  O     . VAL B 1 339 ? 13.448  -56.082 32.772  1.00 30.07 ? 339  VAL B O     1 
ATOM   9618  C  CB    . VAL B 1 339 ? 12.377  -52.978 33.652  1.00 33.71 ? 339  VAL B CB    1 
ATOM   9619  C  CG1   . VAL B 1 339 ? 12.470  -53.047 32.133  1.00 18.81 ? 339  VAL B CG1   1 
ATOM   9620  C  CG2   . VAL B 1 339 ? 11.129  -52.249 34.160  1.00 25.28 ? 339  VAL B CG2   1 
ATOM   9621  N  N     . SER B 1 340 ? 14.829  -54.862 34.021  1.00 29.59 ? 340  SER B N     1 
ATOM   9622  C  CA    . SER B 1 340 ? 15.977  -55.629 33.560  1.00 28.67 ? 340  SER B CA    1 
ATOM   9623  C  C     . SER B 1 340 ? 15.918  -57.094 33.961  1.00 28.01 ? 340  SER B C     1 
ATOM   9624  O  O     . SER B 1 340 ? 16.191  -58.031 33.185  1.00 27.43 ? 340  SER B O     1 
ATOM   9625  C  CB    . SER B 1 340 ? 17.238  -54.989 34.223  1.00 27.17 ? 340  SER B CB    1 
ATOM   9626  O  OG    . SER B 1 340 ? 17.492  -53.864 33.433  1.00 31.12 ? 340  SER B OG    1 
ATOM   9627  N  N     . ALA B 1 341 ? 15.726  -57.320 35.261  1.00 28.28 ? 341  ALA B N     1 
ATOM   9628  C  CA    . ALA B 1 341 ? 15.684  -58.732 35.696  1.00 29.23 ? 341  ALA B CA    1 
ATOM   9629  C  C     . ALA B 1 341 ? 14.600  -59.449 34.874  1.00 32.48 ? 341  ALA B C     1 
ATOM   9630  O  O     . ALA B 1 341 ? 14.628  -60.660 34.599  1.00 34.52 ? 341  ALA B O     1 
ATOM   9631  C  CB    . ALA B 1 341 ? 15.309  -58.688 37.149  1.00 29.33 ? 341  ALA B CB    1 
ATOM   9632  N  N     . ILE B 1 342 ? 13.464  -58.806 34.657  1.00 32.87 ? 342  ILE B N     1 
ATOM   9633  C  CA    . ILE B 1 342 ? 12.355  -59.502 34.017  1.00 33.52 ? 342  ILE B CA    1 
ATOM   9634  C  C     . ILE B 1 342 ? 12.685  -59.856 32.578  1.00 33.59 ? 342  ILE B C     1 
ATOM   9635  O  O     . ILE B 1 342 ? 12.127  -60.860 32.094  1.00 34.22 ? 342  ILE B O     1 
ATOM   9636  C  CB    . ILE B 1 342 ? 11.040  -58.757 34.203  1.00 36.86 ? 342  ILE B CB    1 
ATOM   9637  C  CG1   . ILE B 1 342 ? 10.632  -58.855 35.684  1.00 34.80 ? 342  ILE B CG1   1 
ATOM   9638  C  CG2   . ILE B 1 342 ? 9.918   -59.202 33.291  1.00 29.79 ? 342  ILE B CG2   1 
ATOM   9639  C  CD1   . ILE B 1 342 ? 9.538   -57.866 36.010  1.00 37.87 ? 342  ILE B CD1   1 
ATOM   9640  N  N     . GLU B 1 343 ? 13.615  -59.146 31.958  1.00 32.61 ? 343  GLU B N     1 
ATOM   9641  C  CA    . GLU B 1 343 ? 13.879  -59.402 30.539  1.00 32.58 ? 343  GLU B CA    1 
ATOM   9642  C  C     . GLU B 1 343 ? 15.042  -60.343 30.293  1.00 32.84 ? 343  GLU B C     1 
ATOM   9643  O  O     . GLU B 1 343 ? 15.558  -60.537 29.189  1.00 31.83 ? 343  GLU B O     1 
ATOM   9644  C  CB    . GLU B 1 343 ? 14.108  -58.043 29.878  1.00 33.72 ? 343  GLU B CB    1 
ATOM   9645  C  CG    . GLU B 1 343 ? 12.834  -57.298 29.515  1.00 35.42 ? 343  GLU B CG    1 
ATOM   9646  C  CD    . GLU B 1 343 ? 13.132  -56.142 28.581  1.00 38.56 ? 343  GLU B CD    1 
ATOM   9647  O  OE1   . GLU B 1 343 ? 13.419  -56.436 27.396  1.00 45.54 ? 343  GLU B OE1   1 
ATOM   9648  O  OE2   . GLU B 1 343 ? 13.099  -54.960 28.984  1.00 39.39 ? 343  GLU B OE2   1 
ATOM   9649  N  N     . LYS B 1 344 ? 15.532  -60.986 31.353  1.00 35.07 ? 344  LYS B N     1 
ATOM   9650  C  CA    . LYS B 1 344 ? 16.679  -61.901 31.162  1.00 36.86 ? 344  LYS B CA    1 
ATOM   9651  C  C     . LYS B 1 344 ? 16.209  -63.136 30.435  1.00 38.19 ? 344  LYS B C     1 
ATOM   9652  O  O     . LYS B 1 344 ? 15.086  -63.556 30.640  1.00 37.28 ? 344  LYS B O     1 
ATOM   9653  C  CB    . LYS B 1 344 ? 17.312  -62.218 32.522  1.00 39.84 ? 344  LYS B CB    1 
ATOM   9654  C  CG    . LYS B 1 344 ? 18.173  -61.014 32.905  1.00 40.96 ? 344  LYS B CG    1 
ATOM   9655  C  CD    . LYS B 1 344 ? 18.773  -61.190 34.269  1.00 46.28 ? 344  LYS B CD    1 
ATOM   9656  C  CE    . LYS B 1 344 ? 20.180  -60.546 34.294  1.00 52.09 ? 344  LYS B CE    1 
ATOM   9657  N  NZ    . LYS B 1 344 ? 20.481  -60.250 35.746  1.00 58.02 ? 344  LYS B NZ    1 
ATOM   9658  N  N     . ASN B 1 345 ? 17.039  -63.728 29.598  1.00 40.66 ? 345  ASN B N     1 
ATOM   9659  C  CA    . ASN B 1 345 ? 16.613  -64.848 28.768  1.00 42.42 ? 345  ASN B CA    1 
ATOM   9660  C  C     . ASN B 1 345 ? 16.151  -66.093 29.485  1.00 43.05 ? 345  ASN B C     1 
ATOM   9661  O  O     . ASN B 1 345 ? 15.109  -66.652 29.095  1.00 43.69 ? 345  ASN B O     1 
ATOM   9662  C  CB    . ASN B 1 345 ? 17.758  -65.234 27.803  1.00 41.94 ? 345  ASN B CB    1 
ATOM   9663  C  CG    . ASN B 1 345 ? 17.734  -64.231 26.651  1.00 46.16 ? 345  ASN B CG    1 
ATOM   9664  O  OD1   . ASN B 1 345 ? 18.776  -63.953 26.071  1.00 42.63 ? 345  ASN B OD1   1 
ATOM   9665  N  ND2   . ASN B 1 345 ? 16.534  -63.709 26.385  1.00 41.53 ? 345  ASN B ND2   1 
ATOM   9666  N  N     . LYS B 1 346 ? 16.960  -66.645 30.377  1.00 43.01 ? 346  LYS B N     1 
ATOM   9667  C  CA    . LYS B 1 346 ? 16.513  -67.915 30.974  1.00 43.26 ? 346  LYS B CA    1 
ATOM   9668  C  C     . LYS B 1 346 ? 15.689  -67.630 32.211  1.00 42.88 ? 346  LYS B C     1 
ATOM   9669  O  O     . LYS B 1 346 ? 14.821  -68.386 32.641  1.00 44.34 ? 346  LYS B O     1 
ATOM   9670  C  CB    . LYS B 1 346 ? 17.723  -68.791 31.266  1.00 46.16 ? 346  LYS B CB    1 
ATOM   9671  C  CG    . LYS B 1 346 ? 18.884  -68.803 30.290  1.00 48.37 ? 346  LYS B CG    1 
ATOM   9672  C  CD    . LYS B 1 346 ? 19.058  -70.143 29.596  1.00 53.05 ? 346  LYS B CD    1 
ATOM   9673  C  CE    . LYS B 1 346 ? 19.921  -70.152 28.350  1.00 49.20 ? 346  LYS B CE    1 
ATOM   9674  N  NZ    . LYS B 1 346 ? 19.460  -69.134 27.340  1.00 58.25 ? 346  LYS B NZ    1 
ATOM   9675  N  N     . GLU B 1 347 ? 16.065  -66.623 32.985  1.00 41.67 ? 347  GLU B N     1 
ATOM   9676  C  CA    . GLU B 1 347 ? 15.443  -66.443 34.304  1.00 39.53 ? 347  GLU B CA    1 
ATOM   9677  C  C     . GLU B 1 347 ? 14.319  -65.443 34.350  1.00 37.16 ? 347  GLU B C     1 
ATOM   9678  O  O     . GLU B 1 347 ? 13.641  -65.278 35.367  1.00 36.92 ? 347  GLU B O     1 
ATOM   9679  C  CB    . GLU B 1 347 ? 16.631  -66.089 35.221  1.00 44.74 ? 347  GLU B CB    1 
ATOM   9680  C  CG    . GLU B 1 347 ? 17.486  -64.976 34.661  1.00 54.12 ? 347  GLU B CG    1 
ATOM   9681  C  CD    . GLU B 1 347 ? 18.913  -65.219 34.237  1.00 56.56 ? 347  GLU B CD    1 
ATOM   9682  O  OE1   . GLU B 1 347 ? 19.815  -65.085 35.106  1.00 56.73 ? 347  GLU B OE1   1 
ATOM   9683  O  OE2   . GLU B 1 347 ? 19.176  -65.419 33.014  1.00 54.61 ? 347  GLU B OE2   1 
ATOM   9684  N  N     . GLY B 1 348 ? 14.076  -64.691 33.275  1.00 35.70 ? 348  GLY B N     1 
ATOM   9685  C  CA    . GLY B 1 348 ? 13.154  -63.579 33.271  1.00 34.95 ? 348  GLY B CA    1 
ATOM   9686  C  C     . GLY B 1 348 ? 11.771  -63.833 33.863  1.00 34.00 ? 348  GLY B C     1 
ATOM   9687  O  O     . GLY B 1 348 ? 11.220  -63.104 34.702  1.00 33.68 ? 348  GLY B O     1 
ATOM   9688  N  N     . LEU B 1 349 ? 11.177  -64.929 33.447  1.00 32.84 ? 349  LEU B N     1 
ATOM   9689  C  CA    . LEU B 1 349 ? 9.876   -65.341 33.928  1.00 34.44 ? 349  LEU B CA    1 
ATOM   9690  C  C     . LEU B 1 349 ? 9.950   -65.793 35.379  1.00 33.55 ? 349  LEU B C     1 
ATOM   9691  O  O     . LEU B 1 349 ? 9.041   -65.465 36.160  1.00 34.21 ? 349  LEU B O     1 
ATOM   9692  C  CB    . LEU B 1 349 ? 9.323   -66.392 33.007  1.00 34.25 ? 349  LEU B CB    1 
ATOM   9693  C  CG    . LEU B 1 349 ? 8.462   -65.966 31.831  1.00 39.66 ? 349  LEU B CG    1 
ATOM   9694  C  CD1   . LEU B 1 349 ? 8.511   -64.533 31.418  1.00 38.92 ? 349  LEU B CD1   1 
ATOM   9695  C  CD2   . LEU B 1 349 ? 8.596   -66.971 30.710  1.00 35.49 ? 349  LEU B CD2   1 
ATOM   9696  N  N     . HIS B 1 350 ? 11.040  -66.406 35.772  1.00 33.24 ? 350  HIS B N     1 
ATOM   9697  C  CA    . HIS B 1 350 ? 11.143  -66.749 37.206  1.00 34.62 ? 350  HIS B CA    1 
ATOM   9698  C  C     . HIS B 1 350 ? 11.261  -65.469 38.044  1.00 32.91 ? 350  HIS B C     1 
ATOM   9699  O  O     . HIS B 1 350 ? 10.574  -65.313 39.039  1.00 31.21 ? 350  HIS B O     1 
ATOM   9700  C  CB    . HIS B 1 350 ? 12.318  -67.693 37.450  1.00 40.57 ? 350  HIS B CB    1 
ATOM   9701  C  CG    . HIS B 1 350 ? 12.048  -69.054 36.858  1.00 52.31 ? 350  HIS B CG    1 
ATOM   9702  N  ND1   . HIS B 1 350 ? 13.067  -69.959 36.564  1.00 57.56 ? 350  HIS B ND1   1 
ATOM   9703  C  CD2   . HIS B 1 350 ? 10.901  -69.655 36.476  1.00 53.01 ? 350  HIS B CD2   1 
ATOM   9704  C  CE1   . HIS B 1 350 ? 12.544  -71.055 36.052  1.00 56.47 ? 350  HIS B CE1   1 
ATOM   9705  N  NE2   . HIS B 1 350 ? 11.240  -70.901 35.985  1.00 54.23 ? 350  HIS B NE2   1 
ATOM   9706  N  N     . ASN B 1 351 ? 11.997  -64.487 37.532  1.00 31.93 ? 351  ASN B N     1 
ATOM   9707  C  CA    . ASN B 1 351 ? 12.148  -63.211 38.215  1.00 31.28 ? 351  ASN B CA    1 
ATOM   9708  C  C     . ASN B 1 351 ? 10.820  -62.485 38.253  1.00 31.10 ? 351  ASN B C     1 
ATOM   9709  O  O     . ASN B 1 351 ? 10.481  -61.958 39.314  1.00 31.50 ? 351  ASN B O     1 
ATOM   9710  C  CB    . ASN B 1 351 ? 13.214  -62.389 37.458  1.00 29.05 ? 351  ASN B CB    1 
ATOM   9711  C  CG    . ASN B 1 351 ? 14.606  -62.921 37.697  1.00 29.38 ? 351  ASN B CG    1 
ATOM   9712  O  OD1   . ASN B 1 351 ? 15.516  -62.727 36.877  1.00 29.92 ? 351  ASN B OD1   1 
ATOM   9713  N  ND2   . ASN B 1 351 ? 14.769  -63.488 38.875  1.00 23.59 ? 351  ASN B ND2   1 
ATOM   9714  N  N     . ALA B 1 352 ? 10.057  -62.425 37.149  1.00 30.37 ? 352  ALA B N     1 
ATOM   9715  C  CA    . ALA B 1 352 ? 8.747   -61.787 37.217  1.00 29.94 ? 352  ALA B CA    1 
ATOM   9716  C  C     . ALA B 1 352 ? 7.804   -62.343 38.260  1.00 31.33 ? 352  ALA B C     1 
ATOM   9717  O  O     . ALA B 1 352 ? 7.055   -61.612 38.951  1.00 33.73 ? 352  ALA B O     1 
ATOM   9718  C  CB    . ALA B 1 352 ? 8.128   -61.842 35.824  1.00 31.80 ? 352  ALA B CB    1 
ATOM   9719  N  N     . LYS B 1 353 ? 7.752   -63.643 38.469  1.00 32.71 ? 353  LYS B N     1 
ATOM   9720  C  CA    . LYS B 1 353 ? 6.842   -64.266 39.434  1.00 34.01 ? 353  LYS B CA    1 
ATOM   9721  C  C     . LYS B 1 353 ? 7.215   -63.854 40.854  1.00 34.25 ? 353  LYS B C     1 
ATOM   9722  O  O     . LYS B 1 353 ? 6.350   -63.427 41.622  1.00 34.56 ? 353  LYS B O     1 
ATOM   9723  C  CB    . LYS B 1 353 ? 6.845   -65.788 39.253  1.00 36.84 ? 353  LYS B CB    1 
ATOM   9724  C  CG    . LYS B 1 353 ? 5.870   -66.562 40.118  1.00 41.67 ? 353  LYS B CG    1 
ATOM   9725  C  CD    . LYS B 1 353 ? 5.960   -68.069 39.921  1.00 41.20 ? 353  LYS B CD    1 
ATOM   9726  C  CE    . LYS B 1 353 ? 4.610   -68.744 40.102  1.00 47.96 ? 353  LYS B CE    1 
ATOM   9727  N  NZ    . LYS B 1 353 ? 3.501   -67.965 39.460  1.00 52.00 ? 353  LYS B NZ    1 
ATOM   9728  N  N     . GLU B 1 354 ? 8.487   -63.964 41.219  1.00 33.57 ? 354  GLU B N     1 
ATOM   9729  C  CA    . GLU B 1 354 ? 8.977   -63.557 42.539  1.00 34.46 ? 354  GLU B CA    1 
ATOM   9730  C  C     . GLU B 1 354 ? 8.646   -62.143 42.894  1.00 34.05 ? 354  GLU B C     1 
ATOM   9731  O  O     . GLU B 1 354 ? 8.184   -61.791 43.973  1.00 34.88 ? 354  GLU B O     1 
ATOM   9732  C  CB    . GLU B 1 354 ? 10.470  -63.879 42.641  1.00 28.31 ? 354  GLU B CB    1 
ATOM   9733  C  CG    . GLU B 1 354 ? 11.195  -63.644 43.954  1.00 31.38 ? 354  GLU B CG    1 
ATOM   9734  C  CD    . GLU B 1 354 ? 12.577  -64.262 43.940  1.00 37.60 ? 354  GLU B CD    1 
ATOM   9735  O  OE1   . GLU B 1 354 ? 13.365  -64.100 42.991  1.00 36.58 ? 354  GLU B OE1   1 
ATOM   9736  O  OE2   . GLU B 1 354 ? 12.903  -65.023 44.872  1.00 41.92 ? 354  GLU B OE2   1 
ATOM   9737  N  N     . ILE B 1 355 ? 8.873   -61.252 41.932  1.00 35.17 ? 355  ILE B N     1 
ATOM   9738  C  CA    . ILE B 1 355 ? 8.663   -59.836 42.170  1.00 36.08 ? 355  ILE B CA    1 
ATOM   9739  C  C     . ILE B 1 355 ? 7.201   -59.427 42.220  1.00 36.20 ? 355  ILE B C     1 
ATOM   9740  O  O     . ILE B 1 355 ? 6.837   -58.580 43.032  1.00 35.34 ? 355  ILE B O     1 
ATOM   9741  C  CB    . ILE B 1 355 ? 9.369   -59.020 41.070  1.00 31.90 ? 355  ILE B CB    1 
ATOM   9742  C  CG1   . ILE B 1 355 ? 10.882  -59.230 41.198  1.00 34.85 ? 355  ILE B CG1   1 
ATOM   9743  C  CG2   . ILE B 1 355 ? 9.011   -57.551 41.159  1.00 34.57 ? 355  ILE B CG2   1 
ATOM   9744  C  CD1   . ILE B 1 355 ? 11.606  -58.931 39.909  1.00 29.61 ? 355  ILE B CD1   1 
ATOM   9745  N  N     . LEU B 1 356 ? 6.396   -60.041 41.348  1.00 36.24 ? 356  LEU B N     1 
ATOM   9746  C  CA    . LEU B 1 356 ? 4.973   -59.665 41.303  1.00 35.56 ? 356  LEU B CA    1 
ATOM   9747  C  C     . LEU B 1 356 ? 4.303   -60.265 42.536  1.00 35.95 ? 356  LEU B C     1 
ATOM   9748  O  O     . LEU B 1 356 ? 3.338   -59.785 43.112  1.00 35.19 ? 356  LEU B O     1 
ATOM   9749  C  CB    . LEU B 1 356 ? 4.329   -60.164 40.017  1.00 35.08 ? 356  LEU B CB    1 
ATOM   9750  C  CG    . LEU B 1 356 ? 4.626   -59.460 38.702  1.00 40.13 ? 356  LEU B CG    1 
ATOM   9751  C  CD1   . LEU B 1 356 ? 4.298   -60.352 37.496  1.00 34.30 ? 356  LEU B CD1   1 
ATOM   9752  C  CD2   . LEU B 1 356 ? 3.948   -58.106 38.613  1.00 33.29 ? 356  LEU B CD2   1 
ATOM   9753  N  N     . THR B 1 357 ? 4.815   -61.471 42.884  1.00 36.67 ? 357  THR B N     1 
ATOM   9754  C  CA    . THR B 1 357 ? 4.401   -62.181 44.087  1.00 36.75 ? 357  THR B CA    1 
ATOM   9755  C  C     . THR B 1 357 ? 4.685   -61.354 45.349  1.00 35.64 ? 357  THR B C     1 
ATOM   9756  O  O     . THR B 1 357 ? 3.778   -61.214 46.169  1.00 35.45 ? 357  THR B O     1 
ATOM   9757  C  CB    . THR B 1 357 ? 5.108   -63.540 44.243  1.00 39.48 ? 357  THR B CB    1 
ATOM   9758  O  OG1   . THR B 1 357 ? 4.522   -64.356 43.224  1.00 38.96 ? 357  THR B OG1   1 
ATOM   9759  C  CG2   . THR B 1 357 ? 4.921   -64.185 45.616  1.00 35.01 ? 357  THR B CG2   1 
ATOM   9760  N  N     . ARG B 1 358 ? 5.835   -60.741 45.379  1.00 34.07 ? 358  ARG B N     1 
ATOM   9761  C  CA    . ARG B 1 358 ? 6.192   -59.768 46.380  1.00 36.07 ? 358  ARG B CA    1 
ATOM   9762  C  C     . ARG B 1 358 ? 5.318   -58.532 46.315  1.00 37.75 ? 358  ARG B C     1 
ATOM   9763  O  O     . ARG B 1 358 ? 5.152   -57.901 47.375  1.00 38.77 ? 358  ARG B O     1 
ATOM   9764  C  CB    . ARG B 1 358 ? 7.676   -59.384 46.285  1.00 36.65 ? 358  ARG B CB    1 
ATOM   9765  C  CG    . ARG B 1 358 ? 8.171   -58.440 47.349  1.00 36.12 ? 358  ARG B CG    1 
ATOM   9766  C  CD    . ARG B 1 358 ? 7.728   -59.007 48.695  1.00 46.50 ? 358  ARG B CD    1 
ATOM   9767  N  NE    . ARG B 1 358 ? 8.142   -58.227 49.847  1.00 52.77 ? 358  ARG B NE    1 
ATOM   9768  C  CZ    . ARG B 1 358 ? 9.380   -57.929 50.223  1.00 54.82 ? 358  ARG B CZ    1 
ATOM   9769  N  NH1   . ARG B 1 358 ? 10.439  -58.333 49.530  1.00 56.52 ? 358  ARG B NH1   1 
ATOM   9770  N  NH2   . ARG B 1 358 ? 9.552   -57.208 51.326  1.00 58.46 ? 358  ARG B NH2   1 
ATOM   9771  N  N     . LEU B 1 359 ? 4.699   -58.242 45.170  1.00 37.93 ? 359  LEU B N     1 
ATOM   9772  C  CA    . LEU B 1 359 ? 3.845   -57.042 45.158  1.00 39.05 ? 359  LEU B CA    1 
ATOM   9773  C  C     . LEU B 1 359 ? 2.433   -57.386 45.602  1.00 40.88 ? 359  LEU B C     1 
ATOM   9774  O  O     . LEU B 1 359 ? 1.535   -56.548 45.639  1.00 40.40 ? 359  LEU B O     1 
ATOM   9775  C  CB    . LEU B 1 359 ? 3.892   -56.394 43.801  1.00 43.13 ? 359  LEU B CB    1 
ATOM   9776  C  CG    . LEU B 1 359 ? 4.641   -55.166 43.341  1.00 44.75 ? 359  LEU B CG    1 
ATOM   9777  C  CD1   . LEU B 1 359 ? 5.257   -54.296 44.405  1.00 42.06 ? 359  LEU B CD1   1 
ATOM   9778  C  CD2   . LEU B 1 359 ? 5.671   -55.507 42.270  1.00 46.60 ? 359  LEU B CD2   1 
ATOM   9779  N  N     . GLY B 1 360 ? 2.114   -58.660 45.839  1.00 41.42 ? 360  GLY B N     1 
ATOM   9780  C  CA    . GLY B 1 360 ? 0.888   -59.167 46.349  1.00 40.27 ? 360  GLY B CA    1 
ATOM   9781  C  C     . GLY B 1 360 ? -0.180  -59.597 45.377  1.00 41.08 ? 360  GLY B C     1 
ATOM   9782  O  O     . GLY B 1 360 ? -1.310  -59.956 45.776  1.00 40.15 ? 360  GLY B O     1 
ATOM   9783  N  N     . VAL B 1 361 ? 0.058   -59.524 44.062  1.00 42.20 ? 361  VAL B N     1 
ATOM   9784  C  CA    . VAL B 1 361 ? -1.058  -59.867 43.173  1.00 42.28 ? 361  VAL B CA    1 
ATOM   9785  C  C     . VAL B 1 361 ? -1.220  -61.337 42.861  1.00 41.34 ? 361  VAL B C     1 
ATOM   9786  O  O     . VAL B 1 361 ? -2.037  -61.665 41.989  1.00 38.99 ? 361  VAL B O     1 
ATOM   9787  C  CB    . VAL B 1 361 ? -1.120  -58.997 41.912  1.00 42.72 ? 361  VAL B CB    1 
ATOM   9788  C  CG1   . VAL B 1 361 ? -1.461  -57.601 42.348  1.00 46.65 ? 361  VAL B CG1   1 
ATOM   9789  C  CG2   . VAL B 1 361 ? 0.156   -59.159 41.113  1.00 40.40 ? 361  VAL B CG2   1 
ATOM   9790  N  N     . GLU B 1 362 ? -0.547  -62.218 43.593  1.00 42.28 ? 362  GLU B N     1 
ATOM   9791  C  CA    . GLU B 1 362 ? -0.788  -63.657 43.326  1.00 43.25 ? 362  GLU B CA    1 
ATOM   9792  C  C     . GLU B 1 362 ? -0.816  -63.847 41.806  1.00 42.38 ? 362  GLU B C     1 
ATOM   9793  O  O     . GLU B 1 362 ? -1.821  -64.277 41.237  1.00 43.19 ? 362  GLU B O     1 
ATOM   9794  C  CB    . GLU B 1 362 ? -2.129  -64.085 43.892  1.00 45.08 ? 362  GLU B CB    1 
ATOM   9795  C  CG    . GLU B 1 362 ? -2.298  -63.888 45.393  1.00 53.60 ? 362  GLU B CG    1 
ATOM   9796  C  CD    . GLU B 1 362 ? -3.787  -63.821 45.702  1.00 57.50 ? 362  GLU B CD    1 
ATOM   9797  O  OE1   . GLU B 1 362 ? -4.587  -64.414 44.933  1.00 59.35 ? 362  GLU B OE1   1 
ATOM   9798  O  OE2   . GLU B 1 362 ? -4.155  -63.136 46.675  1.00 61.30 ? 362  GLU B OE2   1 
ATOM   9799  N  N     . PRO B 1 363 ? 0.350   -63.699 41.197  1.00 42.15 ? 363  PRO B N     1 
ATOM   9800  C  CA    . PRO B 1 363 ? 0.484   -63.739 39.761  1.00 41.78 ? 363  PRO B CA    1 
ATOM   9801  C  C     . PRO B 1 363 ? 0.318   -65.123 39.147  1.00 42.49 ? 363  PRO B C     1 
ATOM   9802  O  O     . PRO B 1 363 ? 1.008   -66.036 39.621  1.00 43.61 ? 363  PRO B O     1 
ATOM   9803  C  CB    . PRO B 1 363 ? 1.963   -63.353 39.541  1.00 41.47 ? 363  PRO B CB    1 
ATOM   9804  C  CG    . PRO B 1 363 ? 2.646   -63.714 40.810  1.00 41.25 ? 363  PRO B CG    1 
ATOM   9805  C  CD    . PRO B 1 363 ? 1.638   -63.431 41.889  1.00 42.02 ? 363  PRO B CD    1 
ATOM   9806  N  N     . SER B 1 364 ? -0.199  -65.221 37.922  1.00 41.32 ? 364  SER B N     1 
ATOM   9807  C  CA    . SER B 1 364 ? -0.152  -66.489 37.203  1.00 40.87 ? 364  SER B CA    1 
ATOM   9808  C  C     . SER B 1 364 ? 1.007   -66.494 36.211  1.00 41.44 ? 364  SER B C     1 
ATOM   9809  O  O     . SER B 1 364 ? 1.622   -65.486 35.825  1.00 41.58 ? 364  SER B O     1 
ATOM   9810  C  CB    . SER B 1 364 ? -1.470  -66.700 36.425  1.00 38.60 ? 364  SER B CB    1 
ATOM   9811  O  OG    . SER B 1 364 ? -1.585  -65.734 35.389  1.00 40.81 ? 364  SER B OG    1 
ATOM   9812  N  N     . ASP B 1 365 ? 1.219   -67.650 35.605  1.00 41.94 ? 365  ASP B N     1 
ATOM   9813  C  CA    . ASP B 1 365 ? 2.216   -67.794 34.571  1.00 43.36 ? 365  ASP B CA    1 
ATOM   9814  C  C     . ASP B 1 365 ? 1.932   -66.898 33.381  1.00 44.89 ? 365  ASP B C     1 
ATOM   9815  O  O     . ASP B 1 365 ? 2.839   -66.148 32.972  1.00 45.70 ? 365  ASP B O     1 
ATOM   9816  C  CB    . ASP B 1 365 ? 2.560   -69.244 34.355  1.00 45.14 ? 365  ASP B CB    1 
ATOM   9817  C  CG    . ASP B 1 365 ? 3.233   -69.902 35.551  1.00 49.56 ? 365  ASP B CG    1 
ATOM   9818  O  OD1   . ASP B 1 365 ? 3.835   -69.317 36.478  1.00 49.55 ? 365  ASP B OD1   1 
ATOM   9819  O  OD2   . ASP B 1 365 ? 3.137   -71.151 35.629  1.00 56.32 ? 365  ASP B OD2   1 
ATOM   9820  N  N     . ASP B 1 366 ? 0.699   -66.764 32.910  1.00 44.60 ? 366  ASP B N     1 
ATOM   9821  C  CA    . ASP B 1 366 ? 0.318   -65.787 31.900  1.00 44.28 ? 366  ASP B CA    1 
ATOM   9822  C  C     . ASP B 1 366 ? 0.646   -64.354 32.349  1.00 41.85 ? 366  ASP B C     1 
ATOM   9823  O  O     . ASP B 1 366 ? 1.314   -63.661 31.574  1.00 41.95 ? 366  ASP B O     1 
ATOM   9824  C  CB    . ASP B 1 366 ? -1.178  -65.794 31.528  1.00 50.50 ? 366  ASP B CB    1 
ATOM   9825  C  CG    . ASP B 1 366 ? -1.553  -67.025 30.724  1.00 58.99 ? 366  ASP B CG    1 
ATOM   9826  O  OD1   . ASP B 1 366 ? -0.647  -67.544 30.035  1.00 56.45 ? 366  ASP B OD1   1 
ATOM   9827  O  OD2   . ASP B 1 366 ? -2.737  -67.485 30.813  1.00 66.56 ? 366  ASP B OD2   1 
ATOM   9828  N  N     . ASP B 1 367 ? 0.241   -63.958 33.551  1.00 39.51 ? 367  ASP B N     1 
ATOM   9829  C  CA    . ASP B 1 367 ? 0.619   -62.623 34.015  1.00 38.92 ? 367  ASP B CA    1 
ATOM   9830  C  C     . ASP B 1 367 ? 2.128   -62.375 33.901  1.00 38.26 ? 367  ASP B C     1 
ATOM   9831  O  O     . ASP B 1 367 ? 2.556   -61.335 33.432  1.00 37.05 ? 367  ASP B O     1 
ATOM   9832  C  CB    . ASP B 1 367 ? 0.205   -62.311 35.423  1.00 40.29 ? 367  ASP B CB    1 
ATOM   9833  C  CG    . ASP B 1 367 ? -1.267  -62.473 35.734  1.00 44.76 ? 367  ASP B CG    1 
ATOM   9834  O  OD1   . ASP B 1 367 ? -2.062  -61.898 34.948  1.00 42.67 ? 367  ASP B OD1   1 
ATOM   9835  O  OD2   . ASP B 1 367 ? -1.535  -63.139 36.775  1.00 43.41 ? 367  ASP B OD2   1 
ATOM   9836  N  N     . CYS B 1 368 ? 2.943   -63.379 34.231  1.00 38.58 ? 368  CYS B N     1 
ATOM   9837  C  CA    . CYS B 1 368 ? 4.384   -63.194 34.110  1.00 37.04 ? 368  CYS B CA    1 
ATOM   9838  C  C     . CYS B 1 368 ? 4.742   -62.957 32.661  1.00 36.84 ? 368  CYS B C     1 
ATOM   9839  O  O     . CYS B 1 368 ? 5.530   -62.061 32.395  1.00 35.44 ? 368  CYS B O     1 
ATOM   9840  C  CB    . CYS B 1 368 ? 5.155   -64.358 34.728  1.00 35.29 ? 368  CYS B CB    1 
ATOM   9841  S  SG    . CYS B 1 368 ? 4.906   -64.550 36.510  1.00 37.01 ? 368  CYS B SG    1 
ATOM   9842  N  N     . VAL B 1 369 ? 4.125   -63.686 31.714  1.00 38.66 ? 369  VAL B N     1 
ATOM   9843  C  CA    . VAL B 1 369 ? 4.516   -63.412 30.331  1.00 39.18 ? 369  VAL B CA    1 
ATOM   9844  C  C     . VAL B 1 369 ? 3.967   -62.086 29.860  1.00 38.93 ? 369  VAL B C     1 
ATOM   9845  O  O     . VAL B 1 369 ? 4.656   -61.433 29.077  1.00 39.29 ? 369  VAL B O     1 
ATOM   9846  C  CB    . VAL B 1 369 ? 4.498   -64.544 29.326  1.00 44.93 ? 369  VAL B CB    1 
ATOM   9847  C  CG1   . VAL B 1 369 ? 4.207   -65.888 29.946  1.00 39.50 ? 369  VAL B CG1   1 
ATOM   9848  C  CG2   . VAL B 1 369 ? 3.739   -64.324 28.051  1.00 37.95 ? 369  VAL B CG2   1 
ATOM   9849  N  N     . SER B 1 370 ? 2.875   -61.619 30.474  1.00 37.05 ? 370  SER B N     1 
ATOM   9850  C  CA    . SER B 1 370 ? 2.334   -60.328 30.108  1.00 37.00 ? 370  SER B CA    1 
ATOM   9851  C  C     . SER B 1 370 ? 3.195   -59.180 30.653  1.00 36.95 ? 370  SER B C     1 
ATOM   9852  O  O     . SER B 1 370 ? 3.438   -58.200 29.951  1.00 36.32 ? 370  SER B O     1 
ATOM   9853  C  CB    . SER B 1 370 ? 0.917   -60.220 30.694  1.00 38.40 ? 370  SER B CB    1 
ATOM   9854  O  OG    . SER B 1 370 ? -0.004  -60.749 29.771  1.00 41.12 ? 370  SER B OG    1 
ATOM   9855  N  N     . VAL B 1 371 ? 3.650   -59.281 31.902  1.00 35.36 ? 371  VAL B N     1 
ATOM   9856  C  CA    . VAL B 1 371 ? 4.502   -58.273 32.498  1.00 35.33 ? 371  VAL B CA    1 
ATOM   9857  C  C     . VAL B 1 371 ? 5.867   -58.195 31.803  1.00 35.65 ? 371  VAL B C     1 
ATOM   9858  O  O     . VAL B 1 371 ? 6.451   -57.102 31.619  1.00 37.21 ? 371  VAL B O     1 
ATOM   9859  C  CB    . VAL B 1 371 ? 4.606   -58.475 34.010  1.00 31.68 ? 371  VAL B CB    1 
ATOM   9860  C  CG1   . VAL B 1 371 ? 5.747   -57.658 34.611  1.00 29.46 ? 371  VAL B CG1   1 
ATOM   9861  C  CG2   . VAL B 1 371 ? 3.294   -58.125 34.682  1.00 32.23 ? 371  VAL B CG2   1 
ATOM   9862  N  N     . GLN B 1 372 ? 6.360   -59.318 31.284  1.00 33.81 ? 372  GLN B N     1 
ATOM   9863  C  CA    . GLN B 1 372 ? 7.567   -59.310 30.483  1.00 32.42 ? 372  GLN B CA    1 
ATOM   9864  C  C     . GLN B 1 372 ? 7.417   -58.505 29.201  1.00 34.27 ? 372  GLN B C     1 
ATOM   9865  O  O     . GLN B 1 372 ? 8.384   -57.872 28.719  1.00 35.94 ? 372  GLN B O     1 
ATOM   9866  C  CB    . GLN B 1 372 ? 7.954   -60.750 30.168  1.00 28.96 ? 372  GLN B CB    1 
ATOM   9867  C  CG    . GLN B 1 372 ? 9.372   -60.903 29.625  1.00 32.55 ? 372  GLN B CG    1 
ATOM   9868  C  CD    . GLN B 1 372 ? 9.752   -62.350 29.403  1.00 34.46 ? 372  GLN B CD    1 
ATOM   9869  O  OE1   . GLN B 1 372 ? 9.075   -62.989 28.594  1.00 32.22 ? 372  GLN B OE1   1 
ATOM   9870  N  NE2   . GLN B 1 372 ? 10.775  -62.802 30.120  1.00 27.04 ? 372  GLN B NE2   1 
ATOM   9871  N  N     . HIS B 1 373 ? 6.260   -58.618 28.546  1.00 33.29 ? 373  HIS B N     1 
ATOM   9872  C  CA    . HIS B 1 373 ? 5.958   -58.088 27.254  1.00 32.88 ? 373  HIS B CA    1 
ATOM   9873  C  C     . HIS B 1 373 ? 5.893   -56.583 27.426  1.00 32.68 ? 373  HIS B C     1 
ATOM   9874  O  O     . HIS B 1 373 ? 6.543   -55.809 26.727  1.00 33.13 ? 373  HIS B O     1 
ATOM   9875  C  CB    . HIS B 1 373 ? 4.757   -58.715 26.467  1.00 27.87 ? 373  HIS B CB    1 
ATOM   9876  C  CG    . HIS B 1 373 ? 4.929   -58.479 24.993  1.00 33.72 ? 373  HIS B CG    1 
ATOM   9877  N  ND1   . HIS B 1 373 ? 4.046   -57.767 24.209  1.00 32.93 ? 373  HIS B ND1   1 
ATOM   9878  C  CD2   . HIS B 1 373 ? 6.012   -58.717 24.181  1.00 32.59 ? 373  HIS B CD2   1 
ATOM   9879  C  CE1   . HIS B 1 373 ? 4.579   -57.534 23.008  1.00 27.25 ? 373  HIS B CE1   1 
ATOM   9880  N  NE2   . HIS B 1 373 ? 5.758   -58.098 22.956  1.00 31.25 ? 373  HIS B NE2   1 
ATOM   9881  N  N     . VAL B 1 374 ? 5.291   -56.145 28.514  1.00 33.46 ? 374  VAL B N     1 
ATOM   9882  C  CA    . VAL B 1 374 ? 5.209   -54.711 28.787  1.00 33.42 ? 374  VAL B CA    1 
ATOM   9883  C  C     . VAL B 1 374 ? 6.593   -54.090 29.070  1.00 32.47 ? 374  VAL B C     1 
ATOM   9884  O  O     . VAL B 1 374 ? 6.968   -53.048 28.506  1.00 32.74 ? 374  VAL B O     1 
ATOM   9885  C  CB    . VAL B 1 374 ? 4.329   -54.472 30.044  1.00 34.13 ? 374  VAL B CB    1 
ATOM   9886  C  CG1   . VAL B 1 374 ? 4.381   -52.975 30.356  1.00 32.70 ? 374  VAL B CG1   1 
ATOM   9887  C  CG2   . VAL B 1 374 ? 2.915   -54.913 29.736  1.00 32.54 ? 374  VAL B CG2   1 
ATOM   9888  N  N     . CYS B 1 375 ? 7.361   -54.740 29.918  1.00 30.28 ? 375  CYS B N     1 
ATOM   9889  C  CA    . CYS B 1 375 ? 8.746   -54.379 30.162  1.00 29.65 ? 375  CYS B CA    1 
ATOM   9890  C  C     . CYS B 1 375 ? 9.457   -54.317 28.823  1.00 29.84 ? 375  CYS B C     1 
ATOM   9891  O  O     . CYS B 1 375 ? 10.212  -53.384 28.585  1.00 31.39 ? 375  CYS B O     1 
ATOM   9892  C  CB    . CYS B 1 375 ? 9.429   -55.465 31.020  1.00 26.53 ? 375  CYS B CB    1 
ATOM   9893  S  SG    . CYS B 1 375 ? 8.894   -55.383 32.725  1.00 29.42 ? 375  CYS B SG    1 
ATOM   9894  N  N     . THR B 1 376 ? 9.226   -55.305 27.973  1.00 31.58 ? 376  THR B N     1 
ATOM   9895  C  CA    . THR B 1 376 ? 9.898   -55.327 26.670  1.00 33.26 ? 376  THR B CA    1 
ATOM   9896  C  C     . THR B 1 376 ? 9.571   -54.092 25.847  1.00 34.02 ? 376  THR B C     1 
ATOM   9897  O  O     . THR B 1 376 ? 10.409  -53.593 25.110  1.00 34.84 ? 376  THR B O     1 
ATOM   9898  C  CB    . THR B 1 376 ? 9.615   -56.592 25.831  1.00 33.90 ? 376  THR B CB    1 
ATOM   9899  O  OG1   . THR B 1 376 ? 10.316  -57.685 26.437  1.00 32.56 ? 376  THR B OG1   1 
ATOM   9900  C  CG2   . THR B 1 376 ? 10.165  -56.510 24.389  1.00 25.65 ? 376  THR B CG2   1 
ATOM   9901  N  N     . ILE B 1 377 ? 8.306   -53.679 25.799  1.00 34.10 ? 377  ILE B N     1 
ATOM   9902  C  CA    . ILE B 1 377 ? 7.967   -52.560 24.903  1.00 31.94 ? 377  ILE B CA    1 
ATOM   9903  C  C     . ILE B 1 377 ? 8.427   -51.262 25.543  1.00 31.59 ? 377  ILE B C     1 
ATOM   9904  O  O     . ILE B 1 377 ? 8.851   -50.335 24.844  1.00 31.94 ? 377  ILE B O     1 
ATOM   9905  C  CB    . ILE B 1 377 ? 6.447   -52.580 24.708  1.00 33.12 ? 377  ILE B CB    1 
ATOM   9906  C  CG1   . ILE B 1 377 ? 6.047   -53.695 23.715  1.00 28.66 ? 377  ILE B CG1   1 
ATOM   9907  C  CG2   . ILE B 1 377 ? 5.877   -51.230 24.302  1.00 29.37 ? 377  ILE B CG2   1 
ATOM   9908  C  CD1   . ILE B 1 377 ? 4.511   -53.790 23.733  1.00 31.75 ? 377  ILE B CD1   1 
ATOM   9909  N  N     . VAL B 1 378 ? 8.398   -51.116 26.871  1.00 30.10 ? 378  VAL B N     1 
ATOM   9910  C  CA    . VAL B 1 378 ? 8.910   -49.837 27.369  1.00 29.25 ? 378  VAL B CA    1 
ATOM   9911  C  C     . VAL B 1 378 ? 10.398  -49.675 27.082  1.00 30.11 ? 378  VAL B C     1 
ATOM   9912  O  O     . VAL B 1 378 ? 10.826  -48.560 26.695  1.00 30.27 ? 378  VAL B O     1 
ATOM   9913  C  CB    . VAL B 1 378 ? 8.540   -49.639 28.832  1.00 32.52 ? 378  VAL B CB    1 
ATOM   9914  C  CG1   . VAL B 1 378 ? 9.233   -48.445 29.488  1.00 29.43 ? 378  VAL B CG1   1 
ATOM   9915  C  CG2   . VAL B 1 378 ? 7.028   -49.590 28.951  1.00 25.59 ? 378  VAL B CG2   1 
ATOM   9916  N  N     . SER B 1 379 ? 11.243  -50.676 27.337  1.00 30.25 ? 379  SER B N     1 
ATOM   9917  C  CA    . SER B 1 379 ? 12.691  -50.490 27.226  1.00 28.82 ? 379  SER B CA    1 
ATOM   9918  C  C     . SER B 1 379 ? 13.185  -50.442 25.816  1.00 28.24 ? 379  SER B C     1 
ATOM   9919  O  O     . SER B 1 379 ? 14.170  -49.777 25.567  1.00 28.19 ? 379  SER B O     1 
ATOM   9920  C  CB    . SER B 1 379 ? 13.467  -51.587 27.977  1.00 32.93 ? 379  SER B CB    1 
ATOM   9921  O  OG    . SER B 1 379 ? 13.114  -52.828 27.403  1.00 38.24 ? 379  SER B OG    1 
ATOM   9922  N  N     . PHE B 1 380 ? 12.484  -51.085 24.895  1.00 30.88 ? 380  PHE B N     1 
ATOM   9923  C  CA    . PHE B 1 380 ? 12.783  -51.039 23.450  1.00 31.07 ? 380  PHE B CA    1 
ATOM   9924  C  C     . PHE B 1 380 ? 12.322  -49.674 22.928  1.00 30.47 ? 380  PHE B C     1 
ATOM   9925  O  O     . PHE B 1 380 ? 12.992  -49.051 22.120  1.00 30.89 ? 380  PHE B O     1 
ATOM   9926  C  CB    . PHE B 1 380 ? 11.923  -52.135 22.763  1.00 33.56 ? 380  PHE B CB    1 
ATOM   9927  C  CG    . PHE B 1 380 ? 12.562  -52.696 21.510  1.00 35.90 ? 380  PHE B CG    1 
ATOM   9928  C  CD1   . PHE B 1 380 ? 13.412  -51.917 20.749  1.00 35.52 ? 380  PHE B CD1   1 
ATOM   9929  C  CD2   . PHE B 1 380 ? 12.284  -53.988 21.085  1.00 33.55 ? 380  PHE B CD2   1 
ATOM   9930  C  CE1   . PHE B 1 380 ? 14.059  -52.354 19.604  1.00 31.99 ? 380  PHE B CE1   1 
ATOM   9931  C  CE2   . PHE B 1 380 ? 12.918  -54.456 19.934  1.00 39.93 ? 380  PHE B CE2   1 
ATOM   9932  C  CZ    . PHE B 1 380 ? 13.791  -53.661 19.191  1.00 37.48 ? 380  PHE B CZ    1 
ATOM   9933  N  N     . ARG B 1 381 ? 11.235  -49.129 23.510  1.00 30.00 ? 381  ARG B N     1 
ATOM   9934  C  CA    . ARG B 1 381 ? 10.879  -47.779 23.064  1.00 31.26 ? 381  ARG B CA    1 
ATOM   9935  C  C     . ARG B 1 381 ? 12.026  -46.852 23.487  1.00 31.12 ? 381  ARG B C     1 
ATOM   9936  O  O     . ARG B 1 381 ? 12.513  -46.052 22.697  1.00 31.39 ? 381  ARG B O     1 
ATOM   9937  C  CB    . ARG B 1 381 ? 9.509   -47.283 23.498  1.00 28.47 ? 381  ARG B CB    1 
ATOM   9938  C  CG    . ARG B 1 381 ? 9.193   -45.941 22.921  1.00 31.84 ? 381  ARG B CG    1 
ATOM   9939  C  CD    . ARG B 1 381 ? 8.077   -45.175 23.583  1.00 34.04 ? 381  ARG B CD    1 
ATOM   9940  N  NE    . ARG B 1 381 ? 8.260   -44.868 24.984  1.00 32.69 ? 381  ARG B NE    1 
ATOM   9941  C  CZ    . ARG B 1 381 ? 7.386   -44.206 25.741  1.00 31.98 ? 381  ARG B CZ    1 
ATOM   9942  N  NH1   . ARG B 1 381 ? 6.345   -43.654 25.132  1.00 29.21 ? 381  ARG B NH1   1 
ATOM   9943  N  NH2   . ARG B 1 381 ? 7.586   -43.996 27.039  1.00 26.23 ? 381  ARG B NH2   1 
ATOM   9944  N  N     . SER B 1 382 ? 12.533  -47.008 24.713  1.00 30.50 ? 382  SER B N     1 
ATOM   9945  C  CA    . SER B 1 382 ? 13.703  -46.235 25.116  1.00 30.64 ? 382  SER B CA    1 
ATOM   9946  C  C     . SER B 1 382 ? 14.844  -46.471 24.140  1.00 32.13 ? 382  SER B C     1 
ATOM   9947  O  O     . SER B 1 382 ? 15.453  -45.516 23.625  1.00 33.94 ? 382  SER B O     1 
ATOM   9948  C  CB    . SER B 1 382 ? 14.133  -46.619 26.549  1.00 29.07 ? 382  SER B CB    1 
ATOM   9949  O  OG    . SER B 1 382 ? 15.211  -45.784 26.977  1.00 28.52 ? 382  SER B OG    1 
ATOM   9950  N  N     . ALA B 1 383 ? 15.175  -47.734 23.860  1.00 31.80 ? 383  ALA B N     1 
ATOM   9951  C  CA    . ALA B 1 383 ? 16.319  -48.010 23.003  1.00 33.06 ? 383  ALA B CA    1 
ATOM   9952  C  C     . ALA B 1 383 ? 16.141  -47.318 21.672  1.00 32.51 ? 383  ALA B C     1 
ATOM   9953  O  O     . ALA B 1 383 ? 17.121  -46.877 21.089  1.00 33.72 ? 383  ALA B O     1 
ATOM   9954  C  CB    . ALA B 1 383 ? 16.630  -49.506 22.910  1.00 23.45 ? 383  ALA B CB    1 
ATOM   9955  N  N     . ASN B 1 384 ? 14.984  -47.368 21.048  1.00 33.82 ? 384  ASN B N     1 
ATOM   9956  C  CA    . ASN B 1 384 ? 14.769  -46.803 19.712  1.00 32.78 ? 384  ASN B CA    1 
ATOM   9957  C  C     . ASN B 1 384 ? 14.898  -45.283 19.657  1.00 31.80 ? 384  ASN B C     1 
ATOM   9958  O  O     . ASN B 1 384 ? 15.383  -44.721 18.678  1.00 31.49 ? 384  ASN B O     1 
ATOM   9959  C  CB    . ASN B 1 384 ? 13.317  -47.150 19.309  1.00 33.05 ? 384  ASN B CB    1 
ATOM   9960  C  CG    . ASN B 1 384 ? 13.268  -48.599 18.840  1.00 32.65 ? 384  ASN B CG    1 
ATOM   9961  O  OD1   . ASN B 1 384 ? 12.197  -49.171 18.932  1.00 38.25 ? 384  ASN B OD1   1 
ATOM   9962  N  ND2   . ASN B 1 384 ? 14.372  -49.150 18.404  1.00 33.55 ? 384  ASN B ND2   1 
ATOM   9963  N  N     . LEU B 1 385 ? 14.326  -44.620 20.653  1.00 31.19 ? 385  LEU B N     1 
ATOM   9964  C  CA    . LEU B 1 385 ? 14.384  -43.175 20.758  1.00 31.77 ? 385  LEU B CA    1 
ATOM   9965  C  C     . LEU B 1 385 ? 15.823  -42.666 20.827  1.00 32.35 ? 385  LEU B C     1 
ATOM   9966  O  O     . LEU B 1 385 ? 16.119  -41.746 20.051  1.00 35.25 ? 385  LEU B O     1 
ATOM   9967  C  CB    . LEU B 1 385 ? 13.611  -42.619 21.937  1.00 26.62 ? 385  LEU B CB    1 
ATOM   9968  C  CG    . LEU B 1 385 ? 12.077  -42.643 21.925  1.00 31.97 ? 385  LEU B CG    1 
ATOM   9969  C  CD1   . LEU B 1 385 ? 11.612  -42.422 23.348  1.00 25.57 ? 385  LEU B CD1   1 
ATOM   9970  C  CD2   . LEU B 1 385 ? 11.511  -41.587 20.952  1.00 23.57 ? 385  LEU B CD2   1 
ATOM   9971  N  N     . VAL B 1 386 ? 16.725  -43.288 21.588  1.00 30.28 ? 386  VAL B N     1 
ATOM   9972  C  CA    . VAL B 1 386 ? 18.057  -42.760 21.626  1.00 30.65 ? 386  VAL B CA    1 
ATOM   9973  C  C     . VAL B 1 386 ? 18.858  -43.119 20.375  1.00 30.53 ? 386  VAL B C     1 
ATOM   9974  O  O     . VAL B 1 386 ? 19.823  -42.399 20.019  1.00 31.06 ? 386  VAL B O     1 
ATOM   9975  C  CB    . VAL B 1 386 ? 18.819  -42.955 22.937  1.00 30.80 ? 386  VAL B CB    1 
ATOM   9976  C  CG1   . VAL B 1 386 ? 18.682  -44.388 23.407  1.00 34.45 ? 386  VAL B CG1   1 
ATOM   9977  C  CG2   . VAL B 1 386 ? 20.303  -42.733 22.635  1.00 33.95 ? 386  VAL B CG2   1 
ATOM   9978  N  N     . ALA B 1 387 ? 18.418  -44.148 19.678  1.00 28.28 ? 387  ALA B N     1 
ATOM   9979  C  CA    . ALA B 1 387 ? 18.999  -44.484 18.379  1.00 29.36 ? 387  ALA B CA    1 
ATOM   9980  C  C     . ALA B 1 387 ? 18.675  -43.327 17.426  1.00 29.13 ? 387  ALA B C     1 
ATOM   9981  O  O     . ALA B 1 387 ? 19.458  -43.061 16.562  1.00 28.04 ? 387  ALA B O     1 
ATOM   9982  C  CB    . ALA B 1 387 ? 18.339  -45.747 17.778  1.00 24.53 ? 387  ALA B CB    1 
ATOM   9983  N  N     . ALA B 1 388 ? 17.438  -42.818 17.497  1.00 29.59 ? 388  ALA B N     1 
ATOM   9984  C  CA    . ALA B 1 388 ? 17.049  -41.711 16.630  1.00 30.13 ? 388  ALA B CA    1 
ATOM   9985  C  C     . ALA B 1 388 ? 17.775  -40.395 16.930  1.00 30.49 ? 388  ALA B C     1 
ATOM   9986  O  O     . ALA B 1 388 ? 18.309  -39.736 16.021  1.00 28.51 ? 388  ALA B O     1 
ATOM   9987  C  CB    . ALA B 1 388 ? 15.518  -41.580 16.778  1.00 27.91 ? 388  ALA B CB    1 
ATOM   9988  N  N     . THR B 1 389 ? 17.897  -39.985 18.209  1.00 30.03 ? 389  THR B N     1 
ATOM   9989  C  CA    . THR B 1 389 ? 18.623  -38.734 18.472  1.00 30.16 ? 389  THR B CA    1 
ATOM   9990  C  C     . THR B 1 389 ? 20.109  -38.943 18.340  1.00 31.65 ? 389  THR B C     1 
ATOM   9991  O  O     . THR B 1 389 ? 20.750  -38.034 17.830  1.00 33.45 ? 389  THR B O     1 
ATOM   9992  C  CB    . THR B 1 389 ? 18.300  -38.161 19.857  1.00 26.70 ? 389  THR B CB    1 
ATOM   9993  O  OG1   . THR B 1 389 ? 18.473  -39.264 20.781  1.00 33.45 ? 389  THR B OG1   1 
ATOM   9994  C  CG2   . THR B 1 389 ? 16.822  -37.833 19.920  1.00 29.15 ? 389  THR B CG2   1 
ATOM   9995  N  N     . LEU B 1 390 ? 20.651  -40.098 18.684  1.00 32.86 ? 390  LEU B N     1 
ATOM   9996  C  CA    . LEU B 1 390 ? 22.077  -40.383 18.428  1.00 34.29 ? 390  LEU B CA    1 
ATOM   9997  C  C     . LEU B 1 390 ? 22.370  -40.353 16.929  1.00 34.84 ? 390  LEU B C     1 
ATOM   9998  O  O     . LEU B 1 390 ? 23.451  -39.857 16.583  1.00 36.91 ? 390  LEU B O     1 
ATOM   9999  C  CB    . LEU B 1 390 ? 22.482  -41.756 19.001  1.00 28.46 ? 390  LEU B CB    1 
ATOM   10000 C  CG    . LEU B 1 390 ? 23.989  -42.076 18.898  1.00 32.90 ? 390  LEU B CG    1 
ATOM   10001 C  CD1   . LEU B 1 390 ? 24.197  -42.515 17.456  1.00 36.39 ? 390  LEU B CD1   1 
ATOM   10002 C  CD2   . LEU B 1 390 ? 24.874  -40.847 19.184  1.00 26.49 ? 390  LEU B CD2   1 
ATOM   10003 N  N     . GLY B 1 391 ? 21.491  -40.819 16.039  1.00 32.96 ? 391  GLY B N     1 
ATOM   10004 C  CA    . GLY B 1 391 ? 21.766  -40.824 14.610  1.00 33.02 ? 391  GLY B CA    1 
ATOM   10005 C  C     . GLY B 1 391 ? 21.721  -39.455 13.953  1.00 34.73 ? 391  GLY B C     1 
ATOM   10006 O  O     . GLY B 1 391 ? 22.473  -39.171 12.996  1.00 37.22 ? 391  GLY B O     1 
ATOM   10007 N  N     . ALA B 1 392 ? 20.882  -38.555 14.481  1.00 32.73 ? 392  ALA B N     1 
ATOM   10008 C  CA    . ALA B 1 392 ? 20.932  -37.171 14.060  1.00 32.75 ? 392  ALA B CA    1 
ATOM   10009 C  C     . ALA B 1 392 ? 22.373  -36.665 14.326  1.00 32.23 ? 392  ALA B C     1 
ATOM   10010 O  O     . ALA B 1 392 ? 22.967  -36.020 13.429  1.00 32.42 ? 392  ALA B O     1 
ATOM   10011 C  CB    . ALA B 1 392 ? 19.893  -36.339 14.789  1.00 24.73 ? 392  ALA B CB    1 
ATOM   10012 N  N     . ILE B 1 393 ? 22.867  -36.881 15.545  1.00 30.29 ? 393  ILE B N     1 
ATOM   10013 C  CA    . ILE B 1 393 ? 24.250  -36.483 15.847  1.00 30.77 ? 393  ILE B CA    1 
ATOM   10014 C  C     . ILE B 1 393 ? 25.251  -37.038 14.847  1.00 30.71 ? 393  ILE B C     1 
ATOM   10015 O  O     . ILE B 1 393 ? 26.103  -36.352 14.318  1.00 33.12 ? 393  ILE B O     1 
ATOM   10016 C  CB    . ILE B 1 393 ? 24.669  -36.999 17.262  1.00 29.82 ? 393  ILE B CB    1 
ATOM   10017 C  CG1   . ILE B 1 393 ? 23.874  -36.242 18.323  1.00 27.94 ? 393  ILE B CG1   1 
ATOM   10018 C  CG2   . ILE B 1 393 ? 26.175  -36.781 17.421  1.00 22.74 ? 393  ILE B CG2   1 
ATOM   10019 C  CD1   . ILE B 1 393 ? 24.336  -36.380 19.754  1.00 25.60 ? 393  ILE B CD1   1 
ATOM   10020 N  N     . LEU B 1 394 ? 25.225  -38.305 14.484  1.00 32.05 ? 394  LEU B N     1 
ATOM   10021 C  CA    . LEU B 1 394 ? 26.105  -38.920 13.501  1.00 33.03 ? 394  LEU B CA    1 
ATOM   10022 C  C     . LEU B 1 394 ? 25.909  -38.379 12.087  1.00 33.23 ? 394  LEU B C     1 
ATOM   10023 O  O     . LEU B 1 394 ? 26.875  -38.167 11.360  1.00 31.46 ? 394  LEU B O     1 
ATOM   10024 C  CB    . LEU B 1 394 ? 25.839  -40.437 13.477  1.00 32.13 ? 394  LEU B CB    1 
ATOM   10025 C  CG    . LEU B 1 394 ? 25.992  -41.143 14.791  1.00 28.66 ? 394  LEU B CG    1 
ATOM   10026 C  CD1   . LEU B 1 394 ? 25.501  -42.579 14.583  1.00 35.72 ? 394  LEU B CD1   1 
ATOM   10027 C  CD2   . LEU B 1 394 ? 27.415  -41.067 15.313  1.00 29.94 ? 394  LEU B CD2   1 
ATOM   10028 N  N     . ASN B 1 395 ? 24.644  -38.082 11.732  1.00 35.53 ? 395  ASN B N     1 
ATOM   10029 C  CA    . ASN B 1 395 ? 24.440  -37.422 10.439  1.00 35.88 ? 395  ASN B CA    1 
ATOM   10030 C  C     . ASN B 1 395 ? 25.050  -36.033 10.462  1.00 36.55 ? 395  ASN B C     1 
ATOM   10031 O  O     . ASN B 1 395 ? 25.736  -35.698 9.490   1.00 38.13 ? 395  ASN B O     1 
ATOM   10032 C  CB    . ASN B 1 395 ? 23.005  -37.464 9.964   1.00 38.28 ? 395  ASN B CB    1 
ATOM   10033 C  CG    . ASN B 1 395 ? 22.576  -38.832 9.467   1.00 38.39 ? 395  ASN B CG    1 
ATOM   10034 O  OD1   . ASN B 1 395 ? 23.361  -39.539 8.842   1.00 37.86 ? 395  ASN B OD1   1 
ATOM   10035 N  ND2   . ASN B 1 395 ? 21.356  -39.228 9.783   1.00 35.78 ? 395  ASN B ND2   1 
ATOM   10036 N  N     . ARG B 1 396 ? 25.029  -35.287 11.550  1.00 36.28 ? 396  ARG B N     1 
ATOM   10037 C  CA    . ARG B 1 396 ? 25.724  -34.013 11.656  1.00 35.51 ? 396  ARG B CA    1 
ATOM   10038 C  C     . ARG B 1 396 ? 27.232  -34.163 11.631  1.00 37.55 ? 396  ARG B C     1 
ATOM   10039 O  O     . ARG B 1 396 ? 27.963  -33.508 10.873  1.00 37.89 ? 396  ARG B O     1 
ATOM   10040 C  CB    . ARG B 1 396 ? 25.267  -33.329 12.951  1.00 35.80 ? 396  ARG B CB    1 
ATOM   10041 C  CG    . ARG B 1 396 ? 26.163  -32.135 13.325  1.00 37.67 ? 396  ARG B CG    1 
ATOM   10042 C  CD    . ARG B 1 396 ? 25.295  -30.910 13.571  1.00 44.98 ? 396  ARG B CD    1 
ATOM   10043 N  NE    . ARG B 1 396 ? 25.918  -29.680 13.129  1.00 46.01 ? 396  ARG B NE    1 
ATOM   10044 C  CZ    . ARG B 1 396 ? 25.307  -28.604 12.637  1.00 45.15 ? 396  ARG B CZ    1 
ATOM   10045 N  NH1   . ARG B 1 396 ? 23.979  -28.521 12.555  1.00 45.32 ? 396  ARG B NH1   1 
ATOM   10046 N  NH2   . ARG B 1 396 ? 26.078  -27.603 12.239  1.00 40.42 ? 396  ARG B NH2   1 
ATOM   10047 N  N     . LEU B 1 397 ? 27.763  -35.172 12.366  1.00 38.82 ? 397  LEU B N     1 
ATOM   10048 C  CA    . LEU B 1 397 ? 29.226  -35.388 12.321  1.00 38.83 ? 397  LEU B CA    1 
ATOM   10049 C  C     . LEU B 1 397 ? 29.696  -35.678 10.909  1.00 39.53 ? 397  LEU B C     1 
ATOM   10050 O  O     . LEU B 1 397 ? 30.765  -35.227 10.495  1.00 41.26 ? 397  LEU B O     1 
ATOM   10051 C  CB    . LEU B 1 397 ? 29.667  -36.507 13.257  1.00 36.61 ? 397  LEU B CB    1 
ATOM   10052 C  CG    . LEU B 1 397 ? 29.553  -36.227 14.768  1.00 38.80 ? 397  LEU B CG    1 
ATOM   10053 C  CD1   . LEU B 1 397 ? 29.771  -37.537 15.548  1.00 34.17 ? 397  LEU B CD1   1 
ATOM   10054 C  CD2   . LEU B 1 397 ? 30.596  -35.181 15.164  1.00 33.52 ? 397  LEU B CD2   1 
ATOM   10055 N  N     . ARG B 1 398 ? 29.012  -36.578 10.202  1.00 39.55 ? 398  ARG B N     1 
ATOM   10056 C  CA    . ARG B 1 398 ? 29.321  -36.970 8.860   1.00 38.02 ? 398  ARG B CA    1 
ATOM   10057 C  C     . ARG B 1 398 ? 29.155  -35.792 7.877   1.00 38.18 ? 398  ARG B C     1 
ATOM   10058 O  O     . ARG B 1 398 ? 29.987  -35.693 6.963   1.00 37.13 ? 398  ARG B O     1 
ATOM   10059 C  CB    . ARG B 1 398 ? 28.400  -38.093 8.307   1.00 35.81 ? 398  ARG B CB    1 
ATOM   10060 C  CG    . ARG B 1 398 ? 29.034  -38.515 6.974   1.00 36.18 ? 398  ARG B CG    1 
ATOM   10061 C  CD    . ARG B 1 398 ? 28.521  -39.794 6.399   1.00 40.28 ? 398  ARG B CD    1 
ATOM   10062 N  NE    . ARG B 1 398 ? 27.092  -39.756 6.085   1.00 41.39 ? 398  ARG B NE    1 
ATOM   10063 C  CZ    . ARG B 1 398 ? 26.716  -39.401 4.846   1.00 41.71 ? 398  ARG B CZ    1 
ATOM   10064 N  NH1   . ARG B 1 398 ? 27.675  -39.136 3.961   1.00 40.33 ? 398  ARG B NH1   1 
ATOM   10065 N  NH2   . ARG B 1 398 ? 25.417  -39.379 4.593   1.00 37.24 ? 398  ARG B NH2   1 
ATOM   10066 N  N     . ASP B 1 399 ? 28.137  -34.962 8.095   1.00 38.10 ? 399  ASP B N     1 
ATOM   10067 C  CA    . ASP B 1 399 ? 27.976  -33.823 7.206   1.00 40.79 ? 399  ASP B CA    1 
ATOM   10068 C  C     . ASP B 1 399 ? 29.094  -32.810 7.365   1.00 43.00 ? 399  ASP B C     1 
ATOM   10069 O  O     . ASP B 1 399 ? 29.751  -32.398 6.388   1.00 43.90 ? 399  ASP B O     1 
ATOM   10070 C  CB    . ASP B 1 399 ? 26.572  -33.278 7.162   1.00 49.51 ? 399  ASP B CB    1 
ATOM   10071 C  CG    . ASP B 1 399 ? 25.382  -34.183 6.934   1.00 57.50 ? 399  ASP B CG    1 
ATOM   10072 O  OD1   . ASP B 1 399 ? 25.397  -35.458 6.843   1.00 63.23 ? 399  ASP B OD1   1 
ATOM   10073 O  OD2   . ASP B 1 399 ? 24.247  -33.614 6.873   1.00 56.13 ? 399  ASP B OD2   1 
ATOM   10074 N  N     . ASN B 1 400 ? 29.483  -32.435 8.576   1.00 43.45 ? 400  ASN B N     1 
ATOM   10075 C  CA    . ASN B 1 400 ? 30.628  -31.596 8.861   1.00 42.71 ? 400  ASN B CA    1 
ATOM   10076 C  C     . ASN B 1 400 ? 31.899  -32.122 8.217   1.00 43.25 ? 400  ASN B C     1 
ATOM   10077 O  O     . ASN B 1 400 ? 32.823  -31.377 7.916   1.00 45.37 ? 400  ASN B O     1 
ATOM   10078 C  CB    . ASN B 1 400 ? 30.912  -31.607 10.378  1.00 43.98 ? 400  ASN B CB    1 
ATOM   10079 C  CG    . ASN B 1 400 ? 29.975  -30.848 11.267  1.00 40.03 ? 400  ASN B CG    1 
ATOM   10080 O  OD1   . ASN B 1 400 ? 30.036  -30.934 12.500  1.00 42.06 ? 400  ASN B OD1   1 
ATOM   10081 N  ND2   . ASN B 1 400 ? 29.093  -30.045 10.702  1.00 39.65 ? 400  ASN B ND2   1 
ATOM   10082 N  N     . LYS B 1 401 ? 32.141  -33.412 8.235   1.00 44.56 ? 401  LYS B N     1 
ATOM   10083 C  CA    . LYS B 1 401 ? 33.347  -34.041 7.749   1.00 45.13 ? 401  LYS B CA    1 
ATOM   10084 C  C     . LYS B 1 401 ? 33.508  -34.051 6.238   1.00 45.83 ? 401  LYS B C     1 
ATOM   10085 O  O     . LYS B 1 401 ? 34.669  -34.003 5.786   1.00 46.90 ? 401  LYS B O     1 
ATOM   10086 C  CB    . LYS B 1 401 ? 33.541  -35.433 8.340   1.00 44.72 ? 401  LYS B CB    1 
ATOM   10087 C  CG    . LYS B 1 401 ? 34.761  -36.173 7.814   1.00 49.46 ? 401  LYS B CG    1 
ATOM   10088 C  CD    . LYS B 1 401 ? 35.305  -37.123 8.870   1.00 53.46 ? 401  LYS B CD    1 
ATOM   10089 C  CE    . LYS B 1 401 ? 35.976  -38.363 8.303   1.00 52.84 ? 401  LYS B CE    1 
ATOM   10090 N  NZ    . LYS B 1 401 ? 34.989  -39.345 7.767   1.00 51.60 ? 401  LYS B NZ    1 
ATOM   10091 N  N     . GLY B 1 402 ? 32.458  -34.112 5.445   1.00 45.34 ? 402  GLY B N     1 
ATOM   10092 C  CA    . GLY B 1 402 ? 32.557  -34.037 3.995   1.00 46.09 ? 402  GLY B CA    1 
ATOM   10093 C  C     . GLY B 1 402 ? 32.717  -35.354 3.273   1.00 47.04 ? 402  GLY B C     1 
ATOM   10094 O  O     . GLY B 1 402 ? 33.070  -35.496 2.094   1.00 49.53 ? 402  GLY B O     1 
ATOM   10095 N  N     . THR B 1 403 ? 32.491  -36.429 3.964   1.00 47.40 ? 403  THR B N     1 
ATOM   10096 C  CA    . THR B 1 403 ? 32.762  -37.807 3.601   1.00 47.17 ? 403  THR B CA    1 
ATOM   10097 C  C     . THR B 1 403 ? 31.555  -38.667 3.374   1.00 47.31 ? 403  THR B C     1 
ATOM   10098 O  O     . THR B 1 403 ? 30.519  -38.528 4.031   1.00 47.65 ? 403  THR B O     1 
ATOM   10099 C  CB    . THR B 1 403 ? 33.561  -38.198 4.858   1.00 45.38 ? 403  THR B CB    1 
ATOM   10100 O  OG1   . THR B 1 403 ? 34.929  -38.210 4.433   1.00 56.16 ? 403  THR B OG1   1 
ATOM   10101 C  CG2   . THR B 1 403 ? 33.185  -39.436 5.556   1.00 48.44 ? 403  THR B CG2   1 
ATOM   10102 N  N     . PRO B 1 404 ? 31.591  -39.551 2.386   1.00 47.96 ? 404  PRO B N     1 
ATOM   10103 C  CA    . PRO B 1 404 ? 30.549  -40.531 2.123   1.00 48.07 ? 404  PRO B CA    1 
ATOM   10104 C  C     . PRO B 1 404 ? 30.164  -41.412 3.304   1.00 46.74 ? 404  PRO B C     1 
ATOM   10105 O  O     . PRO B 1 404 ? 28.972  -41.677 3.505   1.00 47.24 ? 404  PRO B O     1 
ATOM   10106 C  CB    . PRO B 1 404 ? 31.124  -41.447 1.035   1.00 48.46 ? 404  PRO B CB    1 
ATOM   10107 C  CG    . PRO B 1 404 ? 32.202  -40.640 0.418   1.00 48.21 ? 404  PRO B CG    1 
ATOM   10108 C  CD    . PRO B 1 404 ? 32.784  -39.805 1.531   1.00 48.16 ? 404  PRO B CD    1 
ATOM   10109 N  N     . ARG B 1 405 ? 31.119  -41.950 4.025   1.00 45.22 ? 405  ARG B N     1 
ATOM   10110 C  CA    . ARG B 1 405 ? 30.829  -42.837 5.170   1.00 43.92 ? 405  ARG B CA    1 
ATOM   10111 C  C     . ARG B 1 405 ? 31.428  -42.191 6.423   1.00 42.96 ? 405  ARG B C     1 
ATOM   10112 O  O     . ARG B 1 405 ? 32.466  -41.554 6.257   1.00 41.97 ? 405  ARG B O     1 
ATOM   10113 C  CB    . ARG B 1 405 ? 31.563  -44.162 4.956   1.00 40.67 ? 405  ARG B CB    1 
ATOM   10114 C  CG    . ARG B 1 405 ? 30.877  -45.394 5.523   1.00 41.24 ? 405  ARG B CG    1 
ATOM   10115 C  CD    . ARG B 1 405 ? 31.678  -46.639 5.093   1.00 33.37 ? 405  ARG B CD    1 
ATOM   10116 N  NE    . ARG B 1 405 ? 31.106  -47.787 5.762   1.00 38.34 ? 405  ARG B NE    1 
ATOM   10117 C  CZ    . ARG B 1 405 ? 31.570  -49.016 5.860   1.00 39.36 ? 405  ARG B CZ    1 
ATOM   10118 N  NH1   . ARG B 1 405 ? 32.707  -49.396 5.282   1.00 36.94 ? 405  ARG B NH1   1 
ATOM   10119 N  NH2   . ARG B 1 405 ? 30.848  -49.897 6.553   1.00 39.27 ? 405  ARG B NH2   1 
ATOM   10120 N  N     . LEU B 1 406 ? 30.961  -42.511 7.616   1.00 42.45 ? 406  LEU B N     1 
ATOM   10121 C  CA    . LEU B 1 406 ? 31.628  -41.919 8.783   1.00 42.15 ? 406  LEU B CA    1 
ATOM   10122 C  C     . LEU B 1 406 ? 31.986  -43.017 9.770   1.00 40.71 ? 406  LEU B C     1 
ATOM   10123 O  O     . LEU B 1 406 ? 31.120  -43.842 9.997   1.00 40.26 ? 406  LEU B O     1 
ATOM   10124 C  CB    . LEU B 1 406 ? 30.707  -40.848 9.408   1.00 41.14 ? 406  LEU B CB    1 
ATOM   10125 C  CG    . LEU B 1 406 ? 31.005  -40.560 10.881  1.00 46.36 ? 406  LEU B CG    1 
ATOM   10126 C  CD1   . LEU B 1 406 ? 32.166  -39.613 11.046  1.00 37.89 ? 406  LEU B CD1   1 
ATOM   10127 C  CD2   . LEU B 1 406 ? 29.781  -40.132 11.669  1.00 43.05 ? 406  LEU B CD2   1 
ATOM   10128 N  N     . ARG B 1 407 ? 33.227  -43.137 10.223  1.00 40.32 ? 407  ARG B N     1 
ATOM   10129 C  CA    . ARG B 1 407 ? 33.532  -44.112 11.283  1.00 40.08 ? 407  ARG B CA    1 
ATOM   10130 C  C     . ARG B 1 407 ? 33.802  -43.399 12.606  1.00 38.27 ? 407  ARG B C     1 
ATOM   10131 O  O     . ARG B 1 407 ? 34.516  -42.417 12.674  1.00 37.76 ? 407  ARG B O     1 
ATOM   10132 C  CB    . ARG B 1 407 ? 34.710  -44.983 10.866  1.00 47.17 ? 407  ARG B CB    1 
ATOM   10133 C  CG    . ARG B 1 407 ? 34.316  -46.417 10.506  1.00 52.59 ? 407  ARG B CG    1 
ATOM   10134 C  CD    . ARG B 1 407 ? 34.965  -46.828 9.198   1.00 58.19 ? 407  ARG B CD    1 
ATOM   10135 N  NE    . ARG B 1 407 ? 36.173  -47.593 9.381   1.00 64.78 ? 407  ARG B NE    1 
ATOM   10136 C  CZ    . ARG B 1 407 ? 37.452  -47.231 9.340   1.00 66.75 ? 407  ARG B CZ    1 
ATOM   10137 N  NH1   . ARG B 1 407 ? 37.798  -45.968 9.095   1.00 64.49 ? 407  ARG B NH1   1 
ATOM   10138 N  NH2   . ARG B 1 407 ? 38.400  -48.157 9.531   1.00 62.59 ? 407  ARG B NH2   1 
ATOM   10139 N  N     . THR B 1 408 ? 33.040  -43.600 13.664  1.00 37.03 ? 408  THR B N     1 
ATOM   10140 C  CA    . THR B 1 408 ? 33.209  -42.848 14.876  1.00 35.46 ? 408  THR B CA    1 
ATOM   10141 C  C     . THR B 1 408 ? 32.978  -43.770 16.070  1.00 34.49 ? 408  THR B C     1 
ATOM   10142 O  O     . THR B 1 408 ? 32.200  -44.721 15.948  1.00 35.46 ? 408  THR B O     1 
ATOM   10143 C  CB    . THR B 1 408 ? 32.242  -41.661 14.981  1.00 38.73 ? 408  THR B CB    1 
ATOM   10144 O  OG1   . THR B 1 408 ? 32.619  -40.925 16.185  1.00 40.68 ? 408  THR B OG1   1 
ATOM   10145 C  CG2   . THR B 1 408 ? 30.828  -42.134 15.299  1.00 40.78 ? 408  THR B CG2   1 
ATOM   10146 N  N     . THR B 1 409 ? 33.629  -43.419 17.176  1.00 32.83 ? 409  THR B N     1 
ATOM   10147 C  CA    . THR B 1 409 ? 33.471  -44.212 18.391  1.00 32.34 ? 409  THR B CA    1 
ATOM   10148 C  C     . THR B 1 409 ? 32.650  -43.416 19.383  1.00 32.44 ? 409  THR B C     1 
ATOM   10149 O  O     . THR B 1 409 ? 32.858  -42.219 19.474  1.00 33.15 ? 409  THR B O     1 
ATOM   10150 C  CB    . THR B 1 409 ? 34.913  -44.421 18.922  1.00 36.90 ? 409  THR B CB    1 
ATOM   10151 O  OG1   . THR B 1 409 ? 35.503  -45.491 18.187  1.00 33.76 ? 409  THR B OG1   1 
ATOM   10152 C  CG2   . THR B 1 409 ? 34.930  -44.746 20.411  1.00 34.05 ? 409  THR B CG2   1 
ATOM   10153 N  N     . VAL B 1 410 ? 31.624  -43.971 20.000  1.00 33.19 ? 410  VAL B N     1 
ATOM   10154 C  CA    . VAL B 1 410 ? 30.856  -43.308 21.047  1.00 31.60 ? 410  VAL B CA    1 
ATOM   10155 C  C     . VAL B 1 410 ? 31.239  -43.935 22.390  1.00 32.45 ? 410  VAL B C     1 
ATOM   10156 O  O     . VAL B 1 410 ? 31.054  -45.146 22.589  1.00 33.23 ? 410  VAL B O     1 
ATOM   10157 C  CB    . VAL B 1 410 ? 29.379  -43.612 20.752  1.00 37.00 ? 410  VAL B CB    1 
ATOM   10158 C  CG1   . VAL B 1 410 ? 28.410  -43.013 21.755  1.00 32.28 ? 410  VAL B CG1   1 
ATOM   10159 C  CG2   . VAL B 1 410 ? 29.066  -43.202 19.320  1.00 30.87 ? 410  VAL B CG2   1 
ATOM   10160 N  N     . GLY B 1 411 ? 31.742  -43.116 23.324  1.00 31.68 ? 411  GLY B N     1 
ATOM   10161 C  CA    . GLY B 1 411 ? 31.989  -43.572 24.687  1.00 30.71 ? 411  GLY B CA    1 
ATOM   10162 C  C     . GLY B 1 411 ? 30.619  -43.610 25.366  1.00 30.46 ? 411  GLY B C     1 
ATOM   10163 O  O     . GLY B 1 411 ? 29.893  -42.614 25.205  1.00 30.56 ? 411  GLY B O     1 
ATOM   10164 N  N     . VAL B 1 412 ? 30.273  -44.677 26.069  1.00 31.00 ? 412  VAL B N     1 
ATOM   10165 C  CA    . VAL B 1 412 ? 28.985  -44.789 26.752  1.00 31.11 ? 412  VAL B CA    1 
ATOM   10166 C  C     . VAL B 1 412 ? 29.169  -45.129 28.251  1.00 32.14 ? 412  VAL B C     1 
ATOM   10167 O  O     . VAL B 1 412 ? 30.078  -45.817 28.664  1.00 31.04 ? 412  VAL B O     1 
ATOM   10168 C  CB    . VAL B 1 412 ? 28.157  -45.972 26.245  1.00 37.13 ? 412  VAL B CB    1 
ATOM   10169 C  CG1   . VAL B 1 412 ? 26.720  -45.938 26.772  1.00 36.11 ? 412  VAL B CG1   1 
ATOM   10170 C  CG2   . VAL B 1 412 ? 28.112  -46.048 24.729  1.00 42.48 ? 412  VAL B CG2   1 
ATOM   10171 N  N     . ASP B 1 413 ? 28.167  -44.746 29.051  1.00 33.49 ? 413  ASP B N     1 
ATOM   10172 C  CA    . ASP B 1 413 ? 28.062  -45.098 30.445  1.00 32.91 ? 413  ASP B CA    1 
ATOM   10173 C  C     . ASP B 1 413 ? 26.630  -44.964 30.954  1.00 32.40 ? 413  ASP B C     1 
ATOM   10174 O  O     . ASP B 1 413 ? 25.823  -44.443 30.213  1.00 28.55 ? 413  ASP B O     1 
ATOM   10175 C  CB    . ASP B 1 413 ? 28.992  -44.181 31.270  1.00 37.35 ? 413  ASP B CB    1 
ATOM   10176 C  CG    . ASP B 1 413 ? 29.331  -44.923 32.570  1.00 42.01 ? 413  ASP B CG    1 
ATOM   10177 O  OD1   . ASP B 1 413 ? 28.593  -45.882 32.869  1.00 37.56 ? 413  ASP B OD1   1 
ATOM   10178 O  OD2   . ASP B 1 413 ? 30.254  -44.462 33.267  1.00 43.10 ? 413  ASP B OD2   1 
ATOM   10179 N  N     . GLY B 1 414 ? 26.306  -45.485 32.143  1.00 33.61 ? 414  GLY B N     1 
ATOM   10180 C  CA    . GLY B 1 414 ? 24.942  -45.394 32.663  1.00 33.15 ? 414  GLY B CA    1 
ATOM   10181 C  C     . GLY B 1 414 ? 24.495  -46.759 33.181  1.00 33.32 ? 414  GLY B C     1 
ATOM   10182 O  O     . GLY B 1 414 ? 24.694  -47.760 32.443  1.00 33.60 ? 414  GLY B O     1 
ATOM   10183 N  N     . SER B 1 415 ? 23.716  -46.796 34.264  1.00 31.94 ? 415  SER B N     1 
ATOM   10184 C  CA    . SER B 1 415 ? 23.362  -48.104 34.834  1.00 33.48 ? 415  SER B CA    1 
ATOM   10185 C  C     . SER B 1 415 ? 22.374  -48.953 34.056  1.00 32.16 ? 415  SER B C     1 
ATOM   10186 O  O     . SER B 1 415 ? 22.570  -50.165 33.985  1.00 31.77 ? 415  SER B O     1 
ATOM   10187 C  CB    . SER B 1 415 ? 22.908  -48.067 36.295  1.00 28.39 ? 415  SER B CB    1 
ATOM   10188 O  OG    . SER B 1 415 ? 23.786  -47.194 37.002  1.00 35.99 ? 415  SER B OG    1 
ATOM   10189 N  N     . LEU B 1 416 ? 21.426  -48.296 33.387  1.00 32.57 ? 416  LEU B N     1 
ATOM   10190 C  CA    . LEU B 1 416 ? 20.456  -49.028 32.579  1.00 33.35 ? 416  LEU B CA    1 
ATOM   10191 C  C     . LEU B 1 416 ? 21.255  -49.621 31.417  1.00 34.17 ? 416  LEU B C     1 
ATOM   10192 O  O     . LEU B 1 416 ? 21.209  -50.816 31.193  1.00 35.41 ? 416  LEU B O     1 
ATOM   10193 C  CB    . LEU B 1 416 ? 19.315  -48.122 32.113  1.00 31.52 ? 416  LEU B CB    1 
ATOM   10194 C  CG    . LEU B 1 416 ? 18.430  -48.673 30.971  1.00 31.36 ? 416  LEU B CG    1 
ATOM   10195 C  CD1   . LEU B 1 416 ? 17.681  -49.930 31.401  1.00 27.92 ? 416  LEU B CD1   1 
ATOM   10196 C  CD2   . LEU B 1 416 ? 17.521  -47.554 30.466  1.00 28.55 ? 416  LEU B CD2   1 
ATOM   10197 N  N     . TYR B 1 417 ? 22.038  -48.829 30.717  1.00 33.84 ? 417  TYR B N     1 
ATOM   10198 C  CA    . TYR B 1 417 ? 22.854  -49.311 29.618  1.00 33.39 ? 417  TYR B CA    1 
ATOM   10199 C  C     . TYR B 1 417 ? 23.696  -50.528 30.027  1.00 33.92 ? 417  TYR B C     1 
ATOM   10200 O  O     . TYR B 1 417 ? 23.742  -51.571 29.380  1.00 31.87 ? 417  TYR B O     1 
ATOM   10201 C  CB    . TYR B 1 417 ? 23.687  -48.161 29.054  1.00 32.01 ? 417  TYR B CB    1 
ATOM   10202 C  CG    . TYR B 1 417 ? 24.393  -48.501 27.745  1.00 31.66 ? 417  TYR B CG    1 
ATOM   10203 C  CD1   . TYR B 1 417 ? 25.654  -49.090 27.806  1.00 33.01 ? 417  TYR B CD1   1 
ATOM   10204 C  CD2   . TYR B 1 417 ? 23.811  -48.308 26.509  1.00 30.76 ? 417  TYR B CD2   1 
ATOM   10205 C  CE1   . TYR B 1 417 ? 26.311  -49.533 26.667  1.00 32.35 ? 417  TYR B CE1   1 
ATOM   10206 C  CE2   . TYR B 1 417 ? 24.459  -48.710 25.380  1.00 32.39 ? 417  TYR B CE2   1 
ATOM   10207 C  CZ    . TYR B 1 417 ? 25.720  -49.273 25.458  1.00 33.30 ? 417  TYR B CZ    1 
ATOM   10208 O  OH    . TYR B 1 417 ? 26.408  -49.579 24.305  1.00 35.11 ? 417  TYR B OH    1 
ATOM   10209 N  N     . LYS B 1 418 ? 24.393  -50.451 31.155  1.00 35.30 ? 418  LYS B N     1 
ATOM   10210 C  CA    . LYS B 1 418 ? 25.280  -51.478 31.639  1.00 33.80 ? 418  LYS B CA    1 
ATOM   10211 C  C     . LYS B 1 418 ? 24.552  -52.740 32.093  1.00 32.53 ? 418  LYS B C     1 
ATOM   10212 O  O     . LYS B 1 418 ? 25.272  -53.717 32.092  1.00 30.85 ? 418  LYS B O     1 
ATOM   10213 C  CB    . LYS B 1 418 ? 26.117  -51.039 32.855  1.00 34.19 ? 418  LYS B CB    1 
ATOM   10214 C  CG    . LYS B 1 418 ? 27.116  -49.974 32.432  1.00 37.76 ? 418  LYS B CG    1 
ATOM   10215 C  CD    . LYS B 1 418 ? 28.505  -50.330 32.884  1.00 46.22 ? 418  LYS B CD    1 
ATOM   10216 C  CE    . LYS B 1 418 ? 29.128  -49.226 33.706  1.00 54.12 ? 418  LYS B CE    1 
ATOM   10217 N  NZ    . LYS B 1 418 ? 28.713  -49.337 35.144  1.00 56.30 ? 418  LYS B NZ    1 
ATOM   10218 N  N     . THR B 1 419 ? 23.403  -52.650 32.740  1.00 32.55 ? 419  THR B N     1 
ATOM   10219 C  CA    . THR B 1 419 ? 22.817  -53.822 33.366  1.00 31.32 ? 419  THR B CA    1 
ATOM   10220 C  C     . THR B 1 419 ? 21.643  -54.398 32.570  1.00 31.15 ? 419  THR B C     1 
ATOM   10221 O  O     . THR B 1 419 ? 21.322  -55.551 32.845  1.00 32.52 ? 419  THR B O     1 
ATOM   10222 C  CB    . THR B 1 419 ? 22.299  -53.445 34.777  1.00 30.66 ? 419  THR B CB    1 
ATOM   10223 O  OG1   . THR B 1 419 ? 21.306  -52.426 34.616  1.00 31.45 ? 419  THR B OG1   1 
ATOM   10224 C  CG2   . THR B 1 419 ? 23.435  -52.816 35.608  1.00 30.06 ? 419  THR B CG2   1 
ATOM   10225 N  N     . HIS B 1 420 ? 20.980  -53.727 31.649  1.00 30.31 ? 420  HIS B N     1 
ATOM   10226 C  CA    . HIS B 1 420 ? 19.858  -54.330 30.934  1.00 30.68 ? 420  HIS B CA    1 
ATOM   10227 C  C     . HIS B 1 420 ? 20.412  -55.413 29.980  1.00 30.39 ? 420  HIS B C     1 
ATOM   10228 O  O     . HIS B 1 420 ? 21.315  -55.165 29.185  1.00 30.27 ? 420  HIS B O     1 
ATOM   10229 C  CB    . HIS B 1 420 ? 19.028  -53.317 30.162  1.00 27.43 ? 420  HIS B CB    1 
ATOM   10230 C  CG    . HIS B 1 420 ? 17.706  -53.811 29.658  1.00 32.21 ? 420  HIS B CG    1 
ATOM   10231 N  ND1   . HIS B 1 420 ? 16.496  -53.505 30.260  1.00 29.14 ? 420  HIS B ND1   1 
ATOM   10232 C  CD2   . HIS B 1 420 ? 17.405  -54.670 28.654  1.00 30.38 ? 420  HIS B CD2   1 
ATOM   10233 C  CE1   . HIS B 1 420 ? 15.519  -54.100 29.639  1.00 30.20 ? 420  HIS B CE1   1 
ATOM   10234 N  NE2   . HIS B 1 420 ? 16.032  -54.822 28.651  1.00 31.11 ? 420  HIS B NE2   1 
ATOM   10235 N  N     . PRO B 1 421 ? 19.780  -56.571 29.935  1.00 30.38 ? 421  PRO B N     1 
ATOM   10236 C  CA    . PRO B 1 421 ? 20.223  -57.707 29.141  1.00 31.95 ? 421  PRO B CA    1 
ATOM   10237 C  C     . PRO B 1 421 ? 19.735  -57.690 27.695  1.00 32.20 ? 421  PRO B C     1 
ATOM   10238 O  O     . PRO B 1 421 ? 20.238  -58.458 26.889  1.00 32.15 ? 421  PRO B O     1 
ATOM   10239 C  CB    . PRO B 1 421 ? 19.560  -58.909 29.845  1.00 31.59 ? 421  PRO B CB    1 
ATOM   10240 C  CG    . PRO B 1 421 ? 18.223  -58.252 30.173  1.00 32.22 ? 421  PRO B CG    1 
ATOM   10241 C  CD    . PRO B 1 421 ? 18.671  -56.952 30.859  1.00 31.27 ? 421  PRO B CD    1 
ATOM   10242 N  N     . GLN B 1 422 ? 18.930  -56.703 27.310  1.00 31.97 ? 422  GLN B N     1 
ATOM   10243 C  CA    . GLN B 1 422 ? 18.640  -56.627 25.870  1.00 32.35 ? 422  GLN B CA    1 
ATOM   10244 C  C     . GLN B 1 422 ? 18.956  -55.279 25.275  1.00 31.31 ? 422  GLN B C     1 
ATOM   10245 O  O     . GLN B 1 422 ? 19.137  -55.156 24.063  1.00 31.57 ? 422  GLN B O     1 
ATOM   10246 C  CB    . GLN B 1 422 ? 17.177  -57.005 25.569  1.00 31.56 ? 422  GLN B CB    1 
ATOM   10247 C  CG    . GLN B 1 422 ? 16.599  -58.180 26.359  1.00 29.29 ? 422  GLN B CG    1 
ATOM   10248 C  CD    . GLN B 1 422 ? 17.270  -59.500 26.054  1.00 30.79 ? 422  GLN B CD    1 
ATOM   10249 O  OE1   . GLN B 1 422 ? 18.018  -59.588 25.085  1.00 30.44 ? 422  GLN B OE1   1 
ATOM   10250 N  NE2   . GLN B 1 422 ? 17.064  -60.524 26.899  1.00 28.28 ? 422  GLN B NE2   1 
ATOM   10251 N  N     . TYR B 1 423 ? 18.977  -54.226 26.072  1.00 31.44 ? 423  TYR B N     1 
ATOM   10252 C  CA    . TYR B 1 423 ? 18.926  -52.841 25.605  1.00 31.42 ? 423  TYR B CA    1 
ATOM   10253 C  C     . TYR B 1 423 ? 19.963  -52.412 24.580  1.00 32.64 ? 423  TYR B C     1 
ATOM   10254 O  O     . TYR B 1 423 ? 19.666  -51.823 23.522  1.00 32.11 ? 423  TYR B O     1 
ATOM   10255 C  CB    . TYR B 1 423 ? 19.024  -51.942 26.842  1.00 29.61 ? 423  TYR B CB    1 
ATOM   10256 C  CG    . TYR B 1 423 ? 18.750  -50.487 26.600  1.00 28.36 ? 423  TYR B CG    1 
ATOM   10257 C  CD1   . TYR B 1 423 ? 19.659  -49.645 26.010  1.00 27.25 ? 423  TYR B CD1   1 
ATOM   10258 C  CD2   . TYR B 1 423 ? 17.510  -49.958 26.984  1.00 28.00 ? 423  TYR B CD2   1 
ATOM   10259 C  CE1   . TYR B 1 423 ? 19.352  -48.320 25.756  1.00 27.03 ? 423  TYR B CE1   1 
ATOM   10260 C  CE2   . TYR B 1 423 ? 17.203  -48.634 26.749  1.00 25.82 ? 423  TYR B CE2   1 
ATOM   10261 C  CZ    . TYR B 1 423 ? 18.126  -47.827 26.152  1.00 26.20 ? 423  TYR B CZ    1 
ATOM   10262 O  OH    . TYR B 1 423 ? 17.844  -46.485 25.969  1.00 26.18 ? 423  TYR B OH    1 
ATOM   10263 N  N     . SER B 1 424 ? 21.231  -52.595 24.972  1.00 31.68 ? 424  SER B N     1 
ATOM   10264 C  CA    . SER B 1 424 ? 22.327  -52.196 24.141  1.00 33.18 ? 424  SER B CA    1 
ATOM   10265 C  C     . SER B 1 424 ? 22.232  -52.824 22.758  1.00 34.05 ? 424  SER B C     1 
ATOM   10266 O  O     . SER B 1 424 ? 22.604  -52.140 21.817  1.00 34.63 ? 424  SER B O     1 
ATOM   10267 C  CB    . SER B 1 424 ? 23.681  -52.389 24.783  1.00 30.76 ? 424  SER B CB    1 
ATOM   10268 O  OG    . SER B 1 424 ? 23.943  -53.666 25.300  1.00 33.73 ? 424  SER B OG    1 
ATOM   10269 N  N     . ARG B 1 425 ? 22.059  -54.142 22.690  1.00 34.54 ? 425  ARG B N     1 
ATOM   10270 C  CA    . ARG B 1 425 ? 21.902  -54.855 21.431  1.00 33.07 ? 425  ARG B CA    1 
ATOM   10271 C  C     . ARG B 1 425 ? 20.754  -54.270 20.596  1.00 30.34 ? 425  ARG B C     1 
ATOM   10272 O  O     . ARG B 1 425 ? 20.992  -53.865 19.469  1.00 29.64 ? 425  ARG B O     1 
ATOM   10273 C  CB    . ARG B 1 425 ? 21.627  -56.341 21.662  1.00 32.28 ? 425  ARG B CB    1 
ATOM   10274 C  CG    . ARG B 1 425 ? 21.488  -57.256 20.464  1.00 26.46 ? 425  ARG B CG    1 
ATOM   10275 C  CD    . ARG B 1 425 ? 21.182  -58.720 20.807  1.00 31.71 ? 425  ARG B CD    1 
ATOM   10276 N  NE    . ARG B 1 425 ? 20.009  -58.833 21.656  1.00 29.68 ? 425  ARG B NE    1 
ATOM   10277 C  CZ    . ARG B 1 425 ? 18.738  -58.692 21.297  1.00 39.92 ? 425  ARG B CZ    1 
ATOM   10278 N  NH1   . ARG B 1 425 ? 18.383  -58.480 20.030  1.00 33.79 ? 425  ARG B NH1   1 
ATOM   10279 N  NH2   . ARG B 1 425 ? 17.752  -58.721 22.216  1.00 33.47 ? 425  ARG B NH2   1 
ATOM   10280 N  N     . ARG B 1 426 ? 19.581  -54.074 21.177  1.00 31.26 ? 426  ARG B N     1 
ATOM   10281 C  CA    . ARG B 1 426 ? 18.460  -53.474 20.459  1.00 32.21 ? 426  ARG B CA    1 
ATOM   10282 C  C     . ARG B 1 426 ? 18.768  -52.085 19.943  1.00 32.16 ? 426  ARG B C     1 
ATOM   10283 O  O     . ARG B 1 426 ? 18.664  -51.779 18.762  1.00 32.61 ? 426  ARG B O     1 
ATOM   10284 C  CB    . ARG B 1 426 ? 17.252  -53.394 21.415  1.00 35.65 ? 426  ARG B CB    1 
ATOM   10285 C  CG    . ARG B 1 426 ? 16.565  -54.768 21.385  1.00 36.96 ? 426  ARG B CG    1 
ATOM   10286 C  CD    . ARG B 1 426 ? 15.654  -54.919 22.571  1.00 30.54 ? 426  ARG B CD    1 
ATOM   10287 N  NE    . ARG B 1 426 ? 15.010  -56.221 22.622  1.00 34.08 ? 426  ARG B NE    1 
ATOM   10288 C  CZ    . ARG B 1 426 ? 14.312  -56.520 23.735  1.00 35.06 ? 426  ARG B CZ    1 
ATOM   10289 N  NH1   . ARG B 1 426 ? 14.174  -55.619 24.703  1.00 31.93 ? 426  ARG B NH1   1 
ATOM   10290 N  NH2   . ARG B 1 426 ? 13.708  -57.680 23.822  1.00 36.49 ? 426  ARG B NH2   1 
ATOM   10291 N  N     . PHE B 1 427 ? 19.357  -51.297 20.832  1.00 32.26 ? 427  PHE B N     1 
ATOM   10292 C  CA    . PHE B 1 427 ? 19.806  -49.944 20.511  1.00 32.13 ? 427  PHE B CA    1 
ATOM   10293 C  C     . PHE B 1 427 ? 20.725  -49.991 19.316  1.00 32.47 ? 427  PHE B C     1 
ATOM   10294 O  O     . PHE B 1 427 ? 20.576  -49.234 18.364  1.00 33.12 ? 427  PHE B O     1 
ATOM   10295 C  CB    . PHE B 1 427 ? 20.425  -49.326 21.786  1.00 30.66 ? 427  PHE B CB    1 
ATOM   10296 C  CG    . PHE B 1 427 ? 21.137  -48.014 21.657  1.00 27.37 ? 427  PHE B CG    1 
ATOM   10297 C  CD1   . PHE B 1 427 ? 20.638  -46.978 20.919  1.00 25.55 ? 427  PHE B CD1   1 
ATOM   10298 C  CD2   . PHE B 1 427 ? 22.386  -47.834 22.237  1.00 28.94 ? 427  PHE B CD2   1 
ATOM   10299 C  CE1   . PHE B 1 427 ? 21.336  -45.784 20.739  1.00 23.86 ? 427  PHE B CE1   1 
ATOM   10300 C  CE2   . PHE B 1 427 ? 23.095  -46.654 22.092  1.00 26.40 ? 427  PHE B CE2   1 
ATOM   10301 C  CZ    . PHE B 1 427 ? 22.569  -45.632 21.307  1.00 27.39 ? 427  PHE B CZ    1 
ATOM   10302 N  N     . HIS B 1 428 ? 21.816  -50.748 19.360  1.00 33.63 ? 428  HIS B N     1 
ATOM   10303 C  CA    . HIS B 1 428 ? 22.805  -50.841 18.294  1.00 33.57 ? 428  HIS B CA    1 
ATOM   10304 C  C     . HIS B 1 428 ? 22.167  -51.220 16.969  1.00 32.17 ? 428  HIS B C     1 
ATOM   10305 O  O     . HIS B 1 428 ? 22.527  -50.663 15.957  1.00 30.55 ? 428  HIS B O     1 
ATOM   10306 C  CB    . HIS B 1 428 ? 24.013  -51.749 18.636  1.00 28.49 ? 428  HIS B CB    1 
ATOM   10307 C  CG    . HIS B 1 428 ? 24.725  -51.287 19.869  1.00 34.23 ? 428  HIS B CG    1 
ATOM   10308 N  ND1   . HIS B 1 428 ? 25.719  -51.992 20.504  1.00 37.73 ? 428  HIS B ND1   1 
ATOM   10309 C  CD2   . HIS B 1 428 ? 24.555  -50.154 20.609  1.00 37.63 ? 428  HIS B CD2   1 
ATOM   10310 C  CE1   . HIS B 1 428 ? 26.152  -51.299 21.562  1.00 40.58 ? 428  HIS B CE1   1 
ATOM   10311 N  NE2   . HIS B 1 428 ? 25.466  -50.169 21.646  1.00 39.40 ? 428  HIS B NE2   1 
ATOM   10312 N  N     . LYS B 1 429 ? 21.255  -52.194 16.963  1.00 33.31 ? 429  LYS B N     1 
ATOM   10313 C  CA    . LYS B 1 429 ? 20.649  -52.620 15.706  1.00 33.62 ? 429  LYS B CA    1 
ATOM   10314 C  C     . LYS B 1 429 ? 19.831  -51.515 15.070  1.00 33.63 ? 429  LYS B C     1 
ATOM   10315 O  O     . LYS B 1 429 ? 19.882  -51.315 13.861  1.00 31.98 ? 429  LYS B O     1 
ATOM   10316 C  CB    . LYS B 1 429 ? 19.779  -53.866 15.940  1.00 32.94 ? 429  LYS B CB    1 
ATOM   10317 C  CG    . LYS B 1 429 ? 20.438  -55.088 15.352  1.00 37.71 ? 429  LYS B CG    1 
ATOM   10318 C  CD    . LYS B 1 429 ? 19.890  -56.383 15.956  1.00 43.76 ? 429  LYS B CD    1 
ATOM   10319 C  CE    . LYS B 1 429 ? 18.452  -56.602 15.524  1.00 41.66 ? 429  LYS B CE    1 
ATOM   10320 N  NZ    . LYS B 1 429 ? 17.931  -57.943 15.900  1.00 47.53 ? 429  LYS B NZ    1 
ATOM   10321 N  N     . THR B 1 430 ? 18.970  -50.865 15.871  1.00 35.21 ? 430  THR B N     1 
ATOM   10322 C  CA    . THR B 1 430 ? 18.151  -49.777 15.304  1.00 36.22 ? 430  THR B CA    1 
ATOM   10323 C  C     . THR B 1 430 ? 19.037  -48.720 14.663  1.00 38.16 ? 430  THR B C     1 
ATOM   10324 O  O     . THR B 1 430 ? 18.877  -48.297 13.511  1.00 39.14 ? 430  THR B O     1 
ATOM   10325 C  CB    . THR B 1 430 ? 17.253  -49.151 16.381  1.00 32.06 ? 430  THR B CB    1 
ATOM   10326 O  OG1   . THR B 1 430 ? 16.431  -50.179 16.937  1.00 27.53 ? 430  THR B OG1   1 
ATOM   10327 C  CG2   . THR B 1 430 ? 16.288  -48.130 15.821  1.00 31.00 ? 430  THR B CG2   1 
ATOM   10328 N  N     . LEU B 1 431 ? 20.097  -48.366 15.407  1.00 38.74 ? 431  LEU B N     1 
ATOM   10329 C  CA    . LEU B 1 431 ? 21.033  -47.318 14.979  1.00 37.52 ? 431  LEU B CA    1 
ATOM   10330 C  C     . LEU B 1 431 ? 21.514  -47.676 13.577  1.00 37.72 ? 431  LEU B C     1 
ATOM   10331 O  O     . LEU B 1 431 ? 21.601  -46.770 12.756  1.00 39.26 ? 431  LEU B O     1 
ATOM   10332 C  CB    . LEU B 1 431 ? 22.282  -47.320 15.868  1.00 30.63 ? 431  LEU B CB    1 
ATOM   10333 C  CG    . LEU B 1 431 ? 22.966  -46.009 16.167  1.00 35.35 ? 431  LEU B CG    1 
ATOM   10334 C  CD1   . LEU B 1 431 ? 24.441  -46.053 16.028  1.00 31.80 ? 431  LEU B CD1   1 
ATOM   10335 C  CD2   . LEU B 1 431 ? 22.379  -44.873 15.336  1.00 35.65 ? 431  LEU B CD2   1 
ATOM   10336 N  N     . ARG B 1 432 ? 22.062  -48.875 13.422  1.00 36.72 ? 432  ARG B N     1 
ATOM   10337 C  CA    . ARG B 1 432 ? 22.602  -49.223 12.103  1.00 37.57 ? 432  ARG B CA    1 
ATOM   10338 C  C     . ARG B 1 432 ? 21.504  -49.174 11.046  1.00 36.14 ? 432  ARG B C     1 
ATOM   10339 O  O     . ARG B 1 432 ? 21.757  -48.503 10.059  1.00 35.17 ? 432  ARG B O     1 
ATOM   10340 C  CB    . ARG B 1 432 ? 23.498  -50.453 12.077  1.00 37.97 ? 432  ARG B CB    1 
ATOM   10341 C  CG    . ARG B 1 432 ? 23.926  -50.984 13.434  1.00 45.41 ? 432  ARG B CG    1 
ATOM   10342 C  CD    . ARG B 1 432 ? 25.022  -52.024 13.454  1.00 45.36 ? 432  ARG B CD    1 
ATOM   10343 N  NE    . ARG B 1 432 ? 26.048  -51.735 14.468  1.00 53.65 ? 432  ARG B NE    1 
ATOM   10344 C  CZ    . ARG B 1 432 ? 26.345  -52.601 15.466  1.00 53.34 ? 432  ARG B CZ    1 
ATOM   10345 N  NH1   . ARG B 1 432 ? 25.617  -53.708 15.531  1.00 51.83 ? 432  ARG B NH1   1 
ATOM   10346 N  NH2   . ARG B 1 432 ? 27.242  -52.316 16.406  1.00 50.76 ? 432  ARG B NH2   1 
ATOM   10347 N  N     . ARG B 1 433 ? 20.261  -49.566 11.270  1.00 36.65 ? 433  ARG B N     1 
ATOM   10348 C  CA    . ARG B 1 433 ? 19.209  -49.388 10.297  1.00 38.37 ? 433  ARG B CA    1 
ATOM   10349 C  C     . ARG B 1 433 ? 18.975  -47.917 10.007  1.00 39.68 ? 433  ARG B C     1 
ATOM   10350 O  O     . ARG B 1 433 ? 18.541  -47.620 8.885   1.00 42.00 ? 433  ARG B O     1 
ATOM   10351 C  CB    . ARG B 1 433 ? 17.824  -49.978 10.635  1.00 38.38 ? 433  ARG B CB    1 
ATOM   10352 C  CG    . ARG B 1 433 ? 17.806  -51.464 10.931  1.00 37.56 ? 433  ARG B CG    1 
ATOM   10353 C  CD    . ARG B 1 433 ? 16.389  -52.036 10.795  1.00 33.65 ? 433  ARG B CD    1 
ATOM   10354 N  NE    . ARG B 1 433 ? 15.498  -51.264 11.639  1.00 37.26 ? 433  ARG B NE    1 
ATOM   10355 C  CZ    . ARG B 1 433 ? 15.357  -51.511 12.952  1.00 36.97 ? 433  ARG B CZ    1 
ATOM   10356 N  NH1   . ARG B 1 433 ? 16.038  -52.492 13.520  1.00 29.32 ? 433  ARG B NH1   1 
ATOM   10357 N  NH2   . ARG B 1 433 ? 14.617  -50.689 13.681  1.00 31.28 ? 433  ARG B NH2   1 
ATOM   10358 N  N     . LEU B 1 434 ? 18.991  -47.034 11.001  1.00 39.19 ? 434  LEU B N     1 
ATOM   10359 C  CA    . LEU B 1 434 ? 18.592  -45.628 10.757  1.00 36.05 ? 434  LEU B CA    1 
ATOM   10360 C  C     . LEU B 1 434 ? 19.672  -44.851 10.055  1.00 35.64 ? 434  LEU B C     1 
ATOM   10361 O  O     . LEU B 1 434 ? 19.464  -43.841 9.359   1.00 35.17 ? 434  LEU B O     1 
ATOM   10362 C  CB    . LEU B 1 434 ? 18.234  -45.015 12.095  1.00 30.92 ? 434  LEU B CB    1 
ATOM   10363 C  CG    . LEU B 1 434 ? 16.825  -44.978 12.608  1.00 33.60 ? 434  LEU B CG    1 
ATOM   10364 C  CD1   . LEU B 1 434 ? 15.915  -45.986 11.964  1.00 33.40 ? 434  LEU B CD1   1 
ATOM   10365 C  CD2   . LEU B 1 434 ? 16.737  -44.934 14.124  1.00 28.46 ? 434  LEU B CD2   1 
ATOM   10366 N  N     . VAL B 1 435 ? 20.917  -45.280 10.280  1.00 35.46 ? 435  VAL B N     1 
ATOM   10367 C  CA    . VAL B 1 435 ? 22.096  -44.613 9.769   1.00 36.14 ? 435  VAL B CA    1 
ATOM   10368 C  C     . VAL B 1 435 ? 23.120  -45.572 9.145   1.00 38.29 ? 435  VAL B C     1 
ATOM   10369 O  O     . VAL B 1 435 ? 24.295  -45.582 9.550   1.00 39.84 ? 435  VAL B O     1 
ATOM   10370 C  CB    . VAL B 1 435 ? 22.780  -43.732 10.824  1.00 32.66 ? 435  VAL B CB    1 
ATOM   10371 C  CG1   . VAL B 1 435 ? 23.793  -42.784 10.208  1.00 35.60 ? 435  VAL B CG1   1 
ATOM   10372 C  CG2   . VAL B 1 435 ? 21.792  -42.855 11.592  1.00 38.34 ? 435  VAL B CG2   1 
ATOM   10373 N  N     . PRO B 1 436 ? 22.834  -46.082 7.944   1.00 39.19 ? 436  PRO B N     1 
ATOM   10374 C  CA    . PRO B 1 436 ? 23.680  -46.982 7.201   1.00 39.29 ? 436  PRO B CA    1 
ATOM   10375 C  C     . PRO B 1 436 ? 24.985  -46.409 6.668   1.00 38.88 ? 436  PRO B C     1 
ATOM   10376 O  O     . PRO B 1 436 ? 25.949  -47.201 6.509   1.00 38.45 ? 436  PRO B O     1 
ATOM   10377 C  CB    . PRO B 1 436 ? 22.826  -47.465 6.042   1.00 39.76 ? 436  PRO B CB    1 
ATOM   10378 C  CG    . PRO B 1 436 ? 21.809  -46.363 5.881   1.00 40.84 ? 436  PRO B CG    1 
ATOM   10379 C  CD    . PRO B 1 436 ? 21.492  -45.942 7.286   1.00 40.27 ? 436  PRO B CD    1 
ATOM   10380 N  N     . ASP B 1 437 ? 25.113  -45.099 6.563   1.00 37.27 ? 437  ASP B N     1 
ATOM   10381 C  CA    . ASP B 1 437 ? 26.363  -44.525 6.069   1.00 40.84 ? 437  ASP B CA    1 
ATOM   10382 C  C     . ASP B 1 437 ? 27.386  -44.238 7.144   1.00 41.45 ? 437  ASP B C     1 
ATOM   10383 O  O     . ASP B 1 437 ? 28.401  -43.610 6.836   1.00 42.10 ? 437  ASP B O     1 
ATOM   10384 C  CB    . ASP B 1 437 ? 26.060  -43.193 5.337   1.00 42.50 ? 437  ASP B CB    1 
ATOM   10385 C  CG    . ASP B 1 437 ? 24.523  -43.086 5.379   1.00 50.96 ? 437  ASP B CG    1 
ATOM   10386 O  OD1   . ASP B 1 437 ? 23.904  -42.688 6.414   1.00 39.01 ? 437  ASP B OD1   1 
ATOM   10387 O  OD2   . ASP B 1 437 ? 24.109  -43.567 4.289   1.00 53.69 ? 437  ASP B OD2   1 
ATOM   10388 N  N     . SER B 1 438 ? 27.025  -44.569 8.371   1.00 42.69 ? 438  SER B N     1 
ATOM   10389 C  CA    . SER B 1 438 ? 27.930  -44.360 9.496   1.00 44.68 ? 438  SER B CA    1 
ATOM   10390 C  C     . SER B 1 438 ? 28.294  -45.684 10.159  1.00 45.31 ? 438  SER B C     1 
ATOM   10391 O  O     . SER B 1 438 ? 27.421  -46.328 10.708  1.00 45.92 ? 438  SER B O     1 
ATOM   10392 C  CB    . SER B 1 438 ? 27.220  -43.511 10.567  1.00 42.33 ? 438  SER B CB    1 
ATOM   10393 O  OG    . SER B 1 438 ? 27.173  -42.136 10.202  1.00 41.19 ? 438  SER B OG    1 
ATOM   10394 N  N     . ASP B 1 439 ? 29.552  -45.937 10.411  1.00 46.82 ? 439  ASP B N     1 
ATOM   10395 C  CA    . ASP B 1 439 ? 29.972  -47.093 11.214  1.00 46.94 ? 439  ASP B CA    1 
ATOM   10396 C  C     . ASP B 1 439 ? 30.378  -46.648 12.606  1.00 45.17 ? 439  ASP B C     1 
ATOM   10397 O  O     . ASP B 1 439 ? 31.331  -45.874 12.793  1.00 47.40 ? 439  ASP B O     1 
ATOM   10398 C  CB    . ASP B 1 439 ? 31.178  -47.717 10.489  1.00 56.68 ? 439  ASP B CB    1 
ATOM   10399 C  CG    . ASP B 1 439 ? 30.859  -49.138 10.007  1.00 60.88 ? 439  ASP B CG    1 
ATOM   10400 O  OD1   . ASP B 1 439 ? 29.661  -49.406 9.726   1.00 59.43 ? 439  ASP B OD1   1 
ATOM   10401 O  OD2   . ASP B 1 439 ? 31.862  -49.902 9.969   1.00 60.79 ? 439  ASP B OD2   1 
ATOM   10402 N  N     . VAL B 1 440 ? 29.687  -47.075 13.615  1.00 41.70 ? 440  VAL B N     1 
ATOM   10403 C  CA    . VAL B 1 440 ? 29.924  -46.772 15.001  1.00 40.03 ? 440  VAL B CA    1 
ATOM   10404 C  C     . VAL B 1 440 ? 30.457  -47.947 15.827  1.00 37.59 ? 440  VAL B C     1 
ATOM   10405 O  O     . VAL B 1 440 ? 29.836  -48.992 15.864  1.00 36.98 ? 440  VAL B O     1 
ATOM   10406 C  CB    . VAL B 1 440 ? 28.515  -46.550 15.641  1.00 44.44 ? 440  VAL B CB    1 
ATOM   10407 C  CG1   . VAL B 1 440 ? 28.599  -45.984 17.039  1.00 40.79 ? 440  VAL B CG1   1 
ATOM   10408 C  CG2   . VAL B 1 440 ? 27.714  -45.762 14.632  1.00 48.36 ? 440  VAL B CG2   1 
ATOM   10409 N  N     . ARG B 1 441 ? 31.496  -47.694 16.583  1.00 34.82 ? 441  ARG B N     1 
ATOM   10410 C  CA    . ARG B 1 441 ? 32.003  -48.587 17.610  1.00 33.69 ? 441  ARG B CA    1 
ATOM   10411 C  C     . ARG B 1 441 ? 31.512  -48.091 18.973  1.00 32.40 ? 441  ARG B C     1 
ATOM   10412 O  O     . ARG B 1 441 ? 31.949  -47.003 19.365  1.00 33.82 ? 441  ARG B O     1 
ATOM   10413 C  CB    . ARG B 1 441 ? 33.532  -48.426 17.616  1.00 32.35 ? 441  ARG B CB    1 
ATOM   10414 C  CG    . ARG B 1 441 ? 34.339  -49.669 17.932  1.00 36.54 ? 441  ARG B CG    1 
ATOM   10415 C  CD    . ARG B 1 441 ? 35.717  -49.358 18.403  1.00 45.33 ? 441  ARG B CD    1 
ATOM   10416 N  NE    . ARG B 1 441 ? 36.783  -49.122 17.406  1.00 47.85 ? 441  ARG B NE    1 
ATOM   10417 C  CZ    . ARG B 1 441 ? 36.852  -50.036 16.437  1.00 50.61 ? 441  ARG B CZ    1 
ATOM   10418 N  NH1   . ARG B 1 441 ? 35.872  -50.920 16.618  1.00 48.20 ? 441  ARG B NH1   1 
ATOM   10419 N  NH2   . ARG B 1 441 ? 37.746  -50.094 15.463  1.00 44.55 ? 441  ARG B NH2   1 
ATOM   10420 N  N     . PHE B 1 442 ? 30.859  -48.876 19.807  1.00 32.87 ? 442  PHE B N     1 
ATOM   10421 C  CA    . PHE B 1 442 ? 30.554  -48.405 21.159  1.00 31.99 ? 442  PHE B CA    1 
ATOM   10422 C  C     . PHE B 1 442 ? 31.627  -48.936 22.122  1.00 31.63 ? 442  PHE B C     1 
ATOM   10423 O  O     . PHE B 1 442 ? 32.101  -50.047 21.938  1.00 28.99 ? 442  PHE B O     1 
ATOM   10424 C  CB    . PHE B 1 442 ? 29.173  -48.710 21.656  1.00 28.97 ? 442  PHE B CB    1 
ATOM   10425 C  CG    . PHE B 1 442 ? 28.068  -48.061 20.902  1.00 32.17 ? 442  PHE B CG    1 
ATOM   10426 C  CD1   . PHE B 1 442 ? 27.629  -48.598 19.689  1.00 32.81 ? 442  PHE B CD1   1 
ATOM   10427 C  CD2   . PHE B 1 442 ? 27.400  -46.956 21.432  1.00 33.86 ? 442  PHE B CD2   1 
ATOM   10428 C  CE1   . PHE B 1 442 ? 26.580  -47.996 19.004  1.00 29.89 ? 442  PHE B CE1   1 
ATOM   10429 C  CE2   . PHE B 1 442 ? 26.332  -46.363 20.747  1.00 27.90 ? 442  PHE B CE2   1 
ATOM   10430 C  CZ    . PHE B 1 442 ? 25.983  -46.850 19.511  1.00 26.15 ? 442  PHE B CZ    1 
ATOM   10431 N  N     . LEU B 1 443 ? 32.171  -47.983 22.897  1.00 31.71 ? 443  LEU B N     1 
ATOM   10432 C  CA    . LEU B 1 443 ? 33.176  -48.304 23.912  1.00 33.07 ? 443  LEU B CA    1 
ATOM   10433 C  C     . LEU B 1 443 ? 32.495  -48.016 25.247  1.00 35.14 ? 443  LEU B C     1 
ATOM   10434 O  O     . LEU B 1 443 ? 32.125  -46.850 25.448  1.00 36.63 ? 443  LEU B O     1 
ATOM   10435 C  CB    . LEU B 1 443 ? 34.326  -47.305 23.800  1.00 30.35 ? 443  LEU B CB    1 
ATOM   10436 C  CG    . LEU B 1 443 ? 35.748  -47.735 23.629  1.00 33.22 ? 443  LEU B CG    1 
ATOM   10437 C  CD1   . LEU B 1 443 ? 36.301  -47.400 22.260  1.00 39.06 ? 443  LEU B CD1   1 
ATOM   10438 C  CD2   . LEU B 1 443 ? 36.687  -46.979 24.597  1.00 37.24 ? 443  LEU B CD2   1 
ATOM   10439 N  N     . LEU B 1 444 ? 32.455  -48.954 26.146  1.00 37.35 ? 444  LEU B N     1 
ATOM   10440 C  CA    . LEU B 1 444 ? 31.730  -48.873 27.408  1.00 39.29 ? 444  LEU B CA    1 
ATOM   10441 C  C     . LEU B 1 444 ? 32.633  -48.329 28.497  1.00 42.15 ? 444  LEU B C     1 
ATOM   10442 O  O     . LEU B 1 444 ? 33.715  -48.866 28.690  1.00 44.41 ? 444  LEU B O     1 
ATOM   10443 C  CB    . LEU B 1 444 ? 31.324  -50.277 27.843  1.00 38.14 ? 444  LEU B CB    1 
ATOM   10444 C  CG    . LEU B 1 444 ? 30.558  -50.487 29.126  1.00 37.03 ? 444  LEU B CG    1 
ATOM   10445 C  CD1   . LEU B 1 444 ? 29.271  -49.717 29.158  1.00 37.00 ? 444  LEU B CD1   1 
ATOM   10446 C  CD2   . LEU B 1 444 ? 30.254  -51.948 29.377  1.00 40.74 ? 444  LEU B CD2   1 
ATOM   10447 N  N     . SER B 1 445 ? 32.257  -47.239 29.156  1.00 43.26 ? 445  SER B N     1 
ATOM   10448 C  CA    . SER B 1 445 ? 33.214  -46.721 30.145  1.00 45.03 ? 445  SER B CA    1 
ATOM   10449 C  C     . SER B 1 445 ? 33.217  -47.634 31.352  1.00 46.97 ? 445  SER B C     1 
ATOM   10450 O  O     . SER B 1 445 ? 32.454  -47.334 32.278  1.00 48.28 ? 445  SER B O     1 
ATOM   10451 C  CB    . SER B 1 445 ? 32.752  -45.312 30.501  1.00 43.58 ? 445  SER B CB    1 
ATOM   10452 O  OG    . SER B 1 445 ? 33.599  -44.752 31.455  1.00 46.65 ? 445  SER B OG    1 
ATOM   10453 N  N     . GLU B 1 446 ? 34.105  -48.613 31.403  1.00 48.83 ? 446  GLU B N     1 
ATOM   10454 C  CA    . GLU B 1 446 ? 34.231  -49.495 32.553  1.00 50.61 ? 446  GLU B CA    1 
ATOM   10455 C  C     . GLU B 1 446 ? 34.327  -48.758 33.884  1.00 51.51 ? 446  GLU B C     1 
ATOM   10456 O  O     . GLU B 1 446 ? 33.582  -49.133 34.794  1.00 52.25 ? 446  GLU B O     1 
ATOM   10457 C  CB    . GLU B 1 446 ? 35.461  -50.388 32.432  1.00 59.12 ? 446  GLU B CB    1 
ATOM   10458 C  CG    . GLU B 1 446 ? 35.224  -51.895 32.566  1.00 66.58 ? 446  GLU B CG    1 
ATOM   10459 C  CD    . GLU B 1 446 ? 36.543  -52.645 32.707  1.00 70.83 ? 446  GLU B CD    1 
ATOM   10460 O  OE1   . GLU B 1 446 ? 37.397  -52.602 31.785  1.00 74.31 ? 446  GLU B OE1   1 
ATOM   10461 O  OE2   . GLU B 1 446 ? 36.787  -53.258 33.773  1.00 74.86 ? 446  GLU B OE2   1 
ATOM   10462 N  N     . SER B 1 447 ? 35.156  -47.729 34.009  1.00 51.12 ? 447  SER B N     1 
ATOM   10463 C  CA    . SER B 1 447 ? 35.333  -47.099 35.309  1.00 51.49 ? 447  SER B CA    1 
ATOM   10464 C  C     . SER B 1 447 ? 34.827  -45.666 35.391  1.00 50.96 ? 447  SER B C     1 
ATOM   10465 O  O     . SER B 1 447 ? 35.283  -44.852 36.200  1.00 51.51 ? 447  SER B O     1 
ATOM   10466 C  CB    . SER B 1 447 ? 36.827  -47.149 35.663  1.00 55.51 ? 447  SER B CB    1 
ATOM   10467 O  OG    . SER B 1 447 ? 37.544  -46.342 34.718  1.00 65.96 ? 447  SER B OG    1 
ATOM   10468 N  N     . GLY B 1 448 ? 33.793  -45.341 34.627  1.00 48.61 ? 448  GLY B N     1 
ATOM   10469 C  CA    . GLY B 1 448 ? 33.152  -44.064 34.716  1.00 46.12 ? 448  GLY B CA    1 
ATOM   10470 C  C     . GLY B 1 448 ? 34.057  -42.937 34.280  1.00 46.07 ? 448  GLY B C     1 
ATOM   10471 O  O     . GLY B 1 448 ? 35.078  -43.157 33.627  1.00 47.46 ? 448  GLY B O     1 
ATOM   10472 N  N     . SER B 1 449 ? 33.628  -41.726 34.608  1.00 43.59 ? 449  SER B N     1 
ATOM   10473 C  CA    . SER B 1 449 ? 34.131  -40.537 33.972  1.00 43.45 ? 449  SER B CA    1 
ATOM   10474 C  C     . SER B 1 449 ? 35.336  -39.913 34.642  1.00 44.32 ? 449  SER B C     1 
ATOM   10475 O  O     . SER B 1 449 ? 35.634  -38.789 34.247  1.00 43.52 ? 449  SER B O     1 
ATOM   10476 C  CB    . SER B 1 449 ? 32.971  -39.512 33.997  1.00 41.97 ? 449  SER B CB    1 
ATOM   10477 O  OG    . SER B 1 449 ? 32.871  -38.956 35.298  1.00 43.92 ? 449  SER B OG    1 
ATOM   10478 N  N     . GLY B 1 450 ? 35.996  -40.549 35.620  1.00 43.71 ? 450  GLY B N     1 
ATOM   10479 C  CA    . GLY B 1 450 ? 37.005  -39.759 36.346  1.00 42.02 ? 450  GLY B CA    1 
ATOM   10480 C  C     . GLY B 1 450 ? 38.270  -39.489 35.560  1.00 39.94 ? 450  GLY B C     1 
ATOM   10481 O  O     . GLY B 1 450 ? 38.920  -38.450 35.691  1.00 39.77 ? 450  GLY B O     1 
ATOM   10482 N  N     . LYS B 1 451 ? 38.659  -40.460 34.766  1.00 39.16 ? 451  LYS B N     1 
ATOM   10483 C  CA    . LYS B 1 451 ? 39.862  -40.408 33.960  1.00 39.97 ? 451  LYS B CA    1 
ATOM   10484 C  C     . LYS B 1 451 ? 39.772  -39.152 33.057  1.00 39.78 ? 451  LYS B C     1 
ATOM   10485 O  O     . LYS B 1 451 ? 40.660  -38.310 32.928  1.00 39.14 ? 451  LYS B O     1 
ATOM   10486 C