data_1QIB
# 
_entry.id   1QIB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QIB         
RCSB  RCSB001174   
WWPDB D_1000001174 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QIB 
_pdbx_database_status.recvd_initial_deposition_date   1999-06-11 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dhanaraj, V.'   1  
'Williams, M.G.' 2  
'Ye, Q.-Z.'      3  
'Molina, F.'     4  
'Johnson, L.L.'  5  
'Ortwine, D.F.'  6  
'Pavlovsky, A.'  7  
'Rubin, J.R.'    8  
'Skeean, R.W.'   9  
'White, A.D.'    10 
'Humblet, C.'    11 
'Hupe, D.J.'     12 
'Blundell, T.L.' 13 
# 
_citation.id                        primary 
_citation.title                     'X-ray structure of gelatinase A catalytic domain complexed with a hydroxamate inhibitor' 
_citation.journal_abbrev            'Croatica Chemica Acta' 
_citation.journal_volume            72 
_citation.page_first                575 
_citation.page_last                 591 
_citation.year                      1999 
_citation.journal_id_ASTM           ? 
_citation.country                   HRV 
_citation.journal_id_ISSN           0011-1643 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   -1 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dhanaraj, V.'   1  
primary 'Williams, M.G.' 2  
primary 'Ye, Q.-Z.'      3  
primary 'Molina, F.'     4  
primary 'Johnson, L.L.'  5  
primary 'Ortwine, D.F.'  6  
primary 'Pavlovsky, A.'  7  
primary 'Rubin, J.R.'    8  
primary 'Skeean, R.W.'   9  
primary 'White, A.D.'    10 
primary 'Humblet, C.'    11 
primary 'Hupe, D.J.'     12 
primary 'Blundell, T.L.' 13 
# 
_cell.entry_id           1QIB 
_cell.length_a           84.830 
_cell.length_b           84.830 
_cell.length_c           57.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QIB 
_symmetry.space_group_name_H-M             'P 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     tetragonal 
_symmetry.Int_Tables_number                91 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '72 kDa type IV collagenase' 17957.861 1 3.4.24.24 ? 
'CATALYTIC DOMAIN RESIDUES 88-250 WITH THE FIBRONECTIN DOMAIN DELETED' ? 
2 non-polymer syn 'ZINC ION'                   65.409    2 ?         ? ? ? 
3 non-polymer syn 'CALCIUM ION'                40.078    3 ?         ? ? ? 
4 water       nat water                        18.015    5 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;72 kDa gelatinase,Gelatinase A,Matrix metalloproteinase-2,MMP-2,TBE-1,72 kDa gelatinase,Gelatinase A,Matrix metalloproteinase-2,MMP-2,TBE-1
;
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        E.C.3.4.24.24 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;RKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHA
FAPGTGVGGDSHFDDDELWSLGKGVGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGAS
P
;
_entity_poly.pdbx_seq_one_letter_code_can   
;RKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHA
FAPGTGVGGDSHFDDDELWSLGKGVGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGAS
P
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   LYS n 
1 3   PRO n 
1 4   LYS n 
1 5   TRP n 
1 6   ASP n 
1 7   LYS n 
1 8   ASN n 
1 9   GLN n 
1 10  ILE n 
1 11  THR n 
1 12  TYR n 
1 13  ARG n 
1 14  ILE n 
1 15  ILE n 
1 16  GLY n 
1 17  TYR n 
1 18  THR n 
1 19  PRO n 
1 20  ASP n 
1 21  LEU n 
1 22  ASP n 
1 23  PRO n 
1 24  GLU n 
1 25  THR n 
1 26  VAL n 
1 27  ASP n 
1 28  ASP n 
1 29  ALA n 
1 30  PHE n 
1 31  ALA n 
1 32  ARG n 
1 33  ALA n 
1 34  PHE n 
1 35  GLN n 
1 36  VAL n 
1 37  TRP n 
1 38  SER n 
1 39  ASP n 
1 40  VAL n 
1 41  THR n 
1 42  PRO n 
1 43  LEU n 
1 44  ARG n 
1 45  PHE n 
1 46  SER n 
1 47  ARG n 
1 48  ILE n 
1 49  HIS n 
1 50  ASP n 
1 51  GLY n 
1 52  GLU n 
1 53  ALA n 
1 54  ASP n 
1 55  ILE n 
1 56  MET n 
1 57  ILE n 
1 58  ASN n 
1 59  PHE n 
1 60  GLY n 
1 61  ARG n 
1 62  TRP n 
1 63  GLU n 
1 64  HIS n 
1 65  GLY n 
1 66  ASP n 
1 67  GLY n 
1 68  TYR n 
1 69  PRO n 
1 70  PHE n 
1 71  ASP n 
1 72  GLY n 
1 73  LYS n 
1 74  ASP n 
1 75  GLY n 
1 76  LEU n 
1 77  LEU n 
1 78  ALA n 
1 79  HIS n 
1 80  ALA n 
1 81  PHE n 
1 82  ALA n 
1 83  PRO n 
1 84  GLY n 
1 85  THR n 
1 86  GLY n 
1 87  VAL n 
1 88  GLY n 
1 89  GLY n 
1 90  ASP n 
1 91  SER n 
1 92  HIS n 
1 93  PHE n 
1 94  ASP n 
1 95  ASP n 
1 96  ASP n 
1 97  GLU n 
1 98  LEU n 
1 99  TRP n 
1 100 SER n 
1 101 LEU n 
1 102 GLY n 
1 103 LYS n 
1 104 GLY n 
1 105 VAL n 
1 106 GLY n 
1 107 TYR n 
1 108 SER n 
1 109 LEU n 
1 110 PHE n 
1 111 LEU n 
1 112 VAL n 
1 113 ALA n 
1 114 ALA n 
1 115 HIS n 
1 116 GLU n 
1 117 PHE n 
1 118 GLY n 
1 119 HIS n 
1 120 ALA n 
1 121 MET n 
1 122 GLY n 
1 123 LEU n 
1 124 GLU n 
1 125 HIS n 
1 126 SER n 
1 127 GLN n 
1 128 ASP n 
1 129 PRO n 
1 130 GLY n 
1 131 ALA n 
1 132 LEU n 
1 133 MET n 
1 134 ALA n 
1 135 PRO n 
1 136 ILE n 
1 137 TYR n 
1 138 THR n 
1 139 TYR n 
1 140 THR n 
1 141 LYS n 
1 142 ASN n 
1 143 PHE n 
1 144 ARG n 
1 145 LEU n 
1 146 SER n 
1 147 GLN n 
1 148 ASP n 
1 149 ASP n 
1 150 ILE n 
1 151 LYS n 
1 152 GLY n 
1 153 ILE n 
1 154 GLN n 
1 155 GLU n 
1 156 LEU n 
1 157 TYR n 
1 158 GLY n 
1 159 ALA n 
1 160 SER n 
1 161 PRO n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   104 Human Homo 'MMP2, CLG4A' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 105 161 Human Homo 'MMP2, CLG4A' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP MMP2_HUMAN P08253 ? 1 
;RKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHA
FAPGTGVGGDSHFDDDELW
;
115 
2 UNP MMP2_HUMAN P08253 ? 1 GYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASP                                               
394 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1QIB A 1   ? 99  ? P08253 115 ? 213 ? 88  186 
2 2 1QIB A 106 ? 161 ? P08253 394 ? 449 ? 192 250 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1QIB SER A 100 ? UNP P08253 ? ? linker 187 1 
1 1QIB LEU A 101 ? UNP P08253 ? ? linker 188 2 
1 1QIB GLY A 102 ? UNP P08253 ? ? linker 189 3 
1 1QIB LYS A 103 ? UNP P08253 ? ? linker 190 4 
1 1QIB GLY A 104 A UNP P08253 ? ? linker 190 5 
1 1QIB VAL A 105 ? UNP P08253 ? ? linker 191 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          1QIB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.90 
_exptl_crystal.density_percent_sol   57.57 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    'pH 6.0' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8700 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        SRS 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             0.8700 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QIB 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   5551 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.130 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.9 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1QIB 
_refine.ls_number_reflns_obs                     5551 
_refine.ls_number_reflns_all                     5551 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.8 
_refine.ls_percent_reflns_obs                    99.5 
_refine.ls_R_factor_obs                          0.2040000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2040000 
_refine.ls_R_factor_R_free                       0.2440000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'THIN SHELLS' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1272 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             5 
_refine_hist.number_atoms_total               1282 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.452 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.76 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.143 ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1QIB 
_struct.title                     'CRYSTAL STRUCTURE OF GELATINASE A CATALYTIC DOMAIN' 
_struct.pdbx_descriptor           'GELATINASE A' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QIB 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'INHIBITOR, MATRIXIN, MATRIX METALLOPROTEINASE-2 (MMP-2), GELATINASE A, METZINCIN, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 23  ? SER A 38  ? PRO A 110 SER A 125 1 ? 16 
HELX_P HELX_P2 2 LEU A 109 ? MET A 121 ? LEU A 195 MET A 207 1 ? 13 
HELX_P HELX_P3 3 GLN A 147 ? TYR A 157 ? GLN A 236 TYR A 246 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 125 NE2 ? ? A ZN 501 A HIS 211 1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc2  metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 115 NE2 ? ? A ZN 501 A HIS 201 1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc3  metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 119 NE2 ? ? A ZN 501 A HIS 205 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc4  metalc ? ? C ZN . ZN ? ? ? 1_555 A ASP 66  OD2 ? ? A ZN 502 A ASP 153 1_555 ? ? ? ? ? ? ? 2.695 ? 
metalc5  metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 79  NE2 ? ? A ZN 502 A HIS 166 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc6  metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 92  ND1 ? ? A ZN 502 A HIS 179 1_555 ? ? ? ? ? ? ? 2.282 ? 
metalc7  metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 64  NE2 ? ? A ZN 502 A HIS 151 1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc8  metalc ? ? D CA . CA ? ? ? 1_555 A ASP 71  OD1 ? ? A CA 503 A ASP 158 1_555 ? ? ? ? ? ? ? 2.870 ? 
metalc9  metalc ? ? D CA . CA ? ? ? 1_555 A ASP 74  O   ? ? A CA 503 A ASP 161 1_555 ? ? ? ? ? ? ? 2.585 ? 
metalc10 metalc ? ? D CA . CA ? ? ? 1_555 A LEU 76  O   ? ? A CA 503 A LEU 163 1_555 ? ? ? ? ? ? ? 2.671 ? 
metalc11 metalc ? ? D CA . CA ? ? ? 1_555 A ASP 94  OD2 ? ? A CA 503 A ASP 181 1_555 ? ? ? ? ? ? ? 2.576 ? 
metalc12 metalc ? ? D CA . CA ? ? ? 1_555 A GLY 72  O   ? ? A CA 503 A GLY 159 1_555 ? ? ? ? ? ? ? 2.496 ? 
metalc13 metalc ? ? D CA . CA ? ? ? 1_555 A GLU 97  OE2 ? ? A CA 503 A GLU 184 1_555 ? ? ? ? ? ? ? 2.659 ? 
metalc14 metalc ? ? E CA . CA ? ? ? 1_555 A ASP 54  O   ? ? A CA 504 A ASP 141 1_555 ? ? ? ? ? ? ? 2.546 ? 
metalc15 metalc ? ? E CA . CA ? ? ? 1_555 A GLY 88  O   ? ? A CA 504 A GLY 175 1_555 ? ? ? ? ? ? ? 2.655 ? 
metalc16 metalc ? ? E CA . CA ? ? ? 1_555 A GLY 86  O   ? ? A CA 504 A GLY 173 1_555 ? ? ? ? ? ? ? 2.584 ? 
metalc17 metalc ? ? E CA . CA ? ? ? 1_555 G HOH .   O   ? ? A CA 504 A HOH 304 1_555 ? ? ? ? ? ? ? 2.679 ? 
metalc18 metalc ? ? E CA . CA ? ? ? 1_555 A ASP 90  OD1 ? ? A CA 504 A ASP 177 1_555 ? ? ? ? ? ? ? 2.690 ? 
metalc19 metalc ? ? E CA . CA ? ? ? 1_555 G HOH .   O   ? ? A CA 504 A HOH 303 1_555 ? ? ? ? ? ? ? 2.538 ? 
metalc20 metalc ? ? F CA . CA ? ? ? 1_555 A ASP 95  OD1 ? ? A CA 505 A ASP 182 1_555 ? ? ? ? ? ? ? 2.801 ? 
metalc21 metalc ? ? F CA . CA ? ? ? 1_555 G HOH .   O   ? ? A CA 505 A HOH 301 1_555 ? ? ? ? ? ? ? 2.934 ? 
metalc22 metalc ? ? F CA . CA ? ? ? 1_555 A ASP 20  OD1 ? ? A CA 505 A ASP 107 1_555 ? ? ? ? ? ? ? 3.052 ? 
metalc23 metalc ? ? F CA . CA ? ? ? 1_555 A ASP 20  OD2 ? ? A CA 505 A ASP 107 1_555 ? ? ? ? ? ? ? 2.593 ? 
metalc24 metalc ? ? F CA . CA ? ? ? 1_555 A GLU 97  O   ? ? A CA 505 A GLU 184 1_555 ? ? ? ? ? ? ? 2.514 ? 
metalc25 metalc ? ? F CA . CA ? ? ? 1_555 G HOH .   O   ? ? A CA 505 A HOH 302 1_555 ? ? ? ? ? ? ? 2.729 ? 
metalc26 metalc ? ? F CA . CA ? ? ? 1_555 A ASP 95  O   ? ? A CA 505 A ASP 182 1_555 ? ? ? ? ? ? ? 2.680 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 44 ? ARG A 47 ? ARG A 131 ARG A 134 
A 2 GLN A 9  ? ILE A 14 ? GLN A 96  ILE A 101 
A 3 ILE A 55 ? GLY A 60 ? ILE A 142 GLY A 147 
A 4 SER A 91 ? ASP A 94 ? SER A 178 ASP A 181 
A 5 ALA A 78 ? ALA A 80 ? ALA A 165 ALA A 167 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 44 ? O ARG A 131 N ILE A 10 ? N ILE A 97  
A 2 3 O ARG A 13 ? O ARG A 100 N ILE A 55 ? N ILE A 142 
A 3 4 O ASN A 58 ? O ASN A 145 N SER A 91 ? N SER A 178 
A 4 5 O HIS A 92 ? O HIS A 179 N HIS A 79 ? N HIS A 166 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE ZN A 501' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 502' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 503' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 504' 
AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA A 505' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 HIS A 115 ? HIS A 201 . ? 1_555 ? 
2  AC1 3 HIS A 119 ? HIS A 205 . ? 1_555 ? 
3  AC1 3 HIS A 125 ? HIS A 211 . ? 1_555 ? 
4  AC2 4 HIS A 64  ? HIS A 151 . ? 1_555 ? 
5  AC2 4 ASP A 66  ? ASP A 153 . ? 1_555 ? 
6  AC2 4 HIS A 79  ? HIS A 166 . ? 1_555 ? 
7  AC2 4 HIS A 92  ? HIS A 179 . ? 1_555 ? 
8  AC3 6 ASP A 71  ? ASP A 158 . ? 1_555 ? 
9  AC3 6 GLY A 72  ? GLY A 159 . ? 1_555 ? 
10 AC3 6 ASP A 74  ? ASP A 161 . ? 1_555 ? 
11 AC3 6 LEU A 76  ? LEU A 163 . ? 1_555 ? 
12 AC3 6 ASP A 94  ? ASP A 181 . ? 1_555 ? 
13 AC3 6 GLU A 97  ? GLU A 184 . ? 1_555 ? 
14 AC4 6 ASP A 54  ? ASP A 141 . ? 1_555 ? 
15 AC4 6 GLY A 86  ? GLY A 173 . ? 1_555 ? 
16 AC4 6 GLY A 88  ? GLY A 175 . ? 1_555 ? 
17 AC4 6 ASP A 90  ? ASP A 177 . ? 1_555 ? 
18 AC4 6 HOH G .   ? HOH A 303 . ? 1_555 ? 
19 AC4 6 HOH G .   ? HOH A 304 . ? 1_555 ? 
20 AC5 5 ASP A 20  ? ASP A 107 . ? 1_555 ? 
21 AC5 5 ASP A 95  ? ASP A 182 . ? 1_555 ? 
22 AC5 5 GLU A 97  ? GLU A 184 . ? 1_555 ? 
23 AC5 5 HOH G .   ? HOH A 301 . ? 1_555 ? 
24 AC5 5 HOH G .   ? HOH A 302 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QIB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QIB 
_atom_sites.fract_transf_matrix[1][1]   0.011788 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011788 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017271 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ARG A 1 1   ? 63.055 9.295  9.736  1.00 25.54 ? 88  ARG A N   1 
ATOM   2    C  CA  . ARG A 1 1   ? 61.952 10.108 10.353 1.00 26.02 ? 88  ARG A CA  1 
ATOM   3    C  C   . ARG A 1 1   ? 62.317 11.576 10.699 1.00 25.93 ? 88  ARG A C   1 
ATOM   4    O  O   . ARG A 1 1   ? 61.436 12.427 10.773 1.00 28.18 ? 88  ARG A O   1 
ATOM   5    C  CB  . ARG A 1 1   ? 61.411 9.393  11.608 1.00 25.64 ? 88  ARG A CB  1 
ATOM   6    C  CG  . ARG A 1 1   ? 59.900 9.558  11.823 1.00 27.37 ? 88  ARG A CG  1 
ATOM   7    C  CD  . ARG A 1 1   ? 59.404 8.954  13.139 1.00 27.40 ? 88  ARG A CD  1 
ATOM   8    N  NE  . ARG A 1 1   ? 59.858 7.571  13.336 1.00 28.77 ? 88  ARG A NE  1 
ATOM   9    C  CZ  . ARG A 1 1   ? 59.662 6.884  14.461 1.00 30.51 ? 88  ARG A CZ  1 
ATOM   10   N  NH1 . ARG A 1 1   ? 59.005 7.450  15.469 1.00 32.15 ? 88  ARG A NH1 1 
ATOM   11   N  NH2 . ARG A 1 1   ? 60.234 5.696  14.645 1.00 31.50 ? 88  ARG A NH2 1 
ATOM   12   N  N   . LYS A 1 2   ? 63.604 11.879 10.868 1.00 26.06 ? 89  LYS A N   1 
ATOM   13   C  CA  . LYS A 1 2   ? 64.055 13.235 11.233 1.00 26.63 ? 89  LYS A CA  1 
ATOM   14   C  C   . LYS A 1 2   ? 65.056 13.844 10.234 1.00 25.21 ? 89  LYS A C   1 
ATOM   15   O  O   . LYS A 1 2   ? 65.736 13.112 9.496  1.00 26.80 ? 89  LYS A O   1 
ATOM   16   C  CB  . LYS A 1 2   ? 64.788 13.189 12.591 1.00 29.98 ? 89  LYS A CB  1 
ATOM   17   C  CG  . LYS A 1 2   ? 64.062 12.527 13.752 1.00 32.17 ? 89  LYS A CG  1 
ATOM   18   C  CD  . LYS A 1 2   ? 62.929 13.404 14.255 1.00 35.93 ? 89  LYS A CD  1 
ATOM   19   C  CE  . LYS A 1 2   ? 62.305 12.858 15.553 1.00 37.88 ? 89  LYS A CE  1 
ATOM   20   N  NZ  . LYS A 1 2   ? 61.180 13.745 16.044 1.00 38.26 ? 89  LYS A NZ  1 
ATOM   21   N  N   . PRO A 1 3   ? 65.175 15.191 10.214 1.00 23.28 ? 90  PRO A N   1 
ATOM   22   C  CA  . PRO A 1 3   ? 66.113 15.887 9.316  1.00 21.20 ? 90  PRO A CA  1 
ATOM   23   C  C   . PRO A 1 3   ? 67.449 16.190 10.015 1.00 19.34 ? 90  PRO A C   1 
ATOM   24   O  O   . PRO A 1 3   ? 67.472 16.627 11.167 1.00 20.12 ? 90  PRO A O   1 
ATOM   25   C  CB  . PRO A 1 3   ? 65.366 17.179 8.984  1.00 19.10 ? 90  PRO A CB  1 
ATOM   26   C  CG  . PRO A 1 3   ? 64.661 17.483 10.252 1.00 19.82 ? 90  PRO A CG  1 
ATOM   27   C  CD  . PRO A 1 3   ? 64.150 16.127 10.724 1.00 21.96 ? 90  PRO A CD  1 
ATOM   28   N  N   . LYS A 1 4   ? 68.559 15.941 9.324  1.00 17.95 ? 91  LYS A N   1 
ATOM   29   C  CA  . LYS A 1 4   ? 69.892 16.215 9.861  1.00 15.11 ? 91  LYS A CA  1 
ATOM   30   C  C   . LYS A 1 4   ? 70.760 16.788 8.739  1.00 15.49 ? 91  LYS A C   1 
ATOM   31   O  O   . LYS A 1 4   ? 70.330 16.852 7.587  1.00 16.35 ? 91  LYS A O   1 
ATOM   32   C  CB  . LYS A 1 4   ? 70.536 14.943 10.410 1.00 13.99 ? 91  LYS A CB  1 
ATOM   33   C  CG  . LYS A 1 4   ? 71.045 13.977 9.348  1.00 14.03 ? 91  LYS A CG  1 
ATOM   34   C  CD  . LYS A 1 4   ? 71.794 12.830 9.999  1.00 14.98 ? 91  LYS A CD  1 
ATOM   35   C  CE  . LYS A 1 4   ? 72.303 11.816 8.990  1.00 16.07 ? 91  LYS A CE  1 
ATOM   36   N  NZ  . LYS A 1 4   ? 73.002 10.661 9.664  1.00 19.28 ? 91  LYS A NZ  1 
ATOM   37   N  N   . TRP A 1 5   ? 71.977 17.212 9.066  1.00 14.38 ? 92  TRP A N   1 
ATOM   38   C  CA  . TRP A 1 5   ? 72.859 17.766 8.049  1.00 13.51 ? 92  TRP A CA  1 
ATOM   39   C  C   . TRP A 1 5   ? 73.489 16.672 7.176  1.00 13.41 ? 92  TRP A C   1 
ATOM   40   O  O   . TRP A 1 5   ? 73.751 15.566 7.642  1.00 14.09 ? 92  TRP A O   1 
ATOM   41   C  CB  . TRP A 1 5   ? 73.946 18.651 8.685  1.00 13.20 ? 92  TRP A CB  1 
ATOM   42   C  CG  . TRP A 1 5   ? 73.426 19.885 9.400  1.00 11.51 ? 92  TRP A CG  1 
ATOM   43   C  CD1 . TRP A 1 5   ? 73.354 20.077 10.752 1.00 10.73 ? 92  TRP A CD1 1 
ATOM   44   C  CD2 . TRP A 1 5   ? 72.878 21.071 8.800  1.00 11.54 ? 92  TRP A CD2 1 
ATOM   45   N  NE1 . TRP A 1 5   ? 72.794 21.299 11.032 1.00 9.73  ? 92  TRP A NE1 1 
ATOM   46   C  CE2 . TRP A 1 5   ? 72.489 21.932 9.855  1.00 12.35 ? 92  TRP A CE2 1 
ATOM   47   C  CE3 . TRP A 1 5   ? 72.674 21.492 7.477  1.00 9.10  ? 92  TRP A CE3 1 
ATOM   48   C  CZ2 . TRP A 1 5   ? 71.893 23.188 9.626  1.00 10.83 ? 92  TRP A CZ2 1 
ATOM   49   C  CZ3 . TRP A 1 5   ? 72.078 22.749 7.254  1.00 7.54  ? 92  TRP A CZ3 1 
ATOM   50   C  CH2 . TRP A 1 5   ? 71.699 23.575 8.324  1.00 7.05  ? 92  TRP A CH2 1 
ATOM   51   N  N   . ASP A 1 6   ? 73.708 16.987 5.903  1.00 14.68 ? 93  ASP A N   1 
ATOM   52   C  CA  . ASP A 1 6   ? 74.306 16.055 4.939  1.00 17.17 ? 93  ASP A CA  1 
ATOM   53   C  C   . ASP A 1 6   ? 75.772 15.642 5.160  1.00 16.06 ? 93  ASP A C   1 
ATOM   54   O  O   . ASP A 1 6   ? 76.134 14.504 4.874  1.00 17.45 ? 93  ASP A O   1 
ATOM   55   C  CB  . ASP A 1 6   ? 74.110 16.573 3.513  1.00 18.10 ? 93  ASP A CB  1 
ATOM   56   C  CG  . ASP A 1 6   ? 74.677 17.962 3.307  1.00 19.97 ? 93  ASP A CG  1 
ATOM   57   O  OD1 . ASP A 1 6   ? 74.953 18.681 4.294  1.00 23.00 ? 93  ASP A OD1 1 
ATOM   58   O  OD2 . ASP A 1 6   ? 74.849 18.347 2.134  1.00 23.44 ? 93  ASP A OD2 1 
ATOM   59   N  N   . LYS A 1 7   ? 76.614 16.571 5.613  1.00 15.12 ? 94  LYS A N   1 
ATOM   60   C  CA  . LYS A 1 7   ? 78.026 16.284 5.905  1.00 13.89 ? 94  LYS A CA  1 
ATOM   61   C  C   . LYS A 1 7   ? 78.334 16.852 7.295  1.00 12.61 ? 94  LYS A C   1 
ATOM   62   O  O   . LYS A 1 7   ? 77.559 17.642 7.829  1.00 10.45 ? 94  LYS A O   1 
ATOM   63   C  CB  . LYS A 1 7   ? 78.958 16.921 4.873  1.00 13.34 ? 94  LYS A CB  1 
ATOM   64   C  CG  . LYS A 1 7   ? 78.608 16.634 3.429  1.00 15.32 ? 94  LYS A CG  1 
ATOM   65   C  CD  . LYS A 1 7   ? 78.817 17.905 2.591  1.00 20.14 ? 94  LYS A CD  1 
ATOM   66   C  CE  . LYS A 1 7   ? 77.977 19.112 3.119  1.00 20.47 ? 94  LYS A CE  1 
ATOM   67   N  NZ  . LYS A 1 7   ? 78.496 20.461 2.706  1.00 18.41 ? 94  LYS A NZ  1 
ATOM   68   N  N   . ASN A 1 8   ? 79.473 16.474 7.864  1.00 13.96 ? 95  ASN A N   1 
ATOM   69   C  CA  . ASN A 1 8   ? 79.856 16.929 9.201  1.00 14.63 ? 95  ASN A CA  1 
ATOM   70   C  C   . ASN A 1 8   ? 80.589 18.264 9.275  1.00 16.71 ? 95  ASN A C   1 
ATOM   71   O  O   . ASN A 1 8   ? 81.032 18.671 10.357 1.00 16.42 ? 95  ASN A O   1 
ATOM   72   C  CB  . ASN A 1 8   ? 80.687 15.857 9.892  1.00 14.16 ? 95  ASN A CB  1 
ATOM   73   C  CG  . ASN A 1 8   ? 80.005 14.516 9.890  1.00 17.51 ? 95  ASN A CG  1 
ATOM   74   O  OD1 . ASN A 1 8   ? 78.779 14.436 9.939  1.00 19.22 ? 95  ASN A OD1 1 
ATOM   75   N  ND2 . ASN A 1 8   ? 80.787 13.450 9.794  1.00 19.46 ? 95  ASN A ND2 1 
ATOM   76   N  N   . GLN A 1 9   ? 80.726 18.937 8.135  1.00 17.54 ? 96  GLN A N   1 
ATOM   77   C  CA  . GLN A 1 9   ? 81.400 20.237 8.071  1.00 18.26 ? 96  GLN A CA  1 
ATOM   78   C  C   . GLN A 1 9   ? 80.355 21.354 8.036  1.00 16.68 ? 96  GLN A C   1 
ATOM   79   O  O   . GLN A 1 9   ? 79.711 21.582 7.003  1.00 17.17 ? 96  GLN A O   1 
ATOM   80   C  CB  . GLN A 1 9   ? 82.270 20.305 6.817  1.00 23.04 ? 96  GLN A CB  1 
ATOM   81   C  CG  . GLN A 1 9   ? 83.308 19.205 6.742  1.00 30.52 ? 96  GLN A CG  1 
ATOM   82   C  CD  . GLN A 1 9   ? 84.401 19.407 7.776  1.00 36.25 ? 96  GLN A CD  1 
ATOM   83   O  OE1 . GLN A 1 9   ? 84.499 20.491 8.380  1.00 38.05 ? 96  GLN A OE1 1 
ATOM   84   N  NE2 . GLN A 1 9   ? 85.248 18.383 7.975  1.00 36.05 ? 96  GLN A NE2 1 
ATOM   85   N  N   . ILE A 1 10  ? 80.207 22.053 9.158  1.00 13.64 ? 97  ILE A N   1 
ATOM   86   C  CA  . ILE A 1 10  ? 79.225 23.130 9.293  1.00 12.61 ? 97  ILE A CA  1 
ATOM   87   C  C   . ILE A 1 10  ? 79.911 24.474 9.577  1.00 13.03 ? 97  ILE A C   1 
ATOM   88   O  O   . ILE A 1 10  ? 80.875 24.531 10.353 1.00 12.83 ? 97  ILE A O   1 
ATOM   89   C  CB  . ILE A 1 10  ? 78.253 22.845 10.488 1.00 11.85 ? 97  ILE A CB  1 
ATOM   90   C  CG1 . ILE A 1 10  ? 77.939 21.345 10.621 1.00 9.55  ? 97  ILE A CG1 1 
ATOM   91   C  CG2 . ILE A 1 10  ? 76.988 23.659 10.353 1.00 9.91  ? 97  ILE A CG2 1 
ATOM   92   C  CD1 . ILE A 1 10  ? 77.209 20.733 9.456  1.00 8.21  ? 97  ILE A CD1 1 
ATOM   93   N  N   . THR A 1 11  ? 79.425 25.546 8.949  1.00 13.26 ? 98  THR A N   1 
ATOM   94   C  CA  . THR A 1 11  ? 79.980 26.892 9.185  1.00 13.69 ? 98  THR A CA  1 
ATOM   95   C  C   . THR A 1 11  ? 79.023 27.762 10.004 1.00 12.76 ? 98  THR A C   1 
ATOM   96   O  O   . THR A 1 11  ? 77.813 27.538 10.015 1.00 13.00 ? 98  THR A O   1 
ATOM   97   C  CB  . THR A 1 11  ? 80.306 27.669 7.868  1.00 12.02 ? 98  THR A CB  1 
ATOM   98   O  OG1 . THR A 1 11  ? 79.132 27.771 7.044  1.00 12.24 ? 98  THR A OG1 1 
ATOM   99   C  CG2 . THR A 1 11  ? 81.437 27.010 7.113  1.00 5.74  ? 98  THR A CG2 1 
ATOM   100  N  N   . TYR A 1 12  ? 79.566 28.762 10.682 1.00 13.09 ? 99  TYR A N   1 
ATOM   101  C  CA  . TYR A 1 12  ? 78.732 29.668 11.459 1.00 15.16 ? 99  TYR A CA  1 
ATOM   102  C  C   . TYR A 1 12  ? 79.317 31.077 11.477 1.00 15.36 ? 99  TYR A C   1 
ATOM   103  O  O   . TYR A 1 12  ? 80.523 31.265 11.301 1.00 13.69 ? 99  TYR A O   1 
ATOM   104  C  CB  . TYR A 1 12  ? 78.515 29.147 12.885 1.00 13.82 ? 99  TYR A CB  1 
ATOM   105  C  CG  . TYR A 1 12  ? 79.710 29.293 13.782 1.00 15.66 ? 99  TYR A CG  1 
ATOM   106  C  CD1 . TYR A 1 12  ? 79.956 30.494 14.457 1.00 18.18 ? 99  TYR A CD1 1 
ATOM   107  C  CD2 . TYR A 1 12  ? 80.617 28.243 13.945 1.00 14.84 ? 99  TYR A CD2 1 
ATOM   108  C  CE1 . TYR A 1 12  ? 81.076 30.649 15.270 1.00 18.08 ? 99  TYR A CE1 1 
ATOM   109  C  CE2 . TYR A 1 12  ? 81.742 28.386 14.759 1.00 16.53 ? 99  TYR A CE2 1 
ATOM   110  C  CZ  . TYR A 1 12  ? 81.966 29.594 15.418 1.00 18.38 ? 99  TYR A CZ  1 
ATOM   111  O  OH  . TYR A 1 12  ? 83.081 29.758 16.218 1.00 20.97 ? 99  TYR A OH  1 
ATOM   112  N  N   . ARG A 1 13  ? 78.446 32.061 11.679 1.00 16.34 ? 100 ARG A N   1 
ATOM   113  C  CA  . ARG A 1 13  ? 78.862 33.458 11.718 1.00 16.14 ? 100 ARG A CA  1 
ATOM   114  C  C   . ARG A 1 13  ? 78.025 34.248 12.709 1.00 15.15 ? 100 ARG A C   1 
ATOM   115  O  O   . ARG A 1 13  ? 76.802 34.104 12.752 1.00 15.24 ? 100 ARG A O   1 
ATOM   116  C  CB  . ARG A 1 13  ? 78.751 34.099 10.323 1.00 16.57 ? 100 ARG A CB  1 
ATOM   117  C  CG  . ARG A 1 13  ? 79.031 35.581 10.312 1.00 15.62 ? 100 ARG A CG  1 
ATOM   118  C  CD  . ARG A 1 13  ? 78.876 36.207 8.943  1.00 15.83 ? 100 ARG A CD  1 
ATOM   119  N  NE  . ARG A 1 13  ? 79.174 37.642 9.021  1.00 20.92 ? 100 ARG A NE  1 
ATOM   120  C  CZ  . ARG A 1 13  ? 79.355 38.447 7.977  1.00 18.77 ? 100 ARG A CZ  1 
ATOM   121  N  NH1 . ARG A 1 13  ? 79.269 37.969 6.743  1.00 21.52 ? 100 ARG A NH1 1 
ATOM   122  N  NH2 . ARG A 1 13  ? 79.603 39.738 8.167  1.00 16.36 ? 100 ARG A NH2 1 
ATOM   123  N  N   . ILE A 1 14  ? 78.697 35.055 13.522 1.00 13.52 ? 101 ILE A N   1 
ATOM   124  C  CA  . ILE A 1 14  ? 78.024 35.904 14.499 1.00 13.91 ? 101 ILE A CA  1 
ATOM   125  C  C   . ILE A 1 14  ? 77.774 37.230 13.789 1.00 14.67 ? 101 ILE A C   1 
ATOM   126  O  O   . ILE A 1 14  ? 78.668 38.065 13.704 1.00 15.45 ? 101 ILE A O   1 
ATOM   127  C  CB  . ILE A 1 14  ? 78.906 36.120 15.738 1.00 11.21 ? 101 ILE A CB  1 
ATOM   128  C  CG1 . ILE A 1 14  ? 79.296 34.763 16.330 1.00 11.15 ? 101 ILE A CG1 1 
ATOM   129  C  CG2 . ILE A 1 14  ? 78.159 36.914 16.779 1.00 9.93  ? 101 ILE A CG2 1 
ATOM   130  C  CD1 . ILE A 1 14  ? 80.509 34.818 17.229 1.00 10.11 ? 101 ILE A CD1 1 
ATOM   131  N  N   . ILE A 1 15  ? 76.561 37.420 13.274 1.00 15.83 ? 102 ILE A N   1 
ATOM   132  C  CA  . ILE A 1 15  ? 76.248 38.636 12.526 1.00 16.10 ? 102 ILE A CA  1 
ATOM   133  C  C   . ILE A 1 15  ? 75.701 39.805 13.341 1.00 16.89 ? 102 ILE A C   1 
ATOM   134  O  O   . ILE A 1 15  ? 75.607 40.932 12.835 1.00 16.72 ? 102 ILE A O   1 
ATOM   135  C  CB  . ILE A 1 15  ? 75.329 38.337 11.313 1.00 16.04 ? 102 ILE A CB  1 
ATOM   136  C  CG1 . ILE A 1 15  ? 75.459 39.453 10.278 1.00 14.53 ? 102 ILE A CG1 1 
ATOM   137  C  CG2 . ILE A 1 15  ? 73.893 38.168 11.759 1.00 14.31 ? 102 ILE A CG2 1 
ATOM   138  C  CD1 . ILE A 1 15  ? 75.448 38.969 8.859  1.00 17.18 ? 102 ILE A CD1 1 
ATOM   139  N  N   . GLY A 1 16  ? 75.393 39.546 14.608 1.00 17.35 ? 103 GLY A N   1 
ATOM   140  C  CA  . GLY A 1 16  ? 74.881 40.584 15.482 1.00 16.51 ? 103 GLY A CA  1 
ATOM   141  C  C   . GLY A 1 16  ? 75.395 40.338 16.885 1.00 17.17 ? 103 GLY A C   1 
ATOM   142  O  O   . GLY A 1 16  ? 75.524 39.186 17.304 1.00 14.83 ? 103 GLY A O   1 
ATOM   143  N  N   . TYR A 1 17  ? 75.686 41.411 17.614 1.00 17.72 ? 104 TYR A N   1 
ATOM   144  C  CA  . TYR A 1 17  ? 76.202 41.302 18.979 1.00 15.84 ? 104 TYR A CA  1 
ATOM   145  C  C   . TYR A 1 17  ? 75.293 41.980 19.986 1.00 16.04 ? 104 TYR A C   1 
ATOM   146  O  O   . TYR A 1 17  ? 74.374 42.711 19.618 1.00 17.73 ? 104 TYR A O   1 
ATOM   147  C  CB  . TYR A 1 17  ? 77.600 41.920 19.077 1.00 13.51 ? 104 TYR A CB  1 
ATOM   148  C  CG  . TYR A 1 17  ? 78.707 41.060 18.519 1.00 9.61  ? 104 TYR A CG  1 
ATOM   149  C  CD1 . TYR A 1 17  ? 79.041 41.109 17.173 1.00 8.88  ? 104 TYR A CD1 1 
ATOM   150  C  CD2 . TYR A 1 17  ? 79.440 40.219 19.345 1.00 11.35 ? 104 TYR A CD2 1 
ATOM   151  C  CE1 . TYR A 1 17  ? 80.073 40.347 16.664 1.00 8.59  ? 104 TYR A CE1 1 
ATOM   152  C  CE2 . TYR A 1 17  ? 80.480 39.450 18.843 1.00 11.49 ? 104 TYR A CE2 1 
ATOM   153  C  CZ  . TYR A 1 17  ? 80.790 39.522 17.502 1.00 8.98  ? 104 TYR A CZ  1 
ATOM   154  O  OH  . TYR A 1 17  ? 81.821 38.771 16.998 1.00 10.16 ? 104 TYR A OH  1 
ATOM   155  N  N   . THR A 1 18  ? 75.560 41.725 21.260 1.00 15.92 ? 105 THR A N   1 
ATOM   156  C  CA  . THR A 1 18  ? 74.795 42.310 22.348 1.00 16.42 ? 105 THR A CA  1 
ATOM   157  C  C   . THR A 1 18  ? 75.680 43.333 23.065 1.00 17.34 ? 105 THR A C   1 
ATOM   158  O  O   . THR A 1 18  ? 76.913 43.246 23.015 1.00 18.10 ? 105 THR A O   1 
ATOM   159  C  CB  . THR A 1 18  ? 74.341 41.218 23.348 1.00 16.58 ? 105 THR A CB  1 
ATOM   160  O  OG1 . THR A 1 18  ? 73.666 41.824 24.460 1.00 16.58 ? 105 THR A OG1 1 
ATOM   161  C  CG2 . THR A 1 18  ? 75.539 40.422 23.857 1.00 14.98 ? 105 THR A CG2 1 
ATOM   162  N  N   . PRO A 1 19  ? 75.063 44.359 23.678 1.00 17.47 ? 106 PRO A N   1 
ATOM   163  C  CA  . PRO A 1 19  ? 75.781 45.409 24.403 1.00 16.38 ? 106 PRO A CA  1 
ATOM   164  C  C   . PRO A 1 19  ? 76.265 44.953 25.776 1.00 16.64 ? 106 PRO A C   1 
ATOM   165  O  O   . PRO A 1 19  ? 77.158 45.573 26.350 1.00 17.41 ? 106 PRO A O   1 
ATOM   166  C  CB  . PRO A 1 19  ? 74.711 46.486 24.572 1.00 13.64 ? 106 PRO A CB  1 
ATOM   167  C  CG  . PRO A 1 19  ? 73.759 46.215 23.486 1.00 13.85 ? 106 PRO A CG  1 
ATOM   168  C  CD  . PRO A 1 19  ? 73.658 44.743 23.490 1.00 15.89 ? 106 PRO A CD  1 
ATOM   169  N  N   . ASP A 1 20  ? 75.690 43.861 26.284 1.00 16.47 ? 107 ASP A N   1 
ATOM   170  C  CA  . ASP A 1 20  ? 76.012 43.352 27.622 1.00 15.30 ? 107 ASP A CA  1 
ATOM   171  C  C   . ASP A 1 20  ? 77.365 42.740 27.898 1.00 14.50 ? 107 ASP A C   1 
ATOM   172  O  O   . ASP A 1 20  ? 77.737 42.650 29.056 1.00 17.33 ? 107 ASP A O   1 
ATOM   173  C  CB  . ASP A 1 20  ? 74.972 42.333 28.088 1.00 15.31 ? 107 ASP A CB  1 
ATOM   174  C  CG  . ASP A 1 20  ? 73.569 42.745 27.773 1.00 15.71 ? 107 ASP A CG  1 
ATOM   175  O  OD1 . ASP A 1 20  ? 73.254 43.958 27.817 1.00 18.62 ? 107 ASP A OD1 1 
ATOM   176  O  OD2 . ASP A 1 20  ? 72.787 41.832 27.480 1.00 13.48 ? 107 ASP A OD2 1 
ATOM   177  N  N   . LEU A 1 21  ? 78.075 42.264 26.876 1.00 15.13 ? 108 LEU A N   1 
ATOM   178  C  CA  . LEU A 1 21  ? 79.380 41.608 27.080 1.00 14.47 ? 108 LEU A CA  1 
ATOM   179  C  C   . LEU A 1 21  ? 80.421 42.053 26.048 1.00 15.71 ? 108 LEU A C   1 
ATOM   180  O  O   . LEU A 1 21  ? 80.058 42.522 24.966 1.00 19.43 ? 108 LEU A O   1 
ATOM   181  C  CB  . LEU A 1 21  ? 79.217 40.082 26.980 1.00 10.91 ? 108 LEU A CB  1 
ATOM   182  C  CG  . LEU A 1 21  ? 78.698 39.216 28.131 1.00 8.38  ? 108 LEU A CG  1 
ATOM   183  C  CD1 . LEU A 1 21  ? 78.384 37.831 27.645 1.00 7.33  ? 108 LEU A CD1 1 
ATOM   184  C  CD2 . LEU A 1 21  ? 79.725 39.127 29.218 1.00 8.30  ? 108 LEU A CD2 1 
ATOM   185  N  N   . ASP A 1 22  ? 81.706 41.931 26.386 1.00 15.23 ? 109 ASP A N   1 
ATOM   186  C  CA  . ASP A 1 22  ? 82.772 42.282 25.452 1.00 15.05 ? 109 ASP A CA  1 
ATOM   187  C  C   . ASP A 1 22  ? 82.694 41.312 24.254 1.00 13.71 ? 109 ASP A C   1 
ATOM   188  O  O   . ASP A 1 22  ? 82.410 40.126 24.423 1.00 11.26 ? 109 ASP A O   1 
ATOM   189  C  CB  . ASP A 1 22  ? 84.137 42.218 26.149 1.00 17.65 ? 109 ASP A CB  1 
ATOM   190  C  CG  . ASP A 1 22  ? 85.280 41.885 25.185 1.00 25.68 ? 109 ASP A CG  1 
ATOM   191  O  OD1 . ASP A 1 22  ? 85.479 40.675 24.947 1.00 31.27 ? 109 ASP A OD1 1 
ATOM   192  O  OD2 . ASP A 1 22  ? 85.971 42.796 24.652 1.00 25.93 ? 109 ASP A OD2 1 
ATOM   193  N  N   . PRO A 1 23  ? 82.936 41.812 23.031 1.00 13.50 ? 110 PRO A N   1 
ATOM   194  C  CA  . PRO A 1 23  ? 82.883 40.988 21.815 1.00 14.20 ? 110 PRO A CA  1 
ATOM   195  C  C   . PRO A 1 23  ? 83.759 39.739 21.846 1.00 14.76 ? 110 PRO A C   1 
ATOM   196  O  O   . PRO A 1 23  ? 83.381 38.703 21.309 1.00 15.76 ? 110 PRO A O   1 
ATOM   197  C  CB  . PRO A 1 23  ? 83.336 41.956 20.727 1.00 13.16 ? 110 PRO A CB  1 
ATOM   198  C  CG  . PRO A 1 23  ? 82.919 43.288 21.266 1.00 13.09 ? 110 PRO A CG  1 
ATOM   199  C  CD  . PRO A 1 23  ? 83.298 43.202 22.702 1.00 12.05 ? 110 PRO A CD  1 
ATOM   200  N  N   . GLU A 1 24  ? 84.935 39.838 22.454 1.00 15.89 ? 111 GLU A N   1 
ATOM   201  C  CA  . GLU A 1 24  ? 85.835 38.696 22.533 1.00 18.23 ? 111 GLU A CA  1 
ATOM   202  C  C   . GLU A 1 24  ? 85.302 37.595 23.458 1.00 17.49 ? 111 GLU A C   1 
ATOM   203  O  O   . GLU A 1 24  ? 85.513 36.409 23.198 1.00 16.39 ? 111 GLU A O   1 
ATOM   204  C  CB  . GLU A 1 24  ? 87.235 39.136 22.961 1.00 21.89 ? 111 GLU A CB  1 
ATOM   205  C  CG  . GLU A 1 24  ? 88.202 37.973 23.134 1.00 30.84 ? 111 GLU A CG  1 
ATOM   206  C  CD  . GLU A 1 24  ? 89.642 38.408 23.367 1.00 35.65 ? 111 GLU A CD  1 
ATOM   207  O  OE1 . GLU A 1 24  ? 89.856 39.471 24.006 1.00 38.52 ? 111 GLU A OE1 1 
ATOM   208  O  OE2 . GLU A 1 24  ? 90.562 37.680 22.907 1.00 39.34 ? 111 GLU A OE2 1 
ATOM   209  N  N   . THR A 1 25  ? 84.615 37.994 24.530 1.00 17.73 ? 112 THR A N   1 
ATOM   210  C  CA  . THR A 1 25  ? 84.017 37.052 25.480 1.00 17.58 ? 112 THR A CA  1 
ATOM   211  C  C   . THR A 1 25  ? 82.817 36.341 24.835 1.00 17.92 ? 112 THR A C   1 
ATOM   212  O  O   . THR A 1 25  ? 82.587 35.146 25.067 1.00 18.27 ? 112 THR A O   1 
ATOM   213  C  CB  . THR A 1 25  ? 83.554 37.763 26.776 1.00 17.39 ? 112 THR A CB  1 
ATOM   214  O  OG1 . THR A 1 25  ? 84.695 38.281 27.470 1.00 19.01 ? 112 THR A OG1 1 
ATOM   215  C  CG2 . THR A 1 25  ? 82.827 36.794 27.695 1.00 14.19 ? 112 THR A CG2 1 
ATOM   216  N  N   . VAL A 1 26  ? 82.065 37.082 24.019 1.00 15.39 ? 113 VAL A N   1 
ATOM   217  C  CA  . VAL A 1 26  ? 80.914 36.535 23.320 1.00 13.40 ? 113 VAL A CA  1 
ATOM   218  C  C   . VAL A 1 26  ? 81.380 35.447 22.350 1.00 13.14 ? 113 VAL A C   1 
ATOM   219  O  O   . VAL A 1 26  ? 80.816 34.353 22.305 1.00 12.14 ? 113 VAL A O   1 
ATOM   220  C  CB  . VAL A 1 26  ? 80.162 37.638 22.536 1.00 11.98 ? 113 VAL A CB  1 
ATOM   221  C  CG1 . VAL A 1 26  ? 79.032 37.041 21.729 1.00 8.08  ? 113 VAL A CG1 1 
ATOM   222  C  CG2 . VAL A 1 26  ? 79.607 38.671 23.495 1.00 12.24 ? 113 VAL A CG2 1 
ATOM   223  N  N   . ASP A 1 27  ? 82.431 35.749 21.604 1.00 12.09 ? 114 ASP A N   1 
ATOM   224  C  CA  . ASP A 1 27  ? 82.978 34.818 20.632 1.00 12.10 ? 114 ASP A CA  1 
ATOM   225  C  C   . ASP A 1 27  ? 83.446 33.537 21.310 1.00 12.71 ? 114 ASP A C   1 
ATOM   226  O  O   . ASP A 1 27  ? 83.314 32.439 20.767 1.00 12.63 ? 114 ASP A O   1 
ATOM   227  C  CB  . ASP A 1 27  ? 84.127 35.486 19.871 1.00 13.55 ? 114 ASP A CB  1 
ATOM   228  C  CG  . ASP A 1 27  ? 83.662 36.672 19.011 1.00 15.95 ? 114 ASP A CG  1 
ATOM   229  O  OD1 . ASP A 1 27  ? 82.447 36.813 18.769 1.00 18.43 ? 114 ASP A OD1 1 
ATOM   230  O  OD2 . ASP A 1 27  ? 84.509 37.464 18.564 1.00 12.31 ? 114 ASP A OD2 1 
ATOM   231  N  N   . ASP A 1 28  ? 83.920 33.680 22.536 1.00 12.13 ? 115 ASP A N   1 
ATOM   232  C  CA  . ASP A 1 28  ? 84.405 32.549 23.306 1.00 11.17 ? 115 ASP A CA  1 
ATOM   233  C  C   . ASP A 1 28  ? 83.287 31.679 23.869 1.00 11.09 ? 115 ASP A C   1 
ATOM   234  O  O   . ASP A 1 28  ? 83.395 30.462 23.906 1.00 10.13 ? 115 ASP A O   1 
ATOM   235  C  CB  . ASP A 1 28  ? 85.275 33.044 24.450 1.00 12.38 ? 115 ASP A CB  1 
ATOM   236  C  CG  . ASP A 1 28  ? 86.069 31.936 25.079 1.00 13.26 ? 115 ASP A CG  1 
ATOM   237  O  OD1 . ASP A 1 28  ? 86.889 31.335 24.346 1.00 14.19 ? 115 ASP A OD1 1 
ATOM   238  O  OD2 . ASP A 1 28  ? 85.864 31.662 26.285 1.00 12.16 ? 115 ASP A OD2 1 
ATOM   239  N  N   . ALA A 1 29  ? 82.231 32.318 24.354 1.00 10.87 ? 116 ALA A N   1 
ATOM   240  C  CA  . ALA A 1 29  ? 81.103 31.605 24.922 1.00 9.37  ? 116 ALA A CA  1 
ATOM   241  C  C   . ALA A 1 29  ? 80.366 30.816 23.847 1.00 9.47  ? 116 ALA A C   1 
ATOM   242  O  O   . ALA A 1 29  ? 79.716 29.820 24.135 1.00 9.78  ? 116 ALA A O   1 
ATOM   243  C  CB  . ALA A 1 29  ? 80.166 32.592 25.590 1.00 9.07  ? 116 ALA A CB  1 
ATOM   244  N  N   . PHE A 1 30  ? 80.459 31.283 22.607 1.00 10.51 ? 117 PHE A N   1 
ATOM   245  C  CA  . PHE A 1 30  ? 79.797 30.634 21.484 1.00 12.56 ? 117 PHE A CA  1 
ATOM   246  C  C   . PHE A 1 30  ? 80.610 29.455 20.958 1.00 14.10 ? 117 PHE A C   1 
ATOM   247  O  O   . PHE A 1 30  ? 80.049 28.440 20.531 1.00 13.39 ? 117 PHE A O   1 
ATOM   248  C  CB  . PHE A 1 30  ? 79.553 31.635 20.352 1.00 11.37 ? 117 PHE A CB  1 
ATOM   249  C  CG  . PHE A 1 30  ? 78.339 32.498 20.541 1.00 8.65  ? 117 PHE A CG  1 
ATOM   250  C  CD1 . PHE A 1 30  ? 77.133 31.950 20.968 1.00 10.09 ? 117 PHE A CD1 1 
ATOM   251  C  CD2 . PHE A 1 30  ? 78.388 33.856 20.244 1.00 10.52 ? 117 PHE A CD2 1 
ATOM   252  C  CE1 . PHE A 1 30  ? 75.987 32.745 21.094 1.00 8.72  ? 117 PHE A CE1 1 
ATOM   253  C  CE2 . PHE A 1 30  ? 77.248 34.659 20.366 1.00 11.73 ? 117 PHE A CE2 1 
ATOM   254  C  CZ  . PHE A 1 30  ? 76.048 34.100 20.790 1.00 10.35 ? 117 PHE A CZ  1 
ATOM   255  N  N   . ALA A 1 31  ? 81.930 29.608 20.948 1.00 13.53 ? 118 ALA A N   1 
ATOM   256  C  CA  . ALA A 1 31  ? 82.796 28.542 20.477 1.00 12.12 ? 118 ALA A CA  1 
ATOM   257  C  C   . ALA A 1 31  ? 82.771 27.409 21.487 1.00 12.98 ? 118 ALA A C   1 
ATOM   258  O  O   . ALA A 1 31  ? 82.707 26.236 21.114 1.00 14.66 ? 118 ALA A O   1 
ATOM   259  C  CB  . ALA A 1 31  ? 84.206 29.045 20.280 1.00 7.78  ? 118 ALA A CB  1 
ATOM   260  N  N   . ARG A 1 32  ? 82.793 27.758 22.770 1.00 11.80 ? 119 ARG A N   1 
ATOM   261  C  CA  . ARG A 1 32  ? 82.764 26.750 23.823 1.00 11.80 ? 119 ARG A CA  1 
ATOM   262  C  C   . ARG A 1 32  ? 81.460 25.949 23.776 1.00 11.92 ? 119 ARG A C   1 
ATOM   263  O  O   . ARG A 1 32  ? 81.453 24.757 24.058 1.00 12.82 ? 119 ARG A O   1 
ATOM   264  C  CB  . ARG A 1 32  ? 82.981 27.407 25.191 1.00 10.34 ? 119 ARG A CB  1 
ATOM   265  C  CG  . ARG A 1 32  ? 84.450 27.603 25.552 1.00 6.88  ? 119 ARG A CG  1 
ATOM   266  C  CD  . ARG A 1 32  ? 84.628 28.670 26.610 1.00 6.98  ? 119 ARG A CD  1 
ATOM   267  N  NE  . ARG A 1 32  ? 83.692 28.515 27.722 1.00 12.10 ? 119 ARG A NE  1 
ATOM   268  C  CZ  . ARG A 1 32  ? 82.916 29.490 28.196 1.00 12.06 ? 119 ARG A CZ  1 
ATOM   269  N  NH1 . ARG A 1 32  ? 82.953 30.704 27.660 1.00 9.34  ? 119 ARG A NH1 1 
ATOM   270  N  NH2 . ARG A 1 32  ? 82.094 29.247 29.207 1.00 13.62 ? 119 ARG A NH2 1 
ATOM   271  N  N   . ALA A 1 33  ? 80.378 26.609 23.360 1.00 13.27 ? 120 ALA A N   1 
ATOM   272  C  CA  . ALA A 1 33  ? 79.058 25.994 23.230 1.00 12.11 ? 120 ALA A CA  1 
ATOM   273  C  C   . ALA A 1 33  ? 79.023 24.953 22.103 1.00 13.38 ? 120 ALA A C   1 
ATOM   274  O  O   . ALA A 1 33  ? 78.341 23.939 22.219 1.00 14.97 ? 120 ALA A O   1 
ATOM   275  C  CB  . ALA A 1 33  ? 78.011 27.063 22.999 1.00 9.31  ? 120 ALA A CB  1 
ATOM   276  N  N   . PHE A 1 34  ? 79.757 25.208 21.015 1.00 13.05 ? 121 PHE A N   1 
ATOM   277  C  CA  . PHE A 1 34  ? 79.839 24.286 19.875 1.00 12.15 ? 121 PHE A CA  1 
ATOM   278  C  C   . PHE A 1 34  ? 80.653 23.038 20.196 1.00 12.52 ? 121 PHE A C   1 
ATOM   279  O  O   . PHE A 1 34  ? 80.347 21.942 19.720 1.00 12.25 ? 121 PHE A O   1 
ATOM   280  C  CB  . PHE A 1 34  ? 80.499 24.963 18.669 1.00 10.48 ? 121 PHE A CB  1 
ATOM   281  C  CG  . PHE A 1 34  ? 79.547 25.713 17.800 1.00 12.75 ? 121 PHE A CG  1 
ATOM   282  C  CD1 . PHE A 1 34  ? 78.459 25.072 17.237 1.00 14.04 ? 121 PHE A CD1 1 
ATOM   283  C  CD2 . PHE A 1 34  ? 79.714 27.080 17.575 1.00 14.52 ? 121 PHE A CD2 1 
ATOM   284  C  CE1 . PHE A 1 34  ? 77.539 25.780 16.465 1.00 14.46 ? 121 PHE A CE1 1 
ATOM   285  C  CE2 . PHE A 1 34  ? 78.800 27.801 16.805 1.00 13.23 ? 121 PHE A CE2 1 
ATOM   286  C  CZ  . PHE A 1 34  ? 77.711 27.151 16.249 1.00 13.56 ? 121 PHE A CZ  1 
ATOM   287  N  N   . GLN A 1 35  ? 81.716 23.232 20.972 1.00 11.93 ? 122 GLN A N   1 
ATOM   288  C  CA  . GLN A 1 35  ? 82.629 22.166 21.356 1.00 10.50 ? 122 GLN A CA  1 
ATOM   289  C  C   . GLN A 1 35  ? 82.004 21.065 22.189 1.00 12.12 ? 122 GLN A C   1 
ATOM   290  O  O   . GLN A 1 35  ? 82.402 19.900 22.093 1.00 10.69 ? 122 GLN A O   1 
ATOM   291  C  CB  . GLN A 1 35  ? 83.806 22.756 22.105 1.00 9.49  ? 122 GLN A CB  1 
ATOM   292  C  CG  . GLN A 1 35  ? 84.883 21.758 22.371 1.00 14.02 ? 122 GLN A CG  1 
ATOM   293  C  CD  . GLN A 1 35  ? 85.978 22.304 23.252 1.00 15.98 ? 122 GLN A CD  1 
ATOM   294  O  OE1 . GLN A 1 35  ? 86.052 23.512 23.504 1.00 17.74 ? 122 GLN A OE1 1 
ATOM   295  N  NE2 . GLN A 1 35  ? 86.846 21.414 23.728 1.00 14.64 ? 122 GLN A NE2 1 
ATOM   296  N  N   . VAL A 1 36  ? 81.030 21.435 23.015 1.00 13.67 ? 123 VAL A N   1 
ATOM   297  C  CA  . VAL A 1 36  ? 80.349 20.458 23.851 1.00 16.10 ? 123 VAL A CA  1 
ATOM   298  C  C   . VAL A 1 36  ? 79.737 19.345 22.993 1.00 14.62 ? 123 VAL A C   1 
ATOM   299  O  O   . VAL A 1 36  ? 79.601 18.216 23.453 1.00 17.12 ? 123 VAL A O   1 
ATOM   300  C  CB  . VAL A 1 36  ? 79.251 21.109 24.749 1.00 17.41 ? 123 VAL A CB  1 
ATOM   301  C  CG1 . VAL A 1 36  ? 79.829 22.260 25.542 1.00 17.18 ? 123 VAL A CG1 1 
ATOM   302  C  CG2 . VAL A 1 36  ? 78.065 21.562 23.926 1.00 18.77 ? 123 VAL A CG2 1 
ATOM   303  N  N   . TRP A 1 37  ? 79.406 19.669 21.742 1.00 11.92 ? 124 TRP A N   1 
ATOM   304  C  CA  . TRP A 1 37  ? 78.827 18.709 20.799 1.00 13.28 ? 124 TRP A CA  1 
ATOM   305  C  C   . TRP A 1 37  ? 79.883 18.035 19.914 1.00 14.42 ? 124 TRP A C   1 
ATOM   306  O  O   . TRP A 1 37  ? 79.739 16.873 19.548 1.00 14.18 ? 124 TRP A O   1 
ATOM   307  C  CB  . TRP A 1 37  ? 77.795 19.387 19.886 1.00 13.13 ? 124 TRP A CB  1 
ATOM   308  C  CG  . TRP A 1 37  ? 76.623 19.977 20.592 1.00 11.00 ? 124 TRP A CG  1 
ATOM   309  C  CD1 . TRP A 1 37  ? 76.259 21.294 20.619 1.00 10.70 ? 124 TRP A CD1 1 
ATOM   310  C  CD2 . TRP A 1 37  ? 75.661 19.276 21.384 1.00 11.95 ? 124 TRP A CD2 1 
ATOM   311  N  NE1 . TRP A 1 37  ? 75.133 21.457 21.385 1.00 12.38 ? 124 TRP A NE1 1 
ATOM   312  C  CE2 . TRP A 1 37  ? 74.744 20.233 21.868 1.00 12.56 ? 124 TRP A CE2 1 
ATOM   313  C  CE3 . TRP A 1 37  ? 75.491 17.931 21.742 1.00 13.78 ? 124 TRP A CE3 1 
ATOM   314  C  CZ2 . TRP A 1 37  ? 73.664 19.885 22.690 1.00 12.13 ? 124 TRP A CZ2 1 
ATOM   315  C  CZ3 . TRP A 1 37  ? 74.418 17.585 22.561 1.00 12.73 ? 124 TRP A CZ3 1 
ATOM   316  C  CH2 . TRP A 1 37  ? 73.520 18.562 23.026 1.00 12.65 ? 124 TRP A CH2 1 
ATOM   317  N  N   . SER A 1 38  ? 80.921 18.780 19.548 1.00 15.24 ? 125 SER A N   1 
ATOM   318  C  CA  . SER A 1 38  ? 81.985 18.252 18.704 1.00 15.70 ? 125 SER A CA  1 
ATOM   319  C  C   . SER A 1 38  ? 82.916 17.283 19.435 1.00 16.93 ? 125 SER A C   1 
ATOM   320  O  O   . SER A 1 38  ? 83.662 16.537 18.795 1.00 19.23 ? 125 SER A O   1 
ATOM   321  C  CB  . SER A 1 38  ? 82.783 19.393 18.064 1.00 14.77 ? 125 SER A CB  1 
ATOM   322  O  OG  . SER A 1 38  ? 83.372 20.229 19.046 1.00 15.21 ? 125 SER A OG  1 
ATOM   323  N  N   . ASP A 1 39  ? 82.885 17.308 20.765 1.00 17.34 ? 126 ASP A N   1 
ATOM   324  C  CA  . ASP A 1 39  ? 83.714 16.414 21.567 1.00 18.57 ? 126 ASP A CA  1 
ATOM   325  C  C   . ASP A 1 39  ? 83.168 14.994 21.616 1.00 19.90 ? 126 ASP A C   1 
ATOM   326  O  O   . ASP A 1 39  ? 83.911 14.049 21.904 1.00 21.49 ? 126 ASP A O   1 
ATOM   327  C  CB  . ASP A 1 39  ? 83.847 16.925 22.997 1.00 18.00 ? 126 ASP A CB  1 
ATOM   328  C  CG  . ASP A 1 39  ? 84.832 18.071 23.128 1.00 19.91 ? 126 ASP A CG  1 
ATOM   329  O  OD1 . ASP A 1 39  ? 85.679 18.279 22.219 1.00 17.79 ? 126 ASP A OD1 1 
ATOM   330  O  OD2 . ASP A 1 39  ? 84.756 18.766 24.165 1.00 19.52 ? 126 ASP A OD2 1 
ATOM   331  N  N   . VAL A 1 40  ? 81.871 14.845 21.345 1.00 20.35 ? 127 VAL A N   1 
ATOM   332  C  CA  . VAL A 1 40  ? 81.226 13.531 21.368 1.00 20.07 ? 127 VAL A CA  1 
ATOM   333  C  C   . VAL A 1 40  ? 80.683 13.070 20.009 1.00 20.04 ? 127 VAL A C   1 
ATOM   334  O  O   . VAL A 1 40  ? 79.926 12.101 19.949 1.00 18.88 ? 127 VAL A O   1 
ATOM   335  C  CB  . VAL A 1 40  ? 80.070 13.476 22.414 1.00 18.97 ? 127 VAL A CB  1 
ATOM   336  C  CG1 . VAL A 1 40  ? 80.613 13.638 23.818 1.00 18.35 ? 127 VAL A CG1 1 
ATOM   337  C  CG2 . VAL A 1 40  ? 79.036 14.555 22.129 1.00 17.15 ? 127 VAL A CG2 1 
ATOM   338  N  N   . THR A 1 41  ? 81.054 13.769 18.934 1.00 20.37 ? 128 THR A N   1 
ATOM   339  C  CA  . THR A 1 41  ? 80.601 13.429 17.570 1.00 21.32 ? 128 THR A CA  1 
ATOM   340  C  C   . THR A 1 41  ? 81.683 13.774 16.539 1.00 20.37 ? 128 THR A C   1 
ATOM   341  O  O   . THR A 1 41  ? 82.687 14.407 16.874 1.00 20.18 ? 128 THR A O   1 
ATOM   342  C  CB  . THR A 1 41  ? 79.339 14.231 17.160 1.00 21.90 ? 128 THR A CB  1 
ATOM   343  O  OG1 . THR A 1 41  ? 79.634 15.638 17.188 1.00 22.05 ? 128 THR A OG1 1 
ATOM   344  C  CG2 . THR A 1 41  ? 78.147 13.905 18.057 1.00 21.14 ? 128 THR A CG2 1 
ATOM   345  N  N   . PRO A 1 42  ? 81.478 13.388 15.259 1.00 19.65 ? 129 PRO A N   1 
ATOM   346  C  CA  . PRO A 1 42  ? 82.496 13.716 14.252 1.00 19.33 ? 129 PRO A CA  1 
ATOM   347  C  C   . PRO A 1 42  ? 82.315 15.124 13.683 1.00 20.33 ? 129 PRO A C   1 
ATOM   348  O  O   . PRO A 1 42  ? 83.079 15.548 12.814 1.00 23.16 ? 129 PRO A O   1 
ATOM   349  C  CB  . PRO A 1 42  ? 82.266 12.659 13.161 1.00 19.89 ? 129 PRO A CB  1 
ATOM   350  C  CG  . PRO A 1 42  ? 81.222 11.701 13.729 1.00 20.22 ? 129 PRO A CG  1 
ATOM   351  C  CD  . PRO A 1 42  ? 80.434 12.533 14.682 1.00 19.21 ? 129 PRO A CD  1 
ATOM   352  N  N   . LEU A 1 43  ? 81.318 15.853 14.190 1.00 19.62 ? 130 LEU A N   1 
ATOM   353  C  CA  . LEU A 1 43  ? 81.015 17.219 13.743 1.00 19.18 ? 130 LEU A CA  1 
ATOM   354  C  C   . LEU A 1 43  ? 82.176 18.215 13.810 1.00 20.04 ? 130 LEU A C   1 
ATOM   355  O  O   . LEU A 1 43  ? 83.018 18.147 14.708 1.00 21.92 ? 130 LEU A O   1 
ATOM   356  C  CB  . LEU A 1 43  ? 79.811 17.762 14.521 1.00 16.32 ? 130 LEU A CB  1 
ATOM   357  C  CG  . LEU A 1 43  ? 78.450 17.550 13.839 1.00 17.10 ? 130 LEU A CG  1 
ATOM   358  C  CD1 . LEU A 1 43  ? 78.434 16.283 13.021 1.00 19.75 ? 130 LEU A CD1 1 
ATOM   359  C  CD2 . LEU A 1 43  ? 77.336 17.539 14.863 1.00 18.94 ? 130 LEU A CD2 1 
ATOM   360  N  N   . ARG A 1 44  ? 82.240 19.111 12.828 1.00 20.91 ? 131 ARG A N   1 
ATOM   361  C  CA  . ARG A 1 44  ? 83.284 20.133 12.783 1.00 21.75 ? 131 ARG A CA  1 
ATOM   362  C  C   . ARG A 1 44  ? 82.645 21.473 12.507 1.00 19.98 ? 131 ARG A C   1 
ATOM   363  O  O   . ARG A 1 44  ? 81.761 21.570 11.658 1.00 21.81 ? 131 ARG A O   1 
ATOM   364  C  CB  . ARG A 1 44  ? 84.329 19.814 11.707 1.00 25.45 ? 131 ARG A CB  1 
ATOM   365  C  CG  . ARG A 1 44  ? 85.179 18.572 12.015 1.00 32.26 ? 131 ARG A CG  1 
ATOM   366  C  CD  . ARG A 1 44  ? 85.858 18.678 13.387 1.00 39.19 ? 131 ARG A CD  1 
ATOM   367  N  NE  . ARG A 1 44  ? 86.606 17.471 13.733 1.00 45.36 ? 131 ARG A NE  1 
ATOM   368  C  CZ  . ARG A 1 44  ? 87.484 17.380 14.735 1.00 49.20 ? 131 ARG A CZ  1 
ATOM   369  N  NH1 . ARG A 1 44  ? 87.736 18.430 15.526 1.00 49.94 ? 131 ARG A NH1 1 
ATOM   370  N  NH2 . ARG A 1 44  ? 88.171 16.246 14.901 1.00 50.66 ? 131 ARG A NH2 1 
ATOM   371  N  N   . PHE A 1 45  ? 83.047 22.487 13.272 1.00 18.73 ? 132 PHE A N   1 
ATOM   372  C  CA  . PHE A 1 45  ? 82.506 23.846 13.131 1.00 16.01 ? 132 PHE A CA  1 
ATOM   373  C  C   . PHE A 1 45  ? 83.575 24.866 12.763 1.00 15.85 ? 132 PHE A C   1 
ATOM   374  O  O   . PHE A 1 45  ? 84.570 25.021 13.478 1.00 14.39 ? 132 PHE A O   1 
ATOM   375  C  CB  . PHE A 1 45  ? 81.808 24.282 14.425 1.00 11.86 ? 132 PHE A CB  1 
ATOM   376  C  CG  . PHE A 1 45  ? 80.675 23.392 14.825 1.00 11.99 ? 132 PHE A CG  1 
ATOM   377  C  CD1 . PHE A 1 45  ? 79.518 23.334 14.056 1.00 12.02 ? 132 PHE A CD1 1 
ATOM   378  C  CD2 . PHE A 1 45  ? 80.790 22.550 15.925 1.00 13.62 ? 132 PHE A CD2 1 
ATOM   379  C  CE1 . PHE A 1 45  ? 78.497 22.443 14.371 1.00 12.93 ? 132 PHE A CE1 1 
ATOM   380  C  CE2 . PHE A 1 45  ? 79.769 21.650 16.249 1.00 13.70 ? 132 PHE A CE2 1 
ATOM   381  C  CZ  . PHE A 1 45  ? 78.621 21.598 15.466 1.00 12.48 ? 132 PHE A CZ  1 
ATOM   382  N  N   . SER A 1 46  ? 83.357 25.564 11.652 1.00 17.83 ? 133 SER A N   1 
ATOM   383  C  CA  . SER A 1 46  ? 84.296 26.581 11.181 1.00 18.46 ? 133 SER A CA  1 
ATOM   384  C  C   . SER A 1 46  ? 83.649 27.959 11.100 1.00 17.52 ? 133 SER A C   1 
ATOM   385  O  O   . SER A 1 46  ? 82.642 28.139 10.426 1.00 17.39 ? 133 SER A O   1 
ATOM   386  C  CB  . SER A 1 46  ? 84.835 26.202 9.804  1.00 18.47 ? 133 SER A CB  1 
ATOM   387  O  OG  . SER A 1 46  ? 85.347 24.881 9.824  1.00 22.58 ? 133 SER A OG  1 
ATOM   388  N  N   . ARG A 1 47  ? 84.246 28.931 11.775 1.00 17.59 ? 134 ARG A N   1 
ATOM   389  C  CA  . ARG A 1 47  ? 83.733 30.294 11.772 1.00 18.79 ? 134 ARG A CA  1 
ATOM   390  C  C   . ARG A 1 47  ? 84.208 31.118 10.566 1.00 19.05 ? 134 ARG A C   1 
ATOM   391  O  O   . ARG A 1 47  ? 85.395 31.109 10.220 1.00 18.46 ? 134 ARG A O   1 
ATOM   392  C  CB  . ARG A 1 47  ? 84.126 30.989 13.075 1.00 18.80 ? 134 ARG A CB  1 
ATOM   393  C  CG  . ARG A 1 47  ? 83.794 32.461 13.147 1.00 19.64 ? 134 ARG A CG  1 
ATOM   394  C  CD  . ARG A 1 47  ? 84.195 33.031 14.485 1.00 21.47 ? 134 ARG A CD  1 
ATOM   395  N  NE  . ARG A 1 47  ? 84.206 34.489 14.456 1.00 27.77 ? 134 ARG A NE  1 
ATOM   396  C  CZ  . ARG A 1 47  ? 84.463 35.261 15.510 1.00 29.11 ? 134 ARG A CZ  1 
ATOM   397  N  NH1 . ARG A 1 47  ? 84.733 34.710 16.692 1.00 30.15 ? 134 ARG A NH1 1 
ATOM   398  N  NH2 . ARG A 1 47  ? 84.467 36.586 15.382 1.00 26.36 ? 134 ARG A NH2 1 
ATOM   399  N  N   . ILE A 1 48  ? 83.261 31.782 9.900  1.00 20.17 ? 135 ILE A N   1 
ATOM   400  C  CA  . ILE A 1 48  ? 83.575 32.637 8.754  1.00 19.62 ? 135 ILE A CA  1 
ATOM   401  C  C   . ILE A 1 48  ? 83.190 34.098 9.056  1.00 21.45 ? 135 ILE A C   1 
ATOM   402  O  O   . ILE A 1 48  ? 82.284 34.371 9.858  1.00 18.86 ? 135 ILE A O   1 
ATOM   403  C  CB  . ILE A 1 48  ? 82.905 32.153 7.433  1.00 18.40 ? 135 ILE A CB  1 
ATOM   404  C  CG1 . ILE A 1 48  ? 81.398 32.406 7.456  1.00 17.61 ? 135 ILE A CG1 1 
ATOM   405  C  CG2 . ILE A 1 48  ? 83.198 30.673 7.201  1.00 13.52 ? 135 ILE A CG2 1 
ATOM   406  C  CD1 . ILE A 1 48  ? 80.728 32.120 6.129  1.00 17.57 ? 135 ILE A CD1 1 
ATOM   407  N  N   . HIS A 1 49  ? 83.874 35.023 8.389  1.00 22.69 ? 136 HIS A N   1 
ATOM   408  C  CA  . HIS A 1 49  ? 83.665 36.451 8.598  1.00 24.94 ? 136 HIS A CA  1 
ATOM   409  C  C   . HIS A 1 49  ? 83.072 37.228 7.420  1.00 26.04 ? 136 HIS A C   1 
ATOM   410  O  O   . HIS A 1 49  ? 82.930 38.455 7.491  1.00 26.68 ? 136 HIS A O   1 
ATOM   411  C  CB  . HIS A 1 49  ? 84.990 37.088 9.013  1.00 28.17 ? 136 HIS A CB  1 
ATOM   412  C  CG  . HIS A 1 49  ? 85.607 36.459 10.218 1.00 33.49 ? 136 HIS A CG  1 
ATOM   413  N  ND1 . HIS A 1 49  ? 85.355 36.906 11.505 1.00 37.14 ? 136 HIS A ND1 1 
ATOM   414  C  CD2 . HIS A 1 49  ? 86.446 35.401 10.355 1.00 33.91 ? 136 HIS A CD2 1 
ATOM   415  C  CE1 . HIS A 1 49  ? 86.005 36.154 12.371 1.00 37.35 ? 136 HIS A CE1 1 
ATOM   416  N  NE2 . HIS A 1 49  ? 86.679 35.227 11.699 1.00 36.73 ? 136 HIS A NE2 1 
ATOM   417  N  N   . ASP A 1 50  ? 82.744 36.538 6.332  1.00 25.13 ? 137 ASP A N   1 
ATOM   418  C  CA  . ASP A 1 50  ? 82.172 37.212 5.173  1.00 25.08 ? 137 ASP A CA  1 
ATOM   419  C  C   . ASP A 1 50  ? 81.209 36.273 4.463  1.00 24.16 ? 137 ASP A C   1 
ATOM   420  O  O   . ASP A 1 50  ? 81.481 35.084 4.334  1.00 26.63 ? 137 ASP A O   1 
ATOM   421  C  CB  . ASP A 1 50  ? 83.282 37.681 4.224  1.00 27.06 ? 137 ASP A CB  1 
ATOM   422  C  CG  . ASP A 1 50  ? 82.769 38.611 3.114  1.00 30.92 ? 137 ASP A CG  1 
ATOM   423  O  OD1 . ASP A 1 50  ? 81.687 39.241 3.272  1.00 30.89 ? 137 ASP A OD1 1 
ATOM   424  O  OD2 . ASP A 1 50  ? 83.468 38.715 2.079  1.00 31.12 ? 137 ASP A OD2 1 
ATOM   425  N  N   . GLY A 1 51  ? 80.066 36.804 4.036  1.00 22.51 ? 138 GLY A N   1 
ATOM   426  C  CA  . GLY A 1 51  ? 79.077 35.986 3.360  1.00 18.41 ? 138 GLY A CA  1 
ATOM   427  C  C   . GLY A 1 51  ? 78.138 35.330 4.349  1.00 17.78 ? 138 GLY A C   1 
ATOM   428  O  O   . GLY A 1 51  ? 78.227 35.570 5.555  1.00 16.53 ? 138 GLY A O   1 
ATOM   429  N  N   . GLU A 1 52  ? 77.219 34.518 3.828  1.00 18.29 ? 139 GLU A N   1 
ATOM   430  C  CA  . GLU A 1 52  ? 76.236 33.810 4.646  1.00 17.56 ? 139 GLU A CA  1 
ATOM   431  C  C   . GLU A 1 52  ? 76.780 32.463 5.124  1.00 15.90 ? 139 GLU A C   1 
ATOM   432  O  O   . GLU A 1 52  ? 77.537 31.809 4.413  1.00 16.25 ? 139 GLU A O   1 
ATOM   433  C  CB  . GLU A 1 52  ? 74.927 33.617 3.870  1.00 17.40 ? 139 GLU A CB  1 
ATOM   434  C  CG  . GLU A 1 52  ? 73.739 33.337 4.775  1.00 21.59 ? 139 GLU A CG  1 
ATOM   435  C  CD  . GLU A 1 52  ? 72.450 33.109 4.010  1.00 25.77 ? 139 GLU A CD  1 
ATOM   436  O  OE1 . GLU A 1 52  ? 72.201 33.851 3.033  1.00 29.23 ? 139 GLU A OE1 1 
ATOM   437  O  OE2 . GLU A 1 52  ? 71.676 32.194 4.391  1.00 25.27 ? 139 GLU A OE2 1 
ATOM   438  N  N   . ALA A 1 53  ? 76.418 32.077 6.344  1.00 13.84 ? 140 ALA A N   1 
ATOM   439  C  CA  . ALA A 1 53  ? 76.875 30.820 6.923  1.00 12.33 ? 140 ALA A CA  1 
ATOM   440  C  C   . ALA A 1 53  ? 75.718 29.874 7.177  1.00 11.65 ? 140 ALA A C   1 
ATOM   441  O  O   . ALA A 1 53  ? 74.558 30.274 7.163  1.00 9.92  ? 140 ALA A O   1 
ATOM   442  C  CB  . ALA A 1 53  ? 77.615 31.088 8.219  1.00 12.35 ? 140 ALA A CB  1 
ATOM   443  N  N   . ASP A 1 54  ? 76.042 28.614 7.429  1.00 11.71 ? 141 ASP A N   1 
ATOM   444  C  CA  . ASP A 1 54  ? 75.015 27.623 7.694  1.00 12.37 ? 141 ASP A CA  1 
ATOM   445  C  C   . ASP A 1 54  ? 74.204 27.974 8.927  1.00 13.40 ? 141 ASP A C   1 
ATOM   446  O  O   . ASP A 1 54  ? 72.992 27.769 8.955  1.00 11.91 ? 141 ASP A O   1 
ATOM   447  C  CB  . ASP A 1 54  ? 75.626 26.233 7.828  1.00 11.86 ? 141 ASP A CB  1 
ATOM   448  C  CG  . ASP A 1 54  ? 76.187 25.719 6.515  1.00 15.18 ? 141 ASP A CG  1 
ATOM   449  O  OD1 . ASP A 1 54  ? 75.524 25.908 5.464  1.00 13.26 ? 141 ASP A OD1 1 
ATOM   450  O  OD2 . ASP A 1 54  ? 77.296 25.130 6.538  1.00 18.61 ? 141 ASP A OD2 1 
ATOM   451  N  N   . ILE A 1 55  ? 74.872 28.523 9.937  1.00 15.12 ? 142 ILE A N   1 
ATOM   452  C  CA  . ILE A 1 55  ? 74.196 28.914 11.171 1.00 15.34 ? 142 ILE A CA  1 
ATOM   453  C  C   . ILE A 1 55  ? 74.481 30.382 11.466 1.00 15.66 ? 142 ILE A C   1 
ATOM   454  O  O   . ILE A 1 55  ? 75.604 30.769 11.806 1.00 17.77 ? 142 ILE A O   1 
ATOM   455  C  CB  . ILE A 1 55  ? 74.612 28.005 12.364 1.00 16.29 ? 142 ILE A CB  1 
ATOM   456  C  CG1 . ILE A 1 55  ? 74.158 26.559 12.099 1.00 14.86 ? 142 ILE A CG1 1 
ATOM   457  C  CG2 . ILE A 1 55  ? 73.995 28.515 13.657 1.00 14.45 ? 142 ILE A CG2 1 
ATOM   458  C  CD1 . ILE A 1 55  ? 74.657 25.556 13.084 1.00 10.31 ? 142 ILE A CD1 1 
ATOM   459  N  N   . MET A 1 56  ? 73.460 31.206 11.261 1.00 14.82 ? 143 MET A N   1 
ATOM   460  C  CA  . MET A 1 56  ? 73.566 32.637 11.489 1.00 12.93 ? 143 MET A CA  1 
ATOM   461  C  C   . MET A 1 56  ? 73.132 32.932 12.914 1.00 13.34 ? 143 MET A C   1 
ATOM   462  O  O   . MET A 1 56  ? 72.017 32.574 13.305 1.00 13.25 ? 143 MET A O   1 
ATOM   463  C  CB  . MET A 1 56  ? 72.674 33.385 10.502 1.00 13.07 ? 143 MET A CB  1 
ATOM   464  C  CG  . MET A 1 56  ? 73.045 33.179 9.046  1.00 13.32 ? 143 MET A CG  1 
ATOM   465  S  SD  . MET A 1 56  ? 74.648 33.912 8.622  1.00 16.79 ? 143 MET A SD  1 
ATOM   466  C  CE  . MET A 1 56  ? 74.117 35.582 8.024  1.00 12.87 ? 143 MET A CE  1 
ATOM   467  N  N   . ILE A 1 57  ? 74.025 33.565 13.682 1.00 13.55 ? 144 ILE A N   1 
ATOM   468  C  CA  . ILE A 1 57  ? 73.776 33.918 15.083 1.00 13.34 ? 144 ILE A CA  1 
ATOM   469  C  C   . ILE A 1 57  ? 73.321 35.372 15.217 1.00 13.57 ? 144 ILE A C   1 
ATOM   470  O  O   . ILE A 1 57  ? 73.917 36.263 14.615 1.00 14.18 ? 144 ILE A O   1 
ATOM   471  C  CB  . ILE A 1 57  ? 75.051 33.732 15.945 1.00 13.57 ? 144 ILE A CB  1 
ATOM   472  C  CG1 . ILE A 1 57  ? 75.709 32.378 15.654 1.00 13.84 ? 144 ILE A CG1 1 
ATOM   473  C  CG2 . ILE A 1 57  ? 74.708 33.814 17.426 1.00 13.13 ? 144 ILE A CG2 1 
ATOM   474  C  CD1 . ILE A 1 57  ? 74.839 31.183 15.929 1.00 10.88 ? 144 ILE A CD1 1 
ATOM   475  N  N   . ASN A 1 58  ? 72.300 35.612 16.045 1.00 14.68 ? 145 ASN A N   1 
ATOM   476  C  CA  . ASN A 1 58  ? 71.773 36.964 16.248 1.00 14.10 ? 145 ASN A CA  1 
ATOM   477  C  C   . ASN A 1 58  ? 71.040 37.243 17.558 1.00 14.28 ? 145 ASN A C   1 
ATOM   478  O  O   . ASN A 1 58  ? 70.699 36.326 18.303 1.00 13.42 ? 145 ASN A O   1 
ATOM   479  C  CB  . ASN A 1 58  ? 70.843 37.336 15.104 1.00 14.20 ? 145 ASN A CB  1 
ATOM   480  C  CG  . ASN A 1 58  ? 71.144 38.697 14.549 1.00 16.44 ? 145 ASN A CG  1 
ATOM   481  O  OD1 . ASN A 1 58  ? 71.631 39.584 15.259 1.00 20.91 ? 145 ASN A OD1 1 
ATOM   482  N  ND2 . ASN A 1 58  ? 70.880 38.875 13.262 1.00 17.32 ? 145 ASN A ND2 1 
ATOM   483  N  N   . PHE A 1 59  ? 70.820 38.537 17.816 1.00 14.21 ? 146 PHE A N   1 
ATOM   484  C  CA  . PHE A 1 59  ? 70.109 39.024 19.000 1.00 13.64 ? 146 PHE A CA  1 
ATOM   485  C  C   . PHE A 1 59  ? 68.899 39.838 18.536 1.00 14.54 ? 146 PHE A C   1 
ATOM   486  O  O   . PHE A 1 59  ? 68.902 40.402 17.443 1.00 15.75 ? 146 PHE A O   1 
ATOM   487  C  CB  . PHE A 1 59  ? 71.028 39.892 19.870 1.00 12.30 ? 146 PHE A CB  1 
ATOM   488  C  CG  . PHE A 1 59  ? 72.130 39.121 20.530 1.00 13.55 ? 146 PHE A CG  1 
ATOM   489  C  CD1 . PHE A 1 59  ? 73.324 38.865 19.853 1.00 14.50 ? 146 PHE A CD1 1 
ATOM   490  C  CD2 . PHE A 1 59  ? 71.956 38.585 21.798 1.00 12.79 ? 146 PHE A CD2 1 
ATOM   491  C  CE1 . PHE A 1 59  ? 74.328 38.073 20.430 1.00 12.13 ? 146 PHE A CE1 1 
ATOM   492  C  CE2 . PHE A 1 59  ? 72.960 37.790 22.383 1.00 15.34 ? 146 PHE A CE2 1 
ATOM   493  C  CZ  . PHE A 1 59  ? 74.145 37.535 21.695 1.00 10.06 ? 146 PHE A CZ  1 
ATOM   494  N  N   . GLY A 1 60  ? 67.851 39.864 19.348 1.00 15.18 ? 147 GLY A N   1 
ATOM   495  C  CA  . GLY A 1 60  ? 66.664 40.615 18.988 1.00 15.51 ? 147 GLY A CA  1 
ATOM   496  C  C   . GLY A 1 60  ? 65.687 40.759 20.137 1.00 17.49 ? 147 GLY A C   1 
ATOM   497  O  O   . GLY A 1 60  ? 65.865 40.162 21.197 1.00 17.27 ? 147 GLY A O   1 
ATOM   498  N  N   . ARG A 1 61  ? 64.659 41.567 19.925 1.00 19.36 ? 148 ARG A N   1 
ATOM   499  C  CA  . ARG A 1 61  ? 63.626 41.794 20.927 1.00 21.12 ? 148 ARG A CA  1 
ATOM   500  C  C   . ARG A 1 61  ? 62.278 41.758 20.215 1.00 20.74 ? 148 ARG A C   1 
ATOM   501  O  O   . ARG A 1 61  ? 62.177 42.181 19.054 1.00 22.67 ? 148 ARG A O   1 
ATOM   502  C  CB  . ARG A 1 61  ? 63.830 43.162 21.593 1.00 23.14 ? 148 ARG A CB  1 
ATOM   503  C  CG  . ARG A 1 61  ? 63.775 44.344 20.620 1.00 27.82 ? 148 ARG A CG  1 
ATOM   504  C  CD  . ARG A 1 61  ? 64.001 45.682 21.324 1.00 33.53 ? 148 ARG A CD  1 
ATOM   505  N  NE  . ARG A 1 61  ? 63.018 45.904 22.383 1.00 38.96 ? 148 ARG A NE  1 
ATOM   506  C  CZ  . ARG A 1 61  ? 63.156 46.782 23.375 1.00 41.15 ? 148 ARG A CZ  1 
ATOM   507  N  NH1 . ARG A 1 61  ? 64.239 47.556 23.454 1.00 41.64 ? 148 ARG A NH1 1 
ATOM   508  N  NH2 . ARG A 1 61  ? 62.255 46.807 24.360 1.00 42.62 ? 148 ARG A NH2 1 
ATOM   509  N  N   . TRP A 1 62  ? 61.254 41.243 20.898 1.00 19.25 ? 149 TRP A N   1 
ATOM   510  C  CA  . TRP A 1 62  ? 59.894 41.147 20.346 1.00 16.50 ? 149 TRP A CA  1 
ATOM   511  C  C   . TRP A 1 62  ? 59.960 40.619 18.914 1.00 15.02 ? 149 TRP A C   1 
ATOM   512  O  O   . TRP A 1 62  ? 60.812 39.794 18.618 1.00 14.90 ? 149 TRP A O   1 
ATOM   513  C  CB  . TRP A 1 62  ? 59.201 42.515 20.431 1.00 15.74 ? 149 TRP A CB  1 
ATOM   514  C  CG  . TRP A 1 62  ? 59.196 43.066 21.838 1.00 15.83 ? 149 TRP A CG  1 
ATOM   515  C  CD1 . TRP A 1 62  ? 60.068 43.990 22.367 1.00 17.28 ? 149 TRP A CD1 1 
ATOM   516  C  CD2 . TRP A 1 62  ? 58.334 42.668 22.916 1.00 15.42 ? 149 TRP A CD2 1 
ATOM   517  N  NE1 . TRP A 1 62  ? 59.805 44.175 23.707 1.00 18.16 ? 149 TRP A NE1 1 
ATOM   518  C  CE2 . TRP A 1 62  ? 58.749 43.378 24.070 1.00 14.74 ? 149 TRP A CE2 1 
ATOM   519  C  CE3 . TRP A 1 62  ? 57.254 41.776 23.022 1.00 15.16 ? 149 TRP A CE3 1 
ATOM   520  C  CZ2 . TRP A 1 62  ? 58.125 43.222 25.309 1.00 12.73 ? 149 TRP A CZ2 1 
ATOM   521  C  CZ3 . TRP A 1 62  ? 56.634 41.622 24.258 1.00 12.57 ? 149 TRP A CZ3 1 
ATOM   522  C  CH2 . TRP A 1 62  ? 57.074 42.342 25.384 1.00 13.22 ? 149 TRP A CH2 1 
ATOM   523  N  N   . GLU A 1 63  ? 59.078 41.070 18.029 1.00 14.21 ? 150 GLU A N   1 
ATOM   524  C  CA  . GLU A 1 63  ? 59.136 40.605 16.649 1.00 14.47 ? 150 GLU A CA  1 
ATOM   525  C  C   . GLU A 1 63  ? 60.420 41.101 16.013 1.00 15.41 ? 150 GLU A C   1 
ATOM   526  O  O   . GLU A 1 63  ? 60.681 42.300 15.986 1.00 17.05 ? 150 GLU A O   1 
ATOM   527  C  CB  . GLU A 1 63  ? 57.940 41.073 15.820 1.00 10.34 ? 150 GLU A CB  1 
ATOM   528  C  CG  . GLU A 1 63  ? 57.074 39.929 15.312 1.00 12.60 ? 150 GLU A CG  1 
ATOM   529  C  CD  . GLU A 1 63  ? 57.857 38.829 14.591 1.00 13.12 ? 150 GLU A CD  1 
ATOM   530  O  OE1 . GLU A 1 63  ? 58.357 37.896 15.265 1.00 17.24 ? 150 GLU A OE1 1 
ATOM   531  O  OE2 . GLU A 1 63  ? 57.963 38.885 13.350 1.00 10.74 ? 150 GLU A OE2 1 
ATOM   532  N  N   . HIS A 1 64  ? 61.212 40.169 15.499 1.00 17.48 ? 151 HIS A N   1 
ATOM   533  C  CA  . HIS A 1 64  ? 62.483 40.496 14.865 1.00 18.93 ? 151 HIS A CA  1 
ATOM   534  C  C   . HIS A 1 64  ? 62.556 40.004 13.429 1.00 20.55 ? 151 HIS A C   1 
ATOM   535  O  O   . HIS A 1 64  ? 63.654 39.798 12.883 1.00 22.80 ? 151 HIS A O   1 
ATOM   536  C  CB  . HIS A 1 64  ? 63.640 39.948 15.691 1.00 18.43 ? 151 HIS A CB  1 
ATOM   537  C  CG  . HIS A 1 64  ? 63.415 38.554 16.192 1.00 17.84 ? 151 HIS A CG  1 
ATOM   538  N  ND1 . HIS A 1 64  ? 62.256 38.135 16.809 1.00 20.24 ? 151 HIS A ND1 1 
ATOM   539  C  CD2 . HIS A 1 64  ? 64.250 37.481 16.215 1.00 16.07 ? 151 HIS A CD2 1 
ATOM   540  C  CE1 . HIS A 1 64  ? 62.425 36.862 17.188 1.00 19.19 ? 151 HIS A CE1 1 
ATOM   541  N  NE2 . HIS A 1 64  ? 63.613 36.432 16.847 1.00 16.38 ? 151 HIS A NE2 1 
ATOM   542  N  N   . GLY A 1 65  ? 61.394 39.793 12.819 1.00 18.66 ? 152 GLY A N   1 
ATOM   543  C  CA  . GLY A 1 65  ? 61.321 39.376 11.438 1.00 16.87 ? 152 GLY A CA  1 
ATOM   544  C  C   . GLY A 1 65  ? 61.269 37.903 11.124 1.00 17.50 ? 152 GLY A C   1 
ATOM   545  O  O   . GLY A 1 65  ? 61.826 37.482 10.118 1.00 19.42 ? 152 GLY A O   1 
ATOM   546  N  N   . ASP A 1 66  ? 60.566 37.105 11.929 1.00 19.20 ? 153 ASP A N   1 
ATOM   547  C  CA  . ASP A 1 66  ? 60.494 35.663 11.646 1.00 19.20 ? 153 ASP A CA  1 
ATOM   548  C  C   . ASP A 1 66  ? 59.221 34.960 12.115 1.00 18.26 ? 153 ASP A C   1 
ATOM   549  O  O   . ASP A 1 66  ? 59.162 33.734 12.085 1.00 18.94 ? 153 ASP A O   1 
ATOM   550  C  CB  . ASP A 1 66  ? 61.721 34.929 12.205 1.00 21.74 ? 153 ASP A CB  1 
ATOM   551  C  CG  . ASP A 1 66  ? 61.610 34.653 13.689 1.00 23.21 ? 153 ASP A CG  1 
ATOM   552  O  OD1 . ASP A 1 66  ? 61.199 35.550 14.466 1.00 25.35 ? 153 ASP A OD1 1 
ATOM   553  O  OD2 . ASP A 1 66  ? 61.889 33.508 14.070 1.00 23.94 ? 153 ASP A OD2 1 
ATOM   554  N  N   . GLY A 1 67  ? 58.226 35.724 12.543 1.00 16.32 ? 154 GLY A N   1 
ATOM   555  C  CA  . GLY A 1 67  ? 56.976 35.135 12.966 1.00 15.68 ? 154 GLY A CA  1 
ATOM   556  C  C   . GLY A 1 67  ? 56.951 34.607 14.382 1.00 17.36 ? 154 GLY A C   1 
ATOM   557  O  O   . GLY A 1 67  ? 55.872 34.447 14.938 1.00 19.58 ? 154 GLY A O   1 
ATOM   558  N  N   . TYR A 1 68  ? 58.126 34.377 14.975 1.00 18.77 ? 155 TYR A N   1 
ATOM   559  C  CA  . TYR A 1 68  ? 58.223 33.859 16.330 1.00 19.12 ? 155 TYR A CA  1 
ATOM   560  C  C   . TYR A 1 68  ? 58.839 34.899 17.245 1.00 19.84 ? 155 TYR A C   1 
ATOM   561  O  O   . TYR A 1 68  ? 60.067 34.916 17.417 1.00 22.19 ? 155 TYR A O   1 
ATOM   562  C  CB  . TYR A 1 68  ? 59.062 32.586 16.331 1.00 18.83 ? 155 TYR A CB  1 
ATOM   563  C  CG  . TYR A 1 68  ? 58.446 31.478 15.513 1.00 20.39 ? 155 TYR A CG  1 
ATOM   564  C  CD1 . TYR A 1 68  ? 58.619 31.421 14.125 1.00 20.40 ? 155 TYR A CD1 1 
ATOM   565  C  CD2 . TYR A 1 68  ? 57.672 30.494 16.119 1.00 21.78 ? 155 TYR A CD2 1 
ATOM   566  C  CE1 . TYR A 1 68  ? 58.030 30.410 13.367 1.00 21.12 ? 155 TYR A CE1 1 
ATOM   567  C  CE2 . TYR A 1 68  ? 57.078 29.481 15.372 1.00 22.67 ? 155 TYR A CE2 1 
ATOM   568  C  CZ  . TYR A 1 68  ? 57.257 29.443 13.997 1.00 22.82 ? 155 TYR A CZ  1 
ATOM   569  O  OH  . TYR A 1 68  ? 56.637 28.458 13.256 1.00 23.20 ? 155 TYR A OH  1 
ATOM   570  N  N   . PRO A 1 69  ? 57.999 35.731 17.895 1.00 20.52 ? 156 PRO A N   1 
ATOM   571  C  CA  . PRO A 1 69  ? 58.337 36.825 18.826 1.00 20.85 ? 156 PRO A CA  1 
ATOM   572  C  C   . PRO A 1 69  ? 58.972 36.445 20.153 1.00 19.20 ? 156 PRO A C   1 
ATOM   573  O  O   . PRO A 1 69  ? 58.829 35.322 20.628 1.00 18.39 ? 156 PRO A O   1 
ATOM   574  C  CB  . PRO A 1 69  ? 56.975 37.495 19.093 1.00 20.14 ? 156 PRO A CB  1 
ATOM   575  C  CG  . PRO A 1 69  ? 56.097 37.039 17.970 1.00 21.78 ? 156 PRO A CG  1 
ATOM   576  C  CD  . PRO A 1 69  ? 56.535 35.617 17.768 1.00 20.90 ? 156 PRO A CD  1 
ATOM   577  N  N   . PHE A 1 70  ? 59.661 37.423 20.736 1.00 18.57 ? 157 PHE A N   1 
ATOM   578  C  CA  . PHE A 1 70  ? 60.281 37.271 22.050 1.00 17.81 ? 157 PHE A CA  1 
ATOM   579  C  C   . PHE A 1 70  ? 59.356 37.992 23.032 1.00 17.74 ? 157 PHE A C   1 
ATOM   580  O  O   . PHE A 1 70  ? 58.292 38.476 22.620 1.00 18.40 ? 157 PHE A O   1 
ATOM   581  C  CB  . PHE A 1 70  ? 61.705 37.828 22.089 1.00 14.66 ? 157 PHE A CB  1 
ATOM   582  C  CG  . PHE A 1 70  ? 62.720 36.915 21.455 1.00 12.47 ? 157 PHE A CG  1 
ATOM   583  C  CD1 . PHE A 1 70  ? 62.670 35.543 21.687 1.00 10.09 ? 157 PHE A CD1 1 
ATOM   584  C  CD2 . PHE A 1 70  ? 63.715 37.416 20.613 1.00 10.44 ? 157 PHE A CD2 1 
ATOM   585  C  CE1 . PHE A 1 70  ? 63.582 34.681 21.093 1.00 8.40  ? 157 PHE A CE1 1 
ATOM   586  C  CE2 . PHE A 1 70  ? 64.638 36.559 20.010 1.00 8.24  ? 157 PHE A CE2 1 
ATOM   587  C  CZ  . PHE A 1 70  ? 64.569 35.189 20.253 1.00 10.97 ? 157 PHE A CZ  1 
ATOM   588  N  N   . ASP A 1 71  ? 59.743 38.112 24.300 1.00 17.29 ? 158 ASP A N   1 
ATOM   589  C  CA  . ASP A 1 71  ? 58.852 38.729 25.277 1.00 17.13 ? 158 ASP A CA  1 
ATOM   590  C  C   . ASP A 1 71  ? 59.419 39.595 26.418 1.00 16.62 ? 158 ASP A C   1 
ATOM   591  O  O   . ASP A 1 71  ? 58.955 39.497 27.557 1.00 17.07 ? 158 ASP A O   1 
ATOM   592  C  CB  . ASP A 1 71  ? 57.946 37.630 25.861 1.00 16.96 ? 158 ASP A CB  1 
ATOM   593  C  CG  . ASP A 1 71  ? 58.734 36.444 26.422 1.00 18.48 ? 158 ASP A CG  1 
ATOM   594  O  OD1 . ASP A 1 71  ? 59.768 36.066 25.834 1.00 18.43 ? 158 ASP A OD1 1 
ATOM   595  O  OD2 . ASP A 1 71  ? 58.322 35.877 27.454 1.00 20.43 ? 158 ASP A OD2 1 
ATOM   596  N  N   . GLY A 1 72  ? 60.366 40.480 26.129 1.00 15.60 ? 159 GLY A N   1 
ATOM   597  C  CA  . GLY A 1 72  ? 60.909 41.319 27.187 1.00 14.90 ? 159 GLY A CA  1 
ATOM   598  C  C   . GLY A 1 72  ? 61.757 40.571 28.204 1.00 15.61 ? 159 GLY A C   1 
ATOM   599  O  O   . GLY A 1 72  ? 62.276 39.506 27.921 1.00 15.11 ? 159 GLY A O   1 
ATOM   600  N  N   . LYS A 1 73  ? 61.866 41.110 29.410 1.00 15.58 ? 160 LYS A N   1 
ATOM   601  C  CA  . LYS A 1 73  ? 62.676 40.496 30.455 1.00 15.76 ? 160 LYS A CA  1 
ATOM   602  C  C   . LYS A 1 73  ? 62.099 39.157 30.922 1.00 15.88 ? 160 LYS A C   1 
ATOM   603  O  O   . LYS A 1 73  ? 60.887 39.015 31.069 1.00 15.39 ? 160 LYS A O   1 
ATOM   604  C  CB  . LYS A 1 73  ? 62.830 41.478 31.616 1.00 16.76 ? 160 LYS A CB  1 
ATOM   605  C  CG  . LYS A 1 73  ? 63.828 41.079 32.671 1.00 19.09 ? 160 LYS A CG  1 
ATOM   606  C  CD  . LYS A 1 73  ? 64.159 42.267 33.563 1.00 21.58 ? 160 LYS A CD  1 
ATOM   607  C  CE  . LYS A 1 73  ? 65.011 41.861 34.758 1.00 24.20 ? 160 LYS A CE  1 
ATOM   608  N  NZ  . LYS A 1 73  ? 64.255 40.923 35.653 1.00 23.16 ? 160 LYS A NZ  1 
ATOM   609  N  N   . ASP A 1 74  ? 62.984 38.178 31.124 1.00 16.07 ? 161 ASP A N   1 
ATOM   610  C  CA  . ASP A 1 74  ? 62.615 36.832 31.561 1.00 16.96 ? 161 ASP A CA  1 
ATOM   611  C  C   . ASP A 1 74  ? 61.641 36.141 30.617 1.00 17.56 ? 161 ASP A C   1 
ATOM   612  O  O   . ASP A 1 74  ? 61.338 36.670 29.556 1.00 19.73 ? 161 ASP A O   1 
ATOM   613  C  CB  . ASP A 1 74  ? 62.031 36.868 32.965 1.00 18.44 ? 161 ASP A CB  1 
ATOM   614  C  CG  . ASP A 1 74  ? 63.024 37.345 33.985 1.00 19.46 ? 161 ASP A CG  1 
ATOM   615  O  OD1 . ASP A 1 74  ? 64.167 36.849 33.973 1.00 16.35 ? 161 ASP A OD1 1 
ATOM   616  O  OD2 . ASP A 1 74  ? 62.657 38.220 34.796 1.00 22.49 ? 161 ASP A OD2 1 
ATOM   617  N  N   . GLY A 1 75  ? 61.129 34.976 31.015 1.00 16.45 ? 162 GLY A N   1 
ATOM   618  C  CA  . GLY A 1 75  ? 60.198 34.244 30.171 1.00 15.91 ? 162 GLY A CA  1 
ATOM   619  C  C   . GLY A 1 75  ? 60.963 33.452 29.138 1.00 16.89 ? 162 GLY A C   1 
ATOM   620  O  O   . GLY A 1 75  ? 61.771 32.606 29.503 1.00 18.42 ? 162 GLY A O   1 
ATOM   621  N  N   . LEU A 1 76  ? 60.691 33.673 27.855 1.00 16.84 ? 163 LEU A N   1 
ATOM   622  C  CA  . LEU A 1 76  ? 61.436 32.968 26.809 1.00 15.74 ? 163 LEU A CA  1 
ATOM   623  C  C   . LEU A 1 76  ? 62.875 33.506 26.789 1.00 14.71 ? 163 LEU A C   1 
ATOM   624  O  O   . LEU A 1 76  ? 63.101 34.674 27.092 1.00 16.90 ? 163 LEU A O   1 
ATOM   625  C  CB  . LEU A 1 76  ? 60.797 33.205 25.449 1.00 15.29 ? 163 LEU A CB  1 
ATOM   626  C  CG  . LEU A 1 76  ? 60.063 32.021 24.832 1.00 17.62 ? 163 LEU A CG  1 
ATOM   627  C  CD1 . LEU A 1 76  ? 58.563 32.115 25.120 1.00 18.77 ? 163 LEU A CD1 1 
ATOM   628  C  CD2 . LEU A 1 76  ? 60.322 32.043 23.342 1.00 15.39 ? 163 LEU A CD2 1 
ATOM   629  N  N   . LEU A 1 77  ? 63.851 32.666 26.460 1.00 11.54 ? 164 LEU A N   1 
ATOM   630  C  CA  . LEU A 1 77  ? 65.232 33.133 26.431 1.00 9.88  ? 164 LEU A CA  1 
ATOM   631  C  C   . LEU A 1 77  ? 65.826 33.184 25.036 1.00 10.93 ? 164 LEU A C   1 
ATOM   632  O  O   . LEU A 1 77  ? 66.484 34.164 24.666 1.00 12.54 ? 164 LEU A O   1 
ATOM   633  C  CB  . LEU A 1 77  ? 66.113 32.280 27.346 1.00 10.60 ? 164 LEU A CB  1 
ATOM   634  C  CG  . LEU A 1 77  ? 65.798 32.338 28.843 1.00 12.35 ? 164 LEU A CG  1 
ATOM   635  C  CD1 . LEU A 1 77  ? 66.901 31.631 29.625 1.00 13.43 ? 164 LEU A CD1 1 
ATOM   636  C  CD2 . LEU A 1 77  ? 65.661 33.789 29.306 1.00 10.69 ? 164 LEU A CD2 1 
ATOM   637  N  N   . ALA A 1 78  ? 65.608 32.119 24.271 1.00 11.70 ? 165 ALA A N   1 
ATOM   638  C  CA  . ALA A 1 78  ? 66.118 32.023 22.910 1.00 11.15 ? 165 ALA A CA  1 
ATOM   639  C  C   . ALA A 1 78  ? 65.418 30.887 22.170 1.00 12.48 ? 165 ALA A C   1 
ATOM   640  O  O   . ALA A 1 78  ? 64.606 30.169 22.756 1.00 10.15 ? 165 ALA A O   1 
ATOM   641  C  CB  . ALA A 1 78  ? 67.610 31.774 22.943 1.00 10.86 ? 165 ALA A CB  1 
ATOM   642  N  N   . HIS A 1 79  ? 65.711 30.760 20.874 1.00 13.22 ? 166 HIS A N   1 
ATOM   643  C  CA  . HIS A 1 79  ? 65.160 29.686 20.038 1.00 12.96 ? 166 HIS A CA  1 
ATOM   644  C  C   . HIS A 1 79  ? 66.023 29.426 18.803 1.00 13.21 ? 166 HIS A C   1 
ATOM   645  O  O   . HIS A 1 79  ? 66.774 30.303 18.381 1.00 15.39 ? 166 HIS A O   1 
ATOM   646  C  CB  . HIS A 1 79  ? 63.692 29.937 19.640 1.00 11.17 ? 166 HIS A CB  1 
ATOM   647  C  CG  . HIS A 1 79  ? 63.469 31.170 18.818 1.00 13.38 ? 166 HIS A CG  1 
ATOM   648  N  ND1 . HIS A 1 79  ? 62.336 31.949 18.900 1.00 15.09 ? 166 HIS A ND1 1 
ATOM   649  C  CD2 . HIS A 1 79  ? 64.269 31.781 17.906 1.00 13.60 ? 166 HIS A CD2 1 
ATOM   650  C  CE1 . HIS A 1 79  ? 62.485 32.991 18.068 1.00 13.62 ? 166 HIS A CE1 1 
ATOM   651  N  NE2 . HIS A 1 79  ? 63.641 32.929 17.446 1.00 14.04 ? 166 HIS A NE2 1 
ATOM   652  N  N   . ALA A 1 80  ? 65.939 28.211 18.258 1.00 13.25 ? 167 ALA A N   1 
ATOM   653  C  CA  . ALA A 1 80  ? 66.694 27.826 17.062 1.00 12.35 ? 167 ALA A CA  1 
ATOM   654  C  C   . ALA A 1 80  ? 65.876 26.939 16.115 1.00 11.73 ? 167 ALA A C   1 
ATOM   655  O  O   . ALA A 1 80  ? 64.950 26.264 16.543 1.00 12.09 ? 167 ALA A O   1 
ATOM   656  C  CB  . ALA A 1 80  ? 67.976 27.130 17.462 1.00 12.68 ? 167 ALA A CB  1 
ATOM   657  N  N   . PHE A 1 81  ? 66.219 26.942 14.830 1.00 12.60 ? 168 PHE A N   1 
ATOM   658  C  CA  . PHE A 1 81  ? 65.505 26.132 13.844 1.00 13.50 ? 168 PHE A CA  1 
ATOM   659  C  C   . PHE A 1 81  ? 66.216 24.814 13.491 1.00 14.49 ? 168 PHE A C   1 
ATOM   660  O  O   . PHE A 1 81  ? 67.435 24.700 13.610 1.00 14.23 ? 168 PHE A O   1 
ATOM   661  C  CB  . PHE A 1 81  ? 65.253 26.963 12.592 1.00 14.96 ? 168 PHE A CB  1 
ATOM   662  C  CG  . PHE A 1 81  ? 64.468 28.216 12.855 1.00 18.88 ? 168 PHE A CG  1 
ATOM   663  C  CD1 . PHE A 1 81  ? 65.065 29.312 13.495 1.00 18.97 ? 168 PHE A CD1 1 
ATOM   664  C  CD2 . PHE A 1 81  ? 63.128 28.307 12.476 1.00 19.83 ? 168 PHE A CD2 1 
ATOM   665  C  CE1 . PHE A 1 81  ? 64.340 30.483 13.757 1.00 16.73 ? 168 PHE A CE1 1 
ATOM   666  C  CE2 . PHE A 1 81  ? 62.388 29.477 12.732 1.00 20.25 ? 168 PHE A CE2 1 
ATOM   667  C  CZ  . PHE A 1 81  ? 63.000 30.566 13.375 1.00 19.86 ? 168 PHE A CZ  1 
ATOM   668  N  N   . ALA A 1 82  ? 65.447 23.811 13.071 1.00 13.68 ? 169 ALA A N   1 
ATOM   669  C  CA  . ALA A 1 82  ? 66.011 22.502 12.724 1.00 14.14 ? 169 ALA A CA  1 
ATOM   670  C  C   . ALA A 1 82  ? 66.915 22.557 11.479 1.00 14.29 ? 169 ALA A C   1 
ATOM   671  O  O   . ALA A 1 82  ? 66.952 23.572 10.775 1.00 13.76 ? 169 ALA A O   1 
ATOM   672  C  CB  . ALA A 1 82  ? 64.889 21.482 12.530 1.00 7.26  ? 169 ALA A CB  1 
ATOM   673  N  N   . PRO A 1 83  ? 67.706 21.491 11.235 1.00 14.00 ? 170 PRO A N   1 
ATOM   674  C  CA  . PRO A 1 83  ? 68.594 21.454 10.072 1.00 13.78 ? 170 PRO A CA  1 
ATOM   675  C  C   . PRO A 1 83  ? 67.805 21.703 8.802  1.00 13.87 ? 170 PRO A C   1 
ATOM   676  O  O   . PRO A 1 83  ? 66.863 20.980 8.515  1.00 15.21 ? 170 PRO A O   1 
ATOM   677  C  CB  . PRO A 1 83  ? 69.128 20.028 10.101 1.00 12.43 ? 170 PRO A CB  1 
ATOM   678  C  CG  . PRO A 1 83  ? 69.210 19.749 11.541 1.00 13.53 ? 170 PRO A CG  1 
ATOM   679  C  CD  . PRO A 1 83  ? 67.909 20.298 12.074 1.00 13.78 ? 170 PRO A CD  1 
ATOM   680  N  N   . GLY A 1 84  ? 68.171 22.753 8.073  1.00 15.53 ? 171 GLY A N   1 
ATOM   681  C  CA  . GLY A 1 84  ? 67.495 23.093 6.830  1.00 14.82 ? 171 GLY A CA  1 
ATOM   682  C  C   . GLY A 1 84  ? 68.197 24.233 6.107  1.00 15.22 ? 171 GLY A C   1 
ATOM   683  O  O   . GLY A 1 84  ? 69.139 24.820 6.637  1.00 15.55 ? 171 GLY A O   1 
ATOM   684  N  N   . THR A 1 85  ? 67.763 24.538 4.890  1.00 14.49 ? 172 THR A N   1 
ATOM   685  C  CA  . THR A 1 85  ? 68.385 25.617 4.132  1.00 14.17 ? 172 THR A CA  1 
ATOM   686  C  C   . THR A 1 85  ? 67.791 26.964 4.532  1.00 15.12 ? 172 THR A C   1 
ATOM   687  O  O   . THR A 1 85  ? 66.781 27.022 5.243  1.00 14.23 ? 172 THR A O   1 
ATOM   688  C  CB  . THR A 1 85  ? 68.264 25.413 2.591  1.00 15.04 ? 172 THR A CB  1 
ATOM   689  O  OG1 . THR A 1 85  ? 66.883 25.400 2.193  1.00 14.02 ? 172 THR A OG1 1 
ATOM   690  C  CG2 . THR A 1 85  ? 68.929 24.122 2.172  1.00 10.46 ? 172 THR A CG2 1 
ATOM   691  N  N   . GLY A 1 86  ? 68.449 28.040 4.114  1.00 14.53 ? 173 GLY A N   1 
ATOM   692  C  CA  . GLY A 1 86  ? 67.963 29.364 4.440  1.00 13.93 ? 173 GLY A CA  1 
ATOM   693  C  C   . GLY A 1 86  ? 68.014 29.666 5.922  1.00 14.56 ? 173 GLY A C   1 
ATOM   694  O  O   . GLY A 1 86  ? 69.082 29.845 6.480  1.00 15.90 ? 173 GLY A O   1 
ATOM   695  N  N   . VAL A 1 87  ? 66.856 29.690 6.564  1.00 16.09 ? 174 VAL A N   1 
ATOM   696  C  CA  . VAL A 1 87  ? 66.756 29.999 7.992  1.00 16.40 ? 174 VAL A CA  1 
ATOM   697  C  C   . VAL A 1 87  ? 67.011 28.797 8.885  1.00 15.29 ? 174 VAL A C   1 
ATOM   698  O  O   . VAL A 1 87  ? 67.367 28.956 10.051 1.00 15.64 ? 174 VAL A O   1 
ATOM   699  C  CB  . VAL A 1 87  ? 65.377 30.655 8.313  1.00 17.06 ? 174 VAL A CB  1 
ATOM   700  C  CG1 . VAL A 1 87  ? 65.047 30.585 9.789  1.00 17.82 ? 174 VAL A CG1 1 
ATOM   701  C  CG2 . VAL A 1 87  ? 65.400 32.106 7.873  1.00 18.81 ? 174 VAL A CG2 1 
ATOM   702  N  N   . GLY A 1 88  ? 66.830 27.598 8.343  1.00 13.64 ? 175 GLY A N   1 
ATOM   703  C  CA  . GLY A 1 88  ? 67.070 26.407 9.135  1.00 12.64 ? 175 GLY A CA  1 
ATOM   704  C  C   . GLY A 1 88  ? 68.453 26.495 9.752  1.00 13.75 ? 175 GLY A C   1 
ATOM   705  O  O   . GLY A 1 88  ? 69.396 26.931 9.094  1.00 12.70 ? 175 GLY A O   1 
ATOM   706  N  N   . GLY A 1 89  ? 68.557 26.152 11.029 1.00 14.28 ? 176 GLY A N   1 
ATOM   707  C  CA  . GLY A 1 89  ? 69.837 26.208 11.711 1.00 11.97 ? 176 GLY A CA  1 
ATOM   708  C  C   . GLY A 1 89  ? 70.129 27.510 12.440 1.00 10.05 ? 176 GLY A C   1 
ATOM   709  O  O   . GLY A 1 89  ? 70.956 27.524 13.344 1.00 8.50  ? 176 GLY A O   1 
ATOM   710  N  N   . ASP A 1 90  ? 69.469 28.597 12.055 1.00 9.82  ? 177 ASP A N   1 
ATOM   711  C  CA  . ASP A 1 90  ? 69.684 29.902 12.691 1.00 12.01 ? 177 ASP A CA  1 
ATOM   712  C  C   . ASP A 1 90  ? 69.311 29.915 14.189 1.00 14.18 ? 177 ASP A C   1 
ATOM   713  O  O   . ASP A 1 90  ? 68.312 29.316 14.595 1.00 12.91 ? 177 ASP A O   1 
ATOM   714  C  CB  . ASP A 1 90  ? 68.886 31.000 11.965 1.00 12.95 ? 177 ASP A CB  1 
ATOM   715  C  CG  . ASP A 1 90  ? 69.459 31.371 10.594 1.00 13.79 ? 177 ASP A CG  1 
ATOM   716  O  OD1 . ASP A 1 90  ? 70.248 30.606 10.023 1.00 10.03 ? 177 ASP A OD1 1 
ATOM   717  O  OD2 . ASP A 1 90  ? 69.105 32.449 10.077 1.00 12.01 ? 177 ASP A OD2 1 
ATOM   718  N  N   . SER A 1 91  ? 70.112 30.624 14.991 1.00 16.01 ? 178 SER A N   1 
ATOM   719  C  CA  . SER A 1 91  ? 69.904 30.742 16.441 1.00 15.21 ? 178 SER A CA  1 
ATOM   720  C  C   . SER A 1 91  ? 69.770 32.205 16.853 1.00 14.53 ? 178 SER A C   1 
ATOM   721  O  O   . SER A 1 91  ? 70.680 33.014 16.623 1.00 13.08 ? 178 SER A O   1 
ATOM   722  C  CB  . SER A 1 91  ? 71.075 30.122 17.203 1.00 16.14 ? 178 SER A CB  1 
ATOM   723  O  OG  . SER A 1 91  ? 71.360 28.822 16.725 1.00 19.06 ? 178 SER A OG  1 
ATOM   724  N  N   . HIS A 1 92  ? 68.641 32.534 17.480 1.00 12.91 ? 179 HIS A N   1 
ATOM   725  C  CA  . HIS A 1 92  ? 68.369 33.899 17.916 1.00 12.69 ? 179 HIS A CA  1 
ATOM   726  C  C   . HIS A 1 92  ? 68.240 33.994 19.428 1.00 12.31 ? 179 HIS A C   1 
ATOM   727  O  O   . HIS A 1 92  ? 67.628 33.136 20.061 1.00 11.29 ? 179 HIS A O   1 
ATOM   728  C  CB  . HIS A 1 92  ? 67.101 34.426 17.241 1.00 10.36 ? 179 HIS A CB  1 
ATOM   729  C  CG  . HIS A 1 92  ? 67.173 34.431 15.746 1.00 10.79 ? 179 HIS A CG  1 
ATOM   730  N  ND1 . HIS A 1 92  ? 66.042 34.461 14.973 1.00 11.77 ? 179 HIS A ND1 1 
ATOM   731  C  CD2 . HIS A 1 92  ? 68.259 34.368 14.938 1.00 11.19 ? 179 HIS A CD2 1 
ATOM   732  C  CE1 . HIS A 1 92  ? 66.456 34.410 13.722 1.00 10.54 ? 179 HIS A CE1 1 
ATOM   733  N  NE2 . HIS A 1 92  ? 67.787 34.352 13.651 1.00 13.28 ? 179 HIS A NE2 1 
ATOM   734  N  N   . PHE A 1 93  ? 68.811 35.060 19.987 1.00 13.60 ? 180 PHE A N   1 
ATOM   735  C  CA  . PHE A 1 93  ? 68.802 35.312 21.423 1.00 13.73 ? 180 PHE A CA  1 
ATOM   736  C  C   . PHE A 1 93  ? 68.120 36.635 21.769 1.00 15.30 ? 180 PHE A C   1 
ATOM   737  O  O   . PHE A 1 93  ? 68.394 37.657 21.139 1.00 15.01 ? 180 PHE A O   1 
ATOM   738  C  CB  . PHE A 1 93  ? 70.235 35.340 21.947 1.00 11.84 ? 180 PHE A CB  1 
ATOM   739  C  CG  . PHE A 1 93  ? 70.968 34.047 21.765 1.00 11.04 ? 180 PHE A CG  1 
ATOM   740  C  CD1 . PHE A 1 93  ? 71.527 33.718 20.542 1.00 10.73 ? 180 PHE A CD1 1 
ATOM   741  C  CD2 . PHE A 1 93  ? 71.109 33.163 22.824 1.00 10.19 ? 180 PHE A CD2 1 
ATOM   742  C  CE1 . PHE A 1 93  ? 72.208 32.524 20.370 1.00 11.87 ? 180 PHE A CE1 1 
ATOM   743  C  CE2 . PHE A 1 93  ? 71.789 31.964 22.663 1.00 12.35 ? 180 PHE A CE2 1 
ATOM   744  C  CZ  . PHE A 1 93  ? 72.343 31.645 21.433 1.00 12.56 ? 180 PHE A CZ  1 
ATOM   745  N  N   . ASP A 1 94  ? 67.274 36.615 22.802 1.00 16.12 ? 181 ASP A N   1 
ATOM   746  C  CA  . ASP A 1 94  ? 66.534 37.802 23.256 1.00 16.61 ? 181 ASP A CA  1 
ATOM   747  C  C   . ASP A 1 94  ? 67.390 38.805 24.028 1.00 14.86 ? 181 ASP A C   1 
ATOM   748  O  O   . ASP A 1 94  ? 67.875 38.510 25.123 1.00 13.50 ? 181 ASP A O   1 
ATOM   749  C  CB  . ASP A 1 94  ? 65.329 37.376 24.116 1.00 17.02 ? 181 ASP A CB  1 
ATOM   750  C  CG  . ASP A 1 94  ? 64.438 38.555 24.537 1.00 18.59 ? 181 ASP A CG  1 
ATOM   751  O  OD1 . ASP A 1 94  ? 64.563 39.697 24.028 1.00 19.90 ? 181 ASP A OD1 1 
ATOM   752  O  OD2 . ASP A 1 94  ? 63.581 38.331 25.394 1.00 17.12 ? 181 ASP A OD2 1 
ATOM   753  N  N   . ASP A 1 95  ? 67.503 40.016 23.489 1.00 14.64 ? 182 ASP A N   1 
ATOM   754  C  CA  . ASP A 1 95  ? 68.304 41.054 24.127 1.00 15.40 ? 182 ASP A CA  1 
ATOM   755  C  C   . ASP A 1 95  ? 67.627 41.910 25.204 1.00 15.20 ? 182 ASP A C   1 
ATOM   756  O  O   . ASP A 1 95  ? 68.188 42.919 25.611 1.00 15.90 ? 182 ASP A O   1 
ATOM   757  C  CB  . ASP A 1 95  ? 68.987 41.947 23.079 1.00 14.72 ? 182 ASP A CB  1 
ATOM   758  C  CG  . ASP A 1 95  ? 70.489 42.124 23.334 1.00 13.20 ? 182 ASP A CG  1 
ATOM   759  O  OD1 . ASP A 1 95  ? 70.969 41.814 24.439 1.00 10.91 ? 182 ASP A OD1 1 
ATOM   760  O  OD2 . ASP A 1 95  ? 71.196 42.571 22.410 1.00 14.16 ? 182 ASP A OD2 1 
ATOM   761  N  N   . ASP A 1 96  ? 66.431 41.550 25.660 1.00 15.11 ? 183 ASP A N   1 
ATOM   762  C  CA  . ASP A 1 96  ? 65.819 42.326 26.735 1.00 14.67 ? 183 ASP A CA  1 
ATOM   763  C  C   . ASP A 1 96  ? 66.301 41.681 28.036 1.00 16.89 ? 183 ASP A C   1 
ATOM   764  O  O   . ASP A 1 96  ? 65.949 42.110 29.143 1.00 17.73 ? 183 ASP A O   1 
ATOM   765  C  CB  . ASP A 1 96  ? 64.296 42.294 26.666 1.00 15.09 ? 183 ASP A CB  1 
ATOM   766  C  CG  . ASP A 1 96  ? 63.729 43.240 25.609 1.00 19.59 ? 183 ASP A CG  1 
ATOM   767  O  OD1 . ASP A 1 96  ? 64.206 44.388 25.498 1.00 21.14 ? 183 ASP A OD1 1 
ATOM   768  O  OD2 . ASP A 1 96  ? 62.787 42.847 24.881 1.00 21.47 ? 183 ASP A OD2 1 
ATOM   769  N  N   . GLU A 1 97  ? 67.102 40.629 27.875 1.00 16.90 ? 184 GLU A N   1 
ATOM   770  C  CA  . GLU A 1 97  ? 67.680 39.865 28.978 1.00 16.95 ? 184 GLU A CA  1 
ATOM   771  C  C   . GLU A 1 97  ? 69.080 40.408 29.261 1.00 16.06 ? 184 GLU A C   1 
ATOM   772  O  O   . GLU A 1 97  ? 69.677 41.069 28.408 1.00 13.06 ? 184 GLU A O   1 
ATOM   773  C  CB  . GLU A 1 97  ? 67.813 38.383 28.582 1.00 16.10 ? 184 GLU A CB  1 
ATOM   774  C  CG  . GLU A 1 97  ? 66.567 37.750 27.967 1.00 17.70 ? 184 GLU A CG  1 
ATOM   775  C  CD  . GLU A 1 97  ? 65.432 37.561 28.961 1.00 18.73 ? 184 GLU A CD  1 
ATOM   776  O  OE1 . GLU A 1 97  ? 65.623 37.844 30.160 1.00 20.55 ? 184 GLU A OE1 1 
ATOM   777  O  OE2 . GLU A 1 97  ? 64.341 37.126 28.545 1.00 15.52 ? 184 GLU A OE2 1 
ATOM   778  N  N   . LEU A 1 98  ? 69.587 40.141 30.464 1.00 16.12 ? 185 LEU A N   1 
ATOM   779  C  CA  . LEU A 1 98  ? 70.938 40.560 30.835 1.00 15.25 ? 185 LEU A CA  1 
ATOM   780  C  C   . LEU A 1 98  ? 71.848 39.340 30.688 1.00 15.27 ? 185 LEU A C   1 
ATOM   781  O  O   . LEU A 1 98  ? 71.733 38.373 31.447 1.00 14.55 ? 185 LEU A O   1 
ATOM   782  C  CB  . LEU A 1 98  ? 70.997 41.086 32.272 1.00 13.82 ? 185 LEU A CB  1 
ATOM   783  C  CG  . LEU A 1 98  ? 72.414 41.481 32.708 1.00 13.80 ? 185 LEU A CG  1 
ATOM   784  C  CD1 . LEU A 1 98  ? 72.895 42.699 31.910 1.00 11.60 ? 185 LEU A CD1 1 
ATOM   785  C  CD2 . LEU A 1 98  ? 72.447 41.762 34.202 1.00 13.51 ? 185 LEU A CD2 1 
ATOM   786  N  N   . TRP A 1 99  ? 72.729 39.377 29.693 1.00 14.03 ? 186 TRP A N   1 
ATOM   787  C  CA  . TRP A 1 99  ? 73.633 38.262 29.457 1.00 14.94 ? 186 TRP A CA  1 
ATOM   788  C  C   . TRP A 1 99  ? 74.923 38.380 30.260 1.00 16.13 ? 186 TRP A C   1 
ATOM   789  O  O   . TRP A 1 99  ? 75.541 39.446 30.332 1.00 16.55 ? 186 TRP A O   1 
ATOM   790  C  CB  . TRP A 1 99  ? 73.935 38.121 27.967 1.00 14.46 ? 186 TRP A CB  1 
ATOM   791  C  CG  . TRP A 1 99  ? 72.710 37.800 27.147 1.00 14.61 ? 186 TRP A CG  1 
ATOM   792  C  CD1 . TRP A 1 99  ? 72.024 38.653 26.329 1.00 12.92 ? 186 TRP A CD1 1 
ATOM   793  C  CD2 . TRP A 1 99  ? 72.010 36.550 27.103 1.00 13.64 ? 186 TRP A CD2 1 
ATOM   794  N  NE1 . TRP A 1 99  ? 70.935 38.013 25.788 1.00 13.57 ? 186 TRP A NE1 1 
ATOM   795  C  CE2 . TRP A 1 99  ? 70.903 36.723 26.242 1.00 13.86 ? 186 TRP A CE2 1 
ATOM   796  C  CE3 . TRP A 1 99  ? 72.209 35.301 27.709 1.00 11.76 ? 186 TRP A CE3 1 
ATOM   797  C  CZ2 . TRP A 1 99  ? 69.993 35.692 25.970 1.00 13.69 ? 186 TRP A CZ2 1 
ATOM   798  C  CZ3 . TRP A 1 99  ? 71.305 34.273 27.440 1.00 11.28 ? 186 TRP A CZ3 1 
ATOM   799  C  CH2 . TRP A 1 99  ? 70.211 34.477 26.577 1.00 11.68 ? 186 TRP A CH2 1 
ATOM   800  N  N   . SER A 1 100 ? 75.289 37.278 30.904 1.00 15.34 ? 187 SER A N   1 
ATOM   801  C  CA  . SER A 1 100 ? 76.495 37.196 31.716 1.00 16.15 ? 187 SER A CA  1 
ATOM   802  C  C   . SER A 1 100 ? 76.982 35.758 31.628 1.00 16.86 ? 187 SER A C   1 
ATOM   803  O  O   . SER A 1 100 ? 76.479 34.977 30.823 1.00 17.74 ? 187 SER A O   1 
ATOM   804  C  CB  . SER A 1 100 ? 76.165 37.561 33.164 1.00 15.25 ? 187 SER A CB  1 
ATOM   805  O  OG  . SER A 1 100 ? 75.086 36.787 33.661 1.00 14.41 ? 187 SER A OG  1 
ATOM   806  N  N   . LEU A 1 101 ? 77.982 35.402 32.420 1.00 18.92 ? 188 LEU A N   1 
ATOM   807  C  CA  . LEU A 1 101 ? 78.461 34.023 32.399 1.00 20.45 ? 188 LEU A CA  1 
ATOM   808  C  C   . LEU A 1 101 ? 77.917 33.318 33.644 1.00 24.64 ? 188 LEU A C   1 
ATOM   809  O  O   . LEU A 1 101 ? 78.563 32.423 34.190 1.00 24.41 ? 188 LEU A O   1 
ATOM   810  C  CB  . LEU A 1 101 ? 79.991 33.994 32.350 1.00 14.44 ? 188 LEU A CB  1 
ATOM   811  C  CG  . LEU A 1 101 ? 80.532 34.617 31.055 1.00 14.53 ? 188 LEU A CG  1 
ATOM   812  C  CD1 . LEU A 1 101 ? 81.991 34.979 31.181 1.00 7.98  ? 188 LEU A CD1 1 
ATOM   813  C  CD2 . LEU A 1 101 ? 80.276 33.700 29.849 1.00 7.16  ? 188 LEU A CD2 1 
ATOM   814  N  N   . GLY A 1 102 ? 76.696 33.711 34.043 1.00 29.46 ? 189 GLY A N   1 
ATOM   815  C  CA  . GLY A 1 102 ? 76.036 33.177 35.230 1.00 34.70 ? 189 GLY A CA  1 
ATOM   816  C  C   . GLY A 1 102 ? 76.503 33.910 36.487 1.00 38.85 ? 189 GLY A C   1 
ATOM   817  O  O   . GLY A 1 102 ? 77.417 34.760 36.419 1.00 41.05 ? 189 GLY A O   1 
ATOM   818  N  N   . LYS A 1 103 ? 75.882 33.595 37.630 1.00 41.51 ? 190 LYS A N   1 
ATOM   819  C  CA  . LYS A 1 103 ? 76.214 34.201 38.951 1.00 44.88 ? 190 LYS A CA  1 
ATOM   820  C  C   . LYS A 1 103 ? 75.461 35.501 39.317 1.00 44.67 ? 190 LYS A C   1 
ATOM   821  O  O   . LYS A 1 103 ? 74.223 35.484 39.407 1.00 45.24 ? 190 LYS A O   1 
ATOM   822  C  CB  . LYS A 1 103 ? 77.744 34.384 39.125 1.00 46.79 ? 190 LYS A CB  1 
ATOM   823  C  CG  . LYS A 1 103 ? 78.590 33.106 38.946 1.00 48.53 ? 190 LYS A CG  1 
ATOM   824  C  CD  . LYS A 1 103 ? 78.245 32.012 39.995 1.00 50.51 ? 190 LYS A CD  1 
ATOM   825  C  CE  . LYS A 1 103 ? 78.607 32.446 41.427 1.00 51.30 ? 190 LYS A CE  1 
ATOM   826  N  NZ  . LYS A 1 103 ? 80.102 32.577 41.622 1.00 52.30 ? 190 LYS A NZ  1 
ATOM   827  N  N   . GLY A 1 104 A 76.201 36.606 39.507 1.00 44.97 ? 190 GLY A N   1 
ATOM   828  C  CA  . GLY A 1 104 A 75.646 37.911 39.899 1.00 44.32 ? 190 GLY A CA  1 
ATOM   829  C  C   . GLY A 1 104 A 74.163 38.117 39.644 1.00 43.44 ? 190 GLY A C   1 
ATOM   830  O  O   . GLY A 1 104 A 73.362 38.233 40.581 1.00 44.45 ? 190 GLY A O   1 
ATOM   831  N  N   . VAL A 1 105 ? 73.813 38.150 38.363 1.00 41.86 ? 191 VAL A N   1 
ATOM   832  C  CA  . VAL A 1 105 ? 72.434 38.306 37.913 1.00 40.64 ? 191 VAL A CA  1 
ATOM   833  C  C   . VAL A 1 105 ? 72.417 38.342 36.369 1.00 39.43 ? 191 VAL A C   1 
ATOM   834  O  O   . VAL A 1 105 ? 73.120 39.144 35.730 1.00 37.76 ? 191 VAL A O   1 
ATOM   835  C  CB  . VAL A 1 105 ? 71.725 39.564 38.530 1.00 41.50 ? 191 VAL A CB  1 
ATOM   836  C  CG1 . VAL A 1 105 ? 72.499 40.849 38.203 1.00 39.59 ? 191 VAL A CG1 1 
ATOM   837  C  CG2 . VAL A 1 105 ? 70.254 39.647 38.057 1.00 39.34 ? 191 VAL A CG2 1 
ATOM   838  N  N   . GLY A 1 106 ? 71.661 37.408 35.793 1.00 37.10 ? 192 GLY A N   1 
ATOM   839  C  CA  . GLY A 1 106 ? 71.543 37.322 34.357 1.00 33.62 ? 192 GLY A CA  1 
ATOM   840  C  C   . GLY A 1 106 ? 71.482 35.866 33.964 1.00 31.11 ? 192 GLY A C   1 
ATOM   841  O  O   . GLY A 1 106 ? 71.305 34.987 34.817 1.00 33.04 ? 192 GLY A O   1 
ATOM   842  N  N   . TYR A 1 107 ? 71.588 35.608 32.666 1.00 26.65 ? 193 TYR A N   1 
ATOM   843  C  CA  . TYR A 1 107 ? 71.560 34.249 32.169 1.00 21.14 ? 193 TYR A CA  1 
ATOM   844  C  C   . TYR A 1 107 ? 72.873 33.969 31.465 1.00 19.24 ? 193 TYR A C   1 
ATOM   845  O  O   . TYR A 1 107 ? 73.415 34.838 30.785 1.00 20.76 ? 193 TYR A O   1 
ATOM   846  C  CB  . TYR A 1 107 ? 70.383 34.068 31.217 1.00 19.23 ? 193 TYR A CB  1 
ATOM   847  C  CG  . TYR A 1 107 ? 69.040 34.169 31.900 1.00 18.06 ? 193 TYR A CG  1 
ATOM   848  C  CD1 . TYR A 1 107 ? 68.648 33.217 32.831 1.00 17.92 ? 193 TYR A CD1 1 
ATOM   849  C  CD2 . TYR A 1 107 ? 68.150 35.204 31.604 1.00 17.06 ? 193 TYR A CD2 1 
ATOM   850  C  CE1 . TYR A 1 107 ? 67.411 33.281 33.447 1.00 16.12 ? 193 TYR A CE1 1 
ATOM   851  C  CE2 . TYR A 1 107 ? 66.905 35.277 32.219 1.00 14.50 ? 193 TYR A CE2 1 
ATOM   852  C  CZ  . TYR A 1 107 ? 66.549 34.307 33.139 1.00 14.73 ? 193 TYR A CZ  1 
ATOM   853  O  OH  . TYR A 1 107 ? 65.336 34.350 33.775 1.00 18.16 ? 193 TYR A OH  1 
ATOM   854  N  N   . SER A 1 108 ? 73.405 32.771 31.667 1.00 16.62 ? 194 SER A N   1 
ATOM   855  C  CA  . SER A 1 108 ? 74.658 32.391 31.045 1.00 14.28 ? 194 SER A CA  1 
ATOM   856  C  C   . SER A 1 108 ? 74.514 32.183 29.548 1.00 14.88 ? 194 SER A C   1 
ATOM   857  O  O   . SER A 1 108 ? 73.826 31.271 29.099 1.00 17.68 ? 194 SER A O   1 
ATOM   858  C  CB  . SER A 1 108 ? 75.205 31.124 31.685 1.00 13.55 ? 194 SER A CB  1 
ATOM   859  O  OG  . SER A 1 108 ? 76.315 30.650 30.955 1.00 16.44 ? 194 SER A OG  1 
ATOM   860  N  N   . LEU A 1 109 ? 75.163 33.043 28.774 1.00 13.46 ? 195 LEU A N   1 
ATOM   861  C  CA  . LEU A 1 109 ? 75.131 32.937 27.330 1.00 10.50 ? 195 LEU A CA  1 
ATOM   862  C  C   . LEU A 1 109 ? 75.700 31.592 26.864 1.00 11.11 ? 195 LEU A C   1 
ATOM   863  O  O   . LEU A 1 109 ? 75.254 31.048 25.858 1.00 10.14 ? 195 LEU A O   1 
ATOM   864  C  CB  . LEU A 1 109 ? 75.917 34.089 26.712 1.00 10.86 ? 195 LEU A CB  1 
ATOM   865  C  CG  . LEU A 1 109 ? 75.895 34.165 25.188 1.00 11.50 ? 195 LEU A CG  1 
ATOM   866  C  CD1 . LEU A 1 109 ? 74.457 34.204 24.692 1.00 10.01 ? 195 LEU A CD1 1 
ATOM   867  C  CD2 . LEU A 1 109 ? 76.669 35.383 24.739 1.00 11.81 ? 195 LEU A CD2 1 
ATOM   868  N  N   . PHE A 1 110 ? 76.680 31.060 27.595 1.00 11.30 ? 196 PHE A N   1 
ATOM   869  C  CA  . PHE A 1 110 ? 77.290 29.776 27.251 1.00 10.00 ? 196 PHE A CA  1 
ATOM   870  C  C   . PHE A 1 110 ? 76.306 28.620 27.415 1.00 10.41 ? 196 PHE A C   1 
ATOM   871  O  O   . PHE A 1 110 ? 76.279 27.702 26.599 1.00 11.78 ? 196 PHE A O   1 
ATOM   872  C  CB  . PHE A 1 110 ? 78.534 29.526 28.104 1.00 7.07  ? 196 PHE A CB  1 
ATOM   873  C  CG  . PHE A 1 110 ? 78.998 28.096 28.096 1.00 7.25  ? 196 PHE A CG  1 
ATOM   874  C  CD1 . PHE A 1 110 ? 79.336 27.465 26.910 1.00 7.96  ? 196 PHE A CD1 1 
ATOM   875  C  CD2 . PHE A 1 110 ? 79.045 27.364 29.272 1.00 4.82  ? 196 PHE A CD2 1 
ATOM   876  C  CE1 . PHE A 1 110 ? 79.709 26.125 26.904 1.00 7.14  ? 196 PHE A CE1 1 
ATOM   877  C  CE2 . PHE A 1 110 ? 79.418 26.024 29.270 1.00 2.00  ? 196 PHE A CE2 1 
ATOM   878  C  CZ  . PHE A 1 110 ? 79.745 25.408 28.093 1.00 2.08  ? 196 PHE A CZ  1 
ATOM   879  N  N   . LEU A 1 111 ? 75.501 28.679 28.474 1.00 10.37 ? 197 LEU A N   1 
ATOM   880  C  CA  . LEU A 1 111 ? 74.515 27.648 28.765 1.00 11.59 ? 197 LEU A CA  1 
ATOM   881  C  C   . LEU A 1 111 ? 73.331 27.665 27.789 1.00 13.35 ? 197 LEU A C   1 
ATOM   882  O  O   . LEU A 1 111 ? 72.966 26.635 27.237 1.00 15.76 ? 197 LEU A O   1 
ATOM   883  C  CB  . LEU A 1 111 ? 74.034 27.795 30.211 1.00 12.24 ? 197 LEU A CB  1 
ATOM   884  C  CG  . LEU A 1 111 ? 74.360 26.700 31.239 1.00 12.35 ? 197 LEU A CG  1 
ATOM   885  C  CD1 . LEU A 1 111 ? 75.743 26.148 31.030 1.00 12.29 ? 197 LEU A CD1 1 
ATOM   886  C  CD2 . LEU A 1 111 ? 74.204 27.237 32.651 1.00 9.48  ? 197 LEU A CD2 1 
ATOM   887  N  N   . VAL A 1 112 ? 72.743 28.832 27.560 1.00 12.19 ? 198 VAL A N   1 
ATOM   888  C  CA  . VAL A 1 112 ? 71.616 28.950 26.637 1.00 11.63 ? 198 VAL A CA  1 
ATOM   889  C  C   . VAL A 1 112 ? 72.025 28.622 25.185 1.00 12.46 ? 198 VAL A C   1 
ATOM   890  O  O   . VAL A 1 112 ? 71.248 28.044 24.424 1.00 13.36 ? 198 VAL A O   1 
ATOM   891  C  CB  . VAL A 1 112 ? 70.979 30.369 26.738 1.00 10.66 ? 198 VAL A CB  1 
ATOM   892  C  CG1 . VAL A 1 112 ? 69.789 30.527 25.791 1.00 6.19  ? 198 VAL A CG1 1 
ATOM   893  C  CG2 . VAL A 1 112 ? 70.554 30.623 28.165 1.00 10.50 ? 198 VAL A CG2 1 
ATOM   894  N  N   . ALA A 1 113 ? 73.250 28.973 24.809 1.00 12.10 ? 199 ALA A N   1 
ATOM   895  C  CA  . ALA A 1 113 ? 73.744 28.699 23.455 1.00 12.22 ? 199 ALA A CA  1 
ATOM   896  C  C   . ALA A 1 113 ? 73.974 27.203 23.212 1.00 11.08 ? 199 ALA A C   1 
ATOM   897  O  O   . ALA A 1 113 ? 73.679 26.691 22.126 1.00 4.42  ? 199 ALA A O   1 
ATOM   898  C  CB  . ALA A 1 113 ? 75.039 29.482 23.180 1.00 11.13 ? 199 ALA A CB  1 
ATOM   899  N  N   . ALA A 1 114 ? 74.516 26.508 24.213 1.00 10.32 ? 200 ALA A N   1 
ATOM   900  C  CA  . ALA A 1 114 ? 74.764 25.080 24.074 1.00 12.74 ? 200 ALA A CA  1 
ATOM   901  C  C   . ALA A 1 114 ? 73.432 24.362 23.799 1.00 13.69 ? 200 ALA A C   1 
ATOM   902  O  O   . ALA A 1 114 ? 73.358 23.443 22.968 1.00 14.28 ? 200 ALA A O   1 
ATOM   903  C  CB  . ALA A 1 114 ? 75.438 24.538 25.322 1.00 11.47 ? 200 ALA A CB  1 
ATOM   904  N  N   . HIS A 1 115 ? 72.373 24.857 24.443 1.00 12.46 ? 201 HIS A N   1 
ATOM   905  C  CA  . HIS A 1 115 ? 71.026 24.327 24.298 1.00 9.71  ? 201 HIS A CA  1 
ATOM   906  C  C   . HIS A 1 115 ? 70.411 24.623 22.925 1.00 9.44  ? 201 HIS A C   1 
ATOM   907  O  O   . HIS A 1 115 ? 69.805 23.752 22.316 1.00 9.46  ? 201 HIS A O   1 
ATOM   908  C  CB  . HIS A 1 115 ? 70.148 24.885 25.416 1.00 9.04  ? 201 HIS A CB  1 
ATOM   909  C  CG  . HIS A 1 115 ? 68.710 24.492 25.317 1.00 9.69  ? 201 HIS A CG  1 
ATOM   910  N  ND1 . HIS A 1 115 ? 68.186 23.332 25.839 1.00 9.02  ? 201 HIS A ND1 1 
ATOM   911  C  CD2 . HIS A 1 115 ? 67.662 25.147 24.762 1.00 10.27 ? 201 HIS A CD2 1 
ATOM   912  C  CE1 . HIS A 1 115 ? 66.877 23.329 25.594 1.00 8.04  ? 201 HIS A CE1 1 
ATOM   913  N  NE2 . HIS A 1 115 ? 66.520 24.412 24.943 1.00 8.73  ? 201 HIS A NE2 1 
ATOM   914  N  N   . GLU A 1 116 ? 70.558 25.845 22.432 1.00 10.10 ? 202 GLU A N   1 
ATOM   915  C  CA  . GLU A 1 116 ? 69.999 26.169 21.125 1.00 10.71 ? 202 GLU A CA  1 
ATOM   916  C  C   . GLU A 1 116 ? 70.728 25.421 19.993 1.00 12.35 ? 202 GLU A C   1 
ATOM   917  O  O   . GLU A 1 116 ? 70.101 24.966 19.034 1.00 13.57 ? 202 GLU A O   1 
ATOM   918  C  CB  . GLU A 1 116 ? 70.015 27.682 20.883 1.00 8.93  ? 202 GLU A CB  1 
ATOM   919  C  CG  . GLU A 1 116 ? 69.371 28.505 21.999 1.00 11.49 ? 202 GLU A CG  1 
ATOM   920  C  CD  . GLU A 1 116 ? 67.922 28.104 22.332 1.00 16.45 ? 202 GLU A CD  1 
ATOM   921  O  OE1 . GLU A 1 116 ? 67.179 27.644 21.434 1.00 16.36 ? 202 GLU A OE1 1 
ATOM   922  O  OE2 . GLU A 1 116 ? 67.514 28.260 23.508 1.00 14.98 ? 202 GLU A OE2 1 
ATOM   923  N  N   . PHE A 1 117 ? 72.044 25.246 20.130 1.00 12.57 ? 203 PHE A N   1 
ATOM   924  C  CA  . PHE A 1 117 ? 72.830 24.551 19.110 1.00 11.72 ? 203 PHE A CA  1 
ATOM   925  C  C   . PHE A 1 117 ? 72.461 23.076 19.010 1.00 12.83 ? 203 PHE A C   1 
ATOM   926  O  O   . PHE A 1 117 ? 72.738 22.432 18.002 1.00 13.10 ? 203 PHE A O   1 
ATOM   927  C  CB  . PHE A 1 117 ? 74.334 24.729 19.337 1.00 10.65 ? 203 PHE A CB  1 
ATOM   928  C  CG  . PHE A 1 117 ? 74.804 26.156 19.227 1.00 9.39  ? 203 PHE A CG  1 
ATOM   929  C  CD1 . PHE A 1 117 ? 74.041 27.114 18.556 1.00 10.36 ? 203 PHE A CD1 1 
ATOM   930  C  CD2 . PHE A 1 117 ? 75.993 26.554 19.821 1.00 9.34  ? 203 PHE A CD2 1 
ATOM   931  C  CE1 . PHE A 1 117 ? 74.453 28.446 18.486 1.00 7.90  ? 203 PHE A CE1 1 
ATOM   932  C  CE2 . PHE A 1 117 ? 76.416 27.886 19.756 1.00 10.83 ? 203 PHE A CE2 1 
ATOM   933  C  CZ  . PHE A 1 117 ? 75.642 28.833 19.087 1.00 8.28  ? 203 PHE A CZ  1 
ATOM   934  N  N   . GLY A 1 118 ? 71.845 22.538 20.061 1.00 13.64 ? 204 GLY A N   1 
ATOM   935  C  CA  . GLY A 1 118 ? 71.393 21.156 20.018 1.00 11.94 ? 204 GLY A CA  1 
ATOM   936  C  C   . GLY A 1 118 ? 70.213 21.098 19.060 1.00 11.36 ? 204 GLY A C   1 
ATOM   937  O  O   . GLY A 1 118 ? 70.019 20.123 18.354 1.00 8.36  ? 204 GLY A O   1 
ATOM   938  N  N   . HIS A 1 119 ? 69.440 22.177 19.016 1.00 13.42 ? 205 HIS A N   1 
ATOM   939  C  CA  . HIS A 1 119 ? 68.297 22.276 18.126 1.00 13.54 ? 205 HIS A CA  1 
ATOM   940  C  C   . HIS A 1 119 ? 68.762 22.369 16.685 1.00 15.54 ? 205 HIS A C   1 
ATOM   941  O  O   . HIS A 1 119 ? 68.278 21.635 15.818 1.00 17.26 ? 205 HIS A O   1 
ATOM   942  C  CB  . HIS A 1 119 ? 67.466 23.506 18.475 1.00 13.08 ? 205 HIS A CB  1 
ATOM   943  C  CG  . HIS A 1 119 ? 66.547 23.299 19.636 1.00 15.66 ? 205 HIS A CG  1 
ATOM   944  N  ND1 . HIS A 1 119 ? 65.503 22.398 19.637 1.00 16.06 ? 205 HIS A ND1 1 
ATOM   945  C  CD2 . HIS A 1 119 ? 66.526 23.895 20.855 1.00 16.39 ? 205 HIS A CD2 1 
ATOM   946  C  CE1 . HIS A 1 119 ? 64.892 22.464 20.824 1.00 13.44 ? 205 HIS A CE1 1 
ATOM   947  N  NE2 . HIS A 1 119 ? 65.479 23.356 21.591 1.00 14.72 ? 205 HIS A NE2 1 
ATOM   948  N  N   . ALA A 1 120 ? 69.703 23.276 16.435 1.00 16.51 ? 206 ALA A N   1 
ATOM   949  C  CA  . ALA A 1 120 ? 70.252 23.478 15.093 1.00 16.76 ? 206 ALA A CA  1 
ATOM   950  C  C   . ALA A 1 120 ? 70.885 22.220 14.480 1.00 14.83 ? 206 ALA A C   1 
ATOM   951  O  O   . ALA A 1 120 ? 71.063 22.148 13.261 1.00 14.17 ? 206 ALA A O   1 
ATOM   952  C  CB  . ALA A 1 120 ? 71.247 24.628 15.098 1.00 16.44 ? 206 ALA A CB  1 
ATOM   953  N  N   . MET A 1 121 ? 71.221 21.243 15.325 1.00 14.12 ? 207 MET A N   1 
ATOM   954  C  CA  . MET A 1 121 ? 71.808 19.982 14.862 1.00 13.84 ? 207 MET A CA  1 
ATOM   955  C  C   . MET A 1 121 ? 70.725 18.947 14.587 1.00 13.18 ? 207 MET A C   1 
ATOM   956  O  O   . MET A 1 121 ? 70.964 17.960 13.902 1.00 13.02 ? 207 MET A O   1 
ATOM   957  C  CB  . MET A 1 121 ? 72.814 19.438 15.878 1.00 13.00 ? 207 MET A CB  1 
ATOM   958  C  CG  . MET A 1 121 ? 74.266 19.674 15.494 1.00 16.52 ? 207 MET A CG  1 
ATOM   959  S  SD  . MET A 1 121 ? 74.578 21.370 14.928 1.00 19.83 ? 207 MET A SD  1 
ATOM   960  C  CE  . MET A 1 121 ? 75.228 21.052 13.303 1.00 20.88 ? 207 MET A CE  1 
ATOM   961  N  N   . GLY A 1 122 ? 69.534 19.180 15.130 1.00 13.72 ? 208 GLY A N   1 
ATOM   962  C  CA  . GLY A 1 122 ? 68.436 18.268 14.904 1.00 14.92 ? 208 GLY A CA  1 
ATOM   963  C  C   . GLY A 1 122 ? 67.810 17.637 16.130 1.00 17.15 ? 208 GLY A C   1 
ATOM   964  O  O   . GLY A 1 122 ? 67.009 16.715 15.970 1.00 20.24 ? 208 GLY A O   1 
ATOM   965  N  N   . LEU A 1 123 ? 68.149 18.109 17.336 1.00 16.14 ? 209 LEU A N   1 
ATOM   966  C  CA  . LEU A 1 123 ? 67.590 17.550 18.575 1.00 15.34 ? 209 LEU A CA  1 
ATOM   967  C  C   . LEU A 1 123 ? 66.315 18.240 19.064 1.00 17.24 ? 209 LEU A C   1 
ATOM   968  O  O   . LEU A 1 123 ? 66.126 19.437 18.858 1.00 19.03 ? 209 LEU A O   1 
ATOM   969  C  CB  . LEU A 1 123 ? 68.617 17.603 19.710 1.00 13.85 ? 209 LEU A CB  1 
ATOM   970  C  CG  . LEU A 1 123 ? 69.891 16.756 19.671 1.00 15.00 ? 209 LEU A CG  1 
ATOM   971  C  CD1 . LEU A 1 123 ? 70.751 17.068 20.874 1.00 12.34 ? 209 LEU A CD1 1 
ATOM   972  C  CD2 . LEU A 1 123 ? 69.545 15.295 19.639 1.00 15.20 ? 209 LEU A CD2 1 
ATOM   973  N  N   . GLU A 1 124 ? 65.442 17.469 19.711 1.00 19.65 ? 210 GLU A N   1 
ATOM   974  C  CA  . GLU A 1 124 ? 64.199 17.984 20.279 1.00 20.98 ? 210 GLU A CA  1 
ATOM   975  C  C   . GLU A 1 124 ? 64.350 18.016 21.804 1.00 20.34 ? 210 GLU A C   1 
ATOM   976  O  O   . GLU A 1 124 ? 65.436 17.768 22.323 1.00 18.79 ? 210 GLU A O   1 
ATOM   977  C  CB  . GLU A 1 124 ? 63.013 17.096 19.887 1.00 26.00 ? 210 GLU A CB  1 
ATOM   978  C  CG  . GLU A 1 124 ? 62.568 17.208 18.423 1.00 35.40 ? 210 GLU A CG  1 
ATOM   979  C  CD  . GLU A 1 124 ? 62.263 18.655 17.997 1.00 42.30 ? 210 GLU A CD  1 
ATOM   980  O  OE1 . GLU A 1 124 ? 61.893 19.484 18.880 1.00 44.88 ? 210 GLU A OE1 1 
ATOM   981  O  OE2 . GLU A 1 124 ? 62.411 18.967 16.779 1.00 44.80 ? 210 GLU A OE2 1 
ATOM   982  N  N   . HIS A 1 125 ? 63.274 18.324 22.525 1.00 21.14 ? 211 HIS A N   1 
ATOM   983  C  CA  . HIS A 1 125 ? 63.350 18.375 23.981 1.00 21.56 ? 211 HIS A CA  1 
ATOM   984  C  C   . HIS A 1 125 ? 63.387 17.004 24.617 1.00 21.50 ? 211 HIS A C   1 
ATOM   985  O  O   . HIS A 1 125 ? 62.962 16.021 24.011 1.00 21.28 ? 211 HIS A O   1 
ATOM   986  C  CB  . HIS A 1 125 ? 62.222 19.218 24.557 1.00 22.32 ? 211 HIS A CB  1 
ATOM   987  C  CG  . HIS A 1 125 ? 62.449 20.688 24.414 1.00 24.02 ? 211 HIS A CG  1 
ATOM   988  N  ND1 . HIS A 1 125 ? 61.440 21.620 24.296 1.00 26.02 ? 211 HIS A ND1 1 
ATOM   989  C  CD2 . HIS A 1 125 ? 63.609 21.391 24.372 1.00 23.64 ? 211 HIS A CD2 1 
ATOM   990  C  CE1 . HIS A 1 125 ? 62.003 22.837 24.192 1.00 22.63 ? 211 HIS A CE1 1 
ATOM   991  N  NE2 . HIS A 1 125 ? 63.314 22.745 24.234 1.00 24.69 ? 211 HIS A NE2 1 
ATOM   992  N  N   . SER A 1 126 ? 63.926 16.949 25.832 1.00 21.51 ? 212 SER A N   1 
ATOM   993  C  CA  . SER A 1 126 ? 64.070 15.704 26.572 1.00 21.60 ? 212 SER A CA  1 
ATOM   994  C  C   . SER A 1 126 ? 63.251 15.707 27.847 1.00 22.34 ? 212 SER A C   1 
ATOM   995  O  O   . SER A 1 126 ? 63.148 16.736 28.530 1.00 21.26 ? 212 SER A O   1 
ATOM   996  C  CB  . SER A 1 126 ? 65.548 15.471 26.922 1.00 22.38 ? 212 SER A CB  1 
ATOM   997  O  OG  . SER A 1 126 ? 65.719 14.478 27.929 1.00 19.24 ? 212 SER A OG  1 
ATOM   998  N  N   . GLN A 1 127 ? 62.699 14.538 28.171 1.00 22.65 ? 213 GLN A N   1 
ATOM   999  C  CA  . GLN A 1 127 ? 61.901 14.354 29.383 1.00 25.07 ? 213 GLN A CA  1 
ATOM   1000 C  C   . GLN A 1 127 ? 62.823 14.243 30.621 1.00 25.26 ? 213 GLN A C   1 
ATOM   1001 O  O   . GLN A 1 127 ? 62.349 14.324 31.752 1.00 27.30 ? 213 GLN A O   1 
ATOM   1002 C  CB  . GLN A 1 127 ? 61.051 13.081 29.279 1.00 28.04 ? 213 GLN A CB  1 
ATOM   1003 C  CG  . GLN A 1 127 ? 60.283 12.893 27.974 1.00 33.73 ? 213 GLN A CG  1 
ATOM   1004 C  CD  . GLN A 1 127 ? 59.168 13.906 27.774 1.00 37.14 ? 213 GLN A CD  1 
ATOM   1005 O  OE1 . GLN A 1 127 ? 59.094 14.569 26.725 1.00 39.56 ? 213 GLN A OE1 1 
ATOM   1006 N  NE2 . GLN A 1 127 ? 58.286 14.032 28.770 1.00 38.73 ? 213 GLN A NE2 1 
ATOM   1007 N  N   . ASP A 1 128 ? 64.119 14.015 30.404 1.00 24.11 ? 214 ASP A N   1 
ATOM   1008 C  CA  . ASP A 1 128 ? 65.100 13.903 31.490 1.00 24.97 ? 214 ASP A CA  1 
ATOM   1009 C  C   . ASP A 1 128 ? 65.326 15.301 32.119 1.00 24.38 ? 214 ASP A C   1 
ATOM   1010 O  O   . ASP A 1 128 ? 65.797 16.217 31.446 1.00 25.34 ? 214 ASP A O   1 
ATOM   1011 C  CB  . ASP A 1 128 ? 66.415 13.338 30.913 1.00 27.03 ? 214 ASP A CB  1 
ATOM   1012 C  CG  . ASP A 1 128 ? 67.387 12.819 31.989 1.00 29.30 ? 214 ASP A CG  1 
ATOM   1013 O  OD1 . ASP A 1 128 ? 67.375 13.326 33.140 1.00 28.79 ? 214 ASP A OD1 1 
ATOM   1014 O  OD2 . ASP A 1 128 ? 68.201 11.913 31.650 1.00 28.96 ? 214 ASP A OD2 1 
ATOM   1015 N  N   . PRO A 1 129 ? 64.966 15.479 33.408 1.00 22.93 ? 215 PRO A N   1 
ATOM   1016 C  CA  . PRO A 1 129 ? 65.106 16.732 34.165 1.00 20.33 ? 215 PRO A CA  1 
ATOM   1017 C  C   . PRO A 1 129 ? 66.539 17.239 34.226 1.00 18.61 ? 215 PRO A C   1 
ATOM   1018 O  O   . PRO A 1 129 ? 66.787 18.450 34.294 1.00 17.28 ? 215 PRO A O   1 
ATOM   1019 C  CB  . PRO A 1 129 ? 64.621 16.342 35.559 1.00 20.31 ? 215 PRO A CB  1 
ATOM   1020 C  CG  . PRO A 1 129 ? 63.637 15.273 35.292 1.00 22.24 ? 215 PRO A CG  1 
ATOM   1021 C  CD  . PRO A 1 129 ? 64.339 14.443 34.250 1.00 23.58 ? 215 PRO A CD  1 
ATOM   1022 N  N   . GLY A 1 130 ? 67.482 16.304 34.197 1.00 15.81 ? 216 GLY A N   1 
ATOM   1023 C  CA  . GLY A 1 130 ? 68.881 16.679 34.259 1.00 15.04 ? 216 GLY A CA  1 
ATOM   1024 C  C   . GLY A 1 130 ? 69.545 16.953 32.922 1.00 14.10 ? 216 GLY A C   1 
ATOM   1025 O  O   . GLY A 1 130 ? 70.720 17.323 32.881 1.00 14.42 ? 216 GLY A O   1 
ATOM   1026 N  N   . ALA A 1 131 ? 68.803 16.790 31.831 1.00 12.09 ? 217 ALA A N   1 
ATOM   1027 C  CA  . ALA A 1 131 ? 69.357 16.996 30.498 1.00 12.48 ? 217 ALA A CA  1 
ATOM   1028 C  C   . ALA A 1 131 ? 69.513 18.448 30.068 1.00 13.03 ? 217 ALA A C   1 
ATOM   1029 O  O   . ALA A 1 131 ? 68.757 19.319 30.494 1.00 12.79 ? 217 ALA A O   1 
ATOM   1030 C  CB  . ALA A 1 131 ? 68.527 16.239 29.468 1.00 11.42 ? 217 ALA A CB  1 
ATOM   1031 N  N   . LEU A 1 132 ? 70.514 18.690 29.221 1.00 14.45 ? 218 LEU A N   1 
ATOM   1032 C  CA  . LEU A 1 132 ? 70.777 20.013 28.663 1.00 14.00 ? 218 LEU A CA  1 
ATOM   1033 C  C   . LEU A 1 132 ? 69.584 20.402 27.787 1.00 14.63 ? 218 LEU A C   1 
ATOM   1034 O  O   . LEU A 1 132 ? 69.248 21.576 27.676 1.00 13.91 ? 218 LEU A O   1 
ATOM   1035 C  CB  . LEU A 1 132 ? 72.048 20.009 27.796 1.00 12.59 ? 218 LEU A CB  1 
ATOM   1036 C  CG  . LEU A 1 132 ? 72.342 21.346 27.088 1.00 11.91 ? 218 LEU A CG  1 
ATOM   1037 C  CD1 . LEU A 1 132 ? 72.773 22.360 28.116 1.00 10.21 ? 218 LEU A CD1 1 
ATOM   1038 C  CD2 . LEU A 1 132 ? 73.405 21.219 26.017 1.00 6.94  ? 218 LEU A CD2 1 
ATOM   1039 N  N   . MET A 1 133 ? 68.955 19.399 27.169 1.00 15.34 ? 219 MET A N   1 
ATOM   1040 C  CA  . MET A 1 133 ? 67.803 19.624 26.303 1.00 14.74 ? 219 MET A CA  1 
ATOM   1041 C  C   . MET A 1 133 ? 66.453 19.770 26.997 1.00 15.41 ? 219 MET A C   1 
ATOM   1042 O  O   . MET A 1 133 ? 65.418 19.809 26.323 1.00 17.17 ? 219 MET A O   1 
ATOM   1043 C  CB  . MET A 1 133 ? 67.717 18.560 25.204 1.00 13.48 ? 219 MET A CB  1 
ATOM   1044 C  CG  . MET A 1 133 ? 68.835 18.625 24.178 1.00 14.12 ? 219 MET A CG  1 
ATOM   1045 S  SD  . MET A 1 133 ? 69.143 20.294 23.537 1.00 14.26 ? 219 MET A SD  1 
ATOM   1046 C  CE  . MET A 1 133 ? 67.599 20.662 22.750 1.00 13.86 ? 219 MET A CE  1 
ATOM   1047 N  N   . ALA A 1 134 ? 66.452 19.834 28.331 1.00 15.22 ? 220 ALA A N   1 
ATOM   1048 C  CA  . ALA A 1 134 ? 65.213 20.021 29.092 1.00 14.26 ? 220 ALA A CA  1 
ATOM   1049 C  C   . ALA A 1 134 ? 64.678 21.411 28.700 1.00 15.29 ? 220 ALA A C   1 
ATOM   1050 O  O   . ALA A 1 134 ? 65.455 22.304 28.351 1.00 15.73 ? 220 ALA A O   1 
ATOM   1051 C  CB  . ALA A 1 134 ? 65.496 19.951 30.571 1.00 10.50 ? 220 ALA A CB  1 
ATOM   1052 N  N   . PRO A 1 135 ? 63.352 21.626 28.767 1.00 16.47 ? 221 PRO A N   1 
ATOM   1053 C  CA  . PRO A 1 135 ? 62.789 22.933 28.388 1.00 15.84 ? 221 PRO A CA  1 
ATOM   1054 C  C   . PRO A 1 135 ? 63.047 24.124 29.324 1.00 16.48 ? 221 PRO A C   1 
ATOM   1055 O  O   . PRO A 1 135 ? 62.911 25.267 28.905 1.00 15.96 ? 221 PRO A O   1 
ATOM   1056 C  CB  . PRO A 1 135 ? 61.284 22.650 28.289 1.00 16.07 ? 221 PRO A CB  1 
ATOM   1057 C  CG  . PRO A 1 135 ? 61.148 21.135 28.381 1.00 14.75 ? 221 PRO A CG  1 
ATOM   1058 C  CD  . PRO A 1 135 ? 62.292 20.723 29.241 1.00 14.33 ? 221 PRO A CD  1 
ATOM   1059 N  N   . ILE A 1 136 ? 63.393 23.850 30.582 1.00 16.98 ? 222 ILE A N   1 
ATOM   1060 C  CA  . ILE A 1 136 ? 63.639 24.887 31.590 1.00 18.31 ? 222 ILE A CA  1 
ATOM   1061 C  C   . ILE A 1 136 ? 65.120 25.228 31.776 1.00 19.09 ? 222 ILE A C   1 
ATOM   1062 O  O   . ILE A 1 136 ? 65.976 24.361 31.657 1.00 21.84 ? 222 ILE A O   1 
ATOM   1063 C  CB  . ILE A 1 136 ? 63.080 24.449 32.971 1.00 19.47 ? 222 ILE A CB  1 
ATOM   1064 C  CG1 . ILE A 1 136 ? 61.576 24.166 32.875 1.00 18.38 ? 222 ILE A CG1 1 
ATOM   1065 C  CG2 . ILE A 1 136 ? 63.349 25.512 34.028 1.00 19.55 ? 222 ILE A CG2 1 
ATOM   1066 C  CD1 . ILE A 1 136 ? 60.753 25.337 32.417 1.00 17.39 ? 222 ILE A CD1 1 
ATOM   1067 N  N   . TYR A 1 137 ? 65.410 26.488 32.092 1.00 18.86 ? 223 TYR A N   1 
ATOM   1068 C  CA  . TYR A 1 137 ? 66.783 26.938 32.315 1.00 18.85 ? 223 TYR A CA  1 
ATOM   1069 C  C   . TYR A 1 137 ? 67.154 26.796 33.784 1.00 18.31 ? 223 TYR A C   1 
ATOM   1070 O  O   . TYR A 1 137 ? 66.390 27.177 34.662 1.00 18.35 ? 223 TYR A O   1 
ATOM   1071 C  CB  . TYR A 1 137 ? 66.968 28.405 31.879 1.00 20.63 ? 223 TYR A CB  1 
ATOM   1072 C  CG  . TYR A 1 137 ? 68.315 29.020 32.279 1.00 20.47 ? 223 TYR A CG  1 
ATOM   1073 C  CD1 . TYR A 1 137 ? 69.433 28.892 31.453 1.00 19.65 ? 223 TYR A CD1 1 
ATOM   1074 C  CD2 . TYR A 1 137 ? 68.472 29.701 33.499 1.00 17.76 ? 223 TYR A CD2 1 
ATOM   1075 C  CE1 . TYR A 1 137 ? 70.678 29.417 31.831 1.00 19.30 ? 223 TYR A CE1 1 
ATOM   1076 C  CE2 . TYR A 1 137 ? 69.707 30.228 33.884 1.00 15.83 ? 223 TYR A CE2 1 
ATOM   1077 C  CZ  . TYR A 1 137 ? 70.808 30.080 33.047 1.00 18.37 ? 223 TYR A CZ  1 
ATOM   1078 O  OH  . TYR A 1 137 ? 72.043 30.561 33.426 1.00 15.58 ? 223 TYR A OH  1 
ATOM   1079 N  N   . THR A 1 138 ? 68.345 26.262 34.031 1.00 20.02 ? 227 THR A N   1 
ATOM   1080 C  CA  . THR A 1 138 ? 68.859 26.063 35.382 1.00 20.89 ? 227 THR A CA  1 
ATOM   1081 C  C   . THR A 1 138 ? 70.358 26.327 35.353 1.00 22.38 ? 227 THR A C   1 
ATOM   1082 O  O   . THR A 1 138 ? 71.075 25.793 34.500 1.00 23.88 ? 227 THR A O   1 
ATOM   1083 C  CB  . THR A 1 138 ? 68.669 24.609 35.868 1.00 19.01 ? 227 THR A CB  1 
ATOM   1084 O  OG1 . THR A 1 138 ? 67.299 24.223 35.711 1.00 16.90 ? 227 THR A OG1 1 
ATOM   1085 C  CG2 . THR A 1 138 ? 69.068 24.489 37.346 1.00 17.49 ? 227 THR A CG2 1 
ATOM   1086 N  N   . TYR A 1 139 ? 70.844 27.142 36.279 1.00 21.95 ? 228 TYR A N   1 
ATOM   1087 C  CA  . TYR A 1 139 ? 72.265 27.416 36.296 1.00 22.97 ? 228 TYR A CA  1 
ATOM   1088 C  C   . TYR A 1 139 ? 73.065 26.401 37.126 1.00 24.77 ? 228 TYR A C   1 
ATOM   1089 O  O   . TYR A 1 139 ? 72.624 25.945 38.185 1.00 26.82 ? 228 TYR A O   1 
ATOM   1090 C  CB  . TYR A 1 139 ? 72.542 28.834 36.788 1.00 20.21 ? 228 TYR A CB  1 
ATOM   1091 C  CG  . TYR A 1 139 ? 74.020 29.128 36.890 1.00 19.95 ? 228 TYR A CG  1 
ATOM   1092 C  CD1 . TYR A 1 139 ? 74.797 29.311 35.744 1.00 18.92 ? 228 TYR A CD1 1 
ATOM   1093 C  CD2 . TYR A 1 139 ? 74.651 29.179 38.128 1.00 17.34 ? 228 TYR A CD2 1 
ATOM   1094 C  CE1 . TYR A 1 139 ? 76.165 29.537 35.833 1.00 17.26 ? 228 TYR A CE1 1 
ATOM   1095 C  CE2 . TYR A 1 139 ? 76.013 29.402 38.225 1.00 17.08 ? 228 TYR A CE2 1 
ATOM   1096 C  CZ  . TYR A 1 139 ? 76.765 29.581 37.082 1.00 17.98 ? 228 TYR A CZ  1 
ATOM   1097 O  OH  . TYR A 1 139 ? 78.115 29.813 37.198 1.00 18.56 ? 228 TYR A OH  1 
ATOM   1098 N  N   . THR A 1 140 ? 74.225 26.021 36.601 1.00 25.31 ? 229 THR A N   1 
ATOM   1099 C  CA  . THR A 1 140 ? 75.143 25.097 37.276 1.00 27.46 ? 229 THR A CA  1 
ATOM   1100 C  C   . THR A 1 140 ? 76.545 25.607 36.973 1.00 27.71 ? 229 THR A C   1 
ATOM   1101 O  O   . THR A 1 140 ? 76.837 25.972 35.828 1.00 27.65 ? 229 THR A O   1 
ATOM   1102 C  CB  . THR A 1 140 ? 75.000 23.623 36.780 1.00 27.47 ? 229 THR A CB  1 
ATOM   1103 O  OG1 . THR A 1 140 ? 75.073 23.584 35.353 1.00 23.81 ? 229 THR A OG1 1 
ATOM   1104 C  CG2 . THR A 1 140 ? 73.669 23.007 37.255 1.00 27.60 ? 229 THR A CG2 1 
ATOM   1105 N  N   . LYS A 1 141 ? 77.403 25.643 37.991 1.00 29.20 ? 230 LYS A N   1 
ATOM   1106 C  CA  . LYS A 1 141 ? 78.760 26.143 37.803 1.00 30.14 ? 230 LYS A CA  1 
ATOM   1107 C  C   . LYS A 1 141 ? 79.655 25.165 37.041 1.00 30.18 ? 230 LYS A C   1 
ATOM   1108 O  O   . LYS A 1 141 ? 80.382 25.577 36.139 1.00 30.61 ? 230 LYS A O   1 
ATOM   1109 C  CB  . LYS A 1 141 ? 79.389 26.534 39.150 1.00 32.41 ? 230 LYS A CB  1 
ATOM   1110 C  CG  . LYS A 1 141 ? 80.665 27.402 39.052 1.00 34.38 ? 230 LYS A CG  1 
ATOM   1111 C  CD  . LYS A 1 141 ? 81.352 27.532 40.431 1.00 37.89 ? 230 LYS A CD  1 
ATOM   1112 C  CE  . LYS A 1 141 ? 82.708 28.280 40.355 1.00 40.10 ? 230 LYS A CE  1 
ATOM   1113 N  NZ  . LYS A 1 141 ? 83.604 28.125 41.582 1.00 35.45 ? 230 LYS A NZ  1 
ATOM   1114 N  N   . ASN A 1 142 ? 79.584 23.876 37.365 1.00 28.98 ? 231 ASN A N   1 
ATOM   1115 C  CA  . ASN A 1 142 ? 80.416 22.908 36.661 1.00 27.29 ? 231 ASN A CA  1 
ATOM   1116 C  C   . ASN A 1 142 ? 79.585 22.074 35.690 1.00 25.66 ? 231 ASN A C   1 
ATOM   1117 O  O   . ASN A 1 142 ? 79.077 21.004 36.050 1.00 24.43 ? 231 ASN A O   1 
ATOM   1118 C  CB  . ASN A 1 142 ? 81.136 22.012 37.666 1.00 29.03 ? 231 ASN A CB  1 
ATOM   1119 C  CG  . ASN A 1 142 ? 82.134 22.778 38.514 1.00 28.60 ? 231 ASN A CG  1 
ATOM   1120 O  OD1 . ASN A 1 142 ? 83.072 23.369 38.000 1.00 27.53 ? 231 ASN A OD1 1 
ATOM   1121 N  ND2 . ASN A 1 142 ? 81.937 22.749 39.831 1.00 30.50 ? 231 ASN A ND2 1 
ATOM   1122 N  N   . PHE A 1 143 ? 79.504 22.536 34.447 1.00 24.08 ? 232 PHE A N   1 
ATOM   1123 C  CA  . PHE A 1 143 ? 78.725 21.859 33.418 1.00 24.46 ? 232 PHE A CA  1 
ATOM   1124 C  C   . PHE A 1 143 ? 79.321 20.575 32.842 1.00 24.30 ? 232 PHE A C   1 
ATOM   1125 O  O   . PHE A 1 143 ? 80.537 20.466 32.635 1.00 23.26 ? 232 PHE A O   1 
ATOM   1126 C  CB  . PHE A 1 143 ? 78.401 22.831 32.278 1.00 23.92 ? 232 PHE A CB  1 
ATOM   1127 C  CG  . PHE A 1 143 ? 77.652 22.198 31.142 1.00 23.09 ? 232 PHE A CG  1 
ATOM   1128 C  CD1 . PHE A 1 143 ? 76.296 21.915 31.269 1.00 21.82 ? 232 PHE A CD1 1 
ATOM   1129 C  CD2 . PHE A 1 143 ? 78.309 21.828 29.974 1.00 21.37 ? 232 PHE A CD2 1 
ATOM   1130 C  CE1 . PHE A 1 143 ? 75.608 21.256 30.255 1.00 22.39 ? 232 PHE A CE1 1 
ATOM   1131 C  CE2 . PHE A 1 143 ? 77.638 21.170 28.949 1.00 20.67 ? 232 PHE A CE2 1 
ATOM   1132 C  CZ  . PHE A 1 143 ? 76.275 20.882 29.089 1.00 21.39 ? 232 PHE A CZ  1 
ATOM   1133 N  N   . ARG A 1 144 ? 78.425 19.636 32.525 1.00 23.97 ? 233 ARG A N   1 
ATOM   1134 C  CA  . ARG A 1 144 ? 78.780 18.337 31.952 1.00 24.05 ? 233 ARG A CA  1 
ATOM   1135 C  C   . ARG A 1 144 ? 77.549 17.780 31.240 1.00 22.30 ? 233 ARG A C   1 
ATOM   1136 O  O   . ARG A 1 144 ? 76.427 17.941 31.720 1.00 22.56 ? 233 ARG A O   1 
ATOM   1137 C  CB  . ARG A 1 144 ? 79.249 17.371 33.055 1.00 27.23 ? 233 ARG A CB  1 
ATOM   1138 C  CG  . ARG A 1 144 ? 80.695 16.890 32.900 1.00 31.95 ? 233 ARG A CG  1 
ATOM   1139 C  CD  . ARG A 1 144 ? 81.091 15.849 33.981 1.00 37.80 ? 233 ARG A CD  1 
ATOM   1140 N  NE  . ARG A 1 144 ? 81.399 14.529 33.408 1.00 42.73 ? 233 ARG A NE  1 
ATOM   1141 C  CZ  . ARG A 1 144 ? 82.506 14.231 32.718 1.00 43.97 ? 233 ARG A CZ  1 
ATOM   1142 N  NH1 . ARG A 1 144 ? 83.440 15.156 32.509 1.00 46.68 ? 233 ARG A NH1 1 
ATOM   1143 N  NH2 . ARG A 1 144 ? 82.678 13.008 32.213 1.00 43.57 ? 233 ARG A NH2 1 
ATOM   1144 N  N   . LEU A 1 145 ? 77.750 17.169 30.077 1.00 20.40 ? 234 LEU A N   1 
ATOM   1145 C  CA  . LEU A 1 145 ? 76.646 16.581 29.310 1.00 18.77 ? 234 LEU A CA  1 
ATOM   1146 C  C   . LEU A 1 145 ? 76.124 15.294 29.943 1.00 18.07 ? 234 LEU A C   1 
ATOM   1147 O  O   . LEU A 1 145 ? 76.910 14.443 30.366 1.00 16.77 ? 234 LEU A O   1 
ATOM   1148 C  CB  . LEU A 1 145 ? 77.076 16.277 27.865 1.00 17.83 ? 234 LEU A CB  1 
ATOM   1149 C  CG  . LEU A 1 145 ? 76.795 17.306 26.766 1.00 17.32 ? 234 LEU A CG  1 
ATOM   1150 C  CD1 . LEU A 1 145 ? 77.212 16.759 25.395 1.00 15.28 ? 234 LEU A CD1 1 
ATOM   1151 C  CD2 . LEU A 1 145 ? 75.323 17.645 26.766 1.00 15.36 ? 234 LEU A CD2 1 
ATOM   1152 N  N   . SER A 1 146 ? 74.803 15.135 29.956 1.00 18.14 ? 235 SER A N   1 
ATOM   1153 C  CA  . SER A 1 146 ? 74.178 13.943 30.526 1.00 18.25 ? 235 SER A CA  1 
ATOM   1154 C  C   . SER A 1 146 ? 74.217 12.836 29.491 1.00 19.61 ? 235 SER A C   1 
ATOM   1155 O  O   . SER A 1 146 ? 74.406 13.096 28.299 1.00 19.25 ? 235 SER A O   1 
ATOM   1156 C  CB  . SER A 1 146 ? 72.728 14.222 30.923 1.00 17.12 ? 235 SER A CB  1 
ATOM   1157 O  OG  . SER A 1 146 ? 71.894 14.312 29.783 1.00 16.59 ? 235 SER A OG  1 
ATOM   1158 N  N   . GLN A 1 147 ? 74.068 11.599 29.952 1.00 21.78 ? 236 GLN A N   1 
ATOM   1159 C  CA  . GLN A 1 147 ? 74.079 10.452 29.048 1.00 23.79 ? 236 GLN A CA  1 
ATOM   1160 C  C   . GLN A 1 147 ? 72.980 10.627 28.018 1.00 22.41 ? 236 GLN A C   1 
ATOM   1161 O  O   . GLN A 1 147 ? 73.191 10.347 26.844 1.00 22.01 ? 236 GLN A O   1 
ATOM   1162 C  CB  . GLN A 1 147 ? 73.832 9.146  29.812 1.00 28.08 ? 236 GLN A CB  1 
ATOM   1163 C  CG  . GLN A 1 147 ? 74.959 8.736  30.748 1.00 33.61 ? 236 GLN A CG  1 
ATOM   1164 C  CD  . GLN A 1 147 ? 76.290 8.580  30.015 1.00 35.46 ? 236 GLN A CD  1 
ATOM   1165 O  OE1 . GLN A 1 147 ? 77.229 9.352  30.253 1.00 35.31 ? 236 GLN A OE1 1 
ATOM   1166 N  NE2 . GLN A 1 147 ? 76.374 7.584  29.111 1.00 33.27 ? 236 GLN A NE2 1 
ATOM   1167 N  N   . ASP A 1 148 ? 71.826 11.125 28.467 1.00 19.99 ? 237 ASP A N   1 
ATOM   1168 C  CA  . ASP A 1 148 ? 70.681 11.331 27.587 1.00 18.93 ? 237 ASP A CA  1 
ATOM   1169 C  C   . ASP A 1 148 ? 71.020 12.208 26.400 1.00 19.26 ? 237 ASP A C   1 
ATOM   1170 O  O   . ASP A 1 148 ? 70.591 11.929 25.288 1.00 19.43 ? 237 ASP A O   1 
ATOM   1171 C  CB  . ASP A 1 148 ? 69.501 11.935 28.347 1.00 19.83 ? 237 ASP A CB  1 
ATOM   1172 C  CG  . ASP A 1 148 ? 68.223 11.965 27.510 1.00 22.30 ? 237 ASP A CG  1 
ATOM   1173 O  OD1 . ASP A 1 148 ? 67.652 10.889 27.227 1.00 19.36 ? 237 ASP A OD1 1 
ATOM   1174 O  OD2 . ASP A 1 148 ? 67.784 13.068 27.128 1.00 24.12 ? 237 ASP A OD2 1 
ATOM   1175 N  N   . ASP A 1 149 ? 71.786 13.270 26.632 1.00 19.30 ? 238 ASP A N   1 
ATOM   1176 C  CA  . ASP A 1 149 ? 72.168 14.159 25.543 1.00 18.45 ? 238 ASP A CA  1 
ATOM   1177 C  C   . ASP A 1 149 ? 73.175 13.494 24.605 1.00 17.63 ? 238 ASP A C   1 
ATOM   1178 O  O   . ASP A 1 149 ? 73.054 13.589 23.385 1.00 18.05 ? 238 ASP A O   1 
ATOM   1179 C  CB  . ASP A 1 149 ? 72.756 15.460 26.079 1.00 18.89 ? 238 ASP A CB  1 
ATOM   1180 C  CG  . ASP A 1 149 ? 71.780 16.244 26.928 1.00 20.13 ? 238 ASP A CG  1 
ATOM   1181 O  OD1 . ASP A 1 149 ? 70.650 16.553 26.477 1.00 17.99 ? 238 ASP A OD1 1 
ATOM   1182 O  OD2 . ASP A 1 149 ? 72.172 16.571 28.062 1.00 19.21 ? 238 ASP A OD2 1 
ATOM   1183 N  N   . ILE A 1 150 ? 74.172 12.831 25.179 1.00 16.43 ? 239 ILE A N   1 
ATOM   1184 C  CA  . ILE A 1 150 ? 75.198 12.154 24.394 1.00 14.44 ? 239 ILE A CA  1 
ATOM   1185 C  C   . ILE A 1 150 ? 74.582 11.073 23.494 1.00 16.22 ? 239 ILE A C   1 
ATOM   1186 O  O   . ILE A 1 150 ? 74.921 10.959 22.315 1.00 15.55 ? 239 ILE A O   1 
ATOM   1187 C  CB  . ILE A 1 150 ? 76.237 11.497 25.312 1.00 11.93 ? 239 ILE A CB  1 
ATOM   1188 C  CG1 . ILE A 1 150 ? 76.875 12.546 26.224 1.00 9.64  ? 239 ILE A CG1 1 
ATOM   1189 C  CG2 . ILE A 1 150 ? 77.286 10.789 24.488 1.00 9.92  ? 239 ILE A CG2 1 
ATOM   1190 C  CD1 . ILE A 1 150 ? 77.877 11.983 27.187 1.00 6.55  ? 239 ILE A CD1 1 
ATOM   1191 N  N   . LYS A 1 151 ? 73.640 10.323 24.062 1.00 19.22 ? 240 LYS A N   1 
ATOM   1192 C  CA  . LYS A 1 151 ? 72.938 9.230  23.384 1.00 21.84 ? 240 LYS A CA  1 
ATOM   1193 C  C   . LYS A 1 151 ? 72.104 9.700  22.179 1.00 22.34 ? 240 LYS A C   1 
ATOM   1194 O  O   . LYS A 1 151 ? 71.970 8.987  21.174 1.00 21.95 ? 240 LYS A O   1 
ATOM   1195 C  CB  . LYS A 1 151 ? 72.037 8.520  24.404 1.00 24.10 ? 240 LYS A CB  1 
ATOM   1196 C  CG  . LYS A 1 151 ? 71.138 7.444  23.827 1.00 30.43 ? 240 LYS A CG  1 
ATOM   1197 C  CD  . LYS A 1 151 ? 70.241 6.813  24.906 1.00 35.31 ? 240 LYS A CD  1 
ATOM   1198 C  CE  . LYS A 1 151 ? 69.420 5.638  24.320 1.00 38.53 ? 240 LYS A CE  1 
ATOM   1199 N  NZ  . LYS A 1 151 ? 68.673 4.839  25.357 1.00 38.71 ? 240 LYS A NZ  1 
ATOM   1200 N  N   . GLY A 1 152 ? 71.534 10.896 22.298 1.00 21.64 ? 241 GLY A N   1 
ATOM   1201 C  CA  . GLY A 1 152 ? 70.719 11.451 21.238 1.00 18.24 ? 241 GLY A CA  1 
ATOM   1202 C  C   . GLY A 1 152 ? 71.505 12.035 20.086 1.00 18.64 ? 241 GLY A C   1 
ATOM   1203 O  O   . GLY A 1 152 ? 71.130 11.821 18.943 1.00 19.53 ? 241 GLY A O   1 
ATOM   1204 N  N   . ILE A 1 153 ? 72.582 12.770 20.366 1.00 17.40 ? 242 ILE A N   1 
ATOM   1205 C  CA  . ILE A 1 153 ? 73.369 13.384 19.298 1.00 18.53 ? 242 ILE A CA  1 
ATOM   1206 C  C   . ILE A 1 153 ? 74.202 12.354 18.541 1.00 19.92 ? 242 ILE A C   1 
ATOM   1207 O  O   . ILE A 1 153 ? 74.453 12.508 17.344 1.00 20.14 ? 242 ILE A O   1 
ATOM   1208 C  CB  . ILE A 1 153 ? 74.276 14.552 19.819 1.00 20.07 ? 242 ILE A CB  1 
ATOM   1209 C  CG1 . ILE A 1 153 ? 74.750 15.427 18.651 1.00 18.57 ? 242 ILE A CG1 1 
ATOM   1210 C  CG2 . ILE A 1 153 ? 75.487 14.020 20.581 1.00 19.28 ? 242 ILE A CG2 1 
ATOM   1211 C  CD1 . ILE A 1 153 ? 73.647 16.270 18.000 1.00 18.34 ? 242 ILE A CD1 1 
ATOM   1212 N  N   . GLN A 1 154 ? 74.632 11.306 19.239 1.00 20.04 ? 243 GLN A N   1 
ATOM   1213 C  CA  . GLN A 1 154 ? 75.415 10.264 18.595 1.00 20.73 ? 243 GLN A CA  1 
ATOM   1214 C  C   . GLN A 1 154 ? 74.511 9.389  17.737 1.00 20.63 ? 243 GLN A C   1 
ATOM   1215 O  O   . GLN A 1 154 ? 74.958 8.756  16.781 1.00 21.96 ? 243 GLN A O   1 
ATOM   1216 C  CB  . GLN A 1 154 ? 76.149 9.408  19.623 1.00 20.47 ? 243 GLN A CB  1 
ATOM   1217 C  CG  . GLN A 1 154 ? 77.214 10.157 20.400 1.00 21.93 ? 243 GLN A CG  1 
ATOM   1218 C  CD  . GLN A 1 154 ? 78.060 9.244  21.283 1.00 22.35 ? 243 GLN A CD  1 
ATOM   1219 O  OE1 . GLN A 1 154 ? 79.214 9.550  21.565 1.00 26.12 ? 243 GLN A OE1 1 
ATOM   1220 N  NE2 . GLN A 1 154 ? 77.486 8.128  21.730 1.00 20.81 ? 243 GLN A NE2 1 
ATOM   1221 N  N   . GLU A 1 155 ? 73.232 9.354  18.073 1.00 19.88 ? 244 GLU A N   1 
ATOM   1222 C  CA  . GLU A 1 155 ? 72.298 8.562  17.300 1.00 21.07 ? 244 GLU A CA  1 
ATOM   1223 C  C   . GLU A 1 155 ? 72.224 9.163  15.892 1.00 20.88 ? 244 GLU A C   1 
ATOM   1224 O  O   . GLU A 1 155 ? 72.196 8.433  14.899 1.00 22.24 ? 244 GLU A O   1 
ATOM   1225 C  CB  . GLU A 1 155 ? 70.916 8.579  17.961 1.00 25.09 ? 244 GLU A CB  1 
ATOM   1226 C  CG  . GLU A 1 155 ? 69.916 7.617  17.333 1.00 32.88 ? 244 GLU A CG  1 
ATOM   1227 C  CD  . GLU A 1 155 ? 70.343 6.147  17.463 1.00 37.92 ? 244 GLU A CD  1 
ATOM   1228 O  OE1 . GLU A 1 155 ? 71.067 5.833  18.447 1.00 41.52 ? 244 GLU A OE1 1 
ATOM   1229 O  OE2 . GLU A 1 155 ? 69.948 5.313  16.597 1.00 38.22 ? 244 GLU A OE2 1 
ATOM   1230 N  N   . LEU A 1 156 ? 72.274 10.493 15.815 1.00 17.94 ? 245 LEU A N   1 
ATOM   1231 C  CA  . LEU A 1 156 ? 72.196 11.209 14.547 1.00 14.06 ? 245 LEU A CA  1 
ATOM   1232 C  C   . LEU A 1 156 ? 73.480 11.306 13.740 1.00 14.35 ? 245 LEU A C   1 
ATOM   1233 O  O   . LEU A 1 156 ? 73.431 11.259 12.515 1.00 16.34 ? 245 LEU A O   1 
ATOM   1234 C  CB  . LEU A 1 156 ? 71.680 12.627 14.773 1.00 12.83 ? 245 LEU A CB  1 
ATOM   1235 C  CG  . LEU A 1 156 ? 70.203 12.886 15.066 1.00 9.32  ? 245 LEU A CG  1 
ATOM   1236 C  CD1 . LEU A 1 156 ? 70.025 14.313 15.548 1.00 5.65  ? 245 LEU A CD1 1 
ATOM   1237 C  CD2 . LEU A 1 156 ? 69.395 12.630 13.828 1.00 5.23  ? 245 LEU A CD2 1 
ATOM   1238 N  N   . TYR A 1 157 ? 74.619 11.476 14.406 1.00 13.96 ? 246 TYR A N   1 
ATOM   1239 C  CA  . TYR A 1 157 ? 75.893 11.636 13.697 1.00 14.42 ? 246 TYR A CA  1 
ATOM   1240 C  C   . TYR A 1 157 ? 76.985 10.629 14.001 1.00 15.45 ? 246 TYR A C   1 
ATOM   1241 O  O   . TYR A 1 157 ? 78.078 10.722 13.445 1.00 16.80 ? 246 TYR A O   1 
ATOM   1242 C  CB  . TYR A 1 157 ? 76.453 13.042 13.942 1.00 13.24 ? 246 TYR A CB  1 
ATOM   1243 C  CG  . TYR A 1 157 ? 75.545 14.141 13.457 1.00 15.78 ? 246 TYR A CG  1 
ATOM   1244 C  CD1 . TYR A 1 157 ? 75.434 14.423 12.096 1.00 15.60 ? 246 TYR A CD1 1 
ATOM   1245 C  CD2 . TYR A 1 157 ? 74.734 14.846 14.348 1.00 15.62 ? 246 TYR A CD2 1 
ATOM   1246 C  CE1 . TYR A 1 157 ? 74.525 15.373 11.629 1.00 16.47 ? 246 TYR A CE1 1 
ATOM   1247 C  CE2 . TYR A 1 157 ? 73.818 15.805 13.895 1.00 15.46 ? 246 TYR A CE2 1 
ATOM   1248 C  CZ  . TYR A 1 157 ? 73.717 16.059 12.533 1.00 17.51 ? 246 TYR A CZ  1 
ATOM   1249 O  OH  . TYR A 1 157 ? 72.803 16.970 12.066 1.00 13.31 ? 246 TYR A OH  1 
ATOM   1250 N  N   . GLY A 1 158 ? 76.699 9.676  14.878 1.00 17.13 ? 247 GLY A N   1 
ATOM   1251 C  CA  . GLY A 1 158 ? 77.692 8.685  15.254 1.00 17.54 ? 247 GLY A CA  1 
ATOM   1252 C  C   . GLY A 1 158 ? 78.525 9.195  16.416 1.00 20.14 ? 247 GLY A C   1 
ATOM   1253 O  O   . GLY A 1 158 ? 78.331 10.326 16.867 1.00 21.73 ? 247 GLY A O   1 
ATOM   1254 N  N   . ALA A 1 159 ? 79.488 8.392  16.867 1.00 21.98 ? 248 ALA A N   1 
ATOM   1255 C  CA  . ALA A 1 159 ? 80.352 8.759  17.996 1.00 22.28 ? 248 ALA A CA  1 
ATOM   1256 C  C   . ALA A 1 159 ? 81.623 9.461  17.545 1.00 22.92 ? 248 ALA A C   1 
ATOM   1257 O  O   . ALA A 1 159 ? 81.899 9.537  16.355 1.00 21.84 ? 248 ALA A O   1 
ATOM   1258 C  CB  . ALA A 1 159 ? 80.705 7.529  18.818 1.00 19.11 ? 248 ALA A CB  1 
ATOM   1259 N  N   . SER A 1 160 ? 82.384 9.974  18.511 1.00 26.47 ? 249 SER A N   1 
ATOM   1260 C  CA  . SER A 1 160 ? 83.632 10.683 18.244 1.00 28.85 ? 249 SER A CA  1 
ATOM   1261 C  C   . SER A 1 160 ? 84.763 9.746  17.828 1.00 32.05 ? 249 SER A C   1 
ATOM   1262 O  O   . SER A 1 160 ? 84.982 8.684  18.445 1.00 29.49 ? 249 SER A O   1 
ATOM   1263 C  CB  . SER A 1 160 ? 84.058 11.501 19.471 1.00 27.81 ? 249 SER A CB  1 
ATOM   1264 O  OG  . SER A 1 160 ? 85.344 12.080 19.291 1.00 23.33 ? 249 SER A OG  1 
ATOM   1265 N  N   . PRO A 1 161 ? 85.506 10.138 16.773 1.00 35.16 ? 250 PRO A N   1 
ATOM   1266 C  CA  . PRO A 1 161 ? 86.641 9.387  16.216 1.00 36.76 ? 250 PRO A CA  1 
ATOM   1267 C  C   . PRO A 1 161 ? 87.731 9.198  17.278 1.00 38.32 ? 250 PRO A C   1 
ATOM   1268 O  O   . PRO A 1 161 ? 88.110 8.027  17.518 1.00 39.78 ? 250 PRO A O   1 
ATOM   1269 C  CB  . PRO A 1 161 ? 87.136 10.302 15.084 1.00 35.99 ? 250 PRO A CB  1 
ATOM   1270 C  CG  . PRO A 1 161 ? 85.903 11.103 14.712 1.00 35.59 ? 250 PRO A CG  1 
ATOM   1271 C  CD  . PRO A 1 161 ? 85.335 11.422 16.064 1.00 35.07 ? 250 PRO A CD  1 
ATOM   1272 O  OXT . PRO A 1 161 ? 88.178 10.216 17.870 1.00 40.11 ? 250 PRO A OXT 1 
HETATM 1273 ZN ZN  . ZN  B 2 .   ? 64.682 24.460 23.463 1.00 16.03 ? 501 ZN  A ZN  1 
HETATM 1274 ZN ZN  . ZN  C 2 .   ? 63.864 34.434 15.653 1.00 14.48 ? 502 ZN  A ZN  1 
HETATM 1275 CA CA  . CA  D 3 .   ? 62.090 37.146 27.129 1.00 14.93 ? 503 CA  A CA  1 
HETATM 1276 CA CA  . CA  E 3 .   ? 70.880 28.876 8.063  1.00 11.96 ? 504 CA  A CA  1 
HETATM 1277 CA CA  . CA  F 3 .   ? 70.505 42.948 26.958 1.00 17.40 ? 505 CA  A CA  1 
HETATM 1278 O  O   . HOH G 4 .   ? 70.366 45.620 25.753 1.00 29.83 ? 301 HOH A O   1 
HETATM 1279 O  O   . HOH G 4 .   ? 69.749 44.183 29.271 1.00 28.44 ? 302 HOH A O   1 
HETATM 1280 O  O   . HOH G 4 .   ? 70.731 26.884 6.498  1.00 21.97 ? 303 HOH A O   1 
HETATM 1281 O  O   . HOH G 4 .   ? 72.019 30.632 6.391  1.00 17.60 ? 304 HOH A O   1 
HETATM 1282 O  O   . HOH G 4 .   ? 63.733 26.845 19.939 1.00 29.47 ? 305 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   88  88  ARG ARG A . n 
A 1 2   LYS 2   89  89  LYS LYS A . n 
A 1 3   PRO 3   90  90  PRO PRO A . n 
A 1 4   LYS 4   91  91  LYS LYS A . n 
A 1 5   TRP 5   92  92  TRP TRP A . n 
A 1 6   ASP 6   93  93  ASP ASP A . n 
A 1 7   LYS 7   94  94  LYS LYS A . n 
A 1 8   ASN 8   95  95  ASN ASN A . n 
A 1 9   GLN 9   96  96  GLN GLN A . n 
A 1 10  ILE 10  97  97  ILE ILE A . n 
A 1 11  THR 11  98  98  THR THR A . n 
A 1 12  TYR 12  99  99  TYR TYR A . n 
A 1 13  ARG 13  100 100 ARG ARG A . n 
A 1 14  ILE 14  101 101 ILE ILE A . n 
A 1 15  ILE 15  102 102 ILE ILE A . n 
A 1 16  GLY 16  103 103 GLY GLY A . n 
A 1 17  TYR 17  104 104 TYR TYR A . n 
A 1 18  THR 18  105 105 THR THR A . n 
A 1 19  PRO 19  106 106 PRO PRO A . n 
A 1 20  ASP 20  107 107 ASP ASP A . n 
A 1 21  LEU 21  108 108 LEU LEU A . n 
A 1 22  ASP 22  109 109 ASP ASP A . n 
A 1 23  PRO 23  110 110 PRO PRO A . n 
A 1 24  GLU 24  111 111 GLU GLU A . n 
A 1 25  THR 25  112 112 THR THR A . n 
A 1 26  VAL 26  113 113 VAL VAL A . n 
A 1 27  ASP 27  114 114 ASP ASP A . n 
A 1 28  ASP 28  115 115 ASP ASP A . n 
A 1 29  ALA 29  116 116 ALA ALA A . n 
A 1 30  PHE 30  117 117 PHE PHE A . n 
A 1 31  ALA 31  118 118 ALA ALA A . n 
A 1 32  ARG 32  119 119 ARG ARG A . n 
A 1 33  ALA 33  120 120 ALA ALA A . n 
A 1 34  PHE 34  121 121 PHE PHE A . n 
A 1 35  GLN 35  122 122 GLN GLN A . n 
A 1 36  VAL 36  123 123 VAL VAL A . n 
A 1 37  TRP 37  124 124 TRP TRP A . n 
A 1 38  SER 38  125 125 SER SER A . n 
A 1 39  ASP 39  126 126 ASP ASP A . n 
A 1 40  VAL 40  127 127 VAL VAL A . n 
A 1 41  THR 41  128 128 THR THR A . n 
A 1 42  PRO 42  129 129 PRO PRO A . n 
A 1 43  LEU 43  130 130 LEU LEU A . n 
A 1 44  ARG 44  131 131 ARG ARG A . n 
A 1 45  PHE 45  132 132 PHE PHE A . n 
A 1 46  SER 46  133 133 SER SER A . n 
A 1 47  ARG 47  134 134 ARG ARG A . n 
A 1 48  ILE 48  135 135 ILE ILE A . n 
A 1 49  HIS 49  136 136 HIS HIS A . n 
A 1 50  ASP 50  137 137 ASP ASP A . n 
A 1 51  GLY 51  138 138 GLY GLY A . n 
A 1 52  GLU 52  139 139 GLU GLU A . n 
A 1 53  ALA 53  140 140 ALA ALA A . n 
A 1 54  ASP 54  141 141 ASP ASP A . n 
A 1 55  ILE 55  142 142 ILE ILE A . n 
A 1 56  MET 56  143 143 MET MET A . n 
A 1 57  ILE 57  144 144 ILE ILE A . n 
A 1 58  ASN 58  145 145 ASN ASN A . n 
A 1 59  PHE 59  146 146 PHE PHE A . n 
A 1 60  GLY 60  147 147 GLY GLY A . n 
A 1 61  ARG 61  148 148 ARG ARG A . n 
A 1 62  TRP 62  149 149 TRP TRP A . n 
A 1 63  GLU 63  150 150 GLU GLU A . n 
A 1 64  HIS 64  151 151 HIS HIS A . n 
A 1 65  GLY 65  152 152 GLY GLY A . n 
A 1 66  ASP 66  153 153 ASP ASP A . n 
A 1 67  GLY 67  154 154 GLY GLY A . n 
A 1 68  TYR 68  155 155 TYR TYR A . n 
A 1 69  PRO 69  156 156 PRO PRO A . n 
A 1 70  PHE 70  157 157 PHE PHE A . n 
A 1 71  ASP 71  158 158 ASP ASP A . n 
A 1 72  GLY 72  159 159 GLY GLY A . n 
A 1 73  LYS 73  160 160 LYS LYS A . n 
A 1 74  ASP 74  161 161 ASP ASP A . n 
A 1 75  GLY 75  162 162 GLY GLY A . n 
A 1 76  LEU 76  163 163 LEU LEU A . n 
A 1 77  LEU 77  164 164 LEU LEU A . n 
A 1 78  ALA 78  165 165 ALA ALA A . n 
A 1 79  HIS 79  166 166 HIS HIS A . n 
A 1 80  ALA 80  167 167 ALA ALA A . n 
A 1 81  PHE 81  168 168 PHE PHE A . n 
A 1 82  ALA 82  169 169 ALA ALA A . n 
A 1 83  PRO 83  170 170 PRO PRO A . n 
A 1 84  GLY 84  171 171 GLY GLY A . n 
A 1 85  THR 85  172 172 THR THR A . n 
A 1 86  GLY 86  173 173 GLY GLY A . n 
A 1 87  VAL 87  174 174 VAL VAL A . n 
A 1 88  GLY 88  175 175 GLY GLY A . n 
A 1 89  GLY 89  176 176 GLY GLY A . n 
A 1 90  ASP 90  177 177 ASP ASP A . n 
A 1 91  SER 91  178 178 SER SER A . n 
A 1 92  HIS 92  179 179 HIS HIS A . n 
A 1 93  PHE 93  180 180 PHE PHE A . n 
A 1 94  ASP 94  181 181 ASP ASP A . n 
A 1 95  ASP 95  182 182 ASP ASP A . n 
A 1 96  ASP 96  183 183 ASP ASP A . n 
A 1 97  GLU 97  184 184 GLU GLU A . n 
A 1 98  LEU 98  185 185 LEU LEU A . n 
A 1 99  TRP 99  186 186 TRP TRP A . n 
A 1 100 SER 100 187 187 SER SER A . n 
A 1 101 LEU 101 188 188 LEU LEU A . n 
A 1 102 GLY 102 189 189 GLY GLY A . n 
A 1 103 LYS 103 190 190 LYS LYS A . n 
A 1 104 GLY 104 190 190 GLY GLY A A n 
A 1 105 VAL 105 191 191 VAL VAL A . n 
A 1 106 GLY 106 192 192 GLY GLY A . n 
A 1 107 TYR 107 193 193 TYR TYR A . n 
A 1 108 SER 108 194 194 SER SER A . n 
A 1 109 LEU 109 195 195 LEU LEU A . n 
A 1 110 PHE 110 196 196 PHE PHE A . n 
A 1 111 LEU 111 197 197 LEU LEU A . n 
A 1 112 VAL 112 198 198 VAL VAL A . n 
A 1 113 ALA 113 199 199 ALA ALA A . n 
A 1 114 ALA 114 200 200 ALA ALA A . n 
A 1 115 HIS 115 201 201 HIS HIS A . n 
A 1 116 GLU 116 202 202 GLU GLU A . n 
A 1 117 PHE 117 203 203 PHE PHE A . n 
A 1 118 GLY 118 204 204 GLY GLY A . n 
A 1 119 HIS 119 205 205 HIS HIS A . n 
A 1 120 ALA 120 206 206 ALA ALA A . n 
A 1 121 MET 121 207 207 MET MET A . n 
A 1 122 GLY 122 208 208 GLY GLY A . n 
A 1 123 LEU 123 209 209 LEU LEU A . n 
A 1 124 GLU 124 210 210 GLU GLU A . n 
A 1 125 HIS 125 211 211 HIS HIS A . n 
A 1 126 SER 126 212 212 SER SER A . n 
A 1 127 GLN 127 213 213 GLN GLN A . n 
A 1 128 ASP 128 214 214 ASP ASP A . n 
A 1 129 PRO 129 215 215 PRO PRO A . n 
A 1 130 GLY 130 216 216 GLY GLY A . n 
A 1 131 ALA 131 217 217 ALA ALA A . n 
A 1 132 LEU 132 218 218 LEU LEU A . n 
A 1 133 MET 133 219 219 MET MET A . n 
A 1 134 ALA 134 220 220 ALA ALA A . n 
A 1 135 PRO 135 221 221 PRO PRO A . n 
A 1 136 ILE 136 222 222 ILE ILE A . n 
A 1 137 TYR 137 223 223 TYR TYR A . n 
A 1 138 THR 138 227 227 THR THR A . n 
A 1 139 TYR 139 228 228 TYR TYR A . n 
A 1 140 THR 140 229 229 THR THR A . n 
A 1 141 LYS 141 230 230 LYS LYS A . n 
A 1 142 ASN 142 231 231 ASN ASN A . n 
A 1 143 PHE 143 232 232 PHE PHE A . n 
A 1 144 ARG 144 233 233 ARG ARG A . n 
A 1 145 LEU 145 234 234 LEU LEU A . n 
A 1 146 SER 146 235 235 SER SER A . n 
A 1 147 GLN 147 236 236 GLN GLN A . n 
A 1 148 ASP 148 237 237 ASP ASP A . n 
A 1 149 ASP 149 238 238 ASP ASP A . n 
A 1 150 ILE 150 239 239 ILE ILE A . n 
A 1 151 LYS 151 240 240 LYS LYS A . n 
A 1 152 GLY 152 241 241 GLY GLY A . n 
A 1 153 ILE 153 242 242 ILE ILE A . n 
A 1 154 GLN 154 243 243 GLN GLN A . n 
A 1 155 GLU 155 244 244 GLU GLU A . n 
A 1 156 LEU 156 245 245 LEU LEU A . n 
A 1 157 TYR 157 246 246 TYR TYR A . n 
A 1 158 GLY 158 247 247 GLY GLY A . n 
A 1 159 ALA 159 248 248 ALA ALA A . n 
A 1 160 SER 160 249 249 SER SER A . n 
A 1 161 PRO 161 250 250 PRO PRO A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1 501 501 ZN  ZN  A . 
C 2 ZN  1 502 502 ZN  ZN  A . 
D 3 CA  1 503 503 CA  CA  A . 
E 3 CA  1 504 504 CA  CA  A . 
F 3 CA  1 505 505 CA  CA  A . 
G 4 HOH 1 301 301 HOH HOH A . 
G 4 HOH 2 302 302 HOH HOH A . 
G 4 HOH 3 303 303 HOH HOH A . 
G 4 HOH 4 304 304 HOH HOH A . 
G 4 HOH 5 305 305 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 125 ? A HIS 211 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 115 ? A HIS 201 ? 1_555 103.6 ? 
2  NE2 ? A HIS 125 ? A HIS 211 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 119 ? A HIS 205 ? 1_555 96.8  ? 
3  NE2 ? A HIS 115 ? A HIS 201 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 119 ? A HIS 205 ? 1_555 103.3 ? 
4  OD2 ? A ASP 66  ? A ASP 153 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 79  ? A HIS 166 ? 1_555 99.1  ? 
5  OD2 ? A ASP 66  ? A ASP 153 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 ND1 ? A HIS 92  ? A HIS 179 ? 1_555 121.9 ? 
6  NE2 ? A HIS 79  ? A HIS 166 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 ND1 ? A HIS 92  ? A HIS 179 ? 1_555 109.0 ? 
7  OD2 ? A ASP 66  ? A ASP 153 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 64  ? A HIS 151 ? 1_555 120.9 ? 
8  NE2 ? A HIS 79  ? A HIS 166 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 64  ? A HIS 151 ? 1_555 98.5  ? 
9  ND1 ? A HIS 92  ? A HIS 179 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 NE2 ? A HIS 64  ? A HIS 151 ? 1_555 104.1 ? 
10 OD1 ? A ASP 71  ? A ASP 158 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 O   ? A ASP 74  ? A ASP 161 ? 1_555 96.8  ? 
11 OD1 ? A ASP 71  ? A ASP 158 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 O   ? A LEU 76  ? A LEU 163 ? 1_555 87.2  ? 
12 O   ? A ASP 74  ? A ASP 161 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 O   ? A LEU 76  ? A LEU 163 ? 1_555 87.3  ? 
13 OD1 ? A ASP 71  ? A ASP 158 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD2 ? A ASP 94  ? A ASP 181 ? 1_555 109.7 ? 
14 O   ? A ASP 74  ? A ASP 161 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD2 ? A ASP 94  ? A ASP 181 ? 1_555 152.3 ? 
15 O   ? A LEU 76  ? A LEU 163 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD2 ? A ASP 94  ? A ASP 181 ? 1_555 101.4 ? 
16 OD1 ? A ASP 71  ? A ASP 158 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 O   ? A GLY 72  ? A GLY 159 ? 1_555 124.0 ? 
17 O   ? A ASP 74  ? A ASP 161 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 O   ? A GLY 72  ? A GLY 159 ? 1_555 84.1  ? 
18 O   ? A LEU 76  ? A LEU 163 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 O   ? A GLY 72  ? A GLY 159 ? 1_555 148.3 ? 
19 OD2 ? A ASP 94  ? A ASP 181 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 O   ? A GLY 72  ? A GLY 159 ? 1_555 74.7  ? 
20 OD1 ? A ASP 71  ? A ASP 158 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OE2 ? A GLU 97  ? A GLU 184 ? 1_555 157.3 ? 
21 O   ? A ASP 74  ? A ASP 161 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OE2 ? A GLU 97  ? A GLU 184 ? 1_555 75.2  ? 
22 O   ? A LEU 76  ? A LEU 163 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OE2 ? A GLU 97  ? A GLU 184 ? 1_555 71.3  ? 
23 OD2 ? A ASP 94  ? A ASP 181 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OE2 ? A GLU 97  ? A GLU 184 ? 1_555 82.7  ? 
24 O   ? A GLY 72  ? A GLY 159 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OE2 ? A GLU 97  ? A GLU 184 ? 1_555 77.0  ? 
25 O   ? A ASP 54  ? A ASP 141 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 O   ? A GLY 88  ? A GLY 175 ? 1_555 90.5  ? 
26 O   ? A ASP 54  ? A ASP 141 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 O   ? A GLY 86  ? A GLY 173 ? 1_555 162.7 ? 
27 O   ? A GLY 88  ? A GLY 175 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 O   ? A GLY 86  ? A GLY 173 ? 1_555 97.1  ? 
28 O   ? A ASP 54  ? A ASP 141 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 O   ? G HOH .   ? A HOH 304 ? 1_555 98.7  ? 
29 O   ? A GLY 88  ? A GLY 175 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 O   ? G HOH .   ? A HOH 304 ? 1_555 163.8 ? 
30 O   ? A GLY 86  ? A GLY 173 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 O   ? G HOH .   ? A HOH 304 ? 1_555 70.6  ? 
31 O   ? A ASP 54  ? A ASP 141 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 OD1 ? A ASP 90  ? A ASP 177 ? 1_555 102.7 ? 
32 O   ? A GLY 88  ? A GLY 175 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 OD1 ? A ASP 90  ? A ASP 177 ? 1_555 93.3  ? 
33 O   ? A GLY 86  ? A GLY 173 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 OD1 ? A ASP 90  ? A ASP 177 ? 1_555 92.4  ? 
34 O   ? G HOH .   ? A HOH 304 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 OD1 ? A ASP 90  ? A ASP 177 ? 1_555 97.6  ? 
35 O   ? A ASP 54  ? A ASP 141 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 O   ? G HOH .   ? A HOH 303 ? 1_555 85.6  ? 
36 O   ? A GLY 88  ? A GLY 175 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 O   ? G HOH .   ? A HOH 303 ? 1_555 68.4  ? 
37 O   ? A GLY 86  ? A GLY 173 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 O   ? G HOH .   ? A HOH 303 ? 1_555 82.9  ? 
38 O   ? G HOH .   ? A HOH 304 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 O   ? G HOH .   ? A HOH 303 ? 1_555 98.9  ? 
39 OD1 ? A ASP 90  ? A ASP 177 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 O   ? G HOH .   ? A HOH 303 ? 1_555 160.1 ? 
40 OD1 ? A ASP 95  ? A ASP 182 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 O   ? G HOH .   ? A HOH 301 ? 1_555 90.4  ? 
41 OD1 ? A ASP 95  ? A ASP 182 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 OD1 ? A ASP 20  ? A ASP 107 ? 1_555 103.8 ? 
42 O   ? G HOH .   ? A HOH 301 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 OD1 ? A ASP 20  ? A ASP 107 ? 1_555 81.8  ? 
43 OD1 ? A ASP 95  ? A ASP 182 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 OD2 ? A ASP 20  ? A ASP 107 ? 1_555 82.0  ? 
44 O   ? G HOH .   ? A HOH 301 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 OD2 ? A ASP 20  ? A ASP 107 ? 1_555 121.1 ? 
45 OD1 ? A ASP 20  ? A ASP 107 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 OD2 ? A ASP 20  ? A ASP 107 ? 1_555 45.0  ? 
46 OD1 ? A ASP 95  ? A ASP 182 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 O   ? A GLU 97  ? A GLU 184 ? 1_555 105.7 ? 
47 O   ? G HOH .   ? A HOH 301 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 O   ? A GLU 97  ? A GLU 184 ? 1_555 154.4 ? 
48 OD1 ? A ASP 20  ? A ASP 107 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 O   ? A GLU 97  ? A GLU 184 ? 1_555 112.4 ? 
49 OD2 ? A ASP 20  ? A ASP 107 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 O   ? A GLU 97  ? A GLU 184 ? 1_555 81.5  ? 
50 OD1 ? A ASP 95  ? A ASP 182 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 O   ? G HOH .   ? A HOH 302 ? 1_555 172.4 ? 
51 O   ? G HOH .   ? A HOH 301 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 O   ? G HOH .   ? A HOH 302 ? 1_555 85.6  ? 
52 OD1 ? A ASP 20  ? A ASP 107 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 O   ? G HOH .   ? A HOH 302 ? 1_555 82.0  ? 
53 OD2 ? A ASP 20  ? A ASP 107 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 O   ? G HOH .   ? A HOH 302 ? 1_555 105.5 ? 
54 O   ? A GLU 97  ? A GLU 184 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 O   ? G HOH .   ? A HOH 302 ? 1_555 76.0  ? 
55 OD1 ? A ASP 95  ? A ASP 182 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 O   ? A ASP 95  ? A ASP 182 ? 1_555 71.8  ? 
56 O   ? G HOH .   ? A HOH 301 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 O   ? A ASP 95  ? A ASP 182 ? 1_555 76.3  ? 
57 OD1 ? A ASP 20  ? A ASP 107 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 O   ? A ASP 95  ? A ASP 182 ? 1_555 157.5 ? 
58 OD2 ? A ASP 20  ? A ASP 107 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 O   ? A ASP 95  ? A ASP 182 ? 1_555 149.0 ? 
59 O   ? A GLU 97  ? A GLU 184 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 O   ? A ASP 95  ? A ASP 182 ? 1_555 89.8  ? 
60 O   ? G HOH .   ? A HOH 302 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 O   ? A ASP 95  ? A ASP 182 ? 1_555 101.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-11-19 
2 'Structure model' 1 1 2008-04-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-05-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Structure summary'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .     ? 1 
X-PLOR    refinement       3.851 ? 2 
DENZO     'data reduction' .     ? 3 
SCALEPACK 'data scaling'   .     ? 4 
# 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.entry_id             1QIB 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
'THE WHOLE FIBRONECTIN DOMAIN DELETED AND REPLACED WITH THE SHORT SEGMENT SLGKGV (187-191), STROMELYSIN NUMBERING' 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TRP A 149 ? ? 44.86   -145.47 
2 1 ASP A 153 ? ? -151.05 9.84    
3 1 ASP A 158 ? ? -144.76 44.34   
4 1 ASP A 161 ? ? 58.26   -172.33 
5 1 LYS A 190 ? ? 88.70   -118.45 
6 1 VAL A 191 ? ? 178.34  122.32  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'    ZN  
3 'CALCIUM ION' CA  
4 water         HOH 
#