data_1QIG
# 
_entry.id   1QIG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QIG         
RCSB  RCSB001187   
WWPDB D_1000001187 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1QID 'EXPERIMENTAL TIME POINT A' unspecified 
PDB 1QIE 'EXPERIMENTAL TIME POINT B' unspecified 
PDB 1QIF 'EXPERIMENTAL TIME POINT C' unspecified 
PDB 1QIG 'EXPERIMENTAL TIME POINT D' unspecified 
PDB 1QIH 'EXPERIMENTAL TIME POINT E' unspecified 
PDB 1QII 'EXPERIMENTAL TIME POINT F' unspecified 
PDB 1QIJ 'EXPERIMENTAL TIME POINT G' unspecified 
PDB 1QIK 'EXPERIMENTAL TIME POINT H' unspecified 
PDB 1QIM 'EXPERIMENTAL TIME POINT I' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QIG 
_pdbx_database_status.recvd_initial_deposition_date   1999-06-14 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kryger, G.'      1 
'Weik, M.'        2 
'Ravelli, R.B.G.' 3 
# 
_citation.id                        primary 
_citation.title                     'Specific chemical and structural damage to proteins produced by synchrotron radiation.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            97 
_citation.page_first                623 
_citation.page_last                 628 
_citation.year                      2000 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10639129 
_citation.pdbx_database_id_DOI      10.1073/pnas.97.2.623 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Weik, M.'      1  
primary 'Ravelli, R.B.' 2  
primary 'Kryger, G.'    3  
primary 'McSweeney, S.' 4  
primary 'Raves, M.L.'   5  
primary 'Harel, M.'     6  
primary 'Gros, P.'      7  
primary 'Silman, I.'    8  
primary 'Kroon, J.'     9  
primary 'Sussman, J.L.' 10 
# 
_cell.entry_id           1QIG 
_cell.length_a           112.049 
_cell.length_b           112.049 
_cell.length_c           137.822 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QIG 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat ACETYLCHOLINESTERASE 60736.516 1   3.1.1.7 ? ? ? 
2 water   nat water                18.015    335 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'Pacific electric ray' 
_entity_src_nat.pdbx_organism_scientific   'Torpedo californica' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      Torpedo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1QIG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 537 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  558 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QIG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.8 
_exptl_crystal.density_percent_sol   68.0 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_details    '30% PEG 200, 0.3 M MES, pH 5.8, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   1999-03-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9320 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             0.9320 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QIG 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             35.53 
_reflns.d_resolution_high            2.30 
_reflns.number_obs                   44671 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.069 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        28.1 
_reflns.pdbx_redundancy              2.09 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1QIG 
_refine.ls_number_reflns_obs                     44552 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           1896193.33 
_refine.ls_d_res_low                             35.53 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    99.1 
_refine.ls_R_factor_obs                          0.2030000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2030000 
_refine.ls_R_factor_R_free                       0.2200000 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2240 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               41.1 
_refine.aniso_B[1][1]                            5.34 
_refine.aniso_B[2][2]                            5.34 
_refine.aniso_B[3][3]                            -10.69 
_refine.aniso_B[1][2]                            3.30 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.339 
_refine.solvent_model_param_bsol                 41.53 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;BULK SOLVENT MODEL USED. ONLY PARTIAL REFINEMENT DONE. ALL SIX CYSTEINE 
RESIDUES TAKING PART IN INTRACHAIN DISULFIDE LINKAGES,CYS 67-CYS 94, CYS 402- 
CYS 521 AND CYS 254-CYS 265, WERE MODELED AND REFINED AS ALANINE RESIDUES.

TCACHE IS A GLYCOPROTEIN OF MR = 65,000, WHICH CONTAINS
THREE INTRACHAIN DISULFIDE BONDS. IN THE COURSE OF
CRYOGENIC DATA COLLECTION ON TRIGONAL CRYSTALS OF TCACHE ON
THE UNDULATOR BEAMLINE, ID14-EH4, AT THE ESRF IN GRENOBLE,
IN PREPARATION FOR TIME-RESOLVED STUDIES, WE COLLECTED A
SERIES OF NINE HIGH-QUALITY COMPLETE DATA SETS ON THE SAME
CRYSTAL. DATA COLLECTION UTILIZED THE UNATTENUATED BEAM,
AND THE DURATION PER DATA SET WAS CA. 19 MIN, FOR 3 H IN
TOTAL, AT 100K. ELECTRON DENSITY MAPS WERE OBTAINED FOR
EACH DATA SET BY ROUTINE REFINEMENT, STARTING FROM THE SAME
MODEL OF NATIVE TCACHE. FOR RESULTS, SEE:
HTTP://SGJS3.WEIZMANN.AC.IL/~KRYGER/RADIATION_DAMAGE
(LOWER CASE!)

THIS ENTRY IS THE FOURTH TIME POINT (4 OF 9). SEE HTTP://
SGJS3.WEIZMANN.AC.IL/~KRYGER/RADIATION_DAMAGE (LOWER CASE!)
;
_refine.pdbx_starting_model                      'PDB ENTRY 1VXR' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1QIG 
_refine_analyze.Luzzati_coordinate_error_obs    0.27 
_refine_analyze.Luzzati_sigma_a_obs             0.30 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.29 
_refine_analyze.Luzzati_sigma_a_free            0.29 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4238 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             335 
_refine_hist.number_atoms_total               4573 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        35.53 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.87  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             2.70  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            4.18  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             6.23  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            8.93  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.30 
_refine_ls_shell.d_res_low                        2.38 
_refine_ls_shell.number_reflns_R_work             4197 
_refine_ls_shell.R_factor_R_work                  0.2830000 
_refine_ls_shell.percent_reflns_obs               99.4 
_refine_ls_shell.R_factor_R_free                  0.2750000 
_refine_ls_shell.R_factor_R_free_error            0.018 
_refine_ls_shell.percent_reflns_R_free            5.5 
_refine_ls_shell.number_reflns_R_free             243 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP     'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER_REP.PARAM 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1QIG 
_struct.title                     
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT D) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QIG 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;RADIATION DAMAGE, TIME SERIES, DISULFIDE BOND, SERINE HYDROLASE, ALPHA/BETA HYDROLASE, NEUROTRANSMITTER CLEAVAGE, CATALYTIC TRIAD, GLYCOSYLATED PROTEIN, HYDROLASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 41  ? MET A 43  ? GLY A 41  MET A 43  5 ? 3  
HELX_P HELX_P2  2  SER A 79  ? TRP A 84  ? SER A 79  TRP A 84  1 ? 6  
HELX_P HELX_P3  3  ASP A 128 ? TYR A 130 ? ASP A 128 TYR A 130 5 ? 3  
HELX_P HELX_P4  4  LYS A 133 ? GLU A 139 ? LYS A 133 GLU A 139 1 ? 7  
HELX_P HELX_P5  5  GLY A 151 ? PHE A 155 ? GLY A 151 PHE A 155 1 ? 5  
HELX_P HELX_P6  6  VAL A 168 ? PHE A 187 ? VAL A 168 PHE A 187 1 ? 20 
HELX_P HELX_P7  7  ALA A 201 ? LEU A 211 ? ALA A 201 LEU A 211 1 ? 11 
HELX_P HELX_P8  8  PRO A 213 ? LEU A 218 ? PRO A 213 LEU A 218 1 ? 6  
HELX_P HELX_P9  9  VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P10 10 ASP A 259 ? GLU A 268 ? ASP A 259 GLU A 268 1 ? 10 
HELX_P HELX_P11 11 PRO A 271 ? VAL A 281 ? PRO A 271 VAL A 281 1 ? 11 
HELX_P HELX_P12 12 LEU A 305 ? SER A 311 ? LEU A 305 SER A 311 1 ? 7  
HELX_P HELX_P13 13 SER A 329 ? GLY A 335 ? SER A 329 GLY A 335 1 ? 7  
HELX_P HELX_P14 14 ARG A 349 ? SER A 359 ? ARG A 349 SER A 359 1 ? 11 
HELX_P HELX_P15 15 ASP A 365 ? GLN A 374 ? ASP A 365 GLN A 374 1 ? 10 
HELX_P HELX_P16 16 GLY A 384 ? ASN A 399 ? GLY A 384 ASN A 399 1 ? 16 
HELX_P HELX_P17 17 ILE A 401 ? PHE A 414 ? ILE A 401 PHE A 414 1 ? 14 
HELX_P HELX_P18 18 GLU A 434 ? MET A 436 ? GLU A 434 MET A 436 5 ? 3  
HELX_P HELX_P19 19 ILE A 444 ? VAL A 447 ? ILE A 444 VAL A 447 1 ? 4  
HELX_P HELX_P20 20 LEU A 450 ? LEU A 452 ? LEU A 450 LEU A 452 5 ? 3  
HELX_P HELX_P21 21 LYS A 454 ? LEU A 456 ? LYS A 454 LEU A 456 5 ? 3  
HELX_P HELX_P22 22 ALA A 460 ? THR A 479 ? ALA A 460 THR A 479 1 ? 20 
HELX_P HELX_P23 23 VAL A 518 ? ASN A 525 ? VAL A 518 ASN A 525 1 ? 8  
HELX_P HELX_P24 24 PHE A 527 ? ASN A 533 ? PHE A 527 ASN A 533 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.17 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 6   ? THR A 10  ? LEU A 6   THR A 10  
A 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
A 3  VAL A 57  ? ALA A 60  ? VAL A 57  ALA A 60  
B 1  MET A 16  ? PRO A 21  ? MET A 16  PRO A 21  
B 2  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
B 3  TYR A 96  ? PRO A 102 ? TYR A 96  PRO A 102 
B 4  VAL A 142 ? SER A 147 ? VAL A 142 SER A 147 
B 5  THR A 109 ? TYR A 116 ? THR A 109 TYR A 116 
B 6  THR A 193 ? GLU A 199 ? THR A 193 GLU A 199 
B 7  ARG A 220 ? SER A 226 ? ARG A 220 SER A 226 
B 8  GLN A 318 ? ASN A 324 ? GLN A 318 ASN A 324 
B 9  GLY A 417 ? PHE A 423 ? GLY A 417 PHE A 423 
B 10 PHE A 502 ? LEU A 505 ? PHE A 502 LEU A 505 
B 11 MET A 510 ? GLN A 514 ? MET A 510 GLN A 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O VAL A 8   ? O VAL A 8   N VAL A 15  ? N VAL A 15  
A 2  3  O LYS A 14  ? O LYS A 14  N TRP A 58  ? N TRP A 58  
B 1  2  N THR A 18  ? N THR A 18  O ALA A 29  ? O ALA A 29  
B 2  3  O PHE A 30  ? O PHE A 30  N ILE A 99  ? N ILE A 99  
B 3  4  O TRP A 100 ? O TRP A 100 N LEU A 143 ? N LEU A 143 
B 4  5  O VAL A 142 ? O VAL A 142 N MET A 112 ? N MET A 112 
B 5  6  N VAL A 113 ? N VAL A 113 O THR A 195 ? O THR A 195 
B 6  7  O ILE A 196 ? O ILE A 196 N ILE A 223 ? N ILE A 223 
B 7  8  O LEU A 224 ? O LEU A 224 N GLY A 322 ? N GLY A 322 
B 8  9  O LEU A 321 ? O LEU A 321 N TYR A 421 ? N TYR A 421 
B 9  10 O LEU A 420 ? O LEU A 420 N ILE A 503 ? N ILE A 503 
B 10 11 O PHE A 502 ? O PHE A 502 N HIS A 513 ? N HIS A 513 
# 
_struct_site.id                   CAT 
_struct_site.pdbx_evidence_code   Author 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    3 
_struct_site.details              'CATALYTIC TRIAD' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 CAT 3 SER A 200 ? SER A 200 . ? 1_555 ? 
2 CAT 3 GLU A 327 ? GLU A 327 . ? 1_555 ? 
3 CAT 3 HIS A 440 ? HIS A 440 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QIG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QIG 
_atom_sites.fract_transf_matrix[1][1]   0.008925 
_atom_sites.fract_transf_matrix[1][2]   0.005153 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010305 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007256 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -13.122 87.736 34.682 1.00 50.65  ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -12.547 88.130 36.006 1.00 50.65  ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -11.378 87.232 36.428 1.00 50.65  ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -11.428 86.011 36.273 1.00 50.65  ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -13.631 88.083 37.090 1.00 55.00  ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -13.092 88.436 38.362 1.00 55.00  ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -10.336 87.844 36.978 1.00 44.96  ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -9.161  87.111 37.432 1.00 44.96  ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.513  86.117 38.545 1.00 44.96  ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.873  85.072 38.682 1.00 44.96  ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -8.099  88.096 37.938 1.00 63.65  ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.766  87.447 38.325 1.00 63.65  ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.694  88.465 38.689 1.00 63.65  ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -5.908  89.262 39.628 1.00 63.65  ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -4.624  88.468 38.041 1.00 63.65  ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.532 86.436 39.335 1.00 37.14  ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -10.931 85.574 40.434 1.00 37.14  ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -11.921 84.484 40.046 1.00 37.14  ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.292 83.653 40.877 1.00 37.14  ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.517 86.420 41.566 1.00 34.26  ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.597 87.533 42.079 1.00 34.26  ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -11.299 88.306 43.185 1.00 34.26  ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -9.290  86.933 42.586 1.00 34.26  ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.345 84.468 38.788 1.00 40.83  ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -13.302 83.461 38.343 1.00 40.83  ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.617 82.424 37.458 1.00 40.83  ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -11.976 82.772 36.469 1.00 40.83  ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.448 84.132 37.584 1.00 50.75  ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.594 83.216 37.144 1.00 50.75  ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -16.230 82.565 38.362 1.00 50.75  ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.635 84.030 36.384 1.00 50.75  ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.743 81.152 37.819 1.00 34.93  ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -12.119 80.093 37.037 1.00 34.93  ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -13.101 78.975 36.723 1.00 34.93  ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.838 78.502 37.594 1.00 34.93  ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -10.894 79.491 37.765 1.00 38.08  ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -10.313 78.336 36.950 1.00 38.08  ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -9.828  80.560 37.958 1.00 38.08  ? 8    VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -13.110 78.557 35.464 1.00 40.10  ? 9    ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -14.000 77.493 35.041 1.00 40.10  ? 9    ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -13.219 76.192 34.938 1.00 40.10  ? 9    ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -12.416 76.010 34.027 1.00 40.10  ? 9    ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -14.640 77.842 33.694 1.00 55.49  ? 9    ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -15.789 76.916 33.348 1.00 55.49  ? 9    ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -16.357 76.255 34.230 1.00 55.49  ? 9    ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -16.152 76.865 32.066 1.00 55.49  ? 9    ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -13.447 75.289 35.881 1.00 42.71  ? 10   THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -12.755 74.008 35.872 1.00 42.71  ? 10   THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -13.688 72.940 35.336 1.00 42.71  ? 10   THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -14.863 73.202 35.071 1.00 42.71  ? 10   THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -12.312 73.565 37.289 1.00 32.98  ? 10   THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -13.442 73.050 37.995 1.00 32.98  ? 10   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -11.727 74.739 38.074 1.00 32.98  ? 10   THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -13.157 71.733 35.194 1.00 37.03  ? 11   LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -13.923 70.604 34.699 1.00 37.03  ? 11   LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -15.002 70.155 35.688 1.00 37.03  ? 11   LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -15.905 69.412 35.318 1.00 37.03  ? 11   LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -12.969 69.447 34.394 1.00 37.73  ? 11   LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -11.918 69.805 33.349 1.00 37.73  ? 11   LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -10.989 68.647 33.047 1.00 37.73  ? 11   LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -10.025 69.037 31.935 1.00 37.73  ? 11   LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -8.938  68.051 31.720 1.00 37.73  ? 11   LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -14.905 70.601 36.940 1.00 38.00  ? 12   SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -15.891 70.244 37.963 1.00 38.00  ? 12   SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -16.951 71.338 38.116 1.00 38.00  ? 12   SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -18.002 71.123 38.743 1.00 38.00  ? 12   SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -15.212 70.028 39.319 1.00 44.21  ? 12   SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -14.376 68.885 39.309 1.00 44.21  ? 12   SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -16.673 72.506 37.544 1.00 36.36  ? 13   GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -17.602 73.619 37.637 1.00 36.36  ? 13   GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -16.849 74.921 37.822 1.00 36.36  ? 13   GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -15.614 74.908 37.861 1.00 36.36  ? 13   GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -17.567 76.038 37.926 1.00 31.26  ? 14   LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -16.917 77.336 38.109 1.00 31.26  ? 14   LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -16.568 77.598 39.569 1.00 31.26  ? 14   LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -17.296 77.199 40.484 1.00 31.26  ? 14   LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -17.799 78.474 37.599 1.00 50.92  ? 14   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -18.104 78.408 36.113 1.00 50.92  ? 14   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -18.869 79.642 35.645 1.00 50.92  ? 14   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -19.489 79.414 34.267 1.00 50.92  ? 14   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -20.491 80.479 33.940 1.00 50.92  ? 14   LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -15.450 78.280 39.780 1.00 35.33  ? 15   VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -15.001 78.590 41.122 1.00 35.33  ? 15   VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -14.692 80.070 41.253 1.00 35.33  ? 15   VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -14.174 80.689 40.331 1.00 35.33  ? 15   VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -13.747 77.754 41.485 1.00 37.15  ? 15   VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -13.119 78.270 42.758 1.00 37.15  ? 15   VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -14.144 76.306 41.685 1.00 37.15  ? 15   VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -15.029 80.635 42.405 1.00 33.35  ? 16   MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -14.785 82.045 42.663 1.00 33.35  ? 16   MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -13.819 82.233 43.822 1.00 33.35  ? 16   MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -14.109 81.865 44.958 1.00 33.35  ? 16   MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -16.090 82.764 42.987 1.00 71.79  ? 16   MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -15.871 84.150 43.579 1.00 71.79  ? 16   MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -16.163 85.466 42.401 1.00 71.79  ? 16   MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -14.695 85.397 41.379 1.00 71.79  ? 16   MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -12.678 82.835 43.529 1.00 37.26  ? 17   GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -11.695 83.052 44.563 1.00 37.26  ? 17   GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -11.797 84.422 45.190 1.00 37.26  ? 17   GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -12.817 85.103 45.086 1.00 37.26  ? 17   GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -10.712 84.826 45.836 1.00 40.35  ? 18   THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -10.643 86.113 46.497 1.00 40.35  ? 18   THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -9.244  86.690 46.360 1.00 40.35  ? 18   THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -8.272  85.958 46.175 1.00 40.35  ? 18   THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -10.992 85.972 47.980 1.00 47.45  ? 18   THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -10.689 87.198 48.652 1.00 47.45  ? 18   THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -10.193 84.834 48.615 1.00 47.45  ? 18   THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -9.145  88.010 46.437 1.00 43.66  ? 19   ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -7.861  88.685 46.316 1.00 43.66  ? 19   ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -7.296  88.834 47.729 1.00 43.66  ? 19   ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -8.028  89.200 48.654 1.00 43.66  ? 19   ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -8.063  90.049 45.646 1.00 60.07  ? 19   ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -6.778  90.784 45.330 1.00 60.07  ? 19   ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -6.983  91.865 44.256 1.00 60.07  ? 19   ARG A CD  1 
ATOM   115  N NE  . ARG A 1 19  ? -5.879  91.844 43.294 1.00 60.07  ? 19   ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 19  ? -5.011  92.835 43.105 1.00 60.07  ? 19   ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 19  ? -5.112  93.958 43.808 1.00 60.07  ? 19   ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 19  ? -4.026  92.692 42.226 1.00 60.07  ? 19   ARG A NH2 1 
ATOM   119  N N   . VAL A 1 20  ? -6.012  88.515 47.911 1.00 40.18  ? 20   VAL A N   1 
ATOM   120  C CA  . VAL A 1 20  ? -5.397  88.619 49.234 1.00 40.18  ? 20   VAL A CA  1 
ATOM   121  C C   . VAL A 1 20  ? -4.085  89.393 49.224 1.00 40.18  ? 20   VAL A C   1 
ATOM   122  O O   . VAL A 1 20  ? -3.260  89.228 48.327 1.00 40.18  ? 20   VAL A O   1 
ATOM   123  C CB  . VAL A 1 20  ? -5.110  87.221 49.860 1.00 45.87  ? 20   VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 20  ? -6.401  86.422 49.986 1.00 45.87  ? 20   VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 20  ? -4.102  86.476 49.018 1.00 45.87  ? 20   VAL A CG2 1 
ATOM   126  N N   . PRO A 1 21  ? -3.877  90.247 50.236 1.00 41.27  ? 21   PRO A N   1 
ATOM   127  C CA  . PRO A 1 21  ? -2.655  91.043 50.338 1.00 41.27  ? 21   PRO A CA  1 
ATOM   128  C C   . PRO A 1 21  ? -1.480  90.188 50.815 1.00 41.27  ? 21   PRO A C   1 
ATOM   129  O O   . PRO A 1 21  ? -1.641  89.290 51.657 1.00 41.27  ? 21   PRO A O   1 
ATOM   130  C CB  . PRO A 1 21  ? -3.039  92.130 51.341 1.00 37.26  ? 21   PRO A CB  1 
ATOM   131  C CG  . PRO A 1 21  ? -3.958  91.408 52.264 1.00 37.26  ? 21   PRO A CG  1 
ATOM   132  C CD  . PRO A 1 21  ? -4.826  90.601 51.310 1.00 37.26  ? 21   PRO A CD  1 
ATOM   133  N N   . VAL A 1 22  ? -0.305  90.478 50.265 1.00 36.34  ? 22   VAL A N   1 
ATOM   134  C CA  . VAL A 1 22  ? 0.913   89.768 50.601 1.00 36.34  ? 22   VAL A CA  1 
ATOM   135  C C   . VAL A 1 22  ? 2.107   90.685 50.342 1.00 36.34  ? 22   VAL A C   1 
ATOM   136  O O   . VAL A 1 22  ? 2.298   91.158 49.224 1.00 36.34  ? 22   VAL A O   1 
ATOM   137  C CB  . VAL A 1 22  ? 1.037   88.457 49.748 1.00 36.17  ? 22   VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 22  ? 0.903   88.780 48.274 1.00 36.17  ? 22   VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 22  ? 2.365   87.758 50.021 1.00 36.17  ? 22   VAL A CG2 1 
ATOM   140  N N   . LEU A 1 23  ? 2.898   90.936 51.387 1.00 44.31  ? 23   LEU A N   1 
ATOM   141  C CA  . LEU A 1 23  ? 4.092   91.789 51.292 1.00 44.31  ? 23   LEU A CA  1 
ATOM   142  C C   . LEU A 1 23  ? 3.858   93.085 50.489 1.00 44.31  ? 23   LEU A C   1 
ATOM   143  O O   . LEU A 1 23  ? 4.618   93.423 49.572 1.00 44.31  ? 23   LEU A O   1 
ATOM   144  C CB  . LEU A 1 23  ? 5.255   90.991 50.680 1.00 49.28  ? 23   LEU A CB  1 
ATOM   145  C CG  . LEU A 1 23  ? 5.686   89.720 51.432 1.00 49.28  ? 23   LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 23  ? 6.831   89.034 50.703 1.00 49.28  ? 23   LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 23  ? 6.111   90.090 52.852 1.00 49.28  ? 23   LEU A CD2 1 
ATOM   148  N N   . SER A 1 24  ? 2.798   93.800 50.859 1.00 58.90  ? 24   SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? 2.399   95.060 50.225 1.00 58.90  ? 24   SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? 1.997   94.891 48.750 1.00 58.90  ? 24   SER A C   1 
ATOM   151  O O   . SER A 1 24  ? 2.135   95.813 47.949 1.00 58.90  ? 24   SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? 3.517   96.109 50.346 1.00 56.72  ? 24   SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? 4.352   96.098 49.193 1.00 56.72  ? 24   SER A OG  1 
ATOM   154  N N   . SER A 1 25  ? 1.512   93.707 48.392 1.00 44.35  ? 25   SER A N   1 
ATOM   155  C CA  . SER A 1 25  ? 1.052   93.447 47.030 1.00 44.35  ? 25   SER A CA  1 
ATOM   156  C C   . SER A 1 25  ? -0.166  92.535 47.108 1.00 44.35  ? 25   SER A C   1 
ATOM   157  O O   . SER A 1 25  ? -0.793  92.435 48.165 1.00 44.35  ? 25   SER A O   1 
ATOM   158  C CB  . SER A 1 25  ? 2.139   92.797 46.184 1.00 46.84  ? 25   SER A CB  1 
ATOM   159  O OG  . SER A 1 25  ? 1.693   92.697 44.837 1.00 46.84  ? 25   SER A OG  1 
ATOM   160  N N   . HIS A 1 26  ? -0.514  91.872 46.011 1.00 38.04  ? 26   HIS A N   1 
ATOM   161  C CA  . HIS A 1 26  ? -1.692  91.004 46.028 1.00 38.04  ? 26   HIS A CA  1 
ATOM   162  C C   . HIS A 1 26  ? -1.603  89.807 45.093 1.00 38.04  ? 26   HIS A C   1 
ATOM   163  O O   . HIS A 1 26  ? -0.872  89.832 44.107 1.00 38.04  ? 26   HIS A O   1 
ATOM   164  C CB  . HIS A 1 26  ? -2.959  91.790 45.639 1.00 62.29  ? 26   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 26  ? -3.354  92.852 46.617 1.00 62.29  ? 26   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 26  ? -3.027  94.183 46.445 1.00 62.29  ? 26   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 26  ? -4.084  92.789 47.759 1.00 62.29  ? 26   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 26  ? -3.541  94.893 47.437 1.00 62.29  ? 26   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 26  ? -4.187  94.072 48.249 1.00 62.29  ? 26   HIS A NE2 1 
ATOM   170  N N   . ILE A 1 27  ? -2.372  88.767 45.413 1.00 40.05  ? 27   ILE A N   1 
ATOM   171  C CA  . ILE A 1 27  ? -2.447  87.569 44.587 1.00 40.05  ? 27   ILE A CA  1 
ATOM   172  C C   . ILE A 1 27  ? -3.840  86.986 44.749 1.00 40.05  ? 27   ILE A C   1 
ATOM   173  O O   . ILE A 1 27  ? -4.609  87.431 45.599 1.00 40.05  ? 27   ILE A O   1 
ATOM   174  C CB  . ILE A 1 27  ? -1.409  86.491 44.981 1.00 43.50  ? 27   ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 27  ? -1.643  86.037 46.411 1.00 43.50  ? 27   ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 27  ? 0.001   87.032 44.809 1.00 43.50  ? 27   ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 27  ? -0.747  84.902 46.803 1.00 43.50  ? 27   ILE A CD1 1 
ATOM   178  N N   . SER A 1 28  ? -4.170  85.994 43.934 1.00 36.44  ? 28   SER A N   1 
ATOM   179  C CA  . SER A 1 28  ? -5.483  85.377 44.008 1.00 36.44  ? 28   SER A CA  1 
ATOM   180  C C   . SER A 1 28  ? -5.398  84.122 44.856 1.00 36.44  ? 28   SER A C   1 
ATOM   181  O O   . SER A 1 28  ? -4.380  83.437 44.874 1.00 36.44  ? 28   SER A O   1 
ATOM   182  C CB  . SER A 1 28  ? -5.979  85.007 42.608 1.00 41.66  ? 28   SER A CB  1 
ATOM   183  O OG  . SER A 1 28  ? -5.824  86.089 41.706 1.00 41.66  ? 28   SER A OG  1 
ATOM   184  N N   . ALA A 1 29  ? -6.470  83.832 45.571 1.00 34.05  ? 29   ALA A N   1 
ATOM   185  C CA  . ALA A 1 29  ? -6.522  82.650 46.397 1.00 34.05  ? 29   ALA A CA  1 
ATOM   186  C C   . ALA A 1 29  ? -7.856  81.974 46.155 1.00 34.05  ? 29   ALA A C   1 
ATOM   187  O O   . ALA A 1 29  ? -8.897  82.632 46.089 1.00 34.05  ? 29   ALA A O   1 
ATOM   188  C CB  . ALA A 1 29  ? -6.380  83.017 47.873 1.00 36.00  ? 29   ALA A CB  1 
ATOM   189  N N   . PHE A 1 30  ? -7.819  80.661 45.978 1.00 32.10  ? 30   PHE A N   1 
ATOM   190  C CA  . PHE A 1 30  ? -9.040  79.899 45.786 1.00 32.10  ? 30   PHE A CA  1 
ATOM   191  C C   . PHE A 1 30  ? -8.991  78.903 46.916 1.00 32.10  ? 30   PHE A C   1 
ATOM   192  O O   . PHE A 1 30  ? -8.230  77.942 46.872 1.00 32.10  ? 30   PHE A O   1 
ATOM   193  C CB  . PHE A 1 30  ? -9.049  79.201 44.422 1.00 30.73  ? 30   PHE A CB  1 
ATOM   194  C CG  . PHE A 1 30  ? -9.016  80.151 43.252 1.00 30.73  ? 30   PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 30  ? -7.821  80.739 42.850 1.00 30.73  ? 30   PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 30  ? -10.183 80.454 42.553 1.00 30.73  ? 30   PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 30  ? -7.783  81.615 41.764 1.00 30.73  ? 30   PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 30  ? -10.164 81.326 41.468 1.00 30.73  ? 30   PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 30  ? -8.958  81.909 41.071 1.00 30.73  ? 30   PHE A CZ  1 
ATOM   200  N N   . LEU A 1 31  ? -9.787  79.157 47.945 1.00 35.89  ? 31   LEU A N   1 
ATOM   201  C CA  . LEU A 1 31  ? -9.806  78.308 49.127 1.00 35.89  ? 31   LEU A CA  1 
ATOM   202  C C   . LEU A 1 31  ? -11.022 77.397 49.227 1.00 35.89  ? 31   LEU A C   1 
ATOM   203  O O   . LEU A 1 31  ? -12.132 77.771 48.853 1.00 35.89  ? 31   LEU A O   1 
ATOM   204  C CB  . LEU A 1 31  ? -9.720  79.186 50.378 1.00 28.11  ? 31   LEU A CB  1 
ATOM   205  C CG  . LEU A 1 31  ? -8.622  80.251 50.316 1.00 28.11  ? 31   LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 31  ? -8.643  81.121 51.571 1.00 28.11  ? 31   LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 31  ? -7.279  79.575 50.151 1.00 28.11  ? 31   LEU A CD2 1 
ATOM   208  N N   . GLY A 1 32  ? -10.795 76.195 49.744 1.00 38.28  ? 32   GLY A N   1 
ATOM   209  C CA  . GLY A 1 32  ? -11.867 75.232 49.917 1.00 38.28  ? 32   GLY A CA  1 
ATOM   210  C C   . GLY A 1 32  ? -12.503 74.668 48.656 1.00 38.28  ? 32   GLY A C   1 
ATOM   211  O O   . GLY A 1 32  ? -13.724 74.562 48.591 1.00 38.28  ? 32   GLY A O   1 
ATOM   212  N N   . ILE A 1 33  ? -11.705 74.313 47.650 1.00 35.42  ? 33   ILE A N   1 
ATOM   213  C CA  . ILE A 1 33  ? -12.272 73.736 46.440 1.00 35.42  ? 33   ILE A CA  1 
ATOM   214  C C   . ILE A 1 33  ? -12.423 72.246 46.723 1.00 35.42  ? 33   ILE A C   1 
ATOM   215  O O   . ILE A 1 33  ? -11.462 71.588 47.124 1.00 35.42  ? 33   ILE A O   1 
ATOM   216  C CB  . ILE A 1 33  ? -11.358 73.905 45.226 1.00 36.75  ? 33   ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 33  ? -11.080 75.385 44.968 1.00 36.75  ? 33   ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 33  ? -12.017 73.278 44.018 1.00 36.75  ? 33   ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 33  ? -10.098 75.632 43.828 1.00 36.75  ? 33   ILE A CD1 1 
ATOM   220  N N   . PRO A 1 34  ? -13.628 71.691 46.518 1.00 34.84  ? 34   PRO A N   1 
ATOM   221  C CA  . PRO A 1 34  ? -13.832 70.264 46.782 1.00 34.84  ? 34   PRO A CA  1 
ATOM   222  C C   . PRO A 1 34  ? -13.299 69.365 45.665 1.00 34.84  ? 34   PRO A C   1 
ATOM   223  O O   . PRO A 1 34  ? -13.491 69.658 44.486 1.00 34.84  ? 34   PRO A O   1 
ATOM   224  C CB  . PRO A 1 34  ? -15.347 70.171 46.953 1.00 32.65  ? 34   PRO A CB  1 
ATOM   225  C CG  . PRO A 1 34  ? -15.841 71.181 45.929 1.00 32.65  ? 34   PRO A CG  1 
ATOM   226  C CD  . PRO A 1 34  ? -14.891 72.352 46.128 1.00 32.65  ? 34   PRO A CD  1 
ATOM   227  N N   . PHE A 1 35  ? -12.629 68.274 46.037 1.00 35.06  ? 35   PHE A N   1 
ATOM   228  C CA  . PHE A 1 35  ? -12.082 67.343 45.044 1.00 35.06  ? 35   PHE A CA  1 
ATOM   229  C C   . PHE A 1 35  ? -12.615 65.931 45.237 1.00 35.06  ? 35   PHE A C   1 
ATOM   230  O O   . PHE A 1 35  ? -12.280 65.026 44.486 1.00 35.06  ? 35   PHE A O   1 
ATOM   231  C CB  . PHE A 1 35  ? -10.544 67.333 45.103 1.00 31.38  ? 35   PHE A CB  1 
ATOM   232  C CG  . PHE A 1 35  ? -9.976  66.818 46.409 1.00 31.38  ? 35   PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 35  ? -9.924  65.455 46.675 1.00 31.38  ? 35   PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 35  ? -9.477  67.701 47.362 1.00 31.38  ? 35   PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 35  ? -9.384  64.980 47.867 1.00 31.38  ? 35   PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 35  ? -8.934  67.235 48.561 1.00 31.38  ? 35   PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 35  ? -8.888  65.873 48.811 1.00 31.38  ? 35   PHE A CZ  1 
ATOM   238  N N   . ALA A 1 36  ? -13.463 65.747 46.237 1.00 36.64  ? 36   ALA A N   1 
ATOM   239  C CA  . ALA A 1 36  ? -14.025 64.432 46.512 1.00 36.64  ? 36   ALA A CA  1 
ATOM   240  C C   . ALA A 1 36  ? -15.386 64.570 47.164 1.00 36.64  ? 36   ALA A C   1 
ATOM   241  O O   . ALA A 1 36  ? -15.707 65.618 47.715 1.00 36.64  ? 36   ALA A O   1 
ATOM   242  C CB  . ALA A 1 36  ? -13.097 63.666 47.445 1.00 30.43  ? 36   ALA A CB  1 
ATOM   243  N N   . GLU A 1 37  ? -16.193 63.518 47.100 1.00 43.27  ? 37   GLU A N   1 
ATOM   244  C CA  . GLU A 1 37  ? -17.492 63.549 47.754 1.00 43.27  ? 37   GLU A CA  1 
ATOM   245  C C   . GLU A 1 37  ? -17.216 63.423 49.253 1.00 43.27  ? 37   GLU A C   1 
ATOM   246  O O   . GLU A 1 37  ? -16.267 62.750 49.656 1.00 43.27  ? 37   GLU A O   1 
ATOM   247  C CB  . GLU A 1 37  ? -18.367 62.376 47.298 1.00 53.45  ? 37   GLU A CB  1 
ATOM   248  C CG  . GLU A 1 37  ? -19.023 62.564 45.924 1.00 53.45  ? 37   GLU A CG  1 
ATOM   249  C CD  . GLU A 1 37  ? -20.003 63.732 45.895 1.00 53.45  ? 37   GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 37  ? -20.942 63.735 46.712 1.00 53.45  ? 37   GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 37  ? -19.838 64.651 45.057 1.00 53.45  ? 37   GLU A OE2 1 
ATOM   252  N N   . PRO A 1 38  ? -18.018 64.099 50.093 1.00 46.65  ? 38   PRO A N   1 
ATOM   253  C CA  . PRO A 1 38  ? -17.833 64.031 51.547 1.00 46.65  ? 38   PRO A CA  1 
ATOM   254  C C   . PRO A 1 38  ? -17.909 62.583 52.033 1.00 46.65  ? 38   PRO A C   1 
ATOM   255  O O   . PRO A 1 38  ? -18.930 61.927 51.873 1.00 46.65  ? 38   PRO A O   1 
ATOM   256  C CB  . PRO A 1 38  ? -18.983 64.883 52.073 1.00 36.48  ? 38   PRO A CB  1 
ATOM   257  C CG  . PRO A 1 38  ? -19.068 65.955 51.045 1.00 36.48  ? 38   PRO A CG  1 
ATOM   258  C CD  . PRO A 1 38  ? -18.972 65.167 49.741 1.00 36.48  ? 38   PRO A CD  1 
ATOM   259  N N   . PRO A 1 39  ? -16.821 62.073 52.638 1.00 44.43  ? 39   PRO A N   1 
ATOM   260  C CA  . PRO A 1 39  ? -16.734 60.701 53.154 1.00 44.43  ? 39   PRO A CA  1 
ATOM   261  C C   . PRO A 1 39  ? -17.496 60.491 54.452 1.00 44.43  ? 39   PRO A C   1 
ATOM   262  O O   . PRO A 1 39  ? -16.906 60.134 55.476 1.00 44.43  ? 39   PRO A O   1 
ATOM   263  C CB  . PRO A 1 39  ? -15.236 60.515 53.346 1.00 51.31  ? 39   PRO A CB  1 
ATOM   264  C CG  . PRO A 1 39  ? -14.818 61.869 53.819 1.00 51.31  ? 39   PRO A CG  1 
ATOM   265  C CD  . PRO A 1 39  ? -15.543 62.781 52.838 1.00 51.31  ? 39   PRO A CD  1 
ATOM   266  N N   . VAL A 1 40  ? -18.806 60.694 54.410 1.00 47.19  ? 40   VAL A N   1 
ATOM   267  C CA  . VAL A 1 40  ? -19.620 60.555 55.611 1.00 47.19  ? 40   VAL A CA  1 
ATOM   268  C C   . VAL A 1 40  ? -20.589 59.377 55.573 1.00 47.19  ? 40   VAL A C   1 
ATOM   269  O O   . VAL A 1 40  ? -20.775 58.735 54.535 1.00 47.19  ? 40   VAL A O   1 
ATOM   270  C CB  . VAL A 1 40  ? -20.421 61.847 55.863 1.00 42.20  ? 40   VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 40  ? -19.467 63.023 56.016 1.00 42.20  ? 40   VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 40  ? -21.362 62.102 54.698 1.00 42.20  ? 40   VAL A CG2 1 
ATOM   273  N N   . GLY A 1 41  ? -21.205 59.105 56.717 1.00 48.81  ? 41   GLY A N   1 
ATOM   274  C CA  . GLY A 1 41  ? -22.157 58.014 56.819 1.00 48.81  ? 41   GLY A CA  1 
ATOM   275  C C   . GLY A 1 41  ? -21.570 56.697 56.353 1.00 48.81  ? 41   GLY A C   1 
ATOM   276  O O   . GLY A 1 41  ? -20.504 56.279 56.818 1.00 48.81  ? 41   GLY A O   1 
ATOM   277  N N   . ASN A 1 42  ? -22.272 56.044 55.429 1.00 43.67  ? 42   ASN A N   1 
ATOM   278  C CA  . ASN A 1 42  ? -21.829 54.771 54.885 1.00 43.67  ? 42   ASN A CA  1 
ATOM   279  C C   . ASN A 1 42  ? -20.511 54.897 54.134 1.00 43.67  ? 42   ASN A C   1 
ATOM   280  O O   . ASN A 1 42  ? -19.886 53.887 53.803 1.00 43.67  ? 42   ASN A O   1 
ATOM   281  C CB  . ASN A 1 42  ? -22.912 54.190 53.969 1.00 81.28  ? 42   ASN A CB  1 
ATOM   282  C CG  . ASN A 1 42  ? -23.874 53.278 54.719 1.00 81.28  ? 42   ASN A CG  1 
ATOM   283  O OD1 . ASN A 1 42  ? -24.164 53.496 55.908 1.00 81.28  ? 42   ASN A OD1 1 
ATOM   284  N ND2 . ASN A 1 42  ? -24.378 52.247 54.029 1.00 81.28  ? 42   ASN A ND2 1 
ATOM   285  N N   . MET A 1 43  ? -20.080 56.126 53.867 1.00 43.45  ? 43   MET A N   1 
ATOM   286  C CA  . MET A 1 43  ? -18.812 56.322 53.166 1.00 43.45  ? 43   MET A CA  1 
ATOM   287  C C   . MET A 1 43  ? -17.573 56.355 54.087 1.00 43.45  ? 43   MET A C   1 
ATOM   288  O O   . MET A 1 43  ? -16.440 56.338 53.598 1.00 43.45  ? 43   MET A O   1 
ATOM   289  C CB  . MET A 1 43  ? -18.854 57.599 52.314 1.00 67.07  ? 43   MET A CB  1 
ATOM   290  C CG  . MET A 1 43  ? -19.691 57.491 51.045 1.00 67.07  ? 43   MET A CG  1 
ATOM   291  S SD  . MET A 1 43  ? -19.405 58.921 49.943 1.00 67.07  ? 43   MET A SD  1 
ATOM   292  C CE  . MET A 1 43  ? -17.625 58.676 49.564 1.00 67.07  ? 43   MET A CE  1 
ATOM   293  N N   . ARG A 1 44  ? -17.775 56.391 55.404 1.00 36.87  ? 44   ARG A N   1 
ATOM   294  C CA  . ARG A 1 44  ? -16.647 56.418 56.344 1.00 36.87  ? 44   ARG A CA  1 
ATOM   295  C C   . ARG A 1 44  ? -15.786 55.160 56.175 1.00 36.87  ? 44   ARG A C   1 
ATOM   296  O O   . ARG A 1 44  ? -16.307 54.051 56.064 1.00 36.87  ? 44   ARG A O   1 
ATOM   297  C CB  . ARG A 1 44  ? -17.154 56.527 57.799 1.00 28.99  ? 44   ARG A CB  1 
ATOM   298  C CG  . ARG A 1 44  ? -16.041 56.564 58.845 1.00 28.99  ? 44   ARG A CG  1 
ATOM   299  C CD  . ARG A 1 44  ? -16.564 56.505 60.282 1.00 28.99  ? 44   ARG A CD  1 
ATOM   300  N NE  . ARG A 1 44  ? -17.221 57.734 60.703 1.00 28.99  ? 44   ARG A NE  1 
ATOM   301  C CZ  . ARG A 1 44  ? -17.877 57.875 61.849 1.00 28.99  ? 44   ARG A CZ  1 
ATOM   302  N NH1 . ARG A 1 44  ? -17.970 56.858 62.696 1.00 28.99  ? 44   ARG A NH1 1 
ATOM   303  N NH2 . ARG A 1 44  ? -18.437 59.034 62.155 1.00 28.99  ? 44   ARG A NH2 1 
ATOM   304  N N   . PHE A 1 45  ? -14.472 55.349 56.154 1.00 32.74  ? 45   PHE A N   1 
ATOM   305  C CA  . PHE A 1 45  ? -13.485 54.276 55.979 1.00 32.74  ? 45   PHE A CA  1 
ATOM   306  C C   . PHE A 1 45  ? -13.387 53.827 54.525 1.00 32.74  ? 45   PHE A C   1 
ATOM   307  O O   . PHE A 1 45  ? -12.444 53.142 54.142 1.00 32.74  ? 45   PHE A O   1 
ATOM   308  C CB  . PHE A 1 45  ? -13.804 53.057 56.859 1.00 38.08  ? 45   PHE A CB  1 
ATOM   309  C CG  . PHE A 1 45  ? -13.978 53.381 58.324 1.00 38.08  ? 45   PHE A CG  1 
ATOM   310  C CD1 . PHE A 1 45  ? -13.018 54.119 59.010 1.00 38.08  ? 45   PHE A CD1 1 
ATOM   311  C CD2 . PHE A 1 45  ? -15.104 52.939 59.016 1.00 38.08  ? 45   PHE A CD2 1 
ATOM   312  C CE1 . PHE A 1 45  ? -13.175 54.416 60.371 1.00 38.08  ? 45   PHE A CE1 1 
ATOM   313  C CE2 . PHE A 1 45  ? -15.275 53.227 60.372 1.00 38.08  ? 45   PHE A CE2 1 
ATOM   314  C CZ  . PHE A 1 45  ? -14.307 53.969 61.053 1.00 38.08  ? 45   PHE A CZ  1 
ATOM   315  N N   . ARG A 1 46  ? -14.350 54.235 53.709 1.00 40.03  ? 46   ARG A N   1 
ATOM   316  C CA  . ARG A 1 46  ? -14.382 53.848 52.299 1.00 40.03  ? 46   ARG A CA  1 
ATOM   317  C C   . ARG A 1 46  ? -13.443 54.676 51.403 1.00 40.03  ? 46   ARG A C   1 
ATOM   318  O O   . ARG A 1 46  ? -13.068 55.798 51.743 1.00 40.03  ? 46   ARG A O   1 
ATOM   319  C CB  . ARG A 1 46  ? -15.833 53.953 51.795 1.00 73.93  ? 46   ARG A CB  1 
ATOM   320  C CG  . ARG A 1 46  ? -16.165 53.112 50.567 1.00 73.93  ? 46   ARG A CG  1 
ATOM   321  C CD  . ARG A 1 46  ? -17.654 53.199 50.189 1.00 73.93  ? 46   ARG A CD  1 
ATOM   322  N NE  . ARG A 1 46  ? -18.525 52.466 51.112 1.00 73.93  ? 46   ARG A NE  1 
ATOM   323  C CZ  . ARG A 1 46  ? -19.861 52.414 51.023 1.00 73.93  ? 46   ARG A CZ  1 
ATOM   324  N NH1 . ARG A 1 46  ? -20.502 53.057 50.049 1.00 73.93  ? 46   ARG A NH1 1 
ATOM   325  N NH2 . ARG A 1 46  ? -20.562 51.705 51.907 1.00 73.93  ? 46   ARG A NH2 1 
ATOM   326  N N   . ARG A 1 47  ? -13.043 54.112 50.265 1.00 38.20  ? 47   ARG A N   1 
ATOM   327  C CA  . ARG A 1 47  ? -12.194 54.846 49.334 1.00 38.20  ? 47   ARG A CA  1 
ATOM   328  C C   . ARG A 1 47  ? -12.952 56.102 48.881 1.00 38.20  ? 47   ARG A C   1 
ATOM   329  O O   . ARG A 1 47  ? -14.175 56.103 48.798 1.00 38.20  ? 47   ARG A O   1 
ATOM   330  C CB  . ARG A 1 47  ? -11.870 53.991 48.114 1.00 55.86  ? 47   ARG A CB  1 
ATOM   331  C CG  . ARG A 1 47  ? -10.976 52.802 48.391 1.00 55.86  ? 47   ARG A CG  1 
ATOM   332  C CD  . ARG A 1 47  ? -10.605 52.120 47.084 1.00 55.86  ? 47   ARG A CD  1 
ATOM   333  N NE  . ARG A 1 47  ? -9.578  51.092 47.255 1.00 55.86  ? 47   ARG A NE  1 
ATOM   334  C CZ  . ARG A 1 47  ? -9.828  49.803 47.477 1.00 55.86  ? 47   ARG A CZ  1 
ATOM   335  N NH1 . ARG A 1 47  ? -11.088 49.363 47.559 1.00 55.86  ? 47   ARG A NH1 1 
ATOM   336  N NH2 . ARG A 1 47  ? -8.809  48.951 47.606 1.00 55.86  ? 47   ARG A NH2 1 
ATOM   337  N N   . PRO A 1 48  ? -12.233 57.185 48.568 1.00 33.75  ? 48   PRO A N   1 
ATOM   338  C CA  . PRO A 1 48  ? -12.928 58.398 48.137 1.00 33.75  ? 48   PRO A CA  1 
ATOM   339  C C   . PRO A 1 48  ? -13.500 58.299 46.725 1.00 33.75  ? 48   PRO A C   1 
ATOM   340  O O   . PRO A 1 48  ? -12.996 57.544 45.887 1.00 33.75  ? 48   PRO A O   1 
ATOM   341  C CB  . PRO A 1 48  ? -11.847 59.459 48.237 1.00 33.70  ? 48   PRO A CB  1 
ATOM   342  C CG  . PRO A 1 48  ? -10.617 58.695 47.802 1.00 33.70  ? 48   PRO A CG  1 
ATOM   343  C CD  . PRO A 1 48  ? -10.769 57.365 48.534 1.00 33.70  ? 48   PRO A CD  1 
ATOM   344  N N   . GLU A 1 49  ? -14.564 59.056 46.473 1.00 36.49  ? 49   GLU A N   1 
ATOM   345  C CA  . GLU A 1 49  ? -15.187 59.096 45.158 1.00 36.49  ? 49   GLU A CA  1 
ATOM   346  C C   . GLU A 1 49  ? -15.054 60.527 44.637 1.00 36.49  ? 49   GLU A C   1 
ATOM   347  O O   . GLU A 1 49  ? -15.053 61.477 45.420 1.00 36.49  ? 49   GLU A O   1 
ATOM   348  C CB  . GLU A 1 49  ? -16.661 58.686 45.246 1.00 87.97  ? 49   GLU A CB  1 
ATOM   349  C CG  . GLU A 1 49  ? -16.885 57.197 45.607 1.00 87.97  ? 49   GLU A CG  1 
ATOM   350  C CD  . GLU A 1 49  ? -16.090 56.229 44.713 1.00 87.97  ? 49   GLU A CD  1 
ATOM   351  O OE1 . GLU A 1 49  ? -16.139 56.378 43.464 1.00 87.97  ? 49   GLU A OE1 1 
ATOM   352  O OE2 . GLU A 1 49  ? -15.421 55.306 45.257 1.00 87.97  ? 49   GLU A OE2 1 
ATOM   353  N N   . PRO A 1 50  ? -14.930 60.697 43.312 1.00 45.16  ? 50   PRO A N   1 
ATOM   354  C CA  . PRO A 1 50  ? -14.789 62.020 42.696 1.00 45.16  ? 50   PRO A CA  1 
ATOM   355  C C   . PRO A 1 50  ? -15.962 62.941 43.014 1.00 45.16  ? 50   PRO A C   1 
ATOM   356  O O   . PRO A 1 50  ? -17.114 62.498 43.047 1.00 45.16  ? 50   PRO A O   1 
ATOM   357  C CB  . PRO A 1 50  ? -14.709 61.706 41.197 1.00 45.95  ? 50   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 50  ? -14.225 60.273 41.145 1.00 45.95  ? 50   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 50  ? -14.983 59.642 42.280 1.00 45.95  ? 50   PRO A CD  1 
ATOM   360  N N   . LYS A 1 51  ? -15.676 64.218 43.246 1.00 38.90  ? 51   LYS A N   1 
ATOM   361  C CA  . LYS A 1 51  ? -16.737 65.176 43.541 1.00 38.90  ? 51   LYS A CA  1 
ATOM   362  C C   . LYS A 1 51  ? -17.574 65.386 42.284 1.00 38.90  ? 51   LYS A C   1 
ATOM   363  O O   . LYS A 1 51  ? -17.033 65.615 41.202 1.00 38.90  ? 51   LYS A O   1 
ATOM   364  C CB  . LYS A 1 51  ? -16.137 66.507 43.985 1.00 34.26  ? 51   LYS A CB  1 
ATOM   365  C CG  . LYS A 1 51  ? -17.133 67.647 44.119 1.00 34.26  ? 51   LYS A CG  1 
ATOM   366  C CD  . LYS A 1 51  ? -18.094 67.449 45.279 1.00 34.26  ? 51   LYS A CD  1 
ATOM   367  C CE  . LYS A 1 51  ? -18.925 68.705 45.491 1.00 34.26  ? 51   LYS A CE  1 
ATOM   368  N NZ  . LYS A 1 51  ? -19.905 68.556 46.599 1.00 34.26  ? 51   LYS A NZ  1 
ATOM   369  N N   . LYS A 1 52  ? -18.894 65.305 42.428 1.00 38.82  ? 52   LYS A N   1 
ATOM   370  C CA  . LYS A 1 52  ? -19.790 65.498 41.293 1.00 38.82  ? 52   LYS A CA  1 
ATOM   371  C C   . LYS A 1 52  ? -19.767 66.954 40.847 1.00 38.82  ? 52   LYS A C   1 
ATOM   372  O O   . LYS A 1 52  ? -19.769 67.869 41.672 1.00 38.82  ? 52   LYS A O   1 
ATOM   373  C CB  . LYS A 1 52  ? -21.206 65.080 41.679 1.00 61.44  ? 52   LYS A CB  1 
ATOM   374  C CG  . LYS A 1 52  ? -21.341 63.576 41.849 1.00 61.44  ? 52   LYS A CG  1 
ATOM   375  C CD  . LYS A 1 52  ? -22.513 63.196 42.748 1.00 61.44  ? 52   LYS A CD  1 
ATOM   376  C CE  . LYS A 1 52  ? -22.528 61.672 42.972 1.00 61.44  ? 52   LYS A CE  1 
ATOM   377  N NZ  . LYS A 1 52  ? -23.463 61.231 44.062 1.00 61.44  ? 52   LYS A NZ  1 
ATOM   378  N N   . PRO A 1 53  ? -19.726 67.187 39.526 1.00 41.87  ? 53   PRO A N   1 
ATOM   379  C CA  . PRO A 1 53  ? -19.702 68.561 39.017 1.00 41.87  ? 53   PRO A CA  1 
ATOM   380  C C   . PRO A 1 53  ? -20.884 69.355 39.572 1.00 41.87  ? 53   PRO A C   1 
ATOM   381  O O   . PRO A 1 53  ? -21.932 68.791 39.894 1.00 41.87  ? 53   PRO A O   1 
ATOM   382  C CB  . PRO A 1 53  ? -19.772 68.369 37.504 1.00 40.31  ? 53   PRO A CB  1 
ATOM   383  C CG  . PRO A 1 53  ? -19.073 67.052 37.307 1.00 40.31  ? 53   PRO A CG  1 
ATOM   384  C CD  . PRO A 1 53  ? -19.652 66.215 38.421 1.00 40.31  ? 53   PRO A CD  1 
ATOM   385  N N   . TRP A 1 54  ? -20.709 70.665 39.682 1.00 43.94  ? 54   TRP A N   1 
ATOM   386  C CA  . TRP A 1 54  ? -21.757 71.513 40.228 1.00 43.94  ? 54   TRP A CA  1 
ATOM   387  C C   . TRP A 1 54  ? -22.094 72.661 39.286 1.00 43.94  ? 54   TRP A C   1 
ATOM   388  O O   . TRP A 1 54  ? -21.247 73.115 38.518 1.00 43.94  ? 54   TRP A O   1 
ATOM   389  C CB  . TRP A 1 54  ? -21.300 72.070 41.578 1.00 34.67  ? 54   TRP A CB  1 
ATOM   390  C CG  . TRP A 1 54  ? -20.049 72.889 41.462 1.00 34.67  ? 54   TRP A CG  1 
ATOM   391  C CD1 . TRP A 1 54  ? -19.951 74.191 41.048 1.00 34.67  ? 54   TRP A CD1 1 
ATOM   392  C CD2 . TRP A 1 54  ? -18.709 72.439 41.683 1.00 34.67  ? 54   TRP A CD2 1 
ATOM   393  N NE1 . TRP A 1 54  ? -18.631 74.574 40.993 1.00 34.67  ? 54   TRP A NE1 1 
ATOM   394  C CE2 . TRP A 1 54  ? -17.849 73.517 41.380 1.00 34.67  ? 54   TRP A CE2 1 
ATOM   395  C CE3 . TRP A 1 54  ? -18.149 71.227 42.105 1.00 34.67  ? 54   TRP A CE3 1 
ATOM   396  C CZ2 . TRP A 1 54  ? -16.461 73.418 41.487 1.00 34.67  ? 54   TRP A CZ2 1 
ATOM   397  C CZ3 . TRP A 1 54  ? -16.769 71.131 42.210 1.00 34.67  ? 54   TRP A CZ3 1 
ATOM   398  C CH2 . TRP A 1 54  ? -15.942 72.219 41.903 1.00 34.67  ? 54   TRP A CH2 1 
ATOM   399  N N   . SER A 1 55  ? -23.341 73.121 39.347 1.00 54.64  ? 55   SER A N   1 
ATOM   400  C CA  . SER A 1 55  ? -23.787 74.241 38.521 1.00 54.64  ? 55   SER A CA  1 
ATOM   401  C C   . SER A 1 55  ? -23.553 75.506 39.339 1.00 54.64  ? 55   SER A C   1 
ATOM   402  O O   . SER A 1 55  ? -23.303 75.425 40.540 1.00 54.64  ? 55   SER A O   1 
ATOM   403  C CB  . SER A 1 55  ? -25.274 74.098 38.187 1.00 70.76  ? 55   SER A CB  1 
ATOM   404  O OG  . SER A 1 55  ? -25.485 72.988 37.316 1.00 70.76  ? 55   SER A OG  1 
ATOM   405  N N   . GLY A 1 56  ? -23.632 76.671 38.706 1.00 50.87  ? 56   GLY A N   1 
ATOM   406  C CA  . GLY A 1 56  ? -23.408 77.897 39.452 1.00 50.87  ? 56   GLY A CA  1 
ATOM   407  C C   . GLY A 1 56  ? -21.939 78.084 39.790 1.00 50.87  ? 56   GLY A C   1 
ATOM   408  O O   . GLY A 1 56  ? -21.080 77.395 39.232 1.00 50.87  ? 56   GLY A O   1 
ATOM   409  N N   . VAL A 1 57  ? -21.651 78.998 40.713 1.00 39.90  ? 57   VAL A N   1 
ATOM   410  C CA  . VAL A 1 57  ? -20.278 79.305 41.102 1.00 39.90  ? 57   VAL A CA  1 
ATOM   411  C C   . VAL A 1 57  ? -19.939 78.871 42.522 1.00 39.90  ? 57   VAL A C   1 
ATOM   412  O O   . VAL A 1 57  ? -20.640 79.221 43.479 1.00 39.90  ? 57   VAL A O   1 
ATOM   413  C CB  . VAL A 1 57  ? -20.006 80.817 41.004 1.00 42.33  ? 57   VAL A CB  1 
ATOM   414  C CG1 . VAL A 1 57  ? -18.535 81.097 41.287 1.00 42.33  ? 57   VAL A CG1 1 
ATOM   415  C CG2 . VAL A 1 57  ? -20.402 81.331 39.622 1.00 42.33  ? 57   VAL A CG2 1 
ATOM   416  N N   . TRP A 1 58  ? -18.859 78.112 42.668 1.00 34.78  ? 58   TRP A N   1 
ATOM   417  C CA  . TRP A 1 58  ? -18.463 77.681 43.996 1.00 34.78  ? 58   TRP A CA  1 
ATOM   418  C C   . TRP A 1 58  ? -17.716 78.838 44.645 1.00 34.78  ? 58   TRP A C   1 
ATOM   419  O O   . TRP A 1 58  ? -16.760 79.354 44.075 1.00 34.78  ? 58   TRP A O   1 
ATOM   420  C CB  . TRP A 1 58  ? -17.566 76.440 43.926 1.00 37.13  ? 58   TRP A CB  1 
ATOM   421  C CG  . TRP A 1 58  ? -17.231 75.898 45.280 1.00 37.13  ? 58   TRP A CG  1 
ATOM   422  C CD1 . TRP A 1 58  ? -16.310 76.401 46.166 1.00 37.13  ? 58   TRP A CD1 1 
ATOM   423  C CD2 . TRP A 1 58  ? -17.886 74.820 45.954 1.00 37.13  ? 58   TRP A CD2 1 
ATOM   424  N NE1 . TRP A 1 58  ? -16.364 75.707 47.344 1.00 37.13  ? 58   TRP A NE1 1 
ATOM   425  C CE2 . TRP A 1 58  ? -17.323 74.730 47.243 1.00 37.13  ? 58   TRP A CE2 1 
ATOM   426  C CE3 . TRP A 1 58  ? -18.901 73.923 45.594 1.00 37.13  ? 58   TRP A CE3 1 
ATOM   427  C CZ2 . TRP A 1 58  ? -17.744 73.772 48.181 1.00 37.13  ? 58   TRP A CZ2 1 
ATOM   428  C CZ3 . TRP A 1 58  ? -19.321 72.969 46.529 1.00 37.13  ? 58   TRP A CZ3 1 
ATOM   429  C CH2 . TRP A 1 58  ? -18.743 72.905 47.803 1.00 37.13  ? 58   TRP A CH2 1 
ATOM   430  N N   . ASN A 1 59  ? -18.168 79.245 45.829 1.00 41.91  ? 59   ASN A N   1 
ATOM   431  C CA  . ASN A 1 59  ? -17.543 80.344 46.569 1.00 41.91  ? 59   ASN A CA  1 
ATOM   432  C C   . ASN A 1 59  ? -16.299 79.786 47.263 1.00 41.91  ? 59   ASN A C   1 
ATOM   433  O O   . ASN A 1 59  ? -16.412 79.068 48.256 1.00 41.91  ? 59   ASN A O   1 
ATOM   434  C CB  . ASN A 1 59  ? -18.520 80.896 47.620 1.00 50.27  ? 59   ASN A CB  1 
ATOM   435  C CG  . ASN A 1 59  ? -17.977 82.121 48.344 1.00 50.27  ? 59   ASN A CG  1 
ATOM   436  O OD1 . ASN A 1 59  ? -16.775 82.392 48.309 1.00 50.27  ? 59   ASN A OD1 1 
ATOM   437  N ND2 . ASN A 1 59  ? -18.863 82.861 49.022 1.00 50.27  ? 59   ASN A ND2 1 
ATOM   438  N N   . ALA A 1 60  ? -15.122 80.116 46.740 1.00 36.52  ? 60   ALA A N   1 
ATOM   439  C CA  . ALA A 1 60  ? -13.859 79.631 47.299 1.00 36.52  ? 60   ALA A CA  1 
ATOM   440  C C   . ALA A 1 60  ? -13.056 80.767 47.919 1.00 36.52  ? 60   ALA A C   1 
ATOM   441  O O   . ALA A 1 60  ? -11.862 80.918 47.649 1.00 36.52  ? 60   ALA A O   1 
ATOM   442  C CB  . ALA A 1 60  ? -13.038 78.958 46.203 1.00 22.84  ? 60   ALA A CB  1 
ATOM   443  N N   . SER A 1 61  ? -13.712 81.554 48.763 1.00 37.13  ? 61   SER A N   1 
ATOM   444  C CA  . SER A 1 61  ? -13.059 82.696 49.393 1.00 37.13  ? 61   SER A CA  1 
ATOM   445  C C   . SER A 1 61  ? -12.640 82.459 50.838 1.00 37.13  ? 61   SER A C   1 
ATOM   446  O O   . SER A 1 61  ? -11.975 83.304 51.434 1.00 37.13  ? 61   SER A O   1 
ATOM   447  C CB  . SER A 1 61  ? -13.983 83.911 49.328 1.00 41.19  ? 61   SER A CB  1 
ATOM   448  O OG  . SER A 1 61  ? -15.148 83.686 50.105 1.00 41.19  ? 61   SER A OG  1 
ATOM   449  N N   . THR A 1 62  ? -13.028 81.321 51.407 1.00 37.96  ? 62   THR A N   1 
ATOM   450  C CA  . THR A 1 62  ? -12.661 81.017 52.786 1.00 37.96  ? 62   THR A CA  1 
ATOM   451  C C   . THR A 1 62  ? -12.157 79.591 52.994 1.00 37.96  ? 62   THR A C   1 
ATOM   452  O O   . THR A 1 62  ? -12.502 78.682 52.248 1.00 37.96  ? 62   THR A O   1 
ATOM   453  C CB  . THR A 1 62  ? -13.838 81.237 53.723 1.00 48.44  ? 62   THR A CB  1 
ATOM   454  O OG1 . THR A 1 62  ? -14.908 80.370 53.338 1.00 48.44  ? 62   THR A OG1 1 
ATOM   455  C CG2 . THR A 1 62  ? -14.306 82.685 53.651 1.00 48.44  ? 62   THR A CG2 1 
ATOM   456  N N   . TYR A 1 63  ? -11.340 79.400 54.020 1.00 40.55  ? 63   TYR A N   1 
ATOM   457  C CA  . TYR A 1 63  ? -10.812 78.078 54.313 1.00 40.55  ? 63   TYR A CA  1 
ATOM   458  C C   . TYR A 1 63  ? -11.923 77.075 54.598 1.00 40.55  ? 63   TYR A C   1 
ATOM   459  O O   . TYR A 1 63  ? -12.991 77.433 55.095 1.00 40.55  ? 63   TYR A O   1 
ATOM   460  C CB  . TYR A 1 63  ? -9.869  78.126 55.510 1.00 33.87  ? 63   TYR A CB  1 
ATOM   461  C CG  . TYR A 1 63  ? -8.470  78.584 55.190 1.00 33.87  ? 63   TYR A CG  1 
ATOM   462  C CD1 . TYR A 1 63  ? -7.789  78.092 54.074 1.00 33.87  ? 63   TYR A CD1 1 
ATOM   463  C CD2 . TYR A 1 63  ? -7.776  79.424 56.069 1.00 33.87  ? 63   TYR A CD2 1 
ATOM   464  C CE1 . TYR A 1 63  ? -6.444  78.411 53.849 1.00 33.87  ? 63   TYR A CE1 1 
ATOM   465  C CE2 . TYR A 1 63  ? -6.429  79.752 55.855 1.00 33.87  ? 63   TYR A CE2 1 
ATOM   466  C CZ  . TYR A 1 63  ? -5.772  79.237 54.747 1.00 33.87  ? 63   TYR A CZ  1 
ATOM   467  O OH  . TYR A 1 63  ? -4.444  79.523 54.564 1.00 33.87  ? 63   TYR A OH  1 
ATOM   468  N N   . PRO A 1 64  ? -11.679 75.797 54.284 1.00 31.71  ? 64   PRO A N   1 
ATOM   469  C CA  . PRO A 1 64  ? -12.647 74.723 54.504 1.00 31.71  ? 64   PRO A CA  1 
ATOM   470  C C   . PRO A 1 64  ? -12.497 74.200 55.923 1.00 31.71  ? 64   PRO A C   1 
ATOM   471  O O   . PRO A 1 64  ? -11.638 74.661 56.659 1.00 31.71  ? 64   PRO A O   1 
ATOM   472  C CB  . PRO A 1 64  ? -12.216 73.680 53.485 1.00 29.85  ? 64   PRO A CB  1 
ATOM   473  C CG  . PRO A 1 64  ? -10.715 73.770 53.595 1.00 29.85  ? 64   PRO A CG  1 
ATOM   474  C CD  . PRO A 1 64  ? -10.471 75.279 53.611 1.00 29.85  ? 64   PRO A CD  1 
ATOM   475  N N   . ASN A 1 65  ? -13.332 73.240 56.304 1.00 32.74  ? 65   ASN A N   1 
ATOM   476  C CA  . ASN A 1 65  ? -13.221 72.649 57.626 1.00 32.74  ? 65   ASN A CA  1 
ATOM   477  C C   . ASN A 1 65  ? -11.963 71.761 57.658 1.00 32.74  ? 65   ASN A C   1 
ATOM   478  O O   . ASN A 1 65  ? -11.385 71.446 56.624 1.00 32.74  ? 65   ASN A O   1 
ATOM   479  C CB  . ASN A 1 65  ? -14.453 71.793 57.939 1.00 49.10  ? 65   ASN A CB  1 
ATOM   480  C CG  . ASN A 1 65  ? -15.716 72.623 58.141 1.00 49.10  ? 65   ASN A CG  1 
ATOM   481  O OD1 . ASN A 1 65  ? -15.756 73.534 58.971 1.00 49.10  ? 65   ASN A OD1 1 
ATOM   482  N ND2 . ASN A 1 65  ? -16.761 72.301 57.385 1.00 49.10  ? 65   ASN A ND2 1 
ATOM   483  N N   . ASN A 1 66  ? -11.531 71.383 58.852 1.00 35.20  ? 66   ASN A N   1 
ATOM   484  C CA  . ASN A 1 66  ? -10.376 70.503 58.998 1.00 35.20  ? 66   ASN A CA  1 
ATOM   485  C C   . ASN A 1 66  ? -10.932 69.112 59.307 1.00 35.20  ? 66   ASN A C   1 
ATOM   486  O O   . ASN A 1 66  ? -12.002 68.992 59.902 1.00 35.20  ? 66   ASN A O   1 
ATOM   487  C CB  . ASN A 1 66  ? -9.484  70.958 60.159 1.00 41.95  ? 66   ASN A CB  1 
ATOM   488  C CG  . ASN A 1 66  ? -8.814  72.299 59.903 1.00 41.95  ? 66   ASN A CG  1 
ATOM   489  O OD1 . ASN A 1 66  ? -8.472  73.019 60.843 1.00 41.95  ? 66   ASN A OD1 1 
ATOM   490  N ND2 . ASN A 1 66  ? -8.604  72.633 58.631 1.00 41.95  ? 66   ASN A ND2 1 
ATOM   491  N N   . CYS A 1 67  ? -10.210 68.072 58.902 1.00 34.26  ? 67   CYS A N   1 
ATOM   492  C CA  . CYS A 1 67  ? -10.630 66.702 59.156 1.00 34.26  ? 67   CYS A CA  1 
ATOM   493  C C   . CYS A 1 67  ? -10.738 66.430 60.656 1.00 34.26  ? 67   CYS A C   1 
ATOM   494  O O   . CYS A 1 67  ? -10.088 67.094 61.461 1.00 34.26  ? 67   CYS A O   1 
ATOM   495  C CB  . CYS A 1 67  ? -9.628  65.725 58.517 1.00 35.91  ? 67   CYS A CB  1 
ATOM   496  N N   . GLN A 1 68  ? -11.573 65.462 61.027 1.00 40.42  ? 68   GLN A N   1 
ATOM   497  C CA  . GLN A 1 68  ? -11.745 65.071 62.428 1.00 40.42  ? 68   GLN A CA  1 
ATOM   498  C C   . GLN A 1 68  ? -10.407 64.511 62.917 1.00 40.42  ? 68   GLN A C   1 
ATOM   499  O O   . GLN A 1 68  ? -9.825  63.638 62.269 1.00 40.42  ? 68   GLN A O   1 
ATOM   500  C CB  . GLN A 1 68  ? -12.822 63.994 62.543 1.00 38.68  ? 68   GLN A CB  1 
ATOM   501  C CG  . GLN A 1 68  ? -14.233 64.501 62.342 1.00 38.68  ? 68   GLN A CG  1 
ATOM   502  C CD  . GLN A 1 68  ? -14.730 65.289 63.536 1.00 38.68  ? 68   GLN A CD  1 
ATOM   503  O OE1 . GLN A 1 68  ? -15.862 65.772 63.551 1.00 38.68  ? 68   GLN A OE1 1 
ATOM   504  N NE2 . GLN A 1 68  ? -13.885 65.424 64.547 1.00 38.68  ? 68   GLN A NE2 1 
ATOM   505  N N   . GLN A 1 69  ? -9.921  65.001 64.054 1.00 33.32  ? 69   GLN A N   1 
ATOM   506  C CA  . GLN A 1 69  ? -8.630  64.543 64.557 1.00 33.32  ? 69   GLN A CA  1 
ATOM   507  C C   . GLN A 1 69  ? -8.398  64.755 66.047 1.00 33.32  ? 69   GLN A C   1 
ATOM   508  O O   . GLN A 1 69  ? -9.129  65.487 66.723 1.00 33.32  ? 69   GLN A O   1 
ATOM   509  C CB  . GLN A 1 69  ? -7.500  65.239 63.782 1.00 32.03  ? 69   GLN A CB  1 
ATOM   510  C CG  . GLN A 1 69  ? -7.618  66.774 63.751 1.00 32.03  ? 69   GLN A CG  1 
ATOM   511  C CD  . GLN A 1 69  ? -6.574  67.452 62.857 1.00 32.03  ? 69   GLN A CD  1 
ATOM   512  O OE1 . GLN A 1 69  ? -5.439  67.694 63.271 1.00 32.03  ? 69   GLN A OE1 1 
ATOM   513  N NE2 . GLN A 1 69  ? -6.962  67.753 61.620 1.00 32.03  ? 69   GLN A NE2 1 
ATOM   514  N N   . TYR A 1 70  ? -7.364  64.092 66.547 1.00 35.47  ? 70   TYR A N   1 
ATOM   515  C CA  . TYR A 1 70  ? -6.971  64.216 67.937 1.00 35.47  ? 70   TYR A CA  1 
ATOM   516  C C   . TYR A 1 70  ? -6.434  65.636 68.063 1.00 35.47  ? 70   TYR A C   1 
ATOM   517  O O   . TYR A 1 70  ? -5.779  66.131 67.149 1.00 35.47  ? 70   TYR A O   1 
ATOM   518  C CB  . TYR A 1 70  ? -5.870  63.214 68.261 1.00 41.08  ? 70   TYR A CB  1 
ATOM   519  C CG  . TYR A 1 70  ? -5.258  63.422 69.615 1.00 41.08  ? 70   TYR A CG  1 
ATOM   520  C CD1 . TYR A 1 70  ? -5.920  63.014 70.779 1.00 41.08  ? 70   TYR A CD1 1 
ATOM   521  C CD2 . TYR A 1 70  ? -4.023  64.058 69.740 1.00 41.08  ? 70   TYR A CD2 1 
ATOM   522  C CE1 . TYR A 1 70  ? -5.357  63.242 72.038 1.00 41.08  ? 70   TYR A CE1 1 
ATOM   523  C CE2 . TYR A 1 70  ? -3.460  64.290 70.980 1.00 41.08  ? 70   TYR A CE2 1 
ATOM   524  C CZ  . TYR A 1 70  ? -4.123  63.886 72.123 1.00 41.08  ? 70   TYR A CZ  1 
ATOM   525  O OH  . TYR A 1 70  ? -3.545  64.151 73.344 1.00 41.08  ? 70   TYR A OH  1 
ATOM   526  N N   . VAL A 1 71  ? -6.721  66.291 69.181 1.00 35.24  ? 71   VAL A N   1 
ATOM   527  C CA  . VAL A 1 71  ? -6.284  67.662 69.402 1.00 35.24  ? 71   VAL A CA  1 
ATOM   528  C C   . VAL A 1 71  ? -5.363  67.740 70.605 1.00 35.24  ? 71   VAL A C   1 
ATOM   529  O O   . VAL A 1 71  ? -5.730  67.335 71.711 1.00 35.24  ? 71   VAL A O   1 
ATOM   530  C CB  . VAL A 1 71  ? -7.489  68.588 69.636 1.00 35.10  ? 71   VAL A CB  1 
ATOM   531  C CG1 . VAL A 1 71  ? -7.015  69.992 69.974 1.00 35.10  ? 71   VAL A CG1 1 
ATOM   532  C CG2 . VAL A 1 71  ? -8.371  68.604 68.397 1.00 35.10  ? 71   VAL A CG2 1 
ATOM   533  N N   . ASP A 1 72  ? -4.164  68.267 70.389 1.00 40.59  ? 72   ASP A N   1 
ATOM   534  C CA  . ASP A 1 72  ? -3.193  68.372 71.468 1.00 40.59  ? 72   ASP A CA  1 
ATOM   535  C C   . ASP A 1 72  ? -3.559  69.445 72.479 1.00 40.59  ? 72   ASP A C   1 
ATOM   536  O O   . ASP A 1 72  ? -3.766  70.604 72.123 1.00 40.59  ? 72   ASP A O   1 
ATOM   537  C CB  . ASP A 1 72  ? -1.806  68.644 70.899 1.00 45.23  ? 72   ASP A CB  1 
ATOM   538  C CG  . ASP A 1 72  ? -0.776  68.894 71.980 1.00 45.23  ? 72   ASP A CG  1 
ATOM   539  O OD1 . ASP A 1 72  ? -0.905  68.308 73.079 1.00 45.23  ? 72   ASP A OD1 1 
ATOM   540  O OD2 . ASP A 1 72  ? 0.174   69.668 71.725 1.00 45.23  ? 72   ASP A OD2 1 
ATOM   541  N N   . GLU A 1 73  ? -3.643  69.042 73.744 1.00 41.60  ? 73   GLU A N   1 
ATOM   542  C CA  . GLU A 1 73  ? -3.984  69.958 74.826 1.00 41.60  ? 73   GLU A CA  1 
ATOM   543  C C   . GLU A 1 73  ? -2.958  69.895 75.954 1.00 41.60  ? 73   GLU A C   1 
ATOM   544  O O   . GLU A 1 73  ? -3.206  70.366 77.068 1.00 41.60  ? 73   GLU A O   1 
ATOM   545  C CB  . GLU A 1 73  ? -5.367  69.626 75.371 1.00 58.34  ? 73   GLU A CB  1 
ATOM   546  C CG  . GLU A 1 73  ? -6.493  70.186 74.538 1.00 58.34  ? 73   GLU A CG  1 
ATOM   547  C CD  . GLU A 1 73  ? -7.853  69.656 74.964 1.00 58.34  ? 73   GLU A CD  1 
ATOM   548  O OE1 . GLU A 1 73  ? -8.214  69.807 76.160 1.00 58.34  ? 73   GLU A OE1 1 
ATOM   549  O OE2 . GLU A 1 73  ? -8.560  69.086 74.101 1.00 58.34  ? 73   GLU A OE2 1 
ATOM   550  N N   . GLN A 1 74  ? -1.797  69.323 75.661 1.00 46.82  ? 74   GLN A N   1 
ATOM   551  C CA  . GLN A 1 74  ? -0.757  69.207 76.667 1.00 46.82  ? 74   GLN A CA  1 
ATOM   552  C C   . GLN A 1 74  ? -0.304  70.577 77.205 1.00 46.82  ? 74   GLN A C   1 
ATOM   553  O O   . GLN A 1 74  ? 0.157   70.666 78.337 1.00 46.82  ? 74   GLN A O   1 
ATOM   554  C CB  . GLN A 1 74  ? 0.432   68.426 76.093 1.00 57.18  ? 74   GLN A CB  1 
ATOM   555  C CG  . GLN A 1 74  ? 1.577   68.201 77.074 1.00 57.18  ? 74   GLN A CG  1 
ATOM   556  C CD  . GLN A 1 74  ? 1.185   67.328 78.263 1.00 57.18  ? 74   GLN A CD  1 
ATOM   557  O OE1 . GLN A 1 74  ? 1.903   67.268 79.273 1.00 57.18  ? 74   GLN A OE1 1 
ATOM   558  N NE2 . GLN A 1 74  ? 0.054   66.639 78.148 1.00 57.18  ? 74   GLN A NE2 1 
ATOM   559  N N   . PHE A 1 75  ? -0.449  71.637 76.410 1.00 36.33  ? 75   PHE A N   1 
ATOM   560  C CA  . PHE A 1 75  ? -0.034  72.981 76.830 1.00 36.33  ? 75   PHE A CA  1 
ATOM   561  C C   . PHE A 1 75  ? -1.042  74.059 76.412 1.00 36.33  ? 75   PHE A C   1 
ATOM   562  O O   . PHE A 1 75  ? -0.753  74.886 75.551 1.00 36.33  ? 75   PHE A O   1 
ATOM   563  C CB  . PHE A 1 75  ? 1.331   73.320 76.224 1.00 35.24  ? 75   PHE A CB  1 
ATOM   564  C CG  . PHE A 1 75  ? 2.430   72.381 76.628 1.00 35.24  ? 75   PHE A CG  1 
ATOM   565  C CD1 . PHE A 1 75  ? 2.905   72.368 77.935 1.00 35.24  ? 75   PHE A CD1 1 
ATOM   566  C CD2 . PHE A 1 75  ? 2.985   71.506 75.699 1.00 35.24  ? 75   PHE A CD2 1 
ATOM   567  C CE1 . PHE A 1 75  ? 3.919   71.497 78.315 1.00 35.24  ? 75   PHE A CE1 1 
ATOM   568  C CE2 . PHE A 1 75  ? 4.002   70.622 76.062 1.00 35.24  ? 75   PHE A CE2 1 
ATOM   569  C CZ  . PHE A 1 75  ? 4.474   70.614 77.372 1.00 35.24  ? 75   PHE A CZ  1 
ATOM   570  N N   . PRO A 1 76  ? -2.228  74.079 77.047 1.00 51.31  ? 76   PRO A N   1 
ATOM   571  C CA  . PRO A 1 76  ? -3.297  75.039 76.755 1.00 51.31  ? 76   PRO A CA  1 
ATOM   572  C C   . PRO A 1 76  ? -2.816  76.479 76.630 1.00 51.31  ? 76   PRO A C   1 
ATOM   573  O O   . PRO A 1 76  ? -2.152  77.003 77.533 1.00 51.31  ? 76   PRO A O   1 
ATOM   574  C CB  . PRO A 1 76  ? -4.251  74.859 77.936 1.00 43.05  ? 76   PRO A CB  1 
ATOM   575  C CG  . PRO A 1 76  ? -4.066  73.427 78.305 1.00 43.05  ? 76   PRO A CG  1 
ATOM   576  C CD  . PRO A 1 76  ? -2.567  73.275 78.240 1.00 43.05  ? 76   PRO A CD  1 
ATOM   577  N N   . GLY A 1 77  ? -3.161  77.120 75.515 1.00 62.83  ? 77   GLY A N   1 
ATOM   578  C CA  . GLY A 1 77  ? -2.757  78.504 75.308 1.00 62.83  ? 77   GLY A CA  1 
ATOM   579  C C   . GLY A 1 77  ? -1.379  78.696 74.687 1.00 62.83  ? 77   GLY A C   1 
ATOM   580  O O   . GLY A 1 77  ? -1.145  79.679 73.977 1.00 62.83  ? 77   GLY A O   1 
ATOM   581  N N   . PHE A 1 78  ? -0.465  77.767 74.946 1.00 40.40  ? 78   PHE A N   1 
ATOM   582  C CA  . PHE A 1 78  ? 0.894   77.836 74.411 1.00 40.40  ? 78   PHE A CA  1 
ATOM   583  C C   . PHE A 1 78  ? 0.897   77.885 72.872 1.00 40.40  ? 78   PHE A C   1 
ATOM   584  O O   . PHE A 1 78  ? 0.404   76.976 72.212 1.00 40.40  ? 78   PHE A O   1 
ATOM   585  C CB  . PHE A 1 78  ? 1.671   76.617 74.909 1.00 34.67  ? 78   PHE A CB  1 
ATOM   586  C CG  . PHE A 1 78  ? 3.136   76.669 74.620 1.00 34.67  ? 78   PHE A CG  1 
ATOM   587  C CD1 . PHE A 1 78  ? 3.893   77.776 74.996 1.00 34.67  ? 78   PHE A CD1 1 
ATOM   588  C CD2 . PHE A 1 78  ? 3.773   75.591 74.013 1.00 34.67  ? 78   PHE A CD2 1 
ATOM   589  C CE1 . PHE A 1 78  ? 5.268   77.807 74.772 1.00 34.67  ? 78   PHE A CE1 1 
ATOM   590  C CE2 . PHE A 1 78  ? 5.143   75.609 73.784 1.00 34.67  ? 78   PHE A CE2 1 
ATOM   591  C CZ  . PHE A 1 78  ? 5.892   76.719 74.164 1.00 34.67  ? 78   PHE A CZ  1 
ATOM   592  N N   . SER A 1 79  ? 1.459   78.936 72.296 1.00 41.40  ? 79   SER A N   1 
ATOM   593  C CA  . SER A 1 79  ? 1.479   79.053 70.837 1.00 41.40  ? 79   SER A CA  1 
ATOM   594  C C   . SER A 1 79  ? 2.308   77.956 70.179 1.00 41.40  ? 79   SER A C   1 
ATOM   595  O O   . SER A 1 79  ? 1.996   77.502 69.072 1.00 41.40  ? 79   SER A O   1 
ATOM   596  C CB  . SER A 1 79  ? 2.040   80.410 70.419 1.00 40.88  ? 79   SER A CB  1 
ATOM   597  O OG  . SER A 1 79  ? 3.326   80.605 70.990 1.00 40.88  ? 79   SER A OG  1 
ATOM   598  N N   . GLY A 1 80  ? 3.363   77.536 70.871 1.00 36.75  ? 80   GLY A N   1 
ATOM   599  C CA  . GLY A 1 80  ? 4.251   76.522 70.337 1.00 36.75  ? 80   GLY A CA  1 
ATOM   600  C C   . GLY A 1 80  ? 3.589   75.246 69.861 1.00 36.75  ? 80   GLY A C   1 
ATOM   601  O O   . GLY A 1 80  ? 4.021   74.642 68.880 1.00 36.75  ? 80   GLY A O   1 
ATOM   602  N N   . SER A 1 81  ? 2.538   74.827 70.552 1.00 40.87  ? 81   SER A N   1 
ATOM   603  C CA  . SER A 1 81  ? 1.854   73.597 70.189 1.00 40.87  ? 81   SER A CA  1 
ATOM   604  C C   . SER A 1 81  ? 0.508   73.847 69.525 1.00 40.87  ? 81   SER A C   1 
ATOM   605  O O   . SER A 1 81  ? 0.066   73.057 68.691 1.00 40.87  ? 81   SER A O   1 
ATOM   606  C CB  . SER A 1 81  ? 1.667   72.723 71.431 1.00 36.16  ? 81   SER A CB  1 
ATOM   607  O OG  . SER A 1 81  ? 0.897   73.396 72.403 1.00 36.16  ? 81   SER A OG  1 
ATOM   608  N N   . GLU A 1 82  ? -0.142  74.948 69.885 1.00 37.76  ? 82   GLU A N   1 
ATOM   609  C CA  . GLU A 1 82  ? -1.439  75.247 69.303 1.00 37.76  ? 82   GLU A CA  1 
ATOM   610  C C   . GLU A 1 82  ? -1.372  75.697 67.855 1.00 37.76  ? 82   GLU A C   1 
ATOM   611  O O   . GLU A 1 82  ? -2.371  75.649 67.151 1.00 37.76  ? 82   GLU A O   1 
ATOM   612  C CB  . GLU A 1 82  ? -2.183  76.267 70.167 1.00 77.15  ? 82   GLU A CB  1 
ATOM   613  C CG  . GLU A 1 82  ? -2.885  75.597 71.346 1.00 77.15  ? 82   GLU A CG  1 
ATOM   614  C CD  . GLU A 1 82  ? -3.441  76.588 72.349 1.00 77.15  ? 82   GLU A CD  1 
ATOM   615  O OE1 . GLU A 1 82  ? -3.156  77.808 72.201 1.00 77.15  ? 82   GLU A OE1 1 
ATOM   616  O OE2 . GLU A 1 82  ? -4.156  76.148 73.292 1.00 77.15  ? 82   GLU A OE2 1 
ATOM   617  N N   . MET A 1 83  ? -0.193  76.114 67.401 1.00 35.63  ? 83   MET A N   1 
ATOM   618  C CA  . MET A 1 83  ? -0.031  76.532 66.012 1.00 35.63  ? 83   MET A CA  1 
ATOM   619  C C   . MET A 1 83  ? -0.147  75.313 65.095 1.00 35.63  ? 83   MET A C   1 
ATOM   620  O O   . MET A 1 83  ? -0.211  75.458 63.879 1.00 35.63  ? 83   MET A O   1 
ATOM   621  C CB  . MET A 1 83  ? 1.335   77.179 65.794 1.00 51.01  ? 83   MET A CB  1 
ATOM   622  C CG  . MET A 1 83  ? 2.498   76.235 66.015 1.00 51.01  ? 83   MET A CG  1 
ATOM   623  S SD  . MET A 1 83  ? 4.066   76.938 65.461 1.00 51.01  ? 83   MET A SD  1 
ATOM   624  C CE  . MET A 1 83  ? 4.851   77.419 67.092 1.00 51.01  ? 83   MET A CE  1 
ATOM   625  N N   . TRP A 1 84  ? -0.147  74.116 65.684 1.00 34.74  ? 84   TRP A N   1 
ATOM   626  C CA  . TRP A 1 84  ? -0.266  72.885 64.911 1.00 34.74  ? 84   TRP A CA  1 
ATOM   627  C C   . TRP A 1 84  ? -1.681  72.316 64.966 1.00 34.74  ? 84   TRP A C   1 
ATOM   628  O O   . TRP A 1 84  ? -2.047  71.484 64.148 1.00 34.74  ? 84   TRP A O   1 
ATOM   629  C CB  . TRP A 1 84  ? 0.731   71.829 65.409 1.00 34.19  ? 84   TRP A CB  1 
ATOM   630  C CG  . TRP A 1 84  ? 2.155   72.292 65.342 1.00 34.19  ? 84   TRP A CG  1 
ATOM   631  C CD1 . TRP A 1 84  ? 2.955   72.644 66.393 1.00 34.19  ? 84   TRP A CD1 1 
ATOM   632  C CD2 . TRP A 1 84  ? 2.928   72.526 64.154 1.00 34.19  ? 84   TRP A CD2 1 
ATOM   633  N NE1 . TRP A 1 84  ? 4.175   73.087 65.933 1.00 34.19  ? 84   TRP A NE1 1 
ATOM   634  C CE2 . TRP A 1 84  ? 4.186   73.026 64.564 1.00 34.19  ? 84   TRP A CE2 1 
ATOM   635  C CE3 . TRP A 1 84  ? 2.679   72.366 62.785 1.00 34.19  ? 84   TRP A CE3 1 
ATOM   636  C CZ2 . TRP A 1 84  ? 5.193   73.367 63.652 1.00 34.19  ? 84   TRP A CZ2 1 
ATOM   637  C CZ3 . TRP A 1 84  ? 3.687   72.708 61.875 1.00 34.19  ? 84   TRP A CZ3 1 
ATOM   638  C CH2 . TRP A 1 84  ? 4.925   73.200 62.316 1.00 34.19  ? 84   TRP A CH2 1 
ATOM   639  N N   . ASN A 1 85  ? -2.481  72.774 65.921 1.00 37.06  ? 85   ASN A N   1 
ATOM   640  C CA  . ASN A 1 85  ? -3.851  72.293 66.059 1.00 37.06  ? 85   ASN A CA  1 
ATOM   641  C C   . ASN A 1 85  ? -4.770  72.849 64.988 1.00 37.06  ? 85   ASN A C   1 
ATOM   642  O O   . ASN A 1 85  ? -4.477  73.871 64.375 1.00 37.06  ? 85   ASN A O   1 
ATOM   643  C CB  . ASN A 1 85  ? -4.434  72.679 67.425 1.00 45.16  ? 85   ASN A CB  1 
ATOM   644  C CG  . ASN A 1 85  ? -3.849  71.872 68.565 1.00 45.16  ? 85   ASN A CG  1 
ATOM   645  O OD1 . ASN A 1 85  ? -3.405  70.735 68.382 1.00 45.16  ? 85   ASN A OD1 1 
ATOM   646  N ND2 . ASN A 1 85  ? -3.864  72.448 69.756 1.00 45.16  ? 85   ASN A ND2 1 
ATOM   647  N N   . PRO A 1 86  ? -5.899  72.168 64.745 1.00 34.02  ? 86   PRO A N   1 
ATOM   648  C CA  . PRO A 1 86  ? -6.881  72.601 63.745 1.00 34.02  ? 86   PRO A CA  1 
ATOM   649  C C   . PRO A 1 86  ? -7.355  74.013 64.101 1.00 34.02  ? 86   PRO A C   1 
ATOM   650  O O   . PRO A 1 86  ? -7.720  74.264 65.243 1.00 34.02  ? 86   PRO A O   1 
ATOM   651  C CB  . PRO A 1 86  ? -8.005  71.585 63.903 1.00 30.25  ? 86   PRO A CB  1 
ATOM   652  C CG  . PRO A 1 86  ? -7.289  70.353 64.333 1.00 30.25  ? 86   PRO A CG  1 
ATOM   653  C CD  . PRO A 1 86  ? -6.278  70.868 65.328 1.00 30.25  ? 86   PRO A CD  1 
ATOM   654  N N   . ASN A 1 87  ? -7.351  74.927 63.134 1.00 42.48  ? 87   ASN A N   1 
ATOM   655  C CA  . ASN A 1 87  ? -7.787  76.292 63.395 1.00 42.48  ? 87   ASN A CA  1 
ATOM   656  C C   . ASN A 1 87  ? -9.172  76.563 62.802 1.00 42.48  ? 87   ASN A C   1 
ATOM   657  O O   . ASN A 1 87  ? -9.609  77.712 62.711 1.00 42.48  ? 87   ASN A O   1 
ATOM   658  C CB  . ASN A 1 87  ? -6.762  77.285 62.839 1.00 39.37  ? 87   ASN A CB  1 
ATOM   659  C CG  . ASN A 1 87  ? -6.566  77.145 61.344 1.00 39.37  ? 87   ASN A CG  1 
ATOM   660  O OD1 . ASN A 1 87  ? -7.095  76.228 60.715 1.00 39.37  ? 87   ASN A OD1 1 
ATOM   661  N ND2 . ASN A 1 87  ? -5.801  78.057 60.764 1.00 39.37  ? 87   ASN A ND2 1 
ATOM   662  N N   . ARG A 1 88  ? -9.857  75.496 62.404 1.00 41.86  ? 88   ARG A N   1 
ATOM   663  C CA  . ARG A 1 88  ? -11.200 75.592 61.831 1.00 41.86  ? 88   ARG A CA  1 
ATOM   664  C C   . ARG A 1 88  ? -12.030 74.487 62.456 1.00 41.86  ? 88   ARG A C   1 
ATOM   665  O O   . ARG A 1 88  ? -11.481 73.566 63.065 1.00 41.86  ? 88   ARG A O   1 
ATOM   666  C CB  . ARG A 1 88  ? -11.165 75.365 60.318 1.00 52.85  ? 88   ARG A CB  1 
ATOM   667  C CG  . ARG A 1 88  ? -10.398 76.401 59.544 1.00 52.85  ? 88   ARG A CG  1 
ATOM   668  C CD  . ARG A 1 88  ? -11.269 77.594 59.311 1.00 52.85  ? 88   ARG A CD  1 
ATOM   669  N NE  . ARG A 1 88  ? -10.478 78.811 59.340 1.00 52.85  ? 88   ARG A NE  1 
ATOM   670  C CZ  . ARG A 1 88  ? -10.981 80.018 59.127 1.00 52.85  ? 88   ARG A CZ  1 
ATOM   671  N NH1 . ARG A 1 88  ? -12.277 80.152 58.871 1.00 52.85  ? 88   ARG A NH1 1 
ATOM   672  N NH2 . ARG A 1 88  ? -10.189 81.081 59.158 1.00 52.85  ? 88   ARG A NH2 1 
ATOM   673  N N   . GLU A 1 89  ? -13.344 74.571 62.295 1.00 41.60  ? 89   GLU A N   1 
ATOM   674  C CA  . GLU A 1 89  ? -14.250 73.560 62.826 1.00 41.60  ? 89   GLU A CA  1 
ATOM   675  C C   . GLU A 1 89  ? -13.866 72.211 62.215 1.00 41.60  ? 89   GLU A C   1 
ATOM   676  O O   . GLU A 1 89  ? -13.570 72.130 61.021 1.00 41.60  ? 89   GLU A O   1 
ATOM   677  C CB  . GLU A 1 89  ? -15.691 73.883 62.418 1.00 88.15  ? 89   GLU A CB  1 
ATOM   678  C CG  . GLU A 1 89  ? -16.703 73.801 63.554 1.00 88.15  ? 89   GLU A CG  1 
ATOM   679  C CD  . GLU A 1 89  ? -16.744 75.079 64.383 1.00 88.15  ? 89   GLU A CD  1 
ATOM   680  O OE1 . GLU A 1 89  ? -17.108 76.144 63.818 1.00 88.15  ? 89   GLU A OE1 1 
ATOM   681  O OE2 . GLU A 1 89  ? -16.414 75.022 65.597 1.00 88.15  ? 89   GLU A OE2 1 
ATOM   682  N N   . MET A 1 90  ? -13.857 71.154 63.014 1.00 34.07  ? 90   MET A N   1 
ATOM   683  C CA  . MET A 1 90  ? -13.534 69.848 62.460 1.00 34.07  ? 90   MET A CA  1 
ATOM   684  C C   . MET A 1 90  ? -14.812 69.246 61.915 1.00 34.07  ? 90   MET A C   1 
ATOM   685  O O   . MET A 1 90  ? -15.908 69.529 62.408 1.00 34.07  ? 90   MET A O   1 
ATOM   686  C CB  . MET A 1 90  ? -12.927 68.921 63.518 1.00 42.21  ? 90   MET A CB  1 
ATOM   687  C CG  . MET A 1 90  ? -11.525 69.328 63.950 1.00 42.21  ? 90   MET A CG  1 
ATOM   688  S SD  . MET A 1 90  ? -10.787 68.148 65.085 1.00 42.21  ? 90   MET A SD  1 
ATOM   689  C CE  . MET A 1 90  ? -11.674 68.540 66.630 1.00 42.21  ? 90   MET A CE  1 
ATOM   690  N N   . SER A 1 91  ? -14.668 68.414 60.893 1.00 35.05  ? 91   SER A N   1 
ATOM   691  C CA  . SER A 1 91  ? -15.815 67.776 60.258 1.00 35.05  ? 91   SER A CA  1 
ATOM   692  C C   . SER A 1 91  ? -15.313 66.608 59.426 1.00 35.05  ? 91   SER A C   1 
ATOM   693  O O   . SER A 1 91  ? -14.183 66.634 58.943 1.00 35.05  ? 91   SER A O   1 
ATOM   694  C CB  . SER A 1 91  ? -16.523 68.792 59.352 1.00 33.84  ? 91   SER A CB  1 
ATOM   695  O OG  . SER A 1 91  ? -17.575 68.199 58.621 1.00 33.84  ? 91   SER A OG  1 
ATOM   696  N N   . GLU A 1 92  ? -16.134 65.577 59.267 1.00 42.63  ? 92   GLU A N   1 
ATOM   697  C CA  . GLU A 1 92  ? -15.721 64.460 58.438 1.00 42.63  ? 92   GLU A CA  1 
ATOM   698  C C   . GLU A 1 92  ? -15.751 64.925 56.980 1.00 42.63  ? 92   GLU A C   1 
ATOM   699  O O   . GLU A 1 92  ? -15.103 64.328 56.118 1.00 42.63  ? 92   GLU A O   1 
ATOM   700  C CB  . GLU A 1 92  ? -16.634 63.256 58.637 1.00 46.62  ? 92   GLU A CB  1 
ATOM   701  C CG  . GLU A 1 92  ? -16.171 62.323 59.735 1.00 46.62  ? 92   GLU A CG  1 
ATOM   702  C CD  . GLU A 1 92  ? -17.072 61.099 59.883 1.00 46.62  ? 92   GLU A CD  1 
ATOM   703  O OE1 . GLU A 1 92  ? -18.216 61.240 60.380 1.00 46.62  ? 92   GLU A OE1 1 
ATOM   704  O OE2 . GLU A 1 92  ? -16.637 59.992 59.491 1.00 46.62  ? 92   GLU A OE2 1 
ATOM   705  N N   . ASP A 1 93  ? -16.505 65.992 56.716 1.00 37.41  ? 93   ASP A N   1 
ATOM   706  C CA  . ASP A 1 93  ? -16.598 66.579 55.375 1.00 37.41  ? 93   ASP A CA  1 
ATOM   707  C C   . ASP A 1 93  ? -15.390 67.512 55.281 1.00 37.41  ? 93   ASP A C   1 
ATOM   708  O O   . ASP A 1 93  ? -15.492 68.704 55.568 1.00 37.41  ? 93   ASP A O   1 
ATOM   709  C CB  . ASP A 1 93  ? -17.902 67.376 55.252 1.00 50.51  ? 93   ASP A CB  1 
ATOM   710  C CG  . ASP A 1 93  ? -18.001 68.144 53.946 1.00 50.51  ? 93   ASP A CG  1 
ATOM   711  O OD1 . ASP A 1 93  ? -17.133 67.950 53.054 1.00 50.51  ? 93   ASP A OD1 1 
ATOM   712  O OD2 . ASP A 1 93  ? -18.960 68.941 53.806 1.00 50.51  ? 93   ASP A OD2 1 
ATOM   713  N N   . CYS A 1 94  ? -14.252 66.974 54.856 1.00 35.40  ? 94   CYS A N   1 
ATOM   714  C CA  . CYS A 1 94  ? -13.020 67.752 54.841 1.00 35.40  ? 94   CYS A CA  1 
ATOM   715  C C   . CYS A 1 94  ? -12.125 67.645 53.629 1.00 35.40  ? 94   CYS A C   1 
ATOM   716  O O   . CYS A 1 94  ? -11.030 68.209 53.640 1.00 35.40  ? 94   CYS A O   1 
ATOM   717  C CB  . CYS A 1 94  ? -12.205 67.383 56.073 1.00 36.04  ? 94   CYS A CB  1 
ATOM   718  N N   . LEU A 1 95  ? -12.552 66.933 52.593 1.00 34.73  ? 95   LEU A N   1 
ATOM   719  C CA  . LEU A 1 95  ? -11.699 66.789 51.421 1.00 34.73  ? 95   LEU A CA  1 
ATOM   720  C C   . LEU A 1 95  ? -11.747 67.969 50.448 1.00 34.73  ? 95   LEU A C   1 
ATOM   721  O O   . LEU A 1 95  ? -12.453 67.936 49.444 1.00 34.73  ? 95   LEU A O   1 
ATOM   722  C CB  . LEU A 1 95  ? -12.028 65.485 50.701 1.00 34.65  ? 95   LEU A CB  1 
ATOM   723  C CG  . LEU A 1 95  ? -11.843 64.256 51.594 1.00 34.65  ? 95   LEU A CG  1 
ATOM   724  C CD1 . LEU A 1 95  ? -12.016 62.989 50.772 1.00 34.65  ? 95   LEU A CD1 1 
ATOM   725  C CD2 . LEU A 1 95  ? -10.452 64.284 52.228 1.00 34.65  ? 95   LEU A CD2 1 
ATOM   726  N N   . TYR A 1 96  ? -10.978 69.008 50.754 1.00 31.15  ? 96   TYR A N   1 
ATOM   727  C CA  . TYR A 1 96  ? -10.916 70.197 49.912 1.00 31.15  ? 96   TYR A CA  1 
ATOM   728  C C   . TYR A 1 96  ? -9.469  70.601 49.683 1.00 31.15  ? 96   TYR A C   1 
ATOM   729  O O   . TYR A 1 96  ? -8.575  70.148 50.388 1.00 31.15  ? 96   TYR A O   1 
ATOM   730  C CB  . TYR A 1 96  ? -11.651 71.370 50.571 1.00 35.79  ? 96   TYR A CB  1 
ATOM   731  C CG  . TYR A 1 96  ? -13.079 71.084 50.939 1.00 35.79  ? 96   TYR A CG  1 
ATOM   732  C CD1 . TYR A 1 96  ? -13.387 70.391 52.106 1.00 35.79  ? 96   TYR A CD1 1 
ATOM   733  C CD2 . TYR A 1 96  ? -14.125 71.481 50.108 1.00 35.79  ? 96   TYR A CD2 1 
ATOM   734  C CE1 . TYR A 1 96  ? -14.703 70.095 52.438 1.00 35.79  ? 96   TYR A CE1 1 
ATOM   735  C CE2 . TYR A 1 96  ? -15.448 71.189 50.430 1.00 35.79  ? 96   TYR A CE2 1 
ATOM   736  C CZ  . TYR A 1 96  ? -15.728 70.496 51.594 1.00 35.79  ? 96   TYR A CZ  1 
ATOM   737  O OH  . TYR A 1 96  ? -17.029 70.186 51.917 1.00 35.79  ? 96   TYR A OH  1 
ATOM   738  N N   . LEU A 1 97  ? -9.234  71.451 48.695 1.00 30.12  ? 97   LEU A N   1 
ATOM   739  C CA  . LEU A 1 97  ? -7.880  71.900 48.436 1.00 30.12  ? 97   LEU A CA  1 
ATOM   740  C C   . LEU A 1 97  ? -7.807  73.420 48.307 1.00 30.12  ? 97   LEU A C   1 
ATOM   741  O O   . LEU A 1 97  ? -8.815  74.084 48.101 1.00 30.12  ? 97   LEU A O   1 
ATOM   742  C CB  . LEU A 1 97  ? -7.314  71.193 47.200 1.00 34.88  ? 97   LEU A CB  1 
ATOM   743  C CG  . LEU A 1 97  ? -7.960  71.348 45.831 1.00 34.88  ? 97   LEU A CG  1 
ATOM   744  C CD1 . LEU A 1 97  ? -7.526  72.653 45.205 1.00 34.88  ? 97   LEU A CD1 1 
ATOM   745  C CD2 . LEU A 1 97  ? -7.524  70.188 44.951 1.00 34.88  ? 97   LEU A CD2 1 
ATOM   746  N N   . ASN A 1 98  ? -6.608  73.965 48.449 1.00 28.56  ? 98   ASN A N   1 
ATOM   747  C CA  . ASN A 1 98  ? -6.412  75.403 48.390 1.00 28.56  ? 98   ASN A CA  1 
ATOM   748  C C   . ASN A 1 98  ? -5.392  75.789 47.337 1.00 28.56  ? 98   ASN A C   1 
ATOM   749  O O   . ASN A 1 98  ? -4.356  75.138 47.206 1.00 28.56  ? 98   ASN A O   1 
ATOM   750  C CB  . ASN A 1 98  ? -5.953  75.920 49.757 1.00 37.34  ? 98   ASN A CB  1 
ATOM   751  C CG  . ASN A 1 98  ? -6.864  75.472 50.897 1.00 37.34  ? 98   ASN A CG  1 
ATOM   752  O OD1 . ASN A 1 98  ? -8.058  75.771 50.910 1.00 37.34  ? 98   ASN A OD1 1 
ATOM   753  N ND2 . ASN A 1 98  ? -6.293  74.754 51.866 1.00 37.34  ? 98   ASN A ND2 1 
ATOM   754  N N   . ILE A 1 99  ? -5.680  76.857 46.593 1.00 33.39  ? 99   ILE A N   1 
ATOM   755  C CA  . ILE A 1 99  ? -4.770  77.317 45.552 1.00 33.39  ? 99   ILE A CA  1 
ATOM   756  C C   . ILE A 1 99  ? -4.433  78.813 45.602 1.00 33.39  ? 99   ILE A C   1 
ATOM   757  O O   . ILE A 1 99  ? -5.320  79.660 45.656 1.00 33.39  ? 99   ILE A O   1 
ATOM   758  C CB  . ILE A 1 99  ? -5.324  77.025 44.139 1.00 32.59  ? 99   ILE A CB  1 
ATOM   759  C CG1 . ILE A 1 99  ? -5.814  75.575 44.039 1.00 32.59  ? 99   ILE A CG1 1 
ATOM   760  C CG2 . ILE A 1 99  ? -4.235  77.288 43.109 1.00 32.59  ? 99   ILE A CG2 1 
ATOM   761  C CD1 . ILE A 1 99  ? -6.337  75.190 42.654 1.00 32.59  ? 99   ILE A CD1 1 
ATOM   762  N N   . TRP A 1 100 ? -3.144  79.123 45.570 1.00 30.23  ? 100  TRP A N   1 
ATOM   763  C CA  . TRP A 1 100 ? -2.678  80.499 45.570 1.00 30.23  ? 100  TRP A CA  1 
ATOM   764  C C   . TRP A 1 100 ? -2.110  80.746 44.182 1.00 30.23  ? 100  TRP A C   1 
ATOM   765  O O   . TRP A 1 100 ? -1.194  80.045 43.744 1.00 30.23  ? 100  TRP A O   1 
ATOM   766  C CB  . TRP A 1 100 ? -1.612  80.698 46.654 1.00 33.43  ? 100  TRP A CB  1 
ATOM   767  C CG  . TRP A 1 100 ? -2.212  80.844 48.024 1.00 33.43  ? 100  TRP A CG  1 
ATOM   768  C CD1 . TRP A 1 100 ? -2.736  81.976 48.567 1.00 33.43  ? 100  TRP A CD1 1 
ATOM   769  C CD2 . TRP A 1 100 ? -2.418  79.805 48.992 1.00 33.43  ? 100  TRP A CD2 1 
ATOM   770  N NE1 . TRP A 1 100 ? -3.256  81.715 49.806 1.00 33.43  ? 100  TRP A NE1 1 
ATOM   771  C CE2 . TRP A 1 100 ? -3.075  80.390 50.095 1.00 33.43  ? 100  TRP A CE2 1 
ATOM   772  C CE3 . TRP A 1 100 ? -2.113  78.438 49.033 1.00 33.43  ? 100  TRP A CE3 1 
ATOM   773  C CZ2 . TRP A 1 100 ? -3.433  79.657 51.233 1.00 33.43  ? 100  TRP A CZ2 1 
ATOM   774  C CZ3 . TRP A 1 100 ? -2.472  77.703 50.172 1.00 33.43  ? 100  TRP A CZ3 1 
ATOM   775  C CH2 . TRP A 1 100 ? -3.124  78.318 51.252 1.00 33.43  ? 100  TRP A CH2 1 
ATOM   776  N N   . VAL A 1 101 ? -2.667  81.728 43.481 1.00 35.62  ? 101  VAL A N   1 
ATOM   777  C CA  . VAL A 1 101 ? -2.235  82.030 42.119 1.00 35.62  ? 101  VAL A CA  1 
ATOM   778  C C   . VAL A 1 101 ? -1.689  83.441 41.974 1.00 35.62  ? 101  VAL A C   1 
ATOM   779  O O   . VAL A 1 101 ? -2.318  84.406 42.404 1.00 35.62  ? 101  VAL A O   1 
ATOM   780  C CB  . VAL A 1 101 ? -3.408  81.874 41.122 1.00 31.88  ? 101  VAL A CB  1 
ATOM   781  C CG1 . VAL A 1 101 ? -2.917  82.074 39.692 1.00 31.88  ? 101  VAL A CG1 1 
ATOM   782  C CG2 . VAL A 1 101 ? -4.054  80.518 41.287 1.00 31.88  ? 101  VAL A CG2 1 
ATOM   783  N N   . PRO A 1 102 ? -0.503  83.577 41.363 1.00 41.23  ? 102  PRO A N   1 
ATOM   784  C CA  . PRO A 1 102 ? 0.123   84.887 41.159 1.00 41.23  ? 102  PRO A CA  1 
ATOM   785  C C   . PRO A 1 102 ? -0.811  85.828 40.386 1.00 41.23  ? 102  PRO A C   1 
ATOM   786  O O   . PRO A 1 102 ? -1.791  85.387 39.777 1.00 41.23  ? 102  PRO A O   1 
ATOM   787  C CB  . PRO A 1 102 ? 1.373   84.552 40.347 1.00 36.07  ? 102  PRO A CB  1 
ATOM   788  C CG  . PRO A 1 102 ? 1.720   83.169 40.811 1.00 36.07  ? 102  PRO A CG  1 
ATOM   789  C CD  . PRO A 1 102 ? 0.371   82.493 40.869 1.00 36.07  ? 102  PRO A CD  1 
ATOM   790  N N   . SER A 1 103 ? -0.497  87.120 40.411 1.00 45.45  ? 103  SER A N   1 
ATOM   791  C CA  . SER A 1 103 ? -1.284  88.122 39.690 1.00 45.45  ? 103  SER A CA  1 
ATOM   792  C C   . SER A 1 103 ? -0.316  89.050 38.966 1.00 45.45  ? 103  SER A C   1 
ATOM   793  O O   . SER A 1 103 ? 0.584   89.606 39.581 1.00 45.45  ? 103  SER A O   1 
ATOM   794  C CB  . SER A 1 103 ? -2.138  88.940 40.658 1.00 51.95  ? 103  SER A CB  1 
ATOM   795  O OG  . SER A 1 103 ? -2.944  89.863 39.936 1.00 51.95  ? 103  SER A OG  1 
ATOM   796  N N   . PRO A 1 104 ? -0.492  89.234 37.647 1.00 49.88  ? 104  PRO A N   1 
ATOM   797  C CA  . PRO A 1 104 ? -1.540  88.626 36.818 1.00 49.88  ? 104  PRO A CA  1 
ATOM   798  C C   . PRO A 1 104 ? -1.396  87.104 36.682 1.00 49.88  ? 104  PRO A C   1 
ATOM   799  O O   . PRO A 1 104 ? -0.285  86.578 36.718 1.00 49.88  ? 104  PRO A O   1 
ATOM   800  C CB  . PRO A 1 104 ? -1.372  89.353 35.483 1.00 42.18  ? 104  PRO A CB  1 
ATOM   801  C CG  . PRO A 1 104 ? 0.119   89.538 35.413 1.00 42.18  ? 104  PRO A CG  1 
ATOM   802  C CD  . PRO A 1 104 ? 0.447   90.012 36.816 1.00 42.18  ? 104  PRO A CD  1 
ATOM   803  N N   . ARG A 1 105 ? -2.529  86.419 36.523 1.00 38.63  ? 105  ARG A N   1 
ATOM   804  C CA  . ARG A 1 105 ? -2.588  84.960 36.381 1.00 38.63  ? 105  ARG A CA  1 
ATOM   805  C C   . ARG A 1 105 ? -1.620  84.478 35.313 1.00 38.63  ? 105  ARG A C   1 
ATOM   806  O O   . ARG A 1 105 ? -1.630  84.972 34.182 1.00 38.63  ? 105  ARG A O   1 
ATOM   807  C CB  . ARG A 1 105 ? -4.017  84.523 36.013 1.00 39.44  ? 105  ARG A CB  1 
ATOM   808  C CG  . ARG A 1 105 ? -4.223  83.010 35.911 1.00 39.44  ? 105  ARG A CG  1 
ATOM   809  C CD  . ARG A 1 105 ? -5.558  82.667 35.251 1.00 39.44  ? 105  ARG A CD  1 
ATOM   810  N NE  . ARG A 1 105 ? -6.704  83.124 36.036 1.00 39.44  ? 105  ARG A NE  1 
ATOM   811  C CZ  . ARG A 1 105 ? -7.971  83.019 35.642 1.00 39.44  ? 105  ARG A CZ  1 
ATOM   812  N NH1 . ARG A 1 105 ? -8.262  82.468 34.474 1.00 39.44  ? 105  ARG A NH1 1 
ATOM   813  N NH2 . ARG A 1 105 ? -8.950  83.485 36.404 1.00 39.44  ? 105  ARG A NH2 1 
ATOM   814  N N   . PRO A 1 106 ? -0.776  83.489 35.653 1.00 43.38  ? 106  PRO A N   1 
ATOM   815  C CA  . PRO A 1 106 ? 0.214   82.929 34.722 1.00 43.38  ? 106  PRO A CA  1 
ATOM   816  C C   . PRO A 1 106 ? -0.475  82.141 33.623 1.00 43.38  ? 106  PRO A C   1 
ATOM   817  O O   . PRO A 1 106 ? -1.671  81.843 33.718 1.00 43.38  ? 106  PRO A O   1 
ATOM   818  C CB  . PRO A 1 106 ? 1.059   82.007 35.610 1.00 39.07  ? 106  PRO A CB  1 
ATOM   819  C CG  . PRO A 1 106 ? 0.708   82.415 37.028 1.00 39.07  ? 106  PRO A CG  1 
ATOM   820  C CD  . PRO A 1 106 ? -0.742  82.766 36.933 1.00 39.07  ? 106  PRO A CD  1 
ATOM   821  N N   . LYS A 1 107 ? 0.284   81.786 32.593 1.00 46.74  ? 107  LYS A N   1 
ATOM   822  C CA  . LYS A 1 107 ? -0.247  81.011 31.483 1.00 46.74  ? 107  LYS A CA  1 
ATOM   823  C C   . LYS A 1 107 ? 0.042   79.528 31.692 1.00 46.74  ? 107  LYS A C   1 
ATOM   824  O O   . LYS A 1 107 ? -0.842  78.690 31.535 1.00 46.74  ? 107  LYS A O   1 
ATOM   825  C CB  . LYS A 1 107 ? 0.370   81.478 30.163 1.00 49.19  ? 107  LYS A CB  1 
ATOM   826  C CG  . LYS A 1 107 ? 0.106   82.944 29.870 1.00 49.19  ? 107  LYS A CG  1 
ATOM   827  C CD  . LYS A 1 107 ? -1.382  83.222 29.983 1.00 49.19  ? 107  LYS A CD  1 
ATOM   828  C CE  . LYS A 1 107 ? -1.709  84.696 29.813 1.00 49.19  ? 107  LYS A CE  1 
ATOM   829  N NZ  . LYS A 1 107 ? -3.190  84.874 29.908 1.00 49.19  ? 107  LYS A NZ  1 
ATOM   830  N N   . SER A 1 108 ? 1.280   79.205 32.052 1.00 47.76  ? 108  SER A N   1 
ATOM   831  C CA  . SER A 1 108 ? 1.655   77.815 32.282 1.00 47.76  ? 108  SER A CA  1 
ATOM   832  C C   . SER A 1 108 ? 2.898   77.773 33.161 1.00 47.76  ? 108  SER A C   1 
ATOM   833  O O   . SER A 1 108 ? 3.993   77.466 32.687 1.00 47.76  ? 108  SER A O   1 
ATOM   834  C CB  . SER A 1 108 ? 1.943   77.132 30.948 1.00 53.39  ? 108  SER A CB  1 
ATOM   835  O OG  . SER A 1 108 ? 1.867   75.722 31.070 1.00 53.39  ? 108  SER A OG  1 
ATOM   836  N N   . THR A 1 109 ? 2.734   78.078 34.442 1.00 36.77  ? 109  THR A N   1 
ATOM   837  C CA  . THR A 1 109 ? 3.870   78.089 35.344 1.00 36.77  ? 109  THR A CA  1 
ATOM   838  C C   . THR A 1 109 ? 3.968   76.870 36.274 1.00 36.77  ? 109  THR A C   1 
ATOM   839  O O   . THR A 1 109 ? 3.022   76.094 36.418 1.00 36.77  ? 109  THR A O   1 
ATOM   840  C CB  . THR A 1 109 ? 3.879   79.380 36.197 1.00 45.38  ? 109  THR A CB  1 
ATOM   841  O OG1 . THR A 1 109 ? 5.126   79.467 36.900 1.00 45.38  ? 109  THR A OG1 1 
ATOM   842  C CG2 . THR A 1 109 ? 2.747   79.374 37.220 1.00 45.38  ? 109  THR A CG2 1 
ATOM   843  N N   . THR A 1 110 ? 5.131   76.724 36.903 1.00 34.14  ? 110  THR A N   1 
ATOM   844  C CA  . THR A 1 110 ? 5.406   75.628 37.821 1.00 34.14  ? 110  THR A CA  1 
ATOM   845  C C   . THR A 1 110 ? 4.400   75.514 38.965 1.00 34.14  ? 110  THR A C   1 
ATOM   846  O O   . THR A 1 110 ? 3.980   76.519 39.539 1.00 34.14  ? 110  THR A O   1 
ATOM   847  C CB  . THR A 1 110 ? 6.802   75.779 38.413 1.00 44.49  ? 110  THR A CB  1 
ATOM   848  O OG1 . THR A 1 110 ? 7.760   75.814 37.348 1.00 44.49  ? 110  THR A OG1 1 
ATOM   849  C CG2 . THR A 1 110 ? 7.118   74.620 39.339 1.00 44.49  ? 110  THR A CG2 1 
ATOM   850  N N   . VAL A 1 111 ? 4.035   74.275 39.295 1.00 35.13  ? 111  VAL A N   1 
ATOM   851  C CA  . VAL A 1 111 ? 3.079   73.989 40.356 1.00 35.13  ? 111  VAL A CA  1 
ATOM   852  C C   . VAL A 1 111 ? 3.725   73.233 41.530 1.00 35.13  ? 111  VAL A C   1 
ATOM   853  O O   . VAL A 1 111 ? 4.536   72.324 41.331 1.00 35.13  ? 111  VAL A O   1 
ATOM   854  C CB  . VAL A 1 111 ? 1.910   73.131 39.813 1.00 30.60  ? 111  VAL A CB  1 
ATOM   855  C CG1 . VAL A 1 111 ? 0.902   72.853 40.916 1.00 30.60  ? 111  VAL A CG1 1 
ATOM   856  C CG2 . VAL A 1 111 ? 1.244   73.835 38.638 1.00 30.60  ? 111  VAL A CG2 1 
ATOM   857  N N   . MET A 1 112 ? 3.356   73.610 42.749 1.00 32.23  ? 112  MET A N   1 
ATOM   858  C CA  . MET A 1 112 ? 3.867   72.946 43.936 1.00 32.23  ? 112  MET A CA  1 
ATOM   859  C C   . MET A 1 112 ? 2.687   72.541 44.798 1.00 32.23  ? 112  MET A C   1 
ATOM   860  O O   . MET A 1 112 ? 1.863   73.381 45.160 1.00 32.23  ? 112  MET A O   1 
ATOM   861  C CB  . MET A 1 112 ? 4.814   73.870 44.702 1.00 34.86  ? 112  MET A CB  1 
ATOM   862  C CG  . MET A 1 112 ? 6.094   74.146 43.922 1.00 34.86  ? 112  MET A CG  1 
ATOM   863  S SD  . MET A 1 112 ? 7.320   75.119 44.797 1.00 34.86  ? 112  MET A SD  1 
ATOM   864  C CE  . MET A 1 112 ? 7.910   73.909 45.997 1.00 34.86  ? 112  MET A CE  1 
ATOM   865  N N   . VAL A 1 113 ? 2.587   71.246 45.091 1.00 27.30  ? 113  VAL A N   1 
ATOM   866  C CA  . VAL A 1 113 ? 1.500   70.721 45.906 1.00 27.30  ? 113  VAL A CA  1 
ATOM   867  C C   . VAL A 1 113 ? 2.036   70.272 47.260 1.00 27.30  ? 113  VAL A C   1 
ATOM   868  O O   . VAL A 1 113 ? 2.868   69.375 47.341 1.00 27.30  ? 113  VAL A O   1 
ATOM   869  C CB  . VAL A 1 113 ? 0.797   69.516 45.223 1.00 22.99  ? 113  VAL A CB  1 
ATOM   870  C CG1 . VAL A 1 113 ? -0.384  69.041 46.087 1.00 22.99  ? 113  VAL A CG1 1 
ATOM   871  C CG2 . VAL A 1 113 ? 0.324   69.903 43.834 1.00 22.99  ? 113  VAL A CG2 1 
ATOM   872  N N   . TRP A 1 114 ? 1.531   70.902 48.316 1.00 27.70  ? 114  TRP A N   1 
ATOM   873  C CA  . TRP A 1 114 ? 1.943   70.616 49.682 1.00 27.70  ? 114  TRP A CA  1 
ATOM   874  C C   . TRP A 1 114 ? 1.059   69.569 50.351 1.00 27.70  ? 114  TRP A C   1 
ATOM   875  O O   . TRP A 1 114 ? -0.169  69.619 50.246 1.00 27.70  ? 114  TRP A O   1 
ATOM   876  C CB  . TRP A 1 114 ? 1.934   71.921 50.500 1.00 29.87  ? 114  TRP A CB  1 
ATOM   877  C CG  . TRP A 1 114 ? 2.124   71.755 51.980 1.00 29.87  ? 114  TRP A CG  1 
ATOM   878  C CD1 . TRP A 1 114 ? 1.164   71.857 52.950 1.00 29.87  ? 114  TRP A CD1 1 
ATOM   879  C CD2 . TRP A 1 114 ? 3.350   71.466 52.661 1.00 29.87  ? 114  TRP A CD2 1 
ATOM   880  N NE1 . TRP A 1 114 ? 1.718   71.652 54.194 1.00 29.87  ? 114  TRP A NE1 1 
ATOM   881  C CE2 . TRP A 1 114 ? 3.060   71.410 54.044 1.00 29.87  ? 114  TRP A CE2 1 
ATOM   882  C CE3 . TRP A 1 114 ? 4.668   71.251 52.238 1.00 29.87  ? 114  TRP A CE3 1 
ATOM   883  C CZ2 . TRP A 1 114 ? 4.043   71.148 55.006 1.00 29.87  ? 114  TRP A CZ2 1 
ATOM   884  C CZ3 . TRP A 1 114 ? 5.646   70.989 53.198 1.00 29.87  ? 114  TRP A CZ3 1 
ATOM   885  C CH2 . TRP A 1 114 ? 5.327   70.941 54.563 1.00 29.87  ? 114  TRP A CH2 1 
ATOM   886  N N   . ILE A 1 115 ? 1.698   68.608 51.008 1.00 25.51  ? 115  ILE A N   1 
ATOM   887  C CA  . ILE A 1 115 ? 1.000   67.555 51.737 1.00 25.51  ? 115  ILE A CA  1 
ATOM   888  C C   . ILE A 1 115 ? 1.456   67.698 53.188 1.00 25.51  ? 115  ILE A C   1 
ATOM   889  O O   . ILE A 1 115 ? 2.627   67.468 53.495 1.00 25.51  ? 115  ILE A O   1 
ATOM   890  C CB  . ILE A 1 115 ? 1.381   66.154 51.222 1.00 28.95  ? 115  ILE A CB  1 
ATOM   891  C CG1 . ILE A 1 115 ? 1.182   66.088 49.701 1.00 28.95  ? 115  ILE A CG1 1 
ATOM   892  C CG2 . ILE A 1 115 ? 0.538   65.105 51.939 1.00 28.95  ? 115  ILE A CG2 1 
ATOM   893  C CD1 . ILE A 1 115 ? 1.422   64.723 49.076 1.00 28.95  ? 115  ILE A CD1 1 
ATOM   894  N N   . TYR A 1 116 ? 0.540   68.081 54.076 1.00 27.92  ? 116  TYR A N   1 
ATOM   895  C CA  . TYR A 1 116 ? 0.893   68.287 55.479 1.00 27.92  ? 116  TYR A CA  1 
ATOM   896  C C   . TYR A 1 116 ? 1.237   67.024 56.249 1.00 27.92  ? 116  TYR A C   1 
ATOM   897  O O   . TYR A 1 116 ? 0.798   65.925 55.906 1.00 27.92  ? 116  TYR A O   1 
ATOM   898  C CB  . TYR A 1 116 ? -0.214  69.064 56.220 1.00 30.28  ? 116  TYR A CB  1 
ATOM   899  C CG  . TYR A 1 116 ? -1.587  68.409 56.239 1.00 30.28  ? 116  TYR A CG  1 
ATOM   900  C CD1 . TYR A 1 116 ? -1.840  67.263 57.006 1.00 30.28  ? 116  TYR A CD1 1 
ATOM   901  C CD2 . TYR A 1 116 ? -2.635  68.941 55.494 1.00 30.28  ? 116  TYR A CD2 1 
ATOM   902  C CE1 . TYR A 1 116 ? -3.111  66.665 57.022 1.00 30.28  ? 116  TYR A CE1 1 
ATOM   903  C CE2 . TYR A 1 116 ? -3.903  68.355 55.502 1.00 30.28  ? 116  TYR A CE2 1 
ATOM   904  C CZ  . TYR A 1 116 ? -4.137  67.222 56.261 1.00 30.28  ? 116  TYR A CZ  1 
ATOM   905  O OH  . TYR A 1 116 ? -5.393  66.651 56.237 1.00 30.28  ? 116  TYR A OH  1 
ATOM   906  N N   . GLY A 1 117 ? 2.043   67.202 57.291 1.00 30.87  ? 117  GLY A N   1 
ATOM   907  C CA  . GLY A 1 117 ? 2.440   66.089 58.131 1.00 30.87  ? 117  GLY A CA  1 
ATOM   908  C C   . GLY A 1 117 ? 1.552   66.027 59.354 1.00 30.87  ? 117  GLY A C   1 
ATOM   909  O O   . GLY A 1 117 ? 0.511   66.679 59.402 1.00 30.87  ? 117  GLY A O   1 
ATOM   910  N N   . GLY A 1 118 ? 1.955   65.245 60.348 1.00 30.89  ? 118  GLY A N   1 
ATOM   911  C CA  . GLY A 1 118 ? 1.157   65.129 61.553 1.00 30.89  ? 118  GLY A CA  1 
ATOM   912  C C   . GLY A 1 118 ? 0.998   63.692 62.009 1.00 30.89  ? 118  GLY A C   1 
ATOM   913  O O   . GLY A 1 118 ? 0.009   63.354 62.650 1.00 30.89  ? 118  GLY A O   1 
ATOM   914  N N   . GLY A 1 119 ? 1.963   62.846 61.655 1.00 28.00  ? 119  GLY A N   1 
ATOM   915  C CA  . GLY A 1 119 ? 1.935   61.452 62.064 1.00 28.00  ? 119  GLY A CA  1 
ATOM   916  C C   . GLY A 1 119 ? 0.777   60.614 61.566 1.00 28.00  ? 119  GLY A C   1 
ATOM   917  O O   . GLY A 1 119 ? 0.513   59.544 62.107 1.00 28.00  ? 119  GLY A O   1 
ATOM   918  N N   . PHE A 1 120 ? 0.102   61.088 60.528 1.00 30.97  ? 120  PHE A N   1 
ATOM   919  C CA  . PHE A 1 120 ? -1.046  60.396 59.952 1.00 30.97  ? 120  PHE A CA  1 
ATOM   920  C C   . PHE A 1 120 ? -2.252  60.407 60.891 1.00 30.97  ? 120  PHE A C   1 
ATOM   921  O O   . PHE A 1 120 ? -3.264  59.769 60.608 1.00 30.97  ? 120  PHE A O   1 
ATOM   922  C CB  . PHE A 1 120 ? -0.689  58.946 59.572 1.00 22.52  ? 120  PHE A CB  1 
ATOM   923  C CG  . PHE A 1 120 ? 0.246   58.834 58.394 1.00 22.52  ? 120  PHE A CG  1 
ATOM   924  C CD1 . PHE A 1 120 ? -0.131  59.302 57.143 1.00 22.52  ? 120  PHE A CD1 1 
ATOM   925  C CD2 . PHE A 1 120 ? 1.512   58.268 58.540 1.00 22.52  ? 120  PHE A CD2 1 
ATOM   926  C CE1 . PHE A 1 120 ? 0.737   59.212 56.055 1.00 22.52  ? 120  PHE A CE1 1 
ATOM   927  C CE2 . PHE A 1 120 ? 2.390   58.173 57.453 1.00 22.52  ? 120  PHE A CE2 1 
ATOM   928  C CZ  . PHE A 1 120 ? 2.001   58.646 56.211 1.00 22.52  ? 120  PHE A CZ  1 
ATOM   929  N N   . TYR A 1 121 ? -2.156  61.136 62.001 1.00 30.50  ? 121  TYR A N   1 
ATOM   930  C CA  . TYR A 1 121 ? -3.273  61.212 62.946 1.00 30.50  ? 121  TYR A CA  1 
ATOM   931  C C   . TYR A 1 121 ? -3.775  62.642 63.148 1.00 30.50  ? 121  TYR A C   1 
ATOM   932  O O   . TYR A 1 121 ? -4.736  62.880 63.880 1.00 30.50  ? 121  TYR A O   1 
ATOM   933  C CB  . TYR A 1 121 ? -2.869  60.627 64.301 1.00 29.56  ? 121  TYR A CB  1 
ATOM   934  C CG  . TYR A 1 121 ? -1.921  61.493 65.102 1.00 29.56  ? 121  TYR A CG  1 
ATOM   935  C CD1 . TYR A 1 121 ? -2.394  62.553 65.882 1.00 29.56  ? 121  TYR A CD1 1 
ATOM   936  C CD2 . TYR A 1 121 ? -0.551  61.243 65.094 1.00 29.56  ? 121  TYR A CD2 1 
ATOM   937  C CE1 . TYR A 1 121 ? -1.524  63.340 66.639 1.00 29.56  ? 121  TYR A CE1 1 
ATOM   938  C CE2 . TYR A 1 121 ? 0.327   62.019 65.845 1.00 29.56  ? 121  TYR A CE2 1 
ATOM   939  C CZ  . TYR A 1 121 ? -0.162  63.064 66.617 1.00 29.56  ? 121  TYR A CZ  1 
ATOM   940  O OH  . TYR A 1 121 ? 0.720   63.812 67.377 1.00 29.56  ? 121  TYR A OH  1 
ATOM   941  N N   . SER A 1 122 ? -3.123  63.595 62.503 1.00 29.16  ? 122  SER A N   1 
ATOM   942  C CA  . SER A 1 122 ? -3.503  64.986 62.642 1.00 29.16  ? 122  SER A CA  1 
ATOM   943  C C   . SER A 1 122 ? -3.006  65.766 61.451 1.00 29.16  ? 122  SER A C   1 
ATOM   944  O O   . SER A 1 122 ? -2.417  65.195 60.539 1.00 29.16  ? 122  SER A O   1 
ATOM   945  C CB  . SER A 1 122 ? -2.890  65.558 63.907 1.00 36.66  ? 122  SER A CB  1 
ATOM   946  O OG  . SER A 1 122 ? -1.488  65.382 63.884 1.00 36.66  ? 122  SER A OG  1 
ATOM   947  N N   . GLY A 1 123 ? -3.242  67.073 61.472 1.00 30.76  ? 123  GLY A N   1 
ATOM   948  C CA  . GLY A 1 123 ? -2.813  67.927 60.378 1.00 30.76  ? 123  GLY A CA  1 
ATOM   949  C C   . GLY A 1 123 ? -3.948  68.673 59.694 1.00 30.76  ? 123  GLY A C   1 
ATOM   950  O O   . GLY A 1 123 ? -5.069  68.177 59.614 1.00 30.76  ? 123  GLY A O   1 
ATOM   951  N N   . SER A 1 124 ? -3.645  69.869 59.204 1.00 30.70  ? 124  SER A N   1 
ATOM   952  C CA  . SER A 1 124 ? -4.613  70.721 58.521 1.00 30.70  ? 124  SER A CA  1 
ATOM   953  C C   . SER A 1 124 ? -3.893  71.488 57.421 1.00 30.70  ? 124  SER A C   1 
ATOM   954  O O   . SER A 1 124 ? -2.709  71.778 57.541 1.00 30.70  ? 124  SER A O   1 
ATOM   955  C CB  . SER A 1 124 ? -5.221  71.729 59.498 1.00 39.06  ? 124  SER A CB  1 
ATOM   956  O OG  . SER A 1 124 ? -5.881  71.078 60.572 1.00 39.06  ? 124  SER A OG  1 
ATOM   957  N N   . SER A 1 125 ? -4.604  71.822 56.353 1.00 40.95  ? 125  SER A N   1 
ATOM   958  C CA  . SER A 1 125 ? -4.008  72.567 55.250 1.00 40.95  ? 125  SER A CA  1 
ATOM   959  C C   . SER A 1 125 ? -4.176  74.059 55.502 1.00 40.95  ? 125  SER A C   1 
ATOM   960  O O   . SER A 1 125 ? -3.629  74.892 54.778 1.00 40.95  ? 125  SER A O   1 
ATOM   961  C CB  . SER A 1 125 ? -4.714  72.222 53.940 1.00 37.31  ? 125  SER A CB  1 
ATOM   962  O OG  . SER A 1 125 ? -6.046  72.721 53.948 1.00 37.31  ? 125  SER A OG  1 
ATOM   963  N N   . THR A 1 126 ? -4.921  74.385 56.548 1.00 40.38  ? 126  THR A N   1 
ATOM   964  C CA  . THR A 1 126 ? -5.232  75.764 56.863 1.00 40.38  ? 126  THR A CA  1 
ATOM   965  C C   . THR A 1 126 ? -4.419  76.444 57.962 1.00 40.38  ? 126  THR A C   1 
ATOM   966  O O   . THR A 1 126 ? -4.729  77.568 58.346 1.00 40.38  ? 126  THR A O   1 
ATOM   967  C CB  . THR A 1 126 ? -6.714  75.856 57.212 1.00 33.53  ? 126  THR A CB  1 
ATOM   968  O OG1 . THR A 1 126 ? -6.972  75.079 58.389 1.00 33.53  ? 126  THR A OG1 1 
ATOM   969  C CG2 . THR A 1 126 ? -7.548  75.296 56.072 1.00 33.53  ? 126  THR A CG2 1 
ATOM   970  N N   . LEU A 1 127 ? -3.386  75.783 58.472 1.00 33.24  ? 127  LEU A N   1 
ATOM   971  C CA  . LEU A 1 127 ? -2.562  76.379 59.521 1.00 33.24  ? 127  LEU A CA  1 
ATOM   972  C C   . LEU A 1 127 ? -1.845  77.627 59.000 1.00 33.24  ? 127  LEU A C   1 
ATOM   973  O O   . LEU A 1 127 ? -1.552  77.730 57.810 1.00 33.24  ? 127  LEU A O   1 
ATOM   974  C CB  . LEU A 1 127 ? -1.528  75.367 60.016 1.00 36.86  ? 127  LEU A CB  1 
ATOM   975  C CG  . LEU A 1 127 ? -2.084  74.004 60.441 1.00 36.86  ? 127  LEU A CG  1 
ATOM   976  C CD1 . LEU A 1 127 ? -0.939  73.080 60.831 1.00 36.86  ? 127  LEU A CD1 1 
ATOM   977  C CD2 . LEU A 1 127 ? -3.057  74.183 61.607 1.00 36.86  ? 127  LEU A CD2 1 
ATOM   978  N N   . ASP A 1 128 ? -1.551  78.569 59.891 1.00 36.39  ? 128  ASP A N   1 
ATOM   979  C CA  . ASP A 1 128 ? -0.866  79.802 59.491 1.00 36.39  ? 128  ASP A CA  1 
ATOM   980  C C   . ASP A 1 128 ? 0.513   79.534 58.873 1.00 36.39  ? 128  ASP A C   1 
ATOM   981  O O   . ASP A 1 128 ? 0.940   80.255 57.969 1.00 36.39  ? 128  ASP A O   1 
ATOM   982  C CB  . ASP A 1 128 ? -0.716  80.757 60.686 1.00 61.38  ? 128  ASP A CB  1 
ATOM   983  C CG  . ASP A 1 128 ? -2.052  81.121 61.329 1.00 61.38  ? 128  ASP A CG  1 
ATOM   984  O OD1 . ASP A 1 128 ? -3.046  81.294 60.586 1.00 61.38  ? 128  ASP A OD1 1 
ATOM   985  O OD2 . ASP A 1 128 ? -2.107  81.249 62.582 1.00 61.38  ? 128  ASP A OD2 1 
ATOM   986  N N   . VAL A 1 129 ? 1.212   78.509 59.353 1.00 35.98  ? 129  VAL A N   1 
ATOM   987  C CA  . VAL A 1 129 ? 2.524   78.183 58.803 1.00 35.98  ? 129  VAL A CA  1 
ATOM   988  C C   . VAL A 1 129 ? 2.431   77.601 57.398 1.00 35.98  ? 129  VAL A C   1 
ATOM   989  O O   . VAL A 1 129 ? 3.452   77.455 56.727 1.00 35.98  ? 129  VAL A O   1 
ATOM   990  C CB  . VAL A 1 129 ? 3.303   77.156 59.671 1.00 33.66  ? 129  VAL A CB  1 
ATOM   991  C CG1 . VAL A 1 129 ? 3.886   77.829 60.871 1.00 33.66  ? 129  VAL A CG1 1 
ATOM   992  C CG2 . VAL A 1 129 ? 2.388   76.023 60.096 1.00 33.66  ? 129  VAL A CG2 1 
ATOM   993  N N   . TYR A 1 130 ? 1.228   77.249 56.951 1.00 34.68  ? 130  TYR A N   1 
ATOM   994  C CA  . TYR A 1 130 ? 1.084   76.686 55.613 1.00 34.68  ? 130  TYR A CA  1 
ATOM   995  C C   . TYR A 1 130 ? 0.473   77.660 54.610 1.00 34.68  ? 130  TYR A C   1 
ATOM   996  O O   . TYR A 1 130 ? 0.039   77.249 53.538 1.00 34.68  ? 130  TYR A O   1 
ATOM   997  C CB  . TYR A 1 130 ? 0.233   75.412 55.636 1.00 29.48  ? 130  TYR A CB  1 
ATOM   998  C CG  . TYR A 1 130 ? 0.757   74.287 56.506 1.00 29.48  ? 130  TYR A CG  1 
ATOM   999  C CD1 . TYR A 1 130 ? 2.126   74.086 56.694 1.00 29.48  ? 130  TYR A CD1 1 
ATOM   1000 C CD2 . TYR A 1 130 ? -0.122  73.397 57.111 1.00 29.48  ? 130  TYR A CD2 1 
ATOM   1001 C CE1 . TYR A 1 130 ? 2.599   73.025 57.465 1.00 29.48  ? 130  TYR A CE1 1 
ATOM   1002 C CE2 . TYR A 1 130 ? 0.338   72.333 57.878 1.00 29.48  ? 130  TYR A CE2 1 
ATOM   1003 C CZ  . TYR A 1 130 ? 1.693   72.150 58.054 1.00 29.48  ? 130  TYR A CZ  1 
ATOM   1004 O OH  . TYR A 1 130 ? 2.131   71.088 58.814 1.00 29.48  ? 130  TYR A OH  1 
ATOM   1005 N N   . ASN A 1 131 ? 0.432   78.947 54.951 1.00 41.02  ? 131  ASN A N   1 
ATOM   1006 C CA  . ASN A 1 131 ? -0.148  79.942 54.047 1.00 41.02  ? 131  ASN A CA  1 
ATOM   1007 C C   . ASN A 1 131 ? 0.729   80.032 52.804 1.00 41.02  ? 131  ASN A C   1 
ATOM   1008 O O   . ASN A 1 131 ? 1.863   80.505 52.866 1.00 41.02  ? 131  ASN A O   1 
ATOM   1009 C CB  . ASN A 1 131 ? -0.238  81.305 54.731 1.00 45.23  ? 131  ASN A CB  1 
ATOM   1010 C CG  . ASN A 1 131 ? -1.229  82.234 54.045 1.00 45.23  ? 131  ASN A CG  1 
ATOM   1011 O OD1 . ASN A 1 131 ? -1.346  82.241 52.811 1.00 45.23  ? 131  ASN A OD1 1 
ATOM   1012 N ND2 . ASN A 1 131 ? -1.941  83.033 54.840 1.00 45.23  ? 131  ASN A ND2 1 
ATOM   1013 N N   . GLY A 1 132 ? 0.197   79.582 51.675 1.00 31.27  ? 132  GLY A N   1 
ATOM   1014 C CA  . GLY A 1 132 ? 0.975   79.577 50.452 1.00 31.27  ? 132  GLY A CA  1 
ATOM   1015 C C   . GLY A 1 132 ? 1.140   80.883 49.707 1.00 31.27  ? 132  GLY A C   1 
ATOM   1016 O O   . GLY A 1 132 ? 1.824   80.921 48.686 1.00 31.27  ? 132  GLY A O   1 
ATOM   1017 N N   . LYS A 1 133 ? 0.547   81.958 50.215 1.00 39.42  ? 133  LYS A N   1 
ATOM   1018 C CA  . LYS A 1 133 ? 0.631   83.246 49.534 1.00 39.42  ? 133  LYS A CA  1 
ATOM   1019 C C   . LYS A 1 133 ? 2.036   83.834 49.411 1.00 39.42  ? 133  LYS A C   1 
ATOM   1020 O O   . LYS A 1 133 ? 2.369   84.423 48.379 1.00 39.42  ? 133  LYS A O   1 
ATOM   1021 C CB  . LYS A 1 133 ? -0.299  84.264 50.202 1.00 42.57  ? 133  LYS A CB  1 
ATOM   1022 C CG  . LYS A 1 133 ? 0.221   84.866 51.488 1.00 42.57  ? 133  LYS A CG  1 
ATOM   1023 C CD  . LYS A 1 133 ? -0.843  85.769 52.108 1.00 42.57  ? 133  LYS A CD  1 
ATOM   1024 C CE  . LYS A 1 133 ? -0.265  86.620 53.237 1.00 42.57  ? 133  LYS A CE  1 
ATOM   1025 N NZ  . LYS A 1 133 ? -1.290  87.527 53.852 1.00 42.57  ? 133  LYS A NZ  1 
ATOM   1026 N N   . TYR A 1 134 ? 2.862   83.668 50.443 1.00 37.55  ? 134  TYR A N   1 
ATOM   1027 C CA  . TYR A 1 134 ? 4.219   84.216 50.420 1.00 37.55  ? 134  TYR A CA  1 
ATOM   1028 C C   . TYR A 1 134 ? 5.078   83.543 49.365 1.00 37.55  ? 134  TYR A C   1 
ATOM   1029 O O   . TYR A 1 134 ? 5.736   84.203 48.564 1.00 37.55  ? 134  TYR A O   1 
ATOM   1030 C CB  . TYR A 1 134 ? 4.888   84.052 51.790 1.00 36.75  ? 134  TYR A CB  1 
ATOM   1031 C CG  . TYR A 1 134 ? 4.126   84.689 52.925 1.00 36.75  ? 134  TYR A CG  1 
ATOM   1032 C CD1 . TYR A 1 134 ? 3.975   86.080 53.003 1.00 36.75  ? 134  TYR A CD1 1 
ATOM   1033 C CD2 . TYR A 1 134 ? 3.521   83.903 53.904 1.00 36.75  ? 134  TYR A CD2 1 
ATOM   1034 C CE1 . TYR A 1 134 ? 3.231   86.669 54.035 1.00 36.75  ? 134  TYR A CE1 1 
ATOM   1035 C CE2 . TYR A 1 134 ? 2.774   84.480 54.938 1.00 36.75  ? 134  TYR A CE2 1 
ATOM   1036 C CZ  . TYR A 1 134 ? 2.634   85.859 54.995 1.00 36.75  ? 134  TYR A CZ  1 
ATOM   1037 O OH  . TYR A 1 134 ? 1.886   86.418 56.007 1.00 36.75  ? 134  TYR A OH  1 
ATOM   1038 N N   . LEU A 1 135 ? 5.061   82.218 49.370 1.00 39.48  ? 135  LEU A N   1 
ATOM   1039 C CA  . LEU A 1 135 ? 5.845   81.431 48.436 1.00 39.48  ? 135  LEU A CA  1 
ATOM   1040 C C   . LEU A 1 135 ? 5.350   81.595 46.999 1.00 39.48  ? 135  LEU A C   1 
ATOM   1041 O O   . LEU A 1 135 ? 6.148   81.702 46.067 1.00 39.48  ? 135  LEU A O   1 
ATOM   1042 C CB  . LEU A 1 135 ? 5.808   79.958 48.871 1.00 42.65  ? 135  LEU A CB  1 
ATOM   1043 C CG  . LEU A 1 135 ? 6.492   78.897 48.009 1.00 42.65  ? 135  LEU A CG  1 
ATOM   1044 C CD1 . LEU A 1 135 ? 7.948   79.279 47.755 1.00 42.65  ? 135  LEU A CD1 1 
ATOM   1045 C CD2 . LEU A 1 135 ? 6.393   77.541 48.721 1.00 42.65  ? 135  LEU A CD2 1 
ATOM   1046 N N   . ALA A 1 136 ? 4.033   81.625 46.818 1.00 45.56  ? 136  ALA A N   1 
ATOM   1047 C CA  . ALA A 1 136 ? 3.459   81.772 45.486 1.00 45.56  ? 136  ALA A CA  1 
ATOM   1048 C C   . ALA A 1 136 ? 3.799   83.150 44.940 1.00 45.56  ? 136  ALA A C   1 
ATOM   1049 O O   . ALA A 1 136 ? 4.091   83.321 43.756 1.00 45.56  ? 136  ALA A O   1 
ATOM   1050 C CB  . ALA A 1 136 ? 1.943   81.586 45.544 1.00 40.52  ? 136  ALA A CB  1 
ATOM   1051 N N   . TYR A 1 137 ? 3.766   84.140 45.817 1.00 47.96  ? 137  TYR A N   1 
ATOM   1052 C CA  . TYR A 1 137 ? 4.073   85.499 45.417 1.00 47.96  ? 137  TYR A CA  1 
ATOM   1053 C C   . TYR A 1 137 ? 5.551   85.679 45.100 1.00 47.96  ? 137  TYR A C   1 
ATOM   1054 O O   . TYR A 1 137 ? 5.906   86.108 44.005 1.00 47.96  ? 137  TYR A O   1 
ATOM   1055 C CB  . TYR A 1 137 ? 3.669   86.468 46.520 1.00 45.12  ? 137  TYR A CB  1 
ATOM   1056 C CG  . TYR A 1 137 ? 4.080   87.887 46.245 1.00 45.12  ? 137  TYR A CG  1 
ATOM   1057 C CD1 . TYR A 1 137 ? 3.516   88.607 45.187 1.00 45.12  ? 137  TYR A CD1 1 
ATOM   1058 C CD2 . TYR A 1 137 ? 5.044   88.514 47.032 1.00 45.12  ? 137  TYR A CD2 1 
ATOM   1059 C CE1 . TYR A 1 137 ? 3.906   89.927 44.921 1.00 45.12  ? 137  TYR A CE1 1 
ATOM   1060 C CE2 . TYR A 1 137 ? 5.446   89.824 46.779 1.00 45.12  ? 137  TYR A CE2 1 
ATOM   1061 C CZ  . TYR A 1 137 ? 4.874   90.523 45.724 1.00 45.12  ? 137  TYR A CZ  1 
ATOM   1062 O OH  . TYR A 1 137 ? 5.280   91.810 45.472 1.00 45.12  ? 137  TYR A OH  1 
ATOM   1063 N N   . THR A 1 138 ? 6.411   85.339 46.053 1.00 46.36  ? 138  THR A N   1 
ATOM   1064 C CA  . THR A 1 138 ? 7.856   85.511 45.892 1.00 46.36  ? 138  THR A CA  1 
ATOM   1065 C C   . THR A 1 138 ? 8.493   84.733 44.753 1.00 46.36  ? 138  THR A C   1 
ATOM   1066 O O   . THR A 1 138 ? 9.368   85.250 44.055 1.00 46.36  ? 138  THR A O   1 
ATOM   1067 C CB  . THR A 1 138 ? 8.609   85.147 47.186 1.00 37.36  ? 138  THR A CB  1 
ATOM   1068 O OG1 . THR A 1 138 ? 8.047   85.874 48.285 1.00 37.36  ? 138  THR A OG1 1 
ATOM   1069 C CG2 . THR A 1 138 ? 10.081  85.492 47.061 1.00 37.36  ? 138  THR A CG2 1 
ATOM   1070 N N   . GLU A 1 139 ? 8.060   83.496 44.544 1.00 45.35  ? 139  GLU A N   1 
ATOM   1071 C CA  . GLU A 1 139 ? 8.662   82.686 43.492 1.00 45.35  ? 139  GLU A CA  1 
ATOM   1072 C C   . GLU A 1 139 ? 7.830   82.563 42.217 1.00 45.35  ? 139  GLU A C   1 
ATOM   1073 O O   . GLU A 1 139 ? 8.275   81.955 41.233 1.00 45.35  ? 139  GLU A O   1 
ATOM   1074 C CB  . GLU A 1 139 ? 9.003   81.307 44.048 1.00 49.61  ? 139  GLU A CB  1 
ATOM   1075 C CG  . GLU A 1 139 ? 10.094  81.332 45.120 1.00 49.61  ? 139  GLU A CG  1 
ATOM   1076 C CD  . GLU A 1 139 ? 11.451  81.743 44.567 1.00 49.61  ? 139  GLU A CD  1 
ATOM   1077 O OE1 . GLU A 1 139 ? 11.811  81.283 43.454 1.00 49.61  ? 139  GLU A OE1 1 
ATOM   1078 O OE2 . GLU A 1 139 ? 12.174  82.511 45.245 1.00 49.61  ? 139  GLU A OE2 1 
ATOM   1079 N N   . GLU A 1 140 ? 6.633   83.145 42.227 1.00 44.79  ? 140  GLU A N   1 
ATOM   1080 C CA  . GLU A 1 140 ? 5.761   83.109 41.054 1.00 44.79  ? 140  GLU A CA  1 
ATOM   1081 C C   . GLU A 1 140 ? 5.423   81.678 40.660 1.00 44.79  ? 140  GLU A C   1 
ATOM   1082 O O   . GLU A 1 140 ? 5.696   81.247 39.537 1.00 44.79  ? 140  GLU A O   1 
ATOM   1083 C CB  . GLU A 1 140 ? 6.443   83.805 39.866 1.00 91.19  ? 140  GLU A CB  1 
ATOM   1084 C CG  . GLU A 1 140 ? 7.054   85.163 40.206 1.00 91.19  ? 140  GLU A CG  1 
ATOM   1085 C CD  . GLU A 1 140 ? 7.983   85.677 39.111 1.00 91.19  ? 140  GLU A CD  1 
ATOM   1086 O OE1 . GLU A 1 140 ? 7.488   85.893 37.978 1.00 91.19  ? 140  GLU A OE1 1 
ATOM   1087 O OE2 . GLU A 1 140 ? 9.202   85.858 39.383 1.00 91.19  ? 140  GLU A OE2 1 
ATOM   1088 N N   . VAL A 1 141 ? 4.842   80.934 41.588 1.00 31.87  ? 141  VAL A N   1 
ATOM   1089 C CA  . VAL A 1 141 ? 4.452   79.564 41.305 1.00 31.87  ? 141  VAL A CA  1 
ATOM   1090 C C   . VAL A 1 141 ? 3.017   79.405 41.769 1.00 31.87  ? 141  VAL A C   1 
ATOM   1091 O O   . VAL A 1 141 ? 2.541   80.181 42.598 1.00 31.87  ? 141  VAL A O   1 
ATOM   1092 C CB  . VAL A 1 141 ? 5.331   78.534 42.074 1.00 40.28  ? 141  VAL A CB  1 
ATOM   1093 C CG1 . VAL A 1 141 ? 6.807   78.704 41.710 1.00 40.28  ? 141  VAL A CG1 1 
ATOM   1094 C CG2 . VAL A 1 141 ? 5.144   78.699 43.571 1.00 40.28  ? 141  VAL A CG2 1 
ATOM   1095 N N   . VAL A 1 142 ? 2.314   78.425 41.215 1.00 33.93  ? 142  VAL A N   1 
ATOM   1096 C CA  . VAL A 1 142 ? 0.954   78.155 41.652 1.00 33.93  ? 142  VAL A CA  1 
ATOM   1097 C C   . VAL A 1 142 ? 1.136   77.191 42.825 1.00 33.93  ? 142  VAL A C   1 
ATOM   1098 O O   . VAL A 1 142 ? 1.712   76.119 42.663 1.00 33.93  ? 142  VAL A O   1 
ATOM   1099 C CB  . VAL A 1 142 ? 0.121   77.483 40.548 1.00 26.00  ? 142  VAL A CB  1 
ATOM   1100 C CG1 . VAL A 1 142 ? -1.159  76.921 41.133 1.00 26.00  ? 142  VAL A CG1 1 
ATOM   1101 C CG2 . VAL A 1 142 ? -0.213  78.492 39.483 1.00 26.00  ? 142  VAL A CG2 1 
ATOM   1102 N N   . LEU A 1 143 ? 0.665   77.586 44.003 1.00 31.30  ? 143  LEU A N   1 
ATOM   1103 C CA  . LEU A 1 143 ? 0.812   76.767 45.204 1.00 31.30  ? 143  LEU A CA  1 
ATOM   1104 C C   . LEU A 1 143 ? -0.498  76.088 45.601 1.00 31.30  ? 143  LEU A C   1 
ATOM   1105 O O   . LEU A 1 143 ? -1.528  76.739 45.778 1.00 31.30  ? 143  LEU A O   1 
ATOM   1106 C CB  . LEU A 1 143 ? 1.332   77.642 46.356 1.00 37.89  ? 143  LEU A CB  1 
ATOM   1107 C CG  . LEU A 1 143 ? 2.023   77.019 47.577 1.00 37.89  ? 143  LEU A CG  1 
ATOM   1108 C CD1 . LEU A 1 143 ? 1.039   76.225 48.408 1.00 37.89  ? 143  LEU A CD1 1 
ATOM   1109 C CD2 . LEU A 1 143 ? 3.162   76.132 47.115 1.00 37.89  ? 143  LEU A CD2 1 
ATOM   1110 N N   . VAL A 1 144 ? -0.450  74.766 45.726 1.00 29.08  ? 144  VAL A N   1 
ATOM   1111 C CA  . VAL A 1 144 ? -1.623  74.000 46.108 1.00 29.08  ? 144  VAL A CA  1 
ATOM   1112 C C   . VAL A 1 144 ? -1.370  73.238 47.396 1.00 29.08  ? 144  VAL A C   1 
ATOM   1113 O O   . VAL A 1 144 ? -0.314  72.629 47.567 1.00 29.08  ? 144  VAL A O   1 
ATOM   1114 C CB  . VAL A 1 144 ? -2.006  72.946 45.032 1.00 25.75  ? 144  VAL A CB  1 
ATOM   1115 C CG1 . VAL A 1 144 ? -3.201  72.119 45.512 1.00 25.75  ? 144  VAL A CG1 1 
ATOM   1116 C CG2 . VAL A 1 144 ? -2.317  73.625 43.706 1.00 25.75  ? 144  VAL A CG2 1 
ATOM   1117 N N   . SER A 1 145 ? -2.325  73.287 48.313 1.00 28.88  ? 145  SER A N   1 
ATOM   1118 C CA  . SER A 1 145 ? -2.202  72.507 49.530 1.00 28.88  ? 145  SER A CA  1 
ATOM   1119 C C   . SER A 1 145 ? -3.486  71.692 49.572 1.00 28.88  ? 145  SER A C   1 
ATOM   1120 O O   . SER A 1 145 ? -4.577  72.222 49.386 1.00 28.88  ? 145  SER A O   1 
ATOM   1121 C CB  . SER A 1 145 ? -2.059  73.389 50.775 1.00 33.43  ? 145  SER A CB  1 
ATOM   1122 O OG  . SER A 1 145 ? -3.256  74.062 51.103 1.00 33.43  ? 145  SER A OG  1 
ATOM   1123 N N   . LEU A 1 146 ? -3.358  70.390 49.777 1.00 37.29  ? 146  LEU A N   1 
ATOM   1124 C CA  . LEU A 1 146 ? -4.531  69.540 49.812 1.00 37.29  ? 146  LEU A CA  1 
ATOM   1125 C C   . LEU A 1 146 ? -4.798  69.044 51.219 1.00 37.29  ? 146  LEU A C   1 
ATOM   1126 O O   . LEU A 1 146 ? -4.117  69.419 52.160 1.00 37.29  ? 146  LEU A O   1 
ATOM   1127 C CB  . LEU A 1 146 ? -4.339  68.361 48.851 1.00 27.77  ? 146  LEU A CB  1 
ATOM   1128 C CG  . LEU A 1 146 ? -3.021  67.595 48.975 1.00 27.77  ? 146  LEU A CG  1 
ATOM   1129 C CD1 . LEU A 1 146 ? -2.958  66.880 50.316 1.00 27.77  ? 146  LEU A CD1 1 
ATOM   1130 C CD2 . LEU A 1 146 ? -2.901  66.596 47.849 1.00 27.77  ? 146  LEU A CD2 1 
ATOM   1131 N N   . SER A 1 147 ? -5.812  68.207 51.358 1.00 33.61  ? 147  SER A N   1 
ATOM   1132 C CA  . SER A 1 147 ? -6.139  67.644 52.645 1.00 33.61  ? 147  SER A CA  1 
ATOM   1133 C C   . SER A 1 147 ? -6.439  66.169 52.432 1.00 33.61  ? 147  SER A C   1 
ATOM   1134 O O   . SER A 1 147 ? -6.665  65.732 51.305 1.00 33.61  ? 147  SER A O   1 
ATOM   1135 C CB  . SER A 1 147 ? -7.345  68.358 53.259 1.00 45.34  ? 147  SER A CB  1 
ATOM   1136 O OG  . SER A 1 147 ? -8.483  68.215 52.437 1.00 45.34  ? 147  SER A OG  1 
ATOM   1137 N N   . TYR A 1 148 ? -6.414  65.408 53.516 1.00 30.82  ? 148  TYR A N   1 
ATOM   1138 C CA  . TYR A 1 148 ? -6.677  63.984 53.463 1.00 30.82  ? 148  TYR A CA  1 
ATOM   1139 C C   . TYR A 1 148 ? -7.076  63.525 54.856 1.00 30.82  ? 148  TYR A C   1 
ATOM   1140 O O   . TYR A 1 148 ? -6.650  64.113 55.851 1.00 30.82  ? 148  TYR A O   1 
ATOM   1141 C CB  . TYR A 1 148 ? -5.434  63.218 52.990 1.00 25.72  ? 148  TYR A CB  1 
ATOM   1142 C CG  . TYR A 1 148 ? -4.210  63.372 53.868 1.00 25.72  ? 148  TYR A CG  1 
ATOM   1143 C CD1 . TYR A 1 148 ? -3.346  64.451 53.720 1.00 25.72  ? 148  TYR A CD1 1 
ATOM   1144 C CD2 . TYR A 1 148 ? -3.914  62.428 54.847 1.00 25.72  ? 148  TYR A CD2 1 
ATOM   1145 C CE1 . TYR A 1 148 ? -2.213  64.584 54.525 1.00 25.72  ? 148  TYR A CE1 1 
ATOM   1146 C CE2 . TYR A 1 148 ? -2.788  62.550 55.660 1.00 25.72  ? 148  TYR A CE2 1 
ATOM   1147 C CZ  . TYR A 1 148 ? -1.942  63.626 55.494 1.00 25.72  ? 148  TYR A CZ  1 
ATOM   1148 O OH  . TYR A 1 148 ? -0.825  63.720 56.291 1.00 25.72  ? 148  TYR A OH  1 
ATOM   1149 N N   . ARG A 1 149 ? -7.902  62.488 54.918 1.00 31.61  ? 149  ARG A N   1 
ATOM   1150 C CA  . ARG A 1 149 ? -8.362  61.948 56.182 1.00 31.61  ? 149  ARG A CA  1 
ATOM   1151 C C   . ARG A 1 149 ? -7.207  61.350 56.978 1.00 31.61  ? 149  ARG A C   1 
ATOM   1152 O O   . ARG A 1 149 ? -6.330  60.691 56.421 1.00 31.61  ? 149  ARG A O   1 
ATOM   1153 C CB  . ARG A 1 149 ? -9.428  60.877 55.941 1.00 31.41  ? 149  ARG A CB  1 
ATOM   1154 C CG  . ARG A 1 149 ? -10.762 61.419 55.457 1.00 31.41  ? 149  ARG A CG  1 
ATOM   1155 C CD  . ARG A 1 149 ? -11.673 60.293 55.017 1.00 31.41  ? 149  ARG A CD  1 
ATOM   1156 N NE  . ARG A 1 149 ? -11.293 59.769 53.712 1.00 31.41  ? 149  ARG A NE  1 
ATOM   1157 C CZ  . ARG A 1 149 ? -11.850 58.709 53.138 1.00 31.41  ? 149  ARG A CZ  1 
ATOM   1158 N NH1 . ARG A 1 149 ? -12.815 58.046 53.761 1.00 31.41  ? 149  ARG A NH1 1 
ATOM   1159 N NH2 . ARG A 1 149 ? -11.455 58.322 51.931 1.00 31.41  ? 149  ARG A NH2 1 
ATOM   1160 N N   . VAL A 1 150 ? -7.213  61.592 58.284 1.00 29.66  ? 150  VAL A N   1 
ATOM   1161 C CA  . VAL A 1 150 ? -6.174  61.076 59.166 1.00 29.66  ? 150  VAL A CA  1 
ATOM   1162 C C   . VAL A 1 150 ? -6.785  60.191 60.259 1.00 29.66  ? 150  VAL A C   1 
ATOM   1163 O O   . VAL A 1 150 ? -8.011  60.066 60.366 1.00 29.66  ? 150  VAL A O   1 
ATOM   1164 C CB  . VAL A 1 150 ? -5.373  62.233 59.843 1.00 23.85  ? 150  VAL A CB  1 
ATOM   1165 C CG1 . VAL A 1 150 ? -4.695  63.083 58.785 1.00 23.85  ? 150  VAL A CG1 1 
ATOM   1166 C CG2 . VAL A 1 150 ? -6.293  63.083 60.701 1.00 23.85  ? 150  VAL A CG2 1 
ATOM   1167 N N   . GLY A 1 151 ? -5.920  59.586 61.071 1.00 28.96  ? 151  GLY A N   1 
ATOM   1168 C CA  . GLY A 1 151 ? -6.389  58.720 62.137 1.00 28.96  ? 151  GLY A CA  1 
ATOM   1169 C C   . GLY A 1 151 ? -7.167  57.539 61.584 1.00 28.96  ? 151  GLY A C   1 
ATOM   1170 O O   . GLY A 1 151 ? -6.949  57.116 60.452 1.00 28.96  ? 151  GLY A O   1 
ATOM   1171 N N   . ALA A 1 152 ? -8.082  57.007 62.382 1.00 32.67  ? 152  ALA A N   1 
ATOM   1172 C CA  . ALA A 1 152 ? -8.888  55.867 61.965 1.00 32.67  ? 152  ALA A CA  1 
ATOM   1173 C C   . ALA A 1 152 ? -9.717  56.172 60.708 1.00 32.67  ? 152  ALA A C   1 
ATOM   1174 O O   . ALA A 1 152 ? -9.932  55.300 59.871 1.00 32.67  ? 152  ALA A O   1 
ATOM   1175 C CB  . ALA A 1 152 ? -9.799  55.443 63.107 1.00 28.90  ? 152  ALA A CB  1 
ATOM   1176 N N   . PHE A 1 153 ? -10.167 57.414 60.574 1.00 28.15  ? 153  PHE A N   1 
ATOM   1177 C CA  . PHE A 1 153 ? -10.981 57.816 59.434 1.00 28.15  ? 153  PHE A CA  1 
ATOM   1178 C C   . PHE A 1 153 ? -10.264 57.650 58.104 1.00 28.15  ? 153  PHE A C   1 
ATOM   1179 O O   . PHE A 1 153 ? -10.902 57.459 57.071 1.00 28.15  ? 153  PHE A O   1 
ATOM   1180 C CB  . PHE A 1 153 ? -11.425 59.271 59.606 1.00 34.84  ? 153  PHE A CB  1 
ATOM   1181 C CG  . PHE A 1 153 ? -12.119 59.539 60.915 1.00 34.84  ? 153  PHE A CG  1 
ATOM   1182 C CD1 . PHE A 1 153 ? -13.445 59.156 61.108 1.00 34.84  ? 153  PHE A CD1 1 
ATOM   1183 C CD2 . PHE A 1 153 ? -11.439 60.149 61.965 1.00 34.84  ? 153  PHE A CD2 1 
ATOM   1184 C CE1 . PHE A 1 153 ? -14.085 59.375 62.327 1.00 34.84  ? 153  PHE A CE1 1 
ATOM   1185 C CE2 . PHE A 1 153 ? -12.069 60.373 63.193 1.00 34.84  ? 153  PHE A CE2 1 
ATOM   1186 C CZ  . PHE A 1 153 ? -13.397 59.985 63.374 1.00 34.84  ? 153  PHE A CZ  1 
ATOM   1187 N N   . GLY A 1 154 ? -8.937  57.720 58.121 1.00 29.09  ? 154  GLY A N   1 
ATOM   1188 C CA  . GLY A 1 154 ? -8.204  57.584 56.879 1.00 29.09  ? 154  GLY A CA  1 
ATOM   1189 C C   . GLY A 1 154 ? -7.307  56.370 56.774 1.00 29.09  ? 154  GLY A C   1 
ATOM   1190 O O   . GLY A 1 154 ? -6.796  56.076 55.689 1.00 29.09  ? 154  GLY A O   1 
ATOM   1191 N N   . PHE A 1 155 ? -7.138  55.638 57.874 1.00 26.26  ? 155  PHE A N   1 
ATOM   1192 C CA  . PHE A 1 155 ? -6.235  54.502 57.859 1.00 26.26  ? 155  PHE A CA  1 
ATOM   1193 C C   . PHE A 1 155 ? -6.668  53.198 58.537 1.00 26.26  ? 155  PHE A C   1 
ATOM   1194 O O   . PHE A 1 155 ? -5.869  52.262 58.663 1.00 26.26  ? 155  PHE A O   1 
ATOM   1195 C CB  . PHE A 1 155 ? -4.880  54.979 58.383 1.00 23.08  ? 155  PHE A CB  1 
ATOM   1196 C CG  . PHE A 1 155 ? -4.268  56.054 57.529 1.00 23.08  ? 155  PHE A CG  1 
ATOM   1197 C CD1 . PHE A 1 155 ? -3.607  55.731 56.350 1.00 23.08  ? 155  PHE A CD1 1 
ATOM   1198 C CD2 . PHE A 1 155 ? -4.452  57.392 57.841 1.00 23.08  ? 155  PHE A CD2 1 
ATOM   1199 C CE1 . PHE A 1 155 ? -3.148  56.725 55.494 1.00 23.08  ? 155  PHE A CE1 1 
ATOM   1200 C CE2 . PHE A 1 155 ? -3.999  58.391 56.989 1.00 23.08  ? 155  PHE A CE2 1 
ATOM   1201 C CZ  . PHE A 1 155 ? -3.345  58.054 55.810 1.00 23.08  ? 155  PHE A CZ  1 
ATOM   1202 N N   . LEU A 1 156 ? -7.925  53.128 58.967 1.00 33.51  ? 156  LEU A N   1 
ATOM   1203 C CA  . LEU A 1 156 ? -8.447  51.899 59.567 1.00 33.51  ? 156  LEU A CA  1 
ATOM   1204 C C   . LEU A 1 156 ? -8.290  50.863 58.453 1.00 33.51  ? 156  LEU A C   1 
ATOM   1205 O O   . LEU A 1 156 ? -8.742  51.081 57.336 1.00 33.51  ? 156  LEU A O   1 
ATOM   1206 C CB  . LEU A 1 156 ? -9.928  52.045 59.916 1.00 38.53  ? 156  LEU A CB  1 
ATOM   1207 C CG  . LEU A 1 156 ? -10.587 50.835 60.587 1.00 38.53  ? 156  LEU A CG  1 
ATOM   1208 C CD1 . LEU A 1 156 ? -10.198 50.810 62.059 1.00 38.53  ? 156  LEU A CD1 1 
ATOM   1209 C CD2 . LEU A 1 156 ? -12.098 50.922 60.462 1.00 38.53  ? 156  LEU A CD2 1 
ATOM   1210 N N   . ALA A 1 157 ? -7.645  49.746 58.748 1.00 37.43  ? 157  ALA A N   1 
ATOM   1211 C CA  . ALA A 1 157 ? -7.422  48.752 57.717 1.00 37.43  ? 157  ALA A CA  1 
ATOM   1212 C C   . ALA A 1 157 ? -7.845  47.326 58.061 1.00 37.43  ? 157  ALA A C   1 
ATOM   1213 O O   . ALA A 1 157 ? -7.286  46.699 58.961 1.00 37.43  ? 157  ALA A O   1 
ATOM   1214 C CB  . ALA A 1 157 ? -5.951  48.773 57.319 1.00 25.13  ? 157  ALA A CB  1 
ATOM   1215 N N   . LEU A 1 158 ? -8.834  46.824 57.324 1.00 39.99  ? 158  LEU A N   1 
ATOM   1216 C CA  . LEU A 1 158 ? -9.336  45.458 57.488 1.00 39.99  ? 158  LEU A CA  1 
ATOM   1217 C C   . LEU A 1 158 ? -9.180  44.793 56.126 1.00 39.99  ? 158  LEU A C   1 
ATOM   1218 O O   . LEU A 1 158 ? -10.157 44.525 55.431 1.00 39.99  ? 158  LEU A O   1 
ATOM   1219 C CB  . LEU A 1 158 ? -10.807 45.477 57.914 1.00 37.26  ? 158  LEU A CB  1 
ATOM   1220 C CG  . LEU A 1 158 ? -11.005 45.879 59.378 1.00 37.26  ? 158  LEU A CG  1 
ATOM   1221 C CD1 . LEU A 1 158 ? -12.488 46.048 59.697 1.00 37.26  ? 158  LEU A CD1 1 
ATOM   1222 C CD2 . LEU A 1 158 ? -10.375 44.810 60.273 1.00 37.26  ? 158  LEU A CD2 1 
ATOM   1223 N N   . HIS A 1 159 ? -7.933  44.553 55.741 1.00 46.40  ? 159  HIS A N   1 
ATOM   1224 C CA  . HIS A 1 159 ? -7.611  43.952 54.450 1.00 46.40  ? 159  HIS A CA  1 
ATOM   1225 C C   . HIS A 1 159 ? -8.593  42.856 54.089 1.00 46.40  ? 159  HIS A C   1 
ATOM   1226 O O   . HIS A 1 159 ? -8.999  42.075 54.955 1.00 46.40  ? 159  HIS A O   1 
ATOM   1227 C CB  . HIS A 1 159 ? -6.201  43.371 54.480 1.00 49.07  ? 159  HIS A CB  1 
ATOM   1228 C CG  . HIS A 1 159 ? -5.706  42.923 53.140 1.00 49.07  ? 159  HIS A CG  1 
ATOM   1229 N ND1 . HIS A 1 159 ? -5.506  43.796 52.090 1.00 49.07  ? 159  HIS A ND1 1 
ATOM   1230 C CD2 . HIS A 1 159 ? -5.356  41.696 52.682 1.00 49.07  ? 159  HIS A CD2 1 
ATOM   1231 C CE1 . HIS A 1 159 ? -5.055  43.126 51.044 1.00 49.07  ? 159  HIS A CE1 1 
ATOM   1232 N NE2 . HIS A 1 159 ? -4.955  41.850 51.378 1.00 49.07  ? 159  HIS A NE2 1 
ATOM   1233 N N   . GLY A 1 160 ? -8.980  42.799 52.814 1.00 54.61  ? 160  GLY A N   1 
ATOM   1234 C CA  . GLY A 1 160 ? -9.915  41.773 52.380 1.00 54.61  ? 160  GLY A CA  1 
ATOM   1235 C C   . GLY A 1 160 ? -11.347 42.254 52.228 1.00 54.61  ? 160  GLY A C   1 
ATOM   1236 O O   . GLY A 1 160 ? -12.148 41.607 51.549 1.00 54.61  ? 160  GLY A O   1 
ATOM   1237 N N   . SER A 1 161 ? -11.687 43.376 52.857 1.00 59.90  ? 161  SER A N   1 
ATOM   1238 C CA  . SER A 1 161 ? -13.042 43.913 52.750 1.00 59.90  ? 161  SER A CA  1 
ATOM   1239 C C   . SER A 1 161 ? -12.967 45.231 51.992 1.00 59.90  ? 161  SER A C   1 
ATOM   1240 O O   . SER A 1 161 ? -11.989 45.976 52.128 1.00 59.90  ? 161  SER A O   1 
ATOM   1241 C CB  . SER A 1 161 ? -13.643 44.161 54.134 1.00 67.94  ? 161  SER A CB  1 
ATOM   1242 O OG  . SER A 1 161 ? -13.240 45.426 54.639 1.00 67.94  ? 161  SER A OG  1 
ATOM   1243 N N   . GLN A 1 162 ? -13.993 45.527 51.201 1.00 51.53  ? 162  GLN A N   1 
ATOM   1244 C CA  . GLN A 1 162 ? -14.001 46.755 50.422 1.00 51.53  ? 162  GLN A CA  1 
ATOM   1245 C C   . GLN A 1 162 ? -14.573 47.929 51.197 1.00 51.53  ? 162  GLN A C   1 
ATOM   1246 O O   . GLN A 1 162 ? -14.568 49.058 50.703 1.00 51.53  ? 162  GLN A O   1 
ATOM   1247 C CB  . GLN A 1 162 ? -14.796 46.559 49.126 1.00 75.68  ? 162  GLN A CB  1 
ATOM   1248 C CG  . GLN A 1 162 ? -14.197 45.517 48.179 1.00 75.68  ? 162  GLN A CG  1 
ATOM   1249 C CD  . GLN A 1 162 ? -12.689 45.678 48.018 1.00 75.68  ? 162  GLN A CD  1 
ATOM   1250 O OE1 . GLN A 1 162 ? -12.162 46.811 48.008 1.00 75.68  ? 162  GLN A OE1 1 
ATOM   1251 N NE2 . GLN A 1 162 ? -11.983 44.551 47.878 1.00 75.68  ? 162  GLN A NE2 1 
ATOM   1252 N N   . GLU A 1 163 ? -15.062 47.665 52.407 1.00 48.25  ? 163  GLU A N   1 
ATOM   1253 C CA  . GLU A 1 163 ? -15.646 48.709 53.240 1.00 48.25  ? 163  GLU A CA  1 
ATOM   1254 C C   . GLU A 1 163 ? -14.617 49.540 54.022 1.00 48.25  ? 163  GLU A C   1 
ATOM   1255 O O   . GLU A 1 163 ? -14.894 50.686 54.387 1.00 48.25  ? 163  GLU A O   1 
ATOM   1256 C CB  . GLU A 1 163 ? -16.659 48.098 54.214 1.00 74.74  ? 163  GLU A CB  1 
ATOM   1257 C CG  . GLU A 1 163 ? -17.921 47.541 53.544 1.00 74.74  ? 163  GLU A CG  1 
ATOM   1258 C CD  . GLU A 1 163 ? -18.483 48.475 52.479 1.00 74.74  ? 163  GLU A CD  1 
ATOM   1259 O OE1 . GLU A 1 163 ? -18.641 49.699 52.746 1.00 74.74  ? 163  GLU A OE1 1 
ATOM   1260 O OE2 . GLU A 1 163 ? -18.775 47.980 51.362 1.00 74.74  ? 163  GLU A OE2 1 
ATOM   1261 N N   . ALA A 1 164 ? -13.449 48.957 54.290 1.00 43.17  ? 164  ALA A N   1 
ATOM   1262 C CA  . ALA A 1 164 ? -12.357 49.641 55.006 1.00 43.17  ? 164  ALA A CA  1 
ATOM   1263 C C   . ALA A 1 164 ? -11.057 48.952 54.599 1.00 43.17  ? 164  ALA A C   1 
ATOM   1264 O O   . ALA A 1 164 ? -10.408 48.286 55.409 1.00 43.17  ? 164  ALA A O   1 
ATOM   1265 C CB  . ALA A 1 164 ? -12.549 49.545 56.524 1.00 22.87  ? 164  ALA A CB  1 
ATOM   1266 N N   . PRO A 1 165 ? -10.666 49.108 53.328 1.00 40.87  ? 165  PRO A N   1 
ATOM   1267 C CA  . PRO A 1 165 ? -9.454  48.508 52.770 1.00 40.87  ? 165  PRO A CA  1 
ATOM   1268 C C   . PRO A 1 165 ? -8.153  49.008 53.368 1.00 40.87  ? 165  PRO A C   1 
ATOM   1269 O O   . PRO A 1 165 ? -7.176  48.265 53.462 1.00 40.87  ? 165  PRO A O   1 
ATOM   1270 C CB  . PRO A 1 165 ? -9.569  48.835 51.284 1.00 28.87  ? 165  PRO A CB  1 
ATOM   1271 C CG  . PRO A 1 165 ? -10.255 50.154 51.291 1.00 28.87  ? 165  PRO A CG  1 
ATOM   1272 C CD  . PRO A 1 165 ? -11.330 49.967 52.332 1.00 28.87  ? 165  PRO A CD  1 
ATOM   1273 N N   . GLY A 1 166 ? -8.148  50.262 53.792 1.00 35.76  ? 166  GLY A N   1 
ATOM   1274 C CA  . GLY A 1 166 ? -6.935  50.835 54.339 1.00 35.76  ? 166  GLY A CA  1 
ATOM   1275 C C   . GLY A 1 166 ? -6.376  51.790 53.304 1.00 35.76  ? 166  GLY A C   1 
ATOM   1276 O O   . GLY A 1 166 ? -6.835  51.817 52.165 1.00 35.76  ? 166  GLY A O   1 
ATOM   1277 N N   . ASN A 1 167 ? -5.407  52.595 53.711 1.00 33.18  ? 167  ASN A N   1 
ATOM   1278 C CA  . ASN A 1 167 ? -4.770  53.552 52.828 1.00 33.18  ? 167  ASN A CA  1 
ATOM   1279 C C   . ASN A 1 167 ? -5.719  54.533 52.154 1.00 33.18  ? 167  ASN A C   1 
ATOM   1280 O O   . ASN A 1 167 ? -5.322  55.237 51.228 1.00 33.18  ? 167  ASN A O   1 
ATOM   1281 C CB  . ASN A 1 167 ? -3.962  52.809 51.759 1.00 32.10  ? 167  ASN A CB  1 
ATOM   1282 C CG  . ASN A 1 167 ? -2.874  51.938 52.359 1.00 32.10  ? 167  ASN A CG  1 
ATOM   1283 O OD1 . ASN A 1 167 ? -2.263  52.301 53.357 1.00 32.10  ? 167  ASN A OD1 1 
ATOM   1284 N ND2 . ASN A 1 167 ? -2.617  50.793 51.744 1.00 32.10  ? 167  ASN A ND2 1 
ATOM   1285 N N   . VAL A 1 168 ? -6.962  54.610 52.609 1.00 29.79  ? 168  VAL A N   1 
ATOM   1286 C CA  . VAL A 1 168 ? -7.886  55.528 51.959 1.00 29.79  ? 168  VAL A CA  1 
ATOM   1287 C C   . VAL A 1 168 ? -7.405  56.966 52.117 1.00 29.79  ? 168  VAL A C   1 
ATOM   1288 O O   . VAL A 1 168 ? -7.738  57.830 51.314 1.00 29.79  ? 168  VAL A O   1 
ATOM   1289 C CB  . VAL A 1 168 ? -9.360  55.351 52.469 1.00 28.83  ? 168  VAL A CB  1 
ATOM   1290 C CG1 . VAL A 1 168 ? -9.793  53.899 52.279 1.00 28.83  ? 168  VAL A CG1 1 
ATOM   1291 C CG2 . VAL A 1 168 ? -9.499  55.773 53.911 1.00 28.83  ? 168  VAL A CG2 1 
ATOM   1292 N N   . GLY A 1 169 ? -6.595  57.213 53.140 1.00 29.45  ? 169  GLY A N   1 
ATOM   1293 C CA  . GLY A 1 169 ? -6.058  58.548 53.340 1.00 29.45  ? 169  GLY A CA  1 
ATOM   1294 C C   . GLY A 1 169 ? -5.080  58.896 52.227 1.00 29.45  ? 169  GLY A C   1 
ATOM   1295 O O   . GLY A 1 169 ? -4.976  60.055 51.821 1.00 29.45  ? 169  GLY A O   1 
ATOM   1296 N N   . LEU A 1 170 ? -4.356  57.892 51.736 1.00 27.43  ? 170  LEU A N   1 
ATOM   1297 C CA  . LEU A 1 170 ? -3.400  58.108 50.660 1.00 27.43  ? 170  LEU A CA  1 
ATOM   1298 C C   . LEU A 1 170 ? -4.170  58.281 49.354 1.00 27.43  ? 170  LEU A C   1 
ATOM   1299 O O   . LEU A 1 170 ? -3.764  59.058 48.488 1.00 27.43  ? 170  LEU A O   1 
ATOM   1300 C CB  . LEU A 1 170 ? -2.417  56.941 50.560 1.00 23.94  ? 170  LEU A CB  1 
ATOM   1301 C CG  . LEU A 1 170 ? -1.456  56.801 51.750 1.00 23.94  ? 170  LEU A CG  1 
ATOM   1302 C CD1 . LEU A 1 170 ? -0.625  55.541 51.617 1.00 23.94  ? 170  LEU A CD1 1 
ATOM   1303 C CD2 . LEU A 1 170 ? -0.551  58.003 51.822 1.00 23.94  ? 170  LEU A CD2 1 
ATOM   1304 N N   . LEU A 1 171 ? -5.289  57.569 49.222 1.00 32.31  ? 171  LEU A N   1 
ATOM   1305 C CA  . LEU A 1 171 ? -6.108  57.698 48.023 1.00 32.31  ? 171  LEU A CA  1 
ATOM   1306 C C   . LEU A 1 171 ? -6.691  59.112 47.961 1.00 32.31  ? 171  LEU A C   1 
ATOM   1307 O O   . LEU A 1 171 ? -6.846  59.661 46.877 1.00 32.31  ? 171  LEU A O   1 
ATOM   1308 C CB  . LEU A 1 171 ? -7.218  56.645 48.000 1.00 32.57  ? 171  LEU A CB  1 
ATOM   1309 C CG  . LEU A 1 171 ? -6.719  55.203 47.820 1.00 32.57  ? 171  LEU A CG  1 
ATOM   1310 C CD1 . LEU A 1 171 ? -7.911  54.297 47.635 1.00 32.57  ? 171  LEU A CD1 1 
ATOM   1311 C CD2 . LEU A 1 171 ? -5.795  55.088 46.610 1.00 32.57  ? 171  LEU A CD2 1 
ATOM   1312 N N   . ASP A 1 172 ? -7.004  59.701 49.123 1.00 37.80  ? 172  ASP A N   1 
ATOM   1313 C CA  . ASP A 1 172 ? -7.509  61.078 49.162 1.00 37.80  ? 172  ASP A CA  1 
ATOM   1314 C C   . ASP A 1 172 ? -6.453  61.983 48.508 1.00 37.80  ? 172  ASP A C   1 
ATOM   1315 O O   . ASP A 1 172 ? -6.759  62.801 47.636 1.00 37.80  ? 172  ASP A O   1 
ATOM   1316 C CB  . ASP A 1 172 ? -7.715  61.585 50.602 1.00 38.17  ? 172  ASP A CB  1 
ATOM   1317 C CG  . ASP A 1 172 ? -8.896  60.935 51.318 1.00 38.17  ? 172  ASP A CG  1 
ATOM   1318 O OD1 . ASP A 1 172 ? -9.873  60.530 50.647 1.00 38.17  ? 172  ASP A OD1 1 
ATOM   1319 O OD2 . ASP A 1 172 ? -8.849  60.860 52.569 1.00 38.17  ? 172  ASP A OD2 1 
ATOM   1320 N N   . GLN A 1 173 ? -5.206  61.842 48.944 1.00 31.88  ? 173  GLN A N   1 
ATOM   1321 C CA  . GLN A 1 173 ? -4.129  62.666 48.404 1.00 31.88  ? 173  GLN A CA  1 
ATOM   1322 C C   . GLN A 1 173 ? -4.032  62.466 46.897 1.00 31.88  ? 173  GLN A C   1 
ATOM   1323 O O   . GLN A 1 173 ? -3.945  63.429 46.136 1.00 31.88  ? 173  GLN A O   1 
ATOM   1324 C CB  . GLN A 1 173 ? -2.796  62.308 49.058 1.00 25.41  ? 173  GLN A CB  1 
ATOM   1325 C CG  . GLN A 1 173 ? -2.775  62.454 50.554 1.00 25.41  ? 173  GLN A CG  1 
ATOM   1326 C CD  . GLN A 1 173 ? -1.475  61.958 51.155 1.00 25.41  ? 173  GLN A CD  1 
ATOM   1327 O OE1 . GLN A 1 173 ? -0.605  61.439 50.449 1.00 25.41  ? 173  GLN A OE1 1 
ATOM   1328 N NE2 . GLN A 1 173 ? -1.339  62.103 52.472 1.00 25.41  ? 173  GLN A NE2 1 
ATOM   1329 N N   . ARG A 1 174 ? -4.055  61.205 46.475 1.00 30.55  ? 174  ARG A N   1 
ATOM   1330 C CA  . ARG A 1 174 ? -3.974  60.874 45.067 1.00 30.55  ? 174  ARG A CA  1 
ATOM   1331 C C   . ARG A 1 174 ? -5.124  61.505 44.294 1.00 30.55  ? 174  ARG A C   1 
ATOM   1332 O O   . ARG A 1 174 ? -4.958  61.922 43.150 1.00 30.55  ? 174  ARG A O   1 
ATOM   1333 C CB  . ARG A 1 174 ? -4.007  59.361 44.857 1.00 34.53  ? 174  ARG A CB  1 
ATOM   1334 C CG  . ARG A 1 174 ? -4.070  58.992 43.386 1.00 34.53  ? 174  ARG A CG  1 
ATOM   1335 C CD  . ARG A 1 174 ? -4.210  57.506 43.173 1.00 34.53  ? 174  ARG A CD  1 
ATOM   1336 N NE  . ARG A 1 174 ? -3.023  56.789 43.607 1.00 34.53  ? 174  ARG A NE  1 
ATOM   1337 C CZ  . ARG A 1 174 ? -2.964  55.473 43.748 1.00 34.53  ? 174  ARG A CZ  1 
ATOM   1338 N NH1 . ARG A 1 174 ? -4.030  54.729 43.490 1.00 34.53  ? 174  ARG A NH1 1 
ATOM   1339 N NH2 . ARG A 1 174 ? -1.837  54.903 44.135 1.00 34.53  ? 174  ARG A NH2 1 
ATOM   1340 N N   . MET A 1 175 ? -6.289  61.568 44.917 1.00 29.11  ? 175  MET A N   1 
ATOM   1341 C CA  . MET A 1 175 ? -7.434  62.139 44.243 1.00 29.11  ? 175  MET A CA  1 
ATOM   1342 C C   . MET A 1 175 ? -7.257  63.631 44.040 1.00 29.11  ? 175  MET A C   1 
ATOM   1343 O O   . MET A 1 175 ? -7.634  64.166 43.006 1.00 29.11  ? 175  MET A O   1 
ATOM   1344 C CB  . MET A 1 175 ? -8.721  61.865 45.017 1.00 53.49  ? 175  MET A CB  1 
ATOM   1345 C CG  . MET A 1 175 ? -9.947  62.251 44.210 1.00 53.49  ? 175  MET A CG  1 
ATOM   1346 S SD  . MET A 1 175 ? -11.262 61.049 44.340 1.00 53.49  ? 175  MET A SD  1 
ATOM   1347 C CE  . MET A 1 175 ? -12.404 62.029 45.091 1.00 53.49  ? 175  MET A CE  1 
ATOM   1348 N N   . ALA A 1 176 ? -6.679  64.295 45.033 1.00 30.59  ? 176  ALA A N   1 
ATOM   1349 C CA  . ALA A 1 176 ? -6.437  65.718 44.939 1.00 30.59  ? 176  ALA A CA  1 
ATOM   1350 C C   . ALA A 1 176 ? -5.390  65.940 43.852 1.00 30.59  ? 176  ALA A C   1 
ATOM   1351 O O   . ALA A 1 176 ? -5.455  66.918 43.107 1.00 30.59  ? 176  ALA A O   1 
ATOM   1352 C CB  . ALA A 1 176 ? -5.948  66.259 46.273 1.00 30.14  ? 176  ALA A CB  1 
ATOM   1353 N N   . LEU A 1 177 ? -4.425  65.030 43.758 1.00 29.53  ? 177  LEU A N   1 
ATOM   1354 C CA  . LEU A 1 177 ? -3.393  65.153 42.734 1.00 29.53  ? 177  LEU A CA  1 
ATOM   1355 C C   . LEU A 1 177 ? -4.007  64.938 41.349 1.00 29.53  ? 177  LEU A C   1 
ATOM   1356 O O   . LEU A 1 177 ? -3.617  65.583 40.383 1.00 29.53  ? 177  LEU A O   1 
ATOM   1357 C CB  . LEU A 1 177 ? -2.257  64.151 42.978 1.00 40.50  ? 177  LEU A CB  1 
ATOM   1358 C CG  . LEU A 1 177 ? -1.328  64.494 44.153 1.00 40.50  ? 177  LEU A CG  1 
ATOM   1359 C CD1 . LEU A 1 177 ? -0.442  63.306 44.494 1.00 40.50  ? 177  LEU A CD1 1 
ATOM   1360 C CD2 . LEU A 1 177 ? -0.481  65.705 43.806 1.00 40.50  ? 177  LEU A CD2 1 
ATOM   1361 N N   . GLN A 1 178 ? -4.981  64.041 41.262 1.00 31.10  ? 178  GLN A N   1 
ATOM   1362 C CA  . GLN A 1 178 ? -5.648  63.776 39.989 1.00 31.10  ? 178  GLN A CA  1 
ATOM   1363 C C   . GLN A 1 178 ? -6.382  65.042 39.550 1.00 31.10  ? 178  GLN A C   1 
ATOM   1364 O O   . GLN A 1 178 ? -6.365  65.397 38.381 1.00 31.10  ? 178  GLN A O   1 
ATOM   1365 C CB  . GLN A 1 178 ? -6.638  62.607 40.122 1.00 37.16  ? 178  GLN A CB  1 
ATOM   1366 C CG  . GLN A 1 178 ? -7.347  62.215 38.824 1.00 37.16  ? 178  GLN A CG  1 
ATOM   1367 C CD  . GLN A 1 178 ? -6.400  61.645 37.782 1.00 37.16  ? 178  GLN A CD  1 
ATOM   1368 O OE1 . GLN A 1 178 ? -5.772  60.609 37.998 1.00 37.16  ? 178  GLN A OE1 1 
ATOM   1369 N NE2 . GLN A 1 178 ? -6.287  62.326 36.645 1.00 37.16  ? 178  GLN A NE2 1 
ATOM   1370 N N   . TRP A 1 179 ? -7.009  65.731 40.493 1.00 29.91  ? 179  TRP A N   1 
ATOM   1371 C CA  . TRP A 1 179 ? -7.722  66.962 40.174 1.00 29.91  ? 179  TRP A CA  1 
ATOM   1372 C C   . TRP A 1 179 ? -6.738  68.021 39.670 1.00 29.91  ? 179  TRP A C   1 
ATOM   1373 O O   . TRP A 1 179 ? -7.011  68.703 38.685 1.00 29.91  ? 179  TRP A O   1 
ATOM   1374 C CB  . TRP A 1 179 ? -8.451  67.484 41.404 1.00 30.45  ? 179  TRP A CB  1 
ATOM   1375 C CG  . TRP A 1 179 ? -9.532  68.449 41.099 1.00 30.45  ? 179  TRP A CG  1 
ATOM   1376 C CD1 . TRP A 1 179 ? -10.833 68.158 40.800 1.00 30.45  ? 179  TRP A CD1 1 
ATOM   1377 C CD2 . TRP A 1 179 ? -9.428  69.874 41.093 1.00 30.45  ? 179  TRP A CD2 1 
ATOM   1378 N NE1 . TRP A 1 179 ? -11.547 69.319 40.616 1.00 30.45  ? 179  TRP A NE1 1 
ATOM   1379 C CE2 . TRP A 1 179 ? -10.707 70.387 40.790 1.00 30.45  ? 179  TRP A CE2 1 
ATOM   1380 C CE3 . TRP A 1 179 ? -8.377  70.768 41.315 1.00 30.45  ? 179  TRP A CE3 1 
ATOM   1381 C CZ2 . TRP A 1 179 ? -10.964 71.754 40.706 1.00 30.45  ? 179  TRP A CZ2 1 
ATOM   1382 C CZ3 . TRP A 1 179 ? -8.636  72.131 41.230 1.00 30.45  ? 179  TRP A CZ3 1 
ATOM   1383 C CH2 . TRP A 1 179 ? -9.919  72.608 40.928 1.00 30.45  ? 179  TRP A CH2 1 
ATOM   1384 N N   . VAL A 1 180 ? -5.596  68.153 40.343 1.00 34.86  ? 180  VAL A N   1 
ATOM   1385 C CA  . VAL A 1 180 ? -4.575  69.116 39.940 1.00 34.86  ? 180  VAL A CA  1 
ATOM   1386 C C   . VAL A 1 180 ? -4.121  68.796 38.519 1.00 34.86  ? 180  VAL A C   1 
ATOM   1387 O O   . VAL A 1 180 ? -3.983  69.680 37.676 1.00 34.86  ? 180  VAL A O   1 
ATOM   1388 C CB  . VAL A 1 180 ? -3.341  69.069 40.889 1.00 29.07  ? 180  VAL A CB  1 
ATOM   1389 C CG1 . VAL A 1 180 ? -2.192  69.891 40.320 1.00 29.07  ? 180  VAL A CG1 1 
ATOM   1390 C CG2 . VAL A 1 180 ? -3.724  69.604 42.242 1.00 29.07  ? 180  VAL A CG2 1 
ATOM   1391 N N   . HIS A 1 181 ? -3.893  67.520 38.253 1.00 34.69  ? 181  HIS A N   1 
ATOM   1392 C CA  . HIS A 1 181 ? -3.463  67.107 36.938 1.00 34.69  ? 181  HIS A CA  1 
ATOM   1393 C C   . HIS A 1 181 ? -4.500  67.465 35.878 1.00 34.69  ? 181  HIS A C   1 
ATOM   1394 O O   . HIS A 1 181 ? -4.147  67.893 34.783 1.00 34.69  ? 181  HIS A O   1 
ATOM   1395 C CB  . HIS A 1 181 ? -3.199  65.607 36.933 1.00 44.03  ? 181  HIS A CB  1 
ATOM   1396 C CG  . HIS A 1 181 ? -2.648  65.101 35.641 1.00 44.03  ? 181  HIS A CG  1 
ATOM   1397 N ND1 . HIS A 1 181 ? -3.451  64.706 34.593 1.00 44.03  ? 181  HIS A ND1 1 
ATOM   1398 C CD2 . HIS A 1 181 ? -1.372  64.942 35.220 1.00 44.03  ? 181  HIS A CD2 1 
ATOM   1399 C CE1 . HIS A 1 181 ? -2.694  64.323 33.581 1.00 44.03  ? 181  HIS A CE1 1 
ATOM   1400 N NE2 . HIS A 1 181 ? -1.428  64.456 33.936 1.00 44.03  ? 181  HIS A NE2 1 
ATOM   1401 N N   . ASP A 1 182 ? -5.779  67.318 36.211 1.00 39.45  ? 182  ASP A N   1 
ATOM   1402 C CA  . ASP A 1 182 ? -6.846  67.613 35.256 1.00 39.45  ? 182  ASP A CA  1 
ATOM   1403 C C   . ASP A 1 182 ? -7.348  69.063 35.209 1.00 39.45  ? 182  ASP A C   1 
ATOM   1404 O O   . ASP A 1 182 ? -7.980  69.458 34.224 1.00 39.45  ? 182  ASP A O   1 
ATOM   1405 C CB  . ASP A 1 182 ? -8.063  66.714 35.514 1.00 52.58  ? 182  ASP A CB  1 
ATOM   1406 C CG  . ASP A 1 182 ? -7.738  65.228 35.419 1.00 52.58  ? 182  ASP A CG  1 
ATOM   1407 O OD1 . ASP A 1 182 ? -6.995  64.824 34.487 1.00 52.58  ? 182  ASP A OD1 1 
ATOM   1408 O OD2 . ASP A 1 182 ? -8.243  64.455 36.270 1.00 52.58  ? 182  ASP A OD2 1 
ATOM   1409 N N   . ASN A 1 183 ? -7.062  69.861 36.233 1.00 32.38  ? 183  ASN A N   1 
ATOM   1410 C CA  . ASN A 1 183 ? -7.593  71.220 36.261 1.00 32.38  ? 183  ASN A CA  1 
ATOM   1411 C C   . ASN A 1 183 ? -6.665  72.403 36.500 1.00 32.38  ? 183  ASN A C   1 
ATOM   1412 O O   . ASN A 1 183 ? -7.061  73.546 36.254 1.00 32.38  ? 183  ASN A O   1 
ATOM   1413 C CB  . ASN A 1 183 ? -8.701  71.294 37.312 1.00 32.63  ? 183  ASN A CB  1 
ATOM   1414 C CG  . ASN A 1 183 ? -9.861  70.381 37.005 1.00 32.63  ? 183  ASN A CG  1 
ATOM   1415 O OD1 . ASN A 1 183 ? -10.684 70.679 36.140 1.00 32.63  ? 183  ASN A OD1 1 
ATOM   1416 N ND2 . ASN A 1 183 ? -9.934  69.255 37.709 1.00 32.63  ? 183  ASN A ND2 1 
ATOM   1417 N N   . ILE A 1 184 ? -5.447  72.158 36.975 1.00 35.32  ? 184  ILE A N   1 
ATOM   1418 C CA  . ILE A 1 184 ? -4.540  73.259 37.281 1.00 35.32  ? 184  ILE A CA  1 
ATOM   1419 C C   . ILE A 1 184 ? -4.190  74.154 36.090 1.00 35.32  ? 184  ILE A C   1 
ATOM   1420 O O   . ILE A 1 184 ? -3.739  75.289 36.275 1.00 35.32  ? 184  ILE A O   1 
ATOM   1421 C CB  . ILE A 1 184 ? -3.239  72.738 37.965 1.00 25.42  ? 184  ILE A CB  1 
ATOM   1422 C CG1 . ILE A 1 184 ? -2.629  73.853 38.822 1.00 25.42  ? 184  ILE A CG1 1 
ATOM   1423 C CG2 . ILE A 1 184 ? -2.262  72.210 36.935 1.00 25.42  ? 184  ILE A CG2 1 
ATOM   1424 C CD1 . ILE A 1 184 ? -3.503  74.260 40.009 1.00 25.42  ? 184  ILE A CD1 1 
ATOM   1425 N N   . GLN A 1 185 ? -4.408  73.653 34.877 1.00 33.14  ? 185  GLN A N   1 
ATOM   1426 C CA  . GLN A 1 185 ? -4.111  74.421 33.678 1.00 33.14  ? 185  GLN A CA  1 
ATOM   1427 C C   . GLN A 1 185 ? -5.020  75.643 33.623 1.00 33.14  ? 185  GLN A C   1 
ATOM   1428 O O   . GLN A 1 185 ? -4.630  76.683 33.110 1.00 33.14  ? 185  GLN A O   1 
ATOM   1429 C CB  . GLN A 1 185 ? -4.310  73.564 32.418 1.00 37.06  ? 185  GLN A CB  1 
ATOM   1430 C CG  . GLN A 1 185 ? -5.763  73.275 32.076 1.00 37.06  ? 185  GLN A CG  1 
ATOM   1431 C CD  . GLN A 1 185 ? -5.936  72.123 31.083 1.00 37.06  ? 185  GLN A CD  1 
ATOM   1432 O OE1 . GLN A 1 185 ? -5.740  70.951 31.425 1.00 37.06  ? 185  GLN A OE1 1 
ATOM   1433 N NE2 . GLN A 1 185 ? -6.306  72.454 29.850 1.00 37.06  ? 185  GLN A NE2 1 
ATOM   1434 N N   . PHE A 1 186 ? -6.227  75.525 34.168 1.00 36.89  ? 186  PHE A N   1 
ATOM   1435 C CA  . PHE A 1 186 ? -7.165  76.646 34.156 1.00 36.89  ? 186  PHE A CA  1 
ATOM   1436 C C   . PHE A 1 186 ? -6.826  77.731 35.173 1.00 36.89  ? 186  PHE A C   1 
ATOM   1437 O O   . PHE A 1 186 ? -7.441  78.800 35.166 1.00 36.89  ? 186  PHE A O   1 
ATOM   1438 C CB  . PHE A 1 186 ? -8.588  76.138 34.389 1.00 30.33  ? 186  PHE A CB  1 
ATOM   1439 C CG  . PHE A 1 186 ? -8.991  75.063 33.430 1.00 30.33  ? 186  PHE A CG  1 
ATOM   1440 C CD1 . PHE A 1 186 ? -9.013  75.312 32.063 1.00 30.33  ? 186  PHE A CD1 1 
ATOM   1441 C CD2 . PHE A 1 186 ? -9.283  73.781 33.883 1.00 30.33  ? 186  PHE A CD2 1 
ATOM   1442 C CE1 . PHE A 1 186 ? -9.315  74.297 31.160 1.00 30.33  ? 186  PHE A CE1 1 
ATOM   1443 C CE2 . PHE A 1 186 ? -9.582  72.764 32.988 1.00 30.33  ? 186  PHE A CE2 1 
ATOM   1444 C CZ  . PHE A 1 186 ? -9.598  73.022 31.621 1.00 30.33  ? 186  PHE A CZ  1 
ATOM   1445 N N   . PHE A 1 187 ? -5.852  77.460 36.041 1.00 36.28  ? 187  PHE A N   1 
ATOM   1446 C CA  . PHE A 1 187 ? -5.431  78.428 37.050 1.00 36.28  ? 187  PHE A CA  1 
ATOM   1447 C C   . PHE A 1 187 ? -4.072  79.006 36.667 1.00 36.28  ? 187  PHE A C   1 
ATOM   1448 O O   . PHE A 1 187 ? -3.484  79.785 37.414 1.00 36.28  ? 187  PHE A O   1 
ATOM   1449 C CB  . PHE A 1 187 ? -5.330  77.779 38.443 1.00 25.71  ? 187  PHE A CB  1 
ATOM   1450 C CG  . PHE A 1 187 ? -6.652  77.319 39.009 1.00 25.71  ? 187  PHE A CG  1 
ATOM   1451 C CD1 . PHE A 1 187 ? -7.163  76.064 38.694 1.00 25.71  ? 187  PHE A CD1 1 
ATOM   1452 C CD2 . PHE A 1 187 ? -7.382  78.143 39.865 1.00 25.71  ? 187  PHE A CD2 1 
ATOM   1453 C CE1 . PHE A 1 187 ? -8.381  75.636 39.226 1.00 25.71  ? 187  PHE A CE1 1 
ATOM   1454 C CE2 . PHE A 1 187 ? -8.606  77.725 40.403 1.00 25.71  ? 187  PHE A CE2 1 
ATOM   1455 C CZ  . PHE A 1 187 ? -9.105  76.469 40.083 1.00 25.71  ? 187  PHE A CZ  1 
ATOM   1456 N N   . GLY A 1 188 ? -3.573  78.611 35.501 1.00 36.87  ? 188  GLY A N   1 
ATOM   1457 C CA  . GLY A 1 188 ? -2.283  79.102 35.049 1.00 36.87  ? 188  GLY A CA  1 
ATOM   1458 C C   . GLY A 1 188 ? -1.125  78.149 35.308 1.00 36.87  ? 188  GLY A C   1 
ATOM   1459 O O   . GLY A 1 188 ? 0.025   78.448 34.961 1.00 36.87  ? 188  GLY A O   1 
ATOM   1460 N N   . GLY A 1 189 ? -1.427  77.000 35.909 1.00 37.13  ? 189  GLY A N   1 
ATOM   1461 C CA  . GLY A 1 189 ? -0.393  76.031 36.210 1.00 37.13  ? 189  GLY A CA  1 
ATOM   1462 C C   . GLY A 1 189 ? -0.119  75.033 35.104 1.00 37.13  ? 189  GLY A C   1 
ATOM   1463 O O   . GLY A 1 189 ? -1.005  74.702 34.313 1.00 37.13  ? 189  GLY A O   1 
ATOM   1464 N N   . ASP A 1 190 ? 1.123   74.564 35.036 1.00 37.18  ? 190  ASP A N   1 
ATOM   1465 C CA  . ASP A 1 190 ? 1.526   73.578 34.035 1.00 37.18  ? 190  ASP A CA  1 
ATOM   1466 C C   . ASP A 1 190 ? 1.392   72.205 34.686 1.00 37.18  ? 190  ASP A C   1 
ATOM   1467 O O   . ASP A 1 190 ? 2.138   71.871 35.595 1.00 37.18  ? 190  ASP A O   1 
ATOM   1468 C CB  . ASP A 1 190 ? 2.977   73.837 33.591 1.00 44.62  ? 190  ASP A CB  1 
ATOM   1469 C CG  . ASP A 1 190 ? 3.524   72.739 32.681 1.00 44.62  ? 190  ASP A CG  1 
ATOM   1470 O OD1 . ASP A 1 190 ? 2.720   71.959 32.127 1.00 44.62  ? 190  ASP A OD1 1 
ATOM   1471 O OD2 . ASP A 1 190 ? 4.764   72.658 32.511 1.00 44.62  ? 190  ASP A OD2 1 
ATOM   1472 N N   . PRO A 1 191 ? 0.433   71.389 34.228 1.00 36.59  ? 191  PRO A N   1 
ATOM   1473 C CA  . PRO A 1 191 ? 0.249   70.060 34.818 1.00 36.59  ? 191  PRO A CA  1 
ATOM   1474 C C   . PRO A 1 191 ? 1.398   69.078 34.591 1.00 36.59  ? 191  PRO A C   1 
ATOM   1475 O O   . PRO A 1 191 ? 1.456   68.042 35.246 1.00 36.59  ? 191  PRO A O   1 
ATOM   1476 C CB  . PRO A 1 191 ? -1.065  69.593 34.200 1.00 29.45  ? 191  PRO A CB  1 
ATOM   1477 C CG  . PRO A 1 191 ? -1.059  70.248 32.852 1.00 29.45  ? 191  PRO A CG  1 
ATOM   1478 C CD  . PRO A 1 191 ? -0.547  71.635 33.153 1.00 29.45  ? 191  PRO A CD  1 
ATOM   1479 N N   . LYS A 1 192 ? 2.307   69.391 33.668 1.00 44.06  ? 192  LYS A N   1 
ATOM   1480 C CA  . LYS A 1 192 ? 3.439   68.502 33.402 1.00 44.06  ? 192  LYS A CA  1 
ATOM   1481 C C   . LYS A 1 192 ? 4.633   68.923 34.272 1.00 44.06  ? 192  LYS A C   1 
ATOM   1482 O O   . LYS A 1 192 ? 5.730   68.362 34.172 1.00 44.06  ? 192  LYS A O   1 
ATOM   1483 C CB  . LYS A 1 192 ? 3.834   68.537 31.908 1.00 54.45  ? 192  LYS A CB  1 
ATOM   1484 C CG  . LYS A 1 192 ? 4.498   69.851 31.463 1.00 54.45  ? 192  LYS A CG  1 
ATOM   1485 C CD  . LYS A 1 192 ? 5.017   69.848 29.995 1.00 54.45  ? 192  LYS A CD  1 
ATOM   1486 C CE  . LYS A 1 192 ? 3.910   69.666 28.937 1.00 54.45  ? 192  LYS A CE  1 
ATOM   1487 N NZ  . LYS A 1 192 ? 3.697   68.235 28.505 1.00 54.45  ? 192  LYS A NZ  1 
ATOM   1488 N N   . THR A 1 193 ? 4.425   69.912 35.134 1.00 34.47  ? 193  THR A N   1 
ATOM   1489 C CA  . THR A 1 193 ? 5.513   70.350 35.995 1.00 34.47  ? 193  THR A CA  1 
ATOM   1490 C C   . THR A 1 193 ? 5.062   70.568 37.437 1.00 34.47  ? 193  THR A C   1 
ATOM   1491 O O   . THR A 1 193 ? 5.218   71.651 38.003 1.00 34.47  ? 193  THR A O   1 
ATOM   1492 C CB  . THR A 1 193 ? 6.166   71.624 35.422 1.00 47.88  ? 193  THR A CB  1 
ATOM   1493 O OG1 . THR A 1 193 ? 6.570   71.361 34.073 1.00 47.88  ? 193  THR A OG1 1 
ATOM   1494 C CG2 . THR A 1 193 ? 7.403   72.014 36.214 1.00 47.88  ? 193  THR A CG2 1 
ATOM   1495 N N   . VAL A 1 194 ? 4.497   69.521 38.029 1.00 31.17  ? 194  VAL A N   1 
ATOM   1496 C CA  . VAL A 1 194 ? 4.041   69.601 39.406 1.00 31.17  ? 194  VAL A CA  1 
ATOM   1497 C C   . VAL A 1 194 ? 4.986   68.879 40.349 1.00 31.17  ? 194  VAL A C   1 
ATOM   1498 O O   . VAL A 1 194 ? 5.351   67.734 40.122 1.00 31.17  ? 194  VAL A O   1 
ATOM   1499 C CB  . VAL A 1 194 ? 2.613   69.020 39.579 1.00 41.36  ? 194  VAL A CB  1 
ATOM   1500 C CG1 . VAL A 1 194 ? 2.477   67.741 38.813 1.00 41.36  ? 194  VAL A CG1 1 
ATOM   1501 C CG2 . VAL A 1 194 ? 2.326   68.755 41.055 1.00 41.36  ? 194  VAL A CG2 1 
ATOM   1502 N N   . THR A 1 195 ? 5.392   69.580 41.401 1.00 34.64  ? 195  THR A N   1 
ATOM   1503 C CA  . THR A 1 195 ? 6.273   69.030 42.416 1.00 34.64  ? 195  THR A CA  1 
ATOM   1504 C C   . THR A 1 195 ? 5.459   68.812 43.683 1.00 34.64  ? 195  THR A C   1 
ATOM   1505 O O   . THR A 1 195 ? 4.805   69.735 44.166 1.00 34.64  ? 195  THR A O   1 
ATOM   1506 C CB  . THR A 1 195 ? 7.429   70.008 42.771 1.00 33.24  ? 195  THR A CB  1 
ATOM   1507 O OG1 . THR A 1 195 ? 8.259   70.208 41.626 1.00 33.24  ? 195  THR A OG1 1 
ATOM   1508 C CG2 . THR A 1 195 ? 8.284   69.451 43.908 1.00 33.24  ? 195  THR A CG2 1 
ATOM   1509 N N   . ILE A 1 196 ? 5.459   67.595 44.209 1.00 24.51  ? 196  ILE A N   1 
ATOM   1510 C CA  . ILE A 1 196 ? 4.757   67.373 45.462 1.00 24.51  ? 196  ILE A CA  1 
ATOM   1511 C C   . ILE A 1 196 ? 5.818   67.451 46.564 1.00 24.51  ? 196  ILE A C   1 
ATOM   1512 O O   . ILE A 1 196 ? 6.946   66.993 46.385 1.00 24.51  ? 196  ILE A O   1 
ATOM   1513 C CB  . ILE A 1 196 ? 4.046   66.004 45.504 1.00 27.78  ? 196  ILE A CB  1 
ATOM   1514 C CG1 . ILE A 1 196 ? 5.037   64.879 45.239 1.00 27.78  ? 196  ILE A CG1 1 
ATOM   1515 C CG2 . ILE A 1 196 ? 2.934   65.967 44.480 1.00 27.78  ? 196  ILE A CG2 1 
ATOM   1516 C CD1 . ILE A 1 196 ? 4.411   63.515 45.306 1.00 27.78  ? 196  ILE A CD1 1 
ATOM   1517 N N   . PHE A 1 197 ? 5.477   68.089 47.676 1.00 27.24  ? 197  PHE A N   1 
ATOM   1518 C CA  . PHE A 1 197 ? 6.400   68.204 48.795 1.00 27.24  ? 197  PHE A CA  1 
ATOM   1519 C C   . PHE A 1 197 ? 5.637   68.163 50.103 1.00 27.24  ? 197  PHE A C   1 
ATOM   1520 O O   . PHE A 1 197 ? 4.488   68.586 50.171 1.00 27.24  ? 197  PHE A O   1 
ATOM   1521 C CB  . PHE A 1 197 ? 7.284   69.472 48.680 1.00 31.51  ? 197  PHE A CB  1 
ATOM   1522 C CG  . PHE A 1 197 ? 6.564   70.793 48.888 1.00 31.51  ? 197  PHE A CG  1 
ATOM   1523 C CD1 . PHE A 1 197 ? 5.416   71.117 48.172 1.00 31.51  ? 197  PHE A CD1 1 
ATOM   1524 C CD2 . PHE A 1 197 ? 7.107   71.753 49.743 1.00 31.51  ? 197  PHE A CD2 1 
ATOM   1525 C CE1 . PHE A 1 197 ? 4.824   72.377 48.301 1.00 31.51  ? 197  PHE A CE1 1 
ATOM   1526 C CE2 . PHE A 1 197 ? 6.527   73.012 49.881 1.00 31.51  ? 197  PHE A CE2 1 
ATOM   1527 C CZ  . PHE A 1 197 ? 5.385   73.328 49.161 1.00 31.51  ? 197  PHE A CZ  1 
ATOM   1528 N N   . GLY A 1 198 ? 6.266   67.606 51.130 1.00 26.97  ? 198  GLY A N   1 
ATOM   1529 C CA  . GLY A 1 198 ? 5.623   67.497 52.421 1.00 26.97  ? 198  GLY A CA  1 
ATOM   1530 C C   . GLY A 1 198 ? 6.624   67.267 53.530 1.00 26.97  ? 198  GLY A C   1 
ATOM   1531 O O   . GLY A 1 198 ? 7.789   66.985 53.271 1.00 26.97  ? 198  GLY A O   1 
ATOM   1532 N N   . GLU A 1 199 ? 6.164   67.386 54.770 1.00 28.36  ? 199  GLU A N   1 
ATOM   1533 C CA  . GLU A 1 199 ? 7.025   67.212 55.927 1.00 28.36  ? 199  GLU A CA  1 
ATOM   1534 C C   . GLU A 1 199 ? 6.479   66.136 56.860 1.00 28.36  ? 199  GLU A C   1 
ATOM   1535 O O   . GLU A 1 199 ? 5.275   66.022 57.035 1.00 28.36  ? 199  GLU A O   1 
ATOM   1536 C CB  . GLU A 1 199 ? 7.149   68.556 56.662 1.00 52.82  ? 199  GLU A CB  1 
ATOM   1537 C CG  . GLU A 1 199 ? 8.162   68.608 57.812 1.00 52.82  ? 199  GLU A CG  1 
ATOM   1538 C CD  . GLU A 1 199 ? 7.544   68.273 59.165 1.00 52.82  ? 199  GLU A CD  1 
ATOM   1539 O OE1 . GLU A 1 199 ? 6.296   68.233 59.266 1.00 52.82  ? 199  GLU A OE1 1 
ATOM   1540 O OE2 . GLU A 1 199 ? 8.306   68.063 60.139 1.00 52.82  ? 199  GLU A OE2 1 
ATOM   1541 N N   . SER A 1 200 ? 7.381   65.351 57.447 1.00 30.60  ? 200  SER A N   1 
ATOM   1542 C CA  . SER A 1 200 ? 7.036   64.273 58.388 1.00 30.60  ? 200  SER A CA  1 
ATOM   1543 C C   . SER A 1 200 ? 6.132   63.261 57.684 1.00 30.60  ? 200  SER A C   1 
ATOM   1544 O O   . SER A 1 200 ? 6.534   62.685 56.679 1.00 30.60  ? 200  SER A O   1 
ATOM   1545 C CB  . SER A 1 200 ? 6.355   64.861 59.638 1.00 44.22  ? 200  SER A CB  1 
ATOM   1546 O OG  . SER A 1 200 ? 6.395   63.959 60.738 1.00 44.22  ? 200  SER A OG  1 
ATOM   1547 N N   . ALA A 1 201 ? 4.925   63.038 58.193 1.00 25.57  ? 201  ALA A N   1 
ATOM   1548 C CA  . ALA A 1 201 ? 4.009   62.102 57.543 1.00 25.57  ? 201  ALA A CA  1 
ATOM   1549 C C   . ALA A 1 201 ? 3.782   62.531 56.079 1.00 25.57  ? 201  ALA A C   1 
ATOM   1550 O O   . ALA A 1 201 ? 3.550   61.700 55.209 1.00 25.57  ? 201  ALA A O   1 
ATOM   1551 C CB  . ALA A 1 201 ? 2.678   62.053 58.292 1.00 19.23  ? 201  ALA A CB  1 
ATOM   1552 N N   . GLY A 1 202 ? 3.851   63.838 55.831 1.00 27.68  ? 202  GLY A N   1 
ATOM   1553 C CA  . GLY A 1 202 ? 3.668   64.360 54.490 1.00 27.68  ? 202  GLY A CA  1 
ATOM   1554 C C   . GLY A 1 202 ? 4.848   63.985 53.618 1.00 27.68  ? 202  GLY A C   1 
ATOM   1555 O O   . GLY A 1 202 ? 4.687   63.744 52.426 1.00 27.68  ? 202  GLY A O   1 
ATOM   1556 N N   . GLY A 1 203 ? 6.035   63.944 54.217 1.00 28.39  ? 203  GLY A N   1 
ATOM   1557 C CA  . GLY A 1 203 ? 7.227   63.569 53.485 1.00 28.39  ? 203  GLY A CA  1 
ATOM   1558 C C   . GLY A 1 203 ? 7.195   62.077 53.209 1.00 28.39  ? 203  GLY A C   1 
ATOM   1559 O O   . GLY A 1 203 ? 7.672   61.613 52.177 1.00 28.39  ? 203  GLY A O   1 
ATOM   1560 N N   . ALA A 1 204 ? 6.638   61.322 54.152 1.00 31.96  ? 204  ALA A N   1 
ATOM   1561 C CA  . ALA A 1 204 ? 6.507   59.883 54.008 1.00 31.96  ? 204  ALA A CA  1 
ATOM   1562 C C   . ALA A 1 204 ? 5.465   59.615 52.909 1.00 31.96  ? 204  ALA A C   1 
ATOM   1563 O O   . ALA A 1 204 ? 5.616   58.685 52.114 1.00 31.96  ? 204  ALA A O   1 
ATOM   1564 C CB  . ALA A 1 204 ? 6.063   59.263 55.328 1.00 22.79  ? 204  ALA A CB  1 
ATOM   1565 N N   . SER A 1 205 ? 4.417   60.439 52.873 1.00 27.67  ? 205  SER A N   1 
ATOM   1566 C CA  . SER A 1 205 ? 3.374   60.312 51.857 1.00 27.67  ? 205  SER A CA  1 
ATOM   1567 C C   . SER A 1 205 ? 3.966   60.540 50.458 1.00 27.67  ? 205  SER A C   1 
ATOM   1568 O O   . SER A 1 205 ? 3.681   59.782 49.527 1.00 27.67  ? 205  SER A O   1 
ATOM   1569 C CB  . SER A 1 205 ? 2.247   61.328 52.098 1.00 25.39  ? 205  SER A CB  1 
ATOM   1570 O OG  . SER A 1 205 ? 1.483   60.995 53.236 1.00 25.39  ? 205  SER A OG  1 
ATOM   1571 N N   . VAL A 1 206 ? 4.778   61.589 50.320 1.00 28.31  ? 206  VAL A N   1 
ATOM   1572 C CA  . VAL A 1 206 ? 5.416   61.907 49.045 1.00 28.31  ? 206  VAL A CA  1 
ATOM   1573 C C   . VAL A 1 206 ? 6.237   60.708 48.577 1.00 28.31  ? 206  VAL A C   1 
ATOM   1574 O O   . VAL A 1 206 ? 6.192   60.335 47.418 1.00 28.31  ? 206  VAL A O   1 
ATOM   1575 C CB  . VAL A 1 206 ? 6.320   63.175 49.168 1.00 27.28  ? 206  VAL A CB  1 
ATOM   1576 C CG1 . VAL A 1 206 ? 7.312   63.240 48.022 1.00 27.28  ? 206  VAL A CG1 1 
ATOM   1577 C CG2 . VAL A 1 206 ? 5.448   64.434 49.165 1.00 27.28  ? 206  VAL A CG2 1 
ATOM   1578 N N   . GLY A 1 207 ? 6.971   60.095 49.492 1.00 27.81  ? 207  GLY A N   1 
ATOM   1579 C CA  . GLY A 1 207 ? 7.758   58.931 49.138 1.00 27.81  ? 207  GLY A CA  1 
ATOM   1580 C C   . GLY A 1 207 ? 6.894   57.747 48.739 1.00 27.81  ? 207  GLY A C   1 
ATOM   1581 O O   . GLY A 1 207 ? 7.302   56.928 47.915 1.00 27.81  ? 207  GLY A O   1 
ATOM   1582 N N   . MET A 1 208 ? 5.698   57.655 49.313 1.00 31.35  ? 208  MET A N   1 
ATOM   1583 C CA  . MET A 1 208 ? 4.788   56.558 49.000 1.00 31.35  ? 208  MET A CA  1 
ATOM   1584 C C   . MET A 1 208 ? 4.151   56.706 47.614 1.00 31.35  ? 208  MET A C   1 
ATOM   1585 O O   . MET A 1 208 ? 3.814   55.707 46.976 1.00 31.35  ? 208  MET A O   1 
ATOM   1586 C CB  . MET A 1 208 ? 3.711   56.437 50.086 1.00 30.64  ? 208  MET A CB  1 
ATOM   1587 C CG  . MET A 1 208 ? 4.256   55.898 51.407 1.00 30.64  ? 208  MET A CG  1 
ATOM   1588 S SD  . MET A 1 208 ? 3.110   56.017 52.779 1.00 30.64  ? 208  MET A SD  1 
ATOM   1589 C CE  . MET A 1 208 ? 4.095   55.360 54.107 1.00 30.64  ? 208  MET A CE  1 
ATOM   1590 N N   . HIS A 1 209 ? 4.003   57.943 47.145 1.00 29.85  ? 209  HIS A N   1 
ATOM   1591 C CA  . HIS A 1 209 ? 3.427   58.182 45.828 1.00 29.85  ? 209  HIS A CA  1 
ATOM   1592 C C   . HIS A 1 209 ? 4.486   57.880 44.796 1.00 29.85  ? 209  HIS A C   1 
ATOM   1593 O O   . HIS A 1 209 ? 4.180   57.509 43.672 1.00 29.85  ? 209  HIS A O   1 
ATOM   1594 C CB  . HIS A 1 209 ? 2.957   59.627 45.691 1.00 34.12  ? 209  HIS A CB  1 
ATOM   1595 C CG  . HIS A 1 209 ? 1.723   59.922 46.478 1.00 34.12  ? 209  HIS A CG  1 
ATOM   1596 N ND1 . HIS A 1 209 ? 0.511   59.326 46.203 1.00 34.12  ? 209  HIS A ND1 1 
ATOM   1597 C CD2 . HIS A 1 209 ? 1.522   60.709 47.562 1.00 34.12  ? 209  HIS A CD2 1 
ATOM   1598 C CE1 . HIS A 1 209 ? -0.384  59.734 47.084 1.00 34.12  ? 209  HIS A CE1 1 
ATOM   1599 N NE2 . HIS A 1 209 ? 0.205   60.573 47.919 1.00 34.12  ? 209  HIS A NE2 1 
ATOM   1600 N N   . ILE A 1 210 ? 5.742   58.045 45.191 1.00 28.62  ? 210  ILE A N   1 
ATOM   1601 C CA  . ILE A 1 210 ? 6.858   57.742 44.307 1.00 28.62  ? 210  ILE A CA  1 
ATOM   1602 C C   . ILE A 1 210 ? 6.921   56.222 44.113 1.00 28.62  ? 210  ILE A C   1 
ATOM   1603 O O   . ILE A 1 210 ? 7.266   55.745 43.037 1.00 28.62  ? 210  ILE A O   1 
ATOM   1604 C CB  . ILE A 1 210 ? 8.184   58.214 44.919 1.00 28.94  ? 210  ILE A CB  1 
ATOM   1605 C CG1 . ILE A 1 210 ? 8.278   59.732 44.819 1.00 28.94  ? 210  ILE A CG1 1 
ATOM   1606 C CG2 . ILE A 1 210 ? 9.358   57.534 44.236 1.00 28.94  ? 210  ILE A CG2 1 
ATOM   1607 C CD1 . ILE A 1 210 ? 9.360   60.307 45.674 1.00 28.94  ? 210  ILE A CD1 1 
ATOM   1608 N N   . LEU A 1 211 ? 6.583   55.475 45.166 1.00 36.12  ? 211  LEU A N   1 
ATOM   1609 C CA  . LEU A 1 211 ? 6.614   54.014 45.128 1.00 36.12  ? 211  LEU A CA  1 
ATOM   1610 C C   . LEU A 1 211 ? 5.366   53.379 44.507 1.00 36.12  ? 211  LEU A C   1 
ATOM   1611 O O   . LEU A 1 211 ? 5.469   52.439 43.724 1.00 36.12  ? 211  LEU A O   1 
ATOM   1612 C CB  . LEU A 1 211 ? 6.804   53.450 46.542 1.00 33.93  ? 211  LEU A CB  1 
ATOM   1613 C CG  . LEU A 1 211 ? 8.113   53.749 47.273 1.00 33.93  ? 211  LEU A CG  1 
ATOM   1614 C CD1 . LEU A 1 211 ? 8.017   53.302 48.720 1.00 33.93  ? 211  LEU A CD1 1 
ATOM   1615 C CD2 . LEU A 1 211 ? 9.248   53.044 46.582 1.00 33.93  ? 211  LEU A CD2 1 
ATOM   1616 N N   . SER A 1 212 ? 4.195   53.889 44.857 1.00 35.22  ? 212  SER A N   1 
ATOM   1617 C CA  . SER A 1 212 ? 2.935   53.351 44.354 1.00 35.22  ? 212  SER A CA  1 
ATOM   1618 C C   . SER A 1 212 ? 2.660   53.569 42.868 1.00 35.22  ? 212  SER A C   1 
ATOM   1619 O O   . SER A 1 212 ? 2.517   54.708 42.413 1.00 35.22  ? 212  SER A O   1 
ATOM   1620 C CB  . SER A 1 212 ? 1.779   53.935 45.147 1.00 36.16  ? 212  SER A CB  1 
ATOM   1621 O OG  . SER A 1 212 ? 0.550   53.592 44.544 1.00 36.16  ? 212  SER A OG  1 
ATOM   1622 N N   . PRO A 1 213 ? 2.552   52.476 42.096 1.00 36.48  ? 213  PRO A N   1 
ATOM   1623 C CA  . PRO A 1 213 ? 2.292   52.551 40.651 1.00 36.48  ? 213  PRO A CA  1 
ATOM   1624 C C   . PRO A 1 213 ? 1.165   53.511 40.258 1.00 36.48  ? 213  PRO A C   1 
ATOM   1625 O O   . PRO A 1 213 ? 1.302   54.270 39.307 1.00 36.48  ? 213  PRO A O   1 
ATOM   1626 C CB  . PRO A 1 213 ? 1.961   51.106 40.284 1.00 34.63  ? 213  PRO A CB  1 
ATOM   1627 C CG  . PRO A 1 213 ? 2.822   50.330 41.241 1.00 34.63  ? 213  PRO A CG  1 
ATOM   1628 C CD  . PRO A 1 213 ? 2.628   51.075 42.546 1.00 34.63  ? 213  PRO A CD  1 
ATOM   1629 N N   . GLY A 1 214 ? 0.060   53.489 41.000 1.00 36.94  ? 214  GLY A N   1 
ATOM   1630 C CA  . GLY A 1 214 ? -1.063  54.354 40.667 1.00 36.94  ? 214  GLY A CA  1 
ATOM   1631 C C   . GLY A 1 214 ? -0.909  55.850 40.890 1.00 36.94  ? 214  GLY A C   1 
ATOM   1632 O O   . GLY A 1 214 ? -1.781  56.622 40.506 1.00 36.94  ? 214  GLY A O   1 
ATOM   1633 N N   . SER A 1 215 ? 0.184   56.286 41.502 1.00 38.20  ? 215  SER A N   1 
ATOM   1634 C CA  . SER A 1 215 ? 0.356   57.711 41.751 1.00 38.20  ? 215  SER A CA  1 
ATOM   1635 C C   . SER A 1 215 ? 1.467   58.326 40.927 1.00 38.20  ? 215  SER A C   1 
ATOM   1636 O O   . SER A 1 215 ? 1.471   59.527 40.689 1.00 38.20  ? 215  SER A O   1 
ATOM   1637 C CB  . SER A 1 215 ? 0.665   57.960 43.237 1.00 38.25  ? 215  SER A CB  1 
ATOM   1638 O OG  . SER A 1 215 ? -0.416  57.606 44.068 1.00 38.25  ? 215  SER A OG  1 
ATOM   1639 N N   . ARG A 1 216 ? 2.402   57.491 40.492 1.00 37.24  ? 216  ARG A N   1 
ATOM   1640 C CA  . ARG A 1 216 ? 3.580   57.928 39.748 1.00 37.24  ? 216  ARG A CA  1 
ATOM   1641 C C   . ARG A 1 216 ? 3.378   58.872 38.568 1.00 37.24  ? 216  ARG A C   1 
ATOM   1642 O O   . ARG A 1 216 ? 4.163   59.795 38.375 1.00 37.24  ? 216  ARG A O   1 
ATOM   1643 C CB  . ARG A 1 216 ? 4.388   56.696 39.297 1.00 40.07  ? 216  ARG A CB  1 
ATOM   1644 C CG  . ARG A 1 216 ? 4.207   55.496 40.236 1.00 40.07  ? 216  ARG A CG  1 
ATOM   1645 C CD  . ARG A 1 216 ? 5.499   54.828 40.691 1.00 40.07  ? 216  ARG A CD  1 
ATOM   1646 N NE  . ARG A 1 216 ? 6.053   53.944 39.678 1.00 40.07  ? 216  ARG A NE  1 
ATOM   1647 C CZ  . ARG A 1 216 ? 6.387   52.672 39.887 1.00 40.07  ? 216  ARG A CZ  1 
ATOM   1648 N NH1 . ARG A 1 216 ? 6.226   52.118 41.082 1.00 40.07  ? 216  ARG A NH1 1 
ATOM   1649 N NH2 . ARG A 1 216 ? 6.873   51.951 38.885 1.00 40.07  ? 216  ARG A NH2 1 
ATOM   1650 N N   . ASP A 1 217 ? 2.328   58.671 37.786 1.00 38.03  ? 217  ASP A N   1 
ATOM   1651 C CA  . ASP A 1 217 ? 2.132   59.522 36.620 1.00 38.03  ? 217  ASP A CA  1 
ATOM   1652 C C   . ASP A 1 217 ? 1.508   60.881 36.935 1.00 38.03  ? 217  ASP A C   1 
ATOM   1653 O O   . ASP A 1 217 ? 1.384   61.720 36.049 1.00 38.03  ? 217  ASP A O   1 
ATOM   1654 C CB  . ASP A 1 217 ? 1.267   58.797 35.572 1.00 42.05  ? 217  ASP A CB  1 
ATOM   1655 C CG  . ASP A 1 217 ? 1.768   57.376 35.251 1.00 42.05  ? 217  ASP A CG  1 
ATOM   1656 O OD1 . ASP A 1 217 ? 2.950   57.062 35.522 1.00 42.05  ? 217  ASP A OD1 1 
ATOM   1657 O OD2 . ASP A 1 217 ? 0.973   56.572 34.708 1.00 42.05  ? 217  ASP A OD2 1 
ATOM   1658 N N   . LEU A 1 218 ? 1.138   61.106 38.194 1.00 38.43  ? 218  LEU A N   1 
ATOM   1659 C CA  . LEU A 1 218 ? 0.477   62.349 38.583 1.00 38.43  ? 218  LEU A CA  1 
ATOM   1660 C C   . LEU A 1 218 ? 1.350   63.529 38.980 1.00 38.43  ? 218  LEU A C   1 
ATOM   1661 O O   . LEU A 1 218 ? 0.829   64.592 39.313 1.00 38.43  ? 218  LEU A O   1 
ATOM   1662 C CB  . LEU A 1 218 ? -0.522  62.074 39.707 1.00 38.84  ? 218  LEU A CB  1 
ATOM   1663 C CG  . LEU A 1 218 ? -1.644  61.107 39.324 1.00 38.84  ? 218  LEU A CG  1 
ATOM   1664 C CD1 . LEU A 1 218 ? -2.625  60.939 40.474 1.00 38.84  ? 218  LEU A CD1 1 
ATOM   1665 C CD2 . LEU A 1 218 ? -2.344  61.635 38.081 1.00 38.84  ? 218  LEU A CD2 1 
ATOM   1666 N N   . PHE A 1 219 ? 2.664   63.353 38.966 1.00 28.42  ? 219  PHE A N   1 
ATOM   1667 C CA  . PHE A 1 219 ? 3.552   64.445 39.319 1.00 28.42  ? 219  PHE A CA  1 
ATOM   1668 C C   . PHE A 1 219 ? 4.899   64.264 38.640 1.00 28.42  ? 219  PHE A C   1 
ATOM   1669 O O   . PHE A 1 219 ? 5.232   63.176 38.172 1.00 28.42  ? 219  PHE A O   1 
ATOM   1670 C CB  . PHE A 1 219 ? 3.713   64.562 40.846 1.00 26.81  ? 219  PHE A CB  1 
ATOM   1671 C CG  . PHE A 1 219 ? 4.330   63.362 41.493 1.00 26.81  ? 219  PHE A CG  1 
ATOM   1672 C CD1 . PHE A 1 219 ? 3.561   62.235 41.784 1.00 26.81  ? 219  PHE A CD1 1 
ATOM   1673 C CD2 . PHE A 1 219 ? 5.691   63.343 41.784 1.00 26.81  ? 219  PHE A CD2 1 
ATOM   1674 C CE1 . PHE A 1 219 ? 4.146   61.103 42.354 1.00 26.81  ? 219  PHE A CE1 1 
ATOM   1675 C CE2 . PHE A 1 219 ? 6.286   62.218 42.354 1.00 26.81  ? 219  PHE A CE2 1 
ATOM   1676 C CZ  . PHE A 1 219 ? 5.510   61.094 42.639 1.00 26.81  ? 219  PHE A CZ  1 
ATOM   1677 N N   . ARG A 1 220 ? 5.664   65.346 38.587 1.00 32.69  ? 220  ARG A N   1 
ATOM   1678 C CA  . ARG A 1 220 ? 6.962   65.353 37.932 1.00 32.69  ? 220  ARG A CA  1 
ATOM   1679 C C   . ARG A 1 220 ? 8.147   65.124 38.876 1.00 32.69  ? 220  ARG A C   1 
ATOM   1680 O O   . ARG A 1 220 ? 8.979   64.247 38.643 1.00 32.69  ? 220  ARG A O   1 
ATOM   1681 C CB  . ARG A 1 220 ? 7.130   66.696 37.212 1.00 40.14  ? 220  ARG A CB  1 
ATOM   1682 C CG  . ARG A 1 220 ? 8.446   66.906 36.504 1.00 40.14  ? 220  ARG A CG  1 
ATOM   1683 C CD  . ARG A 1 220 ? 8.577   66.022 35.288 1.00 40.14  ? 220  ARG A CD  1 
ATOM   1684 N NE  . ARG A 1 220 ? 9.652   66.485 34.410 1.00 40.14  ? 220  ARG A NE  1 
ATOM   1685 C CZ  . ARG A 1 220 ? 9.514   67.441 33.499 1.00 40.14  ? 220  ARG A CZ  1 
ATOM   1686 N NH1 . ARG A 1 220 ? 8.343   68.045 33.333 1.00 40.14  ? 220  ARG A NH1 1 
ATOM   1687 N NH2 . ARG A 1 220 ? 10.547  67.789 32.748 1.00 40.14  ? 220  ARG A NH2 1 
ATOM   1688 N N   . ARG A 1 221 ? 8.217   65.929 39.930 1.00 26.61  ? 221  ARG A N   1 
ATOM   1689 C CA  . ARG A 1 221 ? 9.302   65.872 40.899 1.00 26.61  ? 221  ARG A CA  1 
ATOM   1690 C C   . ARG A 1 221 ? 8.782   65.817 42.324 1.00 26.61  ? 221  ARG A C   1 
ATOM   1691 O O   . ARG A 1 221 ? 7.585   65.985 42.557 1.00 26.61  ? 221  ARG A O   1 
ATOM   1692 C CB  . ARG A 1 221 ? 10.197  67.101 40.743 1.00 37.36  ? 221  ARG A CB  1 
ATOM   1693 C CG  . ARG A 1 221 ? 11.171  66.997 39.610 1.00 37.36  ? 221  ARG A CG  1 
ATOM   1694 C CD  . ARG A 1 221 ? 12.066  68.213 39.569 1.00 37.36  ? 221  ARG A CD  1 
ATOM   1695 N NE  . ARG A 1 221 ? 11.493  69.263 38.754 1.00 37.36  ? 221  ARG A NE  1 
ATOM   1696 C CZ  . ARG A 1 221 ? 11.556  69.286 37.430 1.00 37.36  ? 221  ARG A CZ  1 
ATOM   1697 N NH1 . ARG A 1 221 ? 12.176  68.318 36.769 1.00 37.36  ? 221  ARG A NH1 1 
ATOM   1698 N NH2 . ARG A 1 221 ? 10.980  70.275 36.766 1.00 37.36  ? 221  ARG A NH2 1 
ATOM   1699 N N   . ALA A 1 222 ? 9.690   65.606 43.279 1.00 29.97  ? 222  ALA A N   1 
ATOM   1700 C CA  . ALA A 1 222 ? 9.289   65.509 44.676 1.00 29.97  ? 222  ALA A CA  1 
ATOM   1701 C C   . ALA A 1 222 ? 10.310  66.006 45.685 1.00 29.97  ? 222  ALA A C   1 
ATOM   1702 O O   . ALA A 1 222 ? 11.516  65.878 45.494 1.00 29.97  ? 222  ALA A O   1 
ATOM   1703 C CB  . ALA A 1 222 ? 8.911   64.064 45.000 1.00 25.15  ? 222  ALA A CB  1 
ATOM   1704 N N   . ILE A 1 223 ? 9.794   66.574 46.768 1.00 31.24  ? 223  ILE A N   1 
ATOM   1705 C CA  . ILE A 1 223 ? 10.606  67.084 47.862 1.00 31.24  ? 223  ILE A CA  1 
ATOM   1706 C C   . ILE A 1 223 ? 10.106  66.443 49.157 1.00 31.24  ? 223  ILE A C   1 
ATOM   1707 O O   . ILE A 1 223 ? 8.911   66.486 49.453 1.00 31.24  ? 223  ILE A O   1 
ATOM   1708 C CB  . ILE A 1 223 ? 10.489  68.610 47.983 1.00 26.41  ? 223  ILE A CB  1 
ATOM   1709 C CG1 . ILE A 1 223 ? 10.927  69.273 46.678 1.00 26.41  ? 223  ILE A CG1 1 
ATOM   1710 C CG2 . ILE A 1 223 ? 11.366  69.109 49.122 1.00 26.41  ? 223  ILE A CG2 1 
ATOM   1711 C CD1 . ILE A 1 223 ? 10.745  70.767 46.676 1.00 26.41  ? 223  ILE A CD1 1 
ATOM   1712 N N   . LEU A 1 224 ? 11.022  65.842 49.912 1.00 26.08  ? 224  LEU A N   1 
ATOM   1713 C CA  . LEU A 1 224 ? 10.680  65.187 51.171 1.00 26.08  ? 224  LEU A CA  1 
ATOM   1714 C C   . LEU A 1 224 ? 11.405  65.835 52.348 1.00 26.08  ? 224  LEU A C   1 
ATOM   1715 O O   . LEU A 1 224 ? 12.629  65.819 52.410 1.00 26.08  ? 224  LEU A O   1 
ATOM   1716 C CB  . LEU A 1 224 ? 11.049  63.699 51.120 1.00 25.02  ? 224  LEU A CB  1 
ATOM   1717 C CG  . LEU A 1 224 ? 10.374  62.793 50.084 1.00 25.02  ? 224  LEU A CG  1 
ATOM   1718 C CD1 . LEU A 1 224 ? 10.955  63.040 48.690 1.00 25.02  ? 224  LEU A CD1 1 
ATOM   1719 C CD2 . LEU A 1 224 ? 10.581  61.351 50.499 1.00 25.02  ? 224  LEU A CD2 1 
ATOM   1720 N N   . GLN A 1 225 ? 10.646  66.401 53.279 1.00 30.18  ? 225  GLN A N   1 
ATOM   1721 C CA  . GLN A 1 225 ? 11.234  67.046 54.449 1.00 30.18  ? 225  GLN A CA  1 
ATOM   1722 C C   . GLN A 1 225 ? 11.007  66.204 55.710 1.00 30.18  ? 225  GLN A C   1 
ATOM   1723 O O   . GLN A 1 225 ? 9.874   65.951 56.112 1.00 30.18  ? 225  GLN A O   1 
ATOM   1724 C CB  . GLN A 1 225 ? 10.641  68.450 54.630 1.00 33.18  ? 225  GLN A CB  1 
ATOM   1725 C CG  . GLN A 1 225 ? 10.719  69.310 53.368 1.00 33.18  ? 225  GLN A CG  1 
ATOM   1726 C CD  . GLN A 1 225 ? 10.093  70.691 53.522 1.00 33.18  ? 225  GLN A CD  1 
ATOM   1727 O OE1 . GLN A 1 225 ? 9.769   71.353 52.535 1.00 33.18  ? 225  GLN A OE1 1 
ATOM   1728 N NE2 . GLN A 1 225 ? 9.935   71.136 54.762 1.00 33.18  ? 225  GLN A NE2 1 
ATOM   1729 N N   . SER A 1 226 ? 12.104  65.739 56.295 1.00 33.47  ? 226  SER A N   1 
ATOM   1730 C CA  . SER A 1 226 ? 12.087  64.950 57.526 1.00 33.47  ? 226  SER A CA  1 
ATOM   1731 C C   . SER A 1 226 ? 11.102  63.796 57.549 1.00 33.47  ? 226  SER A C   1 
ATOM   1732 O O   . SER A 1 226 ? 10.375  63.613 58.527 1.00 33.47  ? 226  SER A O   1 
ATOM   1733 C CB  . SER A 1 226 ? 11.794  65.861 58.722 1.00 37.22  ? 226  SER A CB  1 
ATOM   1734 O OG  . SER A 1 226 ? 12.723  66.924 58.795 1.00 37.22  ? 226  SER A OG  1 
ATOM   1735 N N   . GLY A 1 227 ? 11.077  63.012 56.485 1.00 32.10  ? 227  GLY A N   1 
ATOM   1736 C CA  . GLY A 1 227 ? 10.160  61.893 56.449 1.00 32.10  ? 227  GLY A CA  1 
ATOM   1737 C C   . GLY A 1 227 ? 10.369  61.090 55.196 1.00 32.10  ? 227  GLY A C   1 
ATOM   1738 O O   . GLY A 1 227 ? 10.650  61.648 54.147 1.00 32.10  ? 227  GLY A O   1 
ATOM   1739 N N   . SER A 1 228 ? 10.252  59.776 55.305 1.00 33.89  ? 228  SER A N   1 
ATOM   1740 C CA  . SER A 1 228 ? 10.426  58.911 54.148 1.00 33.89  ? 228  SER A CA  1 
ATOM   1741 C C   . SER A 1 228 ? 9.484   57.731 54.315 1.00 33.89  ? 228  SER A C   1 
ATOM   1742 O O   . SER A 1 228 ? 9.110   57.387 55.424 1.00 33.89  ? 228  SER A O   1 
ATOM   1743 C CB  . SER A 1 228 ? 11.877  58.444 54.035 1.00 35.72  ? 228  SER A CB  1 
ATOM   1744 O OG  . SER A 1 228 ? 12.195  57.565 55.081 1.00 35.72  ? 228  SER A OG  1 
ATOM   1745 N N   . PRO A 1 229 ? 9.101   57.087 53.211 1.00 33.15  ? 229  PRO A N   1 
ATOM   1746 C CA  . PRO A 1 229 ? 8.182   55.943 53.238 1.00 33.15  ? 229  PRO A CA  1 
ATOM   1747 C C   . PRO A 1 229 ? 8.563   54.746 54.099 1.00 33.15  ? 229  PRO A C   1 
ATOM   1748 O O   . PRO A 1 229 ? 7.691   54.077 54.648 1.00 33.15  ? 229  PRO A O   1 
ATOM   1749 C CB  . PRO A 1 229 ? 8.039   55.585 51.758 1.00 31.50  ? 229  PRO A CB  1 
ATOM   1750 C CG  . PRO A 1 229 ? 9.375   55.954 51.194 1.00 31.50  ? 229  PRO A CG  1 
ATOM   1751 C CD  . PRO A 1 229 ? 9.663   57.284 51.862 1.00 31.50  ? 229  PRO A CD  1 
ATOM   1752 N N   . ASN A 1 230 ? 9.860   54.496 54.238 1.00 30.20  ? 230  ASN A N   1 
ATOM   1753 C CA  . ASN A 1 230 ? 10.343  53.364 55.014 1.00 30.20  ? 230  ASN A CA  1 
ATOM   1754 C C   . ASN A 1 230 ? 10.585  53.648 56.493 1.00 30.20  ? 230  ASN A C   1 
ATOM   1755 O O   . ASN A 1 230 ? 11.254  52.867 57.161 1.00 30.20  ? 230  ASN A O   1 
ATOM   1756 C CB  . ASN A 1 230 ? 11.628  52.820 54.383 1.00 38.35  ? 230  ASN A CB  1 
ATOM   1757 C CG  . ASN A 1 230 ? 12.754  53.839 54.384 1.00 38.35  ? 230  ASN A CG  1 
ATOM   1758 O OD1 . ASN A 1 230 ? 12.529  55.027 54.155 1.00 38.35  ? 230  ASN A OD1 1 
ATOM   1759 N ND2 . ASN A 1 230 ? 13.973  53.376 54.627 1.00 38.35  ? 230  ASN A ND2 1 
ATOM   1760 N N   . CYS A 1 231 ? 10.051  54.751 57.014 1.00 30.07  ? 231  CYS A N   1 
ATOM   1761 C CA  . CYS A 1 231 ? 10.235  55.050 58.435 1.00 30.07  ? 231  CYS A CA  1 
ATOM   1762 C C   . CYS A 1 231 ? 9.500   53.983 59.262 1.00 30.07  ? 231  CYS A C   1 
ATOM   1763 O O   . CYS A 1 231 ? 8.438   53.517 58.870 1.00 30.07  ? 231  CYS A O   1 
ATOM   1764 C CB  . CYS A 1 231 ? 9.692   56.444 58.780 1.00 32.95  ? 231  CYS A CB  1 
ATOM   1765 S SG  . CYS A 1 231 ? 10.710  57.850 58.240 1.00 32.95  ? 231  CYS A SG  1 
ATOM   1766 N N   . PRO A 1 232 ? 10.060  53.589 60.418 1.00 33.58  ? 232  PRO A N   1 
ATOM   1767 C CA  . PRO A 1 232 ? 9.439   52.570 61.277 1.00 33.58  ? 232  PRO A CA  1 
ATOM   1768 C C   . PRO A 1 232 ? 8.033   52.890 61.813 1.00 33.58  ? 232  PRO A C   1 
ATOM   1769 O O   . PRO A 1 232 ? 7.351   52.003 62.333 1.00 33.58  ? 232  PRO A O   1 
ATOM   1770 C CB  . PRO A 1 232 ? 10.470  52.385 62.396 1.00 25.88  ? 232  PRO A CB  1 
ATOM   1771 C CG  . PRO A 1 232 ? 11.082  53.740 62.519 1.00 25.88  ? 232  PRO A CG  1 
ATOM   1772 C CD  . PRO A 1 232 ? 11.258  54.163 61.064 1.00 25.88  ? 232  PRO A CD  1 
ATOM   1773 N N   . TRP A 1 233 ? 7.600   54.143 61.679 1.00 32.41  ? 233  TRP A N   1 
ATOM   1774 C CA  . TRP A 1 233 ? 6.276   54.559 62.152 1.00 32.41  ? 233  TRP A CA  1 
ATOM   1775 C C   . TRP A 1 233 ? 5.273   54.799 61.033 1.00 32.41  ? 233  TRP A C   1 
ATOM   1776 O O   . TRP A 1 233 ? 4.077   54.860 61.289 1.00 32.41  ? 233  TRP A O   1 
ATOM   1777 C CB  . TRP A 1 233 ? 6.374   55.855 62.961 1.00 27.20  ? 233  TRP A CB  1 
ATOM   1778 C CG  . TRP A 1 233 ? 7.172   56.929 62.264 1.00 27.20  ? 233  TRP A CG  1 
ATOM   1779 C CD1 . TRP A 1 233 ? 8.507   57.182 62.413 1.00 27.20  ? 233  TRP A CD1 1 
ATOM   1780 C CD2 . TRP A 1 233 ? 6.706   57.838 61.265 1.00 27.20  ? 233  TRP A CD2 1 
ATOM   1781 N NE1 . TRP A 1 233 ? 8.899   58.187 61.573 1.00 27.20  ? 233  TRP A NE1 1 
ATOM   1782 C CE2 . TRP A 1 233 ? 7.815   58.610 60.854 1.00 27.20  ? 233  TRP A CE2 1 
ATOM   1783 C CE3 . TRP A 1 233 ? 5.462   58.076 60.673 1.00 27.20  ? 233  TRP A CE3 1 
ATOM   1784 C CZ2 . TRP A 1 233 ? 7.715   59.603 59.877 1.00 27.20  ? 233  TRP A CZ2 1 
ATOM   1785 C CZ3 . TRP A 1 233 ? 5.364   59.062 59.702 1.00 27.20  ? 233  TRP A CZ3 1 
ATOM   1786 C CH2 . TRP A 1 233 ? 6.485   59.813 59.315 1.00 27.20  ? 233  TRP A CH2 1 
ATOM   1787 N N   . ALA A 1 234 ? 5.760   54.934 59.803 1.00 28.16  ? 234  ALA A N   1 
ATOM   1788 C CA  . ALA A 1 234 ? 4.906   55.232 58.661 1.00 28.16  ? 234  ALA A CA  1 
ATOM   1789 C C   . ALA A 1 234 ? 4.034   54.122 58.079 1.00 28.16  ? 234  ALA A C   1 
ATOM   1790 O O   . ALA A 1 234 ? 3.216   54.393 57.210 1.00 28.16  ? 234  ALA A O   1 
ATOM   1791 C CB  . ALA A 1 234 ? 5.744   55.851 57.554 1.00 15.44  ? 234  ALA A CB  1 
ATOM   1792 N N   . SER A 1 235 ? 4.195   52.884 58.524 1.00 31.82  ? 235  SER A N   1 
ATOM   1793 C CA  . SER A 1 235 ? 3.353   51.819 57.987 1.00 31.82  ? 235  SER A CA  1 
ATOM   1794 C C   . SER A 1 235 ? 3.357   50.553 58.821 1.00 31.82  ? 235  SER A C   1 
ATOM   1795 O O   . SER A 1 235 ? 4.256   50.337 59.614 1.00 31.82  ? 235  SER A O   1 
ATOM   1796 C CB  . SER A 1 235 ? 3.765   51.475 56.553 1.00 31.98  ? 235  SER A CB  1 
ATOM   1797 O OG  . SER A 1 235 ? 4.972   50.747 56.537 1.00 31.98  ? 235  SER A OG  1 
ATOM   1798 N N   . VAL A 1 236 ? 2.336   49.724 58.624 1.00 34.90  ? 236  VAL A N   1 
ATOM   1799 C CA  . VAL A 1 236 ? 2.191   48.458 59.337 1.00 34.90  ? 236  VAL A CA  1 
ATOM   1800 C C   . VAL A 1 236 ? 1.759   47.351 58.374 1.00 34.90  ? 236  VAL A C   1 
ATOM   1801 O O   . VAL A 1 236 ? 1.355   47.623 57.245 1.00 34.90  ? 236  VAL A O   1 
ATOM   1802 C CB  . VAL A 1 236 ? 1.125   48.551 60.467 1.00 31.67  ? 236  VAL A CB  1 
ATOM   1803 C CG1 . VAL A 1 236 ? 1.543   49.589 61.497 1.00 31.67  ? 236  VAL A CG1 1 
ATOM   1804 C CG2 . VAL A 1 236 ? -0.253  48.880 59.879 1.00 31.67  ? 236  VAL A CG2 1 
ATOM   1805 N N   . SER A 1 237 ? 1.851   46.104 58.825 1.00 29.15  ? 237  SER A N   1 
ATOM   1806 C CA  . SER A 1 237 ? 1.448   44.956 58.017 1.00 29.15  ? 237  SER A CA  1 
ATOM   1807 C C   . SER A 1 237 ? -0.077  44.866 58.034 1.00 29.15  ? 237  SER A C   1 
ATOM   1808 O O   . SER A 1 237 ? -0.727  45.520 58.844 1.00 29.15  ? 237  SER A O   1 
ATOM   1809 C CB  . SER A 1 237 ? 2.032   43.667 58.599 1.00 27.22  ? 237  SER A CB  1 
ATOM   1810 O OG  . SER A 1 237 ? 1.534   43.436 59.908 1.00 27.22  ? 237  SER A OG  1 
ATOM   1811 N N   . VAL A 1 238 ? -0.649  44.055 57.151 1.00 32.05  ? 238  VAL A N   1 
ATOM   1812 C CA  . VAL A 1 238 ? -2.097  43.926 57.127 1.00 32.05  ? 238  VAL A CA  1 
ATOM   1813 C C   . VAL A 1 238 ? -2.544  43.280 58.423 1.00 32.05  ? 238  VAL A C   1 
ATOM   1814 O O   . VAL A 1 238 ? -3.619  43.587 58.935 1.00 32.05  ? 238  VAL A O   1 
ATOM   1815 C CB  . VAL A 1 238 ? -2.587  43.082 55.935 1.00 39.59  ? 238  VAL A CB  1 
ATOM   1816 C CG1 . VAL A 1 238 ? -2.113  43.697 54.641 1.00 39.59  ? 238  VAL A CG1 1 
ATOM   1817 C CG2 . VAL A 1 238 ? -2.086  41.672 56.053 1.00 39.59  ? 238  VAL A CG2 1 
ATOM   1818 N N   . ALA A 1 239 ? -1.703  42.407 58.970 1.00 35.11  ? 239  ALA A N   1 
ATOM   1819 C CA  . ALA A 1 239 ? -2.016  41.719 60.223 1.00 35.11  ? 239  ALA A CA  1 
ATOM   1820 C C   . ALA A 1 239 ? -2.084  42.675 61.412 1.00 35.11  ? 239  ALA A C   1 
ATOM   1821 O O   . ALA A 1 239 ? -2.998  42.598 62.219 1.00 35.11  ? 239  ALA A O   1 
ATOM   1822 C CB  . ALA A 1 239 ? -0.982  40.623 60.501 1.00 30.72  ? 239  ALA A CB  1 
ATOM   1823 N N   . GLU A 1 240 ? -1.100  43.558 61.535 1.00 34.84  ? 240  GLU A N   1 
ATOM   1824 C CA  . GLU A 1 240 ? -1.096  44.518 62.636 1.00 34.84  ? 240  GLU A CA  1 
ATOM   1825 C C   . GLU A 1 240 ? -2.220  45.526 62.401 1.00 34.84  ? 240  GLU A C   1 
ATOM   1826 O O   . GLU A 1 240 ? -2.820  46.031 63.347 1.00 34.84  ? 240  GLU A O   1 
ATOM   1827 C CB  . GLU A 1 240 ? 0.264   45.220 62.728 1.00 45.74  ? 240  GLU A CB  1 
ATOM   1828 C CG  . GLU A 1 240 ? 0.401   46.258 63.870 1.00 45.74  ? 240  GLU A CG  1 
ATOM   1829 C CD  . GLU A 1 240 ? -0.019  45.737 65.257 1.00 45.74  ? 240  GLU A CD  1 
ATOM   1830 O OE1 . GLU A 1 240 ? -0.056  44.508 65.463 1.00 45.74  ? 240  GLU A OE1 1 
ATOM   1831 O OE2 . GLU A 1 240 ? -0.300  46.568 66.150 1.00 45.74  ? 240  GLU A OE2 1 
ATOM   1832 N N   . GLY A 1 241 ? -2.510  45.803 61.132 1.00 32.33  ? 241  GLY A N   1 
ATOM   1833 C CA  . GLY A 1 241 ? -3.591  46.723 60.815 1.00 32.33  ? 241  GLY A CA  1 
ATOM   1834 C C   . GLY A 1 241 ? -4.893  46.122 61.306 1.00 32.33  ? 241  GLY A C   1 
ATOM   1835 O O   . GLY A 1 241 ? -5.689  46.768 61.983 1.00 32.33  ? 241  GLY A O   1 
ATOM   1836 N N   . ARG A 1 242 ? -5.098  44.858 60.966 1.00 35.72  ? 242  ARG A N   1 
ATOM   1837 C CA  . ARG A 1 242 ? -6.290  44.140 61.371 1.00 35.72  ? 242  ARG A CA  1 
ATOM   1838 C C   . ARG A 1 242 ? -6.381  44.071 62.895 1.00 35.72  ? 242  ARG A C   1 
ATOM   1839 O O   . ARG A 1 242 ? -7.427  44.356 63.480 1.00 35.72  ? 242  ARG A O   1 
ATOM   1840 C CB  . ARG A 1 242 ? -6.268  42.736 60.766 1.00 43.53  ? 242  ARG A CB  1 
ATOM   1841 C CG  . ARG A 1 242 ? -7.388  41.815 61.247 1.00 43.53  ? 242  ARG A CG  1 
ATOM   1842 C CD  . ARG A 1 242 ? -7.531  40.618 60.312 1.00 43.53  ? 242  ARG A CD  1 
ATOM   1843 N NE  . ARG A 1 242 ? -8.094  41.007 59.018 1.00 43.53  ? 242  ARG A NE  1 
ATOM   1844 C CZ  . ARG A 1 242 ? -9.394  41.184 58.792 1.00 43.53  ? 242  ARG A CZ  1 
ATOM   1845 N NH1 . ARG A 1 242 ? -10.276 41.004 59.775 1.00 43.53  ? 242  ARG A NH1 1 
ATOM   1846 N NH2 . ARG A 1 242 ? -9.820  41.543 57.583 1.00 43.53  ? 242  ARG A NH2 1 
ATOM   1847 N N   . ARG A 1 243 ? -5.277  43.708 63.535 1.00 31.86  ? 243  ARG A N   1 
ATOM   1848 C CA  . ARG A 1 243 ? -5.243  43.611 64.982 1.00 31.86  ? 243  ARG A CA  1 
ATOM   1849 C C   . ARG A 1 243 ? -5.661  44.917 65.675 1.00 31.86  ? 243  ARG A C   1 
ATOM   1850 O O   . ARG A 1 243 ? -6.416  44.887 66.653 1.00 31.86  ? 243  ARG A O   1 
ATOM   1851 C CB  . ARG A 1 243 ? -3.843  43.204 65.431 1.00 45.12  ? 243  ARG A CB  1 
ATOM   1852 C CG  . ARG A 1 243 ? -3.733  42.873 66.897 1.00 45.12  ? 243  ARG A CG  1 
ATOM   1853 C CD  . ARG A 1 243 ? -2.510  43.552 67.495 1.00 45.12  ? 243  ARG A CD  1 
ATOM   1854 N NE  . ARG A 1 243 ? -2.878  44.254 68.721 1.00 45.12  ? 243  ARG A NE  1 
ATOM   1855 C CZ  . ARG A 1 243 ? -2.421  45.448 69.077 1.00 45.12  ? 243  ARG A CZ  1 
ATOM   1856 N NH1 . ARG A 1 243 ? -1.567  46.100 68.300 1.00 45.12  ? 243  ARG A NH1 1 
ATOM   1857 N NH2 . ARG A 1 243 ? -2.821  45.988 70.224 1.00 45.12  ? 243  ARG A NH2 1 
ATOM   1858 N N   . ARG A 1 244 ? -5.181  46.054 65.173 1.00 31.82  ? 244  ARG A N   1 
ATOM   1859 C CA  . ARG A 1 244 ? -5.515  47.355 65.763 1.00 31.82  ? 244  ARG A CA  1 
ATOM   1860 C C   . ARG A 1 244 ? -6.959  47.786 65.516 1.00 31.82  ? 244  ARG A C   1 
ATOM   1861 O O   . ARG A 1 244 ? -7.563  48.440 66.360 1.00 31.82  ? 244  ARG A O   1 
ATOM   1862 C CB  . ARG A 1 244 ? -4.573  48.461 65.245 1.00 29.47  ? 244  ARG A CB  1 
ATOM   1863 C CG  . ARG A 1 244 ? -3.133  48.334 65.701 1.00 29.47  ? 244  ARG A CG  1 
ATOM   1864 C CD  . ARG A 1 244 ? -2.257  49.465 65.186 1.00 29.47  ? 244  ARG A CD  1 
ATOM   1865 N NE  . ARG A 1 244 ? -0.850  49.148 65.398 1.00 29.47  ? 244  ARG A NE  1 
ATOM   1866 C CZ  . ARG A 1 244 ? 0.173   49.954 65.130 1.00 29.47  ? 244  ARG A CZ  1 
ATOM   1867 N NH1 . ARG A 1 244 ? -0.019  51.169 64.630 1.00 29.47  ? 244  ARG A NH1 1 
ATOM   1868 N NH2 . ARG A 1 244 ? 1.403   49.529 65.359 1.00 29.47  ? 244  ARG A NH2 1 
ATOM   1869 N N   . ALA A 1 245 ? -7.500  47.439 64.352 1.00 31.45  ? 245  ALA A N   1 
ATOM   1870 C CA  . ALA A 1 245 ? -8.871  47.787 64.011 1.00 31.45  ? 245  ALA A CA  1 
ATOM   1871 C C   . ALA A 1 245 ? -9.836  47.069 64.953 1.00 31.45  ? 245  ALA A C   1 
ATOM   1872 O O   . ALA A 1 245 ? -10.818 47.647 65.423 1.00 31.45  ? 245  ALA A O   1 
ATOM   1873 C CB  . ALA A 1 245 ? -9.155  47.394 62.579 1.00 41.08  ? 245  ALA A CB  1 
ATOM   1874 N N   . VAL A 1 246 ? -9.531  45.805 65.226 1.00 37.97  ? 246  VAL A N   1 
ATOM   1875 C CA  . VAL A 1 246 ? -10.332 44.973 66.108 1.00 37.97  ? 246  VAL A CA  1 
ATOM   1876 C C   . VAL A 1 246 ? -10.273 45.465 67.551 1.00 37.97  ? 246  VAL A C   1 
ATOM   1877 O O   . VAL A 1 246 ? -11.285 45.471 68.259 1.00 37.97  ? 246  VAL A O   1 
ATOM   1878 C CB  . VAL A 1 246 ? -9.843  43.513 66.059 1.00 33.92  ? 246  VAL A CB  1 
ATOM   1879 C CG1 . VAL A 1 246 ? -10.573 42.681 67.110 1.00 33.92  ? 246  VAL A CG1 1 
ATOM   1880 C CG2 . VAL A 1 246 ? -10.073 42.939 64.667 1.00 33.92  ? 246  VAL A CG2 1 
ATOM   1881 N N   . GLU A 1 247 ? -9.082  45.872 67.979 1.00 32.22  ? 247  GLU A N   1 
ATOM   1882 C CA  . GLU A 1 247 ? -8.878  46.364 69.332 1.00 32.22  ? 247  GLU A CA  1 
ATOM   1883 C C   . GLU A 1 247 ? -9.595  47.703 69.476 1.00 32.22  ? 247  GLU A C   1 
ATOM   1884 O O   . GLU A 1 247 ? -10.073 48.046 70.557 1.00 32.22  ? 247  GLU A O   1 
ATOM   1885 C CB  . GLU A 1 247 ? -7.377  46.506 69.605 1.00 59.15  ? 247  GLU A CB  1 
ATOM   1886 C CG  . GLU A 1 247 ? -6.971  46.788 71.054 1.00 59.15  ? 247  GLU A CG  1 
ATOM   1887 C CD  . GLU A 1 247 ? -7.362  45.678 72.039 1.00 59.15  ? 247  GLU A CD  1 
ATOM   1888 O OE1 . GLU A 1 247 ? -7.388  44.479 71.644 1.00 59.15  ? 247  GLU A OE1 1 
ATOM   1889 O OE2 . GLU A 1 247 ? -7.630  46.015 73.222 1.00 59.15  ? 247  GLU A OE2 1 
ATOM   1890 N N   . LEU A 1 248 ? -9.678  48.459 68.382 1.00 34.13  ? 248  LEU A N   1 
ATOM   1891 C CA  . LEU A 1 248 ? -10.376 49.742 68.418 1.00 34.13  ? 248  LEU A CA  1 
ATOM   1892 C C   . LEU A 1 248 ? -11.842 49.437 68.696 1.00 34.13  ? 248  LEU A C   1 
ATOM   1893 O O   . LEU A 1 248 ? -12.481 50.080 69.532 1.00 34.13  ? 248  LEU A O   1 
ATOM   1894 C CB  . LEU A 1 248 ? -10.257 50.473 67.082 1.00 27.63  ? 248  LEU A CB  1 
ATOM   1895 C CG  . LEU A 1 248 ? -11.107 51.749 66.971 1.00 27.63  ? 248  LEU A CG  1 
ATOM   1896 C CD1 . LEU A 1 248 ? -10.600 52.790 67.957 1.00 27.63  ? 248  LEU A CD1 1 
ATOM   1897 C CD2 . LEU A 1 248 ? -11.060 52.298 65.566 1.00 27.63  ? 248  LEU A CD2 1 
ATOM   1898 N N   . GLY A 1 249 ? -12.354 48.430 67.994 1.00 39.50  ? 249  GLY A N   1 
ATOM   1899 C CA  . GLY A 1 249 ? -13.737 48.024 68.153 1.00 39.50  ? 249  GLY A CA  1 
ATOM   1900 C C   . GLY A 1 249 ? -14.035 47.510 69.544 1.00 39.50  ? 249  GLY A C   1 
ATOM   1901 O O   . GLY A 1 249 ? -15.141 47.685 70.046 1.00 39.50  ? 249  GLY A O   1 
ATOM   1902 N N   . ARG A 1 250 ? -13.044 46.884 70.168 1.00 44.86  ? 250  ARG A N   1 
ATOM   1903 C CA  . ARG A 1 250 ? -13.204 46.347 71.512 1.00 44.86  ? 250  ARG A CA  1 
ATOM   1904 C C   . ARG A 1 250 ? -13.271 47.450 72.578 1.00 44.86  ? 250  ARG A C   1 
ATOM   1905 O O   . ARG A 1 250 ? -13.917 47.286 73.619 1.00 44.86  ? 250  ARG A O   1 
ATOM   1906 C CB  . ARG A 1 250 ? -12.049 45.404 71.838 1.00 52.45  ? 250  ARG A CB  1 
ATOM   1907 C CG  . ARG A 1 250 ? -12.261 44.618 73.119 1.00 52.45  ? 250  ARG A CG  1 
ATOM   1908 C CD  . ARG A 1 250 ? -10.980 43.961 73.568 1.00 52.45  ? 250  ARG A CD  1 
ATOM   1909 N NE  . ARG A 1 250 ? -10.307 43.318 72.445 1.00 52.45  ? 250  ARG A NE  1 
ATOM   1910 C CZ  . ARG A 1 250 ? -10.667 42.157 71.908 1.00 52.45  ? 250  ARG A CZ  1 
ATOM   1911 N NH1 . ARG A 1 250 ? -11.715 41.494 72.396 1.00 52.45  ? 250  ARG A NH1 1 
ATOM   1912 N NH2 . ARG A 1 250 ? -9.967  41.652 70.890 1.00 52.45  ? 250  ARG A NH2 1 
ATOM   1913 N N   . ASN A 1 251 ? -12.594 48.568 72.326 1.00 44.06  ? 251  ASN A N   1 
ATOM   1914 C CA  . ASN A 1 251 ? -12.599 49.687 73.265 1.00 44.06  ? 251  ASN A CA  1 
ATOM   1915 C C   . ASN A 1 251 ? -13.942 50.416 73.217 1.00 44.06  ? 251  ASN A C   1 
ATOM   1916 O O   . ASN A 1 251 ? -14.290 51.172 74.131 1.00 44.06  ? 251  ASN A O   1 
ATOM   1917 C CB  . ASN A 1 251 ? -11.465 50.665 72.930 1.00 40.00  ? 251  ASN A CB  1 
ATOM   1918 C CG  . ASN A 1 251 ? -10.139 50.282 73.582 1.00 40.00  ? 251  ASN A CG  1 
ATOM   1919 O OD1 . ASN A 1 251 ? -9.776  50.822 74.631 1.00 40.00  ? 251  ASN A OD1 1 
ATOM   1920 N ND2 . ASN A 1 251 ? -9.412  49.348 72.965 1.00 40.00  ? 251  ASN A ND2 1 
ATOM   1921 N N   . LEU A 1 252 ? -14.693 50.192 72.145 1.00 48.65  ? 252  LEU A N   1 
ATOM   1922 C CA  . LEU A 1 252 ? -16.000 50.831 71.975 1.00 48.65  ? 252  LEU A CA  1 
ATOM   1923 C C   . LEU A 1 252 ? -17.120 49.792 72.084 1.00 48.65  ? 252  LEU A C   1 
ATOM   1924 O O   . LEU A 1 252 ? -18.242 50.021 71.640 1.00 48.65  ? 252  LEU A O   1 
ATOM   1925 C CB  . LEU A 1 252 ? -16.064 51.553 70.623 1.00 37.30  ? 252  LEU A CB  1 
ATOM   1926 C CG  . LEU A 1 252 ? -15.061 52.712 70.506 1.00 37.30  ? 252  LEU A CG  1 
ATOM   1927 C CD1 . LEU A 1 252 ? -14.977 53.200 69.067 1.00 37.30  ? 252  LEU A CD1 1 
ATOM   1928 C CD2 . LEU A 1 252 ? -15.476 53.846 71.433 1.00 37.30  ? 252  LEU A CD2 1 
ATOM   1929 N N   . ASN A 1 253 ? -16.794 48.655 72.689 1.00 55.51  ? 253  ASN A N   1 
ATOM   1930 C CA  . ASN A 1 253 ? -17.750 47.570 72.882 1.00 55.51  ? 253  ASN A CA  1 
ATOM   1931 C C   . ASN A 1 253 ? -18.522 47.307 71.601 1.00 55.51  ? 253  ASN A C   1 
ATOM   1932 O O   . ASN A 1 253 ? -19.734 47.537 71.545 1.00 55.51  ? 253  ASN A O   1 
ATOM   1933 C CB  . ASN A 1 253 ? -18.737 47.933 73.997 1.00 72.52  ? 253  ASN A CB  1 
ATOM   1934 C CG  . ASN A 1 253 ? -18.062 48.604 75.188 1.00 72.52  ? 253  ASN A CG  1 
ATOM   1935 O OD1 . ASN A 1 253 ? -17.123 48.056 75.789 1.00 72.52  ? 253  ASN A OD1 1 
ATOM   1936 N ND2 . ASN A 1 253 ? -18.542 49.802 75.540 1.00 72.52  ? 253  ASN A ND2 1 
ATOM   1937 N N   . CYS A 1 254 ? -17.831 46.843 70.565 1.00 43.26  ? 254  CYS A N   1 
ATOM   1938 C CA  . CYS A 1 254 ? -18.495 46.561 69.297 1.00 43.26  ? 254  CYS A CA  1 
ATOM   1939 C C   . CYS A 1 254 ? -18.561 45.058 69.062 1.00 43.26  ? 254  CYS A C   1 
ATOM   1940 O O   . CYS A 1 254 ? -17.803 44.289 69.656 1.00 43.26  ? 254  CYS A O   1 
ATOM   1941 C CB  . CYS A 1 254 ? -17.754 47.244 68.148 1.00 50.05  ? 254  CYS A CB  1 
ATOM   1942 N N   . ASN A 1 255 ? -19.485 44.639 68.203 1.00 48.26  ? 255  ASN A N   1 
ATOM   1943 C CA  . ASN A 1 255 ? -19.642 43.226 67.873 1.00 48.26  ? 255  ASN A CA  1 
ATOM   1944 C C   . ASN A 1 255 ? -18.404 42.863 67.062 1.00 48.26  ? 255  ASN A C   1 
ATOM   1945 O O   . ASN A 1 255 ? -18.116 43.513 66.056 1.00 48.26  ? 255  ASN A O   1 
ATOM   1946 C CB  . ASN A 1 255 ? -20.890 43.043 67.017 1.00 63.86  ? 255  ASN A CB  1 
ATOM   1947 C CG  . ASN A 1 255 ? -21.281 41.588 66.852 1.00 63.86  ? 255  ASN A CG  1 
ATOM   1948 O OD1 . ASN A 1 255 ? -20.426 40.710 66.684 1.00 63.86  ? 255  ASN A OD1 1 
ATOM   1949 N ND2 . ASN A 1 255 ? -22.590 41.325 66.880 1.00 63.86  ? 255  ASN A ND2 1 
ATOM   1950 N N   . LEU A 1 256 ? -17.673 41.833 67.473 1.00 52.27  ? 256  LEU A N   1 
ATOM   1951 C CA  . LEU A 1 256 ? -16.459 41.473 66.742 1.00 52.27  ? 256  LEU A CA  1 
ATOM   1952 C C   . LEU A 1 256 ? -16.507 40.174 65.937 1.00 52.27  ? 256  LEU A C   1 
ATOM   1953 O O   . LEU A 1 256 ? -15.466 39.722 65.452 1.00 52.27  ? 256  LEU A O   1 
ATOM   1954 C CB  . LEU A 1 256 ? -15.272 41.412 67.710 1.00 42.70  ? 256  LEU A CB  1 
ATOM   1955 C CG  . LEU A 1 256 ? -15.103 42.619 68.644 1.00 42.70  ? 256  LEU A CG  1 
ATOM   1956 C CD1 . LEU A 1 256 ? -13.866 42.424 69.504 1.00 42.70  ? 256  LEU A CD1 1 
ATOM   1957 C CD2 . LEU A 1 256 ? -14.983 43.904 67.828 1.00 42.70  ? 256  LEU A CD2 1 
ATOM   1958 N N   . ASN A 1 257 ? -17.688 39.576 65.772 1.00 56.77  ? 257  ASN A N   1 
ATOM   1959 C CA  . ASN A 1 257 ? -17.788 38.310 65.026 1.00 56.77  ? 257  ASN A CA  1 
ATOM   1960 C C   . ASN A 1 257 ? -17.365 38.361 63.558 1.00 56.77  ? 257  ASN A C   1 
ATOM   1961 O O   . ASN A 1 257 ? -16.891 37.365 63.013 1.00 56.77  ? 257  ASN A O   1 
ATOM   1962 C CB  . ASN A 1 257 ? -19.214 37.756 65.085 1.00 81.78  ? 257  ASN A CB  1 
ATOM   1963 C CG  . ASN A 1 257 ? -19.648 37.424 66.494 1.00 81.78  ? 257  ASN A CG  1 
ATOM   1964 O OD1 . ASN A 1 257 ? -18.899 36.791 67.253 1.00 81.78  ? 257  ASN A OD1 1 
ATOM   1965 N ND2 . ASN A 1 257 ? -20.867 37.842 66.858 1.00 81.78  ? 257  ASN A ND2 1 
ATOM   1966 N N   . SER A 1 258 ? -17.568 39.495 62.902 1.00 46.26  ? 258  SER A N   1 
ATOM   1967 C CA  . SER A 1 258 ? -17.189 39.611 61.496 1.00 46.26  ? 258  SER A CA  1 
ATOM   1968 C C   . SER A 1 258 ? -16.791 41.042 61.151 1.00 46.26  ? 258  SER A C   1 
ATOM   1969 O O   . SER A 1 258 ? -17.129 41.982 61.873 1.00 46.26  ? 258  SER A O   1 
ATOM   1970 C CB  . SER A 1 258 ? -18.354 39.199 60.595 1.00 48.42  ? 258  SER A CB  1 
ATOM   1971 O OG  . SER A 1 258 ? -19.395 40.169 60.653 1.00 48.42  ? 258  SER A OG  1 
ATOM   1972 N N   . ASP A 1 259 ? -16.068 41.203 60.046 1.00 51.90  ? 259  ASP A N   1 
ATOM   1973 C CA  . ASP A 1 259 ? -15.672 42.531 59.604 1.00 51.90  ? 259  ASP A CA  1 
ATOM   1974 C C   . ASP A 1 259 ? -16.925 43.403 59.453 1.00 51.90  ? 259  ASP A C   1 
ATOM   1975 O O   . ASP A 1 259 ? -16.982 44.500 60.001 1.00 51.90  ? 259  ASP A O   1 
ATOM   1976 C CB  . ASP A 1 259 ? -14.899 42.448 58.280 1.00 62.97  ? 259  ASP A CB  1 
ATOM   1977 C CG  . ASP A 1 259 ? -13.488 41.867 58.456 1.00 62.97  ? 259  ASP A CG  1 
ATOM   1978 O OD1 . ASP A 1 259 ? -13.030 41.736 59.617 1.00 62.97  ? 259  ASP A OD1 1 
ATOM   1979 O OD2 . ASP A 1 259 ? -12.823 41.551 57.436 1.00 62.97  ? 259  ASP A OD2 1 
ATOM   1980 N N   . GLU A 1 260 ? -17.932 42.902 58.737 1.00 47.59  ? 260  GLU A N   1 
ATOM   1981 C CA  . GLU A 1 260 ? -19.189 43.629 58.520 1.00 47.59  ? 260  GLU A CA  1 
ATOM   1982 C C   . GLU A 1 260 ? -19.752 44.165 59.828 1.00 47.59  ? 260  GLU A C   1 
ATOM   1983 O O   . GLU A 1 260 ? -20.212 45.309 59.915 1.00 47.59  ? 260  GLU A O   1 
ATOM   1984 C CB  . GLU A 1 260 ? -20.239 42.700 57.906 1.00 86.06  ? 260  GLU A CB  1 
ATOM   1985 C CG  . GLU A 1 260 ? -19.888 42.127 56.530 1.00 86.06  ? 260  GLU A CG  1 
ATOM   1986 C CD  . GLU A 1 260 ? -18.504 41.482 56.481 1.00 86.06  ? 260  GLU A CD  1 
ATOM   1987 O OE1 . GLU A 1 260 ? -18.184 40.644 57.366 1.00 86.06  ? 260  GLU A OE1 1 
ATOM   1988 O OE2 . GLU A 1 260 ? -17.738 41.815 55.544 1.00 86.06  ? 260  GLU A OE2 1 
ATOM   1989 N N   . GLU A 1 261 ? -19.731 43.303 60.835 1.00 46.15  ? 261  GLU A N   1 
ATOM   1990 C CA  . GLU A 1 261 ? -20.232 43.613 62.170 1.00 46.15  ? 261  GLU A CA  1 
ATOM   1991 C C   . GLU A 1 261 ? -19.463 44.779 62.792 1.00 46.15  ? 261  GLU A C   1 
ATOM   1992 O O   . GLU A 1 261 ? -20.060 45.738 63.292 1.00 46.15  ? 261  GLU A O   1 
ATOM   1993 C CB  . GLU A 1 261 ? -20.067 42.380 63.062 1.00 87.54  ? 261  GLU A CB  1 
ATOM   1994 C CG  . GLU A 1 261 ? -21.278 42.006 63.897 1.00 87.54  ? 261  GLU A CG  1 
ATOM   1995 C CD  . GLU A 1 261 ? -22.227 41.079 63.163 1.00 87.54  ? 261  GLU A CD  1 
ATOM   1996 O OE1 . GLU A 1 261 ? -21.727 40.152 62.463 1.00 87.54  ? 261  GLU A OE1 1 
ATOM   1997 O OE2 . GLU A 1 261 ? -23.466 41.264 63.305 1.00 87.54  ? 261  GLU A OE2 1 
ATOM   1998 N N   . LEU A 1 262 ? -18.134 44.678 62.771 1.00 42.55  ? 262  LEU A N   1 
ATOM   1999 C CA  . LEU A 1 262 ? -17.268 45.705 63.339 1.00 42.55  ? 262  LEU A CA  1 
ATOM   2000 C C   . LEU A 1 262 ? -17.414 47.017 62.591 1.00 42.55  ? 262  LEU A C   1 
ATOM   2001 O O   . LEU A 1 262 ? -17.741 48.046 63.182 1.00 42.55  ? 262  LEU A O   1 
ATOM   2002 C CB  . LEU A 1 262 ? -15.807 45.237 63.297 1.00 37.60  ? 262  LEU A CB  1 
ATOM   2003 C CG  . LEU A 1 262 ? -14.665 46.166 63.722 1.00 37.60  ? 262  LEU A CG  1 
ATOM   2004 C CD1 . LEU A 1 262 ? -14.878 46.687 65.112 1.00 37.60  ? 262  LEU A CD1 1 
ATOM   2005 C CD2 . LEU A 1 262 ? -13.358 45.387 63.662 1.00 37.60  ? 262  LEU A CD2 1 
ATOM   2006 N N   . ILE A 1 263 ? -17.185 46.978 61.285 1.00 41.84  ? 263  ILE A N   1 
ATOM   2007 C CA  . ILE A 1 263 ? -17.283 48.181 60.476 1.00 41.84  ? 263  ILE A CA  1 
ATOM   2008 C C   . ILE A 1 263 ? -18.603 48.910 60.717 1.00 41.84  ? 263  ILE A C   1 
ATOM   2009 O O   . ILE A 1 263 ? -18.599 50.096 61.030 1.00 41.84  ? 263  ILE A O   1 
ATOM   2010 C CB  . ILE A 1 263 ? -17.131 47.856 58.976 1.00 46.77  ? 263  ILE A CB  1 
ATOM   2011 C CG1 . ILE A 1 263 ? -15.749 47.251 58.718 1.00 46.77  ? 263  ILE A CG1 1 
ATOM   2012 C CG2 . ILE A 1 263 ? -17.315 49.117 58.150 1.00 46.77  ? 263  ILE A CG2 1 
ATOM   2013 C CD1 . ILE A 1 263 ? -15.507 46.876 57.264 1.00 46.77  ? 263  ILE A CD1 1 
ATOM   2014 N N   . HIS A 1 264 ? -19.727 48.205 60.589 1.00 46.74  ? 264  HIS A N   1 
ATOM   2015 C CA  . HIS A 1 264 ? -21.037 48.824 60.807 1.00 46.74  ? 264  HIS A CA  1 
ATOM   2016 C C   . HIS A 1 264 ? -21.137 49.491 62.176 1.00 46.74  ? 264  HIS A C   1 
ATOM   2017 O O   . HIS A 1 264 ? -21.690 50.584 62.300 1.00 46.74  ? 264  HIS A O   1 
ATOM   2018 C CB  . HIS A 1 264 ? -22.166 47.792 60.663 1.00 67.81  ? 264  HIS A CB  1 
ATOM   2019 C CG  . HIS A 1 264 ? -23.510 48.305 61.093 1.00 67.81  ? 264  HIS A CG  1 
ATOM   2020 N ND1 . HIS A 1 264 ? -23.866 48.446 62.421 1.00 67.81  ? 264  HIS A ND1 1 
ATOM   2021 C CD2 . HIS A 1 264 ? -24.575 48.736 60.372 1.00 67.81  ? 264  HIS A CD2 1 
ATOM   2022 C CE1 . HIS A 1 264 ? -25.090 48.944 62.499 1.00 67.81  ? 264  HIS A CE1 1 
ATOM   2023 N NE2 . HIS A 1 264 ? -25.542 49.130 61.269 1.00 67.81  ? 264  HIS A NE2 1 
ATOM   2024 N N   . CYS A 1 265 ? -20.610 48.838 63.207 1.00 42.74  ? 265  CYS A N   1 
ATOM   2025 C CA  . CYS A 1 265 ? -20.660 49.411 64.551 1.00 42.74  ? 265  CYS A CA  1 
ATOM   2026 C C   . CYS A 1 265 ? -19.800 50.681 64.630 1.00 42.74  ? 265  CYS A C   1 
ATOM   2027 O O   . CYS A 1 265 ? -20.171 51.647 65.289 1.00 42.74  ? 265  CYS A O   1 
ATOM   2028 C CB  . CYS A 1 265 ? -20.191 48.377 65.595 1.00 36.90  ? 265  CYS A CB  1 
ATOM   2029 N N   . LEU A 1 266 ? -18.655 50.679 63.954 1.00 46.38  ? 266  LEU A N   1 
ATOM   2030 C CA  . LEU A 1 266 ? -17.767 51.843 63.970 1.00 46.38  ? 266  LEU A CA  1 
ATOM   2031 C C   . LEU A 1 266 ? -18.342 53.022 63.185 1.00 46.38  ? 266  LEU A C   1 
ATOM   2032 O O   . LEU A 1 266 ? -18.044 54.180 63.480 1.00 46.38  ? 266  LEU A O   1 
ATOM   2033 C CB  . LEU A 1 266 ? -16.392 51.469 63.411 1.00 29.92  ? 266  LEU A CB  1 
ATOM   2034 C CG  . LEU A 1 266 ? -15.543 50.541 64.283 1.00 29.92  ? 266  LEU A CG  1 
ATOM   2035 C CD1 . LEU A 1 266 ? -14.317 50.103 63.525 1.00 29.92  ? 266  LEU A CD1 1 
ATOM   2036 C CD2 . LEU A 1 266 ? -15.154 51.257 65.567 1.00 29.92  ? 266  LEU A CD2 1 
ATOM   2037 N N   . ARG A 1 267 ? -19.172 52.730 62.188 1.00 44.54  ? 267  ARG A N   1 
ATOM   2038 C CA  . ARG A 1 267 ? -19.773 53.784 61.385 1.00 44.54  ? 267  ARG A CA  1 
ATOM   2039 C C   . ARG A 1 267 ? -20.923 54.468 62.108 1.00 44.54  ? 267  ARG A C   1 
ATOM   2040 O O   . ARG A 1 267 ? -21.371 55.531 61.685 1.00 44.54  ? 267  ARG A O   1 
ATOM   2041 C CB  . ARG A 1 267 ? -20.261 53.236 60.039 1.00 43.94  ? 267  ARG A CB  1 
ATOM   2042 C CG  . ARG A 1 267 ? -19.147 52.965 59.056 1.00 43.94  ? 267  ARG A CG  1 
ATOM   2043 C CD  . ARG A 1 267 ? -19.682 52.579 57.696 1.00 43.94  ? 267  ARG A CD  1 
ATOM   2044 N NE  . ARG A 1 267 ? -18.604 52.277 56.759 1.00 43.94  ? 267  ARG A NE  1 
ATOM   2045 C CZ  . ARG A 1 267 ? -18.760 51.553 55.653 1.00 43.94  ? 267  ARG A CZ  1 
ATOM   2046 N NH1 . ARG A 1 267 ? -19.952 51.057 55.348 1.00 43.94  ? 267  ARG A NH1 1 
ATOM   2047 N NH2 . ARG A 1 267 ? -17.725 51.316 54.852 1.00 43.94  ? 267  ARG A NH2 1 
ATOM   2048 N N   . GLU A 1 268 ? -21.404 53.865 63.191 1.00 50.49  ? 268  GLU A N   1 
ATOM   2049 C CA  . GLU A 1 268 ? -22.494 54.472 63.959 1.00 50.49  ? 268  GLU A CA  1 
ATOM   2050 C C   . GLU A 1 268 ? -21.945 55.377 65.059 1.00 50.49  ? 268  GLU A C   1 
ATOM   2051 O O   . GLU A 1 268 ? -22.681 56.168 65.647 1.00 50.49  ? 268  GLU A O   1 
ATOM   2052 C CB  . GLU A 1 268 ? -23.391 53.397 64.586 1.00 92.16  ? 268  GLU A CB  1 
ATOM   2053 C CG  . GLU A 1 268 ? -24.175 52.585 63.561 1.00 92.16  ? 268  GLU A CG  1 
ATOM   2054 C CD  . GLU A 1 268 ? -25.045 53.465 62.664 1.00 92.16  ? 268  GLU A CD  1 
ATOM   2055 O OE1 . GLU A 1 268 ? -25.999 54.104 63.195 1.00 92.16  ? 268  GLU A OE1 1 
ATOM   2056 O OE2 . GLU A 1 268 ? -24.771 53.527 61.435 1.00 92.16  ? 268  GLU A OE2 1 
ATOM   2057 N N   . LYS A 1 269 ? -20.651 55.264 65.332 1.00 39.61  ? 269  LYS A N   1 
ATOM   2058 C CA  . LYS A 1 269 ? -20.028 56.074 66.365 1.00 39.61  ? 269  LYS A CA  1 
ATOM   2059 C C   . LYS A 1 269 ? -19.790 57.525 65.944 1.00 39.61  ? 269  LYS A C   1 
ATOM   2060 O O   . LYS A 1 269 ? -19.520 57.816 64.778 1.00 39.61  ? 269  LYS A O   1 
ATOM   2061 C CB  . LYS A 1 269 ? -18.697 55.446 66.771 1.00 59.76  ? 269  LYS A CB  1 
ATOM   2062 C CG  . LYS A 1 269 ? -18.819 54.028 67.289 1.00 59.76  ? 269  LYS A CG  1 
ATOM   2063 C CD  . LYS A 1 269 ? -19.704 53.986 68.512 1.00 59.76  ? 269  LYS A CD  1 
ATOM   2064 C CE  . LYS A 1 269 ? -19.888 52.563 69.002 1.00 59.76  ? 269  LYS A CE  1 
ATOM   2065 N NZ  . LYS A 1 269 ? -20.681 52.541 70.260 1.00 59.76  ? 269  LYS A NZ  1 
ATOM   2066 N N   . LYS A 1 270 ? -19.902 58.441 66.899 1.00 42.96  ? 270  LYS A N   1 
ATOM   2067 C CA  . LYS A 1 270 ? -19.647 59.849 66.619 1.00 42.96  ? 270  LYS A CA  1 
ATOM   2068 C C   . LYS A 1 270 ? -18.137 59.958 66.393 1.00 42.96  ? 270  LYS A C   1 
ATOM   2069 O O   . LYS A 1 270 ? -17.370 59.158 66.921 1.00 42.96  ? 270  LYS A O   1 
ATOM   2070 C CB  . LYS A 1 270 ? -20.038 60.719 67.816 1.00 72.95  ? 270  LYS A CB  1 
ATOM   2071 C CG  . LYS A 1 270 ? -21.534 60.768 68.136 1.00 72.95  ? 270  LYS A CG  1 
ATOM   2072 C CD  . LYS A 1 270 ? -21.780 61.588 69.421 1.00 72.95  ? 270  LYS A CD  1 
ATOM   2073 C CE  . LYS A 1 270 ? -23.268 61.682 69.777 1.00 72.95  ? 270  LYS A CE  1 
ATOM   2074 N NZ  . LYS A 1 270 ? -23.866 60.343 70.096 1.00 72.95  ? 270  LYS A NZ  1 
ATOM   2075 N N   . PRO A 1 271 ? -17.691 60.950 65.614 1.00 38.34  ? 271  PRO A N   1 
ATOM   2076 C CA  . PRO A 1 271 ? -16.250 61.096 65.369 1.00 38.34  ? 271  PRO A CA  1 
ATOM   2077 C C   . PRO A 1 271 ? -15.384 61.094 66.640 1.00 38.34  ? 271  PRO A C   1 
ATOM   2078 O O   . PRO A 1 271 ? -14.407 60.356 66.733 1.00 38.34  ? 271  PRO A O   1 
ATOM   2079 C CB  . PRO A 1 271 ? -16.161 62.430 64.620 1.00 38.06  ? 271  PRO A CB  1 
ATOM   2080 C CG  . PRO A 1 271 ? -17.449 62.463 63.859 1.00 38.06  ? 271  PRO A CG  1 
ATOM   2081 C CD  . PRO A 1 271 ? -18.459 61.970 64.881 1.00 38.06  ? 271  PRO A CD  1 
ATOM   2082 N N   . GLN A 1 272 ? -15.750 61.921 67.613 1.00 37.89  ? 272  GLN A N   1 
ATOM   2083 C CA  . GLN A 1 272 ? -14.982 62.034 68.852 1.00 37.89  ? 272  GLN A CA  1 
ATOM   2084 C C   . GLN A 1 272 ? -14.900 60.750 69.673 1.00 37.89  ? 272  GLN A C   1 
ATOM   2085 O O   . GLN A 1 272 ? -14.001 60.595 70.505 1.00 37.89  ? 272  GLN A O   1 
ATOM   2086 C CB  . GLN A 1 272 ? -15.551 63.168 69.719 1.00 45.73  ? 272  GLN A CB  1 
ATOM   2087 C CG  . GLN A 1 272 ? -14.630 63.610 70.869 1.00 45.73  ? 272  GLN A CG  1 
ATOM   2088 C CD  . GLN A 1 272 ? -13.212 63.934 70.398 1.00 45.73  ? 272  GLN A CD  1 
ATOM   2089 O OE1 . GLN A 1 272 ? -13.017 64.665 69.421 1.00 45.73  ? 272  GLN A OE1 1 
ATOM   2090 N NE2 . GLN A 1 272 ? -12.216 63.392 71.100 1.00 45.73  ? 272  GLN A NE2 1 
ATOM   2091 N N   . GLU A 1 273 ? -15.826 59.825 69.442 1.00 41.89  ? 273  GLU A N   1 
ATOM   2092 C CA  . GLU A 1 273 ? -15.826 58.569 70.189 1.00 41.89  ? 273  GLU A CA  1 
ATOM   2093 C C   . GLU A 1 273 ? -14.663 57.662 69.789 1.00 41.89  ? 273  GLU A C   1 
ATOM   2094 O O   . GLU A 1 273 ? -14.134 56.924 70.623 1.00 41.89  ? 273  GLU A O   1 
ATOM   2095 C CB  . GLU A 1 273 ? -17.160 57.831 69.996 1.00 78.56  ? 273  GLU A CB  1 
ATOM   2096 C CG  . GLU A 1 273 ? -18.382 58.671 70.371 1.00 78.56  ? 273  GLU A CG  1 
ATOM   2097 C CD  . GLU A 1 273 ? -19.669 57.860 70.377 1.00 78.56  ? 273  GLU A CD  1 
ATOM   2098 O OE1 . GLU A 1 273 ? -19.749 56.907 71.189 1.00 78.56  ? 273  GLU A OE1 1 
ATOM   2099 O OE2 . GLU A 1 273 ? -20.591 58.168 69.579 1.00 78.56  ? 273  GLU A OE2 1 
ATOM   2100 N N   . LEU A 1 274 ? -14.278 57.706 68.515 1.00 36.57  ? 274  LEU A N   1 
ATOM   2101 C CA  . LEU A 1 274 ? -13.167 56.891 68.039 1.00 36.57  ? 274  LEU A CA  1 
ATOM   2102 C C   . LEU A 1 274 ? -11.869 57.569 68.437 1.00 36.57  ? 274  LEU A C   1 
ATOM   2103 O O   . LEU A 1 274 ? -10.910 56.915 68.825 1.00 36.57  ? 274  LEU A O   1 
ATOM   2104 C CB  . LEU A 1 274 ? -13.203 56.725 66.516 1.00 43.44  ? 274  LEU A CB  1 
ATOM   2105 C CG  . LEU A 1 274 ? -14.326 55.875 65.918 1.00 43.44  ? 274  LEU A CG  1 
ATOM   2106 C CD1 . LEU A 1 274 ? -15.647 56.562 66.171 1.00 43.44  ? 274  LEU A CD1 1 
ATOM   2107 C CD2 . LEU A 1 274 ? -14.127 55.699 64.422 1.00 43.44  ? 274  LEU A CD2 1 
ATOM   2108 N N   . ILE A 1 275 ? -11.851 58.889 68.345 1.00 37.94  ? 275  ILE A N   1 
ATOM   2109 C CA  . ILE A 1 275 ? -10.670 59.661 68.696 1.00 37.94  ? 275  ILE A CA  1 
ATOM   2110 C C   . ILE A 1 275 ? -10.294 59.527 70.179 1.00 37.94  ? 275  ILE A C   1 
ATOM   2111 O O   . ILE A 1 275 ? -9.118  59.496 70.515 1.00 37.94  ? 275  ILE A O   1 
ATOM   2112 C CB  . ILE A 1 275 ? -10.877 61.146 68.321 1.00 40.56  ? 275  ILE A CB  1 
ATOM   2113 C CG1 . ILE A 1 275 ? -10.997 61.267 66.798 1.00 40.56  ? 275  ILE A CG1 1 
ATOM   2114 C CG2 . ILE A 1 275 ? -9.720  62.001 68.840 1.00 40.56  ? 275  ILE A CG2 1 
ATOM   2115 C CD1 . ILE A 1 275 ? -11.310 62.661 66.315 1.00 40.56  ? 275  ILE A CD1 1 
ATOM   2116 N N   . ASP A 1 276 ? -11.290 59.426 71.058 1.00 38.41  ? 276  ASP A N   1 
ATOM   2117 C CA  . ASP A 1 276 ? -11.039 59.287 72.499 1.00 38.41  ? 276  ASP A CA  1 
ATOM   2118 C C   . ASP A 1 276 ? -10.330 57.984 72.887 1.00 38.41  ? 276  ASP A C   1 
ATOM   2119 O O   . ASP A 1 276 ? -9.758  57.893 73.974 1.00 38.41  ? 276  ASP A O   1 
ATOM   2120 C CB  . ASP A 1 276 ? -12.354 59.357 73.305 1.00 55.87  ? 276  ASP A CB  1 
ATOM   2121 C CG  . ASP A 1 276 ? -12.927 60.770 73.404 1.00 55.87  ? 276  ASP A CG  1 
ATOM   2122 O OD1 . ASP A 1 276 ? -12.155 61.748 73.303 1.00 55.87  ? 276  ASP A OD1 1 
ATOM   2123 O OD2 . ASP A 1 276 ? -14.156 60.909 73.602 1.00 55.87  ? 276  ASP A OD2 1 
ATOM   2124 N N   . VAL A 1 277 ? -10.368 56.976 72.020 1.00 35.55  ? 277  VAL A N   1 
ATOM   2125 C CA  . VAL A 1 277 ? -9.745  55.690 72.343 1.00 35.55  ? 277  VAL A CA  1 
ATOM   2126 C C   . VAL A 1 277 ? -8.711  55.232 71.332 1.00 35.55  ? 277  VAL A C   1 
ATOM   2127 O O   . VAL A 1 277 ? -8.135  54.148 71.468 1.00 35.55  ? 277  VAL A O   1 
ATOM   2128 C CB  . VAL A 1 277 ? -10.807 54.577 72.462 1.00 30.89  ? 277  VAL A CB  1 
ATOM   2129 C CG1 . VAL A 1 277 ? -11.784 54.908 73.569 1.00 30.89  ? 277  VAL A CG1 1 
ATOM   2130 C CG2 . VAL A 1 277 ? -11.544 54.422 71.140 1.00 30.89  ? 277  VAL A CG2 1 
ATOM   2131 N N   . GLU A 1 278 ? -8.490  56.059 70.317 1.00 30.07  ? 278  GLU A N   1 
ATOM   2132 C CA  . GLU A 1 278 ? -7.536  55.778 69.254 1.00 30.07  ? 278  GLU A CA  1 
ATOM   2133 C C   . GLU A 1 278 ? -6.130  55.401 69.748 1.00 30.07  ? 278  GLU A C   1 
ATOM   2134 O O   . GLU A 1 278 ? -5.496  54.521 69.182 1.00 30.07  ? 278  GLU A O   1 
ATOM   2135 C CB  . GLU A 1 278 ? -7.486  56.992 68.300 1.00 56.00  ? 278  GLU A CB  1 
ATOM   2136 C CG  . GLU A 1 278 ? -6.101  57.463 67.830 1.00 56.00  ? 278  GLU A CG  1 
ATOM   2137 C CD  . GLU A 1 278 ? -6.189  58.520 66.711 1.00 56.00  ? 278  GLU A CD  1 
ATOM   2138 O OE1 . GLU A 1 278 ? -6.809  59.590 66.930 1.00 56.00  ? 278  GLU A OE1 1 
ATOM   2139 O OE2 . GLU A 1 278 ? -5.644  58.282 65.608 1.00 56.00  ? 278  GLU A OE2 1 
ATOM   2140 N N   . TRP A 1 279 ? -5.647  56.043 70.807 1.00 34.92  ? 279  TRP A N   1 
ATOM   2141 C CA  . TRP A 1 279 ? -4.312  55.730 71.308 1.00 34.92  ? 279  TRP A CA  1 
ATOM   2142 C C   . TRP A 1 279 ? -4.193  54.447 72.120 1.00 34.92  ? 279  TRP A C   1 
ATOM   2143 O O   . TRP A 1 279 ? -3.086  54.014 72.413 1.00 34.92  ? 279  TRP A O   1 
ATOM   2144 C CB  . TRP A 1 279 ? -3.751  56.899 72.129 1.00 44.20  ? 279  TRP A CB  1 
ATOM   2145 C CG  . TRP A 1 279 ? -3.533  58.130 71.315 1.00 44.20  ? 279  TRP A CG  1 
ATOM   2146 C CD1 . TRP A 1 279 ? -4.388  59.180 71.178 1.00 44.20  ? 279  TRP A CD1 1 
ATOM   2147 C CD2 . TRP A 1 279 ? -2.402  58.421 70.492 1.00 44.20  ? 279  TRP A CD2 1 
ATOM   2148 N NE1 . TRP A 1 279 ? -3.861  60.115 70.320 1.00 44.20  ? 279  TRP A NE1 1 
ATOM   2149 C CE2 . TRP A 1 279 ? -2.640  59.673 69.883 1.00 44.20  ? 279  TRP A CE2 1 
ATOM   2150 C CE3 . TRP A 1 279 ? -1.207  57.746 70.208 1.00 44.20  ? 279  TRP A CE3 1 
ATOM   2151 C CZ2 . TRP A 1 279 ? -1.721  60.272 68.999 1.00 44.20  ? 279  TRP A CZ2 1 
ATOM   2152 C CZ3 . TRP A 1 279 ? -0.288  58.339 69.331 1.00 44.20  ? 279  TRP A CZ3 1 
ATOM   2153 C CH2 . TRP A 1 279 ? -0.555  59.592 68.737 1.00 44.20  ? 279  TRP A CH2 1 
ATOM   2154 N N   . ASN A 1 280 ? -5.317  53.825 72.464 1.00 37.06  ? 280  ASN A N   1 
ATOM   2155 C CA  . ASN A 1 280 ? -5.284  52.596 73.248 1.00 37.06  ? 280  ASN A CA  1 
ATOM   2156 C C   . ASN A 1 280 ? -4.953  51.334 72.458 1.00 37.06  ? 280  ASN A C   1 
ATOM   2157 O O   . ASN A 1 280 ? -4.882  50.253 73.032 1.00 37.06  ? 280  ASN A O   1 
ATOM   2158 C CB  . ASN A 1 280 ? -6.627  52.371 73.956 1.00 42.96  ? 280  ASN A CB  1 
ATOM   2159 C CG  . ASN A 1 280 ? -6.981  53.488 74.917 1.00 42.96  ? 280  ASN A CG  1 
ATOM   2160 O OD1 . ASN A 1 280 ? -6.142  54.317 75.263 1.00 42.96  ? 280  ASN A OD1 1 
ATOM   2161 N ND2 . ASN A 1 280 ? -8.228  53.511 75.356 1.00 42.96  ? 280  ASN A ND2 1 
ATOM   2162 N N   . VAL A 1 281 ? -4.727  51.447 71.157 1.00 32.29  ? 281  VAL A N   1 
ATOM   2163 C CA  . VAL A 1 281 ? -4.470  50.244 70.386 1.00 32.29  ? 281  VAL A CA  1 
ATOM   2164 C C   . VAL A 1 281 ? -3.022  49.949 70.054 1.00 32.29  ? 281  VAL A C   1 
ATOM   2165 O O   . VAL A 1 281 ? -2.726  48.913 69.461 1.00 32.29  ? 281  VAL A O   1 
ATOM   2166 C CB  . VAL A 1 281 ? -5.301  50.243 69.074 1.00 34.28  ? 281  VAL A CB  1 
ATOM   2167 C CG1 . VAL A 1 281 ? -6.784  50.450 69.404 1.00 34.28  ? 281  VAL A CG1 1 
ATOM   2168 C CG2 . VAL A 1 281 ? -4.785  51.328 68.113 1.00 34.28  ? 281  VAL A CG2 1 
ATOM   2169 N N   . LEU A 1 282 ? -2.117  50.845 70.431 1.00 36.63  ? 282  LEU A N   1 
ATOM   2170 C CA  . LEU A 1 282 ? -0.698  50.633 70.166 1.00 36.63  ? 282  LEU A CA  1 
ATOM   2171 C C   . LEU A 1 282 ? -0.223  49.342 70.821 1.00 36.63  ? 282  LEU A C   1 
ATOM   2172 O O   . LEU A 1 282 ? -0.563  49.045 71.972 1.00 36.63  ? 282  LEU A O   1 
ATOM   2173 C CB  . LEU A 1 282 ? 0.126   51.811 70.682 1.00 32.23  ? 282  LEU A CB  1 
ATOM   2174 C CG  . LEU A 1 282 ? 0.025   53.091 69.847 1.00 32.23  ? 282  LEU A CG  1 
ATOM   2175 C CD1 . LEU A 1 282 ? 0.883   54.176 70.482 1.00 32.23  ? 282  LEU A CD1 1 
ATOM   2176 C CD2 . LEU A 1 282 ? 0.484   52.821 68.419 1.00 32.23  ? 282  LEU A CD2 1 
ATOM   2177 N N   . PRO A 1 283 ? 0.582   48.553 70.099 1.00 38.87  ? 283  PRO A N   1 
ATOM   2178 C CA  . PRO A 1 283 ? 1.062   47.297 70.677 1.00 38.87  ? 283  PRO A CA  1 
ATOM   2179 C C   . PRO A 1 283 ? 2.049   47.442 71.831 1.00 38.87  ? 283  PRO A C   1 
ATOM   2180 O O   . PRO A 1 283 ? 2.097   46.586 72.710 1.00 38.87  ? 283  PRO A O   1 
ATOM   2181 C CB  . PRO A 1 283 ? 1.671   46.582 69.477 1.00 29.82  ? 283  PRO A CB  1 
ATOM   2182 C CG  . PRO A 1 283 ? 2.240   47.718 68.696 1.00 29.82  ? 283  PRO A CG  1 
ATOM   2183 C CD  . PRO A 1 283 ? 1.129   48.752 68.744 1.00 29.82  ? 283  PRO A CD  1 
ATOM   2184 N N   . PHE A 1 284 ? 2.829   48.517 71.838 1.00 34.39  ? 284  PHE A N   1 
ATOM   2185 C CA  . PHE A 1 284 ? 3.808   48.706 72.902 1.00 34.39  ? 284  PHE A CA  1 
ATOM   2186 C C   . PHE A 1 284 ? 3.748   50.079 73.541 1.00 34.39  ? 284  PHE A C   1 
ATOM   2187 O O   . PHE A 1 284 ? 3.169   51.014 72.997 1.00 34.39  ? 284  PHE A O   1 
ATOM   2188 C CB  . PHE A 1 284 ? 5.234   48.537 72.373 1.00 44.63  ? 284  PHE A CB  1 
ATOM   2189 C CG  . PHE A 1 284 ? 5.443   47.311 71.540 1.00 44.63  ? 284  PHE A CG  1 
ATOM   2190 C CD1 . PHE A 1 284 ? 5.448   46.047 72.121 1.00 44.63  ? 284  PHE A CD1 1 
ATOM   2191 C CD2 . PHE A 1 284 ? 5.652   47.424 70.165 1.00 44.63  ? 284  PHE A CD2 1 
ATOM   2192 C CE1 . PHE A 1 284 ? 5.660   44.906 71.345 1.00 44.63  ? 284  PHE A CE1 1 
ATOM   2193 C CE2 . PHE A 1 284 ? 5.867   46.290 69.374 1.00 44.63  ? 284  PHE A CE2 1 
ATOM   2194 C CZ  . PHE A 1 284 ? 5.871   45.028 69.967 1.00 44.63  ? 284  PHE A CZ  1 
ATOM   2195 N N   . ASP A 1 285 ? 4.366   50.168 74.713 1.00 30.73  ? 285  ASP A N   1 
ATOM   2196 C CA  . ASP A 1 285 ? 4.495   51.411 75.445 1.00 30.73  ? 285  ASP A CA  1 
ATOM   2197 C C   . ASP A 1 285 ? 5.552   52.054 74.558 1.00 30.73  ? 285  ASP A C   1 
ATOM   2198 O O   . ASP A 1 285 ? 6.653   51.533 74.428 1.00 30.73  ? 285  ASP A O   1 
ATOM   2199 C CB  . ASP A 1 285 ? 5.063   51.126 76.831 1.00 45.76  ? 285  ASP A CB  1 
ATOM   2200 C CG  . ASP A 1 285 ? 5.202   52.372 77.673 1.00 45.76  ? 285  ASP A CG  1 
ATOM   2201 O OD1 . ASP A 1 285 ? 4.892   53.478 77.158 1.00 45.76  ? 285  ASP A OD1 1 
ATOM   2202 O OD2 . ASP A 1 285 ? 5.625   52.237 78.850 1.00 45.76  ? 285  ASP A OD2 1 
ATOM   2203 N N   . SER A 1 286 ? 5.236   53.174 73.938 1.00 32.72  ? 286  SER A N   1 
ATOM   2204 C CA  . SER A 1 286 ? 6.201   53.738 73.020 1.00 32.72  ? 286  SER A CA  1 
ATOM   2205 C C   . SER A 1 286 ? 6.154   55.233 72.807 1.00 32.72  ? 286  SER A C   1 
ATOM   2206 O O   . SER A 1 286 ? 5.273   55.934 73.294 1.00 32.72  ? 286  SER A O   1 
ATOM   2207 C CB  . SER A 1 286 ? 6.018   53.070 71.667 1.00 37.26  ? 286  SER A CB  1 
ATOM   2208 O OG  . SER A 1 286 ? 4.685   53.298 71.220 1.00 37.26  ? 286  SER A OG  1 
ATOM   2209 N N   . ILE A 1 287 ? 7.113   55.687 72.018 1.00 27.24  ? 287  ILE A N   1 
ATOM   2210 C CA  . ILE A 1 287 ? 7.266   57.084 71.660 1.00 27.24  ? 287  ILE A CA  1 
ATOM   2211 C C   . ILE A 1 287 ? 7.409   57.072 70.129 1.00 27.24  ? 287  ILE A C   1 
ATOM   2212 O O   . ILE A 1 287 ? 7.920   56.111 69.558 1.00 27.24  ? 287  ILE A O   1 
ATOM   2213 C CB  . ILE A 1 287 ? 8.533   57.637 72.350 1.00 49.37  ? 287  ILE A CB  1 
ATOM   2214 C CG1 . ILE A 1 287 ? 8.633   59.139 72.203 1.00 49.37  ? 287  ILE A CG1 1 
ATOM   2215 C CG2 . ILE A 1 287 ? 9.766   57.008 71.755 1.00 49.37  ? 287  ILE A CG2 1 
ATOM   2216 C CD1 . ILE A 1 287 ? 9.990   59.663 72.697 1.00 49.37  ? 287  ILE A CD1 1 
ATOM   2217 N N   . PHE A 1 288 ? 6.915   58.107 69.464 1.00 30.55  ? 288  PHE A N   1 
ATOM   2218 C CA  . PHE A 1 288 ? 7.004   58.195 68.007 1.00 30.55  ? 288  PHE A CA  1 
ATOM   2219 C C   . PHE A 1 288 ? 6.345   57.016 67.272 1.00 30.55  ? 288  PHE A C   1 
ATOM   2220 O O   . PHE A 1 288 ? 6.889   56.495 66.298 1.00 30.55  ? 288  PHE A O   1 
ATOM   2221 C CB  . PHE A 1 288 ? 8.472   58.299 67.579 1.00 27.03  ? 288  PHE A CB  1 
ATOM   2222 C CG  . PHE A 1 288 ? 8.708   59.232 66.423 1.00 27.03  ? 288  PHE A CG  1 
ATOM   2223 C CD1 . PHE A 1 288 ? 7.945   59.137 65.256 1.00 27.03  ? 288  PHE A CD1 1 
ATOM   2224 C CD2 . PHE A 1 288 ? 9.701   60.202 66.496 1.00 27.03  ? 288  PHE A CD2 1 
ATOM   2225 C CE1 . PHE A 1 288 ? 8.169   59.998 64.182 1.00 27.03  ? 288  PHE A CE1 1 
ATOM   2226 C CE2 . PHE A 1 288 ? 9.934   61.066 65.427 1.00 27.03  ? 288  PHE A CE2 1 
ATOM   2227 C CZ  . PHE A 1 288 ? 9.164   60.964 64.266 1.00 27.03  ? 288  PHE A CZ  1 
ATOM   2228 N N   . ARG A 1 289 ? 5.187   56.579 67.746 1.00 31.40  ? 289  ARG A N   1 
ATOM   2229 C CA  . ARG A 1 289 ? 4.460   55.494 67.093 1.00 31.40  ? 289  ARG A CA  1 
ATOM   2230 C C   . ARG A 1 289 ? 3.002   55.930 67.077 1.00 31.40  ? 289  ARG A C   1 
ATOM   2231 O O   . ARG A 1 289 ? 2.507   56.497 68.049 1.00 31.40  ? 289  ARG A O   1 
ATOM   2232 C CB  . ARG A 1 289 ? 4.633   54.168 67.845 1.00 27.22  ? 289  ARG A CB  1 
ATOM   2233 C CG  . ARG A 1 289 ? 6.034   53.558 67.743 1.00 27.22  ? 289  ARG A CG  1 
ATOM   2234 C CD  . ARG A 1 289 ? 6.388   53.164 66.307 1.00 27.22  ? 289  ARG A CD  1 
ATOM   2235 N NE  . ARG A 1 289 ? 7.665   52.451 66.198 1.00 27.22  ? 289  ARG A NE  1 
ATOM   2236 C CZ  . ARG A 1 289 ? 8.868   53.024 66.176 1.00 27.22  ? 289  ARG A CZ  1 
ATOM   2237 N NH1 . ARG A 1 289 ? 8.991   54.341 66.257 1.00 27.22  ? 289  ARG A NH1 1 
ATOM   2238 N NH2 . ARG A 1 289 ? 9.953   52.277 66.062 1.00 27.22  ? 289  ARG A NH2 1 
ATOM   2239 N N   . PHE A 1 290 ? 2.322   55.680 65.967 1.00 29.44  ? 290  PHE A N   1 
ATOM   2240 C CA  . PHE A 1 290 ? 0.938   56.095 65.824 1.00 29.44  ? 290  PHE A CA  1 
ATOM   2241 C C   . PHE A 1 290 ? 0.018   54.936 65.484 1.00 29.44  ? 290  PHE A C   1 
ATOM   2242 O O   . PHE A 1 290 ? 0.422   53.962 64.857 1.00 29.44  ? 290  PHE A O   1 
ATOM   2243 C CB  . PHE A 1 290 ? 0.888   57.204 64.781 1.00 33.70  ? 290  PHE A CB  1 
ATOM   2244 C CG  . PHE A 1 290 ? 1.993   58.210 64.952 1.00 33.70  ? 290  PHE A CG  1 
ATOM   2245 C CD1 . PHE A 1 290 ? 2.074   58.978 66.110 1.00 33.70  ? 290  PHE A CD1 1 
ATOM   2246 C CD2 . PHE A 1 290 ? 3.008   58.322 64.004 1.00 33.70  ? 290  PHE A CD2 1 
ATOM   2247 C CE1 . PHE A 1 290 ? 3.142   59.836 66.332 1.00 33.70  ? 290  PHE A CE1 1 
ATOM   2248 C CE2 . PHE A 1 290 ? 4.084   59.180 64.215 1.00 33.70  ? 290  PHE A CE2 1 
ATOM   2249 C CZ  . PHE A 1 290 ? 4.151   59.939 65.387 1.00 33.70  ? 290  PHE A CZ  1 
ATOM   2250 N N   . SER A 1 291 ? -1.228  55.053 65.906 1.00 32.49  ? 291  SER A N   1 
ATOM   2251 C CA  . SER A 1 291 ? -2.210  53.996 65.723 1.00 32.49  ? 291  SER A CA  1 
ATOM   2252 C C   . SER A 1 291 ? -2.598  53.573 64.313 1.00 32.49  ? 291  SER A C   1 
ATOM   2253 O O   . SER A 1 291 ? -2.407  52.417 63.931 1.00 32.49  ? 291  SER A O   1 
ATOM   2254 C CB  . SER A 1 291 ? -3.472  54.350 66.499 1.00 33.65  ? 291  SER A CB  1 
ATOM   2255 O OG  . SER A 1 291 ? -3.177  54.352 67.874 1.00 33.65  ? 291  SER A OG  1 
ATOM   2256 N N   . PHE A 1 292 ? -3.148  54.504 63.550 1.00 29.17  ? 292  PHE A N   1 
ATOM   2257 C CA  . PHE A 1 292 ? -3.599  54.197 62.206 1.00 29.17  ? 292  PHE A CA  1 
ATOM   2258 C C   . PHE A 1 292 ? -2.771  54.884 61.140 1.00 29.17  ? 292  PHE A C   1 
ATOM   2259 O O   . PHE A 1 292 ? -2.877  56.091 60.921 1.00 29.17  ? 292  PHE A O   1 
ATOM   2260 C CB  . PHE A 1 292 ? -5.072  54.563 62.103 1.00 34.25  ? 292  PHE A CB  1 
ATOM   2261 C CG  . PHE A 1 292 ? -5.900  53.886 63.138 1.00 34.25  ? 292  PHE A CG  1 
ATOM   2262 C CD1 . PHE A 1 292 ? -6.175  52.526 63.036 1.00 34.25  ? 292  PHE A CD1 1 
ATOM   2263 C CD2 . PHE A 1 292 ? -6.322  54.573 64.268 1.00 34.25  ? 292  PHE A CD2 1 
ATOM   2264 C CE1 . PHE A 1 292 ? -6.856  51.862 64.054 1.00 34.25  ? 292  PHE A CE1 1 
ATOM   2265 C CE2 . PHE A 1 292 ? -6.998  53.918 65.284 1.00 34.25  ? 292  PHE A CE2 1 
ATOM   2266 C CZ  . PHE A 1 292 ? -7.265  52.564 65.182 1.00 34.25  ? 292  PHE A CZ  1 
ATOM   2267 N N   . VAL A 1 293 ? -1.944  54.081 60.487 1.00 27.63  ? 293  VAL A N   1 
ATOM   2268 C CA  . VAL A 1 293 ? -1.043  54.554 59.465 1.00 27.63  ? 293  VAL A CA  1 
ATOM   2269 C C   . VAL A 1 293 ? -1.173  53.682 58.220 1.00 27.63  ? 293  VAL A C   1 
ATOM   2270 O O   . VAL A 1 293 ? -1.884  52.684 58.232 1.00 27.63  ? 293  VAL A O   1 
ATOM   2271 C CB  . VAL A 1 293 ? 0.424   54.486 59.972 1.00 23.82  ? 293  VAL A CB  1 
ATOM   2272 C CG1 . VAL A 1 293 ? 0.621   55.429 61.148 1.00 23.82  ? 293  VAL A CG1 1 
ATOM   2273 C CG2 . VAL A 1 293 ? 0.771   53.059 60.366 1.00 23.82  ? 293  VAL A CG2 1 
ATOM   2274 N N   . PRO A 1 294 ? -0.492  54.059 57.130 1.00 29.00  ? 294  PRO A N   1 
ATOM   2275 C CA  . PRO A 1 294 ? -0.564  53.268 55.905 1.00 29.00  ? 294  PRO A CA  1 
ATOM   2276 C C   . PRO A 1 294 ? -0.214  51.800 56.151 1.00 29.00  ? 294  PRO A C   1 
ATOM   2277 O O   . PRO A 1 294 ? 0.512   51.471 57.085 1.00 29.00  ? 294  PRO A O   1 
ATOM   2278 C CB  . PRO A 1 294 ? 0.436   53.974 54.993 1.00 27.62  ? 294  PRO A CB  1 
ATOM   2279 C CG  . PRO A 1 294 ? 0.213   55.411 55.352 1.00 27.62  ? 294  PRO A CG  1 
ATOM   2280 C CD  . PRO A 1 294 ? 0.158   55.358 56.873 1.00 27.62  ? 294  PRO A CD  1 
ATOM   2281 N N   . VAL A 1 295 ? -0.744  50.926 55.306 1.00 32.38  ? 295  VAL A N   1 
ATOM   2282 C CA  . VAL A 1 295 ? -0.498  49.497 55.423 1.00 32.38  ? 295  VAL A CA  1 
ATOM   2283 C C   . VAL A 1 295 ? -0.060  48.861 54.106 1.00 32.38  ? 295  VAL A C   1 
ATOM   2284 O O   . VAL A 1 295 ? -0.605  49.163 53.045 1.00 32.38  ? 295  VAL A O   1 
ATOM   2285 C CB  . VAL A 1 295 ? -1.755  48.774 55.942 1.00 37.86  ? 295  VAL A CB  1 
ATOM   2286 C CG1 . VAL A 1 295 ? -2.946  49.147 55.104 1.00 37.86  ? 295  VAL A CG1 1 
ATOM   2287 C CG2 . VAL A 1 295 ? -1.542  47.276 55.906 1.00 37.86  ? 295  VAL A CG2 1 
ATOM   2288 N N   . ILE A 1 296 ? 0.945   47.996 54.191 1.00 37.11  ? 296  ILE A N   1 
ATOM   2289 C CA  . ILE A 1 296 ? 1.488   47.285 53.039 1.00 37.11  ? 296  ILE A CA  1 
ATOM   2290 C C   . ILE A 1 296 ? 0.422   46.260 52.650 1.00 37.11  ? 296  ILE A C   1 
ATOM   2291 O O   . ILE A 1 296 ? 0.412   45.138 53.165 1.00 37.11  ? 296  ILE A O   1 
ATOM   2292 C CB  . ILE A 1 296 ? 2.795   46.561 53.425 1.00 33.53  ? 296  ILE A CB  1 
ATOM   2293 C CG1 . ILE A 1 296 ? 3.736   47.536 54.146 1.00 33.53  ? 296  ILE A CG1 1 
ATOM   2294 C CG2 . ILE A 1 296 ? 3.456   45.984 52.185 1.00 33.53  ? 296  ILE A CG2 1 
ATOM   2295 C CD1 . ILE A 1 296 ? 4.144   48.765 53.320 1.00 33.53  ? 296  ILE A CD1 1 
ATOM   2296 N N   . ASP A 1 297 ? -0.456  46.657 51.727 1.00 50.05  ? 297  ASP A N   1 
ATOM   2297 C CA  . ASP A 1 297 ? -1.593  45.842 51.301 1.00 50.05  ? 297  ASP A CA  1 
ATOM   2298 C C   . ASP A 1 297 ? -1.506  45.035 50.015 1.00 50.05  ? 297  ASP A C   1 
ATOM   2299 O O   . ASP A 1 297 ? -2.376  44.202 49.764 1.00 50.05  ? 297  ASP A O   1 
ATOM   2300 C CB  . ASP A 1 297 ? -2.834  46.738 51.202 1.00 45.28  ? 297  ASP A CB  1 
ATOM   2301 C CG  . ASP A 1 297 ? -2.652  47.867 50.193 1.00 45.28  ? 297  ASP A CG  1 
ATOM   2302 O OD1 . ASP A 1 297 ? -1.544  47.979 49.616 1.00 45.28  ? 297  ASP A OD1 1 
ATOM   2303 O OD2 . ASP A 1 297 ? -3.608  48.646 49.973 1.00 45.28  ? 297  ASP A OD2 1 
ATOM   2304 N N   . GLY A 1 298 ? -0.503  45.275 49.181 1.00 53.55  ? 298  GLY A N   1 
ATOM   2305 C CA  . GLY A 1 298 ? -0.429  44.525 47.934 1.00 53.55  ? 298  GLY A CA  1 
ATOM   2306 C C   . GLY A 1 298 ? -1.164  45.212 46.790 1.00 53.55  ? 298  GLY A C   1 
ATOM   2307 O O   . GLY A 1 298 ? -1.191  44.706 45.662 1.00 53.55  ? 298  GLY A O   1 
ATOM   2308 N N   . GLU A 1 299 ? -1.775  46.363 47.070 1.00 41.58  ? 299  GLU A N   1 
ATOM   2309 C CA  . GLU A 1 299 ? -2.488  47.122 46.045 1.00 41.58  ? 299  GLU A CA  1 
ATOM   2310 C C   . GLU A 1 299 ? -1.791  48.459 45.849 1.00 41.58  ? 299  GLU A C   1 
ATOM   2311 O O   . GLU A 1 299 ? -1.148  48.693 44.828 1.00 41.58  ? 299  GLU A O   1 
ATOM   2312 C CB  . GLU A 1 299 ? -3.939  47.351 46.468 1.00 101.43 ? 299  GLU A CB  1 
ATOM   2313 C CG  . GLU A 1 299 ? -4.820  46.128 46.293 1.00 101.43 ? 299  GLU A CG  1 
ATOM   2314 C CD  . GLU A 1 299 ? -5.950  46.068 47.307 1.00 101.43 ? 299  GLU A CD  1 
ATOM   2315 O OE1 . GLU A 1 299 ? -6.729  47.055 47.398 1.00 101.43 ? 299  GLU A OE1 1 
ATOM   2316 O OE2 . GLU A 1 299 ? -6.057  45.030 48.008 1.00 101.43 ? 299  GLU A OE2 1 
ATOM   2317 N N   . PHE A 1 300 ? -1.929  49.341 46.833 1.00 37.30  ? 300  PHE A N   1 
ATOM   2318 C CA  . PHE A 1 300 ? -1.284  50.635 46.775 1.00 37.30  ? 300  PHE A CA  1 
ATOM   2319 C C   . PHE A 1 300 ? 0.224   50.357 46.695 1.00 37.30  ? 300  PHE A C   1 
ATOM   2320 O O   . PHE A 1 300 ? 0.936   50.942 45.880 1.00 37.30  ? 300  PHE A O   1 
ATOM   2321 C CB  . PHE A 1 300 ? -1.644  51.441 48.024 1.00 36.18  ? 300  PHE A CB  1 
ATOM   2322 C CG  . PHE A 1 300 ? -1.317  52.905 47.916 1.00 36.18  ? 300  PHE A CG  1 
ATOM   2323 C CD1 . PHE A 1 300 ? -0.003  53.353 48.040 1.00 36.18  ? 300  PHE A CD1 1 
ATOM   2324 C CD2 . PHE A 1 300 ? -2.320  53.834 47.658 1.00 36.18  ? 300  PHE A CD2 1 
ATOM   2325 C CE1 . PHE A 1 300 ? 0.300   54.708 47.905 1.00 36.18  ? 300  PHE A CE1 1 
ATOM   2326 C CE2 . PHE A 1 300 ? -2.027  55.179 47.521 1.00 36.18  ? 300  PHE A CE2 1 
ATOM   2327 C CZ  . PHE A 1 300 ? -0.717  55.621 47.644 1.00 36.18  ? 300  PHE A CZ  1 
ATOM   2328 N N   . PHE A 1 301 ? 0.695   49.437 47.530 1.00 41.42  ? 301  PHE A N   1 
ATOM   2329 C CA  . PHE A 1 301 ? 2.101   49.038 47.543 1.00 41.42  ? 301  PHE A CA  1 
ATOM   2330 C C   . PHE A 1 301 ? 2.144   47.597 47.030 1.00 41.42  ? 301  PHE A C   1 
ATOM   2331 O O   . PHE A 1 301 ? 1.723   46.675 47.725 1.00 41.42  ? 301  PHE A O   1 
ATOM   2332 C CB  . PHE A 1 301 ? 2.658   49.101 48.965 1.00 31.84  ? 301  PHE A CB  1 
ATOM   2333 C CG  . PHE A 1 301 ? 2.534   50.462 49.604 1.00 31.84  ? 301  PHE A CG  1 
ATOM   2334 C CD1 . PHE A 1 301 ? 3.342   51.517 49.189 1.00 31.84  ? 301  PHE A CD1 1 
ATOM   2335 C CD2 . PHE A 1 301 ? 1.595   50.692 50.608 1.00 31.84  ? 301  PHE A CD2 1 
ATOM   2336 C CE1 . PHE A 1 301 ? 3.220   52.784 49.764 1.00 31.84  ? 301  PHE A CE1 1 
ATOM   2337 C CE2 . PHE A 1 301 ? 1.463   51.953 51.191 1.00 31.84  ? 301  PHE A CE2 1 
ATOM   2338 C CZ  . PHE A 1 301 ? 2.281   53.006 50.766 1.00 31.84  ? 301  PHE A CZ  1 
ATOM   2339 N N   . PRO A 1 302 ? 2.637   47.387 45.797 1.00 42.28  ? 302  PRO A N   1 
ATOM   2340 C CA  . PRO A 1 302 ? 2.722   46.048 45.202 1.00 42.28  ? 302  PRO A CA  1 
ATOM   2341 C C   . PRO A 1 302 ? 3.327   44.988 46.119 1.00 42.28  ? 302  PRO A C   1 
ATOM   2342 O O   . PRO A 1 302 ? 2.741   43.920 46.297 1.00 42.28  ? 302  PRO A O   1 
ATOM   2343 C CB  . PRO A 1 302 ? 3.555   46.288 43.947 1.00 48.11  ? 302  PRO A CB  1 
ATOM   2344 C CG  . PRO A 1 302 ? 3.126   47.671 43.542 1.00 48.11  ? 302  PRO A CG  1 
ATOM   2345 C CD  . PRO A 1 302 ? 3.151   48.405 44.862 1.00 48.11  ? 302  PRO A CD  1 
ATOM   2346 N N   . THR A 1 303 ? 4.498   45.278 46.688 1.00 35.85  ? 303  THR A N   1 
ATOM   2347 C CA  . THR A 1 303 ? 5.165   44.347 47.597 1.00 35.85  ? 303  THR A CA  1 
ATOM   2348 C C   . THR A 1 303 ? 5.717   45.103 48.802 1.00 35.85  ? 303  THR A C   1 
ATOM   2349 O O   . THR A 1 303 ? 5.274   46.212 49.092 1.00 35.85  ? 303  THR A O   1 
ATOM   2350 C CB  . THR A 1 303 ? 6.317   43.591 46.889 1.00 50.35  ? 303  THR A CB  1 
ATOM   2351 O OG1 . THR A 1 303 ? 7.311   44.522 46.427 1.00 50.35  ? 303  THR A OG1 1 
ATOM   2352 C CG2 . THR A 1 303 ? 5.772   42.813 45.702 1.00 50.35  ? 303  THR A CG2 1 
ATOM   2353 N N   . SER A 1 304 ? 6.674   44.516 49.512 1.00 35.70  ? 304  SER A N   1 
ATOM   2354 C CA  . SER A 1 304 ? 7.243   45.195 50.669 1.00 35.70  ? 304  SER A CA  1 
ATOM   2355 C C   . SER A 1 304 ? 8.017   46.403 50.161 1.00 35.70  ? 304  SER A C   1 
ATOM   2356 O O   . SER A 1 304 ? 8.455   46.423 49.012 1.00 35.70  ? 304  SER A O   1 
ATOM   2357 C CB  . SER A 1 304 ? 8.186   44.271 51.437 1.00 41.68  ? 304  SER A CB  1 
ATOM   2358 O OG  . SER A 1 304 ? 9.400   44.114 50.735 1.00 41.68  ? 304  SER A OG  1 
ATOM   2359 N N   . LEU A 1 305 ? 8.184   47.410 51.005 1.00 36.98  ? 305  LEU A N   1 
ATOM   2360 C CA  . LEU A 1 305 ? 8.896   48.601 50.588 1.00 36.98  ? 305  LEU A CA  1 
ATOM   2361 C C   . LEU A 1 305 ? 10.373  48.331 50.309 1.00 36.98  ? 305  LEU A C   1 
ATOM   2362 O O   . LEU A 1 305 ? 10.941  48.866 49.351 1.00 36.98  ? 305  LEU A O   1 
ATOM   2363 C CB  . LEU A 1 305 ? 8.742   49.696 51.643 1.00 38.21  ? 305  LEU A CB  1 
ATOM   2364 C CG  . LEU A 1 305 ? 7.298   50.137 51.913 1.00 38.21  ? 305  LEU A CG  1 
ATOM   2365 C CD1 . LEU A 1 305 ? 7.285   51.160 53.050 1.00 38.21  ? 305  LEU A CD1 1 
ATOM   2366 C CD2 . LEU A 1 305 ? 6.668   50.714 50.651 1.00 38.21  ? 305  LEU A CD2 1 
ATOM   2367 N N   . GLU A 1 306 ? 10.989  47.484 51.128 1.00 41.15  ? 306  GLU A N   1 
ATOM   2368 C CA  . GLU A 1 306 ? 12.404  47.174 50.960 1.00 41.15  ? 306  GLU A CA  1 
ATOM   2369 C C   . GLU A 1 306 ? 12.697  46.512 49.613 1.00 41.15  ? 306  GLU A C   1 
ATOM   2370 O O   . GLU A 1 306 ? 13.710  46.815 48.971 1.00 41.15  ? 306  GLU A O   1 
ATOM   2371 C CB  . GLU A 1 306 ? 12.893  46.279 52.105 1.00 76.10  ? 306  GLU A CB  1 
ATOM   2372 C CG  . GLU A 1 306 ? 14.421  46.186 52.216 1.00 76.10  ? 306  GLU A CG  1 
ATOM   2373 C CD  . GLU A 1 306 ? 15.116  47.565 52.175 1.00 76.10  ? 306  GLU A CD  1 
ATOM   2374 O OE1 . GLU A 1 306 ? 14.545  48.559 52.715 1.00 76.10  ? 306  GLU A OE1 1 
ATOM   2375 O OE2 . GLU A 1 306 ? 16.240  47.651 51.611 1.00 76.10  ? 306  GLU A OE2 1 
ATOM   2376 N N   . SER A 1 307 ? 11.822  45.612 49.176 1.00 37.93  ? 307  SER A N   1 
ATOM   2377 C CA  . SER A 1 307 ? 12.038  44.961 47.890 1.00 37.93  ? 307  SER A CA  1 
ATOM   2378 C C   . SER A 1 307 ? 11.754  45.941 46.748 1.00 37.93  ? 307  SER A C   1 
ATOM   2379 O O   . SER A 1 307 ? 12.370  45.859 45.688 1.00 37.93  ? 307  SER A O   1 
ATOM   2380 C CB  . SER A 1 307 ? 11.166  43.705 47.760 1.00 47.73  ? 307  SER A CB  1 
ATOM   2381 O OG  . SER A 1 307 ? 9.795   44.010 47.893 1.00 47.73  ? 307  SER A OG  1 
ATOM   2382 N N   . MET A 1 308 ? 10.835  46.878 46.963 1.00 37.27  ? 308  MET A N   1 
ATOM   2383 C CA  . MET A 1 308 ? 10.545  47.863 45.929 1.00 37.27  ? 308  MET A CA  1 
ATOM   2384 C C   . MET A 1 308 ? 11.771  48.769 45.765 1.00 37.27  ? 308  MET A C   1 
ATOM   2385 O O   . MET A 1 308 ? 12.153  49.106 44.648 1.00 37.27  ? 308  MET A O   1 
ATOM   2386 C CB  . MET A 1 308 ? 9.308   48.694 46.297 1.00 43.69  ? 308  MET A CB  1 
ATOM   2387 C CG  . MET A 1 308 ? 8.012   47.907 46.239 1.00 43.69  ? 308  MET A CG  1 
ATOM   2388 S SD  . MET A 1 308 ? 6.513   48.916 46.402 1.00 43.69  ? 308  MET A SD  1 
ATOM   2389 C CE  . MET A 1 308 ? 6.502   49.736 44.758 1.00 43.69  ? 308  MET A CE  1 
ATOM   2390 N N   . LEU A 1 309 ? 12.395  49.140 46.882 1.00 41.68  ? 309  LEU A N   1 
ATOM   2391 C CA  . LEU A 1 309 ? 13.579  49.995 46.849 1.00 41.68  ? 309  LEU A CA  1 
ATOM   2392 C C   . LEU A 1 309 ? 14.808  49.318 46.236 1.00 41.68  ? 309  LEU A C   1 
ATOM   2393 O O   . LEU A 1 309 ? 15.639  49.973 45.599 1.00 41.68  ? 309  LEU A O   1 
ATOM   2394 C CB  . LEU A 1 309 ? 13.932  50.473 48.258 1.00 36.16  ? 309  LEU A CB  1 
ATOM   2395 C CG  . LEU A 1 309 ? 13.013  51.519 48.883 1.00 36.16  ? 309  LEU A CG  1 
ATOM   2396 C CD1 . LEU A 1 309 ? 13.428  51.763 50.324 1.00 36.16  ? 309  LEU A CD1 1 
ATOM   2397 C CD2 . LEU A 1 309 ? 13.076  52.808 48.078 1.00 36.16  ? 309  LEU A CD2 1 
ATOM   2398 N N   . ASN A 1 310 ? 14.932  48.008 46.435 1.00 38.18  ? 310  ASN A N   1 
ATOM   2399 C CA  . ASN A 1 310 ? 16.069  47.263 45.900 1.00 38.18  ? 310  ASN A CA  1 
ATOM   2400 C C   . ASN A 1 310 ? 15.963  46.963 44.423 1.00 38.18  ? 310  ASN A C   1 
ATOM   2401 O O   . ASN A 1 310 ? 16.976  46.893 43.732 1.00 38.18  ? 310  ASN A O   1 
ATOM   2402 C CB  . ASN A 1 310 ? 16.251  45.942 46.652 1.00 70.29  ? 310  ASN A CB  1 
ATOM   2403 C CG  . ASN A 1 310 ? 17.054  46.110 47.923 1.00 70.29  ? 310  ASN A CG  1 
ATOM   2404 O OD1 . ASN A 1 310 ? 18.121  46.742 47.916 1.00 70.29  ? 310  ASN A OD1 1 
ATOM   2405 N ND2 . ASN A 1 310 ? 16.557  45.545 49.023 1.00 70.29  ? 310  ASN A ND2 1 
ATOM   2406 N N   . SER A 1 311 ? 14.739  46.784 43.941 1.00 35.33  ? 311  SER A N   1 
ATOM   2407 C CA  . SER A 1 311 ? 14.505  46.468 42.535 1.00 35.33  ? 311  SER A CA  1 
ATOM   2408 C C   . SER A 1 311 ? 14.273  47.686 41.630 1.00 35.33  ? 311  SER A C   1 
ATOM   2409 O O   . SER A 1 311 ? 14.094  47.534 40.421 1.00 35.33  ? 311  SER A O   1 
ATOM   2410 C CB  . SER A 1 311 ? 13.310  45.515 42.417 1.00 45.03  ? 311  SER A CB  1 
ATOM   2411 O OG  . SER A 1 311 ? 12.148  46.070 43.024 1.00 45.03  ? 311  SER A OG  1 
ATOM   2412 N N   . GLY A 1 312 ? 14.268  48.885 42.207 1.00 32.86  ? 312  GLY A N   1 
ATOM   2413 C CA  . GLY A 1 312 ? 14.058  50.082 41.406 1.00 32.86  ? 312  GLY A CA  1 
ATOM   2414 C C   . GLY A 1 312 ? 12.617  50.221 40.951 1.00 32.86  ? 312  GLY A C   1 
ATOM   2415 O O   . GLY A 1 312 ? 12.309  50.890 39.966 1.00 32.86  ? 312  GLY A O   1 
ATOM   2416 N N   . ASN A 1 313 ? 11.728  49.567 41.678 1.00 34.71  ? 313  ASN A N   1 
ATOM   2417 C CA  . ASN A 1 313 ? 10.311  49.608 41.377 1.00 34.71  ? 313  ASN A CA  1 
ATOM   2418 C C   . ASN A 1 313 ? 9.718   50.907 41.941 1.00 34.71  ? 313  ASN A C   1 
ATOM   2419 O O   . ASN A 1 313 ? 9.052   50.908 42.978 1.00 34.71  ? 313  ASN A O   1 
ATOM   2420 C CB  . ASN A 1 313 ? 9.626   48.386 41.996 1.00 36.38  ? 313  ASN A CB  1 
ATOM   2421 C CG  . ASN A 1 313 ? 8.219   48.204 41.501 1.00 36.38  ? 313  ASN A CG  1 
ATOM   2422 O OD1 . ASN A 1 313 ? 7.745   48.977 40.668 1.00 36.38  ? 313  ASN A OD1 1 
ATOM   2423 N ND2 . ASN A 1 313 ? 7.534   47.184 42.007 1.00 36.38  ? 313  ASN A ND2 1 
ATOM   2424 N N   . PHE A 1 314 ? 9.995   52.015 41.261 1.00 34.04  ? 314  PHE A N   1 
ATOM   2425 C CA  . PHE A 1 314 ? 9.496   53.321 41.675 1.00 34.04  ? 314  PHE A CA  1 
ATOM   2426 C C   . PHE A 1 314 ? 9.746   54.410 40.629 1.00 34.04  ? 314  PHE A C   1 
ATOM   2427 O O   . PHE A 1 314 ? 10.582  54.263 39.737 1.00 34.04  ? 314  PHE A O   1 
ATOM   2428 C CB  . PHE A 1 314 ? 10.098  53.728 43.035 1.00 29.92  ? 314  PHE A CB  1 
ATOM   2429 C CG  . PHE A 1 314 ? 11.606  53.641 43.104 1.00 29.92  ? 314  PHE A CG  1 
ATOM   2430 C CD1 . PHE A 1 314 ? 12.406  54.623 42.536 1.00 29.92  ? 314  PHE A CD1 1 
ATOM   2431 C CD2 . PHE A 1 314 ? 12.223  52.573 43.759 1.00 29.92  ? 314  PHE A CD2 1 
ATOM   2432 C CE1 . PHE A 1 314 ? 13.796  54.545 42.617 1.00 29.92  ? 314  PHE A CE1 1 
ATOM   2433 C CE2 . PHE A 1 314 ? 13.612  52.488 43.844 1.00 29.92  ? 314  PHE A CE2 1 
ATOM   2434 C CZ  . PHE A 1 314 ? 14.398  53.473 43.274 1.00 29.92  ? 314  PHE A CZ  1 
ATOM   2435 N N   . LYS A 1 315 ? 9.000   55.501 40.733 1.00 35.05  ? 315  LYS A N   1 
ATOM   2436 C CA  . LYS A 1 315 ? 9.151   56.598 39.792 1.00 35.05  ? 315  LYS A CA  1 
ATOM   2437 C C   . LYS A 1 315 ? 10.581  57.129 39.821 1.00 35.05  ? 315  LYS A C   1 
ATOM   2438 O O   . LYS A 1 315 ? 11.108  57.447 40.888 1.00 35.05  ? 315  LYS A O   1 
ATOM   2439 C CB  . LYS A 1 315 ? 8.187   57.723 40.147 1.00 29.91  ? 315  LYS A CB  1 
ATOM   2440 C CG  . LYS A 1 315 ? 8.173   58.857 39.156 1.00 29.91  ? 315  LYS A CG  1 
ATOM   2441 C CD  . LYS A 1 315 ? 7.374   60.029 39.699 1.00 29.91  ? 315  LYS A CD  1 
ATOM   2442 C CE  . LYS A 1 315 ? 7.322   61.148 38.702 1.00 29.91  ? 315  LYS A CE  1 
ATOM   2443 N NZ  . LYS A 1 315 ? 6.699   60.678 37.433 1.00 29.91  ? 315  LYS A NZ  1 
ATOM   2444 N N   . LYS A 1 316 ? 11.207  57.202 38.652 1.00 35.02  ? 316  LYS A N   1 
ATOM   2445 C CA  . LYS A 1 316 ? 12.566  57.717 38.539 1.00 35.02  ? 316  LYS A CA  1 
ATOM   2446 C C   . LYS A 1 316 ? 12.482  59.164 38.093 1.00 35.02  ? 316  LYS A C   1 
ATOM   2447 O O   . LYS A 1 316 ? 11.981  59.459 37.010 1.00 35.02  ? 316  LYS A O   1 
ATOM   2448 C CB  . LYS A 1 316 ? 13.378  56.928 37.515 1.00 48.46  ? 316  LYS A CB  1 
ATOM   2449 C CG  . LYS A 1 316 ? 13.939  55.630 38.033 1.00 48.46  ? 316  LYS A CG  1 
ATOM   2450 C CD  . LYS A 1 316 ? 12.994  54.484 37.792 1.00 48.46  ? 316  LYS A CD  1 
ATOM   2451 C CE  . LYS A 1 316 ? 13.669  53.165 38.130 1.00 48.46  ? 316  LYS A CE  1 
ATOM   2452 N NZ  . LYS A 1 316 ? 12.904  52.018 37.573 1.00 48.46  ? 316  LYS A NZ  1 
ATOM   2453 N N   . THR A 1 317 ? 12.966  60.068 38.930 1.00 32.67  ? 317  THR A N   1 
ATOM   2454 C CA  . THR A 1 317 ? 12.919  61.484 38.618 1.00 32.67  ? 317  THR A CA  1 
ATOM   2455 C C   . THR A 1 317 ? 13.942  62.167 39.519 1.00 32.67  ? 317  THR A C   1 
ATOM   2456 O O   . THR A 1 317 ? 14.879  61.518 39.979 1.00 32.67  ? 317  THR A O   1 
ATOM   2457 C CB  . THR A 1 317 ? 11.478  62.026 38.855 1.00 35.01  ? 317  THR A CB  1 
ATOM   2458 O OG1 . THR A 1 317 ? 11.435  63.434 38.600 1.00 35.01  ? 317  THR A OG1 1 
ATOM   2459 C CG2 . THR A 1 317 ? 11.022  61.729 40.280 1.00 35.01  ? 317  THR A CG2 1 
ATOM   2460 N N   . GLN A 1 318 ? 13.793  63.462 39.758 1.00 29.36  ? 318  GLN A N   1 
ATOM   2461 C CA  . GLN A 1 318 ? 14.724  64.157 40.634 1.00 29.36  ? 318  GLN A CA  1 
ATOM   2462 C C   . GLN A 1 318 ? 14.047  64.336 41.988 1.00 29.36  ? 318  GLN A C   1 
ATOM   2463 O O   . GLN A 1 318 ? 12.832  64.468 42.055 1.00 29.36  ? 318  GLN A O   1 
ATOM   2464 C CB  . GLN A 1 318 ? 15.091  65.543 40.077 1.00 34.56  ? 318  GLN A CB  1 
ATOM   2465 C CG  . GLN A 1 318 ? 15.706  65.572 38.680 1.00 34.56  ? 318  GLN A CG  1 
ATOM   2466 C CD  . GLN A 1 318 ? 14.652  65.534 37.587 1.00 34.56  ? 318  GLN A CD  1 
ATOM   2467 O OE1 . GLN A 1 318 ? 13.602  66.165 37.710 1.00 34.56  ? 318  GLN A OE1 1 
ATOM   2468 N NE2 . GLN A 1 318 ? 14.930  64.800 36.506 1.00 34.56  ? 318  GLN A NE2 1 
ATOM   2469 N N   . ILE A 1 319 ? 14.820  64.314 43.065 1.00 30.00  ? 319  ILE A N   1 
ATOM   2470 C CA  . ILE A 1 319 ? 14.252  64.534 44.383 1.00 30.00  ? 319  ILE A CA  1 
ATOM   2471 C C   . ILE A 1 319 ? 15.183  65.399 45.212 1.00 30.00  ? 319  ILE A C   1 
ATOM   2472 O O   . ILE A 1 319 ? 16.403  65.386 45.031 1.00 30.00  ? 319  ILE A O   1 
ATOM   2473 C CB  . ILE A 1 319 ? 13.979  63.222 45.169 1.00 33.61  ? 319  ILE A CB  1 
ATOM   2474 C CG1 . ILE A 1 319 ? 15.238  62.369 45.239 1.00 33.61  ? 319  ILE A CG1 1 
ATOM   2475 C CG2 . ILE A 1 319 ? 12.825  62.464 44.547 1.00 33.61  ? 319  ILE A CG2 1 
ATOM   2476 C CD1 . ILE A 1 319 ? 15.093  61.179 46.157 1.00 33.61  ? 319  ILE A CD1 1 
ATOM   2477 N N   . LEU A 1 320 ? 14.584  66.171 46.105 1.00 32.63  ? 320  LEU A N   1 
ATOM   2478 C CA  . LEU A 1 320 ? 15.313  67.049 46.998 1.00 32.63  ? 320  LEU A CA  1 
ATOM   2479 C C   . LEU A 1 320 ? 14.776  66.706 48.386 1.00 32.63  ? 320  LEU A C   1 
ATOM   2480 O O   . LEU A 1 320 ? 13.563  66.712 48.599 1.00 32.63  ? 320  LEU A O   1 
ATOM   2481 C CB  . LEU A 1 320 ? 15.028  68.512 46.642 1.00 30.00  ? 320  LEU A CB  1 
ATOM   2482 C CG  . LEU A 1 320 ? 15.842  69.571 47.381 1.00 30.00  ? 320  LEU A CG  1 
ATOM   2483 C CD1 . LEU A 1 320 ? 15.902  70.836 46.543 1.00 30.00  ? 320  LEU A CD1 1 
ATOM   2484 C CD2 . LEU A 1 320 ? 15.232  69.840 48.741 1.00 30.00  ? 320  LEU A CD2 1 
ATOM   2485 N N   . LEU A 1 321 ? 15.668  66.383 49.318 1.00 29.55  ? 321  LEU A N   1 
ATOM   2486 C CA  . LEU A 1 321 ? 15.233  66.010 50.653 1.00 29.55  ? 321  LEU A CA  1 
ATOM   2487 C C   . LEU A 1 321 ? 16.282  66.244 51.737 1.00 29.55  ? 321  LEU A C   1 
ATOM   2488 O O   . LEU A 1 321 ? 17.461  66.478 51.451 1.00 29.55  ? 321  LEU A O   1 
ATOM   2489 C CB  . LEU A 1 321 ? 14.778  64.540 50.661 1.00 34.37  ? 321  LEU A CB  1 
ATOM   2490 C CG  . LEU A 1 321 ? 15.791  63.410 50.441 1.00 34.37  ? 321  LEU A CG  1 
ATOM   2491 C CD1 . LEU A 1 321 ? 15.069  62.067 50.416 1.00 34.37  ? 321  LEU A CD1 1 
ATOM   2492 C CD2 . LEU A 1 321 ? 16.522  63.622 49.137 1.00 34.37  ? 321  LEU A CD2 1 
ATOM   2493 N N   . GLY A 1 322 ? 15.833  66.187 52.988 1.00 28.68  ? 322  GLY A N   1 
ATOM   2494 C CA  . GLY A 1 322 ? 16.727  66.403 54.106 1.00 28.68  ? 322  GLY A CA  1 
ATOM   2495 C C   . GLY A 1 322 ? 16.043  66.280 55.452 1.00 28.68  ? 322  GLY A C   1 
ATOM   2496 O O   . GLY A 1 322 ? 14.860  65.935 55.537 1.00 28.68  ? 322  GLY A O   1 
ATOM   2497 N N   . VAL A 1 323 ? 16.788  66.575 56.508 1.00 29.30  ? 323  VAL A N   1 
ATOM   2498 C CA  . VAL A 1 323 ? 16.269  66.472 57.858 1.00 29.30  ? 323  VAL A CA  1 
ATOM   2499 C C   . VAL A 1 323 ? 16.691  67.651 58.731 1.00 29.30  ? 323  VAL A C   1 
ATOM   2500 O O   . VAL A 1 323 ? 17.514  68.474 58.335 1.00 29.30  ? 323  VAL A O   1 
ATOM   2501 C CB  . VAL A 1 323 ? 16.777  65.168 58.534 1.00 29.70  ? 323  VAL A CB  1 
ATOM   2502 C CG1 . VAL A 1 323 ? 16.324  63.948 57.742 1.00 29.70  ? 323  VAL A CG1 1 
ATOM   2503 C CG2 . VAL A 1 323 ? 18.288  65.188 58.633 1.00 29.70  ? 323  VAL A CG2 1 
ATOM   2504 N N   . ASN A 1 324 ? 16.110  67.718 59.923 1.00 33.71  ? 324  ASN A N   1 
ATOM   2505 C CA  . ASN A 1 324 ? 16.440  68.748 60.901 1.00 33.71  ? 324  ASN A CA  1 
ATOM   2506 C C   . ASN A 1 324 ? 17.413  68.144 61.914 1.00 33.71  ? 324  ASN A C   1 
ATOM   2507 O O   . ASN A 1 324 ? 17.398  66.937 62.160 1.00 33.71  ? 324  ASN A O   1 
ATOM   2508 C CB  . ASN A 1 324 ? 15.183  69.232 61.620 1.00 36.88  ? 324  ASN A CB  1 
ATOM   2509 C CG  . ASN A 1 324 ? 14.277  70.022 60.717 1.00 36.88  ? 324  ASN A CG  1 
ATOM   2510 O OD1 . ASN A 1 324 ? 14.576  70.225 59.538 1.00 36.88  ? 324  ASN A OD1 1 
ATOM   2511 N ND2 . ASN A 1 324 ? 13.159  70.483 61.262 1.00 36.88  ? 324  ASN A ND2 1 
ATOM   2512 N N   . LYS A 1 325 ? 18.250  68.986 62.504 1.00 32.99  ? 325  LYS A N   1 
ATOM   2513 C CA  . LYS A 1 325 ? 19.237  68.531 63.470 1.00 32.99  ? 325  LYS A CA  1 
ATOM   2514 C C   . LYS A 1 325 ? 18.683  67.773 64.675 1.00 32.99  ? 325  LYS A C   1 
ATOM   2515 O O   . LYS A 1 325 ? 19.274  66.786 65.097 1.00 32.99  ? 325  LYS A O   1 
ATOM   2516 C CB  . LYS A 1 325 ? 20.068  69.723 63.967 1.00 43.20  ? 325  LYS A CB  1 
ATOM   2517 C CG  . LYS A 1 325 ? 21.236  69.349 64.868 1.00 43.20  ? 325  LYS A CG  1 
ATOM   2518 C CD  . LYS A 1 325 ? 22.002  70.593 65.297 1.00 43.20  ? 325  LYS A CD  1 
ATOM   2519 C CE  . LYS A 1 325 ? 23.285  70.247 66.032 1.00 43.20  ? 325  LYS A CE  1 
ATOM   2520 N NZ  . LYS A 1 325 ? 23.030  69.422 67.244 1.00 43.20  ? 325  LYS A NZ  1 
ATOM   2521 N N   . ASP A 1 326 ? 17.555  68.218 65.222 1.00 36.35  ? 326  ASP A N   1 
ATOM   2522 C CA  . ASP A 1 326 ? 16.997  67.569 66.410 1.00 36.35  ? 326  ASP A CA  1 
ATOM   2523 C C   . ASP A 1 326 ? 15.562  67.046 66.278 1.00 36.35  ? 326  ASP A C   1 
ATOM   2524 O O   . ASP A 1 326 ? 14.670  67.418 67.041 1.00 36.35  ? 326  ASP A O   1 
ATOM   2525 C CB  . ASP A 1 326 ? 17.090  68.534 67.594 1.00 38.42  ? 326  ASP A CB  1 
ATOM   2526 C CG  . ASP A 1 326 ? 18.511  69.066 67.809 1.00 38.42  ? 326  ASP A CG  1 
ATOM   2527 O OD1 . ASP A 1 326 ? 19.403  68.272 68.190 1.00 38.42  ? 326  ASP A OD1 1 
ATOM   2528 O OD2 . ASP A 1 326 ? 18.737  70.281 67.585 1.00 38.42  ? 326  ASP A OD2 1 
ATOM   2529 N N   . GLU A 1 327 ? 15.354  66.155 65.322 1.00 41.68  ? 327  GLU A N   1 
ATOM   2530 C CA  . GLU A 1 327 ? 14.044  65.573 65.069 1.00 41.68  ? 327  GLU A CA  1 
ATOM   2531 C C   . GLU A 1 327 ? 13.354  64.912 66.270 1.00 41.68  ? 327  GLU A C   1 
ATOM   2532 O O   . GLU A 1 327 ? 12.130  64.880 66.329 1.00 41.68  ? 327  GLU A O   1 
ATOM   2533 C CB  . GLU A 1 327 ? 14.158  64.536 63.944 1.00 51.41  ? 327  GLU A CB  1 
ATOM   2534 C CG  . GLU A 1 327 ? 14.819  65.046 62.667 1.00 51.41  ? 327  GLU A CG  1 
ATOM   2535 C CD  . GLU A 1 327 ? 13.863  65.805 61.760 1.00 51.41  ? 327  GLU A CD  1 
ATOM   2536 O OE1 . GLU A 1 327 ? 12.712  66.077 62.177 1.00 51.41  ? 327  GLU A OE1 1 
ATOM   2537 O OE2 . GLU A 1 327 ? 14.266  66.129 60.620 1.00 51.41  ? 327  GLU A OE2 1 
ATOM   2538 N N   . GLY A 1 328 ? 14.111  64.395 67.231 1.00 34.94  ? 328  GLY A N   1 
ATOM   2539 C CA  . GLY A 1 328 ? 13.471  63.708 68.344 1.00 34.94  ? 328  GLY A CA  1 
ATOM   2540 C C   . GLY A 1 328 ? 12.997  64.435 69.597 1.00 34.94  ? 328  GLY A C   1 
ATOM   2541 O O   . GLY A 1 328 ? 12.116  63.940 70.306 1.00 34.94  ? 328  GLY A O   1 
ATOM   2542 N N   . SER A 1 329 ? 13.556  65.603 69.883 1.00 35.65  ? 329  SER A N   1 
ATOM   2543 C CA  . SER A 1 329 ? 13.192  66.320 71.096 1.00 35.65  ? 329  SER A CA  1 
ATOM   2544 C C   . SER A 1 329 ? 11.694  66.512 71.345 1.00 35.65  ? 329  SER A C   1 
ATOM   2545 O O   . SER A 1 329 ? 11.250  66.529 72.491 1.00 35.65  ? 329  SER A O   1 
ATOM   2546 C CB  . SER A 1 329 ? 13.906  67.668 71.128 1.00 32.35  ? 329  SER A CB  1 
ATOM   2547 O OG  . SER A 1 329 ? 13.451  68.492 70.085 1.00 32.35  ? 329  SER A OG  1 
ATOM   2548 N N   . PHE A 1 330 ? 10.906  66.641 70.289 1.00 37.55  ? 330  PHE A N   1 
ATOM   2549 C CA  . PHE A 1 330 ? 9.469   66.846 70.454 1.00 37.55  ? 330  PHE A CA  1 
ATOM   2550 C C   . PHE A 1 330 ? 8.753   65.645 71.074 1.00 37.55  ? 330  PHE A C   1 
ATOM   2551 O O   . PHE A 1 330 ? 7.878   65.800 71.920 1.00 37.55  ? 330  PHE A O   1 
ATOM   2552 C CB  . PHE A 1 330 ? 8.838   67.158 69.102 1.00 57.02  ? 330  PHE A CB  1 
ATOM   2553 C CG  . PHE A 1 330 ? 7.718   68.135 69.176 1.00 57.02  ? 330  PHE A CG  1 
ATOM   2554 C CD1 . PHE A 1 330 ? 6.527   67.802 69.806 1.00 57.02  ? 330  PHE A CD1 1 
ATOM   2555 C CD2 . PHE A 1 330 ? 7.862   69.413 68.644 1.00 57.02  ? 330  PHE A CD2 1 
ATOM   2556 C CE1 . PHE A 1 330 ? 5.490   68.731 69.910 1.00 57.02  ? 330  PHE A CE1 1 
ATOM   2557 C CE2 . PHE A 1 330 ? 6.833   70.353 68.742 1.00 57.02  ? 330  PHE A CE2 1 
ATOM   2558 C CZ  . PHE A 1 330 ? 5.648   70.010 69.376 1.00 57.02  ? 330  PHE A CZ  1 
ATOM   2559 N N   . PHE A 1 331 ? 9.131   64.443 70.655 1.00 36.22  ? 331  PHE A N   1 
ATOM   2560 C CA  . PHE A 1 331 ? 8.497   63.235 71.153 1.00 36.22  ? 331  PHE A CA  1 
ATOM   2561 C C   . PHE A 1 331 ? 8.965   62.824 72.533 1.00 36.22  ? 331  PHE A C   1 
ATOM   2562 O O   . PHE A 1 331 ? 8.288   62.058 73.210 1.00 36.22  ? 331  PHE A O   1 
ATOM   2563 C CB  . PHE A 1 331 ? 8.703   62.102 70.150 1.00 35.16  ? 331  PHE A CB  1 
ATOM   2564 C CG  . PHE A 1 331 ? 8.276   62.466 68.765 1.00 35.16  ? 331  PHE A CG  1 
ATOM   2565 C CD1 . PHE A 1 331 ? 9.051   63.329 67.993 1.00 35.16  ? 331  PHE A CD1 1 
ATOM   2566 C CD2 . PHE A 1 331 ? 7.063   62.025 68.261 1.00 35.16  ? 331  PHE A CD2 1 
ATOM   2567 C CE1 . PHE A 1 331 ? 8.619   63.750 66.741 1.00 35.16  ? 331  PHE A CE1 1 
ATOM   2568 C CE2 . PHE A 1 331 ? 6.625   62.441 67.011 1.00 35.16  ? 331  PHE A CE2 1 
ATOM   2569 C CZ  . PHE A 1 331 ? 7.405   63.307 66.249 1.00 35.16  ? 331  PHE A CZ  1 
ATOM   2570 N N   . LEU A 1 332 ? 10.120  63.328 72.950 1.00 30.85  ? 332  LEU A N   1 
ATOM   2571 C CA  . LEU A 1 332 ? 10.629  63.016 74.273 1.00 30.85  ? 332  LEU A CA  1 
ATOM   2572 C C   . LEU A 1 332 ? 9.925   63.936 75.272 1.00 30.85  ? 332  LEU A C   1 
ATOM   2573 O O   . LEU A 1 332 ? 9.575   63.523 76.374 1.00 30.85  ? 332  LEU A O   1 
ATOM   2574 C CB  . LEU A 1 332 ? 12.146  63.228 74.324 1.00 31.04  ? 332  LEU A CB  1 
ATOM   2575 C CG  . LEU A 1 332 ? 12.980  62.162 73.619 1.00 31.04  ? 332  LEU A CG  1 
ATOM   2576 C CD1 . LEU A 1 332 ? 14.331  62.721 73.237 1.00 31.04  ? 332  LEU A CD1 1 
ATOM   2577 C CD2 . LEU A 1 332 ? 13.129  60.974 74.536 1.00 31.04  ? 332  LEU A CD2 1 
ATOM   2578 N N   . LEU A 1 333 ? 9.713   65.184 74.870 1.00 36.72  ? 333  LEU A N   1 
ATOM   2579 C CA  . LEU A 1 333 ? 9.046   66.156 75.724 1.00 36.72  ? 333  LEU A CA  1 
ATOM   2580 C C   . LEU A 1 333 ? 7.657   65.672 76.121 1.00 36.72  ? 333  LEU A C   1 
ATOM   2581 O O   . LEU A 1 333 ? 7.274   65.739 77.284 1.00 36.72  ? 333  LEU A O   1 
ATOM   2582 C CB  . LEU A 1 333 ? 8.914   67.508 75.005 1.00 34.15  ? 333  LEU A CB  1 
ATOM   2583 C CG  . LEU A 1 333 ? 8.044   68.534 75.741 1.00 34.15  ? 333  LEU A CG  1 
ATOM   2584 C CD1 . LEU A 1 333 ? 8.649   68.833 77.115 1.00 34.15  ? 333  LEU A CD1 1 
ATOM   2585 C CD2 . LEU A 1 333 ? 7.926   69.813 74.909 1.00 34.15  ? 333  LEU A CD2 1 
ATOM   2586 N N   . TYR A 1 334 ? 6.905   65.184 75.142 1.00 45.45  ? 334  TYR A N   1 
ATOM   2587 C CA  . TYR A 1 334 ? 5.556   64.718 75.399 1.00 45.45  ? 334  TYR A CA  1 
ATOM   2588 C C   . TYR A 1 334 ? 5.453   63.349 76.035 1.00 45.45  ? 334  TYR A C   1 
ATOM   2589 O O   . TYR A 1 334 ? 4.530   63.114 76.816 1.00 45.45  ? 334  TYR A O   1 
ATOM   2590 C CB  . TYR A 1 334 ? 4.728   64.710 74.107 1.00 34.74  ? 334  TYR A CB  1 
ATOM   2591 C CG  . TYR A 1 334 ? 4.197   66.065 73.693 1.00 34.74  ? 334  TYR A CG  1 
ATOM   2592 C CD1 . TYR A 1 334 ? 5.064   67.127 73.456 1.00 34.74  ? 334  TYR A CD1 1 
ATOM   2593 C CD2 . TYR A 1 334 ? 2.826   66.282 73.526 1.00 34.74  ? 334  TYR A CD2 1 
ATOM   2594 C CE1 . TYR A 1 334 ? 4.584   68.373 73.062 1.00 34.74  ? 334  TYR A CE1 1 
ATOM   2595 C CE2 . TYR A 1 334 ? 2.335   67.532 73.128 1.00 34.74  ? 334  TYR A CE2 1 
ATOM   2596 C CZ  . TYR A 1 334 ? 3.223   68.571 72.897 1.00 34.74  ? 334  TYR A CZ  1 
ATOM   2597 O OH  . TYR A 1 334 ? 2.779   69.805 72.479 1.00 34.74  ? 334  TYR A OH  1 
ATOM   2598 N N   . GLY A 1 335 ? 6.386   62.444 75.749 1.00 41.97  ? 335  GLY A N   1 
ATOM   2599 C CA  . GLY A 1 335 ? 6.230   61.115 76.309 1.00 41.97  ? 335  GLY A CA  1 
ATOM   2600 C C   . GLY A 1 335 ? 7.327   60.379 77.053 1.00 41.97  ? 335  GLY A C   1 
ATOM   2601 O O   . GLY A 1 335 ? 7.117   59.224 77.429 1.00 41.97  ? 335  GLY A O   1 
ATOM   2602 N N   . ALA A 1 336 ? 8.479   61.000 77.279 1.00 38.06  ? 336  ALA A N   1 
ATOM   2603 C CA  . ALA A 1 336 ? 9.551   60.313 77.991 1.00 38.06  ? 336  ALA A CA  1 
ATOM   2604 C C   . ALA A 1 336 ? 9.784   60.889 79.387 1.00 38.06  ? 336  ALA A C   1 
ATOM   2605 O O   . ALA A 1 336 ? 9.912   62.096 79.562 1.00 38.06  ? 336  ALA A O   1 
ATOM   2606 C CB  . ALA A 1 336 ? 10.831  60.376 77.189 1.00 28.57  ? 336  ALA A CB  1 
ATOM   2607 N N   . PRO A 1 337 ? 9.863   60.023 80.401 1.00 42.80  ? 337  PRO A N   1 
ATOM   2608 C CA  . PRO A 1 337 ? 10.088  60.494 81.770 1.00 42.80  ? 337  PRO A CA  1 
ATOM   2609 C C   . PRO A 1 337 ? 11.378  61.311 81.895 1.00 42.80  ? 337  PRO A C   1 
ATOM   2610 O O   . PRO A 1 337 ? 12.408  60.973 81.295 1.00 42.80  ? 337  PRO A O   1 
ATOM   2611 C CB  . PRO A 1 337 ? 10.152  59.196 82.565 1.00 48.48  ? 337  PRO A CB  1 
ATOM   2612 C CG  . PRO A 1 337 ? 10.813  58.251 81.567 1.00 48.48  ? 337  PRO A CG  1 
ATOM   2613 C CD  . PRO A 1 337 ? 10.032  58.561 80.312 1.00 48.48  ? 337  PRO A CD  1 
ATOM   2614 N N   . GLY A 1 338 ? 11.312  62.395 82.664 1.00 39.62  ? 338  GLY A N   1 
ATOM   2615 C CA  . GLY A 1 338 ? 12.484  63.232 82.866 1.00 39.62  ? 338  GLY A CA  1 
ATOM   2616 C C   . GLY A 1 338 ? 12.501  64.530 82.083 1.00 39.62  ? 338  GLY A C   1 
ATOM   2617 O O   . GLY A 1 338 ? 13.177  65.476 82.478 1.00 39.62  ? 338  GLY A O   1 
ATOM   2618 N N   . PHE A 1 339 ? 11.760  64.588 80.982 1.00 39.88  ? 339  PHE A N   1 
ATOM   2619 C CA  . PHE A 1 339 ? 11.733  65.791 80.156 1.00 39.88  ? 339  PHE A CA  1 
ATOM   2620 C C   . PHE A 1 339 ? 10.600  66.733 80.513 1.00 39.88  ? 339  PHE A C   1 
ATOM   2621 O O   . PHE A 1 339 ? 9.485   66.300 80.787 1.00 39.88  ? 339  PHE A O   1 
ATOM   2622 C CB  . PHE A 1 339 ? 11.639  65.422 78.673 1.00 28.13  ? 339  PHE A CB  1 
ATOM   2623 C CG  . PHE A 1 339 ? 12.819  64.644 78.166 1.00 28.13  ? 339  PHE A CG  1 
ATOM   2624 C CD1 . PHE A 1 339 ? 12.957  63.291 78.458 1.00 28.13  ? 339  PHE A CD1 1 
ATOM   2625 C CD2 . PHE A 1 339 ? 13.787  65.263 77.377 1.00 28.13  ? 339  PHE A CD2 1 
ATOM   2626 C CE1 . PHE A 1 339 ? 14.039  62.563 77.968 1.00 28.13  ? 339  PHE A CE1 1 
ATOM   2627 C CE2 . PHE A 1 339 ? 14.877  64.542 76.881 1.00 28.13  ? 339  PHE A CE2 1 
ATOM   2628 C CZ  . PHE A 1 339 ? 14.999  63.190 77.178 1.00 28.13  ? 339  PHE A CZ  1 
ATOM   2629 N N   . SER A 1 340 ? 10.889  68.027 80.507 1.00 38.04  ? 340  SER A N   1 
ATOM   2630 C CA  . SER A 1 340 ? 9.885   69.034 80.834 1.00 38.04  ? 340  SER A CA  1 
ATOM   2631 C C   . SER A 1 340 ? 10.106  70.266 79.978 1.00 38.04  ? 340  SER A C   1 
ATOM   2632 O O   . SER A 1 340 ? 11.239  70.576 79.614 1.00 38.04  ? 340  SER A O   1 
ATOM   2633 C CB  . SER A 1 340 ? 9.970   69.413 82.315 1.00 47.79  ? 340  SER A CB  1 
ATOM   2634 O OG  . SER A 1 340 ? 9.685   68.288 83.126 1.00 47.79  ? 340  SER A OG  1 
ATOM   2635 N N   . LYS A 1 341 ? 9.020   70.969 79.672 1.00 36.59  ? 341  LYS A N   1 
ATOM   2636 C CA  . LYS A 1 341 ? 9.103   72.150 78.835 1.00 36.59  ? 341  LYS A CA  1 
ATOM   2637 C C   . LYS A 1 341 ? 9.792   73.312 79.516 1.00 36.59  ? 341  LYS A C   1 
ATOM   2638 O O   . LYS A 1 341 ? 10.448  74.114 78.855 1.00 36.59  ? 341  LYS A O   1 
ATOM   2639 C CB  . LYS A 1 341 ? 7.711   72.603 78.387 1.00 42.51  ? 341  LYS A CB  1 
ATOM   2640 C CG  . LYS A 1 341 ? 7.759   73.761 77.389 1.00 42.51  ? 341  LYS A CG  1 
ATOM   2641 C CD  . LYS A 1 341 ? 6.378   74.186 76.889 1.00 42.51  ? 341  LYS A CD  1 
ATOM   2642 C CE  . LYS A 1 341 ? 5.632   74.981 77.947 1.00 42.51  ? 341  LYS A CE  1 
ATOM   2643 N NZ  . LYS A 1 341 ? 6.378   76.217 78.340 1.00 42.51  ? 341  LYS A NZ  1 
ATOM   2644 N N   . ASP A 1 342 ? 9.650   73.405 80.833 1.00 37.56  ? 342  ASP A N   1 
ATOM   2645 C CA  . ASP A 1 342 ? 10.240  74.514 81.567 1.00 37.56  ? 342  ASP A CA  1 
ATOM   2646 C C   . ASP A 1 342 ? 11.542  74.253 82.328 1.00 37.56  ? 342  ASP A C   1 
ATOM   2647 O O   . ASP A 1 342 ? 11.907  75.042 83.191 1.00 37.56  ? 342  ASP A O   1 
ATOM   2648 C CB  . ASP A 1 342 ? 9.214   75.107 82.541 1.00 49.33  ? 342  ASP A CB  1 
ATOM   2649 C CG  . ASP A 1 342 ? 7.940   75.589 81.851 1.00 49.33  ? 342  ASP A CG  1 
ATOM   2650 O OD1 . ASP A 1 342 ? 7.959   75.866 80.628 1.00 49.33  ? 342  ASP A OD1 1 
ATOM   2651 O OD2 . ASP A 1 342 ? 6.909   75.708 82.552 1.00 49.33  ? 342  ASP A OD2 1 
ATOM   2652 N N   . SER A 1 343 ? 12.238  73.161 82.035 1.00 41.94  ? 343  SER A N   1 
ATOM   2653 C CA  . SER A 1 343 ? 13.507  72.888 82.708 1.00 41.94  ? 343  SER A CA  1 
ATOM   2654 C C   . SER A 1 343 ? 14.522  72.402 81.682 1.00 41.94  ? 343  SER A C   1 
ATOM   2655 O O   . SER A 1 343 ? 14.159  72.092 80.546 1.00 41.94  ? 343  SER A O   1 
ATOM   2656 C CB  . SER A 1 343 ? 13.338  71.831 83.797 1.00 50.05  ? 343  SER A CB  1 
ATOM   2657 O OG  . SER A 1 343 ? 13.516  70.526 83.280 1.00 50.05  ? 343  SER A OG  1 
ATOM   2658 N N   . GLU A 1 344 ? 15.790  72.341 82.080 1.00 40.33  ? 344  GLU A N   1 
ATOM   2659 C CA  . GLU A 1 344 ? 16.858  71.903 81.185 1.00 40.33  ? 344  GLU A CA  1 
ATOM   2660 C C   . GLU A 1 344 ? 16.771  70.424 80.837 1.00 40.33  ? 344  GLU A C   1 
ATOM   2661 O O   . GLU A 1 344 ? 17.497  69.937 79.961 1.00 40.33  ? 344  GLU A O   1 
ATOM   2662 C CB  . GLU A 1 344 ? 18.220  72.154 81.823 1.00 78.78  ? 344  GLU A CB  1 
ATOM   2663 C CG  . GLU A 1 344 ? 18.701  73.581 81.788 1.00 78.78  ? 344  GLU A CG  1 
ATOM   2664 C CD  . GLU A 1 344 ? 20.077  73.697 82.419 1.00 78.78  ? 344  GLU A CD  1 
ATOM   2665 O OE1 . GLU A 1 344 ? 20.203  73.397 83.638 1.00 78.78  ? 344  GLU A OE1 1 
ATOM   2666 O OE2 . GLU A 1 344 ? 21.030  74.070 81.691 1.00 78.78  ? 344  GLU A OE2 1 
ATOM   2667 N N   . SER A 1 345 ? 15.919  69.710 81.562 1.00 39.22  ? 345  SER A N   1 
ATOM   2668 C CA  . SER A 1 345 ? 15.711  68.285 81.350 1.00 39.22  ? 345  SER A CA  1 
ATOM   2669 C C   . SER A 1 345 ? 16.988  67.440 81.353 1.00 39.22  ? 345  SER A C   1 
ATOM   2670 O O   . SER A 1 345 ? 17.230  66.649 80.435 1.00 39.22  ? 345  SER A O   1 
ATOM   2671 C CB  . SER A 1 345 ? 14.954  68.058 80.038 1.00 33.01  ? 345  SER A CB  1 
ATOM   2672 O OG  . SER A 1 345 ? 13.705  68.721 80.047 1.00 33.01  ? 345  SER A OG  1 
ATOM   2673 N N   . LYS A 1 346 ? 17.816  67.598 82.373 1.00 39.90  ? 346  LYS A N   1 
ATOM   2674 C CA  . LYS A 1 346 ? 19.014  66.781 82.442 1.00 39.90  ? 346  LYS A CA  1 
ATOM   2675 C C   . LYS A 1 346 ? 18.499  65.395 82.818 1.00 39.90  ? 346  LYS A C   1 
ATOM   2676 O O   . LYS A 1 346 ? 17.717  65.252 83.751 1.00 39.90  ? 346  LYS A O   1 
ATOM   2677 C CB  . LYS A 1 346 ? 19.957  67.329 83.501 1.00 66.47  ? 346  LYS A CB  1 
ATOM   2678 C CG  . LYS A 1 346 ? 20.479  68.724 83.175 1.00 66.47  ? 346  LYS A CG  1 
ATOM   2679 C CD  . LYS A 1 346 ? 21.345  69.233 84.311 1.00 66.47  ? 346  LYS A CD  1 
ATOM   2680 C CE  . LYS A 1 346 ? 22.110  70.492 83.923 1.00 66.47  ? 346  LYS A CE  1 
ATOM   2681 N NZ  . LYS A 1 346 ? 23.074  70.840 85.019 1.00 66.47  ? 346  LYS A NZ  1 
ATOM   2682 N N   . ILE A 1 347 ? 18.924  64.376 82.084 1.00 45.16  ? 347  ILE A N   1 
ATOM   2683 C CA  . ILE A 1 347 ? 18.439  63.020 82.321 1.00 45.16  ? 347  ILE A CA  1 
ATOM   2684 C C   . ILE A 1 347 ? 19.433  62.111 83.055 1.00 45.16  ? 347  ILE A C   1 
ATOM   2685 O O   . ILE A 1 347 ? 20.629  62.083 82.746 1.00 45.16  ? 347  ILE A O   1 
ATOM   2686 C CB  . ILE A 1 347 ? 18.027  62.369 80.962 1.00 40.73  ? 347  ILE A CB  1 
ATOM   2687 C CG1 . ILE A 1 347 ? 16.936  63.211 80.296 1.00 40.73  ? 347  ILE A CG1 1 
ATOM   2688 C CG2 . ILE A 1 347 ? 17.498  60.970 81.174 1.00 40.73  ? 347  ILE A CG2 1 
ATOM   2689 C CD1 . ILE A 1 347 ? 15.703  63.383 81.151 1.00 40.73  ? 347  ILE A CD1 1 
ATOM   2690 N N   . SER A 1 348 ? 18.919  61.370 84.029 1.00 44.18  ? 348  SER A N   1 
ATOM   2691 C CA  . SER A 1 348 ? 19.722  60.447 84.822 1.00 44.18  ? 348  SER A CA  1 
ATOM   2692 C C   . SER A 1 348 ? 19.929  59.154 84.033 1.00 44.18  ? 348  SER A C   1 
ATOM   2693 O O   . SER A 1 348 ? 19.365  58.993 82.950 1.00 44.18  ? 348  SER A O   1 
ATOM   2694 C CB  . SER A 1 348 ? 18.986  60.123 86.114 1.00 48.25  ? 348  SER A CB  1 
ATOM   2695 O OG  . SER A 1 348 ? 17.778  59.426 85.823 1.00 48.25  ? 348  SER A OG  1 
ATOM   2696 N N   . ARG A 1 349 ? 20.741  58.241 84.564 1.00 48.55  ? 349  ARG A N   1 
ATOM   2697 C CA  . ARG A 1 349 ? 20.975  56.962 83.898 1.00 48.55  ? 349  ARG A CA  1 
ATOM   2698 C C   . ARG A 1 349 ? 19.636  56.249 83.863 1.00 48.55  ? 349  ARG A C   1 
ATOM   2699 O O   . ARG A 1 349 ? 19.256  55.689 82.842 1.00 48.55  ? 349  ARG A O   1 
ATOM   2700 C CB  . ARG A 1 349 ? 21.968  56.092 84.683 1.00 51.05  ? 349  ARG A CB  1 
ATOM   2701 C CG  . ARG A 1 349 ? 23.394  56.045 84.133 1.00 51.05  ? 349  ARG A CG  1 
ATOM   2702 C CD  . ARG A 1 349 ? 23.490  55.286 82.815 1.00 51.05  ? 349  ARG A CD  1 
ATOM   2703 N NE  . ARG A 1 349 ? 23.674  56.196 81.686 1.00 51.05  ? 349  ARG A NE  1 
ATOM   2704 C CZ  . ARG A 1 349 ? 23.814  55.810 80.420 1.00 51.05  ? 349  ARG A CZ  1 
ATOM   2705 N NH1 . ARG A 1 349 ? 23.795  54.519 80.113 1.00 51.05  ? 349  ARG A NH1 1 
ATOM   2706 N NH2 . ARG A 1 349 ? 23.962  56.716 79.456 1.00 51.05  ? 349  ARG A NH2 1 
ATOM   2707 N N   . GLU A 1 350 ? 18.923  56.289 84.987 1.00 46.52  ? 350  GLU A N   1 
ATOM   2708 C CA  . GLU A 1 350 ? 17.616  55.640 85.118 1.00 46.52  ? 350  GLU A CA  1 
ATOM   2709 C C   . GLU A 1 350 ? 16.702  55.974 83.951 1.00 46.52  ? 350  GLU A C   1 
ATOM   2710 O O   . GLU A 1 350 ? 16.289  55.088 83.201 1.00 46.52  ? 350  GLU A O   1 
ATOM   2711 C CB  . GLU A 1 350 ? 16.900  56.096 86.385 1.00 101.43 ? 350  GLU A CB  1 
ATOM   2712 C CG  . GLU A 1 350 ? 17.807  56.571 87.506 1.00 101.43 ? 350  GLU A CG  1 
ATOM   2713 C CD  . GLU A 1 350 ? 18.415  55.421 88.259 1.00 101.43 ? 350  GLU A CD  1 
ATOM   2714 O OE1 . GLU A 1 350 ? 19.085  54.582 87.606 1.00 101.43 ? 350  GLU A OE1 1 
ATOM   2715 O OE2 . GLU A 1 350 ? 18.214  55.361 89.499 1.00 101.43 ? 350  GLU A OE2 1 
ATOM   2716 N N   . ASP A 1 351 ? 16.377  57.259 83.818 1.00 45.46  ? 351  ASP A N   1 
ATOM   2717 C CA  . ASP A 1 351 ? 15.485  57.721 82.758 1.00 45.46  ? 351  ASP A CA  1 
ATOM   2718 C C   . ASP A 1 351 ? 16.045  57.516 81.346 1.00 45.46  ? 351  ASP A C   1 
ATOM   2719 O O   . ASP A 1 351 ? 15.288  57.371 80.388 1.00 45.46  ? 351  ASP A O   1 
ATOM   2720 C CB  . ASP A 1 351 ? 15.104  59.189 82.988 1.00 64.28  ? 351  ASP A CB  1 
ATOM   2721 C CG  . ASP A 1 351 ? 14.296  59.392 84.287 1.00 64.28  ? 351  ASP A CG  1 
ATOM   2722 O OD1 . ASP A 1 351 ? 13.502  58.488 84.667 1.00 64.28  ? 351  ASP A OD1 1 
ATOM   2723 O OD2 . ASP A 1 351 ? 14.442  60.464 84.926 1.00 64.28  ? 351  ASP A OD2 1 
ATOM   2724 N N   . PHE A 1 352 ? 17.366  57.478 81.220 1.00 41.47  ? 352  PHE A N   1 
ATOM   2725 C CA  . PHE A 1 352 ? 17.975  57.266 79.918 1.00 41.47  ? 352  PHE A CA  1 
ATOM   2726 C C   . PHE A 1 352 ? 17.594  55.890 79.388 1.00 41.47  ? 352  PHE A C   1 
ATOM   2727 O O   . PHE A 1 352 ? 17.082  55.753 78.272 1.00 41.47  ? 352  PHE A O   1 
ATOM   2728 C CB  . PHE A 1 352 ? 19.487  57.341 80.014 1.00 33.64  ? 352  PHE A CB  1 
ATOM   2729 C CG  . PHE A 1 352 ? 20.170  57.161 78.706 1.00 33.64  ? 352  PHE A CG  1 
ATOM   2730 C CD1 . PHE A 1 352 ? 20.196  58.192 77.778 1.00 33.64  ? 352  PHE A CD1 1 
ATOM   2731 C CD2 . PHE A 1 352 ? 20.758  55.945 78.377 1.00 33.64  ? 352  PHE A CD2 1 
ATOM   2732 C CE1 . PHE A 1 352 ? 20.795  58.012 76.546 1.00 33.64  ? 352  PHE A CE1 1 
ATOM   2733 C CE2 . PHE A 1 352 ? 21.359  55.756 77.144 1.00 33.64  ? 352  PHE A CE2 1 
ATOM   2734 C CZ  . PHE A 1 352 ? 21.379  56.789 76.226 1.00 33.64  ? 352  PHE A CZ  1 
ATOM   2735 N N   . MET A 1 353 ? 17.859  54.863 80.189 1.00 46.77  ? 353  MET A N   1 
ATOM   2736 C CA  . MET A 1 353 ? 17.537  53.504 79.784 1.00 46.77  ? 353  MET A CA  1 
ATOM   2737 C C   . MET A 1 353 ? 16.026  53.349 79.659 1.00 46.77  ? 353  MET A C   1 
ATOM   2738 O O   . MET A 1 353 ? 15.535  52.526 78.887 1.00 46.77  ? 353  MET A O   1 
ATOM   2739 C CB  . MET A 1 353 ? 18.111  52.507 80.791 1.00 81.82  ? 353  MET A CB  1 
ATOM   2740 C CG  . MET A 1 353 ? 19.636  52.518 80.829 1.00 81.82  ? 353  MET A CG  1 
ATOM   2741 S SD  . MET A 1 353 ? 20.276  51.252 81.950 1.00 81.82  ? 353  MET A SD  1 
ATOM   2742 C CE  . MET A 1 353 ? 19.729  51.931 83.553 1.00 81.82  ? 353  MET A CE  1 
ATOM   2743 N N   . SER A 1 354 ? 15.291  54.148 80.420 1.00 41.78  ? 354  SER A N   1 
ATOM   2744 C CA  . SER A 1 354 ? 13.836  54.119 80.354 1.00 41.78  ? 354  SER A CA  1 
ATOM   2745 C C   . SER A 1 354 ? 13.408  54.710 78.999 1.00 41.78  ? 354  SER A C   1 
ATOM   2746 O O   . SER A 1 354 ? 12.447  54.243 78.373 1.00 41.78  ? 354  SER A O   1 
ATOM   2747 C CB  . SER A 1 354 ? 13.255  54.956 81.483 1.00 53.16  ? 354  SER A CB  1 
ATOM   2748 O OG  . SER A 1 354 ? 12.462  54.155 82.329 1.00 53.16  ? 354  SER A OG  1 
ATOM   2749 N N   . GLY A 1 355 ? 14.137  55.735 78.555 1.00 29.74  ? 355  GLY A N   1 
ATOM   2750 C CA  . GLY A 1 355 ? 13.833  56.368 77.286 1.00 29.74  ? 355  GLY A CA  1 
ATOM   2751 C C   . GLY A 1 355 ? 14.142  55.464 76.108 1.00 29.74  ? 355  GLY A C   1 
ATOM   2752 O O   . GLY A 1 355 ? 13.405  55.424 75.123 1.00 29.74  ? 355  GLY A O   1 
ATOM   2753 N N   . VAL A 1 356 ? 15.243  54.732 76.216 1.00 34.28  ? 356  VAL A N   1 
ATOM   2754 C CA  . VAL A 1 356 ? 15.659  53.817 75.161 1.00 34.28  ? 356  VAL A CA  1 
ATOM   2755 C C   . VAL A 1 356 ? 14.608  52.731 74.951 1.00 34.28  ? 356  VAL A C   1 
ATOM   2756 O O   . VAL A 1 356 ? 14.278  52.389 73.817 1.00 34.28  ? 356  VAL A O   1 
ATOM   2757 C CB  . VAL A 1 356 ? 17.019  53.163 75.497 1.00 30.64  ? 356  VAL A CB  1 
ATOM   2758 C CG1 . VAL A 1 356 ? 17.349  52.094 74.466 1.00 30.64  ? 356  VAL A CG1 1 
ATOM   2759 C CG2 . VAL A 1 356 ? 18.104  54.229 75.530 1.00 30.64  ? 356  VAL A CG2 1 
ATOM   2760 N N   . LYS A 1 357 ? 14.072  52.206 76.046 1.00 37.81  ? 357  LYS A N   1 
ATOM   2761 C CA  . LYS A 1 357 ? 13.045  51.166 75.975 1.00 37.81  ? 357  LYS A CA  1 
ATOM   2762 C C   . LYS A 1 357 ? 11.796  51.706 75.266 1.00 37.81  ? 357  LYS A C   1 
ATOM   2763 O O   . LYS A 1 357 ? 11.135  50.985 74.527 1.00 37.81  ? 357  LYS A O   1 
ATOM   2764 C CB  . LYS A 1 357 ? 12.692  50.682 77.395 1.00 62.82  ? 357  LYS A CB  1 
ATOM   2765 C CG  . LYS A 1 357 ? 11.627  49.581 77.484 1.00 62.82  ? 357  LYS A CG  1 
ATOM   2766 C CD  . LYS A 1 357 ? 12.056  48.288 76.784 1.00 62.82  ? 357  LYS A CD  1 
ATOM   2767 C CE  . LYS A 1 357 ? 11.006  47.179 76.921 1.00 62.82  ? 357  LYS A CE  1 
ATOM   2768 N NZ  . LYS A 1 357 ? 11.353  45.976 76.056 1.00 62.82  ? 357  LYS A NZ  1 
ATOM   2769 N N   . LEU A 1 358 ? 11.490  52.980 75.488 1.00 34.44  ? 358  LEU A N   1 
ATOM   2770 C CA  . LEU A 1 358 ? 10.332  53.638 74.876 1.00 34.44  ? 358  LEU A CA  1 
ATOM   2771 C C   . LEU A 1 358 ? 10.573  53.999 73.397 1.00 34.44  ? 358  LEU A C   1 
ATOM   2772 O O   . LEU A 1 358 ? 9.632   54.084 72.608 1.00 34.44  ? 358  LEU A O   1 
ATOM   2773 C CB  . LEU A 1 358 ? 10.007  54.914 75.663 1.00 32.30  ? 358  LEU A CB  1 
ATOM   2774 C CG  . LEU A 1 358 ? 8.744   55.088 76.520 1.00 32.30  ? 358  LEU A CG  1 
ATOM   2775 C CD1 . LEU A 1 358 ? 8.373   53.840 77.273 1.00 32.30  ? 358  LEU A CD1 1 
ATOM   2776 C CD2 . LEU A 1 358 ? 8.995   56.221 77.489 1.00 32.30  ? 358  LEU A CD2 1 
ATOM   2777 N N   . SER A 1 359 ? 11.833  54.202 73.018 1.00 35.33  ? 359  SER A N   1 
ATOM   2778 C CA  . SER A 1 359 ? 12.168  54.585 71.644 1.00 35.33  ? 359  SER A CA  1 
ATOM   2779 C C   . SER A 1 359 ? 12.318  53.435 70.665 1.00 35.33  ? 359  SER A C   1 
ATOM   2780 O O   . SER A 1 359 ? 12.088  53.595 69.471 1.00 35.33  ? 359  SER A O   1 
ATOM   2781 C CB  . SER A 1 359 ? 13.452  55.403 71.630 1.00 40.41  ? 359  SER A CB  1 
ATOM   2782 O OG  . SER A 1 359 ? 13.378  56.460 72.563 1.00 40.41  ? 359  SER A OG  1 
ATOM   2783 N N   . VAL A 1 360 ? 12.726  52.278 71.160 1.00 36.82  ? 360  VAL A N   1 
ATOM   2784 C CA  . VAL A 1 360 ? 12.894  51.122 70.296 1.00 36.82  ? 360  VAL A CA  1 
ATOM   2785 C C   . VAL A 1 360 ? 12.063  50.030 70.932 1.00 36.82  ? 360  VAL A C   1 
ATOM   2786 O O   . VAL A 1 360 ? 12.586  49.021 71.389 1.00 36.82  ? 360  VAL A O   1 
ATOM   2787 C CB  . VAL A 1 360 ? 14.359  50.683 70.245 1.00 34.96  ? 360  VAL A CB  1 
ATOM   2788 C CG1 . VAL A 1 360 ? 14.555  49.661 69.140 1.00 34.96  ? 360  VAL A CG1 1 
ATOM   2789 C CG2 . VAL A 1 360 ? 15.249  51.897 70.038 1.00 34.96  ? 360  VAL A CG2 1 
ATOM   2790 N N   . PRO A 1 361 ? 10.738  50.219 70.947 1.00 46.00  ? 361  PRO A N   1 
ATOM   2791 C CA  . PRO A 1 361 ? 9.756   49.296 71.525 1.00 46.00  ? 361  PRO A CA  1 
ATOM   2792 C C   . PRO A 1 361 ? 9.816   47.850 71.063 1.00 46.00  ? 361  PRO A C   1 
ATOM   2793 O O   . PRO A 1 361 ? 9.531   46.934 71.837 1.00 46.00  ? 361  PRO A O   1 
ATOM   2794 C CB  . PRO A 1 361 ? 8.434   49.955 71.172 1.00 38.07  ? 361  PRO A CB  1 
ATOM   2795 C CG  . PRO A 1 361 ? 8.738   50.589 69.839 1.00 38.07  ? 361  PRO A CG  1 
ATOM   2796 C CD  . PRO A 1 361 ? 10.066  51.230 70.110 1.00 38.07  ? 361  PRO A CD  1 
ATOM   2797 N N   . HIS A 1 362 ? 10.190  47.637 69.810 1.00 59.50  ? 362  HIS A N   1 
ATOM   2798 C CA  . HIS A 1 362 ? 10.240  46.283 69.267 1.00 59.50  ? 362  HIS A CA  1 
ATOM   2799 C C   . HIS A 1 362 ? 11.513  45.501 69.583 1.00 59.50  ? 362  HIS A C   1 
ATOM   2800 O O   . HIS A 1 362 ? 11.638  44.342 69.189 1.00 59.50  ? 362  HIS A O   1 
ATOM   2801 C CB  . HIS A 1 362 ? 10.048  46.335 67.745 1.00 65.24  ? 362  HIS A CB  1 
ATOM   2802 C CG  . HIS A 1 362 ? 11.030  47.222 67.041 1.00 65.24  ? 362  HIS A CG  1 
ATOM   2803 N ND1 . HIS A 1 362 ? 11.131  48.576 67.301 1.00 65.24  ? 362  HIS A ND1 1 
ATOM   2804 C CD2 . HIS A 1 362 ? 11.943  46.954 66.075 1.00 65.24  ? 362  HIS A CD2 1 
ATOM   2805 C CE1 . HIS A 1 362 ? 12.065  49.102 66.524 1.00 65.24  ? 362  HIS A CE1 1 
ATOM   2806 N NE2 . HIS A 1 362 ? 12.573  48.140 65.771 1.00 65.24  ? 362  HIS A NE2 1 
ATOM   2807 N N   . ALA A 1 363 ? 12.442  46.115 70.308 1.00 47.13  ? 363  ALA A N   1 
ATOM   2808 C CA  . ALA A 1 363 ? 13.718  45.476 70.621 1.00 47.13  ? 363  ALA A CA  1 
ATOM   2809 C C   . ALA A 1 363 ? 13.769  44.574 71.855 1.00 47.13  ? 363  ALA A C   1 
ATOM   2810 O O   . ALA A 1 363 ? 13.240  44.918 72.909 1.00 47.13  ? 363  ALA A O   1 
ATOM   2811 C CB  . ALA A 1 363 ? 14.801  46.553 70.743 1.00 40.96  ? 363  ALA A CB  1 
ATOM   2812 N N   . ASN A 1 364 ? 14.427  43.422 71.718 1.00 43.99  ? 364  ASN A N   1 
ATOM   2813 C CA  . ASN A 1 364 ? 14.595  42.508 72.844 1.00 43.99  ? 364  ASN A CA  1 
ATOM   2814 C C   . ASN A 1 364 ? 15.667  43.141 73.740 1.00 43.99  ? 364  ASN A C   1 
ATOM   2815 O O   . ASN A 1 364 ? 16.186  44.215 73.419 1.00 43.99  ? 364  ASN A O   1 
ATOM   2816 C CB  . ASN A 1 364 ? 15.056  41.119 72.372 1.00 48.02  ? 364  ASN A CB  1 
ATOM   2817 C CG  . ASN A 1 364 ? 16.351  41.164 71.576 1.00 48.02  ? 364  ASN A CG  1 
ATOM   2818 O OD1 . ASN A 1 364 ? 17.117  42.127 71.664 1.00 48.02  ? 364  ASN A OD1 1 
ATOM   2819 N ND2 . ASN A 1 364 ? 16.610  40.113 70.804 1.00 48.02  ? 364  ASN A ND2 1 
ATOM   2820 N N   . ASP A 1 365 ? 16.011  42.487 74.847 1.00 42.55  ? 365  ASP A N   1 
ATOM   2821 C CA  . ASP A 1 365 ? 17.002  43.039 75.765 1.00 42.55  ? 365  ASP A CA  1 
ATOM   2822 C C   . ASP A 1 365 ? 18.411  43.199 75.179 1.00 42.55  ? 365  ASP A C   1 
ATOM   2823 O O   . ASP A 1 365 ? 19.129  44.146 75.519 1.00 42.55  ? 365  ASP A O   1 
ATOM   2824 C CB  . ASP A 1 365 ? 17.031  42.214 77.058 1.00 87.30  ? 365  ASP A CB  1 
ATOM   2825 C CG  . ASP A 1 365 ? 15.946  42.656 78.061 1.00 87.30  ? 365  ASP A CG  1 
ATOM   2826 O OD1 . ASP A 1 365 ? 14.991  43.368 77.640 1.00 87.30  ? 365  ASP A OD1 1 
ATOM   2827 O OD2 . ASP A 1 365 ? 16.039  42.292 79.273 1.00 87.30  ? 365  ASP A OD2 1 
ATOM   2828 N N   . LEU A 1 366 ? 18.814  42.286 74.306 1.00 36.68  ? 366  LEU A N   1 
ATOM   2829 C CA  . LEU A 1 366 ? 20.124  42.394 73.689 1.00 36.68  ? 366  LEU A CA  1 
ATOM   2830 C C   . LEU A 1 366 ? 20.137  43.671 72.837 1.00 36.68  ? 366  LEU A C   1 
ATOM   2831 O O   . LEU A 1 366 ? 21.123  44.408 72.814 1.00 36.68  ? 366  LEU A O   1 
ATOM   2832 C CB  . LEU A 1 366 ? 20.400  41.170 72.809 1.00 41.91  ? 366  LEU A CB  1 
ATOM   2833 C CG  . LEU A 1 366 ? 21.727  41.201 72.044 1.00 41.91  ? 366  LEU A CG  1 
ATOM   2834 C CD1 . LEU A 1 366 ? 22.898  41.138 73.025 1.00 41.91  ? 366  LEU A CD1 1 
ATOM   2835 C CD2 . LEU A 1 366 ? 21.779  40.035 71.063 1.00 41.91  ? 366  LEU A CD2 1 
ATOM   2836 N N   . GLY A 1 367 ? 19.031  43.929 72.140 1.00 31.29  ? 367  GLY A N   1 
ATOM   2837 C CA  . GLY A 1 367 ? 18.930  45.114 71.303 1.00 31.29  ? 367  GLY A CA  1 
ATOM   2838 C C   . GLY A 1 367 ? 18.973  46.417 72.082 1.00 31.29  ? 367  GLY A C   1 
ATOM   2839 O O   . GLY A 1 367 ? 19.629  47.368 71.674 1.00 31.29  ? 367  GLY A O   1 
ATOM   2840 N N   . LEU A 1 368 ? 18.267  46.464 73.206 1.00 34.35  ? 368  LEU A N   1 
ATOM   2841 C CA  . LEU A 1 368 ? 18.260  47.660 74.034 1.00 34.35  ? 368  LEU A CA  1 
ATOM   2842 C C   . LEU A 1 368 ? 19.678  47.948 74.485 1.00 34.35  ? 368  LEU A C   1 
ATOM   2843 O O   . LEU A 1 368 ? 20.087  49.104 74.568 1.00 34.35  ? 368  LEU A O   1 
ATOM   2844 C CB  . LEU A 1 368 ? 17.356  47.461 75.248 1.00 35.17  ? 368  LEU A CB  1 
ATOM   2845 C CG  . LEU A 1 368 ? 15.874  47.386 74.876 1.00 35.17  ? 368  LEU A CG  1 
ATOM   2846 C CD1 . LEU A 1 368 ? 15.036  47.029 76.096 1.00 35.17  ? 368  LEU A CD1 1 
ATOM   2847 C CD2 . LEU A 1 368 ? 15.440  48.723 74.283 1.00 35.17  ? 368  LEU A CD2 1 
ATOM   2848 N N   . ASP A 1 369 ? 20.431  46.888 74.773 1.00 40.23  ? 369  ASP A N   1 
ATOM   2849 C CA  . ASP A 1 369 ? 21.819  47.044 75.195 1.00 40.23  ? 369  ASP A CA  1 
ATOM   2850 C C   . ASP A 1 369 ? 22.688  47.554 74.050 1.00 40.23  ? 369  ASP A C   1 
ATOM   2851 O O   . ASP A 1 369 ? 23.569  48.387 74.266 1.00 40.23  ? 369  ASP A O   1 
ATOM   2852 C CB  . ASP A 1 369 ? 22.387  45.723 75.735 1.00 67.78  ? 369  ASP A CB  1 
ATOM   2853 C CG  . ASP A 1 369 ? 21.801  45.347 77.093 1.00 67.78  ? 369  ASP A CG  1 
ATOM   2854 O OD1 . ASP A 1 369 ? 21.119  46.214 77.705 1.00 67.78  ? 369  ASP A OD1 1 
ATOM   2855 O OD2 . ASP A 1 369 ? 22.029  44.192 77.555 1.00 67.78  ? 369  ASP A OD2 1 
ATOM   2856 N N   . ALA A 1 370 ? 22.451  47.064 72.838 1.00 35.06  ? 370  ALA A N   1 
ATOM   2857 C CA  . ALA A 1 370 ? 23.237  47.531 71.699 1.00 35.06  ? 370  ALA A CA  1 
ATOM   2858 C C   . ALA A 1 370 ? 23.056  49.043 71.556 1.00 35.06  ? 370  ALA A C   1 
ATOM   2859 O O   . ALA A 1 370 ? 24.033  49.778 71.440 1.00 35.06  ? 370  ALA A O   1 
ATOM   2860 C CB  . ALA A 1 370 ? 22.807  46.827 70.423 1.00 23.69  ? 370  ALA A CB  1 
ATOM   2861 N N   . VAL A 1 371 ? 21.808  49.506 71.590 1.00 29.73  ? 371  VAL A N   1 
ATOM   2862 C CA  . VAL A 1 371 ? 21.509  50.931 71.464 1.00 29.73  ? 371  VAL A CA  1 
ATOM   2863 C C   . VAL A 1 371 ? 22.179  51.754 72.564 1.00 29.73  ? 371  VAL A C   1 
ATOM   2864 O O   . VAL A 1 371 ? 22.879  52.734 72.285 1.00 29.73  ? 371  VAL A O   1 
ATOM   2865 C CB  . VAL A 1 371 ? 19.983  51.179 71.506 1.00 30.04  ? 371  VAL A CB  1 
ATOM   2866 C CG1 . VAL A 1 371 ? 19.688  52.673 71.412 1.00 30.04  ? 371  VAL A CG1 1 
ATOM   2867 C CG2 . VAL A 1 371 ? 19.304  50.425 70.364 1.00 30.04  ? 371  VAL A CG2 1 
ATOM   2868 N N   . THR A 1 372 ? 21.961  51.342 73.812 1.00 34.70  ? 372  THR A N   1 
ATOM   2869 C CA  . THR A 1 372 ? 22.525  52.012 74.982 1.00 34.70  ? 372  THR A CA  1 
ATOM   2870 C C   . THR A 1 372 ? 24.045  52.151 74.897 1.00 34.70  ? 372  THR A C   1 
ATOM   2871 O O   . THR A 1 372 ? 24.602  53.197 75.224 1.00 34.70  ? 372  THR A O   1 
ATOM   2872 C CB  . THR A 1 372 ? 22.155  51.256 76.287 1.00 42.06  ? 372  THR A CB  1 
ATOM   2873 O OG1 . THR A 1 372 ? 20.745  51.392 76.535 1.00 42.06  ? 372  THR A OG1 1 
ATOM   2874 C CG2 . THR A 1 372 ? 22.932  51.814 77.477 1.00 42.06  ? 372  THR A CG2 1 
ATOM   2875 N N   . LEU A 1 373 ? 24.712  51.093 74.460 1.00 35.74  ? 373  LEU A N   1 
ATOM   2876 C CA  . LEU A 1 373 ? 26.155  51.133 74.316 1.00 35.74  ? 373  LEU A CA  1 
ATOM   2877 C C   . LEU A 1 373 ? 26.569  52.085 73.190 1.00 35.74  ? 373  LEU A C   1 
ATOM   2878 O O   . LEU A 1 373 ? 27.543  52.819 73.316 1.00 35.74  ? 373  LEU A O   1 
ATOM   2879 C CB  . LEU A 1 373 ? 26.702  49.736 74.015 1.00 42.72  ? 373  LEU A CB  1 
ATOM   2880 C CG  . LEU A 1 373 ? 28.196  49.694 73.686 1.00 42.72  ? 373  LEU A CG  1 
ATOM   2881 C CD1 . LEU A 1 373 ? 28.994  50.355 74.822 1.00 42.72  ? 373  LEU A CD1 1 
ATOM   2882 C CD2 . LEU A 1 373 ? 28.642  48.254 73.488 1.00 42.72  ? 373  LEU A CD2 1 
ATOM   2883 N N   . GLN A 1 374 ? 25.820  52.065 72.092 1.00 30.50  ? 374  GLN A N   1 
ATOM   2884 C CA  . GLN A 1 374 ? 26.117  52.908 70.935 1.00 30.50  ? 374  GLN A CA  1 
ATOM   2885 C C   . GLN A 1 374 ? 25.946  54.401 71.200 1.00 30.50  ? 374  GLN A C   1 
ATOM   2886 O O   . GLN A 1 374 ? 26.539  55.219 70.516 1.00 30.50  ? 374  GLN A O   1 
ATOM   2887 C CB  . GLN A 1 374 ? 25.214  52.512 69.764 1.00 44.42  ? 374  GLN A CB  1 
ATOM   2888 C CG  . GLN A 1 374 ? 25.637  53.078 68.431 1.00 44.42  ? 374  GLN A CG  1 
ATOM   2889 C CD  . GLN A 1 374 ? 26.877  52.388 67.883 1.00 44.42  ? 374  GLN A CD  1 
ATOM   2890 O OE1 . GLN A 1 374 ? 27.320  52.685 66.773 1.00 44.42  ? 374  GLN A OE1 1 
ATOM   2891 N NE2 . GLN A 1 374 ? 27.444  51.460 68.660 1.00 44.42  ? 374  GLN A NE2 1 
ATOM   2892 N N   . TYR A 1 375 ? 25.139  54.752 72.196 1.00 40.00  ? 375  TYR A N   1 
ATOM   2893 C CA  . TYR A 1 375 ? 24.885  56.156 72.501 1.00 40.00  ? 375  TYR A CA  1 
ATOM   2894 C C   . TYR A 1 375 ? 25.351  56.665 73.858 1.00 40.00  ? 375  TYR A C   1 
ATOM   2895 O O   . TYR A 1 375 ? 25.044  57.794 74.239 1.00 40.00  ? 375  TYR A O   1 
ATOM   2896 C CB  . TYR A 1 375 ? 23.394  56.441 72.334 1.00 29.07  ? 375  TYR A CB  1 
ATOM   2897 C CG  . TYR A 1 375 ? 22.989  56.588 70.890 1.00 29.07  ? 375  TYR A CG  1 
ATOM   2898 C CD1 . TYR A 1 375 ? 22.588  55.480 70.141 1.00 29.07  ? 375  TYR A CD1 1 
ATOM   2899 C CD2 . TYR A 1 375 ? 23.013  57.835 70.267 1.00 29.07  ? 375  TYR A CD2 1 
ATOM   2900 C CE1 . TYR A 1 375 ? 22.224  55.610 68.817 1.00 29.07  ? 375  TYR A CE1 1 
ATOM   2901 C CE2 . TYR A 1 375 ? 22.643  57.978 68.932 1.00 29.07  ? 375  TYR A CE2 1 
ATOM   2902 C CZ  . TYR A 1 375 ? 22.254  56.861 68.222 1.00 29.07  ? 375  TYR A CZ  1 
ATOM   2903 O OH  . TYR A 1 375 ? 21.905  56.991 66.911 1.00 29.07  ? 375  TYR A OH  1 
ATOM   2904 N N   . THR A 1 376 ? 26.092  55.844 74.589 1.00 37.17  ? 376  THR A N   1 
ATOM   2905 C CA  . THR A 1 376 ? 26.589  56.248 75.897 1.00 37.17  ? 376  THR A CA  1 
ATOM   2906 C C   . THR A 1 376 ? 28.084  56.548 75.848 1.00 37.17  ? 376  THR A C   1 
ATOM   2907 O O   . THR A 1 376 ? 28.841  55.872 75.156 1.00 37.17  ? 376  THR A O   1 
ATOM   2908 C CB  . THR A 1 376 ? 26.394  55.134 76.944 1.00 34.85  ? 376  THR A CB  1 
ATOM   2909 O OG1 . THR A 1 376 ? 25.001  54.894 77.151 1.00 34.85  ? 376  THR A OG1 1 
ATOM   2910 C CG2 . THR A 1 376 ? 27.026  55.529 78.252 1.00 34.85  ? 376  THR A CG2 1 
ATOM   2911 N N   . ASP A 1 377 ? 28.500  57.574 76.579 1.00 37.49  ? 377  ASP A N   1 
ATOM   2912 C CA  . ASP A 1 377 ? 29.910  57.928 76.683 1.00 37.49  ? 377  ASP A CA  1 
ATOM   2913 C C   . ASP A 1 377 ? 30.284  57.404 78.065 1.00 37.49  ? 377  ASP A C   1 
ATOM   2914 O O   . ASP A 1 377 ? 29.986  58.054 79.069 1.00 37.49  ? 377  ASP A O   1 
ATOM   2915 C CB  . ASP A 1 377 ? 30.095  59.442 76.660 1.00 57.75  ? 377  ASP A CB  1 
ATOM   2916 C CG  . ASP A 1 377 ? 31.525  59.852 76.948 1.00 57.75  ? 377  ASP A CG  1 
ATOM   2917 O OD1 . ASP A 1 377 ? 32.345  58.961 77.276 1.00 57.75  ? 377  ASP A OD1 1 
ATOM   2918 O OD2 . ASP A 1 377 ? 31.836  61.062 76.856 1.00 57.75  ? 377  ASP A OD2 1 
ATOM   2919 N N   . TRP A 1 378 ? 30.927  56.238 78.123 1.00 45.77  ? 378  TRP A N   1 
ATOM   2920 C CA  . TRP A 1 378 ? 31.281  55.651 79.409 1.00 45.77  ? 378  TRP A CA  1 
ATOM   2921 C C   . TRP A 1 378 ? 32.336  56.372 80.232 1.00 45.77  ? 378  TRP A C   1 
ATOM   2922 O O   . TRP A 1 378 ? 32.631  55.946 81.352 1.00 45.77  ? 378  TRP A O   1 
ATOM   2923 C CB  . TRP A 1 378 ? 31.663  54.178 79.240 1.00 45.94  ? 378  TRP A CB  1 
ATOM   2924 C CG  . TRP A 1 378 ? 30.504  53.370 78.734 1.00 45.94  ? 378  TRP A CG  1 
ATOM   2925 C CD1 . TRP A 1 378 ? 30.290  52.968 77.445 1.00 45.94  ? 378  TRP A CD1 1 
ATOM   2926 C CD2 . TRP A 1 378 ? 29.333  52.990 79.473 1.00 45.94  ? 378  TRP A CD2 1 
ATOM   2927 N NE1 . TRP A 1 378 ? 29.058  52.369 77.337 1.00 45.94  ? 378  TRP A NE1 1 
ATOM   2928 C CE2 . TRP A 1 378 ? 28.450  52.371 78.565 1.00 45.94  ? 378  TRP A CE2 1 
ATOM   2929 C CE3 . TRP A 1 378 ? 28.945  53.119 80.812 1.00 45.94  ? 378  TRP A CE3 1 
ATOM   2930 C CZ2 . TRP A 1 378 ? 27.198  51.881 78.950 1.00 45.94  ? 378  TRP A CZ2 1 
ATOM   2931 C CZ3 . TRP A 1 378 ? 27.693  52.630 81.201 1.00 45.94  ? 378  TRP A CZ3 1 
ATOM   2932 C CH2 . TRP A 1 378 ? 26.839  52.020 80.271 1.00 45.94  ? 378  TRP A CH2 1 
ATOM   2933 N N   . MET A 1 379 ? 32.905  57.452 79.702 1.00 46.32  ? 379  MET A N   1 
ATOM   2934 C CA  . MET A 1 379 ? 33.890  58.213 80.473 1.00 46.32  ? 379  MET A CA  1 
ATOM   2935 C C   . MET A 1 379 ? 33.149  59.281 81.269 1.00 46.32  ? 379  MET A C   1 
ATOM   2936 O O   . MET A 1 379 ? 33.745  59.957 82.108 1.00 46.32  ? 379  MET A O   1 
ATOM   2937 C CB  . MET A 1 379 ? 34.892  58.939 79.571 1.00 61.10  ? 379  MET A CB  1 
ATOM   2938 C CG  . MET A 1 379 ? 35.754  58.066 78.686 1.00 61.10  ? 379  MET A CG  1 
ATOM   2939 S SD  . MET A 1 379 ? 37.116  59.049 77.982 1.00 61.10  ? 379  MET A SD  1 
ATOM   2940 C CE  . MET A 1 379 ? 36.281  59.877 76.564 1.00 61.10  ? 379  MET A CE  1 
ATOM   2941 N N   . ASP A 1 380 ? 31.850  59.431 81.004 1.00 47.56  ? 380  ASP A N   1 
ATOM   2942 C CA  . ASP A 1 380 ? 31.033  60.461 81.663 1.00 47.56  ? 380  ASP A CA  1 
ATOM   2943 C C   . ASP A 1 380 ? 29.554  60.055 81.561 1.00 47.56  ? 380  ASP A C   1 
ATOM   2944 O O   . ASP A 1 380 ? 28.713  60.819 81.069 1.00 47.56  ? 380  ASP A O   1 
ATOM   2945 C CB  . ASP A 1 380 ? 31.298  61.800 80.949 1.00 55.70  ? 380  ASP A CB  1 
ATOM   2946 C CG  . ASP A 1 380 ? 30.672  62.994 81.652 1.00 55.70  ? 380  ASP A CG  1 
ATOM   2947 O OD1 . ASP A 1 380 ? 30.658  63.031 82.910 1.00 55.70  ? 380  ASP A OD1 1 
ATOM   2948 O OD2 . ASP A 1 380 ? 30.214  63.913 80.936 1.00 55.70  ? 380  ASP A OD2 1 
ATOM   2949 N N   . ASP A 1 381 ? 29.245  58.853 82.047 1.00 51.11  ? 381  ASP A N   1 
ATOM   2950 C CA  . ASP A 1 381 ? 27.892  58.305 81.959 1.00 51.11  ? 381  ASP A CA  1 
ATOM   2951 C C   . ASP A 1 381 ? 26.781  58.935 82.793 1.00 51.11  ? 381  ASP A C   1 
ATOM   2952 O O   . ASP A 1 381 ? 25.597  58.756 82.481 1.00 51.11  ? 381  ASP A O   1 
ATOM   2953 C CB  . ASP A 1 381 ? 27.929  56.789 82.202 1.00 63.91  ? 381  ASP A CB  1 
ATOM   2954 C CG  . ASP A 1 381 ? 28.501  56.422 83.557 1.00 63.91  ? 381  ASP A CG  1 
ATOM   2955 O OD1 . ASP A 1 381 ? 29.618  56.898 83.906 1.00 63.91  ? 381  ASP A OD1 1 
ATOM   2956 O OD2 . ASP A 1 381 ? 27.833  55.637 84.273 1.00 63.91  ? 381  ASP A OD2 1 
ATOM   2957 N N   . ASN A 1 382 ? 27.126  59.662 83.850 1.00 60.49  ? 382  ASN A N   1 
ATOM   2958 C CA  . ASN A 1 382 ? 26.080  60.301 84.647 1.00 60.49  ? 382  ASN A CA  1 
ATOM   2959 C C   . ASN A 1 382 ? 25.907  61.772 84.305 1.00 60.49  ? 382  ASN A C   1 
ATOM   2960 O O   . ASN A 1 382 ? 25.263  62.519 85.046 1.00 60.49  ? 382  ASN A O   1 
ATOM   2961 C CB  . ASN A 1 382 ? 26.352  60.142 86.138 1.00 59.76  ? 382  ASN A CB  1 
ATOM   2962 C CG  . ASN A 1 382 ? 26.132  58.729 86.602 1.00 59.76  ? 382  ASN A CG  1 
ATOM   2963 O OD1 . ASN A 1 382 ? 25.118  58.101 86.260 1.00 59.76  ? 382  ASN A OD1 1 
ATOM   2964 N ND2 . ASN A 1 382 ? 27.077  58.207 87.382 1.00 59.76  ? 382  ASN A ND2 1 
ATOM   2965 N N   . ASN A 1 383 ? 26.493  62.188 83.186 1.00 42.66  ? 383  ASN A N   1 
ATOM   2966 C CA  . ASN A 1 383 ? 26.367  63.562 82.727 1.00 42.66  ? 383  ASN A CA  1 
ATOM   2967 C C   . ASN A 1 383 ? 24.933  63.709 82.201 1.00 42.66  ? 383  ASN A C   1 
ATOM   2968 O O   . ASN A 1 383 ? 24.566  63.136 81.169 1.00 42.66  ? 383  ASN A O   1 
ATOM   2969 C CB  . ASN A 1 383 ? 27.395  63.826 81.627 1.00 45.84  ? 383  ASN A CB  1 
ATOM   2970 C CG  . ASN A 1 383 ? 27.281  65.210 81.036 1.00 45.84  ? 383  ASN A CG  1 
ATOM   2971 O OD1 . ASN A 1 383 ? 28.256  65.749 80.511 1.00 45.84  ? 383  ASN A OD1 1 
ATOM   2972 N ND2 . ASN A 1 383 ? 26.084  65.790 81.095 1.00 45.84  ? 383  ASN A ND2 1 
ATOM   2973 N N   . GLY A 1 384 ? 24.129  64.472 82.937 1.00 39.03  ? 384  GLY A N   1 
ATOM   2974 C CA  . GLY A 1 384 ? 22.742  64.690 82.579 1.00 39.03  ? 384  GLY A CA  1 
ATOM   2975 C C   . GLY A 1 384 ? 22.524  65.260 81.196 1.00 39.03  ? 384  GLY A C   1 
ATOM   2976 O O   . GLY A 1 384 ? 21.563  64.887 80.519 1.00 39.03  ? 384  GLY A O   1 
ATOM   2977 N N   . ILE A 1 385 ? 23.405  66.157 80.769 1.00 34.66  ? 385  ILE A N   1 
ATOM   2978 C CA  . ILE A 1 385 ? 23.272  66.764 79.455 1.00 34.66  ? 385  ILE A CA  1 
ATOM   2979 C C   . ILE A 1 385 ? 23.636  65.801 78.326 1.00 34.66  ? 385  ILE A C   1 
ATOM   2980 O O   . ILE A 1 385 ? 23.051  65.864 77.252 1.00 34.66  ? 385  ILE A O   1 
ATOM   2981 C CB  . ILE A 1 385 ? 24.119  68.054 79.350 1.00 39.53  ? 385  ILE A CB  1 
ATOM   2982 C CG1 . ILE A 1 385 ? 23.487  69.144 80.224 1.00 39.53  ? 385  ILE A CG1 1 
ATOM   2983 C CG2 . ILE A 1 385 ? 24.192  68.526 77.916 1.00 39.53  ? 385  ILE A CG2 1 
ATOM   2984 C CD1 . ILE A 1 385 ? 24.237  70.460 80.226 1.00 39.53  ? 385  ILE A CD1 1 
ATOM   2985 N N   . LYS A 1 386 ? 24.594  64.907 78.556 1.00 39.94  ? 386  LYS A N   1 
ATOM   2986 C CA  . LYS A 1 386 ? 24.963  63.951 77.514 1.00 39.94  ? 386  LYS A CA  1 
ATOM   2987 C C   . LYS A 1 386 ? 23.886  62.876 77.345 1.00 39.94  ? 386  LYS A C   1 
ATOM   2988 O O   . LYS A 1 386 ? 23.636  62.410 76.231 1.00 39.94  ? 386  LYS A O   1 
ATOM   2989 C CB  . LYS A 1 386 ? 26.327  63.317 77.809 1.00 45.02  ? 386  LYS A CB  1 
ATOM   2990 C CG  . LYS A 1 386 ? 27.486  64.229 77.420 1.00 45.02  ? 386  LYS A CG  1 
ATOM   2991 C CD  . LYS A 1 386 ? 28.846  63.542 77.538 1.00 45.02  ? 386  LYS A CD  1 
ATOM   2992 C CE  . LYS A 1 386 ? 29.977  64.475 77.093 1.00 45.02  ? 386  LYS A CE  1 
ATOM   2993 N NZ  . LYS A 1 386 ? 31.330  63.904 77.384 1.00 45.02  ? 386  LYS A NZ  1 
ATOM   2994 N N   . ASN A 1 387 ? 23.243  62.491 78.443 1.00 31.82  ? 387  ASN A N   1 
ATOM   2995 C CA  . ASN A 1 387 ? 22.183  61.505 78.356 1.00 31.82  ? 387  ASN A CA  1 
ATOM   2996 C C   . ASN A 1 387 ? 20.960  62.130 77.661 1.00 31.82  ? 387  ASN A C   1 
ATOM   2997 O O   . ASN A 1 387 ? 20.292  61.478 76.857 1.00 31.82  ? 387  ASN A O   1 
ATOM   2998 C CB  . ASN A 1 387 ? 21.825  60.981 79.750 1.00 40.24  ? 387  ASN A CB  1 
ATOM   2999 C CG  . ASN A 1 387 ? 22.974  60.205 80.393 1.00 40.24  ? 387  ASN A CG  1 
ATOM   3000 O OD1 . ASN A 1 387 ? 23.793  59.603 79.700 1.00 40.24  ? 387  ASN A OD1 1 
ATOM   3001 N ND2 . ASN A 1 387 ? 23.024  60.204 81.721 1.00 40.24  ? 387  ASN A ND2 1 
ATOM   3002 N N   . ARG A 1 388 ? 20.677  63.397 77.955 1.00 34.29  ? 388  ARG A N   1 
ATOM   3003 C CA  . ARG A 1 388 ? 19.551  64.074 77.312 1.00 34.29  ? 388  ARG A CA  1 
ATOM   3004 C C   . ARG A 1 388 ? 19.755  64.147 75.788 1.00 34.29  ? 388  ARG A C   1 
ATOM   3005 O O   . ARG A 1 388 ? 18.905  63.698 75.015 1.00 34.29  ? 388  ARG A O   1 
ATOM   3006 C CB  . ARG A 1 388 ? 19.374  65.485 77.875 1.00 34.92  ? 388  ARG A CB  1 
ATOM   3007 C CG  . ARG A 1 388 ? 18.238  66.265 77.228 1.00 34.92  ? 388  ARG A CG  1 
ATOM   3008 C CD  . ARG A 1 388 ? 18.756  67.535 76.589 1.00 34.92  ? 388  ARG A CD  1 
ATOM   3009 N NE  . ARG A 1 388 ? 18.916  68.587 77.576 1.00 34.92  ? 388  ARG A NE  1 
ATOM   3010 C CZ  . ARG A 1 388 ? 19.814  69.559 77.500 1.00 34.92  ? 388  ARG A CZ  1 
ATOM   3011 N NH1 . ARG A 1 388 ? 20.654  69.621 76.476 1.00 34.92  ? 388  ARG A NH1 1 
ATOM   3012 N NH2 . ARG A 1 388 ? 19.864  70.469 78.455 1.00 34.92  ? 388  ARG A NH2 1 
ATOM   3013 N N   . ASP A 1 389 ? 20.885  64.694 75.351 1.00 35.27  ? 389  ASP A N   1 
ATOM   3014 C CA  . ASP A 1 389 ? 21.153  64.791 73.919 1.00 35.27  ? 389  ASP A CA  1 
ATOM   3015 C C   . ASP A 1 389 ? 21.298  63.404 73.280 1.00 35.27  ? 389  ASP A C   1 
ATOM   3016 O O   . ASP A 1 389 ? 20.971  63.216 72.104 1.00 35.27  ? 389  ASP A O   1 
ATOM   3017 C CB  . ASP A 1 389 ? 22.409  65.627 73.666 1.00 45.68  ? 389  ASP A CB  1 
ATOM   3018 C CG  . ASP A 1 389 ? 22.317  67.023 74.276 1.00 45.68  ? 389  ASP A CG  1 
ATOM   3019 O OD1 . ASP A 1 389 ? 21.197  67.572 74.365 1.00 45.68  ? 389  ASP A OD1 1 
ATOM   3020 O OD2 . ASP A 1 389 ? 23.371  67.574 74.658 1.00 45.68  ? 389  ASP A OD2 1 
ATOM   3021 N N   . GLY A 1 390 ? 21.779  62.439 74.058 1.00 31.35  ? 390  GLY A N   1 
ATOM   3022 C CA  . GLY A 1 390 ? 21.935  61.085 73.559 1.00 31.35  ? 390  GLY A CA  1 
ATOM   3023 C C   . GLY A 1 390 ? 20.585  60.464 73.230 1.00 31.35  ? 390  GLY A C   1 
ATOM   3024 O O   . GLY A 1 390 ? 20.434  59.762 72.233 1.00 31.35  ? 390  GLY A O   1 
ATOM   3025 N N   . LEU A 1 391 ? 19.599  60.731 74.081 1.00 34.75  ? 391  LEU A N   1 
ATOM   3026 C CA  . LEU A 1 391 ? 18.246  60.224 73.901 1.00 34.75  ? 391  LEU A CA  1 
ATOM   3027 C C   . LEU A 1 391 ? 17.622  60.957 72.706 1.00 34.75  ? 391  LEU A C   1 
ATOM   3028 O O   . LEU A 1 391 ? 16.891  60.378 71.901 1.00 34.75  ? 391  LEU A O   1 
ATOM   3029 C CB  . LEU A 1 391 ? 17.444  60.493 75.175 1.00 36.42  ? 391  LEU A CB  1 
ATOM   3030 C CG  . LEU A 1 391 ? 16.463  59.447 75.699 1.00 36.42  ? 391  LEU A CG  1 
ATOM   3031 C CD1 . LEU A 1 391 ? 17.049  58.047 75.543 1.00 36.42  ? 391  LEU A CD1 1 
ATOM   3032 C CD2 . LEU A 1 391 ? 16.159  59.742 77.174 1.00 36.42  ? 391  LEU A CD2 1 
ATOM   3033 N N   . ASP A 1 392 ? 17.933  62.239 72.594 1.00 27.73  ? 392  ASP A N   1 
ATOM   3034 C CA  . ASP A 1 392 ? 17.424  63.048 71.505 1.00 27.73  ? 392  ASP A CA  1 
ATOM   3035 C C   . ASP A 1 392 ? 17.926  62.487 70.171 1.00 27.73  ? 392  ASP A C   1 
ATOM   3036 O O   . ASP A 1 392 ? 17.153  62.347 69.226 1.00 27.73  ? 392  ASP A O   1 
ATOM   3037 C CB  . ASP A 1 392 ? 17.890  64.488 71.677 1.00 63.13  ? 392  ASP A CB  1 
ATOM   3038 C CG  . ASP A 1 392 ? 17.058  65.472 70.886 1.00 63.13  ? 392  ASP A CG  1 
ATOM   3039 O OD1 . ASP A 1 392 ? 16.788  65.234 69.684 1.00 63.13  ? 392  ASP A OD1 1 
ATOM   3040 O OD2 . ASP A 1 392 ? 16.683  66.509 71.472 1.00 63.13  ? 392  ASP A OD2 1 
ATOM   3041 N N   . ASP A 1 393 ? 19.218  62.168 70.097 1.00 27.47  ? 393  ASP A N   1 
ATOM   3042 C CA  . ASP A 1 393 ? 19.797  61.613 68.870 1.00 27.47  ? 393  ASP A CA  1 
ATOM   3043 C C   . ASP A 1 393 ? 19.181  60.262 68.511 1.00 27.47  ? 393  ASP A C   1 
ATOM   3044 O O   . ASP A 1 393 ? 18.896  59.996 67.352 1.00 27.47  ? 393  ASP A O   1 
ATOM   3045 C CB  . ASP A 1 393 ? 21.310  61.434 69.003 1.00 54.13  ? 393  ASP A CB  1 
ATOM   3046 C CG  . ASP A 1 393 ? 22.064  62.740 68.922 1.00 54.13  ? 393  ASP A CG  1 
ATOM   3047 O OD1 . ASP A 1 393 ? 21.455  63.741 68.482 1.00 54.13  ? 393  ASP A OD1 1 
ATOM   3048 O OD2 . ASP A 1 393 ? 23.269  62.768 69.280 1.00 54.13  ? 393  ASP A OD2 1 
ATOM   3049 N N   . ILE A 1 394 ? 18.996  59.409 69.511 1.00 26.18  ? 394  ILE A N   1 
ATOM   3050 C CA  . ILE A 1 394 ? 18.413  58.095 69.290 1.00 26.18  ? 394  ILE A CA  1 
ATOM   3051 C C   . ILE A 1 394 ? 17.049  58.200 68.611 1.00 26.18  ? 394  ILE A C   1 
ATOM   3052 O O   . ILE A 1 394 ? 16.814  57.587 67.580 1.00 26.18  ? 394  ILE A O   1 
ATOM   3053 C CB  . ILE A 1 394 ? 18.255  57.332 70.629 1.00 25.38  ? 394  ILE A CB  1 
ATOM   3054 C CG1 . ILE A 1 394 ? 19.622  56.861 71.116 1.00 25.38  ? 394  ILE A CG1 1 
ATOM   3055 C CG2 . ILE A 1 394 ? 17.294  56.161 70.469 1.00 25.38  ? 394  ILE A CG2 1 
ATOM   3056 C CD1 . ILE A 1 394 ? 19.604  56.250 72.488 1.00 25.38  ? 394  ILE A CD1 1 
ATOM   3057 N N   . VAL A 1 395 ? 16.162  58.993 69.193 1.00 29.27  ? 395  VAL A N   1 
ATOM   3058 C CA  . VAL A 1 395 ? 14.828  59.157 68.661 1.00 29.27  ? 395  VAL A CA  1 
ATOM   3059 C C   . VAL A 1 395 ? 14.848  59.690 67.230 1.00 29.27  ? 395  VAL A C   1 
ATOM   3060 O O   . VAL A 1 395 ? 14.137  59.174 66.368 1.00 29.27  ? 395  VAL A O   1 
ATOM   3061 C CB  . VAL A 1 395 ? 13.991  60.073 69.582 1.00 26.28  ? 395  VAL A CB  1 
ATOM   3062 C CG1 . VAL A 1 395 ? 12.571  60.153 69.094 1.00 26.28  ? 395  VAL A CG1 1 
ATOM   3063 C CG2 . VAL A 1 395 ? 14.016  59.527 70.996 1.00 26.28  ? 395  VAL A CG2 1 
ATOM   3064 N N   . GLY A 1 396 ? 15.674  60.704 66.975 1.00 31.00  ? 396  GLY A N   1 
ATOM   3065 C CA  . GLY A 1 396 ? 15.772  61.262 65.637 1.00 31.00  ? 396  GLY A CA  1 
ATOM   3066 C C   . GLY A 1 396 ? 16.434  60.331 64.624 1.00 31.00  ? 396  GLY A C   1 
ATOM   3067 O O   . GLY A 1 396 ? 15.948  60.184 63.501 1.00 31.00  ? 396  GLY A O   1 
ATOM   3068 N N   . ASP A 1 397 ? 17.537  59.693 65.010 1.00 28.21  ? 397  ASP A N   1 
ATOM   3069 C CA  . ASP A 1 397 ? 18.239  58.788 64.103 1.00 28.21  ? 397  ASP A CA  1 
ATOM   3070 C C   . ASP A 1 397 ? 17.377  57.597 63.704 1.00 28.21  ? 397  ASP A C   1 
ATOM   3071 O O   . ASP A 1 397 ? 17.202  57.314 62.526 1.00 28.21  ? 397  ASP A O   1 
ATOM   3072 C CB  . ASP A 1 397 ? 19.536  58.270 64.729 1.00 30.13  ? 397  ASP A CB  1 
ATOM   3073 C CG  . ASP A 1 397 ? 20.595  59.350 64.879 1.00 30.13  ? 397  ASP A CG  1 
ATOM   3074 O OD1 . ASP A 1 397 ? 20.486  60.422 64.238 1.00 30.13  ? 397  ASP A OD1 1 
ATOM   3075 O OD2 . ASP A 1 397 ? 21.556  59.116 65.639 1.00 30.13  ? 397  ASP A OD2 1 
ATOM   3076 N N   . HIS A 1 398 ? 16.834  56.904 64.691 1.00 26.86  ? 398  HIS A N   1 
ATOM   3077 C CA  . HIS A 1 398 ? 16.004  55.738 64.435 1.00 26.86  ? 398  HIS A CA  1 
ATOM   3078 C C   . HIS A 1 398 ? 14.703  56.033 63.677 1.00 26.86  ? 398  HIS A C   1 
ATOM   3079 O O   . HIS A 1 398 ? 14.317  55.292 62.787 1.00 26.86  ? 398  HIS A O   1 
ATOM   3080 C CB  . HIS A 1 398 ? 15.656  55.047 65.755 1.00 27.85  ? 398  HIS A CB  1 
ATOM   3081 C CG  . HIS A 1 398 ? 14.597  53.997 65.628 1.00 27.85  ? 398  HIS A CG  1 
ATOM   3082 N ND1 . HIS A 1 398 ? 14.742  52.885 64.829 1.00 27.85  ? 398  HIS A ND1 1 
ATOM   3083 C CD2 . HIS A 1 398 ? 13.376  53.889 66.205 1.00 27.85  ? 398  HIS A CD2 1 
ATOM   3084 C CE1 . HIS A 1 398 ? 13.659  52.137 64.917 1.00 27.85  ? 398  HIS A CE1 1 
ATOM   3085 N NE2 . HIS A 1 398 ? 12.815  52.723 65.748 1.00 27.85  ? 398  HIS A NE2 1 
ATOM   3086 N N   . ASN A 1 399 ? 14.043  57.124 64.033 1.00 26.29  ? 399  ASN A N   1 
ATOM   3087 C CA  . ASN A 1 399 ? 12.778  57.466 63.419 1.00 26.29  ? 399  ASN A CA  1 
ATOM   3088 C C   . ASN A 1 399 ? 12.783  58.303 62.156 1.00 26.29  ? 399  ASN A C   1 
ATOM   3089 O O   . ASN A 1 399 ? 11.886  58.167 61.336 1.00 26.29  ? 399  ASN A O   1 
ATOM   3090 C CB  . ASN A 1 399 ? 11.895  58.144 64.458 1.00 24.24  ? 399  ASN A CB  1 
ATOM   3091 C CG  . ASN A 1 399 ? 11.448  57.189 65.533 1.00 24.24  ? 399  ASN A CG  1 
ATOM   3092 O OD1 . ASN A 1 399 ? 10.693  56.261 65.263 1.00 24.24  ? 399  ASN A OD1 1 
ATOM   3093 N ND2 . ASN A 1 399 ? 11.917  57.397 66.752 1.00 24.24  ? 399  ASN A ND2 1 
ATOM   3094 N N   . VAL A 1 400 ? 13.788  59.151 61.981 1.00 28.60  ? 400  VAL A N   1 
ATOM   3095 C CA  . VAL A 1 400 ? 13.806  60.027 60.826 1.00 28.60  ? 400  VAL A CA  1 
ATOM   3096 C C   . VAL A 1 400 ? 15.061  59.994 59.962 1.00 28.60  ? 400  VAL A C   1 
ATOM   3097 O O   . VAL A 1 400 ? 15.004  59.629 58.787 1.00 28.60  ? 400  VAL A O   1 
ATOM   3098 C CB  . VAL A 1 400 ? 13.553  61.484 61.275 1.00 27.48  ? 400  VAL A CB  1 
ATOM   3099 C CG1 . VAL A 1 400 ? 13.636  62.425 60.094 1.00 27.48  ? 400  VAL A CG1 1 
ATOM   3100 C CG2 . VAL A 1 400 ? 12.194  61.586 61.951 1.00 27.48  ? 400  VAL A CG2 1 
ATOM   3101 N N   . ILE A 1 401 ? 16.191  60.363 60.552 1.00 30.23  ? 401  ILE A N   1 
ATOM   3102 C CA  . ILE A 1 401 ? 17.444  60.432 59.822 1.00 30.23  ? 401  ILE A CA  1 
ATOM   3103 C C   . ILE A 1 401 ? 17.978  59.147 59.198 1.00 30.23  ? 401  ILE A C   1 
ATOM   3104 O O   . ILE A 1 401 ? 18.238  59.128 57.997 1.00 30.23  ? 401  ILE A O   1 
ATOM   3105 C CB  . ILE A 1 401 ? 18.542  61.080 60.685 1.00 26.44  ? 401  ILE A CB  1 
ATOM   3106 C CG1 . ILE A 1 401 ? 18.063  62.458 61.155 1.00 26.44  ? 401  ILE A CG1 1 
ATOM   3107 C CG2 . ILE A 1 401 ? 19.817  61.244 59.869 1.00 26.44  ? 401  ILE A CG2 1 
ATOM   3108 C CD1 . ILE A 1 401 ? 18.938  63.102 62.205 1.00 26.44  ? 401  ILE A CD1 1 
ATOM   3109 N N   . CYS A 1 402 ? 18.152  58.083 59.975 1.00 26.35  ? 402  CYS A N   1 
ATOM   3110 C CA  . CYS A 1 402 ? 18.674  56.855 59.388 1.00 26.35  ? 402  CYS A CA  1 
ATOM   3111 C C   . CYS A 1 402 ? 17.703  56.253 58.358 1.00 26.35  ? 402  CYS A C   1 
ATOM   3112 O O   . CYS A 1 402 ? 18.130  55.680 57.362 1.00 26.35  ? 402  CYS A O   1 
ATOM   3113 C CB  . CYS A 1 402 ? 19.033  55.847 60.484 1.00 30.23  ? 402  CYS A CB  1 
ATOM   3114 N N   . PRO A 1 403 ? 16.381  56.354 58.592 1.00 35.27  ? 403  PRO A N   1 
ATOM   3115 C CA  . PRO A 1 403 ? 15.473  55.788 57.584 1.00 35.27  ? 403  PRO A CA  1 
ATOM   3116 C C   . PRO A 1 403 ? 15.531  56.591 56.268 1.00 35.27  ? 403  PRO A C   1 
ATOM   3117 O O   . PRO A 1 403 ? 15.457  56.016 55.179 1.00 35.27  ? 403  PRO A O   1 
ATOM   3118 C CB  . PRO A 1 403 ? 14.105  55.886 58.254 1.00 27.23  ? 403  PRO A CB  1 
ATOM   3119 C CG  . PRO A 1 403 ? 14.436  55.684 59.679 1.00 27.23  ? 403  PRO A CG  1 
ATOM   3120 C CD  . PRO A 1 403 ? 15.675  56.529 59.873 1.00 27.23  ? 403  PRO A CD  1 
ATOM   3121 N N   . LEU A 1 404 ? 15.667  57.913 56.367 1.00 28.21  ? 404  LEU A N   1 
ATOM   3122 C CA  . LEU A 1 404 ? 15.738  58.739 55.168 1.00 28.21  ? 404  LEU A CA  1 
ATOM   3123 C C   . LEU A 1 404 ? 17.059  58.511 54.408 1.00 28.21  ? 404  LEU A C   1 
ATOM   3124 O O   . LEU A 1 404 ? 17.088  58.559 53.173 1.00 28.21  ? 404  LEU A O   1 
ATOM   3125 C CB  . LEU A 1 404 ? 15.567  60.219 55.526 1.00 32.79  ? 404  LEU A CB  1 
ATOM   3126 C CG  . LEU A 1 404 ? 15.484  61.240 54.382 1.00 32.79  ? 404  LEU A CG  1 
ATOM   3127 C CD1 . LEU A 1 404 ? 14.532  62.373 54.751 1.00 32.79  ? 404  LEU A CD1 1 
ATOM   3128 C CD2 . LEU A 1 404 ? 16.871  61.785 54.082 1.00 32.79  ? 404  LEU A CD2 1 
ATOM   3129 N N   . MET A 1 405 ? 18.143  58.261 55.136 1.00 27.02  ? 405  MET A N   1 
ATOM   3130 C CA  . MET A 1 405 ? 19.415  58.005 54.478 1.00 27.02  ? 405  MET A CA  1 
ATOM   3131 C C   . MET A 1 405 ? 19.379  56.670 53.735 1.00 27.02  ? 405  MET A C   1 
ATOM   3132 O O   . MET A 1 405 ? 19.987  56.525 52.683 1.00 27.02  ? 405  MET A O   1 
ATOM   3133 C CB  . MET A 1 405 ? 20.573  58.031 55.481 1.00 30.92  ? 405  MET A CB  1 
ATOM   3134 C CG  . MET A 1 405 ? 20.918  59.437 55.980 1.00 30.92  ? 405  MET A CG  1 
ATOM   3135 S SD  . MET A 1 405 ? 21.128  60.657 54.649 1.00 30.92  ? 405  MET A SD  1 
ATOM   3136 C CE  . MET A 1 405 ? 22.622  60.045 53.858 1.00 30.92  ? 405  MET A CE  1 
ATOM   3137 N N   . HIS A 1 406 ? 18.652  55.697 54.270 1.00 36.69  ? 406  HIS A N   1 
ATOM   3138 C CA  . HIS A 1 406 ? 18.532  54.405 53.605 1.00 36.69  ? 406  HIS A CA  1 
ATOM   3139 C C   . HIS A 1 406 ? 17.786  54.634 52.273 1.00 36.69  ? 406  HIS A C   1 
ATOM   3140 O O   . HIS A 1 406 ? 18.212  54.169 51.216 1.00 36.69  ? 406  HIS A O   1 
ATOM   3141 C CB  . HIS A 1 406 ? 17.757  53.425 54.491 1.00 43.60  ? 406  HIS A CB  1 
ATOM   3142 C CG  . HIS A 1 406 ? 17.680  52.034 53.939 1.00 43.60  ? 406  HIS A CG  1 
ATOM   3143 N ND1 . HIS A 1 406 ? 18.791  51.233 53.779 1.00 43.60  ? 406  HIS A ND1 1 
ATOM   3144 C CD2 . HIS A 1 406 ? 16.621  51.294 53.529 1.00 43.60  ? 406  HIS A CD2 1 
ATOM   3145 C CE1 . HIS A 1 406 ? 18.420  50.060 53.296 1.00 43.60  ? 406  HIS A CE1 1 
ATOM   3146 N NE2 . HIS A 1 406 ? 17.109  50.070 53.136 1.00 43.60  ? 406  HIS A NE2 1 
ATOM   3147 N N   . PHE A 1 407 ? 16.680  55.368 52.340 1.00 31.50  ? 407  PHE A N   1 
ATOM   3148 C CA  . PHE A 1 407 ? 15.880  55.675 51.159 1.00 31.50  ? 407  PHE A CA  1 
ATOM   3149 C C   . PHE A 1 407 ? 16.699  56.414 50.097 1.00 31.50  ? 407  PHE A C   1 
ATOM   3150 O O   . PHE A 1 407 ? 16.726  56.004 48.944 1.00 31.50  ? 407  PHE A O   1 
ATOM   3151 C CB  . PHE A 1 407 ? 14.669  56.534 51.552 1.00 30.51  ? 407  PHE A CB  1 
ATOM   3152 C CG  . PHE A 1 407 ? 13.844  56.996 50.387 1.00 30.51  ? 407  PHE A CG  1 
ATOM   3153 C CD1 . PHE A 1 407 ? 12.972  56.128 49.747 1.00 30.51  ? 407  PHE A CD1 1 
ATOM   3154 C CD2 . PHE A 1 407 ? 13.935  58.305 49.933 1.00 30.51  ? 407  PHE A CD2 1 
ATOM   3155 C CE1 . PHE A 1 407 ? 12.195  56.556 48.671 1.00 30.51  ? 407  PHE A CE1 1 
ATOM   3156 C CE2 . PHE A 1 407 ? 13.166  58.740 48.858 1.00 30.51  ? 407  PHE A CE2 1 
ATOM   3157 C CZ  . PHE A 1 407 ? 12.292  57.860 48.227 1.00 30.51  ? 407  PHE A CZ  1 
ATOM   3158 N N   . VAL A 1 408 ? 17.366  57.495 50.498 1.00 32.40  ? 408  VAL A N   1 
ATOM   3159 C CA  . VAL A 1 408 ? 18.157  58.294 49.573 1.00 32.40  ? 408  VAL A CA  1 
ATOM   3160 C C   . VAL A 1 408 ? 19.253  57.497 48.897 1.00 32.40  ? 408  VAL A C   1 
ATOM   3161 O O   . VAL A 1 408 ? 19.508  57.684 47.714 1.00 32.40  ? 408  VAL A O   1 
ATOM   3162 C CB  . VAL A 1 408 ? 18.797  59.519 50.268 1.00 42.24  ? 408  VAL A CB  1 
ATOM   3163 C CG1 . VAL A 1 408 ? 19.792  59.071 51.299 1.00 42.24  ? 408  VAL A CG1 1 
ATOM   3164 C CG2 . VAL A 1 408 ? 19.482  60.410 49.232 1.00 42.24  ? 408  VAL A CG2 1 
ATOM   3165 N N   . ASN A 1 409 ? 19.909  56.614 49.639 1.00 39.54  ? 409  ASN A N   1 
ATOM   3166 C CA  . ASN A 1 409 ? 20.966  55.812 49.047 1.00 39.54  ? 409  ASN A CA  1 
ATOM   3167 C C   . ASN A 1 409 ? 20.401  54.744 48.122 1.00 39.54  ? 409  ASN A C   1 
ATOM   3168 O O   . ASN A 1 409 ? 21.035  54.385 47.136 1.00 39.54  ? 409  ASN A O   1 
ATOM   3169 C CB  . ASN A 1 409 ? 21.845  55.193 50.131 1.00 40.38  ? 409  ASN A CB  1 
ATOM   3170 C CG  . ASN A 1 409 ? 22.968  56.131 50.565 1.00 40.38  ? 409  ASN A CG  1 
ATOM   3171 O OD1 . ASN A 1 409 ? 23.818  56.500 49.760 1.00 40.38  ? 409  ASN A OD1 1 
ATOM   3172 N ND2 . ASN A 1 409 ? 22.968  56.524 51.832 1.00 40.38  ? 409  ASN A ND2 1 
ATOM   3173 N N   . LYS A 1 410 ? 19.209  54.240 48.427 1.00 36.28  ? 410  LYS A N   1 
ATOM   3174 C CA  . LYS A 1 410 ? 18.578  53.239 47.568 1.00 36.28  ? 410  LYS A CA  1 
ATOM   3175 C C   . LYS A 1 410 ? 18.020  53.903 46.297 1.00 36.28  ? 410  LYS A C   1 
ATOM   3176 O O   . LYS A 1 410 ? 18.159  53.374 45.188 1.00 36.28  ? 410  LYS A O   1 
ATOM   3177 C CB  . LYS A 1 410 ? 17.437  52.544 48.311 1.00 48.62  ? 410  LYS A CB  1 
ATOM   3178 C CG  . LYS A 1 410 ? 17.873  51.567 49.387 1.00 48.62  ? 410  LYS A CG  1 
ATOM   3179 C CD  . LYS A 1 410 ? 18.565  50.389 48.758 1.00 48.62  ? 410  LYS A CD  1 
ATOM   3180 C CE  . LYS A 1 410 ? 19.071  49.415 49.798 1.00 48.62  ? 410  LYS A CE  1 
ATOM   3181 N NZ  . LYS A 1 410 ? 19.874  48.353 49.119 1.00 48.62  ? 410  LYS A NZ  1 
ATOM   3182 N N   . TYR A 1 411 ? 17.402  55.069 46.472 1.00 36.06  ? 411  TYR A N   1 
ATOM   3183 C CA  . TYR A 1 411 ? 16.805  55.813 45.372 1.00 36.06  ? 411  TYR A CA  1 
ATOM   3184 C C   . TYR A 1 411 ? 17.838  56.326 44.378 1.00 36.06  ? 411  TYR A C   1 
ATOM   3185 O O   . TYR A 1 411 ? 17.688  56.175 43.163 1.00 36.06  ? 411  TYR A O   1 
ATOM   3186 C CB  . TYR A 1 411 ? 16.009  57.013 45.904 1.00 32.19  ? 411  TYR A CB  1 
ATOM   3187 C CG  . TYR A 1 411 ? 15.205  57.698 44.829 1.00 32.19  ? 411  TYR A CG  1 
ATOM   3188 C CD1 . TYR A 1 411 ? 15.774  58.697 44.034 1.00 32.19  ? 411  TYR A CD1 1 
ATOM   3189 C CD2 . TYR A 1 411 ? 13.905  57.286 44.547 1.00 32.19  ? 411  TYR A CD2 1 
ATOM   3190 C CE1 . TYR A 1 411 ? 15.066  59.261 42.976 1.00 32.19  ? 411  TYR A CE1 1 
ATOM   3191 C CE2 . TYR A 1 411 ? 13.184  57.838 43.499 1.00 32.19  ? 411  TYR A CE2 1 
ATOM   3192 C CZ  . TYR A 1 411 ? 13.767  58.823 42.712 1.00 32.19  ? 411  TYR A CZ  1 
ATOM   3193 O OH  . TYR A 1 411 ? 13.058  59.347 41.659 1.00 32.19  ? 411  TYR A OH  1 
ATOM   3194 N N   . THR A 1 412 ? 18.879  56.947 44.908 1.00 37.09  ? 412  THR A N   1 
ATOM   3195 C CA  . THR A 1 412 ? 19.935  57.512 44.092 1.00 37.09  ? 412  THR A CA  1 
ATOM   3196 C C   . THR A 1 412 ? 20.553  56.530 43.095 1.00 37.09  ? 412  THR A C   1 
ATOM   3197 O O   . THR A 1 412 ? 21.092  56.943 42.070 1.00 37.09  ? 412  THR A O   1 
ATOM   3198 C CB  . THR A 1 412 ? 21.017  58.124 44.999 1.00 34.56  ? 412  THR A CB  1 
ATOM   3199 O OG1 . THR A 1 412 ? 20.467  59.276 45.651 1.00 34.56  ? 412  THR A OG1 1 
ATOM   3200 C CG2 . THR A 1 412 ? 22.241  58.531 44.204 1.00 34.56  ? 412  THR A CG2 1 
ATOM   3201 N N   . LYS A 1 413 ? 20.470  55.236 43.378 1.00 40.18  ? 413  LYS A N   1 
ATOM   3202 C CA  . LYS A 1 413 ? 21.019  54.255 42.448 1.00 40.18  ? 413  LYS A CA  1 
ATOM   3203 C C   . LYS A 1 413 ? 20.212  54.194 41.141 1.00 40.18  ? 413  LYS A C   1 
ATOM   3204 O O   . LYS A 1 413 ? 20.748  53.817 40.104 1.00 40.18  ? 413  LYS A O   1 
ATOM   3205 C CB  . LYS A 1 413 ? 21.060  52.862 43.079 1.00 68.62  ? 413  LYS A CB  1 
ATOM   3206 C CG  . LYS A 1 413 ? 21.521  51.785 42.101 1.00 68.62  ? 413  LYS A CG  1 
ATOM   3207 C CD  . LYS A 1 413 ? 21.564  50.398 42.760 1.00 68.62  ? 413  LYS A CD  1 
ATOM   3208 C CE  . LYS A 1 413 ? 22.147  49.370 41.800 1.00 68.62  ? 413  LYS A CE  1 
ATOM   3209 N NZ  . LYS A 1 413 ? 21.518  49.492 40.438 1.00 68.62  ? 413  LYS A NZ  1 
ATOM   3210 N N   . PHE A 1 414 ? 18.930  54.557 41.193 1.00 39.36  ? 414  PHE A N   1 
ATOM   3211 C CA  . PHE A 1 414 ? 18.085  54.545 39.995 1.00 39.36  ? 414  PHE A CA  1 
ATOM   3212 C C   . PHE A 1 414 ? 17.524  55.912 39.586 1.00 39.36  ? 414  PHE A C   1 
ATOM   3213 O O   . PHE A 1 414 ? 16.996  56.051 38.488 1.00 39.36  ? 414  PHE A O   1 
ATOM   3214 C CB  . PHE A 1 414 ? 16.892  53.608 40.171 1.00 37.26  ? 414  PHE A CB  1 
ATOM   3215 C CG  . PHE A 1 414 ? 17.259  52.175 40.387 1.00 37.26  ? 414  PHE A CG  1 
ATOM   3216 C CD1 . PHE A 1 414 ? 17.463  51.684 41.667 1.00 37.26  ? 414  PHE A CD1 1 
ATOM   3217 C CD2 . PHE A 1 414 ? 17.348  51.298 39.306 1.00 37.26  ? 414  PHE A CD2 1 
ATOM   3218 C CE1 . PHE A 1 414 ? 17.745  50.342 41.877 1.00 37.26  ? 414  PHE A CE1 1 
ATOM   3219 C CE2 . PHE A 1 414 ? 17.632  49.948 39.501 1.00 37.26  ? 414  PHE A CE2 1 
ATOM   3220 C CZ  . PHE A 1 414 ? 17.830  49.467 40.790 1.00 37.26  ? 414  PHE A CZ  1 
ATOM   3221 N N   . GLY A 1 415 ? 17.631  56.912 40.458 1.00 31.87  ? 415  GLY A N   1 
ATOM   3222 C CA  . GLY A 1 415 ? 17.081  58.226 40.146 1.00 31.87  ? 415  GLY A CA  1 
ATOM   3223 C C   . GLY A 1 415 ? 17.813  59.035 39.092 1.00 31.87  ? 415  GLY A C   1 
ATOM   3224 O O   . GLY A 1 415 ? 18.847  58.613 38.581 1.00 31.87  ? 415  GLY A O   1 
ATOM   3225 N N   . ASN A 1 416 ? 17.276  60.209 38.775 1.00 32.65  ? 416  ASN A N   1 
ATOM   3226 C CA  . ASN A 1 416 ? 17.883  61.082 37.779 1.00 32.65  ? 416  ASN A CA  1 
ATOM   3227 C C   . ASN A 1 416 ? 18.424  62.370 38.415 1.00 32.65  ? 416  ASN A C   1 
ATOM   3228 O O   . ASN A 1 416 ? 18.658  63.361 37.724 1.00 32.65  ? 416  ASN A O   1 
ATOM   3229 C CB  . ASN A 1 416 ? 16.850  61.396 36.684 1.00 38.92  ? 416  ASN A CB  1 
ATOM   3230 C CG  . ASN A 1 416 ? 17.405  62.269 35.563 1.00 38.92  ? 416  ASN A CG  1 
ATOM   3231 O OD1 . ASN A 1 416 ? 16.918  63.382 35.344 1.00 38.92  ? 416  ASN A OD1 1 
ATOM   3232 N ND2 . ASN A 1 416 ? 18.414  61.768 34.842 1.00 38.92  ? 416  ASN A ND2 1 
ATOM   3233 N N   . GLY A 1 417 ? 18.637  62.341 39.733 1.00 33.58  ? 417  GLY A N   1 
ATOM   3234 C CA  . GLY A 1 417 ? 19.163  63.498 40.442 1.00 33.58  ? 417  GLY A CA  1 
ATOM   3235 C C   . GLY A 1 417 ? 18.686  63.624 41.881 1.00 33.58  ? 417  GLY A C   1 
ATOM   3236 O O   . GLY A 1 417 ? 17.478  63.665 42.146 1.00 33.58  ? 417  GLY A O   1 
ATOM   3237 N N   . THR A 1 418 ? 19.629  63.701 42.810 1.00 31.47  ? 418  THR A N   1 
ATOM   3238 C CA  . THR A 1 418 ? 19.301  63.815 44.224 1.00 31.47  ? 418  THR A CA  1 
ATOM   3239 C C   . THR A 1 418 ? 20.018  64.995 44.882 1.00 31.47  ? 418  THR A C   1 
ATOM   3240 O O   . THR A 1 418 ? 21.208  65.199 44.650 1.00 31.47  ? 418  THR A O   1 
ATOM   3241 C CB  . THR A 1 418 ? 19.707  62.524 44.983 1.00 31.80  ? 418  THR A CB  1 
ATOM   3242 O OG1 . THR A 1 418 ? 19.088  61.386 44.370 1.00 31.80  ? 418  THR A OG1 1 
ATOM   3243 C CG2 . THR A 1 418 ? 19.284  62.609 46.447 1.00 31.80  ? 418  THR A CG2 1 
ATOM   3244 N N   . TYR A 1 419 ? 19.292  65.762 45.696 1.00 29.12  ? 419  TYR A N   1 
ATOM   3245 C CA  . TYR A 1 419 ? 19.856  66.911 46.425 1.00 29.12  ? 419  TYR A CA  1 
ATOM   3246 C C   . TYR A 1 419 ? 19.488  66.779 47.908 1.00 29.12  ? 419  TYR A C   1 
ATOM   3247 O O   . TYR A 1 419 ? 18.311  66.757 48.262 1.00 29.12  ? 419  TYR A O   1 
ATOM   3248 C CB  . TYR A 1 419 ? 19.316  68.231 45.868 1.00 33.61  ? 419  TYR A CB  1 
ATOM   3249 C CG  . TYR A 1 419 ? 19.745  68.494 44.447 1.00 33.61  ? 419  TYR A CG  1 
ATOM   3250 C CD1 . TYR A 1 419 ? 20.971  69.099 44.164 1.00 33.61  ? 419  TYR A CD1 1 
ATOM   3251 C CD2 . TYR A 1 419 ? 18.948  68.086 43.375 1.00 33.61  ? 419  TYR A CD2 1 
ATOM   3252 C CE1 . TYR A 1 419 ? 21.389  69.286 42.854 1.00 33.61  ? 419  TYR A CE1 1 
ATOM   3253 C CE2 . TYR A 1 419 ? 19.360  68.264 42.071 1.00 33.61  ? 419  TYR A CE2 1 
ATOM   3254 C CZ  . TYR A 1 419 ? 20.580  68.864 41.813 1.00 33.61  ? 419  TYR A CZ  1 
ATOM   3255 O OH  . TYR A 1 419 ? 20.986  69.025 40.508 1.00 33.61  ? 419  TYR A OH  1 
ATOM   3256 N N   . LEU A 1 420 ? 20.503  66.705 48.763 1.00 25.76  ? 420  LEU A N   1 
ATOM   3257 C CA  . LEU A 1 420 ? 20.305  66.514 50.193 1.00 25.76  ? 420  LEU A CA  1 
ATOM   3258 C C   . LEU A 1 420 ? 20.745  67.685 51.073 1.00 25.76  ? 420  LEU A C   1 
ATOM   3259 O O   . LEU A 1 420 ? 21.766  68.320 50.826 1.00 25.76  ? 420  LEU A O   1 
ATOM   3260 C CB  . LEU A 1 420 ? 21.037  65.233 50.615 1.00 28.44  ? 420  LEU A CB  1 
ATOM   3261 C CG  . LEU A 1 420 ? 20.981  64.745 52.060 1.00 28.44  ? 420  LEU A CG  1 
ATOM   3262 C CD1 . LEU A 1 420 ? 19.535  64.531 52.469 1.00 28.44  ? 420  LEU A CD1 1 
ATOM   3263 C CD2 . LEU A 1 420 ? 21.769  63.445 52.199 1.00 28.44  ? 420  LEU A CD2 1 
ATOM   3264 N N   . TYR A 1 421 ? 19.963  67.959 52.110 1.00 26.02  ? 421  TYR A N   1 
ATOM   3265 C CA  . TYR A 1 421 ? 20.267  69.048 53.035 1.00 26.02  ? 421  TYR A CA  1 
ATOM   3266 C C   . TYR A 1 421 ? 20.163  68.615 54.507 1.00 26.02  ? 421  TYR A C   1 
ATOM   3267 O O   . TYR A 1 421 ? 19.567  67.586 54.831 1.00 26.02  ? 421  TYR A O   1 
ATOM   3268 C CB  . TYR A 1 421 ? 19.315  70.226 52.790 1.00 29.28  ? 421  TYR A CB  1 
ATOM   3269 C CG  . TYR A 1 421 ? 17.891  70.007 53.281 1.00 29.28  ? 421  TYR A CG  1 
ATOM   3270 C CD1 . TYR A 1 421 ? 17.555  70.197 54.627 1.00 29.28  ? 421  TYR A CD1 1 
ATOM   3271 C CD2 . TYR A 1 421 ? 16.887  69.582 52.407 1.00 29.28  ? 421  TYR A CD2 1 
ATOM   3272 C CE1 . TYR A 1 421 ? 16.253  69.964 55.087 1.00 29.28  ? 421  TYR A CE1 1 
ATOM   3273 C CE2 . TYR A 1 421 ? 15.589  69.349 52.853 1.00 29.28  ? 421  TYR A CE2 1 
ATOM   3274 C CZ  . TYR A 1 421 ? 15.276  69.539 54.193 1.00 29.28  ? 421  TYR A CZ  1 
ATOM   3275 O OH  . TYR A 1 421 ? 13.995  69.291 54.638 1.00 29.28  ? 421  TYR A OH  1 
ATOM   3276 N N   . PHE A 1 422 ? 20.753  69.423 55.381 1.00 31.75  ? 422  PHE A N   1 
ATOM   3277 C CA  . PHE A 1 422 ? 20.727  69.195 56.820 1.00 31.75  ? 422  PHE A CA  1 
ATOM   3278 C C   . PHE A 1 422 ? 20.415  70.573 57.397 1.00 31.75  ? 422  PHE A C   1 
ATOM   3279 O O   . PHE A 1 422 ? 21.267  71.460 57.390 1.00 31.75  ? 422  PHE A O   1 
ATOM   3280 C CB  . PHE A 1 422 ? 22.092  68.705 57.312 1.00 33.99  ? 422  PHE A CB  1 
ATOM   3281 C CG  . PHE A 1 422 ? 22.129  68.329 58.778 1.00 33.99  ? 422  PHE A CG  1 
ATOM   3282 C CD1 . PHE A 1 422 ? 21.499  67.170 59.235 1.00 33.99  ? 422  PHE A CD1 1 
ATOM   3283 C CD2 . PHE A 1 422 ? 22.832  69.114 59.692 1.00 33.99  ? 422  PHE A CD2 1 
ATOM   3284 C CE1 . PHE A 1 422 ? 21.570  66.789 60.584 1.00 33.99  ? 422  PHE A CE1 1 
ATOM   3285 C CE2 . PHE A 1 422 ? 22.913  68.750 61.041 1.00 33.99  ? 422  PHE A CE2 1 
ATOM   3286 C CZ  . PHE A 1 422 ? 22.280  67.580 61.492 1.00 33.99  ? 422  PHE A CZ  1 
ATOM   3287 N N   . PHE A 1 423 ? 19.184  70.756 57.862 1.00 31.49  ? 423  PHE A N   1 
ATOM   3288 C CA  . PHE A 1 423 ? 18.751  72.027 58.420 1.00 31.49  ? 423  PHE A CA  1 
ATOM   3289 C C   . PHE A 1 423 ? 19.141  72.120 59.893 1.00 31.49  ? 423  PHE A C   1 
ATOM   3290 O O   . PHE A 1 423 ? 18.617  71.386 60.731 1.00 31.49  ? 423  PHE A O   1 
ATOM   3291 C CB  . PHE A 1 423 ? 17.234  72.165 58.271 1.00 31.00  ? 423  PHE A CB  1 
ATOM   3292 C CG  . PHE A 1 423 ? 16.705  73.496 58.701 1.00 31.00  ? 423  PHE A CG  1 
ATOM   3293 C CD1 . PHE A 1 423 ? 16.810  74.600 57.868 1.00 31.00  ? 423  PHE A CD1 1 
ATOM   3294 C CD2 . PHE A 1 423 ? 16.120  73.651 59.954 1.00 31.00  ? 423  PHE A CD2 1 
ATOM   3295 C CE1 . PHE A 1 423 ? 16.341  75.845 58.274 1.00 31.00  ? 423  PHE A CE1 1 
ATOM   3296 C CE2 . PHE A 1 423 ? 15.645  74.896 60.375 1.00 31.00  ? 423  PHE A CE2 1 
ATOM   3297 C CZ  . PHE A 1 423 ? 15.757  75.998 59.530 1.00 31.00  ? 423  PHE A CZ  1 
ATOM   3298 N N   . ASN A 1 424 ? 20.055  73.027 60.219 1.00 41.21  ? 424  ASN A N   1 
ATOM   3299 C CA  . ASN A 1 424 ? 20.471  73.146 61.605 1.00 41.21  ? 424  ASN A CA  1 
ATOM   3300 C C   . ASN A 1 424 ? 20.457  74.559 62.161 1.00 41.21  ? 424  ASN A C   1 
ATOM   3301 O O   . ASN A 1 424 ? 21.331  74.937 62.936 1.00 41.21  ? 424  ASN A O   1 
ATOM   3302 C CB  . ASN A 1 424 ? 21.853  72.502 61.814 1.00 33.72  ? 424  ASN A CB  1 
ATOM   3303 C CG  . ASN A 1 424 ? 22.922  73.093 60.920 1.00 33.72  ? 424  ASN A CG  1 
ATOM   3304 O OD1 . ASN A 1 424 ? 22.622  73.788 59.951 1.00 33.72  ? 424  ASN A OD1 1 
ATOM   3305 N ND2 . ASN A 1 424 ? 24.182  72.804 61.233 1.00 33.72  ? 424  ASN A ND2 1 
ATOM   3306 N N   . HIS A 1 425 ? 19.460  75.345 61.773 1.00 38.77  ? 425  HIS A N   1 
ATOM   3307 C CA  . HIS A 1 425 ? 19.353  76.697 62.309 1.00 38.77  ? 425  HIS A CA  1 
ATOM   3308 C C   . HIS A 1 425 ? 18.174  76.784 63.261 1.00 38.77  ? 425  HIS A C   1 
ATOM   3309 O O   . HIS A 1 425 ? 17.038  76.501 62.878 1.00 38.77  ? 425  HIS A O   1 
ATOM   3310 C CB  . HIS A 1 425 ? 19.137  77.740 61.213 1.00 40.35  ? 425  HIS A CB  1 
ATOM   3311 C CG  . HIS A 1 425 ? 18.895  79.119 61.754 1.00 40.35  ? 425  HIS A CG  1 
ATOM   3312 N ND1 . HIS A 1 425 ? 19.864  79.834 62.426 1.00 40.35  ? 425  HIS A ND1 1 
ATOM   3313 C CD2 . HIS A 1 425 ? 17.771  79.872 61.809 1.00 40.35  ? 425  HIS A CD2 1 
ATOM   3314 C CE1 . HIS A 1 425 ? 19.348  80.963 62.877 1.00 40.35  ? 425  HIS A CE1 1 
ATOM   3315 N NE2 . HIS A 1 425 ? 18.078  81.011 62.517 1.00 40.35  ? 425  HIS A NE2 1 
ATOM   3316 N N   . ARG A 1 426 ? 18.427  77.179 64.500 1.00 38.94  ? 426  ARG A N   1 
ATOM   3317 C CA  . ARG A 1 426 ? 17.324  77.319 65.436 1.00 38.94  ? 426  ARG A CA  1 
ATOM   3318 C C   . ARG A 1 426 ? 16.778  78.747 65.334 1.00 38.94  ? 426  ARG A C   1 
ATOM   3319 O O   . ARG A 1 426 ? 17.487  79.704 65.630 1.00 38.94  ? 426  ARG A O   1 
ATOM   3320 C CB  . ARG A 1 426 ? 17.775  77.032 66.876 1.00 41.96  ? 426  ARG A CB  1 
ATOM   3321 C CG  . ARG A 1 426 ? 16.612  77.085 67.879 1.00 41.96  ? 426  ARG A CG  1 
ATOM   3322 C CD  . ARG A 1 426 ? 17.098  76.981 69.298 1.00 41.96  ? 426  ARG A CD  1 
ATOM   3323 N NE  . ARG A 1 426 ? 16.176  77.609 70.241 1.00 41.96  ? 426  ARG A NE  1 
ATOM   3324 C CZ  . ARG A 1 426 ? 15.241  76.967 70.937 1.00 41.96  ? 426  ARG A CZ  1 
ATOM   3325 N NH1 . ARG A 1 426 ? 15.080  75.652 70.808 1.00 41.96  ? 426  ARG A NH1 1 
ATOM   3326 N NH2 . ARG A 1 426 ? 14.466  77.645 71.771 1.00 41.96  ? 426  ARG A NH2 1 
ATOM   3327 N N   . ALA A 1 427 ? 15.523  78.883 64.905 1.00 45.92  ? 427  ALA A N   1 
ATOM   3328 C CA  . ALA A 1 427 ? 14.882  80.196 64.776 1.00 45.92  ? 427  ALA A CA  1 
ATOM   3329 C C   . ALA A 1 427 ? 15.078  81.017 66.051 1.00 45.92  ? 427  ALA A C   1 
ATOM   3330 O O   . ALA A 1 427 ? 14.988  80.483 67.158 1.00 45.92  ? 427  ALA A O   1 
ATOM   3331 C CB  . ALA A 1 427 ? 13.389  80.027 64.486 1.00 30.36  ? 427  ALA A CB  1 
ATOM   3332 N N   . SER A 1 428 ? 15.329  82.314 65.898 1.00 47.16  ? 428  SER A N   1 
ATOM   3333 C CA  . SER A 1 428 ? 15.555  83.191 67.051 1.00 47.16  ? 428  SER A CA  1 
ATOM   3334 C C   . SER A 1 428 ? 14.311  83.470 67.898 1.00 47.16  ? 428  SER A C   1 
ATOM   3335 O O   . SER A 1 428 ? 14.427  83.834 69.072 1.00 47.16  ? 428  SER A O   1 
ATOM   3336 C CB  . SER A 1 428 ? 16.144  84.527 66.586 1.00 53.90  ? 428  SER A CB  1 
ATOM   3337 O OG  . SER A 1 428 ? 15.263  85.169 65.671 1.00 53.90  ? 428  SER A OG  1 
ATOM   3338 N N   . ASN A 1 429 ? 13.129  83.296 67.309 1.00 42.37  ? 429  ASN A N   1 
ATOM   3339 C CA  . ASN A 1 429 ? 11.869  83.557 68.016 1.00 42.37  ? 429  ASN A CA  1 
ATOM   3340 C C   . ASN A 1 429 ? 11.145  82.298 68.505 1.00 42.37  ? 429  ASN A C   1 
ATOM   3341 O O   . ASN A 1 429 ? 9.948   82.349 68.793 1.00 42.37  ? 429  ASN A O   1 
ATOM   3342 C CB  . ASN A 1 429 ? 10.914  84.348 67.109 1.00 48.40  ? 429  ASN A CB  1 
ATOM   3343 C CG  . ASN A 1 429 ? 10.804  83.741 65.713 1.00 48.40  ? 429  ASN A CG  1 
ATOM   3344 O OD1 . ASN A 1 429 ? 11.197  82.591 65.502 1.00 48.40  ? 429  ASN A OD1 1 
ATOM   3345 N ND2 . ASN A 1 429 ? 10.267  84.506 64.758 1.00 48.40  ? 429  ASN A ND2 1 
ATOM   3346 N N   . LEU A 1 430 ? 11.854  81.176 68.606 1.00 41.20  ? 430  LEU A N   1 
ATOM   3347 C CA  . LEU A 1 430 ? 11.211  79.943 69.051 1.00 41.20  ? 430  LEU A CA  1 
ATOM   3348 C C   . LEU A 1 430 ? 10.753  80.054 70.504 1.00 41.20  ? 430  LEU A C   1 
ATOM   3349 O O   . LEU A 1 430 ? 11.483  80.559 71.358 1.00 41.20  ? 430  LEU A O   1 
ATOM   3350 C CB  . LEU A 1 430 ? 12.164  78.750 68.880 1.00 53.20  ? 430  LEU A CB  1 
ATOM   3351 C CG  . LEU A 1 430 ? 11.828  77.784 67.730 1.00 53.20  ? 430  LEU A CG  1 
ATOM   3352 C CD1 . LEU A 1 430 ? 12.921  76.744 67.597 1.00 53.20  ? 430  LEU A CD1 1 
ATOM   3353 C CD2 . LEU A 1 430 ? 10.493  77.089 67.993 1.00 53.20  ? 430  LEU A CD2 1 
ATOM   3354 N N   . VAL A 1 431 ? 9.540   79.586 70.780 1.00 37.15  ? 431  VAL A N   1 
ATOM   3355 C CA  . VAL A 1 431 ? 8.998   79.648 72.134 1.00 37.15  ? 431  VAL A CA  1 
ATOM   3356 C C   . VAL A 1 431 ? 9.293   78.383 72.938 1.00 37.15  ? 431  VAL A C   1 
ATOM   3357 O O   . VAL A 1 431 ? 9.113   78.361 74.154 1.00 37.15  ? 431  VAL A O   1 
ATOM   3358 C CB  . VAL A 1 431 ? 7.469   79.903 72.120 1.00 45.95  ? 431  VAL A CB  1 
ATOM   3359 C CG1 . VAL A 1 431 ? 7.185   81.285 71.549 1.00 45.95  ? 431  VAL A CG1 1 
ATOM   3360 C CG2 . VAL A 1 431 ? 6.765   78.836 71.292 1.00 45.95  ? 431  VAL A CG2 1 
ATOM   3361 N N   . TRP A 1 432 ? 9.740   77.330 72.251 1.00 38.31  ? 432  TRP A N   1 
ATOM   3362 C CA  . TRP A 1 432 ? 10.103  76.074 72.907 1.00 38.31  ? 432  TRP A CA  1 
ATOM   3363 C C   . TRP A 1 432 ? 11.462  76.259 73.602 1.00 38.31  ? 432  TRP A C   1 
ATOM   3364 O O   . TRP A 1 432 ? 12.266  77.097 73.196 1.00 38.31  ? 432  TRP A O   1 
ATOM   3365 C CB  . TRP A 1 432 ? 10.194  74.940 71.881 1.00 33.08  ? 432  TRP A CB  1 
ATOM   3366 C CG  . TRP A 1 432 ? 8.877   74.594 71.224 1.00 33.08  ? 432  TRP A CG  1 
ATOM   3367 C CD1 . TRP A 1 432 ? 8.452   74.973 69.983 1.00 33.08  ? 432  TRP A CD1 1 
ATOM   3368 C CD2 . TRP A 1 432 ? 7.817   73.819 71.792 1.00 33.08  ? 432  TRP A CD2 1 
ATOM   3369 N NE1 . TRP A 1 432 ? 7.193   74.483 69.743 1.00 33.08  ? 432  TRP A NE1 1 
ATOM   3370 C CE2 . TRP A 1 432 ? 6.778   73.770 70.837 1.00 33.08  ? 432  TRP A CE2 1 
ATOM   3371 C CE3 . TRP A 1 432 ? 7.641   73.163 73.018 1.00 33.08  ? 432  TRP A CE3 1 
ATOM   3372 C CZ2 . TRP A 1 432 ? 5.576   73.087 71.069 1.00 33.08  ? 432  TRP A CZ2 1 
ATOM   3373 C CZ3 . TRP A 1 432 ? 6.445   72.485 73.252 1.00 33.08  ? 432  TRP A CZ3 1 
ATOM   3374 C CH2 . TRP A 1 432 ? 5.429   72.454 72.279 1.00 33.08  ? 432  TRP A CH2 1 
ATOM   3375 N N   . PRO A 1 433 ? 11.739  75.474 74.658 1.00 36.02  ? 433  PRO A N   1 
ATOM   3376 C CA  . PRO A 1 433 ? 13.021  75.612 75.361 1.00 36.02  ? 433  PRO A CA  1 
ATOM   3377 C C   . PRO A 1 433 ? 14.242  75.330 74.495 1.00 36.02  ? 433  PRO A C   1 
ATOM   3378 O O   . PRO A 1 433 ? 14.135  74.704 73.444 1.00 36.02  ? 433  PRO A O   1 
ATOM   3379 C CB  . PRO A 1 433 ? 12.881  74.636 76.526 1.00 30.92  ? 433  PRO A CB  1 
ATOM   3380 C CG  . PRO A 1 433 ? 11.938  73.578 75.968 1.00 30.92  ? 433  PRO A CG  1 
ATOM   3381 C CD  . PRO A 1 433 ? 10.915  74.406 75.255 1.00 30.92  ? 433  PRO A CD  1 
ATOM   3382 N N   . GLU A 1 434 ? 15.405  75.787 74.956 1.00 36.85  ? 434  GLU A N   1 
ATOM   3383 C CA  . GLU A 1 434 ? 16.664  75.617 74.231 1.00 36.85  ? 434  GLU A CA  1 
ATOM   3384 C C   . GLU A 1 434 ? 17.096  74.171 74.046 1.00 36.85  ? 434  GLU A C   1 
ATOM   3385 O O   . GLU A 1 434 ? 17.605  73.808 72.987 1.00 36.85  ? 434  GLU A O   1 
ATOM   3386 C CB  . GLU A 1 434 ? 17.808  76.360 74.941 1.00 80.39  ? 434  GLU A CB  1 
ATOM   3387 C CG  . GLU A 1 434 ? 17.649  77.870 75.050 1.00 80.39  ? 434  GLU A CG  1 
ATOM   3388 C CD  . GLU A 1 434 ? 17.563  78.571 73.702 1.00 80.39  ? 434  GLU A CD  1 
ATOM   3389 O OE1 . GLU A 1 434 ? 18.507  78.455 72.883 1.00 80.39  ? 434  GLU A OE1 1 
ATOM   3390 O OE2 . GLU A 1 434 ? 16.538  79.256 73.462 1.00 80.39  ? 434  GLU A OE2 1 
ATOM   3391 N N   . TRP A 1 435 ? 16.908  73.343 75.070 1.00 33.08  ? 435  TRP A N   1 
ATOM   3392 C CA  . TRP A 1 435 ? 17.348  71.954 74.973 1.00 33.08  ? 435  TRP A CA  1 
ATOM   3393 C C   . TRP A 1 435 ? 16.729  71.178 73.807 1.00 33.08  ? 435  TRP A C   1 
ATOM   3394 O O   . TRP A 1 435 ? 17.270  70.167 73.368 1.00 33.08  ? 435  TRP A O   1 
ATOM   3395 C CB  . TRP A 1 435 ? 17.131  71.209 76.305 1.00 34.21  ? 435  TRP A CB  1 
ATOM   3396 C CG  . TRP A 1 435 ? 15.718  70.935 76.680 1.00 34.21  ? 435  TRP A CG  1 
ATOM   3397 C CD1 . TRP A 1 435 ? 14.947  71.649 77.549 1.00 34.21  ? 435  TRP A CD1 1 
ATOM   3398 C CD2 . TRP A 1 435 ? 14.895  69.868 76.196 1.00 34.21  ? 435  TRP A CD2 1 
ATOM   3399 N NE1 . TRP A 1 435 ? 13.692  71.095 77.636 1.00 34.21  ? 435  TRP A NE1 1 
ATOM   3400 C CE2 . TRP A 1 435 ? 13.632  70.001 76.815 1.00 34.21  ? 435  TRP A CE2 1 
ATOM   3401 C CE3 . TRP A 1 435 ? 15.100  68.812 75.295 1.00 34.21  ? 435  TRP A CE3 1 
ATOM   3402 C CZ2 . TRP A 1 435 ? 12.578  69.121 76.563 1.00 34.21  ? 435  TRP A CZ2 1 
ATOM   3403 C CZ3 . TRP A 1 435 ? 14.046  67.934 75.041 1.00 34.21  ? 435  TRP A CZ3 1 
ATOM   3404 C CH2 . TRP A 1 435 ? 12.802  68.097 75.674 1.00 34.21  ? 435  TRP A CH2 1 
ATOM   3405 N N   . MET A 1 436 ? 15.614  71.661 73.280 1.00 31.55  ? 436  MET A N   1 
ATOM   3406 C CA  . MET A 1 436 ? 14.979  70.960 72.171 1.00 31.55  ? 436  MET A CA  1 
ATOM   3407 C C   . MET A 1 436 ? 15.674  71.216 70.829 1.00 31.55  ? 436  MET A C   1 
ATOM   3408 O O   . MET A 1 436 ? 15.468  70.473 69.877 1.00 31.55  ? 436  MET A O   1 
ATOM   3409 C CB  . MET A 1 436 ? 13.494  71.331 72.105 1.00 36.35  ? 436  MET A CB  1 
ATOM   3410 C CG  . MET A 1 436 ? 12.716  70.845 73.319 1.00 36.35  ? 436  MET A CG  1 
ATOM   3411 S SD  . MET A 1 436 ? 11.009  71.400 73.332 1.00 36.35  ? 436  MET A SD  1 
ATOM   3412 C CE  . MET A 1 436 ? 10.227  70.155 72.275 1.00 36.35  ? 436  MET A CE  1 
ATOM   3413 N N   . GLY A 1 437 ? 16.495  72.263 70.763 1.00 33.53  ? 437  GLY A N   1 
ATOM   3414 C CA  . GLY A 1 437 ? 17.236  72.583 69.544 1.00 33.53  ? 437  GLY A CA  1 
ATOM   3415 C C   . GLY A 1 437 ? 16.477  72.938 68.270 1.00 33.53  ? 437  GLY A C   1 
ATOM   3416 O O   . GLY A 1 437 ? 15.531  73.719 68.291 1.00 33.53  ? 437  GLY A O   1 
ATOM   3417 N N   . VAL A 1 438 ? 16.923  72.374 67.152 1.00 31.54  ? 438  VAL A N   1 
ATOM   3418 C CA  . VAL A 1 438 ? 16.307  72.597 65.845 1.00 31.54  ? 438  VAL A CA  1 
ATOM   3419 C C   . VAL A 1 438 ? 15.191  71.568 65.742 1.00 31.54  ? 438  VAL A C   1 
ATOM   3420 O O   . VAL A 1 438 ? 15.387  70.450 65.248 1.00 31.54  ? 438  VAL A O   1 
ATOM   3421 C CB  . VAL A 1 438 ? 17.334  72.377 64.725 1.00 31.70  ? 438  VAL A CB  1 
ATOM   3422 C CG1 . VAL A 1 438 ? 16.736  72.738 63.377 1.00 31.70  ? 438  VAL A CG1 1 
ATOM   3423 C CG2 . VAL A 1 438 ? 18.564  73.206 65.008 1.00 31.70  ? 438  VAL A CG2 1 
ATOM   3424 N N   . ILE A 1 439 ? 14.022  71.976 66.219 1.00 31.77  ? 439  ILE A N   1 
ATOM   3425 C CA  . ILE A 1 439 ? 12.839  71.132 66.299 1.00 31.77  ? 439  ILE A CA  1 
ATOM   3426 C C   . ILE A 1 439 ? 12.160  70.623 65.028 1.00 31.77  ? 439  ILE A C   1 
ATOM   3427 O O   . ILE A 1 439 ? 12.139  71.275 63.988 1.00 31.77  ? 439  ILE A O   1 
ATOM   3428 C CB  . ILE A 1 439 ? 11.764  71.830 67.156 1.00 33.61  ? 439  ILE A CB  1 
ATOM   3429 C CG1 . ILE A 1 439 ? 12.375  72.262 68.488 1.00 33.61  ? 439  ILE A CG1 1 
ATOM   3430 C CG2 . ILE A 1 439 ? 10.585  70.890 67.408 1.00 33.61  ? 439  ILE A CG2 1 
ATOM   3431 C CD1 . ILE A 1 439 ? 11.427  73.076 69.345 1.00 33.61  ? 439  ILE A CD1 1 
ATOM   3432 N N   . HIS A 1 440 ? 11.597  69.431 65.164 1.00 36.33  ? 440  HIS A N   1 
ATOM   3433 C CA  . HIS A 1 440 ? 10.854  68.755 64.116 1.00 36.33  ? 440  HIS A CA  1 
ATOM   3434 C C   . HIS A 1 440 ? 9.775   69.711 63.599 1.00 36.33  ? 440  HIS A C   1 
ATOM   3435 O O   . HIS A 1 440 ? 8.984   70.232 64.376 1.00 36.33  ? 440  HIS A O   1 
ATOM   3436 C CB  . HIS A 1 440 ? 10.209  67.517 64.731 1.00 44.78  ? 440  HIS A CB  1 
ATOM   3437 C CG  . HIS A 1 440 ? 9.444   66.674 63.766 1.00 44.78  ? 440  HIS A CG  1 
ATOM   3438 N ND1 . HIS A 1 440 ? 10.047  66.004 62.718 1.00 44.78  ? 440  HIS A ND1 1 
ATOM   3439 C CD2 . HIS A 1 440 ? 8.133   66.334 63.731 1.00 44.78  ? 440  HIS A CD2 1 
ATOM   3440 C CE1 . HIS A 1 440 ? 9.139   65.282 62.084 1.00 44.78  ? 440  HIS A CE1 1 
ATOM   3441 N NE2 . HIS A 1 440 ? 7.969   65.464 62.681 1.00 44.78  ? 440  HIS A NE2 1 
ATOM   3442 N N   . GLY A 1 441 ? 9.762   69.957 62.295 1.00 35.72  ? 441  GLY A N   1 
ATOM   3443 C CA  . GLY A 1 441 ? 8.756   70.835 61.722 1.00 35.72  ? 441  GLY A CA  1 
ATOM   3444 C C   . GLY A 1 441 ? 9.050   72.328 61.667 1.00 35.72  ? 441  GLY A C   1 
ATOM   3445 O O   . GLY A 1 441 ? 8.299   73.089 61.053 1.00 35.72  ? 441  GLY A O   1 
ATOM   3446 N N   . TYR A 1 442 ? 10.137  72.773 62.279 1.00 39.39  ? 442  TYR A N   1 
ATOM   3447 C CA  . TYR A 1 442 ? 10.418  74.195 62.261 1.00 39.39  ? 442  TYR A CA  1 
ATOM   3448 C C   . TYR A 1 442 ? 11.253  74.733 61.108 1.00 39.39  ? 442  TYR A C   1 
ATOM   3449 O O   . TYR A 1 442 ? 11.761  75.852 61.168 1.00 39.39  ? 442  TYR A O   1 
ATOM   3450 C CB  . TYR A 1 442 ? 10.976  74.630 63.618 1.00 34.59  ? 442  TYR A CB  1 
ATOM   3451 C CG  . TYR A 1 442 ? 9.861   74.729 64.627 1.00 34.59  ? 442  TYR A CG  1 
ATOM   3452 C CD1 . TYR A 1 442 ? 9.371   73.594 65.267 1.00 34.59  ? 442  TYR A CD1 1 
ATOM   3453 C CD2 . TYR A 1 442 ? 9.214   75.941 64.857 1.00 34.59  ? 442  TYR A CD2 1 
ATOM   3454 C CE1 . TYR A 1 442 ? 8.264   73.659 66.102 1.00 34.59  ? 442  TYR A CE1 1 
ATOM   3455 C CE2 . TYR A 1 442 ? 8.099   76.017 65.695 1.00 34.59  ? 442  TYR A CE2 1 
ATOM   3456 C CZ  . TYR A 1 442 ? 7.632   74.872 66.308 1.00 34.59  ? 442  TYR A CZ  1 
ATOM   3457 O OH  . TYR A 1 442 ? 6.520   74.941 67.108 1.00 34.59  ? 442  TYR A OH  1 
ATOM   3458 N N   . GLU A 1 443 ? 11.377  73.942 60.048 1.00 34.31  ? 443  GLU A N   1 
ATOM   3459 C CA  . GLU A 1 443 ? 12.090  74.389 58.858 1.00 34.31  ? 443  GLU A CA  1 
ATOM   3460 C C   . GLU A 1 443 ? 10.978  74.809 57.902 1.00 34.31  ? 443  GLU A C   1 
ATOM   3461 O O   . GLU A 1 443 ? 11.208  75.502 56.916 1.00 34.31  ? 443  GLU A O   1 
ATOM   3462 C CB  . GLU A 1 443 ? 12.920  73.257 58.231 1.00 47.21  ? 443  GLU A CB  1 
ATOM   3463 C CG  . GLU A 1 443 ? 12.169  72.306 57.285 1.00 47.21  ? 443  GLU A CG  1 
ATOM   3464 C CD  . GLU A 1 443 ? 11.204  71.350 57.994 1.00 47.21  ? 443  GLU A CD  1 
ATOM   3465 O OE1 . GLU A 1 443 ? 11.261  71.222 59.236 1.00 47.21  ? 443  GLU A OE1 1 
ATOM   3466 O OE2 . GLU A 1 443 ? 10.389  70.706 57.299 1.00 47.21  ? 443  GLU A OE2 1 
ATOM   3467 N N   . ILE A 1 444 ? 9.764   74.371 58.224 1.00 35.69  ? 444  ILE A N   1 
ATOM   3468 C CA  . ILE A 1 444 ? 8.582   74.676 57.435 1.00 35.69  ? 444  ILE A CA  1 
ATOM   3469 C C   . ILE A 1 444 ? 8.395   76.181 57.280 1.00 35.69  ? 444  ILE A C   1 
ATOM   3470 O O   . ILE A 1 444 ? 8.208   76.668 56.170 1.00 35.69  ? 444  ILE A O   1 
ATOM   3471 C CB  . ILE A 1 444 ? 7.307   74.079 58.095 1.00 39.04  ? 444  ILE A CB  1 
ATOM   3472 C CG1 . ILE A 1 444 ? 7.291   72.557 57.926 1.00 39.04  ? 444  ILE A CG1 1 
ATOM   3473 C CG2 . ILE A 1 444 ? 6.055   74.697 57.481 1.00 39.04  ? 444  ILE A CG2 1 
ATOM   3474 C CD1 . ILE A 1 444 ? 6.099   71.883 58.576 1.00 39.04  ? 444  ILE A CD1 1 
ATOM   3475 N N   . GLU A 1 445 ? 8.447   76.916 58.388 1.00 36.37  ? 445  GLU A N   1 
ATOM   3476 C CA  . GLU A 1 445 ? 8.262   78.364 58.339 1.00 36.37  ? 445  GLU A CA  1 
ATOM   3477 C C   . GLU A 1 445 ? 9.235   79.084 57.404 1.00 36.37  ? 445  GLU A C   1 
ATOM   3478 O O   . GLU A 1 445 ? 8.916   80.155 56.887 1.00 36.37  ? 445  GLU A O   1 
ATOM   3479 C CB  . GLU A 1 445 ? 8.317   78.966 59.756 1.00 50.91  ? 445  GLU A CB  1 
ATOM   3480 C CG  . GLU A 1 445 ? 9.479   78.507 60.632 1.00 50.91  ? 445  GLU A CG  1 
ATOM   3481 C CD  . GLU A 1 445 ? 9.218   78.765 62.120 1.00 50.91  ? 445  GLU A CD  1 
ATOM   3482 O OE1 . GLU A 1 445 ? 8.309   78.118 62.700 1.00 50.91  ? 445  GLU A OE1 1 
ATOM   3483 O OE2 . GLU A 1 445 ? 9.915   79.619 62.716 1.00 50.91  ? 445  GLU A OE2 1 
ATOM   3484 N N   . PHE A 1 446 ? 10.411  78.503 57.174 1.00 32.54  ? 446  PHE A N   1 
ATOM   3485 C CA  . PHE A 1 446 ? 11.373  79.115 56.265 1.00 32.54  ? 446  PHE A CA  1 
ATOM   3486 C C   . PHE A 1 446 ? 10.992  78.773 54.835 1.00 32.54  ? 446  PHE A C   1 
ATOM   3487 O O   . PHE A 1 446 ? 11.169  79.581 53.919 1.00 32.54  ? 446  PHE A O   1 
ATOM   3488 C CB  . PHE A 1 446 ? 12.796  78.632 56.550 1.00 32.74  ? 446  PHE A CB  1 
ATOM   3489 C CG  . PHE A 1 446 ? 13.384  79.205 57.808 1.00 32.74  ? 446  PHE A CG  1 
ATOM   3490 C CD1 . PHE A 1 446 ? 13.076  78.659 59.049 1.00 32.74  ? 446  PHE A CD1 1 
ATOM   3491 C CD2 . PHE A 1 446 ? 14.216  80.325 57.752 1.00 32.74  ? 446  PHE A CD2 1 
ATOM   3492 C CE1 . PHE A 1 446 ? 13.580  79.215 60.212 1.00 32.74  ? 446  PHE A CE1 1 
ATOM   3493 C CE2 . PHE A 1 446 ? 14.724  80.887 58.911 1.00 32.74  ? 446  PHE A CE2 1 
ATOM   3494 C CZ  . PHE A 1 446 ? 14.405  80.331 60.146 1.00 32.74  ? 446  PHE A CZ  1 
ATOM   3495 N N   . VAL A 1 447 ? 10.455  77.571 54.644 1.00 30.73  ? 447  VAL A N   1 
ATOM   3496 C CA  . VAL A 1 447 ? 10.037  77.144 53.320 1.00 30.73  ? 447  VAL A CA  1 
ATOM   3497 C C   . VAL A 1 447 ? 8.846   77.966 52.838 1.00 30.73  ? 447  VAL A C   1 
ATOM   3498 O O   . VAL A 1 447 ? 8.750   78.274 51.653 1.00 30.73  ? 447  VAL A O   1 
ATOM   3499 C CB  . VAL A 1 447 ? 9.666   75.650 53.301 1.00 28.64  ? 447  VAL A CB  1 
ATOM   3500 C CG1 . VAL A 1 447 ? 8.996   75.294 51.980 1.00 28.64  ? 447  VAL A CG1 1 
ATOM   3501 C CG2 . VAL A 1 447 ? 10.915  74.806 53.510 1.00 28.64  ? 447  VAL A CG2 1 
ATOM   3502 N N   . PHE A 1 448 ? 7.945   78.324 53.753 1.00 37.23  ? 448  PHE A N   1 
ATOM   3503 C CA  . PHE A 1 448 ? 6.773   79.116 53.375 1.00 37.23  ? 448  PHE A CA  1 
ATOM   3504 C C   . PHE A 1 448 ? 6.975   80.621 53.489 1.00 37.23  ? 448  PHE A C   1 
ATOM   3505 O O   . PHE A 1 448 ? 6.043   81.397 53.298 1.00 37.23  ? 448  PHE A O   1 
ATOM   3506 C CB  . PHE A 1 448 ? 5.541   78.701 54.176 1.00 32.50  ? 448  PHE A CB  1 
ATOM   3507 C CG  . PHE A 1 448 ? 4.891   77.445 53.673 1.00 32.50  ? 448  PHE A CG  1 
ATOM   3508 C CD1 . PHE A 1 448 ? 5.367   76.194 54.050 1.00 32.50  ? 448  PHE A CD1 1 
ATOM   3509 C CD2 . PHE A 1 448 ? 3.797   77.514 52.812 1.00 32.50  ? 448  PHE A CD2 1 
ATOM   3510 C CE1 . PHE A 1 448 ? 4.757   75.024 53.577 1.00 32.50  ? 448  PHE A CE1 1 
ATOM   3511 C CE2 . PHE A 1 448 ? 3.177   76.349 52.331 1.00 32.50  ? 448  PHE A CE2 1 
ATOM   3512 C CZ  . PHE A 1 448 ? 3.657   75.106 52.715 1.00 32.50  ? 448  PHE A CZ  1 
ATOM   3513 N N   . GLY A 1 449 ? 8.199   81.025 53.816 1.00 40.35  ? 449  GLY A N   1 
ATOM   3514 C CA  . GLY A 1 449 ? 8.524   82.434 53.893 1.00 40.35  ? 449  GLY A CA  1 
ATOM   3515 C C   . GLY A 1 449 ? 7.993   83.286 55.023 1.00 40.35  ? 449  GLY A C   1 
ATOM   3516 O O   . GLY A 1 449 ? 7.930   84.494 54.866 1.00 40.35  ? 449  GLY A O   1 
ATOM   3517 N N   . LEU A 1 450 ? 7.619   82.694 56.152 1.00 43.33  ? 450  LEU A N   1 
ATOM   3518 C CA  . LEU A 1 450 ? 7.122   83.493 57.271 1.00 43.33  ? 450  LEU A CA  1 
ATOM   3519 C C   . LEU A 1 450 ? 8.128   84.563 57.709 1.00 43.33  ? 450  LEU A C   1 
ATOM   3520 O O   . LEU A 1 450 ? 7.737   85.622 58.182 1.00 43.33  ? 450  LEU A O   1 
ATOM   3521 C CB  . LEU A 1 450 ? 6.761   82.602 58.474 1.00 39.39  ? 450  LEU A CB  1 
ATOM   3522 C CG  . LEU A 1 450 ? 5.477   81.765 58.340 1.00 39.39  ? 450  LEU A CG  1 
ATOM   3523 C CD1 . LEU A 1 450 ? 4.263   82.666 58.254 1.00 39.39  ? 450  LEU A CD1 1 
ATOM   3524 C CD2 . LEU A 1 450 ? 5.565   80.895 57.089 1.00 39.39  ? 450  LEU A CD2 1 
ATOM   3525 N N   . PRO A 1 451 ? 9.434   84.302 57.561 1.00 44.12  ? 451  PRO A N   1 
ATOM   3526 C CA  . PRO A 1 451 ? 10.411  85.311 57.972 1.00 44.12  ? 451  PRO A CA  1 
ATOM   3527 C C   . PRO A 1 451 ? 10.369  86.630 57.190 1.00 44.12  ? 451  PRO A C   1 
ATOM   3528 O O   . PRO A 1 451 ? 10.905  87.636 57.657 1.00 44.12  ? 451  PRO A O   1 
ATOM   3529 C CB  . PRO A 1 451 ? 11.742  84.583 57.797 1.00 39.34  ? 451  PRO A CB  1 
ATOM   3530 C CG  . PRO A 1 451 ? 11.371  83.173 58.115 1.00 39.34  ? 451  PRO A CG  1 
ATOM   3531 C CD  . PRO A 1 451 ? 10.107  83.015 57.314 1.00 39.34  ? 451  PRO A CD  1 
ATOM   3532 N N   . LEU A 1 452 ? 9.752   86.634 56.009 1.00 44.59  ? 452  LEU A N   1 
ATOM   3533 C CA  . LEU A 1 452 ? 9.686   87.860 55.220 1.00 44.59  ? 452  LEU A CA  1 
ATOM   3534 C C   . LEU A 1 452 ? 8.682   88.859 55.773 1.00 44.59  ? 452  LEU A C   1 
ATOM   3535 O O   . LEU A 1 452 ? 8.622   89.989 55.295 1.00 44.59  ? 452  LEU A O   1 
ATOM   3536 C CB  . LEU A 1 452 ? 9.309   87.584 53.763 1.00 45.68  ? 452  LEU A CB  1 
ATOM   3537 C CG  . LEU A 1 452 ? 9.906   86.419 52.987 1.00 45.68  ? 452  LEU A CG  1 
ATOM   3538 C CD1 . LEU A 1 452 ? 9.594   86.642 51.506 1.00 45.68  ? 452  LEU A CD1 1 
ATOM   3539 C CD2 . LEU A 1 452 ? 11.405  86.316 53.211 1.00 45.68  ? 452  LEU A CD2 1 
ATOM   3540 N N   . VAL A 1 453 ? 7.879   88.449 56.750 1.00 45.66  ? 453  VAL A N   1 
ATOM   3541 C CA  . VAL A 1 453 ? 6.898   89.353 57.341 1.00 45.66  ? 453  VAL A CA  1 
ATOM   3542 C C   . VAL A 1 453 ? 7.408   89.903 58.682 1.00 45.66  ? 453  VAL A C   1 
ATOM   3543 O O   . VAL A 1 453 ? 7.462   89.198 59.698 1.00 45.66  ? 453  VAL A O   1 
ATOM   3544 C CB  . VAL A 1 453 ? 5.527   88.652 57.524 1.00 66.40  ? 453  VAL A CB  1 
ATOM   3545 C CG1 . VAL A 1 453 ? 5.702   87.347 58.234 1.00 66.40  ? 453  VAL A CG1 1 
ATOM   3546 C CG2 . VAL A 1 453 ? 4.585   89.533 58.320 1.00 66.40  ? 453  VAL A CG2 1 
ATOM   3547 N N   . LYS A 1 454 ? 7.780   91.180 58.665 1.00 56.32  ? 454  LYS A N   1 
ATOM   3548 C CA  . LYS A 1 454 ? 8.326   91.872 59.835 1.00 56.32  ? 454  LYS A CA  1 
ATOM   3549 C C   . LYS A 1 454 ? 7.645   91.578 61.171 1.00 56.32  ? 454  LYS A C   1 
ATOM   3550 O O   . LYS A 1 454 ? 8.295   91.180 62.147 1.00 56.32  ? 454  LYS A O   1 
ATOM   3551 C CB  . LYS A 1 454 ? 8.292   93.390 59.601 1.00 79.69  ? 454  LYS A CB  1 
ATOM   3552 C CG  . LYS A 1 454 ? 8.575   93.833 58.170 1.00 79.69  ? 454  LYS A CG  1 
ATOM   3553 C CD  . LYS A 1 454 ? 9.994   93.527 57.720 1.00 79.69  ? 454  LYS A CD  1 
ATOM   3554 C CE  . LYS A 1 454 ? 10.209  93.992 56.274 1.00 79.69  ? 454  LYS A CE  1 
ATOM   3555 N NZ  . LYS A 1 454 ? 11.577  93.669 55.768 1.00 79.69  ? 454  LYS A NZ  1 
ATOM   3556 N N   . GLU A 1 455 ? 6.337   91.783 61.218 1.00 45.80  ? 455  GLU A N   1 
ATOM   3557 C CA  . GLU A 1 455 ? 5.588   91.582 62.451 1.00 45.80  ? 455  GLU A CA  1 
ATOM   3558 C C   . GLU A 1 455 ? 5.759   90.235 63.154 1.00 45.80  ? 455  GLU A C   1 
ATOM   3559 O O   . GLU A 1 455 ? 5.299   90.069 64.287 1.00 45.80  ? 455  GLU A O   1 
ATOM   3560 C CB  . GLU A 1 455 ? 4.096   91.864 62.208 1.00 81.64  ? 455  GLU A CB  1 
ATOM   3561 C CG  . GLU A 1 455 ? 3.607   91.674 60.759 1.00 81.64  ? 455  GLU A CG  1 
ATOM   3562 C CD  . GLU A 1 455 ? 4.237   92.654 59.753 1.00 81.64  ? 455  GLU A CD  1 
ATOM   3563 O OE1 . GLU A 1 455 ? 5.005   93.558 60.171 1.00 81.64  ? 455  GLU A OE1 1 
ATOM   3564 O OE2 . GLU A 1 455 ? 3.959   92.518 58.535 1.00 81.64  ? 455  GLU A OE2 1 
ATOM   3565 N N   . LEU A 1 456 ? 6.410   89.266 62.514 1.00 53.50  ? 456  LEU A N   1 
ATOM   3566 C CA  . LEU A 1 456 ? 6.588   87.976 63.173 1.00 53.50  ? 456  LEU A CA  1 
ATOM   3567 C C   . LEU A 1 456 ? 7.870   87.954 64.002 1.00 53.50  ? 456  LEU A C   1 
ATOM   3568 O O   . LEU A 1 456 ? 8.073   87.064 64.834 1.00 53.50  ? 456  LEU A O   1 
ATOM   3569 C CB  . LEU A 1 456 ? 6.558   86.838 62.154 1.00 52.28  ? 456  LEU A CB  1 
ATOM   3570 C CG  . LEU A 1 456 ? 5.173   86.632 61.525 1.00 52.28  ? 456  LEU A CG  1 
ATOM   3571 C CD1 . LEU A 1 456 ? 5.171   85.366 60.675 1.00 52.28  ? 456  LEU A CD1 1 
ATOM   3572 C CD2 . LEU A 1 456 ? 4.121   86.533 62.619 1.00 52.28  ? 456  LEU A CD2 1 
ATOM   3573 N N   . ASN A 1 457 ? 8.730   88.943 63.770 1.00 58.13  ? 457  ASN A N   1 
ATOM   3574 C CA  . ASN A 1 457 ? 9.955   89.103 64.547 1.00 58.13  ? 457  ASN A CA  1 
ATOM   3575 C C   . ASN A 1 457 ? 11.175  88.227 64.255 1.00 58.13  ? 457  ASN A C   1 
ATOM   3576 O O   . ASN A 1 457 ? 11.843  87.782 65.192 1.00 58.13  ? 457  ASN A O   1 
ATOM   3577 C CB  . ASN A 1 457 ? 9.632   89.003 66.055 1.00 59.61  ? 457  ASN A CB  1 
ATOM   3578 C CG  . ASN A 1 457 ? 8.637   90.076 66.528 1.00 59.61  ? 457  ASN A CG  1 
ATOM   3579 O OD1 . ASN A 1 457 ? 8.559   91.169 65.956 1.00 59.61  ? 457  ASN A OD1 1 
ATOM   3580 N ND2 . ASN A 1 457 ? 7.894   89.772 67.597 1.00 59.61  ? 457  ASN A ND2 1 
ATOM   3581 N N   . TYR A 1 458 ? 11.480  87.977 62.985 1.00 46.36  ? 458  TYR A N   1 
ATOM   3582 C CA  . TYR A 1 458 ? 12.672  87.192 62.665 1.00 46.36  ? 458  TYR A CA  1 
ATOM   3583 C C   . TYR A 1 458 ? 13.812  88.180 62.407 1.00 46.36  ? 458  TYR A C   1 
ATOM   3584 O O   . TYR A 1 458 ? 13.573  89.369 62.177 1.00 46.36  ? 458  TYR A O   1 
ATOM   3585 C CB  . TYR A 1 458 ? 12.470  86.331 61.410 1.00 34.55  ? 458  TYR A CB  1 
ATOM   3586 C CG  . TYR A 1 458 ? 11.529  85.156 61.576 1.00 34.55  ? 458  TYR A CG  1 
ATOM   3587 C CD1 . TYR A 1 458 ? 10.148  85.308 61.421 1.00 34.55  ? 458  TYR A CD1 1 
ATOM   3588 C CD2 . TYR A 1 458 ? 12.021  83.888 61.891 1.00 34.55  ? 458  TYR A CD2 1 
ATOM   3589 C CE1 . TYR A 1 458 ? 9.279   84.229 61.574 1.00 34.55  ? 458  TYR A CE1 1 
ATOM   3590 C CE2 . TYR A 1 458 ? 11.164  82.804 62.049 1.00 34.55  ? 458  TYR A CE2 1 
ATOM   3591 C CZ  . TYR A 1 458 ? 9.793   82.979 61.890 1.00 34.55  ? 458  TYR A CZ  1 
ATOM   3592 O OH  . TYR A 1 458 ? 8.945   81.905 62.048 1.00 34.55  ? 458  TYR A OH  1 
ATOM   3593 N N   . THR A 1 459 ? 15.048  87.690 62.441 1.00 44.01  ? 459  THR A N   1 
ATOM   3594 C CA  . THR A 1 459 ? 16.217  88.527 62.190 1.00 44.01  ? 459  THR A CA  1 
ATOM   3595 C C   . THR A 1 459 ? 16.395  88.719 60.680 1.00 44.01  ? 459  THR A C   1 
ATOM   3596 O O   . THR A 1 459 ? 15.749  88.040 59.882 1.00 44.01  ? 459  THR A O   1 
ATOM   3597 C CB  . THR A 1 459 ? 17.489  87.859 62.738 1.00 41.63  ? 459  THR A CB  1 
ATOM   3598 O OG1 . THR A 1 459 ? 17.732  86.644 62.016 1.00 41.63  ? 459  THR A OG1 1 
ATOM   3599 C CG2 . THR A 1 459 ? 17.321  87.530 64.224 1.00 41.63  ? 459  THR A CG2 1 
ATOM   3600 N N   . ALA A 1 460 ? 17.282  89.627 60.282 1.00 53.82  ? 460  ALA A N   1 
ATOM   3601 C CA  . ALA A 1 460 ? 17.515  89.863 58.859 1.00 53.82  ? 460  ALA A CA  1 
ATOM   3602 C C   . ALA A 1 460 ? 18.183  88.651 58.208 1.00 53.82  ? 460  ALA A C   1 
ATOM   3603 O O   . ALA A 1 460 ? 17.931  88.357 57.035 1.00 53.82  ? 460  ALA A O   1 
ATOM   3604 C CB  . ALA A 1 460 ? 18.380  91.103 58.661 1.00 41.00  ? 460  ALA A CB  1 
ATOM   3605 N N   . GLU A 1 461 ? 19.044  87.956 58.948 1.00 38.87  ? 461  GLU A N   1 
ATOM   3606 C CA  . GLU A 1 461 ? 19.705  86.781 58.389 1.00 38.87  ? 461  GLU A CA  1 
ATOM   3607 C C   . GLU A 1 461 ? 18.735  85.615 58.236 1.00 38.87  ? 461  GLU A C   1 
ATOM   3608 O O   . GLU A 1 461 ? 18.962  84.724 57.429 1.00 38.87  ? 461  GLU A O   1 
ATOM   3609 C CB  . GLU A 1 461 ? 20.899  86.348 59.245 1.00 76.00  ? 461  GLU A CB  1 
ATOM   3610 C CG  . GLU A 1 461 ? 20.821  86.764 60.704 1.00 76.00  ? 461  GLU A CG  1 
ATOM   3611 C CD  . GLU A 1 461 ? 21.283  88.196 60.917 1.00 76.00  ? 461  GLU A CD  1 
ATOM   3612 O OE1 . GLU A 1 461 ? 22.414  88.516 60.480 1.00 76.00  ? 461  GLU A OE1 1 
ATOM   3613 O OE2 . GLU A 1 461 ? 20.528  89.001 61.521 1.00 76.00  ? 461  GLU A OE2 1 
ATOM   3614 N N   . GLU A 1 462 ? 17.655  85.621 59.009 1.00 42.83  ? 462  GLU A N   1 
ATOM   3615 C CA  . GLU A 1 462 ? 16.662  84.564 58.913 1.00 42.83  ? 462  GLU A CA  1 
ATOM   3616 C C   . GLU A 1 462 ? 15.760  84.838 57.708 1.00 42.83  ? 462  GLU A C   1 
ATOM   3617 O O   . GLU A 1 462 ? 15.252  83.903 57.080 1.00 42.83  ? 462  GLU A O   1 
ATOM   3618 C CB  . GLU A 1 462 ? 15.848  84.479 60.201 1.00 41.42  ? 462  GLU A CB  1 
ATOM   3619 C CG  . GLU A 1 462 ? 16.679  84.010 61.378 1.00 41.42  ? 462  GLU A CG  1 
ATOM   3620 C CD  . GLU A 1 462 ? 15.894  83.915 62.672 1.00 41.42  ? 462  GLU A CD  1 
ATOM   3621 O OE1 . GLU A 1 462 ? 15.161  84.872 63.015 1.00 41.42  ? 462  GLU A OE1 1 
ATOM   3622 O OE2 . GLU A 1 462 ? 16.025  82.887 63.361 1.00 41.42  ? 462  GLU A OE2 1 
ATOM   3623 N N   . GLU A 1 463 ? 15.572  86.118 57.382 1.00 38.54  ? 463  GLU A N   1 
ATOM   3624 C CA  . GLU A 1 463 ? 14.766  86.489 56.227 1.00 38.54  ? 463  GLU A CA  1 
ATOM   3625 C C   . GLU A 1 463 ? 15.543  86.097 54.985 1.00 38.54  ? 463  GLU A C   1 
ATOM   3626 O O   . GLU A 1 463 ? 14.973  85.614 54.006 1.00 38.54  ? 463  GLU A O   1 
ATOM   3627 C CB  . GLU A 1 463 ? 14.511  88.001 56.169 1.00 65.05  ? 463  GLU A CB  1 
ATOM   3628 C CG  . GLU A 1 463 ? 13.566  88.389 55.029 1.00 65.05  ? 463  GLU A CG  1 
ATOM   3629 C CD  . GLU A 1 463 ? 13.579  89.875 54.691 1.00 65.05  ? 463  GLU A CD  1 
ATOM   3630 O OE1 . GLU A 1 463 ? 13.676  90.719 55.619 1.00 65.05  ? 463  GLU A OE1 1 
ATOM   3631 O OE2 . GLU A 1 463 ? 13.467  90.204 53.486 1.00 65.05  ? 463  GLU A OE2 1 
ATOM   3632 N N   . ALA A 1 464 ? 16.853  86.322 55.024 1.00 35.78  ? 464  ALA A N   1 
ATOM   3633 C CA  . ALA A 1 464 ? 17.704  85.982 53.891 1.00 35.78  ? 464  ALA A CA  1 
ATOM   3634 C C   . ALA A 1 464 ? 17.746  84.469 53.714 1.00 35.78  ? 464  ALA A C   1 
ATOM   3635 O O   . ALA A 1 464 ? 17.804  83.968 52.593 1.00 35.78  ? 464  ALA A O   1 
ATOM   3636 C CB  . ALA A 1 464 ? 19.118  86.525 54.102 1.00 25.97  ? 464  ALA A CB  1 
ATOM   3637 N N   . LEU A 1 465 ? 17.732  83.743 54.826 1.00 36.83  ? 465  LEU A N   1 
ATOM   3638 C CA  . LEU A 1 465 ? 17.763  82.289 54.762 1.00 36.83  ? 465  LEU A CA  1 
ATOM   3639 C C   . LEU A 1 465 ? 16.464  81.760 54.163 1.00 36.83  ? 465  LEU A C   1 
ATOM   3640 O O   . LEU A 1 465 ? 16.466  80.793 53.415 1.00 36.83  ? 465  LEU A O   1 
ATOM   3641 C CB  . LEU A 1 465 ? 17.970  81.697 56.153 1.00 31.84  ? 465  LEU A CB  1 
ATOM   3642 C CG  . LEU A 1 465 ? 17.926  80.173 56.229 1.00 31.84  ? 465  LEU A CG  1 
ATOM   3643 C CD1 . LEU A 1 465 ? 18.937  79.574 55.271 1.00 31.84  ? 465  LEU A CD1 1 
ATOM   3644 C CD2 . LEU A 1 465 ? 18.209  79.738 57.646 1.00 31.84  ? 465  LEU A CD2 1 
ATOM   3645 N N   . SER A 1 466 ? 15.354  82.409 54.482 1.00 33.44  ? 466  SER A N   1 
ATOM   3646 C CA  . SER A 1 466 ? 14.075  81.981 53.959 1.00 33.44  ? 466  SER A CA  1 
ATOM   3647 C C   . SER A 1 466 ? 13.988  82.187 52.442 1.00 33.44  ? 466  SER A C   1 
ATOM   3648 O O   . SER A 1 466 ? 13.427  81.354 51.730 1.00 33.44  ? 466  SER A O   1 
ATOM   3649 C CB  . SER A 1 466 ? 12.951  82.733 54.666 1.00 40.62  ? 466  SER A CB  1 
ATOM   3650 O OG  . SER A 1 466 ? 11.684  82.226 54.289 1.00 40.62  ? 466  SER A OG  1 
ATOM   3651 N N   . ARG A 1 467 ? 14.541  83.289 51.940 1.00 36.90  ? 467  ARG A N   1 
ATOM   3652 C CA  . ARG A 1 467 ? 14.501  83.547 50.505 1.00 36.90  ? 467  ARG A CA  1 
ATOM   3653 C C   . ARG A 1 467 ? 15.368  82.533 49.765 1.00 36.90  ? 467  ARG A C   1 
ATOM   3654 O O   . ARG A 1 467 ? 14.983  82.046 48.705 1.00 36.90  ? 467  ARG A O   1 
ATOM   3655 C CB  . ARG A 1 467 ? 14.958  84.980 50.193 1.00 38.28  ? 467  ARG A CB  1 
ATOM   3656 C CG  . ARG A 1 467 ? 13.910  86.031 50.539 1.00 38.28  ? 467  ARG A CG  1 
ATOM   3657 C CD  . ARG A 1 467 ? 14.432  87.466 50.393 1.00 38.28  ? 467  ARG A CD  1 
ATOM   3658 N NE  . ARG A 1 467 ? 13.435  88.426 50.864 1.00 38.28  ? 467  ARG A NE  1 
ATOM   3659 C CZ  . ARG A 1 467 ? 12.302  88.702 50.221 1.00 38.28  ? 467  ARG A CZ  1 
ATOM   3660 N NH1 . ARG A 1 467 ? 12.027  88.101 49.068 1.00 38.28  ? 467  ARG A NH1 1 
ATOM   3661 N NH2 . ARG A 1 467 ? 11.432  89.556 50.745 1.00 38.28  ? 467  ARG A NH2 1 
ATOM   3662 N N   . ARG A 1 468 ? 16.530  82.210 50.329 1.00 36.95  ? 468  ARG A N   1 
ATOM   3663 C CA  . ARG A 1 468 ? 17.417  81.224 49.715 1.00 36.95  ? 468  ARG A CA  1 
ATOM   3664 C C   . ARG A 1 468 ? 16.714  79.872 49.601 1.00 36.95  ? 468  ARG A C   1 
ATOM   3665 O O   . ARG A 1 468 ? 16.783  79.212 48.570 1.00 36.95  ? 468  ARG A O   1 
ATOM   3666 C CB  . ARG A 1 468 ? 18.667  80.991 50.555 1.00 47.81  ? 468  ARG A CB  1 
ATOM   3667 C CG  . ARG A 1 468 ? 19.698  82.065 50.554 1.00 47.81  ? 468  ARG A CG  1 
ATOM   3668 C CD  . ARG A 1 468 ? 20.756  81.681 51.577 1.00 47.81  ? 468  ARG A CD  1 
ATOM   3669 N NE  . ARG A 1 468 ? 21.263  80.338 51.308 1.00 47.81  ? 468  ARG A NE  1 
ATOM   3670 C CZ  . ARG A 1 468 ? 21.884  79.579 52.204 1.00 47.81  ? 468  ARG A CZ  1 
ATOM   3671 N NH1 . ARG A 1 468 ? 22.070  80.028 53.438 1.00 47.81  ? 468  ARG A NH1 1 
ATOM   3672 N NH2 . ARG A 1 468 ? 22.342  78.381 51.858 1.00 47.81  ? 468  ARG A NH2 1 
ATOM   3673 N N   . ILE A 1 469 ? 16.067  79.452 50.684 1.00 33.52  ? 469  ILE A N   1 
ATOM   3674 C CA  . ILE A 1 469 ? 15.380  78.167 50.694 1.00 33.52  ? 469  ILE A CA  1 
ATOM   3675 C C   . ILE A 1 469 ? 14.194  78.184 49.743 1.00 33.52  ? 469  ILE A C   1 
ATOM   3676 O O   . ILE A 1 469 ? 14.000  77.241 48.987 1.00 33.52  ? 469  ILE A O   1 
ATOM   3677 C CB  . ILE A 1 469 ? 14.957  77.775 52.145 1.00 24.99  ? 469  ILE A CB  1 
ATOM   3678 C CG1 . ILE A 1 469 ? 16.216  77.397 52.942 1.00 24.99  ? 469  ILE A CG1 1 
ATOM   3679 C CG2 . ILE A 1 469 ? 13.971  76.620 52.131 1.00 24.99  ? 469  ILE A CG2 1 
ATOM   3680 C CD1 . ILE A 1 469 ? 15.987  77.102 54.406 1.00 24.99  ? 469  ILE A CD1 1 
ATOM   3681 N N   . MET A 1 470 ? 13.418  79.264 49.757 1.00 40.40  ? 470  MET A N   1 
ATOM   3682 C CA  . MET A 1 470 ? 12.268  79.372 48.858 1.00 40.40  ? 470  MET A CA  1 
ATOM   3683 C C   . MET A 1 470 ? 12.723  79.303 47.401 1.00 40.40  ? 470  MET A C   1 
ATOM   3684 O O   . MET A 1 470 ? 12.060  78.684 46.562 1.00 40.40  ? 470  MET A O   1 
ATOM   3685 C CB  . MET A 1 470 ? 11.506  80.687 49.085 1.00 44.33  ? 470  MET A CB  1 
ATOM   3686 C CG  . MET A 1 470 ? 10.564  80.670 50.272 1.00 44.33  ? 470  MET A CG  1 
ATOM   3687 S SD  . MET A 1 470 ? 9.602   82.200 50.463 1.00 44.33  ? 470  MET A SD  1 
ATOM   3688 C CE  . MET A 1 470 ? 10.800  83.214 51.277 1.00 44.33  ? 470  MET A CE  1 
ATOM   3689 N N   . HIS A 1 471 ? 13.859  79.933 47.112 1.00 33.50  ? 471  HIS A N   1 
ATOM   3690 C CA  . HIS A 1 471 ? 14.381  79.953 45.757 1.00 33.50  ? 471  HIS A CA  1 
ATOM   3691 C C   . HIS A 1 471 ? 14.953  78.590 45.385 1.00 33.50  ? 471  HIS A C   1 
ATOM   3692 O O   . HIS A 1 471 ? 14.928  78.220 44.219 1.00 33.50  ? 471  HIS A O   1 
ATOM   3693 C CB  . HIS A 1 471 ? 15.450  81.046 45.593 1.00 51.15  ? 471  HIS A CB  1 
ATOM   3694 C CG  . HIS A 1 471 ? 15.824  81.312 44.164 1.00 51.15  ? 471  HIS A CG  1 
ATOM   3695 N ND1 . HIS A 1 471 ? 14.920  81.787 43.235 1.00 51.15  ? 471  HIS A ND1 1 
ATOM   3696 C CD2 . HIS A 1 471 ? 16.994  81.149 43.500 1.00 51.15  ? 471  HIS A CD2 1 
ATOM   3697 C CE1 . HIS A 1 471 ? 15.516  81.905 42.061 1.00 51.15  ? 471  HIS A CE1 1 
ATOM   3698 N NE2 . HIS A 1 471 ? 16.776  81.524 42.194 1.00 51.15  ? 471  HIS A NE2 1 
ATOM   3699 N N   . TYR A 1 472 ? 15.465  77.848 46.365 1.00 31.52  ? 472  TYR A N   1 
ATOM   3700 C CA  . TYR A 1 472 ? 15.999  76.508 46.095 1.00 31.52  ? 472  TYR A CA  1 
ATOM   3701 C C   . TYR A 1 472 ? 14.835  75.583 45.758 1.00 31.52  ? 472  TYR A C   1 
ATOM   3702 O O   . TYR A 1 472 ? 14.830  74.928 44.721 1.00 31.52  ? 472  TYR A O   1 
ATOM   3703 C CB  . TYR A 1 472 ? 16.706  75.910 47.313 1.00 38.94  ? 472  TYR A CB  1 
ATOM   3704 C CG  . TYR A 1 472 ? 18.084  76.433 47.639 1.00 38.94  ? 472  TYR A CG  1 
ATOM   3705 C CD1 . TYR A 1 472 ? 18.991  76.781 46.637 1.00 38.94  ? 472  TYR A CD1 1 
ATOM   3706 C CD2 . TYR A 1 472 ? 18.514  76.492 48.966 1.00 38.94  ? 472  TYR A CD2 1 
ATOM   3707 C CE1 . TYR A 1 472 ? 20.301  77.171 46.955 1.00 38.94  ? 472  TYR A CE1 1 
ATOM   3708 C CE2 . TYR A 1 472 ? 19.808  76.873 49.290 1.00 38.94  ? 472  TYR A CE2 1 
ATOM   3709 C CZ  . TYR A 1 472 ? 20.697  77.211 48.284 1.00 38.94  ? 472  TYR A CZ  1 
ATOM   3710 O OH  . TYR A 1 472 ? 21.980  77.574 48.631 1.00 38.94  ? 472  TYR A OH  1 
ATOM   3711 N N   . TRP A 1 473 ? 13.860  75.526 46.661 1.00 30.33  ? 473  TRP A N   1 
ATOM   3712 C CA  . TRP A 1 473 ? 12.689  74.680 46.479 1.00 30.33  ? 473  TRP A CA  1 
ATOM   3713 C C   . TRP A 1 473 ? 11.970  74.990 45.160 1.00 30.33  ? 473  TRP A C   1 
ATOM   3714 O O   . TRP A 1 473 ? 11.615  74.087 44.413 1.00 30.33  ? 473  TRP A O   1 
ATOM   3715 C CB  . TRP A 1 473 ? 11.703  74.878 47.637 1.00 29.59  ? 473  TRP A CB  1 
ATOM   3716 C CG  . TRP A 1 473 ? 11.826  73.936 48.830 1.00 29.59  ? 473  TRP A CG  1 
ATOM   3717 C CD1 . TRP A 1 473 ? 10.792  73.324 49.481 1.00 29.59  ? 473  TRP A CD1 1 
ATOM   3718 C CD2 . TRP A 1 473 ? 13.016  73.585 49.558 1.00 29.59  ? 473  TRP A CD2 1 
ATOM   3719 N NE1 . TRP A 1 473 ? 11.257  72.620 50.568 1.00 29.59  ? 473  TRP A NE1 1 
ATOM   3720 C CE2 . TRP A 1 473 ? 12.616  72.761 50.639 1.00 29.59  ? 473  TRP A CE2 1 
ATOM   3721 C CE3 . TRP A 1 473 ? 14.375  73.887 49.407 1.00 29.59  ? 473  TRP A CE3 1 
ATOM   3722 C CZ2 . TRP A 1 473 ? 13.528  72.237 51.563 1.00 29.59  ? 473  TRP A CZ2 1 
ATOM   3723 C CZ3 . TRP A 1 473 ? 15.281  73.365 50.331 1.00 29.59  ? 473  TRP A CZ3 1 
ATOM   3724 C CH2 . TRP A 1 473 ? 14.851  72.550 51.393 1.00 29.59  ? 473  TRP A CH2 1 
ATOM   3725 N N   . ALA A 1 474 ? 11.759  76.274 44.883 1.00 32.62  ? 474  ALA A N   1 
ATOM   3726 C CA  . ALA A 1 474 ? 11.056  76.698 43.673 1.00 32.62  ? 474  ALA A CA  1 
ATOM   3727 C C   . ALA A 1 474 ? 11.863  76.450 42.415 1.00 32.62  ? 474  ALA A C   1 
ATOM   3728 O O   . ALA A 1 474 ? 11.322  76.013 41.413 1.00 32.62  ? 474  ALA A O   1 
ATOM   3729 C CB  . ALA A 1 474 ? 10.677  78.179 43.771 1.00 25.35  ? 474  ALA A CB  1 
ATOM   3730 N N   . THR A 1 475 ? 13.160  76.724 42.462 1.00 38.31  ? 475  THR A N   1 
ATOM   3731 C CA  . THR A 1 475 ? 14.003  76.509 41.294 1.00 38.31  ? 475  THR A CA  1 
ATOM   3732 C C   . THR A 1 475 ? 14.103  75.017 41.004 1.00 38.31  ? 475  THR A C   1 
ATOM   3733 O O   . THR A 1 475 ? 14.176  74.597 39.846 1.00 38.31  ? 475  THR A O   1 
ATOM   3734 C CB  . THR A 1 475 ? 15.415  77.064 41.502 1.00 34.39  ? 475  THR A CB  1 
ATOM   3735 O OG1 . THR A 1 475 ? 15.336  78.466 41.785 1.00 34.39  ? 475  THR A OG1 1 
ATOM   3736 C CG2 . THR A 1 475 ? 16.260  76.841 40.242 1.00 34.39  ? 475  THR A CG2 1 
ATOM   3737 N N   . PHE A 1 476 ? 14.116  74.215 42.059 1.00 30.53  ? 476  PHE A N   1 
ATOM   3738 C CA  . PHE A 1 476 ? 14.174  72.781 41.885 1.00 30.53  ? 476  PHE A CA  1 
ATOM   3739 C C   . PHE A 1 476 ? 12.862  72.291 41.285 1.00 30.53  ? 476  PHE A C   1 
ATOM   3740 O O   . PHE A 1 476 ? 12.859  71.398 40.438 1.00 30.53  ? 476  PHE A O   1 
ATOM   3741 C CB  . PHE A 1 476 ? 14.402  72.084 43.223 1.00 32.26  ? 476  PHE A CB  1 
ATOM   3742 C CG  . PHE A 1 476 ? 14.175  70.600 43.174 1.00 32.26  ? 476  PHE A CG  1 
ATOM   3743 C CD1 . PHE A 1 476 ? 15.129  69.754 42.619 1.00 32.26  ? 476  PHE A CD1 1 
ATOM   3744 C CD2 . PHE A 1 476 ? 12.993  70.050 43.672 1.00 32.26  ? 476  PHE A CD2 1 
ATOM   3745 C CE1 . PHE A 1 476 ? 14.911  68.377 42.564 1.00 32.26  ? 476  PHE A CE1 1 
ATOM   3746 C CE2 . PHE A 1 476 ? 12.765  68.679 43.621 1.00 32.26  ? 476  PHE A CE2 1 
ATOM   3747 C CZ  . PHE A 1 476 ? 13.724  67.840 43.068 1.00 32.26  ? 476  PHE A CZ  1 
ATOM   3748 N N   . ALA A 1 477 ? 11.751  72.873 41.730 1.00 30.58  ? 477  ALA A N   1 
ATOM   3749 C CA  . ALA A 1 477 ? 10.440  72.477 41.239 1.00 30.58  ? 477  ALA A CA  1 
ATOM   3750 C C   . ALA A 1 477 ? 10.308  72.738 39.744 1.00 30.58  ? 477  ALA A C   1 
ATOM   3751 O O   . ALA A 1 477 ? 9.698   71.946 39.019 1.00 30.58  ? 477  ALA A O   1 
ATOM   3752 C CB  . ALA A 1 477 ? 9.360   73.222 41.986 1.00 21.16  ? 477  ALA A CB  1 
ATOM   3753 N N   . LYS A 1 478 ? 10.897  73.849 39.296 1.00 39.41  ? 478  LYS A N   1 
ATOM   3754 C CA  . LYS A 1 478 ? 10.848  74.260 37.901 1.00 39.41  ? 478  LYS A CA  1 
ATOM   3755 C C   . LYS A 1 478 ? 11.782  73.503 36.972 1.00 39.41  ? 478  LYS A C   1 
ATOM   3756 O O   . LYS A 1 478 ? 11.392  73.145 35.862 1.00 39.41  ? 478  LYS A O   1 
ATOM   3757 C CB  . LYS A 1 478 ? 11.186  75.753 37.770 1.00 63.34  ? 478  LYS A CB  1 
ATOM   3758 C CG  . LYS A 1 478 ? 10.181  76.708 38.395 1.00 63.34  ? 478  LYS A CG  1 
ATOM   3759 C CD  . LYS A 1 478 ? 10.795  78.107 38.598 1.00 63.34  ? 478  LYS A CD  1 
ATOM   3760 C CE  . LYS A 1 478 ? 9.856   79.025 39.402 1.00 63.34  ? 478  LYS A CE  1 
ATOM   3761 N NZ  . LYS A 1 478 ? 10.609  80.165 40.029 1.00 63.34  ? 478  LYS A NZ  1 
ATOM   3762 N N   . THR A 1 479 ? 13.011  73.270 37.427 1.00 31.87  ? 479  THR A N   1 
ATOM   3763 C CA  . THR A 1 479 ? 14.035  72.634 36.601 1.00 31.87  ? 479  THR A CA  1 
ATOM   3764 C C   . THR A 1 479 ? 14.604  71.279 37.026 1.00 31.87  ? 479  THR A C   1 
ATOM   3765 O O   . THR A 1 479 ? 15.226  70.601 36.214 1.00 31.87  ? 479  THR A O   1 
ATOM   3766 C CB  . THR A 1 479 ? 15.246  73.580 36.454 1.00 38.97  ? 479  THR A CB  1 
ATOM   3767 O OG1 . THR A 1 479 ? 15.933  73.675 37.714 1.00 38.97  ? 479  THR A OG1 1 
ATOM   3768 C CG2 . THR A 1 479 ? 14.787  74.982 36.040 1.00 38.97  ? 479  THR A CG2 1 
ATOM   3769 N N   . GLY A 1 480 ? 14.428  70.898 38.289 1.00 34.21  ? 480  GLY A N   1 
ATOM   3770 C CA  . GLY A 1 480 ? 14.986  69.636 38.752 1.00 34.21  ? 480  GLY A CA  1 
ATOM   3771 C C   . GLY A 1 480 ? 16.379  69.829 39.328 1.00 34.21  ? 480  GLY A C   1 
ATOM   3772 O O   . GLY A 1 480 ? 17.106  68.866 39.572 1.00 34.21  ? 480  GLY A O   1 
ATOM   3773 N N   . ASN A 1 481 ? 16.743  71.092 39.548 1.00 35.15  ? 481  ASN A N   1 
ATOM   3774 C CA  . ASN A 1 481 ? 18.044  71.475 40.092 1.00 35.15  ? 481  ASN A CA  1 
ATOM   3775 C C   . ASN A 1 481 ? 17.811  72.751 40.923 1.00 35.15  ? 481  ASN A C   1 
ATOM   3776 O O   . ASN A 1 481 ? 17.350  73.765 40.397 1.00 35.15  ? 481  ASN A O   1 
ATOM   3777 C CB  . ASN A 1 481 ? 18.993  71.760 38.934 1.00 40.51  ? 481  ASN A CB  1 
ATOM   3778 C CG  . ASN A 1 481 ? 20.410  72.041 39.384 1.00 40.51  ? 481  ASN A CG  1 
ATOM   3779 O OD1 . ASN A 1 481 ? 20.654  72.475 40.512 1.00 40.51  ? 481  ASN A OD1 1 
ATOM   3780 N ND2 . ASN A 1 481 ? 21.358  71.815 38.484 1.00 40.51  ? 481  ASN A ND2 1 
ATOM   3781 N N   . PRO A 1 482 ? 18.116  72.715 42.231 1.00 33.38  ? 482  PRO A N   1 
ATOM   3782 C CA  . PRO A 1 482 ? 17.910  73.892 43.079 1.00 33.38  ? 482  PRO A CA  1 
ATOM   3783 C C   . PRO A 1 482 ? 18.788  75.098 42.737 1.00 33.38  ? 482  PRO A C   1 
ATOM   3784 O O   . PRO A 1 482 ? 18.510  76.222 43.161 1.00 33.38  ? 482  PRO A O   1 
ATOM   3785 C CB  . PRO A 1 482 ? 18.180  73.352 44.482 1.00 28.26  ? 482  PRO A CB  1 
ATOM   3786 C CG  . PRO A 1 482 ? 19.225  72.306 44.241 1.00 28.26  ? 482  PRO A CG  1 
ATOM   3787 C CD  . PRO A 1 482 ? 18.715  71.609 43.003 1.00 28.26  ? 482  PRO A CD  1 
ATOM   3788 N N   . ASN A 1 483 ? 19.832  74.860 41.953 1.00 41.05  ? 483  ASN A N   1 
ATOM   3789 C CA  . ASN A 1 483 ? 20.766  75.914 41.578 1.00 41.05  ? 483  ASN A CA  1 
ATOM   3790 C C   . ASN A 1 483 ? 20.412  76.693 40.334 1.00 41.05  ? 483  ASN A C   1 
ATOM   3791 O O   . ASN A 1 483 ? 19.890  76.148 39.366 1.00 41.05  ? 483  ASN A O   1 
ATOM   3792 C CB  . ASN A 1 483 ? 22.157  75.323 41.397 1.00 41.29  ? 483  ASN A CB  1 
ATOM   3793 C CG  . ASN A 1 483 ? 22.642  74.633 42.638 1.00 41.29  ? 483  ASN A CG  1 
ATOM   3794 O OD1 . ASN A 1 483 ? 22.888  75.279 43.665 1.00 41.29  ? 483  ASN A OD1 1 
ATOM   3795 N ND2 . ASN A 1 483 ? 22.768  73.309 42.567 1.00 41.29  ? 483  ASN A ND2 1 
ATOM   3796 N N   . GLU A 1 484 ? 20.715  77.984 40.370 1.00 58.43  ? 484  GLU A N   1 
ATOM   3797 C CA  . GLU A 1 484 ? 20.471  78.856 39.229 1.00 58.43  ? 484  GLU A CA  1 
ATOM   3798 C C   . GLU A 1 484 ? 21.522  78.530 38.169 1.00 58.43  ? 484  GLU A C   1 
ATOM   3799 O O   . GLU A 1 484 ? 22.726  78.510 38.456 1.00 58.43  ? 484  GLU A O   1 
ATOM   3800 C CB  . GLU A 1 484 ? 20.577  80.318 39.658 1.00 78.30  ? 484  GLU A CB  1 
ATOM   3801 C CG  . GLU A 1 484 ? 19.294  80.851 40.251 1.00 78.30  ? 484  GLU A CG  1 
ATOM   3802 C CD  . GLU A 1 484 ? 18.275  81.157 39.165 1.00 78.30  ? 484  GLU A CD  1 
ATOM   3803 O OE1 . GLU A 1 484 ? 18.023  80.267 38.314 1.00 78.30  ? 484  GLU A OE1 1 
ATOM   3804 O OE2 . GLU A 1 484 ? 17.728  82.287 39.156 1.00 78.30  ? 484  GLU A OE2 1 
ATOM   3805 N N   . PRO A 1 485 ? 21.075  78.279 36.928 0.75 77.28  ? 485  PRO A N   1 
ATOM   3806 C CA  . PRO A 1 485 ? 21.937  77.939 35.790 0.75 77.28  ? 485  PRO A CA  1 
ATOM   3807 C C   . PRO A 1 485 ? 23.320  78.587 35.784 0.75 77.28  ? 485  PRO A C   1 
ATOM   3808 O O   . PRO A 1 485 ? 24.336  77.893 35.892 0.75 77.28  ? 485  PRO A O   1 
ATOM   3809 C CB  . PRO A 1 485 ? 21.099  78.368 34.587 0.75 65.31  ? 485  PRO A CB  1 
ATOM   3810 C CG  . PRO A 1 485 ? 19.697  78.068 35.044 0.75 65.31  ? 485  PRO A CG  1 
ATOM   3811 C CD  . PRO A 1 485 ? 19.702  78.591 36.473 0.75 65.31  ? 485  PRO A CD  1 
ATOM   3812 N N   . HIS A 1 486 ? 23.360  79.913 35.677 0.75 67.72  ? 486  HIS A N   1 
ATOM   3813 C CA  . HIS A 1 486 ? 24.634  80.633 35.614 0.75 67.72  ? 486  HIS A CA  1 
ATOM   3814 C C   . HIS A 1 486 ? 24.945  81.509 36.829 0.75 67.72  ? 486  HIS A C   1 
ATOM   3815 O O   . HIS A 1 486 ? 25.744  82.443 36.735 0.75 67.72  ? 486  HIS A O   1 
ATOM   3816 C CB  . HIS A 1 486 ? 24.654  81.506 34.355 0.75 82.03  ? 486  HIS A CB  1 
ATOM   3817 C CG  . HIS A 1 486 ? 24.397  80.749 33.088 0.75 82.03  ? 486  HIS A CG  1 
ATOM   3818 N ND1 . HIS A 1 486 ? 25.379  80.036 32.433 0.75 82.03  ? 486  HIS A ND1 1 
ATOM   3819 C CD2 . HIS A 1 486 ? 23.263  80.577 32.366 0.75 82.03  ? 486  HIS A CD2 1 
ATOM   3820 C CE1 . HIS A 1 486 ? 24.861  79.458 31.362 0.75 82.03  ? 486  HIS A CE1 1 
ATOM   3821 N NE2 . HIS A 1 486 ? 23.579  79.769 31.299 0.75 82.03  ? 486  HIS A NE2 1 
ATOM   3822 N N   . SER A 1 487 ? 24.323  81.216 37.962 0.75 43.83  ? 487  SER A N   1 
ATOM   3823 C CA  . SER A 1 487 ? 24.547  81.993 39.178 0.75 43.83  ? 487  SER A CA  1 
ATOM   3824 C C   . SER A 1 487 ? 26.021  82.108 39.579 0.75 43.83  ? 487  SER A C   1 
ATOM   3825 O O   . SER A 1 487 ? 26.886  81.400 39.050 0.75 43.83  ? 487  SER A O   1 
ATOM   3826 C CB  . SER A 1 487 ? 23.770  81.366 40.332 0.75 60.91  ? 487  SER A CB  1 
ATOM   3827 O OG  . SER A 1 487 ? 24.179  81.907 41.571 0.75 60.91  ? 487  SER A OG  1 
ATOM   3828 N N   . GLN A 1 488 ? 26.290  83.007 40.521 0.75 47.07  ? 488  GLN A N   1 
ATOM   3829 C CA  . GLN A 1 488 ? 27.639  83.220 41.034 0.75 47.07  ? 488  GLN A CA  1 
ATOM   3830 C C   . GLN A 1 488 ? 27.656  82.755 42.480 0.75 47.07  ? 488  GLN A C   1 
ATOM   3831 O O   . GLN A 1 488 ? 28.717  82.640 43.101 0.75 47.07  ? 488  GLN A O   1 
ATOM   3832 C CB  . GLN A 1 488 ? 28.018  84.703 40.976 0.75 62.98  ? 488  GLN A CB  1 
ATOM   3833 C CG  . GLN A 1 488 ? 28.129  85.262 39.567 0.75 62.98  ? 488  GLN A CG  1 
ATOM   3834 C CD  . GLN A 1 488 ? 29.107  84.477 38.718 0.75 62.98  ? 488  GLN A CD  1 
ATOM   3835 O OE1 . GLN A 1 488 ? 30.277  84.325 39.072 0.75 62.98  ? 488  GLN A OE1 1 
ATOM   3836 N NE2 . GLN A 1 488 ? 28.631  83.970 37.592 0.75 62.98  ? 488  GLN A NE2 1 
ATOM   3837 N N   . GLU A 1 489 ? 26.462  82.498 43.011 0.75 48.93  ? 489  GLU A N   1 
ATOM   3838 C CA  . GLU A 1 489 ? 26.313  82.035 44.387 0.75 48.93  ? 489  GLU A CA  1 
ATOM   3839 C C   . GLU A 1 489 ? 26.933  80.653 44.545 0.75 48.93  ? 489  GLU A C   1 
ATOM   3840 O O   . GLU A 1 489 ? 27.336  80.033 43.567 0.75 48.93  ? 489  GLU A O   1 
ATOM   3841 C CB  . GLU A 1 489 ? 24.831  81.984 44.775 0.75 80.26  ? 489  GLU A CB  1 
ATOM   3842 C CG  . GLU A 1 489 ? 24.131  83.332 44.739 0.75 80.26  ? 489  GLU A CG  1 
ATOM   3843 C CD  . GLU A 1 489 ? 24.810  84.360 45.630 0.75 80.26  ? 489  GLU A CD  1 
ATOM   3844 O OE1 . GLU A 1 489 ? 24.941  84.107 46.850 0.75 80.26  ? 489  GLU A OE1 1 
ATOM   3845 O OE2 . GLU A 1 489 ? 25.215  85.426 45.110 0.75 80.26  ? 489  GLU A OE2 1 
ATOM   3846 N N   . SER A 1 490 ? 27.004  80.178 45.787 1.00 65.59  ? 490  SER A N   1 
ATOM   3847 C CA  . SER A 1 490 ? 27.579  78.862 46.086 1.00 65.59  ? 490  SER A CA  1 
ATOM   3848 C C   . SER A 1 490 ? 26.669  77.735 45.565 1.00 65.59  ? 490  SER A C   1 
ATOM   3849 O O   . SER A 1 490 ? 25.438  77.820 45.684 1.00 65.59  ? 490  SER A O   1 
ATOM   3850 C CB  . SER A 1 490 ? 27.787  78.724 47.597 1.00 61.81  ? 490  SER A CB  1 
ATOM   3851 O OG  . SER A 1 490 ? 29.083  78.215 47.884 1.00 61.81  ? 490  SER A OG  1 
ATOM   3852 N N   . LYS A 1 491 ? 27.274  76.693 44.993 1.00 44.36  ? 491  LYS A N   1 
ATOM   3853 C CA  . LYS A 1 491 ? 26.526  75.569 44.430 1.00 44.36  ? 491  LYS A CA  1 
ATOM   3854 C C   . LYS A 1 491 ? 26.185  74.416 45.379 1.00 44.36  ? 491  LYS A C   1 
ATOM   3855 O O   . LYS A 1 491 ? 27.045  73.922 46.115 1.00 44.36  ? 491  LYS A O   1 
ATOM   3856 C CB  . LYS A 1 491 ? 27.277  74.996 43.228 1.00 67.05  ? 491  LYS A CB  1 
ATOM   3857 C CG  . LYS A 1 491 ? 27.469  75.988 42.081 1.00 67.05  ? 491  LYS A CG  1 
ATOM   3858 C CD  . LYS A 1 491 ? 26.130  76.480 41.537 1.00 67.05  ? 491  LYS A CD  1 
ATOM   3859 C CE  . LYS A 1 491 ? 26.323  77.586 40.503 1.00 67.05  ? 491  LYS A CE  1 
ATOM   3860 N NZ  . LYS A 1 491 ? 25.005  78.032 39.950 1.00 67.05  ? 491  LYS A NZ  1 
ATOM   3861 N N   . TRP A 1 492 ? 24.919  73.998 45.344 1.00 33.80  ? 492  TRP A N   1 
ATOM   3862 C CA  . TRP A 1 492 ? 24.418  72.880 46.143 1.00 33.80  ? 492  TRP A CA  1 
ATOM   3863 C C   . TRP A 1 492 ? 24.802  71.667 45.312 1.00 33.80  ? 492  TRP A C   1 
ATOM   3864 O O   . TRP A 1 492 ? 24.148  71.354 44.326 1.00 33.80  ? 492  TRP A O   1 
ATOM   3865 C CB  . TRP A 1 492 ? 22.894  72.960 46.252 1.00 28.43  ? 492  TRP A CB  1 
ATOM   3866 C CG  . TRP A 1 492 ? 22.237  71.920 47.132 1.00 28.43  ? 492  TRP A CG  1 
ATOM   3867 C CD1 . TRP A 1 492 ? 22.713  70.674 47.441 1.00 28.43  ? 492  TRP A CD1 1 
ATOM   3868 C CD2 . TRP A 1 492 ? 20.948  72.015 47.744 1.00 28.43  ? 492  TRP A CD2 1 
ATOM   3869 N NE1 . TRP A 1 492 ? 21.800  69.993 48.203 1.00 28.43  ? 492  TRP A NE1 1 
ATOM   3870 C CE2 . TRP A 1 492 ? 20.706  70.791 48.403 1.00 28.43  ? 492  TRP A CE2 1 
ATOM   3871 C CE3 . TRP A 1 492 ? 19.970  73.016 47.797 1.00 28.43  ? 492  TRP A CE3 1 
ATOM   3872 C CZ2 . TRP A 1 492 ? 19.524  70.541 49.107 1.00 28.43  ? 492  TRP A CZ2 1 
ATOM   3873 C CZ3 . TRP A 1 492 ? 18.797  72.767 48.493 1.00 28.43  ? 492  TRP A CZ3 1 
ATOM   3874 C CH2 . TRP A 1 492 ? 18.583  71.540 49.138 1.00 28.43  ? 492  TRP A CH2 1 
ATOM   3875 N N   . PRO A 1 493 ? 25.874  70.967 45.690 1.00 33.89  ? 493  PRO A N   1 
ATOM   3876 C CA  . PRO A 1 493 ? 26.268  69.803 44.902 1.00 33.89  ? 493  PRO A CA  1 
ATOM   3877 C C   . PRO A 1 493 ? 25.216  68.702 44.859 1.00 33.89  ? 493  PRO A C   1 
ATOM   3878 O O   . PRO A 1 493 ? 24.349  68.612 45.722 1.00 33.89  ? 493  PRO A O   1 
ATOM   3879 C CB  . PRO A 1 493 ? 27.555  69.358 45.581 1.00 31.04  ? 493  PRO A CB  1 
ATOM   3880 C CG  . PRO A 1 493 ? 27.282  69.675 46.993 1.00 31.04  ? 493  PRO A CG  1 
ATOM   3881 C CD  . PRO A 1 493 ? 26.682  71.058 46.912 1.00 31.04  ? 493  PRO A CD  1 
ATOM   3882 N N   . LEU A 1 494 ? 25.310  67.876 43.828 1.00 36.64  ? 494  LEU A N   1 
ATOM   3883 C CA  . LEU A 1 494 ? 24.413  66.755 43.608 1.00 36.64  ? 494  LEU A CA  1 
ATOM   3884 C C   . LEU A 1 494 ? 24.855  65.570 44.498 1.00 36.64  ? 494  LEU A C   1 
ATOM   3885 O O   . LEU A 1 494 ? 26.045  65.292 44.627 1.00 36.64  ? 494  LEU A O   1 
ATOM   3886 C CB  . LEU A 1 494 ? 24.498  66.374 42.135 1.00 42.04  ? 494  LEU A CB  1 
ATOM   3887 C CG  . LEU A 1 494 ? 23.531  65.425 41.437 1.00 42.04  ? 494  LEU A CG  1 
ATOM   3888 C CD1 . LEU A 1 494 ? 22.196  66.106 41.160 1.00 42.04  ? 494  LEU A CD1 1 
ATOM   3889 C CD2 . LEU A 1 494 ? 24.164  65.011 40.122 1.00 42.04  ? 494  LEU A CD2 1 
ATOM   3890 N N   . PHE A 1 495 ? 23.900  64.895 45.132 1.00 35.38  ? 495  PHE A N   1 
ATOM   3891 C CA  . PHE A 1 495 ? 24.228  63.749 45.972 1.00 35.38  ? 495  PHE A CA  1 
ATOM   3892 C C   . PHE A 1 495 ? 24.394  62.527 45.062 1.00 35.38  ? 495  PHE A C   1 
ATOM   3893 O O   . PHE A 1 495 ? 23.492  62.181 44.313 1.00 35.38  ? 495  PHE A O   1 
ATOM   3894 C CB  . PHE A 1 495 ? 23.114  63.518 47.014 1.00 29.89  ? 495  PHE A CB  1 
ATOM   3895 C CG  . PHE A 1 495 ? 23.283  62.261 47.838 1.00 29.89  ? 495  PHE A CG  1 
ATOM   3896 C CD1 . PHE A 1 495 ? 23.013  61.007 47.294 1.00 29.89  ? 495  PHE A CD1 1 
ATOM   3897 C CD2 . PHE A 1 495 ? 23.705  62.333 49.164 1.00 29.89  ? 495  PHE A CD2 1 
ATOM   3898 C CE1 . PHE A 1 495 ? 23.159  59.850 48.050 1.00 29.89  ? 495  PHE A CE1 1 
ATOM   3899 C CE2 . PHE A 1 495 ? 23.853  61.178 49.926 1.00 29.89  ? 495  PHE A CE2 1 
ATOM   3900 C CZ  . PHE A 1 495 ? 23.579  59.934 49.365 1.00 29.89  ? 495  PHE A CZ  1 
ATOM   3901 N N   . THR A 1 496 ? 25.554  61.890 45.115 1.00 36.90  ? 496  THR A N   1 
ATOM   3902 C CA  . THR A 1 496 ? 25.816  60.715 44.290 1.00 36.90  ? 496  THR A CA  1 
ATOM   3903 C C   . THR A 1 496 ? 26.169  59.528 45.164 1.00 36.90  ? 496  THR A C   1 
ATOM   3904 O O   . THR A 1 496 ? 26.610  59.697 46.291 1.00 36.90  ? 496  THR A O   1 
ATOM   3905 C CB  . THR A 1 496 ? 26.974  60.959 43.302 1.00 38.31  ? 496  THR A CB  1 
ATOM   3906 O OG1 . THR A 1 496 ? 28.197  61.162 44.027 1.00 38.31  ? 496  THR A OG1 1 
ATOM   3907 C CG2 . THR A 1 496 ? 26.685  62.184 42.452 1.00 38.31  ? 496  THR A CG2 1 
ATOM   3908 N N   . THR A 1 497 ? 25.976  58.326 44.637 1.00 45.67  ? 497  THR A N   1 
ATOM   3909 C CA  . THR A 1 497 ? 26.258  57.106 45.379 1.00 45.67  ? 497  THR A CA  1 
ATOM   3910 C C   . THR A 1 497 ? 27.680  57.092 45.886 1.00 45.67  ? 497  THR A C   1 
ATOM   3911 O O   . THR A 1 497 ? 27.949  56.607 46.989 1.00 45.67  ? 497  THR A O   1 
ATOM   3912 C CB  . THR A 1 497 ? 26.064  55.857 44.510 1.00 53.98  ? 497  THR A CB  1 
ATOM   3913 O OG1 . THR A 1 497 ? 24.737  55.854 43.973 1.00 53.98  ? 497  THR A OG1 1 
ATOM   3914 C CG2 . THR A 1 497 ? 26.261  54.593 45.346 1.00 53.98  ? 497  THR A CG2 1 
ATOM   3915 N N   . LYS A 1 498 ? 28.582  57.649 45.084 1.00 42.20  ? 498  LYS A N   1 
ATOM   3916 C CA  . LYS A 1 498 ? 29.994  57.683 45.424 1.00 42.20  ? 498  LYS A CA  1 
ATOM   3917 C C   . LYS A 1 498 ? 30.392  58.703 46.493 1.00 42.20  ? 498  LYS A C   1 
ATOM   3918 O O   . LYS A 1 498 ? 30.874  58.317 47.556 1.00 42.20  ? 498  LYS A O   1 
ATOM   3919 C CB  . LYS A 1 498 ? 30.821  57.915 44.156 1.00 64.97  ? 498  LYS A CB  1 
ATOM   3920 C CG  . LYS A 1 498 ? 32.328  57.702 44.354 1.00 64.97  ? 498  LYS A CG  1 
ATOM   3921 C CD  . LYS A 1 498 ? 33.127  58.000 43.078 1.00 64.97  ? 498  LYS A CD  1 
ATOM   3922 C CE  . LYS A 1 498 ? 34.633  57.837 43.303 1.00 64.97  ? 498  LYS A CE  1 
ATOM   3923 N NZ  . LYS A 1 498 ? 35.406  57.984 42.013 1.00 64.97  ? 498  LYS A NZ  1 
ATOM   3924 N N   . GLU A 1 499 ? 30.195  59.997 46.225 1.00 37.80  ? 499  GLU A N   1 
ATOM   3925 C CA  . GLU A 1 499 ? 30.589  61.038 47.185 1.00 37.80  ? 499  GLU A CA  1 
ATOM   3926 C C   . GLU A 1 499 ? 29.610  61.283 48.334 1.00 37.80  ? 499  GLU A C   1 
ATOM   3927 O O   . GLU A 1 499 ? 30.027  61.631 49.433 1.00 37.80  ? 499  GLU A O   1 
ATOM   3928 C CB  . GLU A 1 499 ? 30.828  62.372 46.471 1.00 78.83  ? 499  GLU A CB  1 
ATOM   3929 C CG  . GLU A 1 499 ? 31.497  62.280 45.119 1.00 78.83  ? 499  GLU A CG  1 
ATOM   3930 C CD  . GLU A 1 499 ? 32.803  61.536 45.171 1.00 78.83  ? 499  GLU A CD  1 
ATOM   3931 O OE1 . GLU A 1 499 ? 33.714  61.963 45.919 1.00 78.83  ? 499  GLU A OE1 1 
ATOM   3932 O OE2 . GLU A 1 499 ? 32.924  60.515 44.458 1.00 78.83  ? 499  GLU A OE2 1 
ATOM   3933 N N   . GLN A 1 500 ? 28.315  61.127 48.074 1.00 33.61  ? 500  GLN A N   1 
ATOM   3934 C CA  . GLN A 1 500 ? 27.283  61.333 49.097 1.00 33.61  ? 500  GLN A CA  1 
ATOM   3935 C C   . GLN A 1 500 ? 27.316  62.730 49.724 1.00 33.61  ? 500  GLN A C   1 
ATOM   3936 O O   . GLN A 1 500 ? 27.113  62.898 50.920 1.00 33.61  ? 500  GLN A O   1 
ATOM   3937 C CB  . GLN A 1 500 ? 27.417  60.257 50.187 1.00 48.49  ? 500  GLN A CB  1 
ATOM   3938 C CG  . GLN A 1 500 ? 27.271  58.850 49.623 1.00 48.49  ? 500  GLN A CG  1 
ATOM   3939 C CD  . GLN A 1 500 ? 27.572  57.751 50.626 1.00 48.49  ? 500  GLN A CD  1 
ATOM   3940 O OE1 . GLN A 1 500 ? 27.986  56.653 50.246 1.00 48.49  ? 500  GLN A OE1 1 
ATOM   3941 N NE2 . GLN A 1 500 ? 27.356  58.030 51.904 1.00 48.49  ? 500  GLN A NE2 1 
ATOM   3942 N N   . LYS A 1 501 ? 27.558  63.734 48.897 1.00 32.24  ? 501  LYS A N   1 
ATOM   3943 C CA  . LYS A 1 501 ? 27.628  65.103 49.370 1.00 32.24  ? 501  LYS A CA  1 
ATOM   3944 C C   . LYS A 1 501 ? 26.274  65.678 49.762 1.00 32.24  ? 501  LYS A C   1 
ATOM   3945 O O   . LYS A 1 501 ? 25.237  65.287 49.228 1.00 32.24  ? 501  LYS A O   1 
ATOM   3946 C CB  . LYS A 1 501 ? 28.257  65.991 48.293 1.00 45.85  ? 501  LYS A CB  1 
ATOM   3947 C CG  . LYS A 1 501 ? 29.717  65.658 47.984 1.00 45.85  ? 501  LYS A CG  1 
ATOM   3948 C CD  . LYS A 1 501 ? 30.247  66.503 46.828 1.00 45.85  ? 501  LYS A CD  1 
ATOM   3949 C CE  . LYS A 1 501 ? 31.724  66.236 46.594 1.00 45.85  ? 501  LYS A CE  1 
ATOM   3950 N NZ  . LYS A 1 501 ? 32.228  66.932 45.381 1.00 45.85  ? 501  LYS A NZ  1 
ATOM   3951 N N   . PHE A 1 502 ? 26.296  66.595 50.718 1.00 30.95  ? 502  PHE A N   1 
ATOM   3952 C CA  . PHE A 1 502 ? 25.092  67.270 51.157 1.00 30.95  ? 502  PHE A CA  1 
ATOM   3953 C C   . PHE A 1 502 ? 25.508  68.622 51.729 1.00 30.95  ? 502  PHE A C   1 
ATOM   3954 O O   . PHE A 1 502 ? 26.688  68.854 51.982 1.00 30.95  ? 502  PHE A O   1 
ATOM   3955 C CB  . PHE A 1 502 ? 24.335  66.445 52.205 1.00 27.29  ? 502  PHE A CB  1 
ATOM   3956 C CG  . PHE A 1 502 ? 24.963  66.444 53.571 1.00 27.29  ? 502  PHE A CG  1 
ATOM   3957 C CD1 . PHE A 1 502 ? 25.918  65.495 53.911 1.00 27.29  ? 502  PHE A CD1 1 
ATOM   3958 C CD2 . PHE A 1 502 ? 24.563  67.370 54.532 1.00 27.29  ? 502  PHE A CD2 1 
ATOM   3959 C CE1 . PHE A 1 502 ? 26.463  65.464 55.192 1.00 27.29  ? 502  PHE A CE1 1 
ATOM   3960 C CE2 . PHE A 1 502 ? 25.096  67.352 55.809 1.00 27.29  ? 502  PHE A CE2 1 
ATOM   3961 C CZ  . PHE A 1 502 ? 26.049  66.396 56.146 1.00 27.29  ? 502  PHE A CZ  1 
ATOM   3962 N N   . ILE A 1 503 ? 24.549  69.517 51.927 1.00 31.73  ? 503  ILE A N   1 
ATOM   3963 C CA  . ILE A 1 503 ? 24.886  70.825 52.459 1.00 31.73  ? 503  ILE A CA  1 
ATOM   3964 C C   . ILE A 1 503 ? 24.143  71.115 53.751 1.00 31.73  ? 503  ILE A C   1 
ATOM   3965 O O   . ILE A 1 503 ? 23.140  70.479 54.052 1.00 31.73  ? 503  ILE A O   1 
ATOM   3966 C CB  . ILE A 1 503 ? 24.535  71.941 51.457 1.00 34.91  ? 503  ILE A CB  1 
ATOM   3967 C CG1 . ILE A 1 503 ? 23.020  72.011 51.275 1.00 34.91  ? 503  ILE A CG1 1 
ATOM   3968 C CG2 . ILE A 1 503 ? 25.200  71.672 50.106 1.00 34.91  ? 503  ILE A CG2 1 
ATOM   3969 C CD1 . ILE A 1 503 ? 22.561  73.225 50.502 1.00 34.91  ? 503  ILE A CD1 1 
ATOM   3970 N N   . ASP A 1 504 ? 24.658  72.061 54.528 1.00 44.37  ? 504  ASP A N   1 
ATOM   3971 C CA  . ASP A 1 504 ? 23.989  72.474 55.752 1.00 44.37  ? 504  ASP A CA  1 
ATOM   3972 C C   . ASP A 1 504 ? 23.099  73.617 55.278 1.00 44.37  ? 504  ASP A C   1 
ATOM   3973 O O   . ASP A 1 504 ? 23.373  74.249 54.250 1.00 44.37  ? 504  ASP A O   1 
ATOM   3974 C CB  . ASP A 1 504 ? 24.968  73.021 56.801 1.00 75.39  ? 504  ASP A CB  1 
ATOM   3975 C CG  . ASP A 1 504 ? 25.841  71.944 57.424 1.00 75.39  ? 504  ASP A CG  1 
ATOM   3976 O OD1 . ASP A 1 504 ? 25.311  70.864 57.767 1.00 75.39  ? 504  ASP A OD1 1 
ATOM   3977 O OD2 . ASP A 1 504 ? 27.063  72.185 57.593 1.00 75.39  ? 504  ASP A OD2 1 
ATOM   3978 N N   . LEU A 1 505 ? 22.041  73.889 56.025 1.00 37.64  ? 505  LEU A N   1 
ATOM   3979 C CA  . LEU A 1 505 ? 21.134  74.953 55.660 1.00 37.64  ? 505  LEU A CA  1 
ATOM   3980 C C   . LEU A 1 505 ? 20.974  75.832 56.894 1.00 37.64  ? 505  LEU A C   1 
ATOM   3981 O O   . LEU A 1 505 ? 20.279  75.465 57.841 1.00 37.64  ? 505  LEU A O   1 
ATOM   3982 C CB  . LEU A 1 505 ? 19.801  74.345 55.229 1.00 34.27  ? 505  LEU A CB  1 
ATOM   3983 C CG  . LEU A 1 505 ? 19.079  74.927 54.017 1.00 34.27  ? 505  LEU A CG  1 
ATOM   3984 C CD1 . LEU A 1 505 ? 20.052  75.190 52.878 1.00 34.27  ? 505  LEU A CD1 1 
ATOM   3985 C CD2 . LEU A 1 505 ? 18.000  73.945 53.588 1.00 34.27  ? 505  LEU A CD2 1 
ATOM   3986 N N   . ASN A 1 506 ? 21.659  76.974 56.893 1.00 40.56  ? 506  ASN A N   1 
ATOM   3987 C CA  . ASN A 1 506 ? 21.597  77.912 58.010 1.00 40.56  ? 506  ASN A CA  1 
ATOM   3988 C C   . ASN A 1 506 ? 21.963  79.317 57.557 1.00 40.56  ? 506  ASN A C   1 
ATOM   3989 O O   . ASN A 1 506 ? 21.889  79.627 56.371 1.00 40.56  ? 506  ASN A O   1 
ATOM   3990 C CB  . ASN A 1 506 ? 22.523  77.462 59.142 1.00 39.04  ? 506  ASN A CB  1 
ATOM   3991 C CG  . ASN A 1 506 ? 23.926  77.186 58.669 1.00 39.04  ? 506  ASN A CG  1 
ATOM   3992 O OD1 . ASN A 1 506 ? 24.569  78.037 58.055 1.00 39.04  ? 506  ASN A OD1 1 
ATOM   3993 N ND2 . ASN A 1 506 ? 24.417  75.988 58.957 1.00 39.04  ? 506  ASN A ND2 1 
ATOM   3994 N N   . THR A 1 507 ? 22.359  80.172 58.494 1.00 46.57  ? 507  THR A N   1 
ATOM   3995 C CA  . THR A 1 507 ? 22.705  81.548 58.147 1.00 46.57  ? 507  THR A CA  1 
ATOM   3996 C C   . THR A 1 507 ? 24.204  81.741 57.914 1.00 46.57  ? 507  THR A C   1 
ATOM   3997 O O   . THR A 1 507 ? 24.682  82.862 57.714 1.00 46.57  ? 507  THR A O   1 
ATOM   3998 C CB  . THR A 1 507 ? 22.214  82.528 59.235 1.00 39.73  ? 507  THR A CB  1 
ATOM   3999 O OG1 . THR A 1 507 ? 22.709  82.117 60.515 1.00 39.73  ? 507  THR A OG1 1 
ATOM   4000 C CG2 . THR A 1 507 ? 20.697  82.552 59.279 1.00 39.73  ? 507  THR A CG2 1 
ATOM   4001 N N   . GLU A 1 508 ? 24.947  80.643 57.923 1.00 52.03  ? 508  GLU A N   1 
ATOM   4002 C CA  . GLU A 1 508 ? 26.389  80.708 57.704 1.00 52.03  ? 508  GLU A CA  1 
ATOM   4003 C C   . GLU A 1 508 ? 26.700  80.397 56.249 1.00 52.03  ? 508  GLU A C   1 
ATOM   4004 O O   . GLU A 1 508 ? 25.865  79.823 55.541 1.00 52.03  ? 508  GLU A O   1 
ATOM   4005 C CB  . GLU A 1 508 ? 27.104  79.708 58.618 1.00 81.29  ? 508  GLU A CB  1 
ATOM   4006 C CG  . GLU A 1 508 ? 26.958  80.029 60.099 1.00 81.29  ? 508  GLU A CG  1 
ATOM   4007 C CD  . GLU A 1 508 ? 27.552  78.945 60.985 1.00 81.29  ? 508  GLU A CD  1 
ATOM   4008 O OE1 . GLU A 1 508 ? 28.740  78.585 60.783 1.00 81.29  ? 508  GLU A OE1 1 
ATOM   4009 O OE2 . GLU A 1 508 ? 26.829  78.454 61.886 1.00 81.29  ? 508  GLU A OE2 1 
ATOM   4010 N N   . PRO A 1 509 ? 27.899  80.787 55.772 1.00 56.37  ? 509  PRO A N   1 
ATOM   4011 C CA  . PRO A 1 509 ? 28.279  80.522 54.379 1.00 56.37  ? 509  PRO A CA  1 
ATOM   4012 C C   . PRO A 1 509 ? 28.153  79.027 54.105 1.00 56.37  ? 509  PRO A C   1 
ATOM   4013 O O   . PRO A 1 509 ? 28.674  78.208 54.858 1.00 56.37  ? 509  PRO A O   1 
ATOM   4014 C CB  . PRO A 1 509 ? 29.729  80.995 54.321 1.00 50.18  ? 509  PRO A CB  1 
ATOM   4015 C CG  . PRO A 1 509 ? 29.738  82.132 55.306 1.00 50.18  ? 509  PRO A CG  1 
ATOM   4016 C CD  . PRO A 1 509 ? 28.945  81.562 56.465 1.00 50.18  ? 509  PRO A CD  1 
ATOM   4017 N N   . MET A 1 510 ? 27.469  78.672 53.027 1.00 59.94  ? 510  MET A N   1 
ATOM   4018 C CA  . MET A 1 510 ? 27.271  77.268 52.703 1.00 59.94  ? 510  MET A CA  1 
ATOM   4019 C C   . MET A 1 510 ? 28.518  76.417 52.903 1.00 59.94  ? 510  MET A C   1 
ATOM   4020 O O   . MET A 1 510 ? 29.633  76.866 52.644 1.00 59.94  ? 510  MET A O   1 
ATOM   4021 C CB  . MET A 1 510 ? 26.801  77.117 51.257 1.00 68.01  ? 510  MET A CB  1 
ATOM   4022 C CG  . MET A 1 510 ? 26.450  75.672 50.884 1.00 68.01  ? 510  MET A CG  1 
ATOM   4023 S SD  . MET A 1 510 ? 26.193  75.445 49.104 1.00 68.01  ? 510  MET A SD  1 
ATOM   4024 C CE  . MET A 1 510 ? 24.429  75.993 48.943 1.00 68.01  ? 510  MET A CE  1 
ATOM   4025 N N   . LYS A 1 511 ? 28.314  75.191 53.378 1.00 45.62  ? 511  LYS A N   1 
ATOM   4026 C CA  . LYS A 1 511 ? 29.395  74.235 53.574 1.00 45.62  ? 511  LYS A CA  1 
ATOM   4027 C C   . LYS A 1 511 ? 28.883  72.884 53.095 1.00 45.62  ? 511  LYS A C   1 
ATOM   4028 O O   . LYS A 1 511 ? 27.771  72.473 53.434 1.00 45.62  ? 511  LYS A O   1 
ATOM   4029 C CB  . LYS A 1 511 ? 29.787  74.112 55.043 1.00 69.27  ? 511  LYS A CB  1 
ATOM   4030 C CG  . LYS A 1 511 ? 30.329  75.376 55.684 1.00 69.27  ? 511  LYS A CG  1 
ATOM   4031 C CD  . LYS A 1 511 ? 30.871  75.058 57.086 1.00 69.27  ? 511  LYS A CD  1 
ATOM   4032 C CE  . LYS A 1 511 ? 31.252  76.317 57.857 1.00 69.27  ? 511  LYS A CE  1 
ATOM   4033 N NZ  . LYS A 1 511 ? 31.655  75.988 59.267 1.00 69.27  ? 511  LYS A NZ  1 
ATOM   4034 N N   . VAL A 1 512 ? 29.693  72.207 52.295 1.00 37.18  ? 512  VAL A N   1 
ATOM   4035 C CA  . VAL A 1 512 ? 29.348  70.901 51.773 1.00 37.18  ? 512  VAL A CA  1 
ATOM   4036 C C   . VAL A 1 512 ? 29.995  69.839 52.655 1.00 37.18  ? 512  VAL A C   1 
ATOM   4037 O O   . VAL A 1 512 ? 31.145  69.988 53.075 1.00 37.18  ? 512  VAL A O   1 
ATOM   4038 C CB  . VAL A 1 512 ? 29.869  70.729 50.320 1.00 45.05  ? 512  VAL A CB  1 
ATOM   4039 C CG1 . VAL A 1 512 ? 29.754  69.273 49.892 1.00 45.05  ? 512  VAL A CG1 1 
ATOM   4040 C CG2 . VAL A 1 512 ? 29.079  71.627 49.364 1.00 45.05  ? 512  VAL A CG2 1 
ATOM   4041 N N   . HIS A 1 513 ? 29.252  68.772 52.935 1.00 39.52  ? 513  HIS A N   1 
ATOM   4042 C CA  . HIS A 1 513 ? 29.747  67.669 53.758 1.00 39.52  ? 513  HIS A CA  1 
ATOM   4043 C C   . HIS A 1 513 ? 29.519  66.339 53.051 1.00 39.52  ? 513  HIS A C   1 
ATOM   4044 O O   . HIS A 1 513 ? 29.055  66.302 51.914 1.00 39.52  ? 513  HIS A O   1 
ATOM   4045 C CB  . HIS A 1 513 ? 29.011  67.616 55.091 1.00 55.93  ? 513  HIS A CB  1 
ATOM   4046 C CG  . HIS A 1 513 ? 29.204  68.824 55.942 1.00 55.93  ? 513  HIS A CG  1 
ATOM   4047 N ND1 . HIS A 1 513 ? 30.439  69.202 56.423 1.00 55.93  ? 513  HIS A ND1 1 
ATOM   4048 C CD2 . HIS A 1 513 ? 28.314  69.719 56.434 1.00 55.93  ? 513  HIS A CD2 1 
ATOM   4049 C CE1 . HIS A 1 513 ? 30.300  70.276 57.182 1.00 55.93  ? 513  HIS A CE1 1 
ATOM   4050 N NE2 . HIS A 1 513 ? 29.021  70.610 57.204 1.00 55.93  ? 513  HIS A NE2 1 
ATOM   4051 N N   . GLN A 1 514 ? 29.811  65.246 53.748 1.00 38.20  ? 514  GLN A N   1 
ATOM   4052 C CA  . GLN A 1 514 ? 29.635  63.921 53.180 1.00 38.20  ? 514  GLN A CA  1 
ATOM   4053 C C   . GLN A 1 514 ? 29.215  62.891 54.211 1.00 38.20  ? 514  GLN A C   1 
ATOM   4054 O O   . GLN A 1 514 ? 29.584  62.976 55.377 1.00 38.20  ? 514  GLN A O   1 
ATOM   4055 C CB  . GLN A 1 514 ? 30.935  63.456 52.528 1.00 50.80  ? 514  GLN A CB  1 
ATOM   4056 C CG  . GLN A 1 514 ? 31.295  64.176 51.248 1.00 50.80  ? 514  GLN A CG  1 
ATOM   4057 C CD  . GLN A 1 514 ? 32.636  63.723 50.717 1.00 50.80  ? 514  GLN A CD  1 
ATOM   4058 O OE1 . GLN A 1 514 ? 33.683  64.179 51.176 1.00 50.80  ? 514  GLN A OE1 1 
ATOM   4059 N NE2 . GLN A 1 514 ? 32.613  62.798 49.763 1.00 50.80  ? 514  GLN A NE2 1 
ATOM   4060 N N   . ARG A 1 515 ? 28.443  61.912 53.755 1.00 37.10  ? 515  ARG A N   1 
ATOM   4061 C CA  . ARG A 1 515 ? 27.973  60.817 54.591 1.00 37.10  ? 515  ARG A CA  1 
ATOM   4062 C C   . ARG A 1 515 ? 27.285  61.229 55.888 1.00 37.10  ? 515  ARG A C   1 
ATOM   4063 O O   . ARG A 1 515 ? 27.772  60.933 56.979 1.00 37.10  ? 515  ARG A O   1 
ATOM   4064 C CB  . ARG A 1 515 ? 29.146  59.889 54.890 1.00 54.19  ? 515  ARG A CB  1 
ATOM   4065 C CG  . ARG A 1 515 ? 29.770  59.314 53.634 1.00 54.19  ? 515  ARG A CG  1 
ATOM   4066 C CD  . ARG A 1 515 ? 30.808  58.259 53.967 1.00 54.19  ? 515  ARG A CD  1 
ATOM   4067 N NE  . ARG A 1 515 ? 31.302  57.577 52.776 1.00 54.19  ? 515  ARG A NE  1 
ATOM   4068 C CZ  . ARG A 1 515 ? 31.884  56.380 52.801 1.00 54.19  ? 515  ARG A CZ  1 
ATOM   4069 N NH1 . ARG A 1 515 ? 32.037  55.741 53.959 1.00 54.19  ? 515  ARG A NH1 1 
ATOM   4070 N NH2 . ARG A 1 515 ? 32.322  55.819 51.677 1.00 54.19  ? 515  ARG A NH2 1 
ATOM   4071 N N   . LEU A 1 516 ? 26.142  61.895 55.747 1.00 32.27  ? 516  LEU A N   1 
ATOM   4072 C CA  . LEU A 1 516 ? 25.344  62.365 56.872 1.00 32.27  ? 516  LEU A CA  1 
ATOM   4073 C C   . LEU A 1 516 ? 25.097  61.256 57.893 1.00 32.27  ? 516  LEU A C   1 
ATOM   4074 O O   . LEU A 1 516 ? 24.449  60.250 57.598 1.00 32.27  ? 516  LEU A O   1 
ATOM   4075 C CB  . LEU A 1 516 ? 24.009  62.929 56.359 1.00 36.95  ? 516  LEU A CB  1 
ATOM   4076 C CG  . LEU A 1 516 ? 22.931  63.385 57.353 1.00 36.95  ? 516  LEU A CG  1 
ATOM   4077 C CD1 . LEU A 1 516 ? 23.535  64.274 58.431 1.00 36.95  ? 516  LEU A CD1 1 
ATOM   4078 C CD2 . LEU A 1 516 ? 21.847  64.143 56.601 1.00 36.95  ? 516  LEU A CD2 1 
ATOM   4079 N N   . ARG A 1 517 ? 25.621  61.469 59.095 1.00 34.88  ? 517  ARG A N   1 
ATOM   4080 C CA  . ARG A 1 517 ? 25.519  60.526 60.209 1.00 34.88  ? 517  ARG A CA  1 
ATOM   4081 C C   . ARG A 1 517 ? 25.680  59.050 59.822 1.00 34.88  ? 517  ARG A C   1 
ATOM   4082 O O   . ARG A 1 517 ? 24.884  58.205 60.242 1.00 34.88  ? 517  ARG A O   1 
ATOM   4083 C CB  . ARG A 1 517 ? 24.200  60.766 60.983 1.00 45.93  ? 517  ARG A CB  1 
ATOM   4084 C CG  . ARG A 1 517 ? 24.207  62.122 61.731 1.00 45.93  ? 517  ARG A CG  1 
ATOM   4085 C CD  . ARG A 1 517 ? 22.976  62.396 62.589 1.00 45.93  ? 517  ARG A CD  1 
ATOM   4086 N NE  . ARG A 1 517 ? 22.968  61.631 63.834 1.00 45.93  ? 517  ARG A NE  1 
ATOM   4087 C CZ  . ARG A 1 517 ? 23.796  61.843 64.856 1.00 45.93  ? 517  ARG A CZ  1 
ATOM   4088 N NH1 . ARG A 1 517 ? 24.703  62.812 64.779 1.00 45.93  ? 517  ARG A NH1 1 
ATOM   4089 N NH2 . ARG A 1 517 ? 23.726  61.084 65.950 1.00 45.93  ? 517  ARG A NH2 1 
ATOM   4090 N N   . VAL A 1 518 ? 26.719  58.743 59.037 1.00 35.02  ? 518  VAL A N   1 
ATOM   4091 C CA  . VAL A 1 518 ? 26.981  57.359 58.609 1.00 35.02  ? 518  VAL A CA  1 
ATOM   4092 C C   . VAL A 1 518 ? 27.167  56.376 59.748 1.00 35.02  ? 518  VAL A C   1 
ATOM   4093 O O   . VAL A 1 518 ? 26.589  55.296 59.728 1.00 35.02  ? 518  VAL A O   1 
ATOM   4094 C CB  . VAL A 1 518 ? 28.252  57.195 57.739 1.00 31.45  ? 518  VAL A CB  1 
ATOM   4095 C CG1 . VAL A 1 518 ? 27.873  57.129 56.285 1.00 31.45  ? 518  VAL A CG1 1 
ATOM   4096 C CG2 . VAL A 1 518 ? 29.248  58.303 58.027 1.00 31.45  ? 518  VAL A CG2 1 
ATOM   4097 N N   . GLN A 1 519 ? 27.993  56.737 60.724 1.00 35.08  ? 519  GLN A N   1 
ATOM   4098 C CA  . GLN A 1 519 ? 28.245  55.847 61.851 1.00 35.08  ? 519  GLN A CA  1 
ATOM   4099 C C   . GLN A 1 519 ? 26.937  55.290 62.407 1.00 35.08  ? 519  GLN A C   1 
ATOM   4100 O O   . GLN A 1 519 ? 26.773  54.081 62.516 1.00 35.08  ? 519  GLN A O   1 
ATOM   4101 C CB  . GLN A 1 519 ? 29.001  56.574 62.958 1.00 40.62  ? 519  GLN A CB  1 
ATOM   4102 C CG  . GLN A 1 519 ? 29.882  55.658 63.787 1.00 40.62  ? 519  GLN A CG  1 
ATOM   4103 C CD  . GLN A 1 519 ? 30.956  54.982 62.940 1.00 40.62  ? 519  GLN A CD  1 
ATOM   4104 O OE1 . GLN A 1 519 ? 31.631  55.638 62.132 1.00 40.62  ? 519  GLN A OE1 1 
ATOM   4105 N NE2 . GLN A 1 519 ? 31.120  53.666 63.119 1.00 40.62  ? 519  GLN A NE2 1 
ATOM   4106 N N   . MET A 1 520 ? 26.004  56.178 62.737 1.00 33.80  ? 520  MET A N   1 
ATOM   4107 C CA  . MET A 1 520 ? 24.722  55.759 63.287 1.00 33.80  ? 520  MET A CA  1 
ATOM   4108 C C   . MET A 1 520 ? 23.803  55.087 62.272 1.00 33.80  ? 520  MET A C   1 
ATOM   4109 O O   . MET A 1 520 ? 23.105  54.143 62.607 1.00 33.80  ? 520  MET A O   1 
ATOM   4110 C CB  . MET A 1 520 ? 24.003  56.951 63.931 1.00 52.17  ? 520  MET A CB  1 
ATOM   4111 C CG  . MET A 1 520 ? 24.736  57.564 65.120 1.00 52.17  ? 520  MET A CG  1 
ATOM   4112 S SD  . MET A 1 520 ? 25.008  56.406 66.498 1.00 52.17  ? 520  MET A SD  1 
ATOM   4113 C CE  . MET A 1 520 ? 26.699  55.802 66.134 1.00 52.17  ? 520  MET A CE  1 
ATOM   4114 N N   . CYS A 1 521 ? 23.791  55.562 61.035 1.00 31.17  ? 521  CYS A N   1 
ATOM   4115 C CA  . CYS A 1 521 ? 22.933  54.948 60.031 1.00 31.17  ? 521  CYS A CA  1 
ATOM   4116 C C   . CYS A 1 521 ? 23.335  53.491 59.772 1.00 31.17  ? 521  CYS A C   1 
ATOM   4117 O O   . CYS A 1 521 ? 22.483  52.644 59.535 1.00 31.17  ? 521  CYS A O   1 
ATOM   4118 C CB  . CYS A 1 521 ? 22.964  55.765 58.728 1.00 39.59  ? 521  CYS A CB  1 
ATOM   4119 N N   . VAL A 1 522 ? 24.626  53.186 59.820 1.00 31.99  ? 522  VAL A N   1 
ATOM   4120 C CA  . VAL A 1 522 ? 25.055  51.807 59.610 1.00 31.99  ? 522  VAL A CA  1 
ATOM   4121 C C   . VAL A 1 522 ? 24.550  50.956 60.778 1.00 31.99  ? 522  VAL A C   1 
ATOM   4122 O O   . VAL A 1 522 ? 24.168  49.797 60.598 1.00 31.99  ? 522  VAL A O   1 
ATOM   4123 C CB  . VAL A 1 522 ? 26.598  51.695 59.503 1.00 34.78  ? 522  VAL A CB  1 
ATOM   4124 C CG1 . VAL A 1 522 ? 27.035  50.239 59.664 1.00 34.78  ? 522  VAL A CG1 1 
ATOM   4125 C CG2 . VAL A 1 522 ? 27.062  52.242 58.150 1.00 34.78  ? 522  VAL A CG2 1 
ATOM   4126 N N   . PHE A 1 523 ? 24.535  51.544 61.972 1.00 29.82  ? 523  PHE A N   1 
ATOM   4127 C CA  . PHE A 1 523 ? 24.045  50.844 63.148 1.00 29.82  ? 523  PHE A CA  1 
ATOM   4128 C C   . PHE A 1 523 ? 22.549  50.565 63.032 1.00 29.82  ? 523  PHE A C   1 
ATOM   4129 O O   . PHE A 1 523 ? 22.102  49.447 63.255 1.00 29.82  ? 523  PHE A O   1 
ATOM   4130 C CB  . PHE A 1 523 ? 24.281  51.666 64.417 1.00 28.23  ? 523  PHE A CB  1 
ATOM   4131 C CG  . PHE A 1 523 ? 23.577  51.119 65.626 1.00 28.23  ? 523  PHE A CG  1 
ATOM   4132 C CD1 . PHE A 1 523 ? 24.097  50.030 66.318 1.00 28.23  ? 523  PHE A CD1 1 
ATOM   4133 C CD2 . PHE A 1 523 ? 22.375  51.671 66.051 1.00 28.23  ? 523  PHE A CD2 1 
ATOM   4134 C CE1 . PHE A 1 523 ? 23.432  49.497 67.420 1.00 28.23  ? 523  PHE A CE1 1 
ATOM   4135 C CE2 . PHE A 1 523 ? 21.699  51.151 67.144 1.00 28.23  ? 523  PHE A CE2 1 
ATOM   4136 C CZ  . PHE A 1 523 ? 22.232  50.055 67.835 1.00 28.23  ? 523  PHE A CZ  1 
ATOM   4137 N N   . TRP A 1 524 ? 21.780  51.591 62.688 1.00 30.96  ? 524  TRP A N   1 
ATOM   4138 C CA  . TRP A 1 524 ? 20.335  51.453 62.567 1.00 30.96  ? 524  TRP A CA  1 
ATOM   4139 C C   . TRP A 1 524 ? 19.822  50.754 61.314 1.00 30.96  ? 524  TRP A C   1 
ATOM   4140 O O   . TRP A 1 524 ? 18.752  50.167 61.342 1.00 30.96  ? 524  TRP A O   1 
ATOM   4141 C CB  . TRP A 1 524 ? 19.663  52.826 62.674 1.00 25.86  ? 524  TRP A CB  1 
ATOM   4142 C CG  . TRP A 1 524 ? 19.763  53.452 64.039 1.00 25.86  ? 524  TRP A CG  1 
ATOM   4143 C CD1 . TRP A 1 524 ? 20.569  54.489 64.411 1.00 25.86  ? 524  TRP A CD1 1 
ATOM   4144 C CD2 . TRP A 1 524 ? 19.026  53.077 65.208 1.00 25.86  ? 524  TRP A CD2 1 
ATOM   4145 N NE1 . TRP A 1 524 ? 20.380  54.784 65.738 1.00 25.86  ? 524  TRP A NE1 1 
ATOM   4146 C CE2 . TRP A 1 524 ? 19.436  53.933 66.252 1.00 25.86  ? 524  TRP A CE2 1 
ATOM   4147 C CE3 . TRP A 1 524 ? 18.058  52.102 65.476 1.00 25.86  ? 524  TRP A CE3 1 
ATOM   4148 C CZ2 . TRP A 1 524 ? 18.905  53.843 67.546 1.00 25.86  ? 524  TRP A CZ2 1 
ATOM   4149 C CZ3 . TRP A 1 524 ? 17.532  52.015 66.762 1.00 25.86  ? 524  TRP A CZ3 1 
ATOM   4150 C CH2 . TRP A 1 524 ? 17.956  52.879 67.777 1.00 25.86  ? 524  TRP A CH2 1 
ATOM   4151 N N   . ASN A 1 525 ? 20.570  50.804 60.219 1.00 32.65  ? 525  ASN A N   1 
ATOM   4152 C CA  . ASN A 1 525 ? 20.102  50.173 58.989 1.00 32.65  ? 525  ASN A CA  1 
ATOM   4153 C C   . ASN A 1 525 ? 20.733  48.821 58.675 1.00 32.65  ? 525  ASN A C   1 
ATOM   4154 O O   . ASN A 1 525 ? 20.158  48.034 57.932 1.00 32.65  ? 525  ASN A O   1 
ATOM   4155 C CB  . ASN A 1 525 ? 20.302  51.107 57.786 1.00 39.10  ? 525  ASN A CB  1 
ATOM   4156 C CG  . ASN A 1 525 ? 19.551  52.423 57.932 1.00 39.10  ? 525  ASN A CG  1 
ATOM   4157 O OD1 . ASN A 1 525 ? 18.424  52.458 58.442 1.00 39.10  ? 525  ASN A OD1 1 
ATOM   4158 N ND2 . ASN A 1 525 ? 20.166  53.512 57.474 1.00 39.10  ? 525  ASN A ND2 1 
ATOM   4159 N N   . GLN A 1 526 ? 21.908  48.538 59.226 1.00 36.84  ? 526  GLN A N   1 
ATOM   4160 C CA  . GLN A 1 526 ? 22.544  47.256 58.938 1.00 36.84  ? 526  GLN A CA  1 
ATOM   4161 C C   . GLN A 1 526 ? 22.689  46.326 60.135 1.00 36.84  ? 526  GLN A C   1 
ATOM   4162 O O   . GLN A 1 526 ? 22.242  45.181 60.086 1.00 36.84  ? 526  GLN A O   1 
ATOM   4163 C CB  . GLN A 1 526 ? 23.927  47.460 58.325 1.00 69.51  ? 526  GLN A CB  1 
ATOM   4164 C CG  . GLN A 1 526 ? 23.957  48.223 57.005 1.00 69.51  ? 526  GLN A CG  1 
ATOM   4165 C CD  . GLN A 1 526 ? 25.359  48.213 56.376 1.00 69.51  ? 526  GLN A CD  1 
ATOM   4166 O OE1 . GLN A 1 526 ? 25.669  49.031 55.499 1.00 69.51  ? 526  GLN A OE1 1 
ATOM   4167 N NE2 . GLN A 1 526 ? 26.214  47.273 56.829 1.00 69.51  ? 526  GLN A NE2 1 
ATOM   4168 N N   . PHE A 1 527 ? 23.313  46.816 61.203 1.00 34.04  ? 527  PHE A N   1 
ATOM   4169 C CA  . PHE A 1 527 ? 23.552  46.002 62.385 1.00 34.04  ? 527  PHE A CA  1 
ATOM   4170 C C   . PHE A 1 527 ? 22.359  45.612 63.252 1.00 34.04  ? 527  PHE A C   1 
ATOM   4171 O O   . PHE A 1 527 ? 22.105  44.421 63.446 1.00 34.04  ? 527  PHE A O   1 
ATOM   4172 C CB  . PHE A 1 527 ? 24.604  46.652 63.291 1.00 28.72  ? 527  PHE A CB  1 
ATOM   4173 C CG  . PHE A 1 527 ? 24.977  45.797 64.475 1.00 28.72  ? 527  PHE A CG  1 
ATOM   4174 C CD1 . PHE A 1 527 ? 25.655  44.596 64.295 1.00 28.72  ? 527  PHE A CD1 1 
ATOM   4175 C CD2 . PHE A 1 527 ? 24.622  46.172 65.762 1.00 28.72  ? 527  PHE A CD2 1 
ATOM   4176 C CE1 . PHE A 1 527 ? 25.971  43.784 65.374 1.00 28.72  ? 527  PHE A CE1 1 
ATOM   4177 C CE2 . PHE A 1 527 ? 24.933  45.364 66.849 1.00 28.72  ? 527  PHE A CE2 1 
ATOM   4178 C CZ  . PHE A 1 527 ? 25.609  44.167 66.655 1.00 28.72  ? 527  PHE A CZ  1 
ATOM   4179 N N   . LEU A 1 528 ? 21.643  46.596 63.791 1.00 37.95  ? 528  LEU A N   1 
ATOM   4180 C CA  . LEU A 1 528 ? 20.512  46.299 64.668 1.00 37.95  ? 528  LEU A CA  1 
ATOM   4181 C C   . LEU A 1 528 ? 19.451  45.392 64.029 1.00 37.95  ? 528  LEU A C   1 
ATOM   4182 O O   . LEU A 1 528 ? 19.011  44.435 64.646 1.00 37.95  ? 528  LEU A O   1 
ATOM   4183 C CB  . LEU A 1 528 ? 19.873  47.598 65.193 1.00 34.07  ? 528  LEU A CB  1 
ATOM   4184 C CG  . LEU A 1 528 ? 18.826  47.425 66.308 1.00 34.07  ? 528  LEU A CG  1 
ATOM   4185 C CD1 . LEU A 1 528 ? 19.411  46.620 67.462 1.00 34.07  ? 528  LEU A CD1 1 
ATOM   4186 C CD2 . LEU A 1 528 ? 18.365  48.789 66.807 1.00 34.07  ? 528  LEU A CD2 1 
ATOM   4187 N N   . PRO A 1 529 ? 19.017  45.688 62.796 1.00 42.39  ? 529  PRO A N   1 
ATOM   4188 C CA  . PRO A 1 529 ? 18.009  44.814 62.180 1.00 42.39  ? 529  PRO A CA  1 
ATOM   4189 C C   . PRO A 1 529 ? 18.497  43.362 62.185 1.00 42.39  ? 529  PRO A C   1 
ATOM   4190 O O   . PRO A 1 529 ? 17.744  42.441 62.503 1.00 42.39  ? 529  PRO A O   1 
ATOM   4191 C CB  . PRO A 1 529 ? 17.887  45.377 60.768 1.00 36.44  ? 529  PRO A CB  1 
ATOM   4192 C CG  . PRO A 1 529 ? 18.119  46.841 60.986 1.00 36.44  ? 529  PRO A CG  1 
ATOM   4193 C CD  . PRO A 1 529 ? 19.287  46.864 61.949 1.00 36.44  ? 529  PRO A CD  1 
ATOM   4194 N N   . LYS A 1 530 ? 19.768  43.172 61.834 1.00 43.87  ? 530  LYS A N   1 
ATOM   4195 C CA  . LYS A 1 530 ? 20.385  41.847 61.817 1.00 43.87  ? 530  LYS A CA  1 
ATOM   4196 C C   . LYS A 1 530 ? 20.379  41.230 63.216 1.00 43.87  ? 530  LYS A C   1 
ATOM   4197 O O   . LYS A 1 530 ? 20.075  40.054 63.385 1.00 43.87  ? 530  LYS A O   1 
ATOM   4198 C CB  . LYS A 1 530 ? 21.821  41.948 61.303 1.00 66.64  ? 530  LYS A CB  1 
ATOM   4199 C CG  . LYS A 1 530 ? 22.618  40.661 61.440 1.00 66.64  ? 530  LYS A CG  1 
ATOM   4200 C CD  . LYS A 1 530 ? 23.802  40.614 60.461 1.00 66.64  ? 530  LYS A CD  1 
ATOM   4201 C CE  . LYS A 1 530 ? 24.468  39.227 60.493 1.00 66.64  ? 530  LYS A CE  1 
ATOM   4202 N NZ  . LYS A 1 530 ? 25.285  38.938 59.263 1.00 66.64  ? 530  LYS A NZ  1 
ATOM   4203 N N   . LEU A 1 531 ? 20.712  42.028 64.220 1.00 39.05  ? 531  LEU A N   1 
ATOM   4204 C CA  . LEU A 1 531 ? 20.730  41.540 65.591 1.00 39.05  ? 531  LEU A CA  1 
ATOM   4205 C C   . LEU A 1 531 ? 19.334  41.087 66.041 1.00 39.05  ? 531  LEU A C   1 
ATOM   4206 O O   . LEU A 1 531 ? 19.178  40.006 66.608 1.00 39.05  ? 531  LEU A O   1 
ATOM   4207 C CB  . LEU A 1 531 ? 21.271  42.634 66.515 1.00 35.55  ? 531  LEU A CB  1 
ATOM   4208 C CG  . LEU A 1 531 ? 21.344  42.373 68.019 1.00 35.55  ? 531  LEU A CG  1 
ATOM   4209 C CD1 . LEU A 1 531 ? 22.253  43.411 68.653 1.00 35.55  ? 531  LEU A CD1 1 
ATOM   4210 C CD2 . LEU A 1 531 ? 19.940  42.433 68.642 1.00 35.55  ? 531  LEU A CD2 1 
ATOM   4211 N N   . LEU A 1 532 ? 18.321  41.910 65.792 1.00 47.62  ? 532  LEU A N   1 
ATOM   4212 C CA  . LEU A 1 532 ? 16.952  41.558 66.183 1.00 47.62  ? 532  LEU A CA  1 
ATOM   4213 C C   . LEU A 1 532 ? 16.436  40.329 65.420 1.00 47.62  ? 532  LEU A C   1 
ATOM   4214 O O   . LEU A 1 532 ? 15.609  39.579 65.934 1.00 47.62  ? 532  LEU A O   1 
ATOM   4215 C CB  . LEU A 1 532 ? 15.999  42.741 65.951 1.00 35.45  ? 532  LEU A CB  1 
ATOM   4216 C CG  . LEU A 1 532 ? 16.298  44.018 66.736 1.00 35.45  ? 532  LEU A CG  1 
ATOM   4217 C CD1 . LEU A 1 532 ? 15.498  45.189 66.178 1.00 35.45  ? 532  LEU A CD1 1 
ATOM   4218 C CD2 . LEU A 1 532 ? 15.993  43.786 68.192 1.00 35.45  ? 532  LEU A CD2 1 
ATOM   4219 N N   . ASN A 1 533 ? 16.922  40.124 64.200 1.00 54.04  ? 533  ASN A N   1 
ATOM   4220 C CA  . ASN A 1 533 ? 16.494  38.978 63.399 1.00 54.04  ? 533  ASN A CA  1 
ATOM   4221 C C   . ASN A 1 533 ? 17.163  37.664 63.798 1.00 54.04  ? 533  ASN A C   1 
ATOM   4222 O O   . ASN A 1 533 ? 16.598  36.583 63.596 1.00 54.04  ? 533  ASN A O   1 
ATOM   4223 C CB  . ASN A 1 533 ? 16.787  39.201 61.918 1.00 58.32  ? 533  ASN A CB  1 
ATOM   4224 C CG  . ASN A 1 533 ? 16.294  38.057 61.062 1.00 58.32  ? 533  ASN A CG  1 
ATOM   4225 O OD1 . ASN A 1 533 ? 16.950  37.651 60.105 1.00 58.32  ? 533  ASN A OD1 1 
ATOM   4226 N ND2 . ASN A 1 533 ? 15.121  37.532 61.401 1.00 58.32  ? 533  ASN A ND2 1 
ATOM   4227 N N   . ALA A 1 534 ? 18.373  37.744 64.340 1.00 65.60  ? 534  ALA A N   1 
ATOM   4228 C CA  . ALA A 1 534 ? 19.082  36.536 64.724 1.00 65.60  ? 534  ALA A CA  1 
ATOM   4229 C C   . ALA A 1 534 ? 18.693  36.104 66.129 1.00 65.60  ? 534  ALA A C   1 
ATOM   4230 O O   . ALA A 1 534 ? 18.634  34.908 66.421 1.00 65.60  ? 534  ALA A O   1 
ATOM   4231 C CB  . ALA A 1 534 ? 20.595  36.758 64.629 1.00 55.31  ? 534  ALA A CB  1 
ATOM   4232 N N   . THR A 1 535 ? 18.405  37.081 66.988 1.00 88.79  ? 535  THR A N   1 
ATOM   4233 C CA  . THR A 1 535 ? 18.023  36.813 68.374 1.00 88.79  ? 535  THR A CA  1 
ATOM   4234 C C   . THR A 1 535 ? 16.540  37.088 68.630 1.00 88.79  ? 535  THR A C   1 
ATOM   4235 O O   . THR A 1 535 ? 15.803  37.357 67.657 1.00 88.79  ? 535  THR A O   1 
ATOM   4236 C CB  . THR A 1 535 ? 18.843  37.682 69.351 1.00 79.26  ? 535  THR A CB  1 
ATOM   4237 O OG1 . THR A 1 535 ? 18.485  39.058 69.175 1.00 79.26  ? 535  THR A OG1 1 
ATOM   4238 C CG2 . THR A 1 535 ? 20.348  37.518 69.086 1.00 79.26  ? 535  THR A CG2 1 
HETATM 4239 O O   . HOH B 2 .   ? 21.308  57.386 61.316 1.00 43.72  ? 1001 HOH A O   1 
HETATM 4240 O O   . HOH B 2 .   ? 1.425   90.084 54.589 1.00 33.75  ? 1002 HOH A O   1 
HETATM 4241 O O   . HOH B 2 .   ? -0.558  63.394 59.039 1.00 24.83  ? 1003 HOH A O   1 
HETATM 4242 O O   . HOH B 2 .   ? -11.899 64.534 56.066 1.00 42.33  ? 1004 HOH A O   1 
HETATM 4243 O O   . HOH B 2 .   ? 4.246   64.473 61.814 1.00 65.96  ? 1005 HOH A O   1 
HETATM 4244 O O   . HOH B 2 .   ? 19.673  62.432 32.584 1.00 57.31  ? 1006 HOH A O   1 
HETATM 4245 O O   . HOH B 2 .   ? -13.482 57.936 56.660 1.00 32.16  ? 1007 HOH A O   1 
HETATM 4246 O O   . HOH B 2 .   ? -4.539  70.834 34.023 1.00 32.59  ? 1008 HOH A O   1 
HETATM 4247 O O   . HOH B 2 .   ? 2.982   54.078 63.742 1.00 29.09  ? 1009 HOH A O   1 
HETATM 4248 O O   . HOH B 2 .   ? 3.811   66.777 36.318 1.00 38.12  ? 1010 HOH A O   1 
HETATM 4249 O O   . HOH B 2 .   ? 3.892   69.132 57.988 1.00 33.08  ? 1011 HOH A O   1 
HETATM 4250 O O   . HOH B 2 .   ? 7.369   52.361 56.690 1.00 33.52  ? 1012 HOH A O   1 
HETATM 4251 O O   . HOH B 2 .   ? -4.176  51.967 56.469 1.00 31.47  ? 1013 HOH A O   1 
HETATM 4252 O O   . HOH B 2 .   ? -6.757  61.649 65.164 1.00 29.09  ? 1014 HOH A O   1 
HETATM 4253 O O   . HOH B 2 .   ? 0.091   69.485 59.845 1.00 33.27  ? 1015 HOH A O   1 
HETATM 4254 O O   . HOH B 2 .   ? 10.653  55.875 68.859 1.00 29.63  ? 1016 HOH A O   1 
HETATM 4255 O O   . HOH B 2 .   ? 4.097   80.796 51.509 1.00 32.88  ? 1017 HOH A O   1 
HETATM 4256 O O   . HOH B 2 .   ? 18.133  50.676 44.990 1.00 32.83  ? 1018 HOH A O   1 
HETATM 4257 O O   . HOH B 2 .   ? -10.625 65.946 68.907 1.00 41.06  ? 1019 HOH A O   1 
HETATM 4258 O O   . HOH B 2 .   ? -4.363  85.724 39.490 1.00 37.27  ? 1020 HOH A O   1 
HETATM 4259 O O   . HOH B 2 .   ? -18.464 84.556 51.275 1.00 59.33  ? 1021 HOH A O   1 
HETATM 4260 O O   . HOH B 2 .   ? -4.172  70.119 62.550 1.00 38.68  ? 1022 HOH A O   1 
HETATM 4261 O O   . HOH B 2 .   ? -19.715 85.456 49.012 1.00 57.48  ? 1023 HOH A O   1 
HETATM 4262 O O   . HOH B 2 .   ? -0.471  69.573 62.588 1.00 39.19  ? 1024 HOH A O   1 
HETATM 4263 O O   . HOH B 2 .   ? -9.757  62.470 59.749 1.00 35.42  ? 1025 HOH A O   1 
HETATM 4264 O O   . HOH B 2 .   ? -7.305  68.244 58.008 1.00 34.11  ? 1026 HOH A O   1 
HETATM 4265 O O   . HOH B 2 .   ? 21.072  71.579 68.062 1.00 52.77  ? 1027 HOH A O   1 
HETATM 4266 O O   . HOH B 2 .   ? -15.208 60.428 48.864 1.00 37.58  ? 1028 HOH A O   1 
HETATM 4267 O O   . HOH B 2 .   ? -1.494  69.977 52.703 1.00 34.42  ? 1029 HOH A O   1 
HETATM 4268 O O   . HOH B 2 .   ? 27.864  63.580 46.069 1.00 33.06  ? 1030 HOH A O   1 
HETATM 4269 O O   . HOH B 2 .   ? -6.354  83.926 38.805 1.00 36.56  ? 1031 HOH A O   1 
HETATM 4270 O O   . HOH B 2 .   ? -9.802  70.356 54.705 1.00 47.24  ? 1032 HOH A O   1 
HETATM 4271 O O   . HOH B 2 .   ? 21.461  62.021 36.246 1.00 41.96  ? 1033 HOH A O   1 
HETATM 4272 O O   . HOH B 2 .   ? 7.344   46.822 53.894 1.00 37.38  ? 1034 HOH A O   1 
HETATM 4273 O O   . HOH B 2 .   ? 7.257   79.042 68.098 1.00 51.05  ? 1035 HOH A O   1 
HETATM 4274 O O   . HOH B 2 .   ? -3.333  46.017 72.989 1.00 54.56  ? 1036 HOH A O   1 
HETATM 4275 O O   . HOH B 2 .   ? 7.352   70.779 39.277 1.00 53.12  ? 1037 HOH A O   1 
HETATM 4276 O O   . HOH B 2 .   ? -1.670  57.812 62.656 1.00 42.71  ? 1038 HOH A O   1 
HETATM 4277 O O   . HOH B 2 .   ? -3.510  51.047 59.700 1.00 38.45  ? 1039 HOH A O   1 
HETATM 4278 O O   . HOH B 2 .   ? 0.183   77.687 62.156 1.00 40.32  ? 1040 HOH A O   1 
HETATM 4279 O O   . HOH B 2 .   ? 4.221   68.267 61.421 1.00 51.78  ? 1041 HOH A O   1 
HETATM 4280 O O   . HOH B 2 .   ? 19.543  67.842 38.543 1.00 40.36  ? 1042 HOH A O   1 
HETATM 4281 O O   . HOH B 2 .   ? 3.674   50.752 69.804 1.00 39.61  ? 1043 HOH A O   1 
HETATM 4282 O O   . HOH B 2 .   ? 11.601  64.803 35.484 1.00 43.90  ? 1044 HOH A O   1 
HETATM 4283 O O   . HOH B 2 .   ? 24.993  58.588 52.786 1.00 40.28  ? 1045 HOH A O   1 
HETATM 4284 O O   . HOH B 2 .   ? 9.805   56.322 36.393 1.00 39.19  ? 1046 HOH A O   1 
HETATM 4285 O O   . HOH B 2 .   ? 4.105   64.101 64.681 1.00 43.21  ? 1047 HOH A O   1 
HETATM 4286 O O   . HOH B 2 .   ? 16.851  57.543 36.240 1.00 38.95  ? 1048 HOH A O   1 
HETATM 4287 O O   . HOH B 2 .   ? -5.728  44.947 57.609 1.00 37.30  ? 1049 HOH A O   1 
HETATM 4288 O O   . HOH B 2 .   ? -6.285  49.545 61.230 1.00 35.62  ? 1050 HOH A O   1 
HETATM 4289 O O   . HOH B 2 .   ? 25.173  58.306 41.284 1.00 45.64  ? 1051 HOH A O   1 
HETATM 4290 O O   . HOH B 2 .   ? 21.181  82.772 54.255 1.00 56.29  ? 1052 HOH A O   1 
HETATM 4291 O O   . HOH B 2 .   ? 15.632  52.695 61.957 1.00 41.74  ? 1053 HOH A O   1 
HETATM 4292 O O   . HOH B 2 .   ? 1.527   43.393 55.042 1.00 39.58  ? 1054 HOH A O   1 
HETATM 4293 O O   . HOH B 2 .   ? 3.503   51.494 64.660 1.00 32.53  ? 1055 HOH A O   1 
HETATM 4294 O O   . HOH B 2 .   ? -14.847 60.065 57.411 1.00 37.18  ? 1056 HOH A O   1 
HETATM 4295 O O   . HOH B 2 .   ? 13.289  69.062 57.263 1.00 33.18  ? 1057 HOH A O   1 
HETATM 4296 O O   . HOH B 2 .   ? 25.222  61.535 52.969 1.00 35.63  ? 1058 HOH A O   1 
HETATM 4297 O O   . HOH B 2 .   ? 19.030  85.337 50.559 1.00 36.45  ? 1059 HOH A O   1 
HETATM 4298 O O   . HOH B 2 .   ? 24.831  73.304 39.249 1.00 47.51  ? 1060 HOH A O   1 
HETATM 4299 O O   . HOH B 2 .   ? -20.387 77.031 47.698 1.00 54.60  ? 1061 HOH A O   1 
HETATM 4300 O O   . HOH B 2 .   ? 18.475  60.328 41.977 1.00 36.09  ? 1062 HOH A O   1 
HETATM 4301 O O   . HOH B 2 .   ? -20.399 75.475 37.487 1.00 41.37  ? 1063 HOH A O   1 
HETATM 4302 O O   . HOH B 2 .   ? -10.362 56.110 45.139 1.00 42.17  ? 1064 HOH A O   1 
HETATM 4303 O O   . HOH B 2 .   ? -10.568 81.749 55.574 1.00 41.45  ? 1065 HOH A O   1 
HETATM 4304 O O   . HOH B 2 .   ? 3.872   47.625 65.524 1.00 44.48  ? 1066 HOH A O   1 
HETATM 4305 O O   . HOH B 2 .   ? 23.233  67.161 47.926 1.00 34.07  ? 1067 HOH A O   1 
HETATM 4306 O O   . HOH B 2 .   ? 4.862   59.750 70.350 1.00 35.71  ? 1068 HOH A O   1 
HETATM 4307 O O   . HOH B 2 .   ? -15.260 67.552 49.545 1.00 31.04  ? 1069 HOH A O   1 
HETATM 4308 O O   . HOH B 2 .   ? 25.066  58.461 55.542 1.00 39.94  ? 1070 HOH A O   1 
HETATM 4309 O O   . HOH B 2 .   ? 0.395   40.596 57.618 1.00 42.12  ? 1071 HOH A O   1 
HETATM 4310 O O   . HOH B 2 .   ? 7.219   49.268 66.618 1.00 45.18  ? 1072 HOH A O   1 
HETATM 4311 O O   . HOH B 2 .   ? -0.840  66.713 39.923 1.00 41.30  ? 1073 HOH A O   1 
HETATM 4312 O O   . HOH B 2 .   ? 4.875   50.638 62.380 1.00 39.13  ? 1074 HOH A O   1 
HETATM 4313 O O   . HOH B 2 .   ? -2.544  77.940 62.619 1.00 36.83  ? 1075 HOH A O   1 
HETATM 4314 O O   . HOH B 2 .   ? -9.543  82.698 30.285 1.00 50.68  ? 1076 HOH A O   1 
HETATM 4315 O O   . HOH B 2 .   ? -20.222 57.101 59.633 1.00 45.82  ? 1077 HOH A O   1 
HETATM 4316 O O   . HOH B 2 .   ? 22.607  79.569 61.701 1.00 45.93  ? 1078 HOH A O   1 
HETATM 4317 O O   . HOH B 2 .   ? -21.814 46.173 66.828 1.00 50.94  ? 1079 HOH A O   1 
HETATM 4318 O O   . HOH B 2 .   ? -3.534  76.429 64.682 1.00 42.42  ? 1080 HOH A O   1 
HETATM 4319 O O   . HOH B 2 .   ? 21.565  52.120 53.983 1.00 46.10  ? 1081 HOH A O   1 
HETATM 4320 O O   . HOH B 2 .   ? 29.089  59.552 61.460 1.00 36.78  ? 1082 HOH A O   1 
HETATM 4321 O O   . HOH B 2 .   ? 3.581   46.071 61.559 1.00 36.96  ? 1083 HOH A O   1 
HETATM 4322 O O   . HOH B 2 .   ? 7.409   49.187 59.472 1.00 43.53  ? 1084 HOH A O   1 
HETATM 4323 O O   . HOH B 2 .   ? 13.090  83.780 47.539 1.00 43.06  ? 1085 HOH A O   1 
HETATM 4324 O O   . HOH B 2 .   ? 9.128   81.123 36.918 1.00 58.65  ? 1086 HOH A O   1 
HETATM 4325 O O   . HOH B 2 .   ? 24.703  66.620 85.087 1.00 50.40  ? 1087 HOH A O   1 
HETATM 4326 O O   . HOH B 2 .   ? -12.051 67.180 37.187 1.00 34.80  ? 1088 HOH A O   1 
HETATM 4327 O O   . HOH B 2 .   ? 24.485  60.648 40.056 1.00 42.87  ? 1089 HOH A O   1 
HETATM 4328 O O   . HOH B 2 .   ? -0.441  61.391 72.551 1.00 51.50  ? 1090 HOH A O   1 
HETATM 4329 O O   . HOH B 2 .   ? 2.657   63.191 70.242 1.00 53.08  ? 1091 HOH A O   1 
HETATM 4330 O O   . HOH B 2 .   ? 18.568  67.558 73.311 1.00 46.59  ? 1092 HOH A O   1 
HETATM 4331 O O   . HOH B 2 .   ? -10.017 51.952 55.021 1.00 45.85  ? 1093 HOH A O   1 
HETATM 4332 O O   . HOH B 2 .   ? 19.047  78.956 43.754 1.00 59.13  ? 1094 HOH A O   1 
HETATM 4333 O O   . HOH B 2 .   ? 4.359   55.913 78.444 1.00 43.87  ? 1095 HOH A O   1 
HETATM 4334 O O   . HOH B 2 .   ? 18.093  75.339 37.502 1.00 42.10  ? 1096 HOH A O   1 
HETATM 4335 O O   . HOH B 2 .   ? 22.790  54.302 55.074 1.00 47.28  ? 1097 HOH A O   1 
HETATM 4336 O O   . HOH B 2 .   ? -0.071  66.691 37.267 1.00 46.76  ? 1098 HOH A O   1 
HETATM 4337 O O   . HOH B 2 .   ? 27.087  63.824 59.687 1.00 39.14  ? 1099 HOH A O   1 
HETATM 4338 O O   . HOH B 2 .   ? 6.703   62.752 35.316 1.00 41.94  ? 1100 HOH A O   1 
HETATM 4339 O O   . HOH B 2 .   ? -15.293 66.397 51.959 1.00 41.12  ? 1101 HOH A O   1 
HETATM 4340 O O   . HOH B 2 .   ? -0.675  41.157 51.598 1.00 51.84  ? 1102 HOH A O   1 
HETATM 4341 O O   . HOH B 2 .   ? -8.859  61.068 63.632 1.00 36.04  ? 1103 HOH A O   1 
HETATM 4342 O O   . HOH B 2 .   ? -7.632  59.350 42.115 1.00 41.24  ? 1104 HOH A O   1 
HETATM 4343 O O   . HOH B 2 .   ? 23.949  70.138 40.258 1.00 37.50  ? 1105 HOH A O   1 
HETATM 4344 O O   . HOH B 2 .   ? 31.397  58.288 73.060 1.00 53.23  ? 1106 HOH A O   1 
HETATM 4345 O O   . HOH B 2 .   ? -3.604  57.168 64.310 1.00 36.25  ? 1107 HOH A O   1 
HETATM 4346 O O   . HOH B 2 .   ? 31.569  58.892 50.346 1.00 49.04  ? 1108 HOH A O   1 
HETATM 4347 O O   . HOH B 2 .   ? -8.969  58.366 64.786 1.00 43.17  ? 1109 HOH A O   1 
HETATM 4348 O O   . HOH B 2 .   ? 2.549   39.818 59.424 1.00 46.35  ? 1110 HOH A O   1 
HETATM 4349 O O   . HOH B 2 .   ? 12.561  80.095 75.393 1.00 55.48  ? 1111 HOH A O   1 
HETATM 4350 O O   . HOH B 2 .   ? 7.669   64.014 79.488 1.00 38.84  ? 1112 HOH A O   1 
HETATM 4351 O O   . HOH B 2 .   ? 23.192  77.929 44.168 1.00 44.92  ? 1113 HOH A O   1 
HETATM 4352 O O   . HOH B 2 .   ? 16.649  89.112 52.561 1.00 40.59  ? 1114 HOH A O   1 
HETATM 4353 O O   . HOH B 2 .   ? 18.822  54.544 35.789 1.00 49.31  ? 1115 HOH A O   1 
HETATM 4354 O O   . HOH B 2 .   ? -18.135 65.711 61.422 1.00 48.03  ? 1116 HOH A O   1 
HETATM 4355 O O   . HOH B 2 .   ? 14.188  51.366 56.938 1.00 52.15  ? 1117 HOH A O   1 
HETATM 4356 O O   . HOH B 2 .   ? 9.209   88.582 48.325 1.00 47.98  ? 1118 HOH A O   1 
HETATM 4357 O O   . HOH B 2 .   ? 20.562  47.107 51.997 1.00 50.25  ? 1119 HOH A O   1 
HETATM 4358 O O   . HOH B 2 .   ? 28.079  65.901 42.999 1.00 37.21  ? 1120 HOH A O   1 
HETATM 4359 O O   . HOH B 2 .   ? 30.263  52.592 66.173 1.00 50.69  ? 1121 HOH A O   1 
HETATM 4360 O O   . HOH B 2 .   ? 15.204  77.677 77.421 1.00 41.23  ? 1122 HOH A O   1 
HETATM 4361 O O   . HOH B 2 .   ? 19.650  84.837 63.079 1.00 49.60  ? 1123 HOH A O   1 
HETATM 4362 O O   . HOH B 2 .   ? -2.195  68.291 67.166 1.00 58.82  ? 1124 HOH A O   1 
HETATM 4363 O O   . HOH B 2 .   ? -4.828  39.545 57.896 1.00 57.89  ? 1125 HOH A O   1 
HETATM 4364 O O   . HOH B 2 .   ? -12.893 40.403 62.658 1.00 54.08  ? 1126 HOH A O   1 
HETATM 4365 O O   . HOH B 2 .   ? 34.735  65.167 45.572 1.00 53.70  ? 1127 HOH A O   1 
HETATM 4366 O O   . HOH B 2 .   ? 4.402   50.077 67.134 1.00 39.90  ? 1128 HOH A O   1 
HETATM 4367 O O   . HOH B 2 .   ? -8.134  79.861 31.967 1.00 59.91  ? 1129 HOH A O   1 
HETATM 4368 O O   . HOH B 2 .   ? 5.454   53.887 80.986 1.00 43.96  ? 1130 HOH A O   1 
HETATM 4369 O O   . HOH B 2 .   ? 4.157   43.830 55.851 1.00 39.84  ? 1131 HOH A O   1 
HETATM 4370 O O   . HOH B 2 .   ? -8.248  71.816 52.593 1.00 41.50  ? 1132 HOH A O   1 
HETATM 4371 O O   . HOH B 2 .   ? -24.519 44.643 60.712 1.00 55.86  ? 1133 HOH A O   1 
HETATM 4372 O O   . HOH B 2 .   ? 8.909   45.075 43.674 1.00 49.29  ? 1134 HOH A O   1 
HETATM 4373 O O   . HOH B 2 .   ? -10.417 76.117 66.978 1.00 58.75  ? 1135 HOH A O   1 
HETATM 4374 O O   . HOH B 2 .   ? -0.144  66.103 68.544 1.00 57.82  ? 1136 HOH A O   1 
HETATM 4375 O O   . HOH B 2 .   ? 33.679  63.484 84.267 1.00 53.59  ? 1137 HOH A O   1 
HETATM 4376 O O   . HOH B 2 .   ? 8.590   76.972 76.482 1.00 43.17  ? 1138 HOH A O   1 
HETATM 4377 O O   . HOH B 2 .   ? -3.665  69.133 79.761 1.00 54.14  ? 1139 HOH A O   1 
HETATM 4378 O O   . HOH B 2 .   ? 15.887  80.393 69.777 1.00 44.05  ? 1140 HOH A O   1 
HETATM 4379 O O   . HOH B 2 .   ? -13.488 62.389 57.000 1.00 39.96  ? 1141 HOH A O   1 
HETATM 4380 O O   . HOH B 2 .   ? 22.083  62.017 42.037 1.00 40.14  ? 1142 HOH A O   1 
HETATM 4381 O O   . HOH B 2 .   ? -8.812  64.984 70.800 1.00 42.46  ? 1143 HOH A O   1 
HETATM 4382 O O   . HOH B 2 .   ? -2.086  97.850 48.343 1.00 64.34  ? 1144 HOH A O   1 
HETATM 4383 O O   . HOH B 2 .   ? 7.835   75.852 61.248 1.00 42.99  ? 1145 HOH A O   1 
HETATM 4384 O O   . HOH B 2 .   ? 4.761   57.524 76.229 1.00 45.77  ? 1146 HOH A O   1 
HETATM 4385 O O   . HOH B 2 .   ? 23.394  77.393 54.297 1.00 53.25  ? 1147 HOH A O   1 
HETATM 4386 O O   . HOH B 2 .   ? 9.095   59.568 35.910 1.00 57.75  ? 1148 HOH A O   1 
HETATM 4387 O O   . HOH B 2 .   ? 14.372  76.674 63.780 1.00 51.91  ? 1149 HOH A O   1 
HETATM 4388 O O   . HOH B 2 .   ? 2.286   87.061 37.226 1.00 60.37  ? 1150 HOH A O   1 
HETATM 4389 O O   . HOH B 2 .   ? 13.871  91.368 65.508 1.00 52.15  ? 1151 HOH A O   1 
HETATM 4390 O O   . HOH B 2 .   ? 15.858  64.245 32.575 1.00 57.77  ? 1152 HOH A O   1 
HETATM 4391 O O   . HOH B 2 .   ? -4.316  46.522 75.572 1.00 54.08  ? 1153 HOH A O   1 
HETATM 4392 O O   . HOH B 2 .   ? 3.425   81.738 73.603 1.00 59.17  ? 1154 HOH A O   1 
HETATM 4393 O O   . HOH B 2 .   ? -17.893 68.675 48.944 1.00 50.18  ? 1155 HOH A O   1 
HETATM 4394 O O   . HOH B 2 .   ? 23.401  52.040 81.351 1.00 58.09  ? 1156 HOH A O   1 
HETATM 4395 O O   . HOH B 2 .   ? 21.454  58.358 38.028 1.00 60.08  ? 1157 HOH A O   1 
HETATM 4396 O O   . HOH B 2 .   ? -6.576  46.282 51.490 1.00 66.15  ? 1158 HOH A O   1 
HETATM 4397 O O   . HOH B 2 .   ? 3.532   81.069 32.501 1.00 49.68  ? 1159 HOH A O   1 
HETATM 4398 O O   . HOH B 2 .   ? 22.716  51.597 45.491 1.00 51.35  ? 1160 HOH A O   1 
HETATM 4399 O O   . HOH B 2 .   ? 19.071  58.802 35.046 1.00 49.25  ? 1161 HOH A O   1 
HETATM 4400 O O   . HOH B 2 .   ? 25.887  66.548 74.569 1.00 47.10  ? 1162 HOH A O   1 
HETATM 4401 O O   . HOH B 2 .   ? 23.467  79.238 46.984 1.00 50.54  ? 1163 HOH A O   1 
HETATM 4402 O O   . HOH B 2 .   ? -22.063 70.266 47.911 1.00 54.49  ? 1164 HOH A O   1 
HETATM 4403 O O   . HOH B 2 .   ? 15.099  65.448 84.641 1.00 47.11  ? 1165 HOH A O   1 
HETATM 4404 O O   . HOH B 2 .   ? -22.698 80.773 35.995 1.00 52.42  ? 1166 HOH A O   1 
HETATM 4405 O O   . HOH B 2 .   ? -6.907  50.556 49.752 1.00 54.22  ? 1167 HOH A O   1 
HETATM 4406 O O   . HOH B 2 .   ? 21.428  84.286 56.481 1.00 45.36  ? 1168 HOH A O   1 
HETATM 4407 O O   . HOH B 2 .   ? -17.860 63.905 67.583 1.00 52.04  ? 1169 HOH A O   1 
HETATM 4408 O O   . HOH B 2 .   ? -7.533  70.519 56.488 1.00 41.94  ? 1170 HOH A O   1 
HETATM 4409 O O   . HOH B 2 .   ? -14.915 86.969 32.750 1.00 62.81  ? 1171 HOH A O   1 
HETATM 4410 O O   . HOH B 2 .   ? 9.046   50.267 37.280 1.00 54.16  ? 1172 HOH A O   1 
HETATM 4411 O O   . HOH B 2 .   ? 22.807  72.607 76.873 1.00 52.43  ? 1173 HOH A O   1 
HETATM 4412 O O   . HOH B 2 .   ? 20.807  59.470 40.849 1.00 54.71  ? 1174 HOH A O   1 
HETATM 4413 O O   . HOH B 2 .   ? -14.967 47.615 45.499 1.00 56.28  ? 1175 HOH A O   1 
HETATM 4414 O O   . HOH B 2 .   ? 28.421  68.355 78.808 1.00 50.27  ? 1176 HOH A O   1 
HETATM 4415 O O   . HOH B 2 .   ? 9.580   80.246 65.375 1.00 56.66  ? 1177 HOH A O   1 
HETATM 4416 O O   . HOH B 2 .   ? 5.591   47.768 75.705 1.00 45.19  ? 1178 HOH A O   1 
HETATM 4417 O O   . HOH B 2 .   ? 30.307  76.730 45.069 1.00 54.56  ? 1179 HOH A O   1 
HETATM 4418 O O   . HOH B 2 .   ? 11.085  68.562 60.362 1.00 57.00  ? 1180 HOH A O   1 
HETATM 4419 O O   . HOH B 2 .   ? -12.317 63.371 59.179 1.00 46.47  ? 1181 HOH A O   1 
HETATM 4420 O O   . HOH B 2 .   ? 7.625   78.439 35.932 1.00 55.25  ? 1182 HOH A O   1 
HETATM 4421 O O   . HOH B 2 .   ? 13.853  74.609 65.618 1.00 79.22  ? 1183 HOH A O   1 
HETATM 4422 O O   . HOH B 2 .   ? -7.894  58.095 44.600 1.00 41.53  ? 1184 HOH A O   1 
HETATM 4423 O O   . HOH B 2 .   ? 18.485  91.529 62.806 1.00 49.07  ? 1185 HOH A O   1 
HETATM 4424 O O   . HOH B 2 .   ? 9.817   53.034 80.023 1.00 54.59  ? 1186 HOH A O   1 
HETATM 4425 O O   . HOH B 2 .   ? -19.412 55.339 48.811 1.00 78.63  ? 1187 HOH A O   1 
HETATM 4426 O O   . HOH B 2 .   ? 11.759  87.269 44.562 1.00 52.85  ? 1188 HOH A O   1 
HETATM 4427 O O   . HOH B 2 .   ? 6.178   74.529 29.629 1.00 59.45  ? 1189 HOH A O   1 
HETATM 4428 O O   . HOH B 2 .   ? -6.636  48.537 74.262 1.00 58.02  ? 1190 HOH A O   1 
HETATM 4429 O O   . HOH B 2 .   ? -13.551 51.294 49.441 1.00 48.64  ? 1191 HOH A O   1 
HETATM 4430 O O   . HOH B 2 .   ? 11.347  77.966 35.604 1.00 65.61  ? 1192 HOH A O   1 
HETATM 4431 O O   . HOH B 2 .   ? 0.166   67.664 64.439 1.00 50.66  ? 1193 HOH A O   1 
HETATM 4432 O O   . HOH B 2 .   ? 20.125  62.928 65.540 1.00 48.38  ? 1194 HOH A O   1 
HETATM 4433 O O   . HOH B 2 .   ? 16.112  36.219 58.010 1.00 58.16  ? 1195 HOH A O   1 
HETATM 4434 O O   . HOH B 2 .   ? -4.558  68.148 65.834 1.00 56.53  ? 1196 HOH A O   1 
HETATM 4435 O O   . HOH B 2 .   ? 33.206  69.254 47.744 1.00 58.64  ? 1197 HOH A O   1 
HETATM 4436 O O   . HOH B 2 .   ? -16.812 44.410 54.416 1.00 64.49  ? 1198 HOH A O   1 
HETATM 4437 O O   . HOH B 2 .   ? 0.280   70.051 68.464 1.00 47.00  ? 1199 HOH A O   1 
HETATM 4438 O O   . HOH B 2 .   ? 17.113  64.202 67.079 1.00 48.10  ? 1200 HOH A O   1 
HETATM 4439 O O   . HOH B 2 .   ? 11.714  67.463 67.569 1.00 41.28  ? 1201 HOH A O   1 
HETATM 4440 O O   . HOH B 2 .   ? 15.879  52.892 59.214 1.00 59.45  ? 1202 HOH A O   1 
HETATM 4441 O O   . HOH B 2 .   ? -16.056 65.851 36.410 1.00 61.98  ? 1203 HOH A O   1 
HETATM 4442 O O   . HOH B 2 .   ? 14.168  39.817 76.010 1.00 49.33  ? 1204 HOH A O   1 
HETATM 4443 O O   . HOH B 2 .   ? 28.650  75.611 39.129 1.00 53.09  ? 1205 HOH A O   1 
HETATM 4444 O O   . HOH B 2 .   ? 17.234  69.289 84.818 1.00 43.88  ? 1206 HOH A O   1 
HETATM 4445 O O   . HOH B 2 .   ? 29.805  56.589 66.691 1.00 65.90  ? 1207 HOH A O   1 
HETATM 4446 O O   . HOH B 2 .   ? 15.973  49.847 62.938 1.00 47.41  ? 1208 HOH A O   1 
HETATM 4447 O O   . HOH B 2 .   ? 4.976   88.202 68.301 1.00 53.38  ? 1209 HOH A O   1 
HETATM 4448 O O   . HOH B 2 .   ? 3.838   65.595 69.666 1.00 58.85  ? 1210 HOH A O   1 
HETATM 4449 O O   . HOH B 2 .   ? -4.493  40.155 63.302 1.00 44.52  ? 1211 HOH A O   1 
HETATM 4450 O O   . HOH B 2 .   ? 10.394  76.821 78.546 1.00 46.65  ? 1212 HOH A O   1 
HETATM 4451 O O   . HOH B 2 .   ? -24.193 80.507 41.837 1.00 48.05  ? 1213 HOH A O   1 
HETATM 4452 O O   . HOH B 2 .   ? -1.232  71.933 73.353 1.00 53.90  ? 1214 HOH A O   1 
HETATM 4453 O O   . HOH B 2 .   ? 21.183  81.627 35.982 1.00 54.29  ? 1215 HOH A O   1 
HETATM 4454 O O   . HOH B 2 .   ? 32.287  62.464 56.783 1.00 63.58  ? 1216 HOH A O   1 
HETATM 4455 O O   . HOH B 2 .   ? -1.219  51.442 42.568 1.00 51.97  ? 1217 HOH A O   1 
HETATM 4456 O O   . HOH B 2 .   ? -3.432  67.679 31.775 1.00 52.91  ? 1218 HOH A O   1 
HETATM 4457 O O   . HOH B 2 .   ? 16.258  62.532 84.865 1.00 49.51  ? 1219 HOH A O   1 
HETATM 4458 O O   . HOH B 2 .   ? -16.820 55.786 48.391 1.00 80.64  ? 1220 HOH A O   1 
HETATM 4459 O O   . HOH B 2 .   ? 34.327  62.007 77.778 1.00 55.62  ? 1221 HOH A O   1 
HETATM 4460 O O   . HOH B 2 .   ? -18.627 60.362 41.885 1.00 54.82  ? 1222 HOH A O   1 
HETATM 4461 O O   . HOH B 2 .   ? 11.072  70.949 34.103 1.00 49.27  ? 1223 HOH A O   1 
HETATM 4462 O O   . HOH B 2 .   ? -15.395 73.027 54.406 1.00 47.97  ? 1224 HOH A O   1 
HETATM 4463 O O   . HOH B 2 .   ? 30.579  58.901 65.485 1.00 54.83  ? 1225 HOH A O   1 
HETATM 4464 O O   . HOH B 2 .   ? 25.019  48.561 77.060 1.00 49.37  ? 1226 HOH A O   1 
HETATM 4465 O O   . HOH B 2 .   ? -7.934  73.185 67.710 1.00 49.50  ? 1227 HOH A O   1 
HETATM 4466 O O   . HOH B 2 .   ? 12.464  74.002 32.550 1.00 56.83  ? 1228 HOH A O   1 
HETATM 4467 O O   . HOH B 2 .   ? 19.349  65.506 68.424 1.00 53.00  ? 1229 HOH A O   1 
HETATM 4468 O O   . HOH B 2 .   ? -18.780 72.634 51.643 1.00 59.47  ? 1230 HOH A O   1 
HETATM 4469 O O   . HOH B 2 .   ? 17.951  39.578 74.734 1.00 51.48  ? 1231 HOH A O   1 
HETATM 4470 O O   . HOH B 2 .   ? 3.854   56.377 70.564 1.00 43.71  ? 1232 HOH A O   1 
HETATM 4471 O O   . HOH B 2 .   ? -12.442 72.628 65.749 1.00 53.19  ? 1233 HOH A O   1 
HETATM 4472 O O   . HOH B 2 .   ? 5.322   46.315 57.356 1.00 51.39  ? 1234 HOH A O   1 
HETATM 4473 O O   . HOH B 2 .   ? -3.451  51.774 44.095 1.00 53.25  ? 1235 HOH A O   1 
HETATM 4474 O O   . HOH B 2 .   ? -2.626  69.667 29.218 1.00 64.99  ? 1236 HOH A O   1 
HETATM 4475 O O   . HOH B 2 .   ? 16.066  86.604 46.923 1.00 48.76  ? 1237 HOH A O   1 
HETATM 4476 O O   . HOH B 2 .   ? 2.625   54.291 36.646 1.00 42.99  ? 1238 HOH A O   1 
HETATM 4477 O O   . HOH B 2 .   ? -7.347  69.211 29.357 1.00 60.52  ? 1239 HOH A O   1 
HETATM 4478 O O   . HOH B 2 .   ? -18.588 77.496 50.119 1.00 57.07  ? 1240 HOH A O   1 
HETATM 4479 O O   . HOH B 2 .   ? 26.829  59.274 63.011 1.00 42.87  ? 1241 HOH A O   1 
HETATM 4480 O O   . HOH B 2 .   ? -20.598 68.892 51.379 1.00 57.33  ? 1242 HOH A O   1 
HETATM 4481 O O   . HOH B 2 .   ? -14.633 65.527 67.455 1.00 53.81  ? 1243 HOH A O   1 
HETATM 4482 O O   . HOH B 2 .   ? 19.863  45.237 56.028 1.00 50.98  ? 1244 HOH A O   1 
HETATM 4483 O O   . HOH B 2 .   ? 13.962  87.193 66.843 1.00 53.44  ? 1245 HOH A O   1 
HETATM 4484 O O   . HOH B 2 .   ? -5.079  89.419 42.178 1.00 78.37  ? 1246 HOH A O   1 
HETATM 4485 O O   . HOH B 2 .   ? 20.150  69.736 35.798 1.00 55.24  ? 1247 HOH A O   1 
HETATM 4486 O O   . HOH B 2 .   ? -0.159  56.905 38.087 1.00 46.22  ? 1248 HOH A O   1 
HETATM 4487 O O   . HOH B 2 .   ? 0.113   83.320 57.840 1.00 51.14  ? 1249 HOH A O   1 
HETATM 4488 O O   . HOH B 2 .   ? -1.073  36.732 59.508 1.00 58.91  ? 1250 HOH A O   1 
HETATM 4489 O O   . HOH B 2 .   ? 21.843  65.952 70.272 1.00 51.73  ? 1251 HOH A O   1 
HETATM 4490 O O   . HOH B 2 .   ? 29.781  62.560 74.604 1.00 66.40  ? 1252 HOH A O   1 
HETATM 4491 O O   . HOH B 2 .   ? -4.801  80.647 31.888 1.00 56.21  ? 1253 HOH A O   1 
HETATM 4492 O O   . HOH B 2 .   ? -24.323 56.043 59.555 1.00 60.05  ? 1254 HOH A O   1 
HETATM 4493 O O   . HOH B 2 .   ? 21.243  72.773 79.120 1.00 51.26  ? 1255 HOH A O   1 
HETATM 4494 O O   . HOH B 2 .   ? 22.096  87.357 51.708 1.00 56.43  ? 1256 HOH A O   1 
HETATM 4495 O O   . HOH B 2 .   ? -7.753  43.529 74.341 1.00 63.39  ? 1257 HOH A O   1 
HETATM 4496 O O   . HOH B 2 .   ? 9.078   62.456 60.943 1.00 67.32  ? 1258 HOH A O   1 
HETATM 4497 O O   . HOH B 2 .   ? 22.811  56.291 39.259 1.00 48.91  ? 1259 HOH A O   1 
HETATM 4498 O O   . HOH B 2 .   ? -3.483  86.549 32.589 1.00 57.64  ? 1260 HOH A O   1 
HETATM 4499 O O   . HOH B 2 .   ? 32.283  58.210 62.013 1.00 63.17  ? 1261 HOH A O   1 
HETATM 4500 O O   . HOH B 2 .   ? 1.224   46.498 40.340 1.00 55.81  ? 1262 HOH A O   1 
HETATM 4501 O O   . HOH B 2 .   ? -10.364 71.983 67.342 1.00 55.83  ? 1263 HOH A O   1 
HETATM 4502 O O   . HOH B 2 .   ? 12.527  48.104 36.713 1.00 60.86  ? 1264 HOH A O   1 
HETATM 4503 O O   . HOH B 2 .   ? 11.994  50.753 59.565 1.00 59.42  ? 1265 HOH A O   1 
HETATM 4504 O O   . HOH B 2 .   ? 11.890  77.670 63.053 1.00 70.94  ? 1266 HOH A O   1 
HETATM 4505 O O   . HOH B 2 .   ? 11.490  55.994 84.371 1.00 65.77  ? 1267 HOH A O   1 
HETATM 4506 O O   . HOH B 2 .   ? -5.670  76.874 66.664 1.00 50.30  ? 1268 HOH A O   1 
HETATM 4507 O O   . HOH B 2 .   ? 10.999  77.559 84.241 1.00 56.74  ? 1269 HOH A O   1 
HETATM 4508 O O   . HOH B 2 .   ? -10.000 63.743 40.964 1.00 37.71  ? 1270 HOH A O   1 
HETATM 4509 O O   . HOH B 2 .   ? -21.585 60.230 63.083 1.00 57.25  ? 1271 HOH A O   1 
HETATM 4510 O O   . HOH B 2 .   ? -14.378 68.916 42.088 1.00 65.22  ? 1272 HOH A O   1 
HETATM 4511 O O   . HOH B 2 .   ? -12.315 90.738 39.487 1.00 70.03  ? 1273 HOH A O   1 
HETATM 4512 O O   . HOH B 2 .   ? -3.623  50.068 62.236 1.00 46.58  ? 1274 HOH A O   1 
HETATM 4513 O O   . HOH B 2 .   ? 30.299  64.519 43.415 1.00 72.34  ? 1275 HOH A O   1 
HETATM 4514 O O   . HOH B 2 .   ? -10.006 65.224 38.325 1.00 46.22  ? 1276 HOH A O   1 
HETATM 4515 O O   . HOH B 2 .   ? 31.995  65.657 55.864 1.00 51.57  ? 1277 HOH A O   1 
HETATM 4516 O O   . HOH B 2 .   ? -0.832  75.026 31.333 1.00 66.00  ? 1278 HOH A O   1 
HETATM 4517 O O   . HOH B 2 .   ? -8.579  66.865 72.656 1.00 58.38  ? 1279 HOH A O   1 
HETATM 4518 O O   . HOH B 2 .   ? 13.592  59.436 79.441 1.00 44.87  ? 1280 HOH A O   1 
HETATM 4519 O O   . HOH B 2 .   ? 19.370  64.459 86.448 1.00 52.52  ? 1281 HOH A O   1 
HETATM 4520 O O   . HOH B 2 .   ? -1.178  57.994 33.551 1.00 55.42  ? 1282 HOH A O   1 
HETATM 4521 O O   . HOH B 2 .   ? 5.575   58.005 35.754 1.00 51.03  ? 1283 HOH A O   1 
HETATM 4522 O O   . HOH B 2 .   ? 0.348   75.552 79.005 1.00 58.86  ? 1284 HOH A O   1 
HETATM 4523 O O   . HOH B 2 .   ? 1.917   83.343 61.354 1.00 58.44  ? 1285 HOH A O   1 
HETATM 4524 O O   . HOH B 2 .   ? -20.583 83.054 35.072 1.00 57.07  ? 1286 HOH A O   1 
HETATM 4525 O O   . HOH B 2 .   ? 11.755  57.699 86.535 1.00 62.09  ? 1287 HOH A O   1 
HETATM 4526 O O   . HOH B 2 .   ? -2.315  65.057 77.713 1.00 71.97  ? 1288 HOH A O   1 
HETATM 4527 O O   . HOH B 2 .   ? -15.646 75.271 50.699 1.00 54.64  ? 1289 HOH A O   1 
HETATM 4528 O O   . HOH B 2 .   ? 25.291  70.348 63.216 1.00 49.73  ? 1290 HOH A O   1 
HETATM 4529 O O   . HOH B 2 .   ? 30.540  79.063 56.966 1.00 69.27  ? 1291 HOH A O   1 
HETATM 4530 O O   . HOH B 2 .   ? 29.776  54.402 85.951 1.00 54.32  ? 1292 HOH A O   1 
HETATM 4531 O O   . HOH B 2 .   ? 13.201  86.843 46.884 1.00 55.40  ? 1293 HOH A O   1 
HETATM 4532 O O   . HOH B 2 .   ? 27.117  69.215 59.693 1.00 58.49  ? 1294 HOH A O   1 
HETATM 4533 O O   . HOH B 2 .   ? -7.173  84.936 31.437 1.00 61.23  ? 1295 HOH A O   1 
HETATM 4534 O O   . HOH B 2 .   ? 11.276  42.742 52.410 1.00 57.51  ? 1296 HOH A O   1 
HETATM 4535 O O   . HOH B 2 .   ? 3.706   92.121 55.715 1.00 64.32  ? 1297 HOH A O   1 
HETATM 4536 O O   . HOH B 2 .   ? 24.850  80.713 50.047 1.00 59.55  ? 1298 HOH A O   1 
HETATM 4537 O O   . HOH B 2 .   ? 4.161   87.093 41.661 1.00 53.97  ? 1299 HOH A O   1 
HETATM 4538 O O   . HOH B 2 .   ? 25.908  66.850 60.320 1.00 58.28  ? 1300 HOH A O   1 
HETATM 4539 O O   . HOH B 2 .   ? 9.211   91.152 49.881 1.00 52.70  ? 1301 HOH A O   1 
HETATM 4540 O O   . HOH B 2 .   ? 19.086  75.158 71.075 1.00 53.41  ? 1302 HOH A O   1 
HETATM 4541 O O   . HOH B 2 .   ? 26.580  68.823 41.369 1.00 51.12  ? 1303 HOH A O   1 
HETATM 4542 O O   . HOH B 2 .   ? 1.746   88.262 41.781 1.00 51.87  ? 1304 HOH A O   1 
HETATM 4543 O O   . HOH B 2 .   ? 10.991  49.165 54.971 1.00 55.32  ? 1305 HOH A O   1 
HETATM 4544 O O   . HOH B 2 .   ? -12.085 39.480 65.159 1.00 63.26  ? 1306 HOH A O   1 
HETATM 4545 O O   . HOH B 2 .   ? 28.780  50.378 70.732 1.00 73.45  ? 1307 HOH A O   1 
HETATM 4546 O O   . HOH B 2 .   ? 4.962   46.875 40.505 1.00 53.58  ? 1308 HOH A O   1 
HETATM 4547 O O   . HOH B 2 .   ? -15.366 83.883 46.554 1.00 78.13  ? 1309 HOH A O   1 
HETATM 4548 O O   . HOH B 2 .   ? 29.046  54.204 52.193 1.00 58.03  ? 1310 HOH A O   1 
HETATM 4549 O O   . HOH B 2 .   ? 9.940   88.806 60.893 1.00 67.95  ? 1311 HOH A O   1 
HETATM 4550 O O   . HOH B 2 .   ? 8.660   49.713 75.175 1.00 55.64  ? 1312 HOH A O   1 
HETATM 4551 O O   . HOH B 2 .   ? -2.198  57.740 66.732 1.00 57.41  ? 1313 HOH A O   1 
HETATM 4552 O O   . HOH B 2 .   ? -21.863 82.119 48.238 1.00 63.37  ? 1314 HOH A O   1 
HETATM 4553 O O   . HOH B 2 .   ? 34.521  59.715 48.851 1.00 59.72  ? 1315 HOH A O   1 
HETATM 4554 O O   . HOH B 2 .   ? -12.432 64.674 41.810 1.00 53.48  ? 1316 HOH A O   1 
HETATM 4555 O O   . HOH B 2 .   ? 26.002  45.873 77.575 1.00 51.47  ? 1317 HOH A O   1 
HETATM 4556 O O   . HOH B 2 .   ? 12.636  43.704 75.286 1.00 58.38  ? 1318 HOH A O   1 
HETATM 4557 O O   . HOH B 2 .   ? 30.222  74.220 46.634 1.00 54.37  ? 1319 HOH A O   1 
HETATM 4558 O O   . HOH B 2 .   ? 18.627  79.857 46.542 1.00 47.36  ? 1320 HOH A O   1 
HETATM 4559 O O   . HOH B 2 .   ? 10.726  89.653 45.781 1.00 54.65  ? 1321 HOH A O   1 
HETATM 4560 O O   . HOH B 2 .   ? 29.909  54.219 47.916 1.00 54.58  ? 1322 HOH A O   1 
HETATM 4561 O O   . HOH B 2 .   ? 3.230   79.909 66.075 1.00 70.85  ? 1323 HOH A O   1 
HETATM 4562 O O   . HOH B 2 .   ? 6.477   48.471 55.930 1.00 45.30  ? 1324 HOH A O   1 
HETATM 4563 O O   . HOH B 2 .   ? 0.255   41.784 64.604 1.00 47.87  ? 1325 HOH A O   1 
HETATM 4564 O O   . HOH B 2 .   ? 25.129  82.222 52.649 1.00 61.55  ? 1326 HOH A O   1 
HETATM 4565 O O   . HOH B 2 .   ? 12.110  67.467 83.887 1.00 49.19  ? 1327 HOH A O   1 
HETATM 4566 O O   . HOH B 2 .   ? -10.782 82.704 33.451 1.00 60.25  ? 1328 HOH A O   1 
HETATM 4567 O O   . HOH B 2 .   ? 18.376  88.065 50.719 1.00 46.96  ? 1329 HOH A O   1 
HETATM 4568 O O   . HOH B 2 .   ? -17.961 40.112 70.166 1.00 55.24  ? 1330 HOH A O   1 
HETATM 4569 O O   . HOH B 2 .   ? 12.317  60.980 86.478 1.00 59.30  ? 1331 HOH A O   1 
HETATM 4570 O O   . HOH B 2 .   ? -15.063 38.889 58.612 1.00 59.53  ? 1332 HOH A O   1 
HETATM 4571 O O   . HOH B 2 .   ? -8.950  62.995 72.672 1.00 51.80  ? 1333 HOH A O   1 
HETATM 4572 O O   . HOH B 2 .   ? 21.495  43.575 80.138 1.00 73.02  ? 1334 HOH A O   1 
HETATM 4573 O O   . HOH B 2 .   ? -3.967  85.914 53.828 1.00 50.17  ? 1335 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS ALA A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS ALA A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS ALA A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS ALA A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS ALA A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 488 GLN GLN A . n 
A 1 489 GLU 489 489 489 GLU GLU A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS ALA A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   1001 1001 HOH HOH A . 
B 2 HOH 2   1002 1002 HOH HOH A . 
B 2 HOH 3   1003 1003 HOH HOH A . 
B 2 HOH 4   1004 1004 HOH HOH A . 
B 2 HOH 5   1005 1005 HOH HOH A . 
B 2 HOH 6   1006 1006 HOH HOH A . 
B 2 HOH 7   1007 1007 HOH HOH A . 
B 2 HOH 8   1008 1008 HOH HOH A . 
B 2 HOH 9   1009 1009 HOH HOH A . 
B 2 HOH 10  1010 1010 HOH HOH A . 
B 2 HOH 11  1011 1011 HOH HOH A . 
B 2 HOH 12  1012 1012 HOH HOH A . 
B 2 HOH 13  1013 1013 HOH HOH A . 
B 2 HOH 14  1014 1014 HOH HOH A . 
B 2 HOH 15  1015 1015 HOH HOH A . 
B 2 HOH 16  1016 1016 HOH HOH A . 
B 2 HOH 17  1017 1017 HOH HOH A . 
B 2 HOH 18  1018 1018 HOH HOH A . 
B 2 HOH 19  1019 1019 HOH HOH A . 
B 2 HOH 20  1020 1020 HOH HOH A . 
B 2 HOH 21  1021 1021 HOH HOH A . 
B 2 HOH 22  1022 1022 HOH HOH A . 
B 2 HOH 23  1023 1023 HOH HOH A . 
B 2 HOH 24  1024 1024 HOH HOH A . 
B 2 HOH 25  1025 1025 HOH HOH A . 
B 2 HOH 26  1026 1026 HOH HOH A . 
B 2 HOH 27  1027 1027 HOH HOH A . 
B 2 HOH 28  1028 1028 HOH HOH A . 
B 2 HOH 29  1029 1029 HOH HOH A . 
B 2 HOH 30  1030 1030 HOH HOH A . 
B 2 HOH 31  1031 1031 HOH HOH A . 
B 2 HOH 32  1032 1032 HOH HOH A . 
B 2 HOH 33  1033 1033 HOH HOH A . 
B 2 HOH 34  1034 1034 HOH HOH A . 
B 2 HOH 35  1035 1035 HOH HOH A . 
B 2 HOH 36  1036 1036 HOH HOH A . 
B 2 HOH 37  1037 1037 HOH HOH A . 
B 2 HOH 38  1038 1038 HOH HOH A . 
B 2 HOH 39  1039 1039 HOH HOH A . 
B 2 HOH 40  1040 1040 HOH HOH A . 
B 2 HOH 41  1041 1041 HOH HOH A . 
B 2 HOH 42  1042 1042 HOH HOH A . 
B 2 HOH 43  1043 1043 HOH HOH A . 
B 2 HOH 44  1044 1044 HOH HOH A . 
B 2 HOH 45  1045 1045 HOH HOH A . 
B 2 HOH 46  1046 1046 HOH HOH A . 
B 2 HOH 47  1047 1047 HOH HOH A . 
B 2 HOH 48  1048 1048 HOH HOH A . 
B 2 HOH 49  1049 1049 HOH HOH A . 
B 2 HOH 50  1050 1050 HOH HOH A . 
B 2 HOH 51  1051 1051 HOH HOH A . 
B 2 HOH 52  1052 1052 HOH HOH A . 
B 2 HOH 53  1053 1053 HOH HOH A . 
B 2 HOH 54  1054 1054 HOH HOH A . 
B 2 HOH 55  1055 1055 HOH HOH A . 
B 2 HOH 56  1056 1056 HOH HOH A . 
B 2 HOH 57  1057 1057 HOH HOH A . 
B 2 HOH 58  1058 1058 HOH HOH A . 
B 2 HOH 59  1059 1059 HOH HOH A . 
B 2 HOH 60  1060 1060 HOH HOH A . 
B 2 HOH 61  1061 1061 HOH HOH A . 
B 2 HOH 62  1062 1062 HOH HOH A . 
B 2 HOH 63  1063 1063 HOH HOH A . 
B 2 HOH 64  1064 1064 HOH HOH A . 
B 2 HOH 65  1065 1065 HOH HOH A . 
B 2 HOH 66  1066 1066 HOH HOH A . 
B 2 HOH 67  1067 1067 HOH HOH A . 
B 2 HOH 68  1068 1068 HOH HOH A . 
B 2 HOH 69  1069 1069 HOH HOH A . 
B 2 HOH 70  1070 1070 HOH HOH A . 
B 2 HOH 71  1071 1071 HOH HOH A . 
B 2 HOH 72  1072 1072 HOH HOH A . 
B 2 HOH 73  1073 1073 HOH HOH A . 
B 2 HOH 74  1074 1074 HOH HOH A . 
B 2 HOH 75  1075 1075 HOH HOH A . 
B 2 HOH 76  1076 1076 HOH HOH A . 
B 2 HOH 77  1077 1077 HOH HOH A . 
B 2 HOH 78  1078 1078 HOH HOH A . 
B 2 HOH 79  1079 1079 HOH HOH A . 
B 2 HOH 80  1080 1080 HOH HOH A . 
B 2 HOH 81  1081 1081 HOH HOH A . 
B 2 HOH 82  1082 1082 HOH HOH A . 
B 2 HOH 83  1083 1083 HOH HOH A . 
B 2 HOH 84  1084 1084 HOH HOH A . 
B 2 HOH 85  1085 1085 HOH HOH A . 
B 2 HOH 86  1086 1086 HOH HOH A . 
B 2 HOH 87  1087 1087 HOH HOH A . 
B 2 HOH 88  1088 1088 HOH HOH A . 
B 2 HOH 89  1089 1089 HOH HOH A . 
B 2 HOH 90  1090 1090 HOH HOH A . 
B 2 HOH 91  1091 1091 HOH HOH A . 
B 2 HOH 92  1092 1092 HOH HOH A . 
B 2 HOH 93  1093 1093 HOH HOH A . 
B 2 HOH 94  1094 1094 HOH HOH A . 
B 2 HOH 95  1095 1095 HOH HOH A . 
B 2 HOH 96  1096 1096 HOH HOH A . 
B 2 HOH 97  1097 1097 HOH HOH A . 
B 2 HOH 98  1098 1098 HOH HOH A . 
B 2 HOH 99  1099 1099 HOH HOH A . 
B 2 HOH 100 1100 1100 HOH HOH A . 
B 2 HOH 101 1101 1101 HOH HOH A . 
B 2 HOH 102 1102 1102 HOH HOH A . 
B 2 HOH 103 1103 1103 HOH HOH A . 
B 2 HOH 104 1104 1104 HOH HOH A . 
B 2 HOH 105 1105 1105 HOH HOH A . 
B 2 HOH 106 1106 1106 HOH HOH A . 
B 2 HOH 107 1107 1107 HOH HOH A . 
B 2 HOH 108 1108 1108 HOH HOH A . 
B 2 HOH 109 1109 1109 HOH HOH A . 
B 2 HOH 110 1110 1110 HOH HOH A . 
B 2 HOH 111 1111 1111 HOH HOH A . 
B 2 HOH 112 1112 1112 HOH HOH A . 
B 2 HOH 113 1113 1113 HOH HOH A . 
B 2 HOH 114 1114 1114 HOH HOH A . 
B 2 HOH 115 1115 1115 HOH HOH A . 
B 2 HOH 116 1116 1116 HOH HOH A . 
B 2 HOH 117 1117 1117 HOH HOH A . 
B 2 HOH 118 1118 1118 HOH HOH A . 
B 2 HOH 119 1119 1119 HOH HOH A . 
B 2 HOH 120 1120 1120 HOH HOH A . 
B 2 HOH 121 1121 1121 HOH HOH A . 
B 2 HOH 122 1122 1122 HOH HOH A . 
B 2 HOH 123 1123 1123 HOH HOH A . 
B 2 HOH 124 1124 1124 HOH HOH A . 
B 2 HOH 125 1125 1125 HOH HOH A . 
B 2 HOH 126 1126 1126 HOH HOH A . 
B 2 HOH 127 1127 1127 HOH HOH A . 
B 2 HOH 128 1128 1128 HOH HOH A . 
B 2 HOH 129 1129 1129 HOH HOH A . 
B 2 HOH 130 1130 1130 HOH HOH A . 
B 2 HOH 131 1131 1131 HOH HOH A . 
B 2 HOH 132 1132 1132 HOH HOH A . 
B 2 HOH 133 1133 1133 HOH HOH A . 
B 2 HOH 134 1134 1134 HOH HOH A . 
B 2 HOH 135 1135 1135 HOH HOH A . 
B 2 HOH 136 1136 1136 HOH HOH A . 
B 2 HOH 137 1137 1137 HOH HOH A . 
B 2 HOH 138 1138 1138 HOH HOH A . 
B 2 HOH 139 1139 1139 HOH HOH A . 
B 2 HOH 140 1140 1140 HOH HOH A . 
B 2 HOH 141 1141 1141 HOH HOH A . 
B 2 HOH 142 1142 1142 HOH HOH A . 
B 2 HOH 143 1143 1143 HOH HOH A . 
B 2 HOH 144 1144 1144 HOH HOH A . 
B 2 HOH 145 1145 1145 HOH HOH A . 
B 2 HOH 146 1146 1146 HOH HOH A . 
B 2 HOH 147 1147 1147 HOH HOH A . 
B 2 HOH 148 1148 1148 HOH HOH A . 
B 2 HOH 149 1149 1149 HOH HOH A . 
B 2 HOH 150 1150 1150 HOH HOH A . 
B 2 HOH 151 1151 1151 HOH HOH A . 
B 2 HOH 152 1152 1152 HOH HOH A . 
B 2 HOH 153 1153 1153 HOH HOH A . 
B 2 HOH 154 1154 1154 HOH HOH A . 
B 2 HOH 155 1155 1155 HOH HOH A . 
B 2 HOH 156 1156 1156 HOH HOH A . 
B 2 HOH 157 1157 1157 HOH HOH A . 
B 2 HOH 158 1158 1158 HOH HOH A . 
B 2 HOH 159 1159 1159 HOH HOH A . 
B 2 HOH 160 1160 1160 HOH HOH A . 
B 2 HOH 161 1161 1161 HOH HOH A . 
B 2 HOH 162 1162 1162 HOH HOH A . 
B 2 HOH 163 1163 1163 HOH HOH A . 
B 2 HOH 164 1164 1164 HOH HOH A . 
B 2 HOH 165 1165 1165 HOH HOH A . 
B 2 HOH 166 1166 1166 HOH HOH A . 
B 2 HOH 167 1167 1167 HOH HOH A . 
B 2 HOH 168 1168 1168 HOH HOH A . 
B 2 HOH 169 1169 1169 HOH HOH A . 
B 2 HOH 170 1170 1170 HOH HOH A . 
B 2 HOH 171 1171 1171 HOH HOH A . 
B 2 HOH 172 1172 1172 HOH HOH A . 
B 2 HOH 173 1173 1173 HOH HOH A . 
B 2 HOH 174 1174 1174 HOH HOH A . 
B 2 HOH 175 1175 1175 HOH HOH A . 
B 2 HOH 176 1176 1176 HOH HOH A . 
B 2 HOH 177 1177 1177 HOH HOH A . 
B 2 HOH 178 1178 1178 HOH HOH A . 
B 2 HOH 179 1179 1179 HOH HOH A . 
B 2 HOH 180 1180 1180 HOH HOH A . 
B 2 HOH 181 1181 1181 HOH HOH A . 
B 2 HOH 182 1182 1182 HOH HOH A . 
B 2 HOH 183 1183 1183 HOH HOH A . 
B 2 HOH 184 1184 1184 HOH HOH A . 
B 2 HOH 185 1185 1185 HOH HOH A . 
B 2 HOH 186 1186 1186 HOH HOH A . 
B 2 HOH 187 1187 1187 HOH HOH A . 
B 2 HOH 188 1188 1188 HOH HOH A . 
B 2 HOH 189 1189 1189 HOH HOH A . 
B 2 HOH 190 1190 1190 HOH HOH A . 
B 2 HOH 191 1191 1191 HOH HOH A . 
B 2 HOH 192 1192 1192 HOH HOH A . 
B 2 HOH 193 1193 1193 HOH HOH A . 
B 2 HOH 194 1194 1194 HOH HOH A . 
B 2 HOH 195 1195 1195 HOH HOH A . 
B 2 HOH 196 1196 1196 HOH HOH A . 
B 2 HOH 197 1197 1197 HOH HOH A . 
B 2 HOH 198 1198 1198 HOH HOH A . 
B 2 HOH 199 1199 1199 HOH HOH A . 
B 2 HOH 200 1200 1200 HOH HOH A . 
B 2 HOH 201 1201 1201 HOH HOH A . 
B 2 HOH 202 1202 1202 HOH HOH A . 
B 2 HOH 203 1203 1203 HOH HOH A . 
B 2 HOH 204 1204 1204 HOH HOH A . 
B 2 HOH 205 1205 1205 HOH HOH A . 
B 2 HOH 206 1206 1206 HOH HOH A . 
B 2 HOH 207 1207 1207 HOH HOH A . 
B 2 HOH 208 1208 1208 HOH HOH A . 
B 2 HOH 209 1209 1209 HOH HOH A . 
B 2 HOH 210 1210 1210 HOH HOH A . 
B 2 HOH 211 1211 1211 HOH HOH A . 
B 2 HOH 212 1212 1212 HOH HOH A . 
B 2 HOH 213 1213 1213 HOH HOH A . 
B 2 HOH 214 1214 1214 HOH HOH A . 
B 2 HOH 215 1215 1215 HOH HOH A . 
B 2 HOH 216 1216 1216 HOH HOH A . 
B 2 HOH 217 1217 1217 HOH HOH A . 
B 2 HOH 218 1218 1218 HOH HOH A . 
B 2 HOH 219 1219 1219 HOH HOH A . 
B 2 HOH 220 1220 1220 HOH HOH A . 
B 2 HOH 221 1221 1221 HOH HOH A . 
B 2 HOH 222 1222 1222 HOH HOH A . 
B 2 HOH 223 1223 1223 HOH HOH A . 
B 2 HOH 224 1224 1224 HOH HOH A . 
B 2 HOH 225 1225 1225 HOH HOH A . 
B 2 HOH 226 1226 1226 HOH HOH A . 
B 2 HOH 227 1227 1227 HOH HOH A . 
B 2 HOH 228 1228 1228 HOH HOH A . 
B 2 HOH 229 1229 1229 HOH HOH A . 
B 2 HOH 230 1230 1230 HOH HOH A . 
B 2 HOH 231 1231 1231 HOH HOH A . 
B 2 HOH 232 1232 1232 HOH HOH A . 
B 2 HOH 233 1233 1233 HOH HOH A . 
B 2 HOH 234 1234 1234 HOH HOH A . 
B 2 HOH 235 1235 1235 HOH HOH A . 
B 2 HOH 236 1236 1236 HOH HOH A . 
B 2 HOH 237 1237 1237 HOH HOH A . 
B 2 HOH 238 1238 1238 HOH HOH A . 
B 2 HOH 239 1239 1239 HOH HOH A . 
B 2 HOH 240 1240 1240 HOH HOH A . 
B 2 HOH 241 1241 1241 HOH HOH A . 
B 2 HOH 242 1242 1242 HOH HOH A . 
B 2 HOH 243 1243 1243 HOH HOH A . 
B 2 HOH 244 1244 1244 HOH HOH A . 
B 2 HOH 245 1245 1245 HOH HOH A . 
B 2 HOH 246 1246 1246 HOH HOH A . 
B 2 HOH 247 1247 1247 HOH HOH A . 
B 2 HOH 248 1248 1248 HOH HOH A . 
B 2 HOH 249 1249 1249 HOH HOH A . 
B 2 HOH 250 1250 1250 HOH HOH A . 
B 2 HOH 251 1251 1251 HOH HOH A . 
B 2 HOH 252 1252 1252 HOH HOH A . 
B 2 HOH 253 1253 1253 HOH HOH A . 
B 2 HOH 254 1254 1254 HOH HOH A . 
B 2 HOH 255 1255 1255 HOH HOH A . 
B 2 HOH 256 1256 1256 HOH HOH A . 
B 2 HOH 257 1257 1257 HOH HOH A . 
B 2 HOH 258 1258 1258 HOH HOH A . 
B 2 HOH 259 1259 1259 HOH HOH A . 
B 2 HOH 260 1260 1260 HOH HOH A . 
B 2 HOH 261 1261 1261 HOH HOH A . 
B 2 HOH 262 1262 1262 HOH HOH A . 
B 2 HOH 263 1263 1263 HOH HOH A . 
B 2 HOH 264 1264 1264 HOH HOH A . 
B 2 HOH 265 1265 1265 HOH HOH A . 
B 2 HOH 266 1266 1266 HOH HOH A . 
B 2 HOH 267 1267 1267 HOH HOH A . 
B 2 HOH 268 1268 1268 HOH HOH A . 
B 2 HOH 269 1269 1269 HOH HOH A . 
B 2 HOH 270 1270 1270 HOH HOH A . 
B 2 HOH 271 1271 1271 HOH HOH A . 
B 2 HOH 272 1272 1272 HOH HOH A . 
B 2 HOH 273 1273 1273 HOH HOH A . 
B 2 HOH 274 1274 1274 HOH HOH A . 
B 2 HOH 275 1275 1275 HOH HOH A . 
B 2 HOH 276 1276 1276 HOH HOH A . 
B 2 HOH 277 1277 1277 HOH HOH A . 
B 2 HOH 278 1278 1278 HOH HOH A . 
B 2 HOH 279 1279 1279 HOH HOH A . 
B 2 HOH 280 1280 1280 HOH HOH A . 
B 2 HOH 281 1281 1281 HOH HOH A . 
B 2 HOH 282 1282 1282 HOH HOH A . 
B 2 HOH 283 1283 1283 HOH HOH A . 
B 2 HOH 284 1284 1284 HOH HOH A . 
B 2 HOH 285 1285 1285 HOH HOH A . 
B 2 HOH 286 1286 1286 HOH HOH A . 
B 2 HOH 287 1287 1287 HOH HOH A . 
B 2 HOH 288 1288 1288 HOH HOH A . 
B 2 HOH 289 1289 1289 HOH HOH A . 
B 2 HOH 290 1290 1290 HOH HOH A . 
B 2 HOH 291 1291 1291 HOH HOH A . 
B 2 HOH 292 1292 1292 HOH HOH A . 
B 2 HOH 293 1293 1293 HOH HOH A . 
B 2 HOH 294 1294 1294 HOH HOH A . 
B 2 HOH 295 1295 1295 HOH HOH A . 
B 2 HOH 296 1296 1296 HOH HOH A . 
B 2 HOH 297 1297 1297 HOH HOH A . 
B 2 HOH 298 1298 1298 HOH HOH A . 
B 2 HOH 299 1299 1299 HOH HOH A . 
B 2 HOH 300 1300 1300 HOH HOH A . 
B 2 HOH 301 1301 1301 HOH HOH A . 
B 2 HOH 302 1302 1302 HOH HOH A . 
B 2 HOH 303 1303 1303 HOH HOH A . 
B 2 HOH 304 1304 1304 HOH HOH A . 
B 2 HOH 305 1305 1305 HOH HOH A . 
B 2 HOH 306 1306 1306 HOH HOH A . 
B 2 HOH 307 1307 1307 HOH HOH A . 
B 2 HOH 308 1308 1308 HOH HOH A . 
B 2 HOH 309 1309 1309 HOH HOH A . 
B 2 HOH 310 1310 1310 HOH HOH A . 
B 2 HOH 311 1311 1311 HOH HOH A . 
B 2 HOH 312 1312 1312 HOH HOH A . 
B 2 HOH 313 1313 1313 HOH HOH A . 
B 2 HOH 314 1314 1314 HOH HOH A . 
B 2 HOH 315 1315 1315 HOH HOH A . 
B 2 HOH 316 1316 1316 HOH HOH A . 
B 2 HOH 317 1317 1317 HOH HOH A . 
B 2 HOH 318 1318 1318 HOH HOH A . 
B 2 HOH 319 1319 1319 HOH HOH A . 
B 2 HOH 320 1320 1320 HOH HOH A . 
B 2 HOH 321 1321 1321 HOH HOH A . 
B 2 HOH 322 1322 1322 HOH HOH A . 
B 2 HOH 323 1323 1323 HOH HOH A . 
B 2 HOH 324 1324 1324 HOH HOH A . 
B 2 HOH 325 1325 1325 HOH HOH A . 
B 2 HOH 326 1326 1326 HOH HOH A . 
B 2 HOH 327 1327 1327 HOH HOH A . 
B 2 HOH 328 1328 1328 HOH HOH A . 
B 2 HOH 329 1329 1329 HOH HOH A . 
B 2 HOH 330 1330 1330 HOH HOH A . 
B 2 HOH 331 1331 1331 HOH HOH A . 
B 2 HOH 332 1332 1332 HOH HOH A . 
B 2 HOH 333 1333 1333 HOH HOH A . 
B 2 HOH 334 1334 1334 HOH HOH A . 
B 2 HOH 335 1335 1335 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 137.8220000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-01-28 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       0.5 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
SOLVE     phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 45  ? ? 76.99   -13.44  
2  1 SER A 108 ? ? -158.67 73.06   
3  1 HIS A 159 ? ? -39.44  139.76  
4  1 ALA A 164 ? ? -155.69 67.88   
5  1 ASN A 167 ? ? 56.18   12.83   
6  1 SER A 200 ? ? 59.76   -120.73 
7  1 GLU A 299 ? ? -115.94 -71.71  
8  1 THR A 317 ? ? -161.29 -157.86 
9  1 ASP A 380 ? ? -159.17 55.78   
10 1 VAL A 400 ? ? -126.50 -62.13  
11 1 GLU A 455 ? ? -52.52  -9.73   
12 1 ASN A 457 ? ? 78.56   40.86   
13 1 ASN A 506 ? ? -156.62 -159.30 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A CYS 67  ? SG ? A CYS 67  SG 
2 1 Y 1 A CYS 94  ? SG ? A CYS 94  SG 
3 1 Y 1 A CYS 254 ? SG ? A CYS 254 SG 
4 1 Y 1 A CYS 265 ? SG ? A CYS 265 SG 
5 1 Y 1 A CYS 402 ? SG ? A CYS 402 SG 
6 1 Y 1 A CYS 521 ? SG ? A CYS 521 SG 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 1   ? A ASP 1   
2 1 Y 1 A ASP 2   ? A ASP 2   
3 1 Y 1 A HIS 3   ? A HIS 3   
4 1 Y 1 A ALA 536 ? A ALA 536 
5 1 Y 1 A CYS 537 ? A CYS 537 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#