data_1QIH
# 
_entry.id   1QIH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QIH         
RCSB  RCSB001188   
WWPDB D_1000001188 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1QID 'EXPERIMENTAL TIME POINT A' unspecified 
PDB 1QIE 'EXPERIMENTAL TIME POINT B' unspecified 
PDB 1QIF 'EXPERIMENTAL TIME POINT C' unspecified 
PDB 1QIG 'EXPERIMENTAL TIME POINT D' unspecified 
PDB 1QIH 'EXPERIMENTAL TIME POINT E' unspecified 
PDB 1QII 'EXPERIMENTAL TIME POINT F' unspecified 
PDB 1QIJ 'EXPERIMENTAL TIME POINT G' unspecified 
PDB 1QIK 'EXPERIMENTAL TIME POINT H' unspecified 
PDB 1QIM 'EXPERIMENTAL TIME POINT I' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QIH 
_pdbx_database_status.recvd_initial_deposition_date   1999-06-14 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kryger, G.'      1 
'Weik, M.'        2 
'Ravelli, R.B.G.' 3 
# 
_citation.id                        primary 
_citation.title                     'Specific chemical and structural damage to proteins produced by synchrotron radiation.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            97 
_citation.page_first                623 
_citation.page_last                 628 
_citation.year                      2000 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10639129 
_citation.pdbx_database_id_DOI      10.1073/pnas.97.2.623 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Weik, M.'      1  ? 
primary 'Ravelli, R.B.' 2  ? 
primary 'Kryger, G.'    3  ? 
primary 'McSweeney, S.' 4  ? 
primary 'Raves, M.L.'   5  ? 
primary 'Harel, M.'     6  ? 
primary 'Gros, P.'      7  ? 
primary 'Silman, I.'    8  ? 
primary 'Kroon, J.'     9  ? 
primary 'Sussman, J.L.' 10 ? 
# 
_cell.entry_id           1QIH 
_cell.length_a           112.088 
_cell.length_b           112.088 
_cell.length_c           137.922 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QIH 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'PROTEIN (ACETYLCHOLINESTERASE)' 60736.516 1   3.1.1.7 ? ? ? 
2 water   nat water                            18.015    325 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'Pacific electric ray' 
_entity_src_nat.pdbx_organism_scientific   'Torpedo californica' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      Torpedo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1QIH 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 537 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  558 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QIH 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.80 
_exptl_crystal.density_percent_sol   68.0 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.80 
_exptl_crystal_grow.pdbx_details    '30% PEG 200, 0.3 M MES, pH 5.80' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   1999-03-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9320 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             0.9320 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QIH 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             35.550 
_reflns.d_resolution_high            2.500 
_reflns.number_obs                   34910 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.043 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        39.00 
_reflns.pdbx_redundancy              2.090 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1QIH 
_refine.ls_number_reflns_obs                     34817 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           1831786.39000 
_refine.ls_d_res_low                             35.55 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    99.0 
_refine.ls_R_factor_obs                          0.1990000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1990000 
_refine.ls_R_factor_R_free                       0.2160000 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.900 
_refine.ls_number_reflns_R_free                  1716 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               43.90 
_refine.aniso_B[1][1]                            5.03000 
_refine.aniso_B[2][2]                            5.03000 
_refine.aniso_B[3][3]                            -10.06000 
_refine.aniso_B[1][2]                            4.31000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.33 
_refine.solvent_model_param_bsol                 40.35 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;BULK SOLVENT MODEL USED. ONLY PARTIAL REFINEMENT DONE. ALL SIX CYSTEINE 
RESIDUES TAKING PART IN INTRACHAIN DISULFIDE LINKAGES, CYS 67-CYS 94, CYS 402- 

CYS 521 AND CYS 254-CYS 265, WERE MODELED AND REFINED AS ALANINE RESIDUES.

TCACHE IS A GLYCOPROTEIN OF MR = 65,000, WHICH CONTAINS
THREE INTRACHAIN DISULFIDE BONDS. IN THE COURSE OF
CRYOGENIC DATA COLLECTION ON TRIGONAL CRYSTALS OF TCACHE ON
THE UNDULATOR BEAMLINE, ID14-EH4, AT THE ESRF IN GRENOBLE,
IN PREPARATION FOR TIME-RESOLVED STUDIES, WE COLLECTED A
SERIES OF NINE HIGH-QUALITY COMPLETE DATA SETS ON THE SAME
CRYSTAL. DATA COLLECTION UTILIZED THE UNATTENUATED BEAM,
AND THE DURATION PER DATA SET WAS CA. 19 MIN, FOR 3 H IN
TOTAL, AT 100K. ELECTRON DENSITY MAPS WERE OBTAINED FOR
EACH DATA SET BY ROUTINE REFINEMENT, STARTING FROM THE SAME
MODEL OF NATIVE TCACHE. FOR RESULTS, SEE:
HTTP://SGJS3.WEIZMANN.AC.IL/~KRYGER/RADIATION_DAMAGE
(LOWER CASE!)

THIS ENTRY IS THE 5TH TIME POINT (5 OF 9). SEE HTTP://
SGJS3.WEIZMANN.AC.IL/~KRYGER/RADIATION_DAMAGE (LOWER CASE!)
;
_refine.pdbx_starting_model                      'PDB ENTRY 1VXR' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1QIH 
_refine_analyze.Luzzati_coordinate_error_obs    0.28 
_refine_analyze.Luzzati_sigma_a_obs             0.35 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.31 
_refine_analyze.Luzzati_sigma_a_free            0.34 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4238 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             325 
_refine_hist.number_atoms_total               4563 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        35.55 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.40  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.00 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.87  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             2.98  1.500 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            4.62  2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             6.63  2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            9.50  2.500 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.59 
_refine_ls_shell.number_reflns_R_work             3232 
_refine_ls_shell.R_factor_R_work                  0.2820000 
_refine_ls_shell.percent_reflns_obs               99.30 
_refine_ls_shell.R_factor_R_free                  0.2770000 
_refine_ls_shell.R_factor_R_free_error            0.020 
_refine_ls_shell.percent_reflns_R_free            5.70 
_refine_ls_shell.number_reflns_R_free             196 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP     'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER_REP.PARAM 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1QIH 
_struct.title                     
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT E) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QIH 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;RADIATION DAMAGE, TIME SERIES, DISULFIDE BOND, SERINE HYDROLASE, ALPHA/BETA HYDROLASE, NEUROTRANSMITTER CLEAVAGE, CATALYTIC TRIAD, GLYCOSYLATED PROTEIN, HYDROLASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  2  PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  3  LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  4  GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  5  GLY A 151 ? LEU A 156 ? GLY A 151 LEU A 156 1 ? 6  
HELX_P HELX_P6  6  ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  7  GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  8  SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  9  SER A 215 ? PHE A 219 ? SER A 215 PHE A 219 5 ? 5  
HELX_P HELX_P10 10 VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P11 11 SER A 258 ? GLU A 268 ? SER A 258 GLU A 268 1 ? 11 
HELX_P HELX_P12 12 LYS A 270 ? ASP A 276 ? LYS A 270 ASP A 276 1 ? 7  
HELX_P HELX_P13 13 VAL A 277 ? LEU A 282 ? VAL A 277 LEU A 282 5 ? 6  
HELX_P HELX_P14 14 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P15 15 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 16 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 17 ASN A 364 ? TYR A 375 ? ASN A 364 TYR A 375 1 ? 12 
HELX_P HELX_P18 18 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 19 VAL A 400 ? THR A 412 ? VAL A 400 THR A 412 1 ? 13 
HELX_P HELX_P20 20 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 21 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P22 22 GLY A 449 ? VAL A 453 ? GLY A 449 VAL A 453 5 ? 5  
HELX_P HELX_P23 23 VAL A 453 ? ASN A 457 ? VAL A 453 ASN A 457 5 ? 5  
HELX_P HELX_P24 24 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P25 25 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P26 26 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.05 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 6   ? THR A 10  ? LEU A 6   THR A 10  
A 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
A 3  VAL A 57  ? ALA A 60  ? VAL A 57  ALA A 60  
B 1  MET A 16  ? PRO A 21  ? MET A 16  PRO A 21  
B 2  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
B 3  TYR A 96  ? PRO A 102 ? TYR A 96  PRO A 102 
B 4  VAL A 142 ? SER A 147 ? VAL A 142 SER A 147 
B 5  THR A 109 ? TYR A 116 ? THR A 109 TYR A 116 
B 6  THR A 193 ? GLU A 199 ? THR A 193 GLU A 199 
B 7  ARG A 220 ? SER A 226 ? ARG A 220 SER A 226 
B 8  GLN A 318 ? ASN A 324 ? GLN A 318 ASN A 324 
B 9  GLY A 417 ? PHE A 423 ? GLY A 417 PHE A 423 
B 10 PHE A 502 ? LEU A 505 ? PHE A 502 LEU A 505 
B 11 MET A 510 ? GLN A 514 ? MET A 510 GLN A 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O VAL A 8   ? O VAL A 8   N VAL A 15  ? N VAL A 15  
A 2  3  O LYS A 14  ? O LYS A 14  N TRP A 58  ? N TRP A 58  
B 1  2  N THR A 18  ? N THR A 18  O ALA A 29  ? O ALA A 29  
B 2  3  O PHE A 30  ? O PHE A 30  N ILE A 99  ? N ILE A 99  
B 3  4  O TRP A 100 ? O TRP A 100 N LEU A 143 ? N LEU A 143 
B 4  5  O VAL A 142 ? O VAL A 142 N MET A 112 ? N MET A 112 
B 5  6  N VAL A 113 ? N VAL A 113 O THR A 195 ? O THR A 195 
B 6  7  O ILE A 196 ? O ILE A 196 N ILE A 223 ? N ILE A 223 
B 7  8  O LEU A 224 ? O LEU A 224 N GLY A 322 ? N GLY A 322 
B 8  9  O LEU A 321 ? O LEU A 321 N TYR A 421 ? N TYR A 421 
B 9  10 O LEU A 420 ? O LEU A 420 N ILE A 503 ? N ILE A 503 
B 10 11 O PHE A 502 ? O PHE A 502 N HIS A 513 ? N HIS A 513 
# 
_struct_site.id                   CAT 
_struct_site.pdbx_evidence_code   Author 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    3 
_struct_site.details              'CATALYTIC TRIAD.' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 CAT 3 SER A 200 ? SER A 200 . ? 1_555 ? 
2 CAT 3 GLU A 327 ? GLU A 327 . ? 1_555 ? 
3 CAT 3 HIS A 440 ? HIS A 440 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QIH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QIH 
_atom_sites.fract_transf_matrix[1][1]   0.008921 
_atom_sites.fract_transf_matrix[1][2]   0.005151 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010302 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007250 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -13.103 87.785 34.608 1.00 50.06  ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -12.564 88.180 35.947 1.00 50.06  ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -11.425 87.275 36.422 1.00 50.06  ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -11.518 86.047 36.361 1.00 50.06  ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -13.676 88.162 36.999 1.00 51.30  ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -13.127 88.338 38.297 1.00 51.30  ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -10.358 87.899 36.912 1.00 46.04  ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -9.194  87.177 37.399 1.00 46.04  ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.537  86.194 38.523 1.00 46.04  ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.891  85.158 38.669 1.00 46.04  ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -8.138  88.170 37.894 1.00 65.75  ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.817  87.515 38.276 1.00 65.75  ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.734  88.522 38.636 1.00 65.75  ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -5.942  89.325 39.578 1.00 65.75  ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -4.667  88.504 37.978 1.00 65.75  ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.557 86.508 39.311 1.00 41.92  ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -10.931 85.642 40.413 1.00 41.92  ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -11.936 84.553 40.047 1.00 41.92  ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.293 83.730 40.887 1.00 41.92  ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.480 86.482 41.557 1.00 37.24  ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.552 87.569 42.090 1.00 37.24  ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -11.254 88.312 43.215 1.00 37.24  ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -9.250  86.944 42.581 1.00 37.24  ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.388 84.530 38.801 1.00 38.87  ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -13.349 83.518 38.380 1.00 38.87  ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.654 82.482 37.500 1.00 38.87  ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -12.004 82.829 36.516 1.00 38.87  ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.500 84.176 37.616 1.00 53.35  ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.598 83.246 37.088 1.00 53.35  ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -16.255 82.489 38.239 1.00 53.35  ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.638 84.070 36.346 1.00 53.35  ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.779 81.210 37.861 1.00 37.31  ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -12.142 80.156 37.085 1.00 37.31  ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -13.128 79.048 36.749 1.00 37.31  ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.921 78.610 37.591 1.00 37.31  ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -10.947 79.546 37.838 1.00 41.57  ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -10.264 78.505 36.971 1.00 41.57  ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -9.958  80.634 38.212 1.00 41.57  ? 8    VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -13.069 78.584 35.509 1.00 42.20  ? 9    ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -13.975 77.542 35.075 1.00 42.20  ? 9    ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -13.265 76.200 34.958 1.00 42.20  ? 9    ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -12.567 75.941 33.985 1.00 42.20  ? 9    ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -14.600 77.937 33.742 1.00 60.98  ? 9    ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -15.716 77.014 33.342 1.00 60.98  ? 9    ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -16.539 76.617 34.176 1.00 60.98  ? 9    ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -15.763 76.658 32.058 1.00 60.98  ? 9    ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -13.454 75.342 35.953 1.00 50.58  ? 10   THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -12.810 74.034 35.948 1.00 50.58  ? 10   THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -13.729 72.972 35.382 1.00 50.58  ? 10   THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -14.900 73.230 35.101 1.00 50.58  ? 10   THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -12.425 73.567 37.368 1.00 41.12  ? 10   THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -13.599 73.106 38.040 1.00 41.12  ? 10   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -11.800 74.707 38.168 1.00 41.12  ? 10   THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -13.189 71.768 35.239 1.00 40.77  ? 11   LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -13.945 70.642 34.725 1.00 40.77  ? 11   LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -15.013 70.167 35.712 1.00 40.77  ? 11   LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -15.839 69.329 35.367 1.00 40.77  ? 11   LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -12.989 69.494 34.385 1.00 36.15  ? 11   LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -11.976 69.852 33.296 1.00 36.15  ? 11   LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -11.021 68.714 33.004 1.00 36.15  ? 11   LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -10.045 69.124 31.908 1.00 36.15  ? 11   LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -8.924  68.168 31.702 1.00 36.15  ? 11   LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -15.002 70.700 36.934 1.00 41.85  ? 12   SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -15.992 70.322 37.944 1.00 41.85  ? 12   SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -17.048 71.417 38.127 1.00 41.85  ? 12   SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -18.085 71.209 38.784 1.00 41.85  ? 12   SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -15.319 70.065 39.291 1.00 47.11  ? 12   SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -14.464 68.937 39.242 1.00 47.11  ? 12   SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -16.786 72.582 37.544 1.00 35.63  ? 13   GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -17.716 73.689 37.669 1.00 35.63  ? 13   GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -16.952 74.976 37.883 1.00 35.63  ? 13   GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -15.723 74.944 37.986 1.00 35.63  ? 13   GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -17.663 76.101 37.954 1.00 38.73  ? 14   LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -17.016 77.393 38.152 1.00 38.73  ? 14   LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -16.616 77.626 39.599 1.00 38.73  ? 14   LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -17.263 77.131 40.529 1.00 38.73  ? 14   LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -17.920 78.528 37.682 1.00 55.08  ? 14   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -18.104 78.583 36.179 1.00 55.08  ? 14   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -19.051 79.701 35.780 1.00 55.08  ? 14   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -19.410 79.622 34.304 1.00 55.08  ? 14   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -20.496 80.596 33.942 1.00 55.08  ? 14   LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -15.548 78.393 39.783 1.00 41.01  ? 15   VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -15.035 78.683 41.109 1.00 41.01  ? 15   VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -14.741 80.168 41.275 1.00 41.01  ? 15   VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -14.181 80.798 40.381 1.00 41.01  ? 15   VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -13.752 77.851 41.368 1.00 34.99  ? 15   VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -12.995 78.394 42.554 1.00 34.99  ? 15   VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -14.128 76.405 41.620 1.00 34.99  ? 15   VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -15.126 80.720 42.422 1.00 36.17  ? 16   MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -14.910 82.136 42.714 1.00 36.17  ? 16   MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -13.906 82.326 43.843 1.00 36.17  ? 16   MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -14.172 81.984 44.996 1.00 36.17  ? 16   MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -16.228 82.804 43.107 1.00 71.94  ? 16   MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -16.115 84.289 43.494 1.00 71.94  ? 16   MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -16.154 85.400 42.059 1.00 71.94  ? 16   MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -14.423 85.696 41.819 1.00 71.94  ? 16   MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -12.758 82.894 43.509 1.00 40.06  ? 17   GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -11.748 83.109 44.516 1.00 40.06  ? 17   GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -11.855 84.462 45.181 1.00 40.06  ? 17   GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -12.861 85.158 45.056 1.00 40.06  ? 17   GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -10.795 84.827 45.891 1.00 41.31  ? 18   THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -10.716 86.096 46.586 1.00 41.31  ? 18   THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -9.324  86.682 46.424 1.00 41.31  ? 18   THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -8.356  85.955 46.203 1.00 41.31  ? 18   THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -10.995 85.922 48.075 1.00 48.26  ? 18   THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -10.699 87.147 48.749 1.00 48.26  ? 18   THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -10.130 84.811 48.657 1.00 48.26  ? 18   THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -9.224  88.002 46.528 1.00 45.71  ? 19   ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -7.942  88.693 46.390 1.00 45.71  ? 19   ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -7.330  88.834 47.788 1.00 45.71  ? 19   ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -8.038  89.151 48.750 1.00 45.71  ? 19   ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -8.175  90.064 45.752 1.00 65.15  ? 19   ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -6.922  90.785 45.308 1.00 65.15  ? 19   ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -7.244  91.808 44.217 1.00 65.15  ? 19   ARG A CD  1 
ATOM   115  N NE  . ARG A 1 19  ? -6.172  91.896 43.221 1.00 65.15  ? 19   ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 19  ? -5.168  92.771 43.258 1.00 65.15  ? 19   ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 19  ? -5.095  93.655 44.242 1.00 65.15  ? 19   ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 19  ? -4.228  92.753 42.318 1.00 65.15  ? 19   ARG A NH2 1 
ATOM   119  N N   . VAL A 1 20  ? -6.031  88.572 47.918 1.00 41.06  ? 20   VAL A N   1 
ATOM   120  C CA  . VAL A 1 20  ? -5.402  88.686 49.231 1.00 41.06  ? 20   VAL A CA  1 
ATOM   121  C C   . VAL A 1 20  ? -4.101  89.471 49.230 1.00 41.06  ? 20   VAL A C   1 
ATOM   122  O O   . VAL A 1 20  ? -3.284  89.345 48.326 1.00 41.06  ? 20   VAL A O   1 
ATOM   123  C CB  . VAL A 1 20  ? -5.114  87.291 49.868 1.00 43.78  ? 20   VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 20  ? -6.396  86.476 49.952 1.00 43.78  ? 20   VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 20  ? -4.077  86.558 49.060 1.00 43.78  ? 20   VAL A CG2 1 
ATOM   126  N N   . PRO A 1 21  ? -3.900  90.300 50.259 1.00 42.51  ? 21   PRO A N   1 
ATOM   127  C CA  . PRO A 1 21  ? -2.684  91.105 50.376 1.00 42.51  ? 21   PRO A CA  1 
ATOM   128  C C   . PRO A 1 21  ? -1.516  90.237 50.848 1.00 42.51  ? 21   PRO A C   1 
ATOM   129  O O   . PRO A 1 21  ? -1.693  89.323 51.666 1.00 42.51  ? 21   PRO A O   1 
ATOM   130  C CB  . PRO A 1 21  ? -3.078  92.170 51.395 1.00 36.79  ? 21   PRO A CB  1 
ATOM   131  C CG  . PRO A 1 21  ? -4.006  91.427 52.298 1.00 36.79  ? 21   PRO A CG  1 
ATOM   132  C CD  . PRO A 1 21  ? -4.860  90.631 51.327 1.00 36.79  ? 21   PRO A CD  1 
ATOM   133  N N   . VAL A 1 22  ? -0.331  90.523 50.315 1.00 38.78  ? 22   VAL A N   1 
ATOM   134  C CA  . VAL A 1 22  ? 0.873   89.787 50.661 1.00 38.78  ? 22   VAL A CA  1 
ATOM   135  C C   . VAL A 1 22  ? 2.083   90.680 50.405 1.00 38.78  ? 22   VAL A C   1 
ATOM   136  O O   . VAL A 1 22  ? 2.256   91.188 49.298 1.00 38.78  ? 22   VAL A O   1 
ATOM   137  C CB  . VAL A 1 22  ? 0.985   88.478 49.816 1.00 35.26  ? 22   VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 22  ? 0.890   88.795 48.346 1.00 35.26  ? 22   VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 22  ? 2.287   87.764 50.115 1.00 35.26  ? 22   VAL A CG2 1 
ATOM   140  N N   . LEU A 1 23  ? 2.907   90.874 51.436 1.00 48.84  ? 23   LEU A N   1 
ATOM   141  C CA  . LEU A 1 23  ? 4.110   91.712 51.341 1.00 48.84  ? 23   LEU A CA  1 
ATOM   142  C C   . LEU A 1 23  ? 3.843   93.025 50.582 1.00 48.84  ? 23   LEU A C   1 
ATOM   143  O O   . LEU A 1 23  ? 4.609   93.430 49.694 1.00 48.84  ? 23   LEU A O   1 
ATOM   144  C CB  . LEU A 1 23  ? 5.246   90.924 50.664 1.00 46.06  ? 23   LEU A CB  1 
ATOM   145  C CG  . LEU A 1 23  ? 5.747   89.689 51.428 1.00 46.06  ? 23   LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 23  ? 6.919   89.052 50.703 1.00 46.06  ? 23   LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 23  ? 6.168   90.109 52.833 1.00 46.06  ? 23   LEU A CD2 1 
ATOM   148  N N   . SER A 1 24  ? 2.741   93.674 50.955 1.00 65.87  ? 24   SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? 2.287   94.940 50.362 1.00 65.87  ? 24   SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? 1.979   94.832 48.852 1.00 65.87  ? 24   SER A C   1 
ATOM   151  O O   . SER A 1 24  ? 2.271   95.739 48.074 1.00 65.87  ? 24   SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? 3.309   96.056 50.622 1.00 58.45  ? 24   SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? 4.401   95.969 49.720 1.00 58.45  ? 24   SER A OG  1 
ATOM   154  N N   . SER A 1 25  ? 1.393   93.707 48.453 1.00 43.54  ? 25   SER A N   1 
ATOM   155  C CA  . SER A 1 25  ? 0.990   93.469 47.070 1.00 43.54  ? 25   SER A CA  1 
ATOM   156  C C   . SER A 1 25  ? -0.230  92.556 47.140 1.00 43.54  ? 25   SER A C   1 
ATOM   157  O O   . SER A 1 25  ? -0.858  92.436 48.196 1.00 43.54  ? 25   SER A O   1 
ATOM   158  C CB  . SER A 1 25  ? 2.107   92.800 46.273 1.00 51.55  ? 25   SER A CB  1 
ATOM   159  O OG  . SER A 1 25  ? 1.735   92.673 44.905 1.00 51.55  ? 25   SER A OG  1 
ATOM   160  N N   . HIS A 1 26  ? -0.581  91.909 46.040 1.00 45.61  ? 26   HIS A N   1 
ATOM   161  C CA  . HIS A 1 26  ? -1.752  91.040 46.073 1.00 45.61  ? 26   HIS A CA  1 
ATOM   162  C C   . HIS A 1 26  ? -1.631  89.834 45.154 1.00 45.61  ? 26   HIS A C   1 
ATOM   163  O O   . HIS A 1 26  ? -0.902  89.872 44.161 1.00 45.61  ? 26   HIS A O   1 
ATOM   164  C CB  . HIS A 1 26  ? -3.023  91.823 45.689 1.00 65.69  ? 26   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 26  ? -3.421  92.877 46.679 1.00 65.69  ? 26   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 26  ? -3.108  94.212 46.515 1.00 65.69  ? 26   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 26  ? -4.121  92.794 47.839 1.00 65.69  ? 26   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 26  ? -3.601  94.906 47.530 1.00 65.69  ? 26   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 26  ? -4.220  94.070 48.348 1.00 65.69  ? 26   HIS A NE2 1 
ATOM   170  N N   . ILE A 1 27  ? -2.340  88.764 45.503 1.00 41.33  ? 27   ILE A N   1 
ATOM   171  C CA  . ILE A 1 27  ? -2.374  87.555 44.690 1.00 41.33  ? 27   ILE A CA  1 
ATOM   172  C C   . ILE A 1 27  ? -3.778  86.995 44.836 1.00 41.33  ? 27   ILE A C   1 
ATOM   173  O O   . ILE A 1 27  ? -4.541  87.460 45.680 1.00 41.33  ? 27   ILE A O   1 
ATOM   174  C CB  . ILE A 1 27  ? -1.311  86.506 45.128 1.00 44.81  ? 27   ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 27  ? -1.502  86.122 46.588 1.00 44.81  ? 27   ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 27  ? 0.084   87.058 44.910 1.00 44.81  ? 27   ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 27  ? -2.384  84.908 46.775 1.00 44.81  ? 27   ILE A CD1 1 
ATOM   178  N N   . SER A 1 28  ? -4.135  86.021 44.006 1.00 37.88  ? 28   SER A N   1 
ATOM   179  C CA  . SER A 1 28  ? -5.465  85.434 44.073 1.00 37.88  ? 28   SER A CA  1 
ATOM   180  C C   . SER A 1 28  ? -5.397  84.176 44.913 1.00 37.88  ? 28   SER A C   1 
ATOM   181  O O   . SER A 1 28  ? -4.370  83.519 44.971 1.00 37.88  ? 28   SER A O   1 
ATOM   182  C CB  . SER A 1 28  ? -5.972  85.073 42.676 1.00 42.95  ? 28   SER A CB  1 
ATOM   183  O OG  . SER A 1 28  ? -5.798  86.148 41.774 1.00 42.95  ? 28   SER A OG  1 
ATOM   184  N N   . ALA A 1 29  ? -6.499  83.850 45.566 1.00 39.03  ? 29   ALA A N   1 
ATOM   185  C CA  . ALA A 1 29  ? -6.556  82.666 46.392 1.00 39.03  ? 29   ALA A CA  1 
ATOM   186  C C   . ALA A 1 29  ? -7.896  81.999 46.183 1.00 39.03  ? 29   ALA A C   1 
ATOM   187  O O   . ALA A 1 29  ? -8.934  82.663 46.167 1.00 39.03  ? 29   ALA A O   1 
ATOM   188  C CB  . ALA A 1 29  ? -6.386  83.033 47.861 1.00 37.27  ? 29   ALA A CB  1 
ATOM   189  N N   . PHE A 1 30  ? -7.870  80.688 45.989 1.00 35.25  ? 30   PHE A N   1 
ATOM   190  C CA  . PHE A 1 30  ? -9.096  79.927 45.823 1.00 35.25  ? 30   PHE A CA  1 
ATOM   191  C C   . PHE A 1 30  ? -9.032  78.945 46.957 1.00 35.25  ? 30   PHE A C   1 
ATOM   192  O O   . PHE A 1 30  ? -8.273  77.990 46.911 1.00 35.25  ? 30   PHE A O   1 
ATOM   193  C CB  . PHE A 1 30  ? -9.125  79.209 44.473 1.00 31.81  ? 30   PHE A CB  1 
ATOM   194  C CG  . PHE A 1 30  ? -9.082  80.140 43.297 1.00 31.81  ? 30   PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 30  ? -7.892  80.753 42.924 1.00 31.81  ? 30   PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 30  ? -10.240 80.424 42.581 1.00 31.81  ? 30   PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 30  ? -7.851  81.633 41.860 1.00 31.81  ? 30   PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 30  ? -10.216 81.304 41.514 1.00 31.81  ? 30   PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 30  ? -9.016  81.911 41.150 1.00 31.81  ? 30   PHE A CZ  1 
ATOM   200  N N   . LEU A 1 31  ? -9.818  79.205 47.991 1.00 37.84  ? 31   LEU A N   1 
ATOM   201  C CA  . LEU A 1 31  ? -9.824  78.369 49.178 1.00 37.84  ? 31   LEU A CA  1 
ATOM   202  C C   . LEU A 1 31  ? -11.031 77.448 49.288 1.00 37.84  ? 31   LEU A C   1 
ATOM   203  O O   . LEU A 1 31  ? -12.152 77.822 48.953 1.00 37.84  ? 31   LEU A O   1 
ATOM   204  C CB  . LEU A 1 31  ? -9.743  79.267 50.410 1.00 29.04  ? 31   LEU A CB  1 
ATOM   205  C CG  . LEU A 1 31  ? -8.644  80.333 50.335 1.00 29.04  ? 31   LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 31  ? -8.658  81.186 51.596 1.00 29.04  ? 31   LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 31  ? -7.290  79.668 50.150 1.00 29.04  ? 31   LEU A CD2 1 
ATOM   208  N N   . GLY A 1 32  ? -10.784 76.233 49.760 1.00 41.53  ? 32   GLY A N   1 
ATOM   209  C CA  . GLY A 1 32  ? -11.846 75.263 49.944 1.00 41.53  ? 32   GLY A CA  1 
ATOM   210  C C   . GLY A 1 32  ? -12.494 74.681 48.699 1.00 41.53  ? 32   GLY A C   1 
ATOM   211  O O   . GLY A 1 32  ? -13.713 74.537 48.670 1.00 41.53  ? 32   GLY A O   1 
ATOM   212  N N   . ILE A 1 33  ? -11.714 74.349 47.673 1.00 39.97  ? 33   ILE A N   1 
ATOM   213  C CA  . ILE A 1 33  ? -12.295 73.757 46.472 1.00 39.97  ? 33   ILE A CA  1 
ATOM   214  C C   . ILE A 1 33  ? -12.433 72.262 46.755 1.00 39.97  ? 33   ILE A C   1 
ATOM   215  O O   . ILE A 1 33  ? -11.472 71.616 47.175 1.00 39.97  ? 33   ILE A O   1 
ATOM   216  C CB  . ILE A 1 33  ? -11.398 73.935 45.251 1.00 39.68  ? 33   ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 33  ? -11.070 75.413 45.043 1.00 39.68  ? 33   ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 33  ? -12.102 73.377 44.030 1.00 39.68  ? 33   ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 33  ? -10.062 75.662 43.936 1.00 39.68  ? 33   ILE A CD1 1 
ATOM   220  N N   . PRO A 1 34  ? -13.628 71.690 46.536 1.00 39.86  ? 34   PRO A N   1 
ATOM   221  C CA  . PRO A 1 34  ? -13.820 70.262 46.799 1.00 39.86  ? 34   PRO A CA  1 
ATOM   222  C C   . PRO A 1 34  ? -13.248 69.366 45.693 1.00 39.86  ? 34   PRO A C   1 
ATOM   223  O O   . PRO A 1 34  ? -13.311 69.721 44.518 1.00 39.86  ? 34   PRO A O   1 
ATOM   224  C CB  . PRO A 1 34  ? -15.338 70.154 46.931 1.00 35.44  ? 34   PRO A CB  1 
ATOM   225  C CG  . PRO A 1 34  ? -15.818 71.149 45.900 1.00 35.44  ? 34   PRO A CG  1 
ATOM   226  C CD  . PRO A 1 34  ? -14.885 72.332 46.100 1.00 35.44  ? 34   PRO A CD  1 
ATOM   227  N N   . PHE A 1 35  ? -12.683 68.214 46.067 1.00 39.57  ? 35   PHE A N   1 
ATOM   228  C CA  . PHE A 1 35  ? -12.116 67.288 45.078 1.00 39.57  ? 35   PHE A CA  1 
ATOM   229  C C   . PHE A 1 35  ? -12.641 65.866 45.253 1.00 39.57  ? 35   PHE A C   1 
ATOM   230  O O   . PHE A 1 35  ? -12.267 64.959 44.517 1.00 39.57  ? 35   PHE A O   1 
ATOM   231  C CB  . PHE A 1 35  ? -10.573 67.291 45.134 1.00 32.89  ? 35   PHE A CB  1 
ATOM   232  C CG  . PHE A 1 35  ? -9.993  66.770 46.433 1.00 32.89  ? 35   PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 35  ? -10.020 65.415 46.735 1.00 32.89  ? 35   PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 35  ? -9.416  67.642 47.351 1.00 32.89  ? 35   PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 35  ? -9.482  64.940 47.926 1.00 32.89  ? 35   PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 35  ? -8.876  67.176 48.543 1.00 32.89  ? 35   PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 35  ? -8.909  65.825 48.831 1.00 32.89  ? 35   PHE A CZ  1 
ATOM   238  N N   . ALA A 1 36  ? -13.519 65.679 46.228 1.00 36.94  ? 36   ALA A N   1 
ATOM   239  C CA  . ALA A 1 36  ? -14.102 64.370 46.490 1.00 36.94  ? 36   ALA A CA  1 
ATOM   240  C C   . ALA A 1 36  ? -15.440 64.562 47.187 1.00 36.94  ? 36   ALA A C   1 
ATOM   241  O O   . ALA A 1 36  ? -15.695 65.621 47.758 1.00 36.94  ? 36   ALA A O   1 
ATOM   242  C CB  . ALA A 1 36  ? -13.168 63.551 47.378 1.00 25.39  ? 36   ALA A CB  1 
ATOM   243  N N   . GLU A 1 37  ? -16.302 63.551 47.134 1.00 45.98  ? 37   GLU A N   1 
ATOM   244  C CA  . GLU A 1 37  ? -17.592 63.643 47.813 1.00 45.98  ? 37   GLU A CA  1 
ATOM   245  C C   . GLU A 1 37  ? -17.339 63.541 49.320 1.00 45.98  ? 37   GLU A C   1 
ATOM   246  O O   . GLU A 1 37  ? -16.405 62.869 49.754 1.00 45.98  ? 37   GLU A O   1 
ATOM   247  C CB  . GLU A 1 37  ? -18.525 62.509 47.366 1.00 58.47  ? 37   GLU A CB  1 
ATOM   248  C CG  . GLU A 1 37  ? -19.129 62.695 45.968 1.00 58.47  ? 37   GLU A CG  1 
ATOM   249  C CD  . GLU A 1 37  ? -20.062 63.908 45.878 1.00 58.47  ? 37   GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 37  ? -21.084 63.919 46.595 1.00 58.47  ? 37   GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 37  ? -19.774 64.852 45.098 1.00 58.47  ? 37   GLU A OE2 1 
ATOM   252  N N   . PRO A 1 38  ? -18.150 64.234 50.135 1.00 55.21  ? 38   PRO A N   1 
ATOM   253  C CA  . PRO A 1 38  ? -17.938 64.151 51.583 1.00 55.21  ? 38   PRO A CA  1 
ATOM   254  C C   . PRO A 1 38  ? -18.006 62.693 52.026 1.00 55.21  ? 38   PRO A C   1 
ATOM   255  O O   . PRO A 1 38  ? -18.998 62.015 51.789 1.00 55.21  ? 38   PRO A O   1 
ATOM   256  C CB  . PRO A 1 38  ? -19.081 64.991 52.139 1.00 39.40  ? 38   PRO A CB  1 
ATOM   257  C CG  . PRO A 1 38  ? -19.193 66.072 51.124 1.00 39.40  ? 38   PRO A CG  1 
ATOM   258  C CD  . PRO A 1 38  ? -19.123 65.293 49.811 1.00 39.40  ? 38   PRO A CD  1 
ATOM   259  N N   . PRO A 1 39  ? -16.936 62.188 52.662 1.00 49.16  ? 39   PRO A N   1 
ATOM   260  C CA  . PRO A 1 39  ? -16.849 60.805 53.144 1.00 49.16  ? 39   PRO A CA  1 
ATOM   261  C C   . PRO A 1 39  ? -17.588 60.570 54.451 1.00 49.16  ? 39   PRO A C   1 
ATOM   262  O O   . PRO A 1 39  ? -16.979 60.182 55.449 1.00 49.16  ? 39   PRO A O   1 
ATOM   263  C CB  . PRO A 1 39  ? -15.350 60.612 53.311 1.00 48.31  ? 39   PRO A CB  1 
ATOM   264  C CG  . PRO A 1 39  ? -14.931 61.954 53.818 1.00 48.31  ? 39   PRO A CG  1 
ATOM   265  C CD  . PRO A 1 39  ? -15.653 62.885 52.866 1.00 48.31  ? 39   PRO A CD  1 
ATOM   266  N N   . VAL A 1 40  ? -18.895 60.786 54.447 1.00 49.48  ? 40   VAL A N   1 
ATOM   267  C CA  . VAL A 1 40  ? -19.677 60.614 55.667 1.00 49.48  ? 40   VAL A CA  1 
ATOM   268  C C   . VAL A 1 40  ? -20.617 59.408 55.661 1.00 49.48  ? 40   VAL A C   1 
ATOM   269  O O   . VAL A 1 40  ? -20.825 58.760 54.631 1.00 49.48  ? 40   VAL A O   1 
ATOM   270  C CB  . VAL A 1 40  ? -20.502 61.884 55.951 1.00 39.50  ? 40   VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 40  ? -19.574 63.058 56.218 1.00 39.50  ? 40   VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 40  ? -21.383 62.192 54.756 1.00 39.50  ? 40   VAL A CG2 1 
ATOM   273  N N   . GLY A 1 41  ? -21.184 59.119 56.826 1.00 52.68  ? 41   GLY A N   1 
ATOM   274  C CA  . GLY A 1 41  ? -22.100 58.001 56.956 1.00 52.68  ? 41   GLY A CA  1 
ATOM   275  C C   . GLY A 1 41  ? -21.530 56.710 56.403 1.00 52.68  ? 41   GLY A C   1 
ATOM   276  O O   . GLY A 1 41  ? -20.442 56.280 56.792 1.00 52.68  ? 41   GLY A O   1 
ATOM   277  N N   . ASN A 1 42  ? -22.270 56.091 55.488 1.00 47.34  ? 42   ASN A N   1 
ATOM   278  C CA  . ASN A 1 42  ? -21.842 54.845 54.878 1.00 47.34  ? 42   ASN A CA  1 
ATOM   279  C C   . ASN A 1 42  ? -20.506 54.955 54.183 1.00 47.34  ? 42   ASN A C   1 
ATOM   280  O O   . ASN A 1 42  ? -19.844 53.942 53.955 1.00 47.34  ? 42   ASN A O   1 
ATOM   281  C CB  . ASN A 1 42  ? -22.898 54.354 53.892 1.00 90.14  ? 42   ASN A CB  1 
ATOM   282  C CG  . ASN A 1 42  ? -23.867 53.380 54.535 1.00 90.14  ? 42   ASN A CG  1 
ATOM   283  O OD1 . ASN A 1 42  ? -24.339 53.605 55.667 1.00 90.14  ? 42   ASN A OD1 1 
ATOM   284  N ND2 . ASN A 1 42  ? -24.173 52.285 53.825 1.00 90.14  ? 42   ASN A ND2 1 
ATOM   285  N N   . MET A 1 43  ? -20.100 56.173 53.850 1.00 44.77  ? 43   MET A N   1 
ATOM   286  C CA  . MET A 1 43  ? -18.822 56.353 53.181 1.00 44.77  ? 43   MET A CA  1 
ATOM   287  C C   . MET A 1 43  ? -17.589 56.343 54.103 1.00 44.77  ? 43   MET A C   1 
ATOM   288  O O   . MET A 1 43  ? -16.463 56.254 53.619 1.00 44.77  ? 43   MET A O   1 
ATOM   289  C CB  . MET A 1 43  ? -18.835 57.639 52.342 1.00 66.38  ? 43   MET A CB  1 
ATOM   290  C CG  . MET A 1 43  ? -19.606 57.527 51.035 1.00 66.38  ? 43   MET A CG  1 
ATOM   291  S SD  . MET A 1 43  ? -19.332 59.002 49.966 1.00 66.38  ? 43   MET A SD  1 
ATOM   292  C CE  . MET A 1 43  ? -17.687 58.577 49.221 1.00 66.38  ? 43   MET A CE  1 
ATOM   293  N N   . ARG A 1 44  ? -17.790 56.416 55.416 1.00 37.79  ? 44   ARG A N   1 
ATOM   294  C CA  . ARG A 1 44  ? -16.663 56.414 56.357 1.00 37.79  ? 44   ARG A CA  1 
ATOM   295  C C   . ARG A 1 44  ? -15.784 55.165 56.187 1.00 37.79  ? 44   ARG A C   1 
ATOM   296  O O   . ARG A 1 44  ? -16.288 54.053 56.058 1.00 37.79  ? 44   ARG A O   1 
ATOM   297  C CB  . ARG A 1 44  ? -17.174 56.517 57.807 1.00 31.18  ? 44   ARG A CB  1 
ATOM   298  C CG  . ARG A 1 44  ? -16.068 56.606 58.845 1.00 31.18  ? 44   ARG A CG  1 
ATOM   299  C CD  . ARG A 1 44  ? -16.588 56.537 60.266 1.00 31.18  ? 44   ARG A CD  1 
ATOM   300  N NE  . ARG A 1 44  ? -17.233 57.770 60.688 1.00 31.18  ? 44   ARG A NE  1 
ATOM   301  C CZ  . ARG A 1 44  ? -17.876 57.914 61.842 1.00 31.18  ? 44   ARG A CZ  1 
ATOM   302  N NH1 . ARG A 1 44  ? -17.964 56.901 62.691 1.00 31.18  ? 44   ARG A NH1 1 
ATOM   303  N NH2 . ARG A 1 44  ? -18.428 59.074 62.150 1.00 31.18  ? 44   ARG A NH2 1 
ATOM   304  N N   . PHE A 1 45  ? -14.470 55.368 56.188 1.00 36.78  ? 45   PHE A N   1 
ATOM   305  C CA  . PHE A 1 45  ? -13.464 54.308 56.016 1.00 36.78  ? 45   PHE A CA  1 
ATOM   306  C C   . PHE A 1 45  ? -13.383 53.849 54.568 1.00 36.78  ? 45   PHE A C   1 
ATOM   307  O O   . PHE A 1 45  ? -12.457 53.136 54.188 1.00 36.78  ? 45   PHE A O   1 
ATOM   308  C CB  . PHE A 1 45  ? -13.751 53.088 56.901 1.00 41.46  ? 45   PHE A CB  1 
ATOM   309  C CG  . PHE A 1 45  ? -13.908 53.410 58.365 1.00 41.46  ? 45   PHE A CG  1 
ATOM   310  C CD1 . PHE A 1 45  ? -12.953 54.169 59.037 1.00 41.46  ? 45   PHE A CD1 1 
ATOM   311  C CD2 . PHE A 1 45  ? -15.011 52.940 59.076 1.00 41.46  ? 45   PHE A CD2 1 
ATOM   312  C CE1 . PHE A 1 45  ? -13.089 54.460 60.400 1.00 41.46  ? 45   PHE A CE1 1 
ATOM   313  C CE2 . PHE A 1 45  ? -15.163 53.222 60.438 1.00 41.46  ? 45   PHE A CE2 1 
ATOM   314  C CZ  . PHE A 1 45  ? -14.197 53.986 61.104 1.00 41.46  ? 45   PHE A CZ  1 
ATOM   315  N N   . ARG A 1 46  ? -14.344 54.274 53.757 1.00 39.67  ? 46   ARG A N   1 
ATOM   316  C CA  . ARG A 1 46  ? -14.395 53.882 52.350 1.00 39.67  ? 46   ARG A CA  1 
ATOM   317  C C   . ARG A 1 46  ? -13.481 54.711 51.424 1.00 39.67  ? 46   ARG A C   1 
ATOM   318  O O   . ARG A 1 46  ? -13.084 55.827 51.754 1.00 39.67  ? 46   ARG A O   1 
ATOM   319  C CB  . ARG A 1 46  ? -15.858 53.957 51.872 1.00 76.09  ? 46   ARG A CB  1 
ATOM   320  C CG  . ARG A 1 46  ? -16.154 53.227 50.577 1.00 76.09  ? 46   ARG A CG  1 
ATOM   321  C CD  . ARG A 1 46  ? -17.653 53.229 50.243 1.00 76.09  ? 46   ARG A CD  1 
ATOM   322  N NE  . ARG A 1 46  ? -18.411 52.262 51.039 1.00 76.09  ? 46   ARG A NE  1 
ATOM   323  C CZ  . ARG A 1 46  ? -19.747 52.180 51.067 1.00 76.09  ? 46   ARG A CZ  1 
ATOM   324  N NH1 . ARG A 1 46  ? -20.494 53.017 50.338 1.00 76.09  ? 46   ARG A NH1 1 
ATOM   325  N NH2 . ARG A 1 46  ? -20.340 51.252 51.822 1.00 76.09  ? 46   ARG A NH2 1 
ATOM   326  N N   . ARG A 1 47  ? -13.126 54.154 50.271 1.00 40.22  ? 47   ARG A N   1 
ATOM   327  C CA  . ARG A 1 47  ? -12.294 54.886 49.327 1.00 40.22  ? 47   ARG A CA  1 
ATOM   328  C C   . ARG A 1 47  ? -13.037 56.144 48.864 1.00 40.22  ? 47   ARG A C   1 
ATOM   329  O O   . ARG A 1 47  ? -14.262 56.156 48.749 1.00 40.22  ? 47   ARG A O   1 
ATOM   330  C CB  . ARG A 1 47  ? -11.957 54.016 48.121 1.00 57.37  ? 47   ARG A CB  1 
ATOM   331  C CG  . ARG A 1 47  ? -11.022 52.865 48.422 1.00 57.37  ? 47   ARG A CG  1 
ATOM   332  C CD  . ARG A 1 47  ? -10.649 52.145 47.132 1.00 57.37  ? 47   ARG A CD  1 
ATOM   333  N NE  . ARG A 1 47  ? -9.598  51.142 47.316 1.00 57.37  ? 47   ARG A NE  1 
ATOM   334  C CZ  . ARG A 1 47  ? -9.817  49.859 47.600 1.00 57.37  ? 47   ARG A CZ  1 
ATOM   335  N NH1 . ARG A 1 47  ? -11.065 49.401 47.741 1.00 57.37  ? 47   ARG A NH1 1 
ATOM   336  N NH2 . ARG A 1 47  ? -8.779  49.027 47.722 1.00 57.37  ? 47   ARG A NH2 1 
ATOM   337  N N   . PRO A 1 48  ? -12.301 57.222 48.584 1.00 34.95  ? 48   PRO A N   1 
ATOM   338  C CA  . PRO A 1 48  ? -12.973 58.442 48.148 1.00 34.95  ? 48   PRO A CA  1 
ATOM   339  C C   . PRO A 1 48  ? -13.550 58.371 46.741 1.00 34.95  ? 48   PRO A C   1 
ATOM   340  O O   . PRO A 1 48  ? -13.039 57.652 45.876 1.00 34.95  ? 48   PRO A O   1 
ATOM   341  C CB  . PRO A 1 48  ? -11.879 59.488 48.270 1.00 35.90  ? 48   PRO A CB  1 
ATOM   342  C CG  . PRO A 1 48  ? -10.657 58.717 47.872 1.00 35.90  ? 48   PRO A CG  1 
ATOM   343  C CD  . PRO A 1 48  ? -10.838 57.402 48.610 1.00 35.90  ? 48   PRO A CD  1 
ATOM   344  N N   . GLU A 1 49  ? -14.632 59.112 46.525 1.00 40.68  ? 49   GLU A N   1 
ATOM   345  C CA  . GLU A 1 49  ? -15.267 59.175 45.220 1.00 40.68  ? 49   GLU A CA  1 
ATOM   346  C C   . GLU A 1 49  ? -15.071 60.591 44.678 1.00 40.68  ? 49   GLU A C   1 
ATOM   347  O O   . GLU A 1 49  ? -15.017 61.552 45.441 1.00 40.68  ? 49   GLU A O   1 
ATOM   348  C CB  . GLU A 1 49  ? -16.759 58.839 45.331 1.00 95.96  ? 49   GLU A CB  1 
ATOM   349  C CG  . GLU A 1 49  ? -17.046 57.377 45.720 1.00 95.96  ? 49   GLU A CG  1 
ATOM   350  C CD  . GLU A 1 49  ? -16.268 56.356 44.862 1.00 95.96  ? 49   GLU A CD  1 
ATOM   351  O OE1 . GLU A 1 49  ? -16.336 56.441 43.605 1.00 95.96  ? 49   GLU A OE1 1 
ATOM   352  O OE2 . GLU A 1 49  ? -15.591 55.465 45.449 1.00 95.96  ? 49   GLU A OE2 1 
ATOM   353  N N   . PRO A 1 50  ? -14.947 60.734 43.351 1.00 47.54  ? 50   PRO A N   1 
ATOM   354  C CA  . PRO A 1 50  ? -14.751 62.057 42.749 1.00 47.54  ? 50   PRO A CA  1 
ATOM   355  C C   . PRO A 1 50  ? -15.923 62.980 43.071 1.00 47.54  ? 50   PRO A C   1 
ATOM   356  O O   . PRO A 1 50  ? -17.061 62.525 43.186 1.00 47.54  ? 50   PRO A O   1 
ATOM   357  C CB  . PRO A 1 50  ? -14.667 61.752 41.250 1.00 44.15  ? 50   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 50  ? -14.268 60.296 41.187 1.00 44.15  ? 50   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 50  ? -15.057 59.694 42.311 1.00 44.15  ? 50   PRO A CD  1 
ATOM   360  N N   . LYS A 1 51  ? -15.656 64.273 43.220 1.00 41.23  ? 51   LYS A N   1 
ATOM   361  C CA  . LYS A 1 51  ? -16.734 65.214 43.508 1.00 41.23  ? 51   LYS A CA  1 
ATOM   362  C C   . LYS A 1 51  ? -17.603 65.345 42.266 1.00 41.23  ? 51   LYS A C   1 
ATOM   363  O O   . LYS A 1 51  ? -17.088 65.383 41.147 1.00 41.23  ? 51   LYS A O   1 
ATOM   364  C CB  . LYS A 1 51  ? -16.164 66.580 43.873 1.00 38.13  ? 51   LYS A CB  1 
ATOM   365  C CG  . LYS A 1 51  ? -17.206 67.662 44.094 1.00 38.13  ? 51   LYS A CG  1 
ATOM   366  C CD  . LYS A 1 51  ? -18.019 67.441 45.353 1.00 38.13  ? 51   LYS A CD  1 
ATOM   367  C CE  . LYS A 1 51  ? -18.957 68.617 45.574 1.00 38.13  ? 51   LYS A CE  1 
ATOM   368  N NZ  . LYS A 1 51  ? -19.845 68.432 46.749 1.00 38.13  ? 51   LYS A NZ  1 
ATOM   369  N N   . LYS A 1 52  ? -18.918 65.401 42.456 1.00 43.52  ? 52   LYS A N   1 
ATOM   370  C CA  . LYS A 1 52  ? -19.828 65.544 41.324 1.00 43.52  ? 52   LYS A CA  1 
ATOM   371  C C   . LYS A 1 52  ? -19.813 66.989 40.849 1.00 43.52  ? 52   LYS A C   1 
ATOM   372  O O   . LYS A 1 52  ? -19.829 67.922 41.654 1.00 43.52  ? 52   LYS A O   1 
ATOM   373  C CB  . LYS A 1 52  ? -21.244 65.138 41.724 1.00 64.36  ? 52   LYS A CB  1 
ATOM   374  C CG  . LYS A 1 52  ? -21.404 63.643 41.862 1.00 64.36  ? 52   LYS A CG  1 
ATOM   375  C CD  . LYS A 1 52  ? -22.547 63.272 42.803 1.00 64.36  ? 52   LYS A CD  1 
ATOM   376  C CE  . LYS A 1 52  ? -22.578 61.742 43.016 1.00 64.36  ? 52   LYS A CE  1 
ATOM   377  N NZ  . LYS A 1 52  ? -23.383 61.312 44.218 1.00 64.36  ? 52   LYS A NZ  1 
ATOM   378  N N   . PRO A 1 53  ? -19.763 67.195 39.528 1.00 44.58  ? 53   PRO A N   1 
ATOM   379  C CA  . PRO A 1 53  ? -19.747 68.565 39.012 1.00 44.58  ? 53   PRO A CA  1 
ATOM   380  C C   . PRO A 1 53  ? -20.915 69.353 39.601 1.00 44.58  ? 53   PRO A C   1 
ATOM   381  O O   . PRO A 1 53  ? -21.934 68.783 40.002 1.00 44.58  ? 53   PRO A O   1 
ATOM   382  C CB  . PRO A 1 53  ? -19.867 68.362 37.506 1.00 40.77  ? 53   PRO A CB  1 
ATOM   383  C CG  . PRO A 1 53  ? -19.180 67.037 37.296 1.00 40.77  ? 53   PRO A CG  1 
ATOM   384  C CD  . PRO A 1 53  ? -19.725 66.214 38.430 1.00 40.77  ? 53   PRO A CD  1 
ATOM   385  N N   . TRP A 1 54  ? -20.763 70.667 39.658 1.00 46.86  ? 54   TRP A N   1 
ATOM   386  C CA  . TRP A 1 54  ? -21.800 71.509 40.222 1.00 46.86  ? 54   TRP A CA  1 
ATOM   387  C C   . TRP A 1 54  ? -22.099 72.672 39.288 1.00 46.86  ? 54   TRP A C   1 
ATOM   388  O O   . TRP A 1 54  ? -21.218 73.137 38.563 1.00 46.86  ? 54   TRP A O   1 
ATOM   389  C CB  . TRP A 1 54  ? -21.330 72.046 41.574 1.00 36.46  ? 54   TRP A CB  1 
ATOM   390  C CG  . TRP A 1 54  ? -20.095 72.889 41.463 1.00 36.46  ? 54   TRP A CG  1 
ATOM   391  C CD1 . TRP A 1 54  ? -20.021 74.196 41.060 1.00 36.46  ? 54   TRP A CD1 1 
ATOM   392  C CD2 . TRP A 1 54  ? -18.748 72.467 41.696 1.00 36.46  ? 54   TRP A CD2 1 
ATOM   393  N NE1 . TRP A 1 54  ? -18.710 74.610 41.027 1.00 36.46  ? 54   TRP A NE1 1 
ATOM   394  C CE2 . TRP A 1 54  ? -17.909 73.568 41.414 1.00 36.46  ? 54   TRP A CE2 1 
ATOM   395  C CE3 . TRP A 1 54  ? -18.167 71.264 42.115 1.00 36.46  ? 54   TRP A CE3 1 
ATOM   396  C CZ2 . TRP A 1 54  ? -16.520 73.500 41.540 1.00 36.46  ? 54   TRP A CZ2 1 
ATOM   397  C CZ3 . TRP A 1 54  ? -16.783 71.198 42.239 1.00 36.46  ? 54   TRP A CZ3 1 
ATOM   398  C CH2 . TRP A 1 54  ? -15.977 72.309 41.953 1.00 36.46  ? 54   TRP A CH2 1 
ATOM   399  N N   . SER A 1 55  ? -23.349 73.128 39.305 1.00 65.17  ? 55   SER A N   1 
ATOM   400  C CA  . SER A 1 55  ? -23.763 74.268 38.490 1.00 65.17  ? 55   SER A CA  1 
ATOM   401  C C   . SER A 1 55  ? -23.509 75.511 39.332 1.00 65.17  ? 55   SER A C   1 
ATOM   402  O O   . SER A 1 55  ? -23.165 75.397 40.506 1.00 65.17  ? 55   SER A O   1 
ATOM   403  C CB  . SER A 1 55  ? -25.248 74.169 38.145 1.00 75.90  ? 55   SER A CB  1 
ATOM   404  O OG  . SER A 1 55  ? -25.475 73.104 37.227 1.00 75.90  ? 55   SER A OG  1 
ATOM   405  N N   . GLY A 1 56  ? -23.671 76.694 38.750 1.00 51.78  ? 56   GLY A N   1 
ATOM   406  C CA  . GLY A 1 56  ? -23.436 77.902 39.522 1.00 51.78  ? 56   GLY A CA  1 
ATOM   407  C C   . GLY A 1 56  ? -21.960 78.093 39.814 1.00 51.78  ? 56   GLY A C   1 
ATOM   408  O O   . GLY A 1 56  ? -21.115 77.418 39.219 1.00 51.78  ? 56   GLY A O   1 
ATOM   409  N N   . VAL A 1 57  ? -21.650 78.998 40.738 1.00 41.60  ? 57   VAL A N   1 
ATOM   410  C CA  . VAL A 1 57  ? -20.271 79.306 41.101 1.00 41.60  ? 57   VAL A CA  1 
ATOM   411  C C   . VAL A 1 57  ? -19.949 78.891 42.532 1.00 41.60  ? 57   VAL A C   1 
ATOM   412  O O   . VAL A 1 57  ? -20.692 79.209 43.463 1.00 41.60  ? 57   VAL A O   1 
ATOM   413  C CB  . VAL A 1 57  ? -20.004 80.814 40.976 1.00 43.83  ? 57   VAL A CB  1 
ATOM   414  C CG1 . VAL A 1 57  ? -18.528 81.104 41.227 1.00 43.83  ? 57   VAL A CG1 1 
ATOM   415  C CG2 . VAL A 1 57  ? -20.433 81.302 39.590 1.00 43.83  ? 57   VAL A CG2 1 
ATOM   416  N N   . TRP A 1 58  ? -18.839 78.183 42.717 1.00 37.77  ? 58   TRP A N   1 
ATOM   417  C CA  . TRP A 1 58  ? -18.468 77.761 44.055 1.00 37.77  ? 58   TRP A CA  1 
ATOM   418  C C   . TRP A 1 58  ? -17.712 78.892 44.741 1.00 37.77  ? 58   TRP A C   1 
ATOM   419  O O   . TRP A 1 58  ? -16.765 79.438 44.186 1.00 37.77  ? 58   TRP A O   1 
ATOM   420  C CB  . TRP A 1 58  ? -17.614 76.493 43.996 1.00 37.34  ? 58   TRP A CB  1 
ATOM   421  C CG  . TRP A 1 58  ? -17.289 75.941 45.343 1.00 37.34  ? 58   TRP A CG  1 
ATOM   422  C CD1 . TRP A 1 58  ? -16.332 76.396 46.212 1.00 37.34  ? 58   TRP A CD1 1 
ATOM   423  C CD2 . TRP A 1 58  ? -17.962 74.869 46.011 1.00 37.34  ? 58   TRP A CD2 1 
ATOM   424  N NE1 . TRP A 1 58  ? -16.375 75.677 47.374 1.00 37.34  ? 58   TRP A NE1 1 
ATOM   425  C CE2 . TRP A 1 58  ? -17.364 74.731 47.280 1.00 37.34  ? 58   TRP A CE2 1 
ATOM   426  C CE3 . TRP A 1 58  ? -19.012 74.012 45.660 1.00 37.34  ? 58   TRP A CE3 1 
ATOM   427  C CZ2 . TRP A 1 58  ? -17.785 73.765 48.205 1.00 37.34  ? 58   TRP A CZ2 1 
ATOM   428  C CZ3 . TRP A 1 58  ? -19.432 73.050 46.581 1.00 37.34  ? 58   TRP A CZ3 1 
ATOM   429  C CH2 . TRP A 1 58  ? -18.817 72.937 47.838 1.00 37.34  ? 58   TRP A CH2 1 
ATOM   430  N N   . ASN A 1 59  ? -18.156 79.255 45.940 1.00 45.30  ? 59   ASN A N   1 
ATOM   431  C CA  . ASN A 1 59  ? -17.531 80.324 46.713 1.00 45.30  ? 59   ASN A CA  1 
ATOM   432  C C   . ASN A 1 59  ? -16.259 79.779 47.367 1.00 45.30  ? 59   ASN A C   1 
ATOM   433  O O   . ASN A 1 59  ? -16.333 79.081 48.379 1.00 45.30  ? 59   ASN A O   1 
ATOM   434  C CB  . ASN A 1 59  ? -18.496 80.817 47.801 1.00 49.55  ? 59   ASN A CB  1 
ATOM   435  C CG  . ASN A 1 59  ? -18.011 82.083 48.492 1.00 49.55  ? 59   ASN A CG  1 
ATOM   436  O OD1 . ASN A 1 59  ? -16.813 82.370 48.511 1.00 49.55  ? 59   ASN A OD1 1 
ATOM   437  N ND2 . ASN A 1 59  ? -18.942 82.841 49.081 1.00 49.55  ? 59   ASN A ND2 1 
ATOM   438  N N   . ALA A 1 60  ? -15.103 80.104 46.795 1.00 39.04  ? 60   ALA A N   1 
ATOM   439  C CA  . ALA A 1 60  ? -13.826 79.629 47.323 1.00 39.04  ? 60   ALA A CA  1 
ATOM   440  C C   . ALA A 1 60  ? -13.015 80.758 47.949 1.00 39.04  ? 60   ALA A C   1 
ATOM   441  O O   . ALA A 1 60  ? -11.816 80.895 47.685 1.00 39.04  ? 60   ALA A O   1 
ATOM   442  C CB  . ALA A 1 60  ? -13.021 78.973 46.207 1.00 29.39  ? 60   ALA A CB  1 
ATOM   443  N N   . SER A 1 61  ? -13.665 81.553 48.791 1.00 40.79  ? 61   SER A N   1 
ATOM   444  C CA  . SER A 1 61  ? -13.005 82.691 49.425 1.00 40.79  ? 61   SER A CA  1 
ATOM   445  C C   . SER A 1 61  ? -12.654 82.486 50.893 1.00 40.79  ? 61   SER A C   1 
ATOM   446  O O   . SER A 1 61  ? -12.050 83.361 51.510 1.00 40.79  ? 61   SER A O   1 
ATOM   447  C CB  . SER A 1 61  ? -13.888 83.926 49.301 1.00 46.31  ? 61   SER A CB  1 
ATOM   448  O OG  . SER A 1 61  ? -15.060 83.754 50.085 1.00 46.31  ? 61   SER A OG  1 
ATOM   449  N N   . THR A 1 62  ? -13.044 81.349 51.459 1.00 39.01  ? 62   THR A N   1 
ATOM   450  C CA  . THR A 1 62  ? -12.736 81.065 52.856 1.00 39.01  ? 62   THR A CA  1 
ATOM   451  C C   . THR A 1 62  ? -12.242 79.634 53.064 1.00 39.01  ? 62   THR A C   1 
ATOM   452  O O   . THR A 1 62  ? -12.636 78.716 52.347 1.00 39.01  ? 62   THR A O   1 
ATOM   453  C CB  . THR A 1 62  ? -13.958 81.272 53.743 1.00 51.68  ? 62   THR A CB  1 
ATOM   454  O OG1 . THR A 1 62  ? -14.954 80.300 53.406 1.00 51.68  ? 62   THR A OG1 1 
ATOM   455  C CG2 . THR A 1 62  ? -14.524 82.662 53.542 1.00 51.68  ? 62   THR A CG2 1 
ATOM   456  N N   . TYR A 1 63  ? -11.382 79.446 54.056 1.00 40.47  ? 63   TYR A N   1 
ATOM   457  C CA  . TYR A 1 63  ? -10.855 78.121 54.344 1.00 40.47  ? 63   TYR A CA  1 
ATOM   458  C C   . TYR A 1 63  ? -11.952 77.103 54.638 1.00 40.47  ? 63   TYR A C   1 
ATOM   459  O O   . TYR A 1 63  ? -13.009 77.440 55.163 1.00 40.47  ? 63   TYR A O   1 
ATOM   460  C CB  . TYR A 1 63  ? -9.895  78.169 55.529 1.00 38.10  ? 63   TYR A CB  1 
ATOM   461  C CG  . TYR A 1 63  ? -8.495  78.628 55.197 1.00 38.10  ? 63   TYR A CG  1 
ATOM   462  C CD1 . TYR A 1 63  ? -7.812  78.119 54.089 1.00 38.10  ? 63   TYR A CD1 1 
ATOM   463  C CD2 . TYR A 1 63  ? -7.801  79.479 56.064 1.00 38.10  ? 63   TYR A CD2 1 
ATOM   464  C CE1 . TYR A 1 63  ? -6.466  78.433 53.860 1.00 38.10  ? 63   TYR A CE1 1 
ATOM   465  C CE2 . TYR A 1 63  ? -6.453  79.801 55.847 1.00 38.10  ? 63   TYR A CE2 1 
ATOM   466  C CZ  . TYR A 1 63  ? -5.794  79.271 54.750 1.00 38.10  ? 63   TYR A CZ  1 
ATOM   467  O OH  . TYR A 1 63  ? -4.459  79.541 54.580 1.00 38.10  ? 63   TYR A OH  1 
ATOM   468  N N   . PRO A 1 64  ? -11.707 75.833 54.294 1.00 36.20  ? 64   PRO A N   1 
ATOM   469  C CA  . PRO A 1 64  ? -12.670 74.756 54.522 1.00 36.20  ? 64   PRO A CA  1 
ATOM   470  C C   . PRO A 1 64  ? -12.495 74.246 55.937 1.00 36.20  ? 64   PRO A C   1 
ATOM   471  O O   . PRO A 1 64  ? -11.642 74.737 56.666 1.00 36.20  ? 64   PRO A O   1 
ATOM   472  C CB  . PRO A 1 64  ? -12.237 73.713 53.510 1.00 36.34  ? 64   PRO A CB  1 
ATOM   473  C CG  . PRO A 1 64  ? -10.737 73.815 53.616 1.00 36.34  ? 64   PRO A CG  1 
ATOM   474  C CD  . PRO A 1 64  ? -10.513 75.322 53.593 1.00 36.34  ? 64   PRO A CD  1 
ATOM   475  N N   . ASN A 1 65  ? -13.296 73.261 56.325 1.00 36.91  ? 65   ASN A N   1 
ATOM   476  C CA  . ASN A 1 65  ? -13.164 72.682 57.653 1.00 36.91  ? 65   ASN A CA  1 
ATOM   477  C C   . ASN A 1 65  ? -11.917 71.785 57.701 1.00 36.91  ? 65   ASN A C   1 
ATOM   478  O O   . ASN A 1 65  ? -11.307 71.483 56.678 1.00 36.91  ? 65   ASN A O   1 
ATOM   479  C CB  . ASN A 1 65  ? -14.394 71.845 58.003 1.00 55.84  ? 65   ASN A CB  1 
ATOM   480  C CG  . ASN A 1 65  ? -15.669 72.673 58.096 1.00 55.84  ? 65   ASN A CG  1 
ATOM   481  O OD1 . ASN A 1 65  ? -15.732 73.675 58.813 1.00 55.84  ? 65   ASN A OD1 1 
ATOM   482  N ND2 . ASN A 1 65  ? -16.700 72.245 57.374 1.00 55.84  ? 65   ASN A ND2 1 
ATOM   483  N N   . ASN A 1 66  ? -11.536 71.379 58.902 1.00 41.64  ? 66   ASN A N   1 
ATOM   484  C CA  . ASN A 1 66  ? -10.391 70.501 59.084 1.00 41.64  ? 66   ASN A CA  1 
ATOM   485  C C   . ASN A 1 66  ? -10.958 69.111 59.371 1.00 41.64  ? 66   ASN A C   1 
ATOM   486  O O   . ASN A 1 66  ? -12.044 68.988 59.935 1.00 41.64  ? 66   ASN A O   1 
ATOM   487  C CB  . ASN A 1 66  ? -9.537  70.964 60.273 1.00 44.59  ? 66   ASN A CB  1 
ATOM   488  C CG  . ASN A 1 66  ? -8.911  72.335 60.056 1.00 44.59  ? 66   ASN A CG  1 
ATOM   489  O OD1 . ASN A 1 66  ? -8.720  73.099 61.002 1.00 44.59  ? 66   ASN A OD1 1 
ATOM   490  N ND2 . ASN A 1 66  ? -8.578  72.645 58.811 1.00 44.59  ? 66   ASN A ND2 1 
ATOM   491  N N   . CYS A 1 67  ? -10.228 68.076 58.980 1.00 34.88  ? 67   CYS A N   1 
ATOM   492  C CA  . CYS A 1 67  ? -10.659 66.709 59.211 1.00 34.88  ? 67   CYS A CA  1 
ATOM   493  C C   . CYS A 1 67  ? -10.763 66.419 60.703 1.00 34.88  ? 67   CYS A C   1 
ATOM   494  O O   . CYS A 1 67  ? -10.072 67.036 61.511 1.00 34.88  ? 67   CYS A O   1 
ATOM   495  C CB  . CYS A 1 67  ? -9.666  65.735 58.556 1.00 31.87  ? 67   CYS A CB  1 
ATOM   496  N N   . GLN A 1 68  ? -11.641 65.489 61.066 1.00 35.99  ? 68   GLN A N   1 
ATOM   497  C CA  . GLN A 1 68  ? -11.802 65.091 62.461 1.00 35.99  ? 68   GLN A CA  1 
ATOM   498  C C   . GLN A 1 68  ? -10.463 64.546 62.958 1.00 35.99  ? 68   GLN A C   1 
ATOM   499  O O   . GLN A 1 68  ? -9.875  63.666 62.323 1.00 35.99  ? 68   GLN A O   1 
ATOM   500  C CB  . GLN A 1 68  ? -12.871 64.010 62.575 1.00 40.92  ? 68   GLN A CB  1 
ATOM   501  C CG  . GLN A 1 68  ? -14.278 64.529 62.451 1.00 40.92  ? 68   GLN A CG  1 
ATOM   502  C CD  . GLN A 1 68  ? -14.689 65.332 63.663 1.00 40.92  ? 68   GLN A CD  1 
ATOM   503  O OE1 . GLN A 1 68  ? -15.805 65.844 63.737 1.00 40.92  ? 68   GLN A OE1 1 
ATOM   504  N NE2 . GLN A 1 68  ? -13.787 65.446 64.626 1.00 40.92  ? 68   GLN A NE2 1 
ATOM   505  N N   . GLN A 1 69  ? -9.981  65.058 64.087 1.00 38.81  ? 69   GLN A N   1 
ATOM   506  C CA  . GLN A 1 69  ? -8.693  64.611 64.609 1.00 38.81  ? 69   GLN A CA  1 
ATOM   507  C C   . GLN A 1 69  ? -8.470  64.815 66.100 1.00 38.81  ? 69   GLN A C   1 
ATOM   508  O O   . GLN A 1 69  ? -9.220  65.525 66.785 1.00 38.81  ? 69   GLN A O   1 
ATOM   509  C CB  . GLN A 1 69  ? -7.552  65.301 63.851 1.00 32.45  ? 69   GLN A CB  1 
ATOM   510  C CG  . GLN A 1 69  ? -7.684  66.823 63.772 1.00 32.45  ? 69   GLN A CG  1 
ATOM   511  C CD  . GLN A 1 69  ? -6.565  67.494 62.964 1.00 32.45  ? 69   GLN A CD  1 
ATOM   512  O OE1 . GLN A 1 69  ? -5.455  67.707 63.461 1.00 32.45  ? 69   GLN A OE1 1 
ATOM   513  N NE2 . GLN A 1 69  ? -6.860  67.822 61.713 1.00 32.45  ? 69   GLN A NE2 1 
ATOM   514  N N   . TYR A 1 70  ? -7.421  64.166 66.586 1.00 36.98  ? 70   TYR A N   1 
ATOM   515  C CA  . TYR A 1 70  ? -7.013  64.272 67.973 1.00 36.98  ? 70   TYR A CA  1 
ATOM   516  C C   . TYR A 1 70  ? -6.429  65.672 68.119 1.00 36.98  ? 70   TYR A C   1 
ATOM   517  O O   . TYR A 1 70  ? -5.734  66.149 67.229 1.00 36.98  ? 70   TYR A O   1 
ATOM   518  C CB  . TYR A 1 70  ? -5.949  63.232 68.278 1.00 46.76  ? 70   TYR A CB  1 
ATOM   519  C CG  . TYR A 1 70  ? -5.326  63.408 69.629 1.00 46.76  ? 70   TYR A CG  1 
ATOM   520  C CD1 . TYR A 1 70  ? -5.985  62.981 70.793 1.00 46.76  ? 70   TYR A CD1 1 
ATOM   521  C CD2 . TYR A 1 70  ? -4.081  64.029 69.756 1.00 46.76  ? 70   TYR A CD2 1 
ATOM   522  C CE1 . TYR A 1 70  ? -5.409  63.173 72.053 1.00 46.76  ? 70   TYR A CE1 1 
ATOM   523  C CE2 . TYR A 1 70  ? -3.503  64.226 70.996 1.00 46.76  ? 70   TYR A CE2 1 
ATOM   524  C CZ  . TYR A 1 70  ? -4.165  63.799 72.142 1.00 46.76  ? 70   TYR A CZ  1 
ATOM   525  O OH  . TYR A 1 70  ? -3.564  64.009 73.365 1.00 46.76  ? 70   TYR A OH  1 
ATOM   526  N N   . VAL A 1 71  ? -6.718  66.335 69.230 1.00 34.28  ? 71   VAL A N   1 
ATOM   527  C CA  . VAL A 1 71  ? -6.225  67.686 69.440 1.00 34.28  ? 71   VAL A CA  1 
ATOM   528  C C   . VAL A 1 71  ? -5.328  67.762 70.657 1.00 34.28  ? 71   VAL A C   1 
ATOM   529  O O   . VAL A 1 71  ? -5.728  67.401 71.765 1.00 34.28  ? 71   VAL A O   1 
ATOM   530  C CB  . VAL A 1 71  ? -7.387  68.678 69.622 1.00 35.84  ? 71   VAL A CB  1 
ATOM   531  C CG1 . VAL A 1 71  ? -6.844  70.075 69.811 1.00 35.84  ? 71   VAL A CG1 1 
ATOM   532  C CG2 . VAL A 1 71  ? -8.310  68.621 68.425 1.00 35.84  ? 71   VAL A CG2 1 
ATOM   533  N N   . ASP A 1 72  ? -4.110  68.244 70.444 1.00 42.09  ? 72   ASP A N   1 
ATOM   534  C CA  . ASP A 1 72  ? -3.147  68.358 71.524 1.00 42.09  ? 72   ASP A CA  1 
ATOM   535  C C   . ASP A 1 72  ? -3.524  69.432 72.524 1.00 42.09  ? 72   ASP A C   1 
ATOM   536  O O   . ASP A 1 72  ? -3.731  70.592 72.163 1.00 42.09  ? 72   ASP A O   1 
ATOM   537  C CB  . ASP A 1 72  ? -1.764  68.637 70.962 1.00 53.00  ? 72   ASP A CB  1 
ATOM   538  C CG  . ASP A 1 72  ? -0.762  68.983 72.043 1.00 53.00  ? 72   ASP A CG  1 
ATOM   539  O OD1 . ASP A 1 72  ? -0.876  68.433 73.163 1.00 53.00  ? 72   ASP A OD1 1 
ATOM   540  O OD2 . ASP A 1 72  ? 0.149   69.798 71.766 1.00 53.00  ? 72   ASP A OD2 1 
ATOM   541  N N   . GLU A 1 73  ? -3.616  69.027 73.787 1.00 49.15  ? 73   GLU A N   1 
ATOM   542  C CA  . GLU A 1 73  ? -3.967  69.936 74.866 1.00 49.15  ? 73   GLU A CA  1 
ATOM   543  C C   . GLU A 1 73  ? -2.932  69.875 75.983 1.00 49.15  ? 73   GLU A C   1 
ATOM   544  O O   . GLU A 1 73  ? -3.171  70.336 77.100 1.00 49.15  ? 73   GLU A O   1 
ATOM   545  C CB  . GLU A 1 73  ? -5.345  69.587 75.410 1.00 62.97  ? 73   GLU A CB  1 
ATOM   546  C CG  . GLU A 1 73  ? -6.469  70.307 74.701 1.00 62.97  ? 73   GLU A CG  1 
ATOM   547  C CD  . GLU A 1 73  ? -7.844  69.730 75.028 1.00 62.97  ? 73   GLU A CD  1 
ATOM   548  O OE1 . GLU A 1 73  ? -8.243  69.738 76.225 1.00 62.97  ? 73   GLU A OE1 1 
ATOM   549  O OE2 . GLU A 1 73  ? -8.527  69.265 74.080 1.00 62.97  ? 73   GLU A OE2 1 
ATOM   550  N N   . GLN A 1 74  ? -1.775  69.307 75.676 1.00 48.28  ? 74   GLN A N   1 
ATOM   551  C CA  . GLN A 1 74  ? -0.713  69.199 76.659 1.00 48.28  ? 74   GLN A CA  1 
ATOM   552  C C   . GLN A 1 74  ? -0.257  70.572 77.184 1.00 48.28  ? 74   GLN A C   1 
ATOM   553  O O   . GLN A 1 74  ? 0.268   70.657 78.290 1.00 48.28  ? 74   GLN A O   1 
ATOM   554  C CB  . GLN A 1 74  ? 0.466   68.426 76.049 1.00 61.50  ? 74   GLN A CB  1 
ATOM   555  C CG  . GLN A 1 74  ? 1.690   68.271 76.945 1.00 61.50  ? 74   GLN A CG  1 
ATOM   556  C CD  . GLN A 1 74  ? 1.413   67.476 78.213 1.00 61.50  ? 74   GLN A CD  1 
ATOM   557  O OE1 . GLN A 1 74  ? 2.291   67.336 79.085 1.00 61.50  ? 74   GLN A OE1 1 
ATOM   558  N NE2 . GLN A 1 74  ? 0.200   66.948 78.328 1.00 61.50  ? 74   GLN A NE2 1 
ATOM   559  N N   . PHE A 1 75  ? -0.469  71.638 76.412 1.00 39.22  ? 75   PHE A N   1 
ATOM   560  C CA  . PHE A 1 75  ? -0.055  72.984 76.833 1.00 39.22  ? 75   PHE A CA  1 
ATOM   561  C C   . PHE A 1 75  ? -1.053  74.088 76.454 1.00 39.22  ? 75   PHE A C   1 
ATOM   562  O O   . PHE A 1 75  ? -0.763  74.934 75.614 1.00 39.22  ? 75   PHE A O   1 
ATOM   563  C CB  . PHE A 1 75  ? 1.303   73.337 76.220 1.00 38.48  ? 75   PHE A CB  1 
ATOM   564  C CG  . PHE A 1 75  ? 2.411   72.413 76.612 1.00 38.48  ? 75   PHE A CG  1 
ATOM   565  C CD1 . PHE A 1 75  ? 2.882   72.386 77.919 1.00 38.48  ? 75   PHE A CD1 1 
ATOM   566  C CD2 . PHE A 1 75  ? 2.989   71.569 75.671 1.00 38.48  ? 75   PHE A CD2 1 
ATOM   567  C CE1 . PHE A 1 75  ? 3.918   71.530 78.285 1.00 38.48  ? 75   PHE A CE1 1 
ATOM   568  C CE2 . PHE A 1 75  ? 4.023   70.706 76.021 1.00 38.48  ? 75   PHE A CE2 1 
ATOM   569  C CZ  . PHE A 1 75  ? 4.493   70.682 77.330 1.00 38.48  ? 75   PHE A CZ  1 
ATOM   570  N N   . PRO A 1 76  ? -2.229  74.110 77.103 1.00 54.54  ? 76   PRO A N   1 
ATOM   571  C CA  . PRO A 1 76  ? -3.273  75.105 76.835 1.00 54.54  ? 76   PRO A CA  1 
ATOM   572  C C   . PRO A 1 76  ? -2.751  76.538 76.701 1.00 54.54  ? 76   PRO A C   1 
ATOM   573  O O   . PRO A 1 76  ? -2.051  77.049 77.592 1.00 54.54  ? 76   PRO A O   1 
ATOM   574  C CB  . PRO A 1 76  ? -4.207  74.945 78.031 1.00 41.38  ? 76   PRO A CB  1 
ATOM   575  C CG  . PRO A 1 76  ? -4.085  73.489 78.355 1.00 41.38  ? 76   PRO A CG  1 
ATOM   576  C CD  . PRO A 1 76  ? -2.591  73.280 78.270 1.00 41.38  ? 76   PRO A CD  1 
ATOM   577  N N   . GLY A 1 77  ? -3.099  77.186 75.588 1.00 59.70  ? 77   GLY A N   1 
ATOM   578  C CA  . GLY A 1 77  ? -2.659  78.555 75.367 1.00 59.70  ? 77   GLY A CA  1 
ATOM   579  C C   . GLY A 1 77  ? -1.295  78.703 74.705 1.00 59.70  ? 77   GLY A C   1 
ATOM   580  O O   . GLY A 1 77  ? -1.079  79.627 73.916 1.00 59.70  ? 77   GLY A O   1 
ATOM   581  N N   . PHE A 1 78  ? -0.370  77.802 75.019 1.00 42.80  ? 78   PHE A N   1 
ATOM   582  C CA  . PHE A 1 78  ? 0.979   77.833 74.452 1.00 42.80  ? 78   PHE A CA  1 
ATOM   583  C C   . PHE A 1 78  ? 0.965   77.878 72.918 1.00 42.80  ? 78   PHE A C   1 
ATOM   584  O O   . PHE A 1 78  ? 0.535   76.936 72.263 1.00 42.80  ? 78   PHE A O   1 
ATOM   585  C CB  . PHE A 1 78  ? 1.735   76.597 74.930 1.00 36.43  ? 78   PHE A CB  1 
ATOM   586  C CG  . PHE A 1 78  ? 3.200   76.638 74.656 1.00 36.43  ? 78   PHE A CG  1 
ATOM   587  C CD1 . PHE A 1 78  ? 3.973   77.704 75.106 1.00 36.43  ? 78   PHE A CD1 1 
ATOM   588  C CD2 . PHE A 1 78  ? 3.820   75.592 73.980 1.00 36.43  ? 78   PHE A CD2 1 
ATOM   589  C CE1 . PHE A 1 78  ? 5.347   77.728 74.887 1.00 36.43  ? 78   PHE A CE1 1 
ATOM   590  C CE2 . PHE A 1 78  ? 5.190   75.602 73.755 1.00 36.43  ? 78   PHE A CE2 1 
ATOM   591  C CZ  . PHE A 1 78  ? 5.956   76.674 74.211 1.00 36.43  ? 78   PHE A CZ  1 
ATOM   592  N N   . SER A 1 79  ? 1.432   78.968 72.333 1.00 45.72  ? 79   SER A N   1 
ATOM   593  C CA  . SER A 1 79  ? 1.435   79.066 70.875 1.00 45.72  ? 79   SER A CA  1 
ATOM   594  C C   . SER A 1 79  ? 2.251   77.942 70.256 1.00 45.72  ? 79   SER A C   1 
ATOM   595  O O   . SER A 1 79  ? 1.884   77.388 69.218 1.00 45.72  ? 79   SER A O   1 
ATOM   596  C CB  . SER A 1 79  ? 2.012   80.406 70.429 1.00 41.73  ? 79   SER A CB  1 
ATOM   597  O OG  . SER A 1 79  ? 3.242   80.658 71.086 1.00 41.73  ? 79   SER A OG  1 
ATOM   598  N N   . GLY A 1 80  ? 3.355   77.606 70.914 1.00 44.30  ? 80   GLY A N   1 
ATOM   599  C CA  . GLY A 1 80  ? 4.244   76.570 70.425 1.00 44.30  ? 80   GLY A CA  1 
ATOM   600  C C   . GLY A 1 80  ? 3.570   75.305 69.942 1.00 44.30  ? 80   GLY A C   1 
ATOM   601  O O   . GLY A 1 80  ? 3.971   74.736 68.927 1.00 44.30  ? 80   GLY A O   1 
ATOM   602  N N   . SER A 1 81  ? 2.550   74.860 70.665 1.00 44.59  ? 81   SER A N   1 
ATOM   603  C CA  . SER A 1 81  ? 1.849   73.637 70.298 1.00 44.59  ? 81   SER A CA  1 
ATOM   604  C C   . SER A 1 81  ? 0.493   73.874 69.646 1.00 44.59  ? 81   SER A C   1 
ATOM   605  O O   . SER A 1 81  ? 0.026   73.042 68.868 1.00 44.59  ? 81   SER A O   1 
ATOM   606  C CB  . SER A 1 81  ? 1.676   72.740 71.528 1.00 44.49  ? 81   SER A CB  1 
ATOM   607  O OG  . SER A 1 81  ? 0.951   73.407 72.539 1.00 44.49  ? 81   SER A OG  1 
ATOM   608  N N   . GLU A 1 82  ? -0.139  75.002 69.949 1.00 45.67  ? 82   GLU A N   1 
ATOM   609  C CA  . GLU A 1 82  ? -1.444  75.276 69.366 1.00 45.67  ? 82   GLU A CA  1 
ATOM   610  C C   . GLU A 1 82  ? -1.383  75.727 67.924 1.00 45.67  ? 82   GLU A C   1 
ATOM   611  O O   . GLU A 1 82  ? -2.376  75.660 67.215 1.00 45.67  ? 82   GLU A O   1 
ATOM   612  C CB  . GLU A 1 82  ? -2.216  76.275 70.229 1.00 74.13  ? 82   GLU A CB  1 
ATOM   613  C CG  . GLU A 1 82  ? -2.978  75.566 71.342 1.00 74.13  ? 82   GLU A CG  1 
ATOM   614  C CD  . GLU A 1 82  ? -3.378  76.485 72.479 1.00 74.13  ? 82   GLU A CD  1 
ATOM   615  O OE1 . GLU A 1 82  ? -2.925  77.659 72.487 1.00 74.13  ? 82   GLU A OE1 1 
ATOM   616  O OE2 . GLU A 1 82  ? -4.137  76.030 73.377 1.00 74.13  ? 82   GLU A OE2 1 
ATOM   617  N N   . MET A 1 83  ? -0.214  76.165 67.476 1.00 39.49  ? 83   MET A N   1 
ATOM   618  C CA  . MET A 1 83  ? -0.062  76.578 66.085 1.00 39.49  ? 83   MET A CA  1 
ATOM   619  C C   . MET A 1 83  ? -0.156  75.356 65.168 1.00 39.49  ? 83   MET A C   1 
ATOM   620  O O   . MET A 1 83  ? -0.165  75.495 63.944 1.00 39.49  ? 83   MET A O   1 
ATOM   621  C CB  . MET A 1 83  ? 1.288   77.241 65.864 1.00 50.93  ? 83   MET A CB  1 
ATOM   622  C CG  . MET A 1 83  ? 2.444   76.306 66.072 1.00 50.93  ? 83   MET A CG  1 
ATOM   623  S SD  . MET A 1 83  ? 3.974   76.988 65.432 1.00 50.93  ? 83   MET A SD  1 
ATOM   624  C CE  . MET A 1 83  ? 4.882   77.396 67.035 1.00 50.93  ? 83   MET A CE  1 
ATOM   625  N N   . TRP A 1 84  ? -0.190  74.162 65.760 1.00 36.73  ? 84   TRP A N   1 
ATOM   626  C CA  . TRP A 1 84  ? -0.302  72.937 64.979 1.00 36.73  ? 84   TRP A CA  1 
ATOM   627  C C   . TRP A 1 84  ? -1.709  72.358 65.063 1.00 36.73  ? 84   TRP A C   1 
ATOM   628  O O   . TRP A 1 84  ? -2.079  71.526 64.245 1.00 36.73  ? 84   TRP A O   1 
ATOM   629  C CB  . TRP A 1 84  ? 0.719   71.887 65.436 1.00 35.92  ? 84   TRP A CB  1 
ATOM   630  C CG  . TRP A 1 84  ? 2.149   72.349 65.330 1.00 35.92  ? 84   TRP A CG  1 
ATOM   631  C CD1 . TRP A 1 84  ? 2.982   72.680 66.363 1.00 35.92  ? 84   TRP A CD1 1 
ATOM   632  C CD2 . TRP A 1 84  ? 2.901   72.572 64.124 1.00 35.92  ? 84   TRP A CD2 1 
ATOM   633  N NE1 . TRP A 1 84  ? 4.201   73.098 65.876 1.00 35.92  ? 84   TRP A NE1 1 
ATOM   634  C CE2 . TRP A 1 84  ? 4.179   73.042 64.507 1.00 35.92  ? 84   TRP A CE2 1 
ATOM   635  C CE3 . TRP A 1 84  ? 2.618   72.423 62.760 1.00 35.92  ? 84   TRP A CE3 1 
ATOM   636  C CZ2 . TRP A 1 84  ? 5.175   73.363 63.574 1.00 35.92  ? 84   TRP A CZ2 1 
ATOM   637  C CZ3 . TRP A 1 84  ? 3.611   72.742 61.831 1.00 35.92  ? 84   TRP A CZ3 1 
ATOM   638  C CH2 . TRP A 1 84  ? 4.872   73.207 62.246 1.00 35.92  ? 84   TRP A CH2 1 
ATOM   639  N N   . ASN A 1 85  ? -2.493  72.801 66.043 1.00 38.38  ? 85   ASN A N   1 
ATOM   640  C CA  . ASN A 1 85  ? -3.863  72.313 66.199 1.00 38.38  ? 85   ASN A CA  1 
ATOM   641  C C   . ASN A 1 85  ? -4.744  72.851 65.087 1.00 38.38  ? 85   ASN A C   1 
ATOM   642  O O   . ASN A 1 85  ? -4.404  73.837 64.444 1.00 38.38  ? 85   ASN A O   1 
ATOM   643  C CB  . ASN A 1 85  ? -4.475  72.767 67.534 1.00 49.19  ? 85   ASN A CB  1 
ATOM   644  C CG  . ASN A 1 85  ? -3.910  72.030 68.730 1.00 49.19  ? 85   ASN A CG  1 
ATOM   645  O OD1 . ASN A 1 85  ? -3.618  70.832 68.666 1.00 49.19  ? 85   ASN A OD1 1 
ATOM   646  N ND2 . ASN A 1 85  ? -3.775  72.741 69.839 1.00 49.19  ? 85   ASN A ND2 1 
ATOM   647  N N   . PRO A 1 86  ? -5.899  72.210 64.851 1.00 38.23  ? 86   PRO A N   1 
ATOM   648  C CA  . PRO A 1 86  ? -6.834  72.647 63.807 1.00 38.23  ? 86   PRO A CA  1 
ATOM   649  C C   . PRO A 1 86  ? -7.354  74.048 64.154 1.00 38.23  ? 86   PRO A C   1 
ATOM   650  O O   . PRO A 1 86  ? -7.734  74.293 65.292 1.00 38.23  ? 86   PRO A O   1 
ATOM   651  C CB  . PRO A 1 86  ? -7.950  71.606 63.881 1.00 32.54  ? 86   PRO A CB  1 
ATOM   652  C CG  . PRO A 1 86  ? -7.270  70.397 64.410 1.00 32.54  ? 86   PRO A CG  1 
ATOM   653  C CD  . PRO A 1 86  ? -6.355  70.956 65.471 1.00 32.54  ? 86   PRO A CD  1 
ATOM   654  N N   . ASN A 1 87  ? -7.374  74.959 63.185 1.00 43.58  ? 87   ASN A N   1 
ATOM   655  C CA  . ASN A 1 87  ? -7.853  76.308 63.441 1.00 43.58  ? 87   ASN A CA  1 
ATOM   656  C C   . ASN A 1 87  ? -9.226  76.558 62.816 1.00 43.58  ? 87   ASN A C   1 
ATOM   657  O O   . ASN A 1 87  ? -9.633  77.703 62.628 1.00 43.58  ? 87   ASN A O   1 
ATOM   658  C CB  . ASN A 1 87  ? -6.838  77.328 62.924 1.00 44.76  ? 87   ASN A CB  1 
ATOM   659  C CG  . ASN A 1 87  ? -6.582  77.193 61.435 1.00 44.76  ? 87   ASN A CG  1 
ATOM   660  O OD1 . ASN A 1 87  ? -6.972  76.201 60.807 1.00 44.76  ? 87   ASN A OD1 1 
ATOM   661  N ND2 . ASN A 1 87  ? -5.919  78.186 60.861 1.00 44.76  ? 87   ASN A ND2 1 
ATOM   662  N N   . ARG A 1 88  ? -9.937  75.481 62.501 1.00 39.89  ? 88   ARG A N   1 
ATOM   663  C CA  . ARG A 1 88  ? -11.272 75.566 61.914 1.00 39.89  ? 88   ARG A CA  1 
ATOM   664  C C   . ARG A 1 88  ? -12.126 74.489 62.551 1.00 39.89  ? 88   ARG A C   1 
ATOM   665  O O   . ARG A 1 88  ? -11.605 73.580 63.197 1.00 39.89  ? 88   ARG A O   1 
ATOM   666  C CB  . ARG A 1 88  ? -11.231 75.287 60.416 1.00 54.71  ? 88   ARG A CB  1 
ATOM   667  C CG  . ARG A 1 88  ? -10.434 76.266 59.617 1.00 54.71  ? 88   ARG A CG  1 
ATOM   668  C CD  . ARG A 1 88  ? -11.225 77.509 59.430 1.00 54.71  ? 88   ARG A CD  1 
ATOM   669  N NE  . ARG A 1 88  ? -10.338 78.656 59.419 1.00 54.71  ? 88   ARG A NE  1 
ATOM   670  C CZ  . ARG A 1 88  ? -10.738 79.894 59.176 1.00 54.71  ? 88   ARG A CZ  1 
ATOM   671  N NH1 . ARG A 1 88  ? -12.023 80.133 58.926 1.00 54.71  ? 88   ARG A NH1 1 
ATOM   672  N NH2 . ARG A 1 88  ? -9.851  80.881 59.167 1.00 54.71  ? 88   ARG A NH2 1 
ATOM   673  N N   . GLU A 1 89  ? -13.436 74.585 62.358 1.00 46.79  ? 89   GLU A N   1 
ATOM   674  C CA  . GLU A 1 89  ? -14.352 73.587 62.891 1.00 46.79  ? 89   GLU A CA  1 
ATOM   675  C C   . GLU A 1 89  ? -13.921 72.252 62.278 1.00 46.79  ? 89   GLU A C   1 
ATOM   676  O O   . GLU A 1 89  ? -13.621 72.194 61.087 1.00 46.79  ? 89   GLU A O   1 
ATOM   677  C CB  . GLU A 1 89  ? -15.781 73.885 62.434 1.00 100.52 ? 89   GLU A CB  1 
ATOM   678  C CG  . GLU A 1 89  ? -16.822 73.785 63.527 1.00 100.52 ? 89   GLU A CG  1 
ATOM   679  C CD  . GLU A 1 89  ? -16.905 75.071 64.348 1.00 100.52 ? 89   GLU A CD  1 
ATOM   680  O OE1 . GLU A 1 89  ? -17.254 76.132 63.760 1.00 100.52 ? 89   GLU A OE1 1 
ATOM   681  O OE2 . GLU A 1 89  ? -16.617 75.024 65.573 1.00 100.52 ? 89   GLU A OE2 1 
ATOM   682  N N   . MET A 1 90  ? -13.872 71.190 63.071 1.00 34.66  ? 90   MET A N   1 
ATOM   683  C CA  . MET A 1 90  ? -13.511 69.889 62.522 1.00 34.66  ? 90   MET A CA  1 
ATOM   684  C C   . MET A 1 90  ? -14.784 69.274 61.976 1.00 34.66  ? 90   MET A C   1 
ATOM   685  O O   . MET A 1 90  ? -15.874 69.557 62.466 1.00 34.66  ? 90   MET A O   1 
ATOM   686  C CB  . MET A 1 90  ? -12.904 68.973 63.591 1.00 44.66  ? 90   MET A CB  1 
ATOM   687  C CG  . MET A 1 90  ? -11.483 69.348 63.986 1.00 44.66  ? 90   MET A CG  1 
ATOM   688  S SD  . MET A 1 90  ? -10.778 68.170 65.151 1.00 44.66  ? 90   MET A SD  1 
ATOM   689  C CE  . MET A 1 90  ? -11.694 68.587 66.664 1.00 44.66  ? 90   MET A CE  1 
ATOM   690  N N   . SER A 1 91  ? -14.644 68.428 60.963 1.00 34.58  ? 91   SER A N   1 
ATOM   691  C CA  . SER A 1 91  ? -15.800 67.798 60.330 1.00 34.58  ? 91   SER A CA  1 
ATOM   692  C C   . SER A 1 91  ? -15.339 66.639 59.459 1.00 34.58  ? 91   SER A C   1 
ATOM   693  O O   . SER A 1 91  ? -14.223 66.655 58.947 1.00 34.58  ? 91   SER A O   1 
ATOM   694  C CB  . SER A 1 91  ? -16.526 68.839 59.469 1.00 30.80  ? 91   SER A CB  1 
ATOM   695  O OG  . SER A 1 91  ? -17.501 68.260 58.630 1.00 30.80  ? 91   SER A OG  1 
ATOM   696  N N   . GLU A 1 92  ? -16.185 65.627 59.293 1.00 49.54  ? 92   GLU A N   1 
ATOM   697  C CA  . GLU A 1 92  ? -15.808 64.513 58.442 1.00 49.54  ? 92   GLU A CA  1 
ATOM   698  C C   . GLU A 1 92  ? -15.822 64.978 56.983 1.00 49.54  ? 92   GLU A C   1 
ATOM   699  O O   . GLU A 1 92  ? -15.178 64.371 56.120 1.00 49.54  ? 92   GLU A O   1 
ATOM   700  C CB  . GLU A 1 92  ? -16.740 63.322 58.650 1.00 47.41  ? 92   GLU A CB  1 
ATOM   701  C CG  . GLU A 1 92  ? -16.323 62.437 59.811 1.00 47.41  ? 92   GLU A CG  1 
ATOM   702  C CD  . GLU A 1 92  ? -17.068 61.101 59.840 1.00 47.41  ? 92   GLU A CD  1 
ATOM   703  O OE1 . GLU A 1 92  ? -18.271 61.076 60.198 1.00 47.41  ? 92   GLU A OE1 1 
ATOM   704  O OE2 . GLU A 1 92  ? -16.444 60.071 59.493 1.00 47.41  ? 92   GLU A OE2 1 
ATOM   705  N N   . ASP A 1 93  ? -16.552 66.059 56.718 1.00 39.72  ? 93   ASP A N   1 
ATOM   706  C CA  . ASP A 1 93  ? -16.627 66.648 55.378 1.00 39.72  ? 93   ASP A CA  1 
ATOM   707  C C   . ASP A 1 93  ? -15.409 67.570 55.323 1.00 39.72  ? 93   ASP A C   1 
ATOM   708  O O   . ASP A 1 93  ? -15.508 68.772 55.587 1.00 39.72  ? 93   ASP A O   1 
ATOM   709  C CB  . ASP A 1 93  ? -17.929 67.448 55.249 1.00 49.57  ? 93   ASP A CB  1 
ATOM   710  C CG  . ASP A 1 93  ? -18.055 68.168 53.916 1.00 49.57  ? 93   ASP A CG  1 
ATOM   711  O OD1 . ASP A 1 93  ? -17.189 67.970 53.023 1.00 49.57  ? 93   ASP A OD1 1 
ATOM   712  O OD2 . ASP A 1 93  ? -19.037 68.931 53.765 1.00 49.57  ? 93   ASP A OD2 1 
ATOM   713  N N   . CYS A 1 94  ? -14.265 66.992 54.963 1.00 44.40  ? 94   CYS A N   1 
ATOM   714  C CA  . CYS A 1 94  ? -12.985 67.697 54.966 1.00 44.40  ? 94   CYS A CA  1 
ATOM   715  C C   . CYS A 1 94  ? -12.154 67.676 53.698 1.00 44.40  ? 94   CYS A C   1 
ATOM   716  O O   . CYS A 1 94  ? -11.104 68.319 53.657 1.00 44.40  ? 94   CYS A O   1 
ATOM   717  C CB  . CYS A 1 94  ? -12.133 67.131 56.102 1.00 29.82  ? 94   CYS A CB  1 
ATOM   718  N N   . LEU A 1 95  ? -12.582 66.950 52.672 1.00 38.57  ? 95   LEU A N   1 
ATOM   719  C CA  . LEU A 1 95  ? -11.771 66.862 51.460 1.00 38.57  ? 95   LEU A CA  1 
ATOM   720  C C   . LEU A 1 95  ? -11.815 68.041 50.490 1.00 38.57  ? 95   LEU A C   1 
ATOM   721  O O   . LEU A 1 95  ? -12.525 68.011 49.491 1.00 38.57  ? 95   LEU A O   1 
ATOM   722  C CB  . LEU A 1 95  ? -12.091 65.560 50.726 1.00 28.02  ? 95   LEU A CB  1 
ATOM   723  C CG  . LEU A 1 95  ? -11.866 64.342 51.622 1.00 28.02  ? 95   LEU A CG  1 
ATOM   724  C CD1 . LEU A 1 95  ? -12.008 63.051 50.829 1.00 28.02  ? 95   LEU A CD1 1 
ATOM   725  C CD2 . LEU A 1 95  ? -10.478 64.432 52.240 1.00 28.02  ? 95   LEU A CD2 1 
ATOM   726  N N   . TYR A 1 96  ? -11.025 69.068 50.784 1.00 32.23  ? 96   TYR A N   1 
ATOM   727  C CA  . TYR A 1 96  ? -10.947 70.256 49.942 1.00 32.23  ? 96   TYR A CA  1 
ATOM   728  C C   . TYR A 1 96  ? -9.491  70.655 49.711 1.00 32.23  ? 96   TYR A C   1 
ATOM   729  O O   . TYR A 1 96  ? -8.599  70.200 50.418 1.00 32.23  ? 96   TYR A O   1 
ATOM   730  C CB  . TYR A 1 96  ? -11.678 71.431 50.599 1.00 36.28  ? 96   TYR A CB  1 
ATOM   731  C CG  . TYR A 1 96  ? -13.105 71.145 50.965 1.00 36.28  ? 96   TYR A CG  1 
ATOM   732  C CD1 . TYR A 1 96  ? -13.419 70.493 52.155 1.00 36.28  ? 96   TYR A CD1 1 
ATOM   733  C CD2 . TYR A 1 96  ? -14.141 71.495 50.109 1.00 36.28  ? 96   TYR A CD2 1 
ATOM   734  C CE1 . TYR A 1 96  ? -14.732 70.195 52.481 1.00 36.28  ? 96   TYR A CE1 1 
ATOM   735  C CE2 . TYR A 1 96  ? -15.456 71.201 50.423 1.00 36.28  ? 96   TYR A CE2 1 
ATOM   736  C CZ  . TYR A 1 96  ? -15.745 70.549 51.608 1.00 36.28  ? 96   TYR A CZ  1 
ATOM   737  O OH  . TYR A 1 96  ? -17.046 70.236 51.913 1.00 36.28  ? 96   TYR A OH  1 
ATOM   738  N N   . LEU A 1 97  ? -9.245  71.499 48.718 1.00 29.67  ? 97   LEU A N   1 
ATOM   739  C CA  . LEU A 1 97  ? -7.885  71.945 48.468 1.00 29.67  ? 97   LEU A CA  1 
ATOM   740  C C   . LEU A 1 97  ? -7.815  73.467 48.339 1.00 29.67  ? 97   LEU A C   1 
ATOM   741  O O   . LEU A 1 97  ? -8.816  74.124 48.103 1.00 29.67  ? 97   LEU A O   1 
ATOM   742  C CB  . LEU A 1 97  ? -7.303  71.239 47.234 1.00 29.81  ? 97   LEU A CB  1 
ATOM   743  C CG  . LEU A 1 97  ? -7.955  71.391 45.864 1.00 29.81  ? 97   LEU A CG  1 
ATOM   744  C CD1 . LEU A 1 97  ? -7.619  72.742 45.287 1.00 29.81  ? 97   LEU A CD1 1 
ATOM   745  C CD2 . LEU A 1 97  ? -7.457  70.291 44.941 1.00 29.81  ? 97   LEU A CD2 1 
ATOM   746  N N   . ASN A 1 98  ? -6.624  74.019 48.513 1.00 33.39  ? 98   ASN A N   1 
ATOM   747  C CA  . ASN A 1 98  ? -6.433  75.457 48.450 1.00 33.39  ? 98   ASN A CA  1 
ATOM   748  C C   . ASN A 1 98  ? -5.408  75.842 47.387 1.00 33.39  ? 98   ASN A C   1 
ATOM   749  O O   . ASN A 1 98  ? -4.366  75.198 47.263 1.00 33.39  ? 98   ASN A O   1 
ATOM   750  C CB  . ASN A 1 98  ? -5.984  75.963 49.818 1.00 41.02  ? 98   ASN A CB  1 
ATOM   751  C CG  . ASN A 1 98  ? -6.895  75.488 50.946 1.00 41.02  ? 98   ASN A CG  1 
ATOM   752  O OD1 . ASN A 1 98  ? -8.076  75.836 51.000 1.00 41.02  ? 98   ASN A OD1 1 
ATOM   753  N ND2 . ASN A 1 98  ? -6.345  74.685 51.852 1.00 41.02  ? 98   ASN A ND2 1 
ATOM   754  N N   . ILE A 1 99  ? -5.699  76.898 46.630 1.00 35.33  ? 99   ILE A N   1 
ATOM   755  C CA  . ILE A 1 99  ? -4.787  77.339 45.581 1.00 35.33  ? 99   ILE A CA  1 
ATOM   756  C C   . ILE A 1 99  ? -4.447  78.828 45.626 1.00 35.33  ? 99   ILE A C   1 
ATOM   757  O O   . ILE A 1 99  ? -5.331  79.674 45.676 1.00 35.33  ? 99   ILE A O   1 
ATOM   758  C CB  . ILE A 1 99  ? -5.351  77.049 44.173 1.00 31.34  ? 99   ILE A CB  1 
ATOM   759  C CG1 . ILE A 1 99  ? -5.828  75.597 44.068 1.00 31.34  ? 99   ILE A CG1 1 
ATOM   760  C CG2 . ILE A 1 99  ? -4.272  77.321 43.134 1.00 31.34  ? 99   ILE A CG2 1 
ATOM   761  C CD1 . ILE A 1 99  ? -6.472  75.257 42.717 1.00 31.34  ? 99   ILE A CD1 1 
ATOM   762  N N   . TRP A 1 100 ? -3.159  79.140 45.599 1.00 35.87  ? 100  TRP A N   1 
ATOM   763  C CA  . TRP A 1 100 ? -2.706  80.519 45.603 1.00 35.87  ? 100  TRP A CA  1 
ATOM   764  C C   . TRP A 1 100 ? -2.119  80.766 44.225 1.00 35.87  ? 100  TRP A C   1 
ATOM   765  O O   . TRP A 1 100 ? -1.183  80.081 43.814 1.00 35.87  ? 100  TRP A O   1 
ATOM   766  C CB  . TRP A 1 100 ? -1.659  80.724 46.697 1.00 32.43  ? 100  TRP A CB  1 
ATOM   767  C CG  . TRP A 1 100 ? -2.264  80.846 48.063 1.00 32.43  ? 100  TRP A CG  1 
ATOM   768  C CD1 . TRP A 1 100 ? -2.784  81.969 48.625 1.00 32.43  ? 100  TRP A CD1 1 
ATOM   769  C CD2 . TRP A 1 100 ? -2.439  79.800 49.025 1.00 32.43  ? 100  TRP A CD2 1 
ATOM   770  N NE1 . TRP A 1 100 ? -3.269  81.696 49.875 1.00 32.43  ? 100  TRP A NE1 1 
ATOM   771  C CE2 . TRP A 1 100 ? -3.070  80.370 50.149 1.00 32.43  ? 100  TRP A CE2 1 
ATOM   772  C CE3 . TRP A 1 100 ? -2.124  78.433 49.047 1.00 32.43  ? 100  TRP A CE3 1 
ATOM   773  C CZ2 . TRP A 1 100 ? -3.392  79.626 51.288 1.00 32.43  ? 100  TRP A CZ2 1 
ATOM   774  C CZ3 . TRP A 1 100 ? -2.447  77.687 50.186 1.00 32.43  ? 100  TRP A CZ3 1 
ATOM   775  C CH2 . TRP A 1 100 ? -3.072  78.290 51.288 1.00 32.43  ? 100  TRP A CH2 1 
ATOM   776  N N   . VAL A 1 101 ? -2.685  81.726 43.500 1.00 36.38  ? 101  VAL A N   1 
ATOM   777  C CA  . VAL A 1 101 ? -2.230  82.027 42.148 1.00 36.38  ? 101  VAL A CA  1 
ATOM   778  C C   . VAL A 1 101 ? -1.691  83.446 42.022 1.00 36.38  ? 101  VAL A C   1 
ATOM   779  O O   . VAL A 1 101 ? -2.296  84.400 42.510 1.00 36.38  ? 101  VAL A O   1 
ATOM   780  C CB  . VAL A 1 101 ? -3.380  81.867 41.124 1.00 28.12  ? 101  VAL A CB  1 
ATOM   781  C CG1 . VAL A 1 101 ? -2.834  81.966 39.711 1.00 28.12  ? 101  VAL A CG1 1 
ATOM   782  C CG2 . VAL A 1 101 ? -4.095  80.553 41.337 1.00 28.12  ? 101  VAL A CG2 1 
ATOM   783  N N   . PRO A 1 102 ? -0.533  83.598 41.368 1.00 45.13  ? 102  PRO A N   1 
ATOM   784  C CA  . PRO A 1 102 ? 0.093   84.907 41.170 1.00 45.13  ? 102  PRO A CA  1 
ATOM   785  C C   . PRO A 1 102 ? -0.817  85.870 40.396 1.00 45.13  ? 102  PRO A C   1 
ATOM   786  O O   . PRO A 1 102 ? -1.793  85.459 39.756 1.00 45.13  ? 102  PRO A O   1 
ATOM   787  C CB  . PRO A 1 102 ? 1.357   84.561 40.388 1.00 36.01  ? 102  PRO A CB  1 
ATOM   788  C CG  . PRO A 1 102 ? 1.716   83.217 40.925 1.00 36.01  ? 102  PRO A CG  1 
ATOM   789  C CD  . PRO A 1 102 ? 0.381   82.515 40.960 1.00 36.01  ? 102  PRO A CD  1 
ATOM   790  N N   . SER A 1 103 ? -0.497  87.157 40.458 1.00 51.91  ? 103  SER A N   1 
ATOM   791  C CA  . SER A 1 103 ? -1.288  88.161 39.749 1.00 51.91  ? 103  SER A CA  1 
ATOM   792  C C   . SER A 1 103 ? -0.343  89.117 39.053 1.00 51.91  ? 103  SER A C   1 
ATOM   793  O O   . SER A 1 103 ? 0.553   89.663 39.682 1.00 51.91  ? 103  SER A O   1 
ATOM   794  C CB  . SER A 1 103 ? -2.170  88.946 40.720 1.00 53.00  ? 103  SER A CB  1 
ATOM   795  O OG  . SER A 1 103 ? -2.942  89.902 40.012 1.00 53.00  ? 103  SER A OG  1 
ATOM   796  N N   . PRO A 1 104 ? -0.522  89.323 37.741 1.00 51.37  ? 104  PRO A N   1 
ATOM   797  C CA  . PRO A 1 104 ? -1.562  88.700 36.911 1.00 51.37  ? 104  PRO A CA  1 
ATOM   798  C C   . PRO A 1 104 ? -1.418  87.173 36.773 1.00 51.37  ? 104  PRO A C   1 
ATOM   799  O O   . PRO A 1 104 ? -0.314  86.631 36.869 1.00 51.37  ? 104  PRO A O   1 
ATOM   800  C CB  . PRO A 1 104 ? -1.406  89.428 35.576 1.00 41.89  ? 104  PRO A CB  1 
ATOM   801  C CG  . PRO A 1 104 ? 0.083   89.659 35.510 1.00 41.89  ? 104  PRO A CG  1 
ATOM   802  C CD  . PRO A 1 104 ? 0.392   90.137 36.916 1.00 41.89  ? 104  PRO A CD  1 
ATOM   803  N N   . ARG A 1 105 ? -2.546  86.501 36.542 1.00 42.32  ? 105  ARG A N   1 
ATOM   804  C CA  . ARG A 1 105 ? -2.603  85.041 36.390 1.00 42.32  ? 105  ARG A CA  1 
ATOM   805  C C   . ARG A 1 105 ? -1.627  84.548 35.333 1.00 42.32  ? 105  ARG A C   1 
ATOM   806  O O   . ARG A 1 105 ? -1.611  85.046 34.206 1.00 42.32  ? 105  ARG A O   1 
ATOM   807  C CB  . ARG A 1 105 ? -4.024  84.605 36.004 1.00 41.94  ? 105  ARG A CB  1 
ATOM   808  C CG  . ARG A 1 105 ? -4.221  83.100 35.915 1.00 41.94  ? 105  ARG A CG  1 
ATOM   809  C CD  . ARG A 1 105 ? -5.568  82.744 35.288 1.00 41.94  ? 105  ARG A CD  1 
ATOM   810  N NE  . ARG A 1 105 ? -6.706  83.203 36.082 1.00 41.94  ? 105  ARG A NE  1 
ATOM   811  C CZ  . ARG A 1 105 ? -7.976  83.087 35.696 1.00 41.94  ? 105  ARG A CZ  1 
ATOM   812  N NH1 . ARG A 1 105 ? -8.270  82.527 34.532 1.00 41.94  ? 105  ARG A NH1 1 
ATOM   813  N NH2 . ARG A 1 105 ? -8.954  83.545 36.462 1.00 41.94  ? 105  ARG A NH2 1 
ATOM   814  N N   . PRO A 1 106 ? -0.803  83.547 35.682 1.00 47.63  ? 106  PRO A N   1 
ATOM   815  C CA  . PRO A 1 106 ? 0.191   82.970 34.767 1.00 47.63  ? 106  PRO A CA  1 
ATOM   816  C C   . PRO A 1 106 ? -0.517  82.234 33.643 1.00 47.63  ? 106  PRO A C   1 
ATOM   817  O O   . PRO A 1 106 ? -1.731  82.017 33.698 1.00 47.63  ? 106  PRO A O   1 
ATOM   818  C CB  . PRO A 1 106 ? 0.965   81.991 35.654 1.00 42.06  ? 106  PRO A CB  1 
ATOM   819  C CG  . PRO A 1 106 ? 0.646   82.434 37.069 1.00 42.06  ? 106  PRO A CG  1 
ATOM   820  C CD  . PRO A 1 106 ? -0.789  82.844 36.974 1.00 42.06  ? 106  PRO A CD  1 
ATOM   821  N N   . LYS A 1 107 ? 0.239   81.845 32.625 1.00 54.71  ? 107  LYS A N   1 
ATOM   822  C CA  . LYS A 1 107 ? -0.324  81.096 31.514 1.00 54.71  ? 107  LYS A CA  1 
ATOM   823  C C   . LYS A 1 107 ? -0.009  79.621 31.737 1.00 54.71  ? 107  LYS A C   1 
ATOM   824  O O   . LYS A 1 107 ? -0.885  78.770 31.632 1.00 54.71  ? 107  LYS A O   1 
ATOM   825  C CB  . LYS A 1 107 ? 0.276   81.559 30.191 1.00 52.38  ? 107  LYS A CB  1 
ATOM   826  C CG  . LYS A 1 107 ? 0.042   83.029 29.909 1.00 52.38  ? 107  LYS A CG  1 
ATOM   827  C CD  . LYS A 1 107 ? -1.438  83.367 30.000 1.00 52.38  ? 107  LYS A CD  1 
ATOM   828  C CE  . LYS A 1 107 ? -1.686  84.864 29.831 1.00 52.38  ? 107  LYS A CE  1 
ATOM   829  N NZ  . LYS A 1 107 ? -3.144  85.171 29.948 1.00 52.38  ? 107  LYS A NZ  1 
ATOM   830  N N   . SER A 1 108 ? 1.239   79.315 32.069 1.00 52.88  ? 108  SER A N   1 
ATOM   831  C CA  . SER A 1 108 ? 1.613   77.928 32.292 1.00 52.88  ? 108  SER A CA  1 
ATOM   832  C C   . SER A 1 108 ? 2.851   77.860 33.174 1.00 52.88  ? 108  SER A C   1 
ATOM   833  O O   . SER A 1 108 ? 3.942   77.547 32.698 1.00 52.88  ? 108  SER A O   1 
ATOM   834  C CB  . SER A 1 108 ? 1.889   77.260 30.947 1.00 55.82  ? 108  SER A CB  1 
ATOM   835  O OG  . SER A 1 108 ? 2.094   75.866 31.106 1.00 55.82  ? 108  SER A OG  1 
ATOM   836  N N   . THR A 1 109 ? 2.685   78.142 34.458 1.00 39.35  ? 109  THR A N   1 
ATOM   837  C CA  . THR A 1 109 ? 3.819   78.137 35.361 1.00 39.35  ? 109  THR A CA  1 
ATOM   838  C C   . THR A 1 109 ? 3.921   76.906 36.274 1.00 39.35  ? 109  THR A C   1 
ATOM   839  O O   . THR A 1 109 ? 2.983   76.114 36.391 1.00 39.35  ? 109  THR A O   1 
ATOM   840  C CB  . THR A 1 109 ? 3.824   79.422 36.228 1.00 48.55  ? 109  THR A CB  1 
ATOM   841  O OG1 . THR A 1 109 ? 5.111   79.572 36.842 1.00 48.55  ? 109  THR A OG1 1 
ATOM   842  C CG2 . THR A 1 109 ? 2.767   79.352 37.327 1.00 48.55  ? 109  THR A CG2 1 
ATOM   843  N N   . THR A 1 110 ? 5.076   76.769 36.919 1.00 36.75  ? 110  THR A N   1 
ATOM   844  C CA  . THR A 1 110 ? 5.364   75.666 37.829 1.00 36.75  ? 110  THR A CA  1 
ATOM   845  C C   . THR A 1 110 ? 4.375   75.543 38.986 1.00 36.75  ? 110  THR A C   1 
ATOM   846  O O   . THR A 1 110 ? 3.976   76.540 39.586 1.00 36.75  ? 110  THR A O   1 
ATOM   847  C CB  . THR A 1 110 ? 6.755   75.822 38.418 1.00 43.88  ? 110  THR A CB  1 
ATOM   848  O OG1 . THR A 1 110 ? 7.696   75.969 37.349 1.00 43.88  ? 110  THR A OG1 1 
ATOM   849  C CG2 . THR A 1 110 ? 7.115   74.614 39.265 1.00 43.88  ? 110  THR A CG2 1 
ATOM   850  N N   . VAL A 1 111 ? 4.004   74.303 39.298 1.00 37.80  ? 111  VAL A N   1 
ATOM   851  C CA  . VAL A 1 111 ? 3.059   74.012 40.368 1.00 37.80  ? 111  VAL A CA  1 
ATOM   852  C C   . VAL A 1 111 ? 3.717   73.267 41.533 1.00 37.80  ? 111  VAL A C   1 
ATOM   853  O O   . VAL A 1 111 ? 4.583   72.412 41.331 1.00 37.80  ? 111  VAL A O   1 
ATOM   854  C CB  . VAL A 1 111 ? 1.891   73.152 39.834 1.00 30.53  ? 111  VAL A CB  1 
ATOM   855  C CG1 . VAL A 1 111 ? 0.876   72.883 40.941 1.00 30.53  ? 111  VAL A CG1 1 
ATOM   856  C CG2 . VAL A 1 111 ? 1.239   73.848 38.657 1.00 30.53  ? 111  VAL A CG2 1 
ATOM   857  N N   . MET A 1 112 ? 3.299   73.599 42.750 1.00 34.66  ? 112  MET A N   1 
ATOM   858  C CA  . MET A 1 112 ? 3.813   72.950 43.941 1.00 34.66  ? 112  MET A CA  1 
ATOM   859  C C   . MET A 1 112 ? 2.642   72.527 44.809 1.00 34.66  ? 112  MET A C   1 
ATOM   860  O O   . MET A 1 112 ? 1.830   73.359 45.217 1.00 34.66  ? 112  MET A O   1 
ATOM   861  C CB  . MET A 1 112 ? 4.739   73.891 44.702 1.00 38.58  ? 112  MET A CB  1 
ATOM   862  C CG  . MET A 1 112 ? 6.010   74.186 43.926 1.00 38.58  ? 112  MET A CG  1 
ATOM   863  S SD  . MET A 1 112 ? 7.217   75.178 44.798 1.00 38.58  ? 112  MET A SD  1 
ATOM   864  C CE  . MET A 1 112 ? 7.889   73.945 45.943 1.00 38.58  ? 112  MET A CE  1 
ATOM   865  N N   . VAL A 1 113 ? 2.533   71.223 45.056 1.00 30.81  ? 113  VAL A N   1 
ATOM   866  C CA  . VAL A 1 113 ? 1.457   70.695 45.878 1.00 30.81  ? 113  VAL A CA  1 
ATOM   867  C C   . VAL A 1 113 ? 2.026   70.264 47.225 1.00 30.81  ? 113  VAL A C   1 
ATOM   868  O O   . VAL A 1 113 ? 2.864   69.371 47.296 1.00 30.81  ? 113  VAL A O   1 
ATOM   869  C CB  . VAL A 1 113 ? 0.762   69.488 45.192 1.00 27.10  ? 113  VAL A CB  1 
ATOM   870  C CG1 . VAL A 1 113 ? -0.373  68.967 46.068 1.00 27.10  ? 113  VAL A CG1 1 
ATOM   871  C CG2 . VAL A 1 113 ? 0.234   69.901 43.822 1.00 27.10  ? 113  VAL A CG2 1 
ATOM   872  N N   . TRP A 1 114 ? 1.556   70.910 48.288 1.00 33.26  ? 114  TRP A N   1 
ATOM   873  C CA  . TRP A 1 114 ? 2.009   70.633 49.646 1.00 33.26  ? 114  TRP A CA  1 
ATOM   874  C C   . TRP A 1 114 ? 1.122   69.620 50.359 1.00 33.26  ? 114  TRP A C   1 
ATOM   875  O O   . TRP A 1 114 ? -0.101  69.705 50.290 1.00 33.26  ? 114  TRP A O   1 
ATOM   876  C CB  . TRP A 1 114 ? 2.070   71.953 50.442 1.00 30.88  ? 114  TRP A CB  1 
ATOM   877  C CG  . TRP A 1 114 ? 2.176   71.816 51.938 1.00 30.88  ? 114  TRP A CG  1 
ATOM   878  C CD1 . TRP A 1 114 ? 1.168   71.964 52.851 1.00 30.88  ? 114  TRP A CD1 1 
ATOM   879  C CD2 . TRP A 1 114 ? 3.355   71.512 52.693 1.00 30.88  ? 114  TRP A CD2 1 
ATOM   880  N NE1 . TRP A 1 114 ? 1.646   71.772 54.127 1.00 30.88  ? 114  TRP A NE1 1 
ATOM   881  C CE2 . TRP A 1 114 ? 2.986   71.493 54.059 1.00 30.88  ? 114  TRP A CE2 1 
ATOM   882  C CE3 . TRP A 1 114 ? 4.689   71.256 52.351 1.00 30.88  ? 114  TRP A CE3 1 
ATOM   883  C CZ2 . TRP A 1 114 ? 3.907   71.226 55.081 1.00 30.88  ? 114  TRP A CZ2 1 
ATOM   884  C CZ3 . TRP A 1 114 ? 5.606   70.991 53.371 1.00 30.88  ? 114  TRP A CZ3 1 
ATOM   885  C CH2 . TRP A 1 114 ? 5.209   70.979 54.715 1.00 30.88  ? 114  TRP A CH2 1 
ATOM   886  N N   . ILE A 1 115 ? 1.751   68.651 51.020 1.00 29.45  ? 115  ILE A N   1 
ATOM   887  C CA  . ILE A 1 115 ? 1.042   67.626 51.782 1.00 29.45  ? 115  ILE A CA  1 
ATOM   888  C C   . ILE A 1 115 ? 1.484   67.751 53.244 1.00 29.45  ? 115  ILE A C   1 
ATOM   889  O O   . ILE A 1 115 ? 2.633   67.461 53.576 1.00 29.45  ? 115  ILE A O   1 
ATOM   890  C CB  . ILE A 1 115 ? 1.374   66.212 51.266 1.00 31.70  ? 115  ILE A CB  1 
ATOM   891  C CG1 . ILE A 1 115 ? 1.161   66.150 49.748 1.00 31.70  ? 115  ILE A CG1 1 
ATOM   892  C CG2 . ILE A 1 115 ? 0.493   65.186 51.974 1.00 31.70  ? 115  ILE A CG2 1 
ATOM   893  C CD1 . ILE A 1 115 ? 1.379   64.777 49.113 1.00 31.70  ? 115  ILE A CD1 1 
ATOM   894  N N   . TYR A 1 116 ? 0.574   68.182 54.117 1.00 29.71  ? 116  TYR A N   1 
ATOM   895  C CA  . TYR A 1 116 ? 0.906   68.374 55.528 1.00 29.71  ? 116  TYR A CA  1 
ATOM   896  C C   . TYR A 1 116 ? 1.242   67.106 56.289 1.00 29.71  ? 116  TYR A C   1 
ATOM   897  O O   . TYR A 1 116 ? 0.816   66.010 55.921 1.00 29.71  ? 116  TYR A O   1 
ATOM   898  C CB  . TYR A 1 116 ? -0.214  69.135 56.263 1.00 32.37  ? 116  TYR A CB  1 
ATOM   899  C CG  . TYR A 1 116 ? -1.572  68.460 56.295 1.00 32.37  ? 116  TYR A CG  1 
ATOM   900  C CD1 . TYR A 1 116 ? -1.812  67.335 57.091 1.00 32.37  ? 116  TYR A CD1 1 
ATOM   901  C CD2 . TYR A 1 116 ? -2.621  68.950 55.527 1.00 32.37  ? 116  TYR A CD2 1 
ATOM   902  C CE1 . TYR A 1 116 ? -3.072  66.718 57.111 1.00 32.37  ? 116  TYR A CE1 1 
ATOM   903  C CE2 . TYR A 1 116 ? -3.874  68.349 55.540 1.00 32.37  ? 116  TYR A CE2 1 
ATOM   904  C CZ  . TYR A 1 116 ? -4.096  67.237 56.327 1.00 32.37  ? 116  TYR A CZ  1 
ATOM   905  O OH  . TYR A 1 116 ? -5.342  66.652 56.299 1.00 32.37  ? 116  TYR A OH  1 
ATOM   906  N N   . GLY A 1 117 ? 2.025   67.276 57.352 1.00 33.35  ? 117  GLY A N   1 
ATOM   907  C CA  . GLY A 1 117 ? 2.416   66.157 58.190 1.00 33.35  ? 117  GLY A CA  1 
ATOM   908  C C   . GLY A 1 117 ? 1.544   66.109 59.430 1.00 33.35  ? 117  GLY A C   1 
ATOM   909  O O   . GLY A 1 117 ? 0.571   66.848 59.530 1.00 33.35  ? 117  GLY A O   1 
ATOM   910  N N   . GLY A 1 118 ? 1.881   65.240 60.378 1.00 39.35  ? 118  GLY A N   1 
ATOM   911  C CA  . GLY A 1 118 ? 1.084   65.141 61.588 1.00 39.35  ? 118  GLY A CA  1 
ATOM   912  C C   . GLY A 1 118 ? 0.941   63.711 62.061 1.00 39.35  ? 118  GLY A C   1 
ATOM   913  O O   . GLY A 1 118 ? -0.048  63.364 62.707 1.00 39.35  ? 118  GLY A O   1 
ATOM   914  N N   . GLY A 1 119 ? 1.920   62.878 61.717 1.00 29.77  ? 119  GLY A N   1 
ATOM   915  C CA  . GLY A 1 119 ? 1.900   61.490 62.132 1.00 29.77  ? 119  GLY A CA  1 
ATOM   916  C C   . GLY A 1 119 ? 0.728   60.686 61.625 1.00 29.77  ? 119  GLY A C   1 
ATOM   917  O O   . GLY A 1 119 ? 0.399   59.650 62.193 1.00 29.77  ? 119  GLY A O   1 
ATOM   918  N N   . PHE A 1 120 ? 0.103   61.152 60.550 1.00 35.17  ? 120  PHE A N   1 
ATOM   919  C CA  . PHE A 1 120 ? -1.046  60.473 59.963 1.00 35.17  ? 120  PHE A CA  1 
ATOM   920  C C   . PHE A 1 120 ? -2.244  60.471 60.917 1.00 35.17  ? 120  PHE A C   1 
ATOM   921  O O   . PHE A 1 120 ? -3.238  59.791 60.663 1.00 35.17  ? 120  PHE A O   1 
ATOM   922  C CB  . PHE A 1 120 ? -0.695  59.024 59.576 1.00 25.11  ? 120  PHE A CB  1 
ATOM   923  C CG  . PHE A 1 120 ? 0.254   58.907 58.410 1.00 25.11  ? 120  PHE A CG  1 
ATOM   924  C CD1 . PHE A 1 120 ? -0.092  59.396 57.159 1.00 25.11  ? 120  PHE A CD1 1 
ATOM   925  C CD2 . PHE A 1 120 ? 1.498   58.303 58.567 1.00 25.11  ? 120  PHE A CD2 1 
ATOM   926  C CE1 . PHE A 1 120 ? 0.783   59.287 56.087 1.00 25.11  ? 120  PHE A CE1 1 
ATOM   927  C CE2 . PHE A 1 120 ? 2.379   58.192 57.494 1.00 25.11  ? 120  PHE A CE2 1 
ATOM   928  C CZ  . PHE A 1 120 ? 2.017   58.686 56.253 1.00 25.11  ? 120  PHE A CZ  1 
ATOM   929  N N   . TYR A 1 121 ? -2.158  61.228 62.007 1.00 33.29  ? 121  TYR A N   1 
ATOM   930  C CA  . TYR A 1 121 ? -3.267  61.291 62.959 1.00 33.29  ? 121  TYR A CA  1 
ATOM   931  C C   . TYR A 1 121 ? -3.761  62.716 63.182 1.00 33.29  ? 121  TYR A C   1 
ATOM   932  O O   . TYR A 1 121 ? -4.704  62.944 63.930 1.00 33.29  ? 121  TYR A O   1 
ATOM   933  C CB  . TYR A 1 121 ? -2.865  60.678 64.305 1.00 33.00  ? 121  TYR A CB  1 
ATOM   934  C CG  . TYR A 1 121 ? -1.909  61.513 65.123 1.00 33.00  ? 121  TYR A CG  1 
ATOM   935  C CD1 . TYR A 1 121 ? -2.368  62.560 65.927 1.00 33.00  ? 121  TYR A CD1 1 
ATOM   936  C CD2 . TYR A 1 121 ? -0.542  61.257 65.091 1.00 33.00  ? 121  TYR A CD2 1 
ATOM   937  C CE1 . TYR A 1 121 ? -1.481  63.331 66.683 1.00 33.00  ? 121  TYR A CE1 1 
ATOM   938  C CE2 . TYR A 1 121 ? 0.351   62.013 65.837 1.00 33.00  ? 121  TYR A CE2 1 
ATOM   939  C CZ  . TYR A 1 121 ? -0.119  63.048 66.636 1.00 33.00  ? 121  TYR A CZ  1 
ATOM   940  O OH  . TYR A 1 121 ? 0.792   63.769 67.393 1.00 33.00  ? 121  TYR A OH  1 
ATOM   941  N N   . SER A 1 122 ? -3.119  63.674 62.530 1.00 29.85  ? 122  SER A N   1 
ATOM   942  C CA  . SER A 1 122 ? -3.497  65.063 62.675 1.00 29.85  ? 122  SER A CA  1 
ATOM   943  C C   . SER A 1 122 ? -2.993  65.837 61.484 1.00 29.85  ? 122  SER A C   1 
ATOM   944  O O   . SER A 1 122 ? -2.370  65.269 60.602 1.00 29.85  ? 122  SER A O   1 
ATOM   945  C CB  . SER A 1 122 ? -2.884  65.627 63.942 1.00 41.40  ? 122  SER A CB  1 
ATOM   946  O OG  . SER A 1 122 ? -1.498  65.351 63.963 1.00 41.40  ? 122  SER A OG  1 
ATOM   947  N N   . GLY A 1 123 ? -3.261  67.135 61.473 1.00 33.56  ? 123  GLY A N   1 
ATOM   948  C CA  . GLY A 1 123 ? -2.827  67.976 60.374 1.00 33.56  ? 123  GLY A CA  1 
ATOM   949  C C   . GLY A 1 123 ? -3.968  68.736 59.727 1.00 33.56  ? 123  GLY A C   1 
ATOM   950  O O   . GLY A 1 123 ? -5.112  68.295 59.756 1.00 33.56  ? 123  GLY A O   1 
ATOM   951  N N   . SER A 1 124 ? -3.650  69.881 59.138 1.00 33.01  ? 124  SER A N   1 
ATOM   952  C CA  . SER A 1 124 ? -4.634  70.729 58.481 1.00 33.01  ? 124  SER A CA  1 
ATOM   953  C C   . SER A 1 124 ? -3.920  71.532 57.403 1.00 33.01  ? 124  SER A C   1 
ATOM   954  O O   . SER A 1 124 ? -2.741  71.840 57.536 1.00 33.01  ? 124  SER A O   1 
ATOM   955  C CB  . SER A 1 124 ? -5.247  71.695 59.487 1.00 41.52  ? 124  SER A CB  1 
ATOM   956  O OG  . SER A 1 124 ? -5.731  71.009 60.624 1.00 41.52  ? 124  SER A OG  1 
ATOM   957  N N   . SER A 1 125 ? -4.625  71.882 56.338 1.00 43.52  ? 125  SER A N   1 
ATOM   958  C CA  . SER A 1 125 ? -4.021  72.656 55.259 1.00 43.52  ? 125  SER A CA  1 
ATOM   959  C C   . SER A 1 125 ? -4.154  74.143 55.558 1.00 43.52  ? 125  SER A C   1 
ATOM   960  O O   . SER A 1 125 ? -3.526  74.987 54.913 1.00 43.52  ? 125  SER A O   1 
ATOM   961  C CB  . SER A 1 125 ? -4.735  72.356 53.938 1.00 39.08  ? 125  SER A CB  1 
ATOM   962  O OG  . SER A 1 125 ? -6.085  72.797 53.987 1.00 39.08  ? 125  SER A OG  1 
ATOM   963  N N   . THR A 1 126 ? -4.961  74.446 56.562 1.00 40.32  ? 126  THR A N   1 
ATOM   964  C CA  . THR A 1 126 ? -5.262  75.812 56.929 1.00 40.32  ? 126  THR A CA  1 
ATOM   965  C C   . THR A 1 126 ? -4.435  76.475 58.032 1.00 40.32  ? 126  THR A C   1 
ATOM   966  O O   . THR A 1 126 ? -4.738  77.596 58.436 1.00 40.32  ? 126  THR A O   1 
ATOM   967  C CB  . THR A 1 126 ? -6.739  75.887 57.299 1.00 38.77  ? 126  THR A CB  1 
ATOM   968  O OG1 . THR A 1 126 ? -6.992  75.020 58.412 1.00 38.77  ? 126  THR A OG1 1 
ATOM   969  C CG2 . THR A 1 126 ? -7.589  75.420 56.130 1.00 38.77  ? 126  THR A CG2 1 
ATOM   970  N N   . LEU A 1 127 ? -3.400  75.809 58.528 1.00 36.49  ? 127  LEU A N   1 
ATOM   971  C CA  . LEU A 1 127 ? -2.574  76.406 59.581 1.00 36.49  ? 127  LEU A CA  1 
ATOM   972  C C   . LEU A 1 127 ? -1.872  77.656 59.057 1.00 36.49  ? 127  LEU A C   1 
ATOM   973  O O   . LEU A 1 127 ? -1.603  77.766 57.861 1.00 36.49  ? 127  LEU A O   1 
ATOM   974  C CB  . LEU A 1 127 ? -1.515  75.415 60.058 1.00 37.97  ? 127  LEU A CB  1 
ATOM   975  C CG  . LEU A 1 127 ? -2.008  74.043 60.514 1.00 37.97  ? 127  LEU A CG  1 
ATOM   976  C CD1 . LEU A 1 127 ? -0.817  73.177 60.926 1.00 37.97  ? 127  LEU A CD1 1 
ATOM   977  C CD2 . LEU A 1 127 ? -2.991  74.215 61.669 1.00 37.97  ? 127  LEU A CD2 1 
ATOM   978  N N   . ASP A 1 128 ? -1.560  78.591 59.948 1.00 40.87  ? 128  ASP A N   1 
ATOM   979  C CA  . ASP A 1 128 ? -0.878  79.819 59.537 1.00 40.87  ? 128  ASP A CA  1 
ATOM   980  C C   . ASP A 1 128 ? 0.476   79.527 58.883 1.00 40.87  ? 128  ASP A C   1 
ATOM   981  O O   . ASP A 1 128 ? 0.843   80.173 57.906 1.00 40.87  ? 128  ASP A O   1 
ATOM   982  C CB  . ASP A 1 128 ? -0.679  80.764 60.731 1.00 66.36  ? 128  ASP A CB  1 
ATOM   983  C CG  . ASP A 1 128 ? -2.001  81.224 61.356 1.00 66.36  ? 128  ASP A CG  1 
ATOM   984  O OD1 . ASP A 1 128 ? -3.006  81.358 60.611 1.00 66.36  ? 128  ASP A OD1 1 
ATOM   985  O OD2 . ASP A 1 128 ? -2.032  81.469 62.592 1.00 66.36  ? 128  ASP A OD2 1 
ATOM   986  N N   . VAL A 1 129 ? 1.218   78.560 59.419 1.00 44.98  ? 129  VAL A N   1 
ATOM   987  C CA  . VAL A 1 129 ? 2.513   78.205 58.851 1.00 44.98  ? 129  VAL A CA  1 
ATOM   988  C C   . VAL A 1 129 ? 2.412   77.620 57.449 1.00 44.98  ? 129  VAL A C   1 
ATOM   989  O O   . VAL A 1 129 ? 3.435   77.456 56.781 1.00 44.98  ? 129  VAL A O   1 
ATOM   990  C CB  . VAL A 1 129 ? 3.269   77.163 59.709 1.00 39.52  ? 129  VAL A CB  1 
ATOM   991  C CG1 . VAL A 1 129 ? 4.153   77.853 60.695 1.00 39.52  ? 129  VAL A CG1 1 
ATOM   992  C CG2 . VAL A 1 129 ? 2.284   76.251 60.419 1.00 39.52  ? 129  VAL A CG2 1 
ATOM   993  N N   . TYR A 1 130 ? 1.204   77.284 57.002 1.00 38.73  ? 130  TYR A N   1 
ATOM   994  C CA  . TYR A 1 130 ? 1.054   76.711 55.663 1.00 38.73  ? 130  TYR A CA  1 
ATOM   995  C C   . TYR A 1 130 ? 0.415   77.666 54.665 1.00 38.73  ? 130  TYR A C   1 
ATOM   996  O O   . TYR A 1 130 ? -0.118  77.229 53.651 1.00 38.73  ? 130  TYR A O   1 
ATOM   997  C CB  . TYR A 1 130 ? 0.224   75.420 55.694 1.00 31.07  ? 130  TYR A CB  1 
ATOM   998  C CG  . TYR A 1 130 ? 0.772   74.309 56.562 1.00 31.07  ? 130  TYR A CG  1 
ATOM   999  C CD1 . TYR A 1 130 ? 2.142   74.141 56.755 1.00 31.07  ? 130  TYR A CD1 1 
ATOM   1000 C CD2 . TYR A 1 130 ? -0.089  73.410 57.178 1.00 31.07  ? 130  TYR A CD2 1 
ATOM   1001 C CE1 . TYR A 1 130 ? 2.633   73.105 57.549 1.00 31.07  ? 130  TYR A CE1 1 
ATOM   1002 C CE2 . TYR A 1 130 ? 0.388   72.374 57.963 1.00 31.07  ? 130  TYR A CE2 1 
ATOM   1003 C CZ  . TYR A 1 130 ? 1.742   72.225 58.149 1.00 31.07  ? 130  TYR A CZ  1 
ATOM   1004 O OH  . TYR A 1 130 ? 2.187   71.196 58.943 1.00 31.07  ? 130  TYR A OH  1 
ATOM   1005 N N   . ASN A 1 131 ? 0.464   78.965 54.949 1.00 47.56  ? 131  ASN A N   1 
ATOM   1006 C CA  . ASN A 1 131 ? -0.125  79.962 54.055 1.00 47.56  ? 131  ASN A CA  1 
ATOM   1007 C C   . ASN A 1 131 ? 0.729   80.066 52.798 1.00 47.56  ? 131  ASN A C   1 
ATOM   1008 O O   . ASN A 1 131 ? 1.838   80.606 52.830 1.00 47.56  ? 131  ASN A O   1 
ATOM   1009 C CB  . ASN A 1 131 ? -0.195  81.325 54.741 1.00 49.17  ? 131  ASN A CB  1 
ATOM   1010 C CG  . ASN A 1 131 ? -1.192  82.258 54.074 1.00 49.17  ? 131  ASN A CG  1 
ATOM   1011 O OD1 . ASN A 1 131 ? -1.344  82.251 52.843 1.00 49.17  ? 131  ASN A OD1 1 
ATOM   1012 N ND2 . ASN A 1 131 ? -1.873  83.075 54.882 1.00 49.17  ? 131  ASN A ND2 1 
ATOM   1013 N N   . GLY A 1 132 ? 0.201   79.558 51.691 1.00 32.86  ? 132  GLY A N   1 
ATOM   1014 C CA  . GLY A 1 132 ? 0.949   79.571 50.449 1.00 32.86  ? 132  GLY A CA  1 
ATOM   1015 C C   . GLY A 1 132 ? 1.149   80.905 49.760 1.00 32.86  ? 132  GLY A C   1 
ATOM   1016 O O   . GLY A 1 132 ? 1.929   80.994 48.810 1.00 32.86  ? 132  GLY A O   1 
ATOM   1017 N N   . LYS A 1 133 ? 0.478   81.948 50.237 1.00 44.50  ? 133  LYS A N   1 
ATOM   1018 C CA  . LYS A 1 133 ? 0.590   83.252 49.593 1.00 44.50  ? 133  LYS A CA  1 
ATOM   1019 C C   . LYS A 1 133 ? 1.996   83.835 49.488 1.00 44.50  ? 133  LYS A C   1 
ATOM   1020 O O   . LYS A 1 133 ? 2.347   84.399 48.448 1.00 44.50  ? 133  LYS A O   1 
ATOM   1021 C CB  . LYS A 1 133 ? -0.341  84.264 50.262 1.00 48.96  ? 133  LYS A CB  1 
ATOM   1022 C CG  . LYS A 1 133 ? 0.135   84.806 51.584 1.00 48.96  ? 133  LYS A CG  1 
ATOM   1023 C CD  . LYS A 1 133 ? -0.883  85.803 52.095 1.00 48.96  ? 133  LYS A CD  1 
ATOM   1024 C CE  . LYS A 1 133 ? -0.345  86.634 53.247 1.00 48.96  ? 133  LYS A CE  1 
ATOM   1025 N NZ  . LYS A 1 133 ? -1.347  87.664 53.685 1.00 48.96  ? 133  LYS A NZ  1 
ATOM   1026 N N   . TYR A 1 134 ? 2.802   83.699 50.536 1.00 39.37  ? 134  TYR A N   1 
ATOM   1027 C CA  . TYR A 1 134 ? 4.160   84.244 50.509 1.00 39.37  ? 134  TYR A CA  1 
ATOM   1028 C C   . TYR A 1 134 ? 5.014   83.577 49.444 1.00 39.37  ? 134  TYR A C   1 
ATOM   1029 O O   . TYR A 1 134 ? 5.714   84.242 48.681 1.00 39.37  ? 134  TYR A O   1 
ATOM   1030 C CB  . TYR A 1 134 ? 4.844   84.069 51.870 1.00 40.17  ? 134  TYR A CB  1 
ATOM   1031 C CG  . TYR A 1 134 ? 4.097   84.693 53.020 1.00 40.17  ? 134  TYR A CG  1 
ATOM   1032 C CD1 . TYR A 1 134 ? 3.982   86.084 53.135 1.00 40.17  ? 134  TYR A CD1 1 
ATOM   1033 C CD2 . TYR A 1 134 ? 3.461   83.897 53.970 1.00 40.17  ? 134  TYR A CD2 1 
ATOM   1034 C CE1 . TYR A 1 134 ? 3.247   86.666 54.171 1.00 40.17  ? 134  TYR A CE1 1 
ATOM   1035 C CE2 . TYR A 1 134 ? 2.717   84.465 55.012 1.00 40.17  ? 134  TYR A CE2 1 
ATOM   1036 C CZ  . TYR A 1 134 ? 2.615   85.850 55.104 1.00 40.17  ? 134  TYR A CZ  1 
ATOM   1037 O OH  . TYR A 1 134 ? 1.873   86.408 56.120 1.00 40.17  ? 134  TYR A OH  1 
ATOM   1038 N N   . LEU A 1 135 ? 4.952   82.254 49.394 1.00 40.06  ? 135  LEU A N   1 
ATOM   1039 C CA  . LEU A 1 135 ? 5.743   81.484 48.448 1.00 40.06  ? 135  LEU A CA  1 
ATOM   1040 C C   . LEU A 1 135 ? 5.264   81.681 47.010 1.00 40.06  ? 135  LEU A C   1 
ATOM   1041 O O   . LEU A 1 135 ? 6.072   81.847 46.095 1.00 40.06  ? 135  LEU A O   1 
ATOM   1042 C CB  . LEU A 1 135 ? 5.704   80.006 48.854 1.00 43.49  ? 135  LEU A CB  1 
ATOM   1043 C CG  . LEU A 1 135 ? 6.553   78.961 48.125 1.00 43.49  ? 135  LEU A CG  1 
ATOM   1044 C CD1 . LEU A 1 135 ? 8.021   79.378 48.096 1.00 43.49  ? 135  LEU A CD1 1 
ATOM   1045 C CD2 . LEU A 1 135 ? 6.390   77.621 48.847 1.00 43.49  ? 135  LEU A CD2 1 
ATOM   1046 N N   . ALA A 1 136 ? 3.949   81.673 46.810 1.00 49.03  ? 136  ALA A N   1 
ATOM   1047 C CA  . ALA A 1 136 ? 3.382   81.854 45.477 1.00 49.03  ? 136  ALA A CA  1 
ATOM   1048 C C   . ALA A 1 136 ? 3.767   83.233 44.966 1.00 49.03  ? 136  ALA A C   1 
ATOM   1049 O O   . ALA A 1 136 ? 4.098   83.415 43.791 1.00 49.03  ? 136  ALA A O   1 
ATOM   1050 C CB  . ALA A 1 136 ? 1.865   81.722 45.527 1.00 35.26  ? 136  ALA A CB  1 
ATOM   1051 N N   . TYR A 1 137 ? 3.726   84.207 45.864 1.00 47.75  ? 137  TYR A N   1 
ATOM   1052 C CA  . TYR A 1 137 ? 4.065   85.567 45.502 1.00 47.75  ? 137  TYR A CA  1 
ATOM   1053 C C   . TYR A 1 137 ? 5.545   85.724 45.192 1.00 47.75  ? 137  TYR A C   1 
ATOM   1054 O O   . TYR A 1 137 ? 5.910   86.140 44.100 1.00 47.75  ? 137  TYR A O   1 
ATOM   1055 C CB  . TYR A 1 137 ? 3.686   86.520 46.625 1.00 47.28  ? 137  TYR A CB  1 
ATOM   1056 C CG  . TYR A 1 137 ? 4.115   87.932 46.355 1.00 47.28  ? 137  TYR A CG  1 
ATOM   1057 C CD1 . TYR A 1 137 ? 3.530   88.675 45.326 1.00 47.28  ? 137  TYR A CD1 1 
ATOM   1058 C CD2 . TYR A 1 137 ? 5.121   88.530 47.114 1.00 47.28  ? 137  TYR A CD2 1 
ATOM   1059 C CE1 . TYR A 1 137 ? 3.936   89.989 45.061 1.00 47.28  ? 137  TYR A CE1 1 
ATOM   1060 C CE2 . TYR A 1 137 ? 5.539   89.837 46.862 1.00 47.28  ? 137  TYR A CE2 1 
ATOM   1061 C CZ  . TYR A 1 137 ? 4.942   90.558 45.837 1.00 47.28  ? 137  TYR A CZ  1 
ATOM   1062 O OH  . TYR A 1 137 ? 5.346   91.847 45.594 1.00 47.28  ? 137  TYR A OH  1 
ATOM   1063 N N   . THR A 1 138 ? 6.396   85.373 46.149 1.00 48.72  ? 138  THR A N   1 
ATOM   1064 C CA  . THR A 1 138 ? 7.836   85.528 45.981 1.00 48.72  ? 138  THR A CA  1 
ATOM   1065 C C   . THR A 1 138 ? 8.470   84.759 44.833 1.00 48.72  ? 138  THR A C   1 
ATOM   1066 O O   . THR A 1 138 ? 9.313   85.306 44.119 1.00 48.72  ? 138  THR A O   1 
ATOM   1067 C CB  . THR A 1 138 ? 8.590   85.163 47.276 1.00 40.30  ? 138  THR A CB  1 
ATOM   1068 O OG1 . THR A 1 138 ? 8.088   85.960 48.355 1.00 40.30  ? 138  THR A OG1 1 
ATOM   1069 C CG2 . THR A 1 138 ? 10.078  85.428 47.118 1.00 40.30  ? 138  THR A CG2 1 
ATOM   1070 N N   . GLU A 1 139 ? 8.076   83.504 44.640 1.00 52.11  ? 139  GLU A N   1 
ATOM   1071 C CA  . GLU A 1 139 ? 8.674   82.698 43.573 1.00 52.11  ? 139  GLU A CA  1 
ATOM   1072 C C   . GLU A 1 139 ? 7.826   82.574 42.299 1.00 52.11  ? 139  GLU A C   1 
ATOM   1073 O O   . GLU A 1 139 ? 8.251   81.945 41.323 1.00 52.11  ? 139  GLU A O   1 
ATOM   1074 C CB  . GLU A 1 139 ? 9.016   81.306 44.100 1.00 56.23  ? 139  GLU A CB  1 
ATOM   1075 C CG  . GLU A 1 139 ? 10.025  81.289 45.248 1.00 56.23  ? 139  GLU A CG  1 
ATOM   1076 C CD  . GLU A 1 139 ? 11.410  81.800 44.850 1.00 56.23  ? 139  GLU A CD  1 
ATOM   1077 O OE1 . GLU A 1 139 ? 11.973  81.318 43.838 1.00 56.23  ? 139  GLU A OE1 1 
ATOM   1078 O OE2 . GLU A 1 139 ? 11.949  82.680 45.558 1.00 56.23  ? 139  GLU A OE2 1 
ATOM   1079 N N   . GLU A 1 140 ? 6.632   83.164 42.303 1.00 48.23  ? 140  GLU A N   1 
ATOM   1080 C CA  . GLU A 1 140 ? 5.773   83.121 41.121 1.00 48.23  ? 140  GLU A CA  1 
ATOM   1081 C C   . GLU A 1 140 ? 5.430   81.696 40.696 1.00 48.23  ? 140  GLU A C   1 
ATOM   1082 O O   . GLU A 1 140 ? 5.708   81.283 39.564 1.00 48.23  ? 140  GLU A O   1 
ATOM   1083 C CB  . GLU A 1 140 ? 6.464   83.836 39.950 1.00 93.70  ? 140  GLU A CB  1 
ATOM   1084 C CG  . GLU A 1 140 ? 7.057   85.198 40.321 1.00 93.70  ? 140  GLU A CG  1 
ATOM   1085 C CD  . GLU A 1 140 ? 7.809   85.853 39.166 1.00 93.70  ? 140  GLU A CD  1 
ATOM   1086 O OE1 . GLU A 1 140 ? 7.140   86.199 38.159 1.00 93.70  ? 140  GLU A OE1 1 
ATOM   1087 O OE2 . GLU A 1 140 ? 9.061   86.019 39.269 1.00 93.70  ? 140  GLU A OE2 1 
ATOM   1088 N N   . VAL A 1 141 ? 4.837   80.938 41.606 1.00 33.78  ? 141  VAL A N   1 
ATOM   1089 C CA  . VAL A 1 141 ? 4.443   79.580 41.292 1.00 33.78  ? 141  VAL A CA  1 
ATOM   1090 C C   . VAL A 1 141 ? 3.012   79.422 41.772 1.00 33.78  ? 141  VAL A C   1 
ATOM   1091 O O   . VAL A 1 141 ? 2.547   80.198 42.605 1.00 33.78  ? 141  VAL A O   1 
ATOM   1092 C CB  . VAL A 1 141 ? 5.330   78.536 42.027 1.00 44.75  ? 141  VAL A CB  1 
ATOM   1093 C CG1 . VAL A 1 141 ? 6.804   78.780 41.726 1.00 44.75  ? 141  VAL A CG1 1 
ATOM   1094 C CG2 . VAL A 1 141 ? 5.082   78.589 43.530 1.00 44.75  ? 141  VAL A CG2 1 
ATOM   1095 N N   . VAL A 1 142 ? 2.305   78.439 41.230 1.00 33.40  ? 142  VAL A N   1 
ATOM   1096 C CA  . VAL A 1 142 ? 0.948   78.167 41.675 1.00 33.40  ? 142  VAL A CA  1 
ATOM   1097 C C   . VAL A 1 142 ? 1.131   77.209 42.855 1.00 33.40  ? 142  VAL A C   1 
ATOM   1098 O O   . VAL A 1 142 ? 1.728   76.153 42.705 1.00 33.40  ? 142  VAL A O   1 
ATOM   1099 C CB  . VAL A 1 142 ? 0.119   77.494 40.577 1.00 27.02  ? 142  VAL A CB  1 
ATOM   1100 C CG1 . VAL A 1 142 ? -1.146  76.918 41.161 1.00 27.02  ? 142  VAL A CG1 1 
ATOM   1101 C CG2 . VAL A 1 142 ? -0.225  78.505 39.515 1.00 27.02  ? 142  VAL A CG2 1 
ATOM   1102 N N   . LEU A 1 143 ? 0.633   77.592 44.025 1.00 35.13  ? 143  LEU A N   1 
ATOM   1103 C CA  . LEU A 1 143 ? 0.779   76.777 45.226 1.00 35.13  ? 143  LEU A CA  1 
ATOM   1104 C C   . LEU A 1 143 ? -0.532  76.100 45.623 1.00 35.13  ? 143  LEU A C   1 
ATOM   1105 O O   . LEU A 1 143 ? -1.561  76.758 45.803 1.00 35.13  ? 143  LEU A O   1 
ATOM   1106 C CB  . LEU A 1 143 ? 1.292   77.655 46.381 1.00 43.35  ? 143  LEU A CB  1 
ATOM   1107 C CG  . LEU A 1 143 ? 2.148   77.033 47.488 1.00 43.35  ? 143  LEU A CG  1 
ATOM   1108 C CD1 . LEU A 1 143 ? 1.373   75.983 48.248 1.00 43.35  ? 143  LEU A CD1 1 
ATOM   1109 C CD2 . LEU A 1 143 ? 3.387   76.418 46.874 1.00 43.35  ? 143  LEU A CD2 1 
ATOM   1110 N N   . VAL A 1 144 ? -0.484  74.778 45.763 1.00 32.24  ? 144  VAL A N   1 
ATOM   1111 C CA  . VAL A 1 144 ? -1.663  74.008 46.139 1.00 32.24  ? 144  VAL A CA  1 
ATOM   1112 C C   . VAL A 1 144 ? -1.439  73.239 47.432 1.00 32.24  ? 144  VAL A C   1 
ATOM   1113 O O   . VAL A 1 144 ? -0.390  72.623 47.624 1.00 32.24  ? 144  VAL A O   1 
ATOM   1114 C CB  . VAL A 1 144 ? -2.033  72.961 45.053 1.00 27.52  ? 144  VAL A CB  1 
ATOM   1115 C CG1 . VAL A 1 144 ? -3.256  72.167 45.483 1.00 27.52  ? 144  VAL A CG1 1 
ATOM   1116 C CG2 . VAL A 1 144 ? -2.281  73.640 43.724 1.00 27.52  ? 144  VAL A CG2 1 
ATOM   1117 N N   . SER A 1 145 ? -2.413  73.285 48.330 1.00 31.69  ? 145  SER A N   1 
ATOM   1118 C CA  . SER A 1 145 ? -2.302  72.501 49.546 1.00 31.69  ? 145  SER A CA  1 
ATOM   1119 C C   . SER A 1 145 ? -3.576  71.669 49.615 1.00 31.69  ? 145  SER A C   1 
ATOM   1120 O O   . SER A 1 145 ? -4.689  72.192 49.567 1.00 31.69  ? 145  SER A O   1 
ATOM   1121 C CB  . SER A 1 145 ? -2.146  73.381 50.788 1.00 34.97  ? 145  SER A CB  1 
ATOM   1122 O OG  . SER A 1 145 ? -3.309  74.135 51.048 1.00 34.97  ? 145  SER A OG  1 
ATOM   1123 N N   . LEU A 1 146 ? -3.413  70.358 49.691 1.00 36.22  ? 146  LEU A N   1 
ATOM   1124 C CA  . LEU A 1 146 ? -4.562  69.480 49.750 1.00 36.22  ? 146  LEU A CA  1 
ATOM   1125 C C   . LEU A 1 146 ? -4.816  69.051 51.184 1.00 36.22  ? 146  LEU A C   1 
ATOM   1126 O O   . LEU A 1 146 ? -4.145  69.492 52.098 1.00 36.22  ? 146  LEU A O   1 
ATOM   1127 C CB  . LEU A 1 146 ? -4.324  68.254 48.858 1.00 32.59  ? 146  LEU A CB  1 
ATOM   1128 C CG  . LEU A 1 146 ? -2.976  67.551 49.025 1.00 32.59  ? 146  LEU A CG  1 
ATOM   1129 C CD1 . LEU A 1 146 ? -2.939  66.807 50.345 1.00 32.59  ? 146  LEU A CD1 1 
ATOM   1130 C CD2 . LEU A 1 146 ? -2.754  66.587 47.882 1.00 32.59  ? 146  LEU A CD2 1 
ATOM   1131 N N   . SER A 1 147 ? -5.807  68.195 51.367 1.00 38.51  ? 147  SER A N   1 
ATOM   1132 C CA  . SER A 1 147 ? -6.125  67.681 52.678 1.00 38.51  ? 147  SER A CA  1 
ATOM   1133 C C   . SER A 1 147 ? -6.461  66.218 52.470 1.00 38.51  ? 147  SER A C   1 
ATOM   1134 O O   . SER A 1 147 ? -6.706  65.791 51.343 1.00 38.51  ? 147  SER A O   1 
ATOM   1135 C CB  . SER A 1 147 ? -7.300  68.440 53.293 1.00 49.44  ? 147  SER A CB  1 
ATOM   1136 O OG  . SER A 1 147 ? -8.438  68.381 52.461 1.00 49.44  ? 147  SER A OG  1 
ATOM   1137 N N   . TYR A 1 148 ? -6.444  65.450 53.550 1.00 33.87  ? 148  TYR A N   1 
ATOM   1138 C CA  . TYR A 1 148 ? -6.724  64.029 53.482 1.00 33.87  ? 148  TYR A CA  1 
ATOM   1139 C C   . TYR A 1 148 ? -7.134  63.568 54.864 1.00 33.87  ? 148  TYR A C   1 
ATOM   1140 O O   . TYR A 1 148 ? -6.786  64.202 55.854 1.00 33.87  ? 148  TYR A O   1 
ATOM   1141 C CB  . TYR A 1 148 ? -5.482  63.260 53.016 1.00 26.79  ? 148  TYR A CB  1 
ATOM   1142 C CG  . TYR A 1 148 ? -4.260  63.402 53.905 1.00 26.79  ? 148  TYR A CG  1 
ATOM   1143 C CD1 . TYR A 1 148 ? -3.377  64.466 53.760 1.00 26.79  ? 148  TYR A CD1 1 
ATOM   1144 C CD2 . TYR A 1 148 ? -3.987  62.457 54.891 1.00 26.79  ? 148  TYR A CD2 1 
ATOM   1145 C CE1 . TYR A 1 148 ? -2.250  64.581 54.570 1.00 26.79  ? 148  TYR A CE1 1 
ATOM   1146 C CE2 . TYR A 1 148 ? -2.865  62.563 55.711 1.00 26.79  ? 148  TYR A CE2 1 
ATOM   1147 C CZ  . TYR A 1 148 ? -2.000  63.622 55.546 1.00 26.79  ? 148  TYR A CZ  1 
ATOM   1148 O OH  . TYR A 1 148 ? -0.886  63.695 56.353 1.00 26.79  ? 148  TYR A OH  1 
ATOM   1149 N N   . ARG A 1 149 ? -7.876  62.473 54.937 1.00 33.42  ? 149  ARG A N   1 
ATOM   1150 C CA  . ARG A 1 149 ? -8.316  61.964 56.222 1.00 33.42  ? 149  ARG A CA  1 
ATOM   1151 C C   . ARG A 1 149 ? -7.167  61.370 57.031 1.00 33.42  ? 149  ARG A C   1 
ATOM   1152 O O   . ARG A 1 149 ? -6.280  60.726 56.481 1.00 33.42  ? 149  ARG A O   1 
ATOM   1153 C CB  . ARG A 1 149 ? -9.405  60.916 56.024 1.00 31.39  ? 149  ARG A CB  1 
ATOM   1154 C CG  . ARG A 1 149 ? -10.732 61.483 55.585 1.00 31.39  ? 149  ARG A CG  1 
ATOM   1155 C CD  . ARG A 1 149 ? -11.660 60.390 55.107 1.00 31.39  ? 149  ARG A CD  1 
ATOM   1156 N NE  . ARG A 1 149 ? -11.290 59.896 53.789 1.00 31.39  ? 149  ARG A NE  1 
ATOM   1157 C CZ  . ARG A 1 149 ? -11.855 58.847 53.198 1.00 31.39  ? 149  ARG A CZ  1 
ATOM   1158 N NH1 . ARG A 1 149 ? -12.817 58.172 53.817 1.00 31.39  ? 149  ARG A NH1 1 
ATOM   1159 N NH2 . ARG A 1 149 ? -11.472 58.484 51.978 1.00 31.39  ? 149  ARG A NH2 1 
ATOM   1160 N N   . VAL A 1 150 ? -7.197  61.601 58.341 1.00 36.38  ? 150  VAL A N   1 
ATOM   1161 C CA  . VAL A 1 150 ? -6.181  61.094 59.254 1.00 36.38  ? 150  VAL A CA  1 
ATOM   1162 C C   . VAL A 1 150 ? -6.814  60.207 60.330 1.00 36.38  ? 150  VAL A C   1 
ATOM   1163 O O   . VAL A 1 150 ? -8.041  60.069 60.401 1.00 36.38  ? 150  VAL A O   1 
ATOM   1164 C CB  . VAL A 1 150 ? -5.418  62.256 59.963 1.00 32.95  ? 150  VAL A CB  1 
ATOM   1165 C CG1 . VAL A 1 150 ? -4.723  63.121 58.936 1.00 32.95  ? 150  VAL A CG1 1 
ATOM   1166 C CG2 . VAL A 1 150 ? -6.378  63.091 60.808 1.00 32.95  ? 150  VAL A CG2 1 
ATOM   1167 N N   . GLY A 1 151 ? -5.968  59.617 61.173 1.00 33.15  ? 151  GLY A N   1 
ATOM   1168 C CA  . GLY A 1 151 ? -6.456  58.754 62.231 1.00 33.15  ? 151  GLY A CA  1 
ATOM   1169 C C   . GLY A 1 151 ? -7.219  57.571 61.667 1.00 33.15  ? 151  GLY A C   1 
ATOM   1170 O O   . GLY A 1 151 ? -7.015  57.180 60.524 1.00 33.15  ? 151  GLY A O   1 
ATOM   1171 N N   . ALA A 1 152 ? -8.107  56.994 62.465 1.00 35.41  ? 152  ALA A N   1 
ATOM   1172 C CA  . ALA A 1 152 ? -8.882  55.851 62.010 1.00 35.41  ? 152  ALA A CA  1 
ATOM   1173 C C   . ALA A 1 152 ? -9.707  56.182 60.758 1.00 35.41  ? 152  ALA A C   1 
ATOM   1174 O O   . ALA A 1 152 ? -9.945  55.322 59.914 1.00 35.41  ? 152  ALA A O   1 
ATOM   1175 C CB  . ALA A 1 152 ? -9.790  55.373 63.128 1.00 27.71  ? 152  ALA A CB  1 
ATOM   1176 N N   . PHE A 1 153 ? -10.122 57.436 60.636 1.00 33.70  ? 153  PHE A N   1 
ATOM   1177 C CA  . PHE A 1 153 ? -10.935 57.862 59.509 1.00 33.70  ? 153  PHE A CA  1 
ATOM   1178 C C   . PHE A 1 153 ? -10.258 57.684 58.163 1.00 33.70  ? 153  PHE A C   1 
ATOM   1179 O O   . PHE A 1 153 ? -10.931 57.489 57.153 1.00 33.70  ? 153  PHE A O   1 
ATOM   1180 C CB  . PHE A 1 153 ? -11.349 59.321 59.700 1.00 36.60  ? 153  PHE A CB  1 
ATOM   1181 C CG  . PHE A 1 153 ? -12.105 59.566 60.972 1.00 36.60  ? 153  PHE A CG  1 
ATOM   1182 C CD1 . PHE A 1 153 ? -13.442 59.181 61.090 1.00 36.60  ? 153  PHE A CD1 1 
ATOM   1183 C CD2 . PHE A 1 153 ? -11.472 60.146 62.073 1.00 36.60  ? 153  PHE A CD2 1 
ATOM   1184 C CE1 . PHE A 1 153 ? -14.137 59.367 62.281 1.00 36.60  ? 153  PHE A CE1 1 
ATOM   1185 C CE2 . PHE A 1 153 ? -12.160 60.338 63.275 1.00 36.60  ? 153  PHE A CE2 1 
ATOM   1186 C CZ  . PHE A 1 153 ? -13.495 59.947 63.379 1.00 36.60  ? 153  PHE A CZ  1 
ATOM   1187 N N   . GLY A 1 154 ? -8.931  57.745 58.143 1.00 31.58  ? 154  GLY A N   1 
ATOM   1188 C CA  . GLY A 1 154 ? -8.216  57.592 56.891 1.00 31.58  ? 154  GLY A CA  1 
ATOM   1189 C C   . GLY A 1 154 ? -7.301  56.382 56.819 1.00 31.58  ? 154  GLY A C   1 
ATOM   1190 O O   . GLY A 1 154 ? -6.734  56.094 55.757 1.00 31.58  ? 154  GLY A O   1 
ATOM   1191 N N   . PHE A 1 155 ? -7.174  55.645 57.922 1.00 29.51  ? 155  PHE A N   1 
ATOM   1192 C CA  . PHE A 1 155 ? -6.268  54.510 57.929 1.00 29.51  ? 155  PHE A CA  1 
ATOM   1193 C C   . PHE A 1 155 ? -6.714  53.208 58.593 1.00 29.51  ? 155  PHE A C   1 
ATOM   1194 O O   . PHE A 1 155 ? -5.916  52.275 58.735 1.00 29.51  ? 155  PHE A O   1 
ATOM   1195 C CB  . PHE A 1 155 ? -4.923  54.982 58.482 1.00 22.00  ? 155  PHE A CB  1 
ATOM   1196 C CG  . PHE A 1 155 ? -4.271  56.031 57.630 1.00 22.00  ? 155  PHE A CG  1 
ATOM   1197 C CD1 . PHE A 1 155 ? -3.640  55.683 56.442 1.00 22.00  ? 155  PHE A CD1 1 
ATOM   1198 C CD2 . PHE A 1 155 ? -4.377  57.372 57.956 1.00 22.00  ? 155  PHE A CD2 1 
ATOM   1199 C CE1 . PHE A 1 155 ? -3.130  56.656 55.590 1.00 22.00  ? 155  PHE A CE1 1 
ATOM   1200 C CE2 . PHE A 1 155 ? -3.876  58.348 57.116 1.00 22.00  ? 155  PHE A CE2 1 
ATOM   1201 C CZ  . PHE A 1 155 ? -3.250  57.990 55.925 1.00 22.00  ? 155  PHE A CZ  1 
ATOM   1202 N N   . LEU A 1 156 ? -7.983  53.130 58.988 1.00 36.92  ? 156  LEU A N   1 
ATOM   1203 C CA  . LEU A 1 156 ? -8.503  51.895 59.577 1.00 36.92  ? 156  LEU A CA  1 
ATOM   1204 C C   . LEU A 1 156 ? -8.312  50.856 58.477 1.00 36.92  ? 156  LEU A C   1 
ATOM   1205 O O   . LEU A 1 156 ? -8.730  51.069 57.345 1.00 36.92  ? 156  LEU A O   1 
ATOM   1206 C CB  . LEU A 1 156 ? -9.993  52.017 59.898 1.00 39.31  ? 156  LEU A CB  1 
ATOM   1207 C CG  . LEU A 1 156 ? -10.602 50.820 60.639 1.00 39.31  ? 156  LEU A CG  1 
ATOM   1208 C CD1 . LEU A 1 156 ? -10.123 50.838 62.079 1.00 39.31  ? 156  LEU A CD1 1 
ATOM   1209 C CD2 . LEU A 1 156 ? -12.122 50.893 60.612 1.00 39.31  ? 156  LEU A CD2 1 
ATOM   1210 N N   . ALA A 1 157 ? -7.681  49.737 58.797 1.00 40.36  ? 157  ALA A N   1 
ATOM   1211 C CA  . ALA A 1 157 ? -7.436  48.736 57.777 1.00 40.36  ? 157  ALA A CA  1 
ATOM   1212 C C   . ALA A 1 157 ? -7.877  47.310 58.115 1.00 40.36  ? 157  ALA A C   1 
ATOM   1213 O O   . ALA A 1 157 ? -7.336  46.670 59.023 1.00 40.36  ? 157  ALA A O   1 
ATOM   1214 C CB  . ALA A 1 157 ? -5.960  48.749 57.418 1.00 22.05  ? 157  ALA A CB  1 
ATOM   1215 N N   . LEU A 1 158 ? -8.869  46.825 57.371 1.00 43.05  ? 158  LEU A N   1 
ATOM   1216 C CA  . LEU A 1 158 ? -9.381  45.466 57.520 1.00 43.05  ? 158  LEU A CA  1 
ATOM   1217 C C   . LEU A 1 158 ? -9.219  44.841 56.145 1.00 43.05  ? 158  LEU A C   1 
ATOM   1218 O O   . LEU A 1 158 ? -10.190 44.659 55.412 1.00 43.05  ? 158  LEU A O   1 
ATOM   1219 C CB  . LEU A 1 158 ? -10.849 45.493 57.930 1.00 40.07  ? 158  LEU A CB  1 
ATOM   1220 C CG  . LEU A 1 158 ? -11.034 45.908 59.388 1.00 40.07  ? 158  LEU A CG  1 
ATOM   1221 C CD1 . LEU A 1 158 ? -12.510 46.080 59.725 1.00 40.07  ? 158  LEU A CD1 1 
ATOM   1222 C CD2 . LEU A 1 158 ? -10.390 44.844 60.271 1.00 40.07  ? 158  LEU A CD2 1 
ATOM   1223 N N   . HIS A 1 159 ? -7.974  44.543 55.791 1.00 51.91  ? 159  HIS A N   1 
ATOM   1224 C CA  . HIS A 1 159 ? -7.637  43.965 54.492 1.00 51.91  ? 159  HIS A CA  1 
ATOM   1225 C C   . HIS A 1 159 ? -8.607  42.863 54.143 1.00 51.91  ? 159  HIS A C   1 
ATOM   1226 O O   . HIS A 1 159 ? -9.087  42.152 55.030 1.00 51.91  ? 159  HIS A O   1 
ATOM   1227 C CB  . HIS A 1 159 ? -6.216  43.407 54.518 1.00 48.55  ? 159  HIS A CB  1 
ATOM   1228 C CG  . HIS A 1 159 ? -5.726  42.927 53.185 1.00 48.55  ? 159  HIS A CG  1 
ATOM   1229 N ND1 . HIS A 1 159 ? -5.558  43.769 52.104 1.00 48.55  ? 159  HIS A ND1 1 
ATOM   1230 C CD2 . HIS A 1 159 ? -5.326  41.698 52.773 1.00 48.55  ? 159  HIS A CD2 1 
ATOM   1231 C CE1 . HIS A 1 159 ? -5.069  43.081 51.087 1.00 48.55  ? 159  HIS A CE1 1 
ATOM   1232 N NE2 . HIS A 1 159 ? -4.918  41.823 51.467 1.00 48.55  ? 159  HIS A NE2 1 
ATOM   1233 N N   . GLY A 1 160 ? -8.910  42.722 52.855 1.00 60.29  ? 160  GLY A N   1 
ATOM   1234 C CA  . GLY A 1 160 ? -9.833  41.678 52.444 1.00 60.29  ? 160  GLY A CA  1 
ATOM   1235 C C   . GLY A 1 160 ? -11.264 42.156 52.258 1.00 60.29  ? 160  GLY A C   1 
ATOM   1236 O O   . GLY A 1 160 ? -12.073 41.460 51.638 1.00 60.29  ? 160  GLY A O   1 
ATOM   1237 N N   . SER A 1 161 ? -11.596 43.329 52.794 1.00 63.54  ? 161  SER A N   1 
ATOM   1238 C CA  . SER A 1 161 ? -12.949 43.862 52.640 1.00 63.54  ? 161  SER A CA  1 
ATOM   1239 C C   . SER A 1 161 ? -12.864 45.146 51.821 1.00 63.54  ? 161  SER A C   1 
ATOM   1240 O O   . SER A 1 161 ? -11.782 45.722 51.664 1.00 63.54  ? 161  SER A O   1 
ATOM   1241 C CB  . SER A 1 161 ? -13.571 44.182 53.997 1.00 71.53  ? 161  SER A CB  1 
ATOM   1242 O OG  . SER A 1 161 ? -13.353 45.546 54.329 1.00 71.53  ? 161  SER A OG  1 
ATOM   1243 N N   . GLN A 1 162 ? -13.996 45.602 51.300 1.00 55.22  ? 162  GLN A N   1 
ATOM   1244 C CA  . GLN A 1 162 ? -13.996 46.814 50.499 1.00 55.22  ? 162  GLN A CA  1 
ATOM   1245 C C   . GLN A 1 162 ? -14.579 47.980 51.275 1.00 55.22  ? 162  GLN A C   1 
ATOM   1246 O O   . GLN A 1 162 ? -14.588 49.111 50.791 1.00 55.22  ? 162  GLN A O   1 
ATOM   1247 C CB  . GLN A 1 162 ? -14.785 46.594 49.205 1.00 77.14  ? 162  GLN A CB  1 
ATOM   1248 C CG  . GLN A 1 162 ? -14.185 45.523 48.283 1.00 77.14  ? 162  GLN A CG  1 
ATOM   1249 C CD  . GLN A 1 162 ? -12.666 45.669 48.118 1.00 77.14  ? 162  GLN A CD  1 
ATOM   1250 O OE1 . GLN A 1 162 ? -12.125 46.790 48.133 1.00 77.14  ? 162  GLN A OE1 1 
ATOM   1251 N NE2 . GLN A 1 162 ? -11.971 44.535 47.942 1.00 77.14  ? 162  GLN A NE2 1 
ATOM   1252 N N   . GLU A 1 163 ? -15.057 47.701 52.485 1.00 52.30  ? 163  GLU A N   1 
ATOM   1253 C CA  . GLU A 1 163 ? -15.649 48.728 53.327 1.00 52.30  ? 163  GLU A CA  1 
ATOM   1254 C C   . GLU A 1 163 ? -14.634 49.563 54.123 1.00 52.30  ? 163  GLU A C   1 
ATOM   1255 O O   . GLU A 1 163 ? -14.936 50.686 54.547 1.00 52.30  ? 163  GLU A O   1 
ATOM   1256 C CB  . GLU A 1 163 ? -16.663 48.081 54.272 1.00 80.31  ? 163  GLU A CB  1 
ATOM   1257 C CG  . GLU A 1 163 ? -17.930 47.622 53.552 1.00 80.31  ? 163  GLU A CG  1 
ATOM   1258 C CD  . GLU A 1 163 ? -18.476 48.716 52.636 1.00 80.31  ? 163  GLU A CD  1 
ATOM   1259 O OE1 . GLU A 1 163 ? -18.641 49.869 53.115 1.00 80.31  ? 163  GLU A OE1 1 
ATOM   1260 O OE2 . GLU A 1 163 ? -18.736 48.428 51.437 1.00 80.31  ? 163  GLU A OE2 1 
ATOM   1261 N N   . ALA A 1 164 ? -13.441 49.010 54.329 1.00 50.55  ? 164  ALA A N   1 
ATOM   1262 C CA  . ALA A 1 164 ? -12.354 49.692 55.047 1.00 50.55  ? 164  ALA A CA  1 
ATOM   1263 C C   . ALA A 1 164 ? -11.081 48.993 54.591 1.00 50.55  ? 164  ALA A C   1 
ATOM   1264 O O   . ALA A 1 164 ? -10.397 48.334 55.374 1.00 50.55  ? 164  ALA A O   1 
ATOM   1265 C CB  . ALA A 1 164 ? -12.531 49.552 56.567 1.00 26.16  ? 164  ALA A CB  1 
ATOM   1266 N N   . PRO A 1 165 ? -10.752 49.130 53.300 1.00 47.21  ? 165  PRO A N   1 
ATOM   1267 C CA  . PRO A 1 165 ? -9.570  48.511 52.702 1.00 47.21  ? 165  PRO A CA  1 
ATOM   1268 C C   . PRO A 1 165 ? -8.250  48.981 53.282 1.00 47.21  ? 165  PRO A C   1 
ATOM   1269 O O   . PRO A 1 165 ? -7.273  48.234 53.299 1.00 47.21  ? 165  PRO A O   1 
ATOM   1270 C CB  . PRO A 1 165 ? -9.718  48.859 51.220 1.00 30.01  ? 165  PRO A CB  1 
ATOM   1271 C CG  . PRO A 1 165 ? -10.359 50.199 51.264 1.00 30.01  ? 165  PRO A CG  1 
ATOM   1272 C CD  . PRO A 1 165 ? -11.404 50.046 52.345 1.00 30.01  ? 165  PRO A CD  1 
ATOM   1273 N N   . GLY A 1 166 ? -8.229  50.212 53.771 1.00 39.83  ? 166  GLY A N   1 
ATOM   1274 C CA  . GLY A 1 166 ? -7.003  50.763 54.313 1.00 39.83  ? 166  GLY A CA  1 
ATOM   1275 C C   . GLY A 1 166 ? -6.441  51.758 53.312 1.00 39.83  ? 166  GLY A C   1 
ATOM   1276 O O   . GLY A 1 166 ? -6.917  51.844 52.179 1.00 39.83  ? 166  GLY A O   1 
ATOM   1277 N N   . ASN A 1 167 ? -5.448  52.524 53.742 1.00 35.97  ? 167  ASN A N   1 
ATOM   1278 C CA  . ASN A 1 167 ? -4.802  53.515 52.897 1.00 35.97  ? 167  ASN A CA  1 
ATOM   1279 C C   . ASN A 1 167 ? -5.738  54.507 52.220 1.00 35.97  ? 167  ASN A C   1 
ATOM   1280 O O   . ASN A 1 167 ? -5.324  55.224 51.318 1.00 35.97  ? 167  ASN A O   1 
ATOM   1281 C CB  . ASN A 1 167 ? -3.951  52.815 51.830 1.00 34.15  ? 167  ASN A CB  1 
ATOM   1282 C CG  . ASN A 1 167 ? -2.858  51.947 52.436 1.00 34.15  ? 167  ASN A CG  1 
ATOM   1283 O OD1 . ASN A 1 167 ? -2.262  52.305 53.446 1.00 34.15  ? 167  ASN A OD1 1 
ATOM   1284 N ND2 . ASN A 1 167 ? -2.583  50.812 51.813 1.00 34.15  ? 167  ASN A ND2 1 
ATOM   1285 N N   . VAL A 1 168 ? -6.988  54.583 52.650 1.00 36.73  ? 168  VAL A N   1 
ATOM   1286 C CA  . VAL A 1 168 ? -7.894  55.507 51.985 1.00 36.73  ? 168  VAL A CA  1 
ATOM   1287 C C   . VAL A 1 168 ? -7.420  56.948 52.145 1.00 36.73  ? 168  VAL A C   1 
ATOM   1288 O O   . VAL A 1 168 ? -7.740  57.812 51.332 1.00 36.73  ? 168  VAL A O   1 
ATOM   1289 C CB  . VAL A 1 168 ? -9.378  55.334 52.475 1.00 31.51  ? 168  VAL A CB  1 
ATOM   1290 C CG1 . VAL A 1 168 ? -9.774  53.863 52.384 1.00 31.51  ? 168  VAL A CG1 1 
ATOM   1291 C CG2 . VAL A 1 168 ? -9.562  55.867 53.879 1.00 31.51  ? 168  VAL A CG2 1 
ATOM   1292 N N   . GLY A 1 169 ? -6.635  57.202 53.183 1.00 30.71  ? 169  GLY A N   1 
ATOM   1293 C CA  . GLY A 1 169 ? -6.114  58.542 53.387 1.00 30.71  ? 169  GLY A CA  1 
ATOM   1294 C C   . GLY A 1 169 ? -5.137  58.903 52.280 1.00 30.71  ? 169  GLY A C   1 
ATOM   1295 O O   . GLY A 1 169 ? -5.038  60.065 51.898 1.00 30.71  ? 169  GLY A O   1 
ATOM   1296 N N   . LEU A 1 170 ? -4.411  57.906 51.768 1.00 28.09  ? 170  LEU A N   1 
ATOM   1297 C CA  . LEU A 1 170 ? -3.458  58.137 50.694 1.00 28.09  ? 170  LEU A CA  1 
ATOM   1298 C C   . LEU A 1 170 ? -4.213  58.291 49.381 1.00 28.09  ? 170  LEU A C   1 
ATOM   1299 O O   . LEU A 1 170 ? -3.808  59.073 48.514 1.00 28.09  ? 170  LEU A O   1 
ATOM   1300 C CB  . LEU A 1 170 ? -2.445  56.994 50.601 1.00 24.23  ? 170  LEU A CB  1 
ATOM   1301 C CG  . LEU A 1 170 ? -1.448  56.906 51.765 1.00 24.23  ? 170  LEU A CG  1 
ATOM   1302 C CD1 . LEU A 1 170 ? -0.535  55.722 51.573 1.00 24.23  ? 170  LEU A CD1 1 
ATOM   1303 C CD2 . LEU A 1 170 ? -0.629  58.172 51.851 1.00 24.23  ? 170  LEU A CD2 1 
ATOM   1304 N N   . LEU A 1 171 ? -5.318  57.557 49.237 1.00 36.65  ? 171  LEU A N   1 
ATOM   1305 C CA  . LEU A 1 171 ? -6.118  57.676 48.026 1.00 36.65  ? 171  LEU A CA  1 
ATOM   1306 C C   . LEU A 1 171 ? -6.703  59.082 47.964 1.00 36.65  ? 171  LEU A C   1 
ATOM   1307 O O   . LEU A 1 171 ? -6.906  59.621 46.880 1.00 36.65  ? 171  LEU A O   1 
ATOM   1308 C CB  . LEU A 1 171 ? -7.229  56.632 47.996 1.00 34.99  ? 171  LEU A CB  1 
ATOM   1309 C CG  . LEU A 1 171 ? -6.740  55.187 47.872 1.00 34.99  ? 171  LEU A CG  1 
ATOM   1310 C CD1 . LEU A 1 171 ? -7.939  54.291 47.721 1.00 34.99  ? 171  LEU A CD1 1 
ATOM   1311 C CD2 . LEU A 1 171 ? -5.812  55.023 46.679 1.00 34.99  ? 171  LEU A CD2 1 
ATOM   1312 N N   . ASP A 1 172 ? -6.967  59.675 49.132 1.00 39.55  ? 172  ASP A N   1 
ATOM   1313 C CA  . ASP A 1 172 ? -7.481  61.043 49.205 1.00 39.55  ? 172  ASP A CA  1 
ATOM   1314 C C   . ASP A 1 172 ? -6.456  61.972 48.541 1.00 39.55  ? 172  ASP A C   1 
ATOM   1315 O O   . ASP A 1 172 ? -6.797  62.787 47.683 1.00 39.55  ? 172  ASP A O   1 
ATOM   1316 C CB  . ASP A 1 172 ? -7.664  61.501 50.666 1.00 46.11  ? 172  ASP A CB  1 
ATOM   1317 C CG  . ASP A 1 172 ? -8.930  60.947 51.326 1.00 46.11  ? 172  ASP A CG  1 
ATOM   1318 O OD1 . ASP A 1 172 ? -9.826  60.458 50.600 1.00 46.11  ? 172  ASP A OD1 1 
ATOM   1319 O OD2 . ASP A 1 172 ? -9.033  61.023 52.576 1.00 46.11  ? 172  ASP A OD2 1 
ATOM   1320 N N   . GLN A 1 173 ? -5.198  61.850 48.951 1.00 37.20  ? 173  GLN A N   1 
ATOM   1321 C CA  . GLN A 1 173 ? -4.132  62.691 48.408 1.00 37.20  ? 173  GLN A CA  1 
ATOM   1322 C C   . GLN A 1 173 ? -4.001  62.467 46.914 1.00 37.20  ? 173  GLN A C   1 
ATOM   1323 O O   . GLN A 1 173 ? -3.812  63.410 46.149 1.00 37.20  ? 173  GLN A O   1 
ATOM   1324 C CB  . GLN A 1 173 ? -2.794  62.367 49.070 1.00 28.23  ? 173  GLN A CB  1 
ATOM   1325 C CG  . GLN A 1 173 ? -2.757  62.545 50.562 1.00 28.23  ? 173  GLN A CG  1 
ATOM   1326 C CD  . GLN A 1 173 ? -1.507  61.938 51.159 1.00 28.23  ? 173  GLN A CD  1 
ATOM   1327 O OE1 . GLN A 1 173 ? -0.642  61.438 50.440 1.00 28.23  ? 173  GLN A OE1 1 
ATOM   1328 N NE2 . GLN A 1 173 ? -1.405  61.974 52.481 1.00 28.23  ? 173  GLN A NE2 1 
ATOM   1329 N N   . ARG A 1 174 ? -4.094  61.208 46.505 1.00 34.30  ? 174  ARG A N   1 
ATOM   1330 C CA  . ARG A 1 174 ? -3.978  60.869 45.099 1.00 34.30  ? 174  ARG A CA  1 
ATOM   1331 C C   . ARG A 1 174 ? -5.102  61.506 44.310 1.00 34.30  ? 174  ARG A C   1 
ATOM   1332 O O   . ARG A 1 174 ? -4.912  61.914 43.170 1.00 34.30  ? 174  ARG A O   1 
ATOM   1333 C CB  . ARG A 1 174 ? -4.015  59.355 44.887 1.00 38.76  ? 174  ARG A CB  1 
ATOM   1334 C CG  . ARG A 1 174 ? -4.054  58.994 43.417 1.00 38.76  ? 174  ARG A CG  1 
ATOM   1335 C CD  . ARG A 1 174 ? -4.188  57.509 43.194 1.00 38.76  ? 174  ARG A CD  1 
ATOM   1336 N NE  . ARG A 1 174 ? -2.992  56.804 43.620 1.00 38.76  ? 174  ARG A NE  1 
ATOM   1337 C CZ  . ARG A 1 174 ? -2.917  55.489 43.750 1.00 38.76  ? 174  ARG A CZ  1 
ATOM   1338 N NH1 . ARG A 1 174 ? -3.974  54.737 43.486 1.00 38.76  ? 174  ARG A NH1 1 
ATOM   1339 N NH2 . ARG A 1 174 ? -1.784  54.932 44.143 1.00 38.76  ? 174  ARG A NH2 1 
ATOM   1340 N N   . MET A 1 175 ? -6.273  61.598 44.917 1.00 32.64  ? 175  MET A N   1 
ATOM   1341 C CA  . MET A 1 175 ? -7.389  62.180 44.207 1.00 32.64  ? 175  MET A CA  1 
ATOM   1342 C C   . MET A 1 175 ? -7.200  63.667 44.057 1.00 32.64  ? 175  MET A C   1 
ATOM   1343 O O   . MET A 1 175 ? -7.540  64.241 43.026 1.00 32.64  ? 175  MET A O   1 
ATOM   1344 C CB  . MET A 1 175 ? -8.709  61.895 44.910 1.00 54.43  ? 175  MET A CB  1 
ATOM   1345 C CG  . MET A 1 175 ? -9.879  62.151 43.985 1.00 54.43  ? 175  MET A CG  1 
ATOM   1346 S SD  . MET A 1 175 ? -11.435 61.646 44.649 1.00 54.43  ? 175  MET A SD  1 
ATOM   1347 C CE  . MET A 1 175 ? -11.408 59.878 44.270 1.00 54.43  ? 175  MET A CE  1 
ATOM   1348 N N   . ALA A 1 176 ? -6.657  64.291 45.094 1.00 36.15  ? 176  ALA A N   1 
ATOM   1349 C CA  . ALA A 1 176 ? -6.397  65.712 45.048 1.00 36.15  ? 176  ALA A CA  1 
ATOM   1350 C C   . ALA A 1 176 ? -5.382  65.950 43.928 1.00 36.15  ? 176  ALA A C   1 
ATOM   1351 O O   . ALA A 1 176 ? -5.503  66.917 43.176 1.00 36.15  ? 176  ALA A O   1 
ATOM   1352 C CB  . ALA A 1 176 ? -5.851  66.185 46.379 1.00 29.37  ? 176  ALA A CB  1 
ATOM   1353 N N   . LEU A 1 177 ? -4.391  65.066 43.809 1.00 30.52  ? 177  LEU A N   1 
ATOM   1354 C CA  . LEU A 1 177 ? -3.383  65.207 42.756 1.00 30.52  ? 177  LEU A CA  1 
ATOM   1355 C C   . LEU A 1 177 ? -3.993  64.976 41.377 1.00 30.52  ? 177  LEU A C   1 
ATOM   1356 O O   . LEU A 1 177 ? -3.582  65.588 40.395 1.00 30.52  ? 177  LEU A O   1 
ATOM   1357 C CB  . LEU A 1 177 ? -2.221  64.230 42.969 1.00 39.41  ? 177  LEU A CB  1 
ATOM   1358 C CG  . LEU A 1 177 ? -1.279  64.516 44.146 1.00 39.41  ? 177  LEU A CG  1 
ATOM   1359 C CD1 . LEU A 1 177 ? -0.339  63.333 44.353 1.00 39.41  ? 177  LEU A CD1 1 
ATOM   1360 C CD2 . LEU A 1 177 ? -0.491  65.790 43.891 1.00 39.41  ? 177  LEU A CD2 1 
ATOM   1361 N N   . GLN A 1 178 ? -4.976  64.087 41.305 1.00 33.97  ? 178  GLN A N   1 
ATOM   1362 C CA  . GLN A 1 178 ? -5.648  63.797 40.042 1.00 33.97  ? 178  GLN A CA  1 
ATOM   1363 C C   . GLN A 1 178 ? -6.380  65.054 39.578 1.00 33.97  ? 178  GLN A C   1 
ATOM   1364 O O   . GLN A 1 178 ? -6.404  65.368 38.396 1.00 33.97  ? 178  GLN A O   1 
ATOM   1365 C CB  . GLN A 1 178 ? -6.641  62.638 40.220 1.00 42.60  ? 178  GLN A CB  1 
ATOM   1366 C CG  . GLN A 1 178 ? -7.359  62.179 38.948 1.00 42.60  ? 178  GLN A CG  1 
ATOM   1367 C CD  . GLN A 1 178 ? -6.412  61.587 37.920 1.00 42.60  ? 178  GLN A CD  1 
ATOM   1368 O OE1 . GLN A 1 178 ? -5.709  60.612 38.198 1.00 42.60  ? 178  GLN A OE1 1 
ATOM   1369 N NE2 . GLN A 1 178 ? -6.386  62.175 36.725 1.00 42.60  ? 178  GLN A NE2 1 
ATOM   1370 N N   . TRP A 1 179 ? -6.967  65.779 40.518 1.00 33.80  ? 179  TRP A N   1 
ATOM   1371 C CA  . TRP A 1 179 ? -7.685  67.002 40.187 1.00 33.80  ? 179  TRP A CA  1 
ATOM   1372 C C   . TRP A 1 179 ? -6.691  68.068 39.709 1.00 33.80  ? 179  TRP A C   1 
ATOM   1373 O O   . TRP A 1 179 ? -6.951  68.767 38.737 1.00 33.80  ? 179  TRP A O   1 
ATOM   1374 C CB  . TRP A 1 179 ? -8.444  67.495 41.408 1.00 30.02  ? 179  TRP A CB  1 
ATOM   1375 C CG  . TRP A 1 179 ? -9.535  68.441 41.106 1.00 30.02  ? 179  TRP A CG  1 
ATOM   1376 C CD1 . TRP A 1 179 ? -10.825 68.133 40.792 1.00 30.02  ? 179  TRP A CD1 1 
ATOM   1377 C CD2 . TRP A 1 179 ? -9.450  69.867 41.110 1.00 30.02  ? 179  TRP A CD2 1 
ATOM   1378 N NE1 . TRP A 1 179 ? -11.553 69.284 40.602 1.00 30.02  ? 179  TRP A NE1 1 
ATOM   1379 C CE2 . TRP A 1 179 ? -10.731 70.363 40.791 1.00 30.02  ? 179  TRP A CE2 1 
ATOM   1380 C CE3 . TRP A 1 179 ? -8.415  70.773 41.352 1.00 30.02  ? 179  TRP A CE3 1 
ATOM   1381 C CZ2 . TRP A 1 179 ? -11.005 71.726 40.709 1.00 30.02  ? 179  TRP A CZ2 1 
ATOM   1382 C CZ3 . TRP A 1 179 ? -8.689  72.133 41.268 1.00 30.02  ? 179  TRP A CZ3 1 
ATOM   1383 C CH2 . TRP A 1 179 ? -9.975  72.593 40.949 1.00 30.02  ? 179  TRP A CH2 1 
ATOM   1384 N N   . VAL A 1 180 ? -5.554  68.187 40.391 1.00 38.98  ? 180  VAL A N   1 
ATOM   1385 C CA  . VAL A 1 180 ? -4.534  69.153 39.997 1.00 38.98  ? 180  VAL A CA  1 
ATOM   1386 C C   . VAL A 1 180 ? -4.072  68.803 38.582 1.00 38.98  ? 180  VAL A C   1 
ATOM   1387 O O   . VAL A 1 180 ? -3.823  69.675 37.751 1.00 38.98  ? 180  VAL A O   1 
ATOM   1388 C CB  . VAL A 1 180 ? -3.306  69.108 40.946 1.00 26.90  ? 180  VAL A CB  1 
ATOM   1389 C CG1 . VAL A 1 180 ? -2.157  69.934 40.382 1.00 26.90  ? 180  VAL A CG1 1 
ATOM   1390 C CG2 . VAL A 1 180 ? -3.693  69.630 42.302 1.00 26.90  ? 180  VAL A CG2 1 
ATOM   1391 N N   . HIS A 1 181 ? -3.966  67.515 38.303 1.00 37.65  ? 181  HIS A N   1 
ATOM   1392 C CA  . HIS A 1 181 ? -3.533  67.097 36.995 1.00 37.65  ? 181  HIS A CA  1 
ATOM   1393 C C   . HIS A 1 181 ? -4.553  67.445 35.917 1.00 37.65  ? 181  HIS A C   1 
ATOM   1394 O O   . HIS A 1 181 ? -4.179  67.838 34.818 1.00 37.65  ? 181  HIS A O   1 
ATOM   1395 C CB  . HIS A 1 181 ? -3.258  65.599 36.999 1.00 45.23  ? 181  HIS A CB  1 
ATOM   1396 C CG  . HIS A 1 181 ? -2.748  65.088 35.693 1.00 45.23  ? 181  HIS A CG  1 
ATOM   1397 N ND1 . HIS A 1 181 ? -3.586  64.701 34.669 1.00 45.23  ? 181  HIS A ND1 1 
ATOM   1398 C CD2 . HIS A 1 181 ? -1.488  64.963 35.220 1.00 45.23  ? 181  HIS A CD2 1 
ATOM   1399 C CE1 . HIS A 1 181 ? -2.863  64.360 33.619 1.00 45.23  ? 181  HIS A CE1 1 
ATOM   1400 N NE2 . HIS A 1 181 ? -1.586  64.510 33.926 1.00 45.23  ? 181  HIS A NE2 1 
ATOM   1401 N N   . ASP A 1 182 ? -5.839  67.319 36.232 1.00 41.68  ? 182  ASP A N   1 
ATOM   1402 C CA  . ASP A 1 182 ? -6.893  67.605 35.266 1.00 41.68  ? 182  ASP A CA  1 
ATOM   1403 C C   . ASP A 1 182 ? -7.362  69.066 35.211 1.00 41.68  ? 182  ASP A C   1 
ATOM   1404 O O   . ASP A 1 182 ? -7.963  69.480 34.217 1.00 41.68  ? 182  ASP A O   1 
ATOM   1405 C CB  . ASP A 1 182 ? -8.125  66.725 35.541 1.00 58.19  ? 182  ASP A CB  1 
ATOM   1406 C CG  . ASP A 1 182 ? -7.803  65.225 35.578 1.00 58.19  ? 182  ASP A CG  1 
ATOM   1407 O OD1 . ASP A 1 182 ? -6.941  64.765 34.782 1.00 58.19  ? 182  ASP A OD1 1 
ATOM   1408 O OD2 . ASP A 1 182 ? -8.431  64.494 36.392 1.00 58.19  ? 182  ASP A OD2 1 
ATOM   1409 N N   . ASN A 1 183 ? -7.078  69.855 36.243 1.00 32.28  ? 183  ASN A N   1 
ATOM   1410 C CA  . ASN A 1 183 ? -7.575  71.227 36.272 1.00 32.28  ? 183  ASN A CA  1 
ATOM   1411 C C   . ASN A 1 183 ? -6.627  72.399 36.510 1.00 32.28  ? 183  ASN A C   1 
ATOM   1412 O O   . ASN A 1 183 ? -6.988  73.540 36.220 1.00 32.28  ? 183  ASN A O   1 
ATOM   1413 C CB  . ASN A 1 183 ? -8.680  71.325 37.324 1.00 37.69  ? 183  ASN A CB  1 
ATOM   1414 C CG  . ASN A 1 183 ? -9.835  70.394 37.046 1.00 37.69  ? 183  ASN A CG  1 
ATOM   1415 O OD1 . ASN A 1 183 ? -10.648 70.645 36.153 1.00 37.69  ? 183  ASN A OD1 1 
ATOM   1416 N ND2 . ASN A 1 183 ? -9.913  69.305 37.803 1.00 37.69  ? 183  ASN A ND2 1 
ATOM   1417 N N   . ILE A 1 184 ? -5.432  72.153 37.033 1.00 40.49  ? 184  ILE A N   1 
ATOM   1418 C CA  . ILE A 1 184 ? -4.530  73.258 37.333 1.00 40.49  ? 184  ILE A CA  1 
ATOM   1419 C C   . ILE A 1 184 ? -4.203  74.160 36.137 1.00 40.49  ? 184  ILE A C   1 
ATOM   1420 O O   . ILE A 1 184 ? -3.784  75.306 36.321 1.00 40.49  ? 184  ILE A O   1 
ATOM   1421 C CB  . ILE A 1 184 ? -3.222  72.744 38.009 1.00 27.92  ? 184  ILE A CB  1 
ATOM   1422 C CG1 . ILE A 1 184 ? -2.596  73.865 38.844 1.00 27.92  ? 184  ILE A CG1 1 
ATOM   1423 C CG2 . ILE A 1 184 ? -2.252  72.205 36.972 1.00 27.92  ? 184  ILE A CG2 1 
ATOM   1424 C CD1 . ILE A 1 184 ? -3.485  74.352 39.988 1.00 27.92  ? 184  ILE A CD1 1 
ATOM   1425 N N   . GLN A 1 185 ? -4.414  73.659 34.921 1.00 33.09  ? 185  GLN A N   1 
ATOM   1426 C CA  . GLN A 1 185 ? -4.127  74.440 33.727 1.00 33.09  ? 185  GLN A CA  1 
ATOM   1427 C C   . GLN A 1 185 ? -5.040  75.656 33.670 1.00 33.09  ? 185  GLN A C   1 
ATOM   1428 O O   . GLN A 1 185 ? -4.676  76.685 33.113 1.00 33.09  ? 185  GLN A O   1 
ATOM   1429 C CB  . GLN A 1 185 ? -4.317  73.591 32.459 1.00 42.89  ? 185  GLN A CB  1 
ATOM   1430 C CG  . GLN A 1 185 ? -5.769  73.289 32.111 1.00 42.89  ? 185  GLN A CG  1 
ATOM   1431 C CD  . GLN A 1 185 ? -5.925  72.200 31.045 1.00 42.89  ? 185  GLN A CD  1 
ATOM   1432 O OE1 . GLN A 1 185 ? -5.659  71.020 31.292 1.00 42.89  ? 185  GLN A OE1 1 
ATOM   1433 N NE2 . GLN A 1 185 ? -6.362  72.599 29.852 1.00 42.89  ? 185  GLN A NE2 1 
ATOM   1434 N N   . PHE A 1 186 ? -6.226  75.547 34.257 1.00 39.06  ? 186  PHE A N   1 
ATOM   1435 C CA  . PHE A 1 186 ? -7.162  76.664 34.242 1.00 39.06  ? 186  PHE A CA  1 
ATOM   1436 C C   . PHE A 1 186 ? -6.818  77.735 35.266 1.00 39.06  ? 186  PHE A C   1 
ATOM   1437 O O   . PHE A 1 186 ? -7.439  78.796 35.284 1.00 39.06  ? 186  PHE A O   1 
ATOM   1438 C CB  . PHE A 1 186 ? -8.588  76.157 34.462 1.00 30.95  ? 186  PHE A CB  1 
ATOM   1439 C CG  . PHE A 1 186 ? -8.990  75.089 33.491 1.00 30.95  ? 186  PHE A CG  1 
ATOM   1440 C CD1 . PHE A 1 186 ? -8.983  75.343 32.125 1.00 30.95  ? 186  PHE A CD1 1 
ATOM   1441 C CD2 . PHE A 1 186 ? -9.304  73.808 33.933 1.00 30.95  ? 186  PHE A CD2 1 
ATOM   1442 C CE1 . PHE A 1 186 ? -9.277  74.336 31.212 1.00 30.95  ? 186  PHE A CE1 1 
ATOM   1443 C CE2 . PHE A 1 186 ? -9.597  72.795 33.027 1.00 30.95  ? 186  PHE A CE2 1 
ATOM   1444 C CZ  . PHE A 1 186 ? -9.583  73.060 31.662 1.00 30.95  ? 186  PHE A CZ  1 
ATOM   1445 N N   . PHE A 1 187 ? -5.832  77.462 36.117 1.00 36.88  ? 187  PHE A N   1 
ATOM   1446 C CA  . PHE A 1 187 ? -5.412  78.426 37.128 1.00 36.88  ? 187  PHE A CA  1 
ATOM   1447 C C   . PHE A 1 187 ? -4.060  79.009 36.737 1.00 36.88  ? 187  PHE A C   1 
ATOM   1448 O O   . PHE A 1 187 ? -3.475  79.796 37.475 1.00 36.88  ? 187  PHE A O   1 
ATOM   1449 C CB  . PHE A 1 187 ? -5.317  77.770 38.515 1.00 27.79  ? 187  PHE A CB  1 
ATOM   1450 C CG  . PHE A 1 187 ? -6.644  77.335 39.082 1.00 27.79  ? 187  PHE A CG  1 
ATOM   1451 C CD1 . PHE A 1 187 ? -7.163  76.080 38.793 1.00 27.79  ? 187  PHE A CD1 1 
ATOM   1452 C CD2 . PHE A 1 187 ? -7.377  78.188 39.911 1.00 27.79  ? 187  PHE A CD2 1 
ATOM   1453 C CE1 . PHE A 1 187 ? -8.387  75.677 39.321 1.00 27.79  ? 187  PHE A CE1 1 
ATOM   1454 C CE2 . PHE A 1 187 ? -8.609  77.795 40.446 1.00 27.79  ? 187  PHE A CE2 1 
ATOM   1455 C CZ  . PHE A 1 187 ? -9.115  76.538 40.150 1.00 27.79  ? 187  PHE A CZ  1 
ATOM   1456 N N   . GLY A 1 188 ? -3.572  78.616 35.567 1.00 39.33  ? 188  GLY A N   1 
ATOM   1457 C CA  . GLY A 1 188 ? -2.292  79.110 35.096 1.00 39.33  ? 188  GLY A CA  1 
ATOM   1458 C C   . GLY A 1 188 ? -1.137  78.148 35.329 1.00 39.33  ? 188  GLY A C   1 
ATOM   1459 O O   . GLY A 1 188 ? 0.000   78.419 34.927 1.00 39.33  ? 188  GLY A O   1 
ATOM   1460 N N   . GLY A 1 189 ? -1.429  77.021 35.974 1.00 42.24  ? 189  GLY A N   1 
ATOM   1461 C CA  . GLY A 1 189 ? -0.396  76.048 36.261 1.00 42.24  ? 189  GLY A CA  1 
ATOM   1462 C C   . GLY A 1 189 ? -0.108  75.083 35.131 1.00 42.24  ? 189  GLY A C   1 
ATOM   1463 O O   . GLY A 1 189 ? -0.973  74.805 34.301 1.00 42.24  ? 189  GLY A O   1 
ATOM   1464 N N   . ASP A 1 190 ? 1.125   74.587 35.086 1.00 42.93  ? 190  ASP A N   1 
ATOM   1465 C CA  . ASP A 1 190 ? 1.527   73.622 34.070 1.00 42.93  ? 190  ASP A CA  1 
ATOM   1466 C C   . ASP A 1 190 ? 1.388   72.249 34.723 1.00 42.93  ? 190  ASP A C   1 
ATOM   1467 O O   . ASP A 1 190 ? 2.129   71.914 35.636 1.00 42.93  ? 190  ASP A O   1 
ATOM   1468 C CB  . ASP A 1 190 ? 2.976   73.872 33.630 1.00 49.97  ? 190  ASP A CB  1 
ATOM   1469 C CG  . ASP A 1 190 ? 3.487   72.810 32.655 1.00 49.97  ? 190  ASP A CG  1 
ATOM   1470 O OD1 . ASP A 1 190 ? 2.668   71.983 32.182 1.00 49.97  ? 190  ASP A OD1 1 
ATOM   1471 O OD2 . ASP A 1 190 ? 4.707   72.797 32.357 1.00 49.97  ? 190  ASP A OD2 1 
ATOM   1472 N N   . PRO A 1 191 ? 0.427   71.438 34.265 1.00 39.45  ? 191  PRO A N   1 
ATOM   1473 C CA  . PRO A 1 191 ? 0.229   70.111 34.848 1.00 39.45  ? 191  PRO A CA  1 
ATOM   1474 C C   . PRO A 1 191 ? 1.378   69.134 34.637 1.00 39.45  ? 191  PRO A C   1 
ATOM   1475 O O   . PRO A 1 191 ? 1.468   68.139 35.344 1.00 39.45  ? 191  PRO A O   1 
ATOM   1476 C CB  . PRO A 1 191 ? -1.064  69.645 34.196 1.00 31.61  ? 191  PRO A CB  1 
ATOM   1477 C CG  . PRO A 1 191 ? -0.987  70.277 32.835 1.00 31.61  ? 191  PRO A CG  1 
ATOM   1478 C CD  . PRO A 1 191 ? -0.510  71.669 33.149 1.00 31.61  ? 191  PRO A CD  1 
ATOM   1479 N N   . LYS A 1 192 ? 2.254   69.412 33.674 1.00 46.45  ? 192  LYS A N   1 
ATOM   1480 C CA  . LYS A 1 192 ? 3.389   68.526 33.407 1.00 46.45  ? 192  LYS A CA  1 
ATOM   1481 C C   . LYS A 1 192 ? 4.603   68.963 34.247 1.00 46.45  ? 192  LYS A C   1 
ATOM   1482 O O   . LYS A 1 192 ? 5.726   68.479 34.058 1.00 46.45  ? 192  LYS A O   1 
ATOM   1483 C CB  . LYS A 1 192 ? 3.744   68.532 31.903 1.00 62.34  ? 192  LYS A CB  1 
ATOM   1484 C CG  . LYS A 1 192 ? 4.326   69.870 31.400 1.00 62.34  ? 192  LYS A CG  1 
ATOM   1485 C CD  . LYS A 1 192 ? 4.843   69.853 29.923 1.00 62.34  ? 192  LYS A CD  1 
ATOM   1486 C CE  . LYS A 1 192 ? 3.748   69.566 28.865 1.00 62.34  ? 192  LYS A CE  1 
ATOM   1487 N NZ  . LYS A 1 192 ? 3.530   68.096 28.571 1.00 62.34  ? 192  LYS A NZ  1 
ATOM   1488 N N   . THR A 1 193 ? 4.382   69.881 35.182 1.00 35.11  ? 193  THR A N   1 
ATOM   1489 C CA  . THR A 1 193 ? 5.481   70.330 36.026 1.00 35.11  ? 193  THR A CA  1 
ATOM   1490 C C   . THR A 1 193 ? 5.052   70.549 37.472 1.00 35.11  ? 193  THR A C   1 
ATOM   1491 O O   . THR A 1 193 ? 5.281   71.606 38.053 1.00 35.11  ? 193  THR A O   1 
ATOM   1492 C CB  . THR A 1 193 ? 6.120   71.616 35.462 1.00 52.16  ? 193  THR A CB  1 
ATOM   1493 O OG1 . THR A 1 193 ? 6.490   71.388 34.101 1.00 52.16  ? 193  THR A OG1 1 
ATOM   1494 C CG2 . THR A 1 193 ? 7.380   71.985 36.229 1.00 52.16  ? 193  THR A CG2 1 
ATOM   1495 N N   . VAL A 1 194 ? 4.419   69.538 38.048 1.00 29.35  ? 194  VAL A N   1 
ATOM   1496 C CA  . VAL A 1 194 ? 3.990   69.633 39.428 1.00 29.35  ? 194  VAL A CA  1 
ATOM   1497 C C   . VAL A 1 194 ? 4.958   68.906 40.339 1.00 29.35  ? 194  VAL A C   1 
ATOM   1498 O O   . VAL A 1 194 ? 5.356   67.780 40.079 1.00 29.35  ? 194  VAL A O   1 
ATOM   1499 C CB  . VAL A 1 194 ? 2.554   69.075 39.640 1.00 42.84  ? 194  VAL A CB  1 
ATOM   1500 C CG1 . VAL A 1 194 ? 2.256   68.008 38.630 1.00 42.84  ? 194  VAL A CG1 1 
ATOM   1501 C CG2 . VAL A 1 194 ? 2.411   68.504 41.045 1.00 42.84  ? 194  VAL A CG2 1 
ATOM   1502 N N   . THR A 1 195 ? 5.345   69.595 41.402 1.00 34.95  ? 195  THR A N   1 
ATOM   1503 C CA  . THR A 1 195 ? 6.245   69.066 42.407 1.00 34.95  ? 195  THR A CA  1 
ATOM   1504 C C   . THR A 1 195 ? 5.437   68.854 43.677 1.00 34.95  ? 195  THR A C   1 
ATOM   1505 O O   . THR A 1 195 ? 4.764   69.772 44.135 1.00 34.95  ? 195  THR A O   1 
ATOM   1506 C CB  . THR A 1 195 ? 7.365   70.077 42.746 1.00 34.99  ? 195  THR A CB  1 
ATOM   1507 O OG1 . THR A 1 195 ? 8.113   70.375 41.568 1.00 34.99  ? 195  THR A OG1 1 
ATOM   1508 C CG2 . THR A 1 195 ? 8.292   69.517 43.805 1.00 34.99  ? 195  THR A CG2 1 
ATOM   1509 N N   . ILE A 1 196 ? 5.465   67.654 44.237 1.00 28.48  ? 196  ILE A N   1 
ATOM   1510 C CA  . ILE A 1 196 ? 4.765   67.458 45.495 1.00 28.48  ? 196  ILE A CA  1 
ATOM   1511 C C   . ILE A 1 196 ? 5.828   67.499 46.597 1.00 28.48  ? 196  ILE A C   1 
ATOM   1512 O O   . ILE A 1 196 ? 6.935   66.994 46.417 1.00 28.48  ? 196  ILE A O   1 
ATOM   1513 C CB  . ILE A 1 196 ? 3.998   66.125 45.528 1.00 34.25  ? 196  ILE A CB  1 
ATOM   1514 C CG1 . ILE A 1 196 ? 4.940   64.955 45.285 1.00 34.25  ? 196  ILE A CG1 1 
ATOM   1515 C CG2 . ILE A 1 196 ? 2.920   66.132 44.473 1.00 34.25  ? 196  ILE A CG2 1 
ATOM   1516 C CD1 . ILE A 1 196 ? 4.236   63.628 45.299 1.00 34.25  ? 196  ILE A CD1 1 
ATOM   1517 N N   . PHE A 1 197 ? 5.515   68.154 47.711 1.00 26.66  ? 197  PHE A N   1 
ATOM   1518 C CA  . PHE A 1 197 ? 6.447   68.241 48.832 1.00 26.66  ? 197  PHE A CA  1 
ATOM   1519 C C   . PHE A 1 197 ? 5.708   68.195 50.157 1.00 26.66  ? 197  PHE A C   1 
ATOM   1520 O O   . PHE A 1 197 ? 4.583   68.655 50.253 1.00 26.66  ? 197  PHE A O   1 
ATOM   1521 C CB  . PHE A 1 197 ? 7.342   69.502 48.732 1.00 35.22  ? 197  PHE A CB  1 
ATOM   1522 C CG  . PHE A 1 197 ? 6.631   70.824 48.958 1.00 35.22  ? 197  PHE A CG  1 
ATOM   1523 C CD1 . PHE A 1 197 ? 5.507   71.179 48.225 1.00 35.22  ? 197  PHE A CD1 1 
ATOM   1524 C CD2 . PHE A 1 197 ? 7.147   71.749 49.864 1.00 35.22  ? 197  PHE A CD2 1 
ATOM   1525 C CE1 . PHE A 1 197 ? 4.912   72.432 48.388 1.00 35.22  ? 197  PHE A CE1 1 
ATOM   1526 C CE2 . PHE A 1 197 ? 6.559   73.006 50.033 1.00 35.22  ? 197  PHE A CE2 1 
ATOM   1527 C CZ  . PHE A 1 197 ? 5.443   73.348 49.294 1.00 35.22  ? 197  PHE A CZ  1 
ATOM   1528 N N   . GLY A 1 198 ? 6.332   67.603 51.168 1.00 23.94  ? 198  GLY A N   1 
ATOM   1529 C CA  . GLY A 1 198 ? 5.697   67.499 52.465 1.00 23.94  ? 198  GLY A CA  1 
ATOM   1530 C C   . GLY A 1 198 ? 6.698   67.290 53.581 1.00 23.94  ? 198  GLY A C   1 
ATOM   1531 O O   . GLY A 1 198 ? 7.869   67.044 53.329 1.00 23.94  ? 198  GLY A O   1 
ATOM   1532 N N   . GLU A 1 199 ? 6.225   67.385 54.818 1.00 32.93  ? 199  GLU A N   1 
ATOM   1533 C CA  . GLU A 1 199 ? 7.069   67.223 55.993 1.00 32.93  ? 199  GLU A CA  1 
ATOM   1534 C C   . GLU A 1 199 ? 6.494   66.162 56.935 1.00 32.93  ? 199  GLU A C   1 
ATOM   1535 O O   . GLU A 1 199 ? 5.283   66.049 57.072 1.00 32.93  ? 199  GLU A O   1 
ATOM   1536 C CB  . GLU A 1 199 ? 7.197   68.582 56.701 1.00 68.18  ? 199  GLU A CB  1 
ATOM   1537 C CG  . GLU A 1 199 ? 8.079   68.633 57.962 1.00 68.18  ? 199  GLU A CG  1 
ATOM   1538 C CD  . GLU A 1 199 ? 7.299   68.334 59.238 1.00 68.18  ? 199  GLU A CD  1 
ATOM   1539 O OE1 . GLU A 1 199 ? 6.089   68.664 59.287 1.00 68.18  ? 199  GLU A OE1 1 
ATOM   1540 O OE2 . GLU A 1 199 ? 7.889   67.785 60.201 1.00 68.18  ? 199  GLU A OE2 1 
ATOM   1541 N N   . SER A 1 200 ? 7.370   65.379 57.566 1.00 34.26  ? 200  SER A N   1 
ATOM   1542 C CA  . SER A 1 200 ? 6.971   64.324 58.516 1.00 34.26  ? 200  SER A CA  1 
ATOM   1543 C C   . SER A 1 200 ? 6.092   63.310 57.776 1.00 34.26  ? 200  SER A C   1 
ATOM   1544 O O   . SER A 1 200 ? 6.521   62.775 56.758 1.00 34.26  ? 200  SER A O   1 
ATOM   1545 C CB  . SER A 1 200 ? 6.243   64.953 59.724 1.00 47.32  ? 200  SER A CB  1 
ATOM   1546 O OG  . SER A 1 200 ? 5.999   64.017 60.771 1.00 47.32  ? 200  SER A OG  1 
ATOM   1547 N N   . ALA A 1 201 ? 4.883   63.040 58.257 1.00 26.78  ? 201  ALA A N   1 
ATOM   1548 C CA  . ALA A 1 201 ? 4.003   62.097 57.564 1.00 26.78  ? 201  ALA A CA  1 
ATOM   1549 C C   . ALA A 1 201 ? 3.777   62.539 56.107 1.00 26.78  ? 201  ALA A C   1 
ATOM   1550 O O   . ALA A 1 201 ? 3.499   61.722 55.236 1.00 26.78  ? 201  ALA A O   1 
ATOM   1551 C CB  . ALA A 1 201 ? 2.665   61.986 58.291 1.00 24.16  ? 201  ALA A CB  1 
ATOM   1552 N N   . GLY A 1 202 ? 3.896   63.840 55.858 1.00 31.78  ? 202  GLY A N   1 
ATOM   1553 C CA  . GLY A 1 202 ? 3.719   64.368 54.520 1.00 31.78  ? 202  GLY A CA  1 
ATOM   1554 C C   . GLY A 1 202 ? 4.911   64.003 53.666 1.00 31.78  ? 202  GLY A C   1 
ATOM   1555 O O   . GLY A 1 202 ? 4.772   63.777 52.473 1.00 31.78  ? 202  GLY A O   1 
ATOM   1556 N N   . GLY A 1 203 ? 6.087   63.954 54.281 1.00 34.17  ? 203  GLY A N   1 
ATOM   1557 C CA  . GLY A 1 203 ? 7.287   63.581 53.563 1.00 34.17  ? 203  GLY A CA  1 
ATOM   1558 C C   . GLY A 1 203 ? 7.235   62.091 53.296 1.00 34.17  ? 203  GLY A C   1 
ATOM   1559 O O   . GLY A 1 203 ? 7.741   61.610 52.288 1.00 34.17  ? 203  GLY A O   1 
ATOM   1560 N N   . ALA A 1 204 ? 6.619   61.354 54.215 1.00 33.75  ? 204  ALA A N   1 
ATOM   1561 C CA  . ALA A 1 204 ? 6.473   59.913 54.070 1.00 33.75  ? 204  ALA A CA  1 
ATOM   1562 C C   . ALA A 1 204 ? 5.430   59.644 52.970 1.00 33.75  ? 204  ALA A C   1 
ATOM   1563 O O   . ALA A 1 204 ? 5.575   58.710 52.176 1.00 33.75  ? 204  ALA A O   1 
ATOM   1564 C CB  . ALA A 1 204 ? 6.037   59.293 55.396 1.00 27.37  ? 204  ALA A CB  1 
ATOM   1565 N N   . SER A 1 205 ? 4.385   60.467 52.930 1.00 29.51  ? 205  SER A N   1 
ATOM   1566 C CA  . SER A 1 205 ? 3.350   60.346 51.905 1.00 29.51  ? 205  SER A CA  1 
ATOM   1567 C C   . SER A 1 205 ? 3.948   60.578 50.505 1.00 29.51  ? 205  SER A C   1 
ATOM   1568 O O   . SER A 1 205 ? 3.657   59.835 49.569 1.00 29.51  ? 205  SER A O   1 
ATOM   1569 C CB  . SER A 1 205 ? 2.233   61.374 52.130 1.00 27.23  ? 205  SER A CB  1 
ATOM   1570 O OG  . SER A 1 205 ? 1.440   61.047 53.243 1.00 27.23  ? 205  SER A OG  1 
ATOM   1571 N N   . VAL A 1 206 ? 4.763   61.624 50.372 1.00 31.30  ? 206  VAL A N   1 
ATOM   1572 C CA  . VAL A 1 206 ? 5.397   61.956 49.102 1.00 31.30  ? 206  VAL A CA  1 
ATOM   1573 C C   . VAL A 1 206 ? 6.207   60.773 48.597 1.00 31.30  ? 206  VAL A C   1 
ATOM   1574 O O   . VAL A 1 206 ? 6.158   60.442 47.425 1.00 31.30  ? 206  VAL A O   1 
ATOM   1575 C CB  . VAL A 1 206 ? 6.316   63.216 49.235 1.00 29.76  ? 206  VAL A CB  1 
ATOM   1576 C CG1 . VAL A 1 206 ? 7.356   63.247 48.124 1.00 29.76  ? 206  VAL A CG1 1 
ATOM   1577 C CG2 . VAL A 1 206 ? 5.470   64.487 49.172 1.00 29.76  ? 206  VAL A CG2 1 
ATOM   1578 N N   . GLY A 1 207 ? 6.939   60.131 49.495 1.00 29.99  ? 207  GLY A N   1 
ATOM   1579 C CA  . GLY A 1 207 ? 7.738   58.984 49.119 1.00 29.99  ? 207  GLY A CA  1 
ATOM   1580 C C   . GLY A 1 207 ? 6.895   57.785 48.735 1.00 29.99  ? 207  GLY A C   1 
ATOM   1581 O O   . GLY A 1 207 ? 7.326   56.942 47.950 1.00 29.99  ? 207  GLY A O   1 
ATOM   1582 N N   . MET A 1 208 ? 5.687   57.707 49.284 1.00 37.42  ? 208  MET A N   1 
ATOM   1583 C CA  . MET A 1 208 ? 4.789   56.603 48.977 1.00 37.42  ? 208  MET A CA  1 
ATOM   1584 C C   . MET A 1 208 ? 4.146   56.770 47.601 1.00 37.42  ? 208  MET A C   1 
ATOM   1585 O O   . MET A 1 208 ? 3.781   55.784 46.964 1.00 37.42  ? 208  MET A O   1 
ATOM   1586 C CB  . MET A 1 208 ? 3.733   56.464 50.066 1.00 33.90  ? 208  MET A CB  1 
ATOM   1587 C CG  . MET A 1 208 ? 4.312   55.926 51.358 1.00 33.90  ? 208  MET A CG  1 
ATOM   1588 S SD  . MET A 1 208 ? 3.194   56.017 52.745 1.00 33.90  ? 208  MET A SD  1 
ATOM   1589 C CE  . MET A 1 208 ? 4.202   55.349 54.046 1.00 33.90  ? 208  MET A CE  1 
ATOM   1590 N N   . HIS A 1 209 ? 4.025   58.008 47.130 1.00 33.93  ? 209  HIS A N   1 
ATOM   1591 C CA  . HIS A 1 209 ? 3.447   58.229 45.815 1.00 33.93  ? 209  HIS A CA  1 
ATOM   1592 C C   . HIS A 1 209 ? 4.514   57.922 44.787 1.00 33.93  ? 209  HIS A C   1 
ATOM   1593 O O   . HIS A 1 209 ? 4.215   57.557 43.659 1.00 33.93  ? 209  HIS A O   1 
ATOM   1594 C CB  . HIS A 1 209 ? 2.955   59.663 45.677 1.00 40.98  ? 209  HIS A CB  1 
ATOM   1595 C CG  . HIS A 1 209 ? 1.747   59.947 46.507 1.00 40.98  ? 209  HIS A CG  1 
ATOM   1596 N ND1 . HIS A 1 209 ? 0.541   59.317 46.294 1.00 40.98  ? 209  HIS A ND1 1 
ATOM   1597 C CD2 . HIS A 1 209 ? 1.569   60.754 47.580 1.00 40.98  ? 209  HIS A CD2 1 
ATOM   1598 C CE1 . HIS A 1 209 ? -0.330  59.724 47.200 1.00 40.98  ? 209  HIS A CE1 1 
ATOM   1599 N NE2 . HIS A 1 209 ? 0.269   60.596 47.992 1.00 40.98  ? 209  HIS A NE2 1 
ATOM   1600 N N   . ILE A 1 210 ? 5.768   58.068 45.194 1.00 31.61  ? 210  ILE A N   1 
ATOM   1601 C CA  . ILE A 1 210 ? 6.893   57.761 44.327 1.00 31.61  ? 210  ILE A CA  1 
ATOM   1602 C C   . ILE A 1 210 ? 6.956   56.244 44.118 1.00 31.61  ? 210  ILE A C   1 
ATOM   1603 O O   . ILE A 1 210 ? 7.309   55.784 43.041 1.00 31.61  ? 210  ILE A O   1 
ATOM   1604 C CB  . ILE A 1 210 ? 8.215   58.249 44.963 1.00 30.08  ? 210  ILE A CB  1 
ATOM   1605 C CG1 . ILE A 1 210 ? 8.301   59.765 44.836 1.00 30.08  ? 210  ILE A CG1 1 
ATOM   1606 C CG2 . ILE A 1 210 ? 9.409   57.572 44.318 1.00 30.08  ? 210  ILE A CG2 1 
ATOM   1607 C CD1 . ILE A 1 210 ? 9.351   60.374 45.704 1.00 30.08  ? 210  ILE A CD1 1 
ATOM   1608 N N   . LEU A 1 211 ? 6.599   55.483 45.156 1.00 40.34  ? 211  LEU A N   1 
ATOM   1609 C CA  . LEU A 1 211 ? 6.619   54.022 45.119 1.00 40.34  ? 211  LEU A CA  1 
ATOM   1610 C C   . LEU A 1 211 ? 5.360   53.375 44.534 1.00 40.34  ? 211  LEU A C   1 
ATOM   1611 O O   . LEU A 1 211 ? 5.446   52.402 43.790 1.00 40.34  ? 211  LEU A O   1 
ATOM   1612 C CB  . LEU A 1 211 ? 6.833   53.463 46.526 1.00 32.09  ? 211  LEU A CB  1 
ATOM   1613 C CG  . LEU A 1 211 ? 8.095   53.822 47.305 1.00 32.09  ? 211  LEU A CG  1 
ATOM   1614 C CD1 . LEU A 1 211 ? 8.000   53.254 48.701 1.00 32.09  ? 211  LEU A CD1 1 
ATOM   1615 C CD2 . LEU A 1 211 ? 9.307   53.280 46.598 1.00 32.09  ? 211  LEU A CD2 1 
ATOM   1616 N N   . SER A 1 212 ? 4.193   53.903 44.883 1.00 40.59  ? 212  SER A N   1 
ATOM   1617 C CA  . SER A 1 212 ? 2.924   53.363 44.403 1.00 40.59  ? 212  SER A CA  1 
ATOM   1618 C C   . SER A 1 212 ? 2.659   53.564 42.905 1.00 40.59  ? 212  SER A C   1 
ATOM   1619 O O   . SER A 1 212 ? 2.583   54.696 42.424 1.00 40.59  ? 212  SER A O   1 
ATOM   1620 C CB  . SER A 1 212 ? 1.783   53.986 45.190 1.00 44.98  ? 212  SER A CB  1 
ATOM   1621 O OG  . SER A 1 212 ? 0.540   53.581 44.655 1.00 44.98  ? 212  SER A OG  1 
ATOM   1622 N N   . PRO A 1 213 ? 2.493   52.464 42.153 1.00 39.01  ? 213  PRO A N   1 
ATOM   1623 C CA  . PRO A 1 213 ? 2.235   52.543 40.707 1.00 39.01  ? 213  PRO A CA  1 
ATOM   1624 C C   . PRO A 1 213 ? 1.102   53.494 40.310 1.00 39.01  ? 213  PRO A C   1 
ATOM   1625 O O   . PRO A 1 213 ? 1.230   54.248 39.351 1.00 39.01  ? 213  PRO A O   1 
ATOM   1626 C CB  . PRO A 1 213 ? 1.926   51.097 40.335 1.00 32.98  ? 213  PRO A CB  1 
ATOM   1627 C CG  . PRO A 1 213 ? 2.813   50.329 41.283 1.00 32.98  ? 213  PRO A CG  1 
ATOM   1628 C CD  . PRO A 1 213 ? 2.609   51.062 42.594 1.00 32.98  ? 213  PRO A CD  1 
ATOM   1629 N N   . GLY A 1 214 ? -0.002  53.465 41.053 1.00 41.59  ? 214  GLY A N   1 
ATOM   1630 C CA  . GLY A 1 214 ? -1.127  54.327 40.725 1.00 41.59  ? 214  GLY A CA  1 
ATOM   1631 C C   . GLY A 1 214 ? -0.940  55.826 40.912 1.00 41.59  ? 214  GLY A C   1 
ATOM   1632 O O   . GLY A 1 214 ? -1.789  56.601 40.489 1.00 41.59  ? 214  GLY A O   1 
ATOM   1633 N N   . SER A 1 215 ? 0.153   56.258 41.531 1.00 39.63  ? 215  SER A N   1 
ATOM   1634 C CA  . SER A 1 215 ? 0.363   57.684 41.757 1.00 39.63  ? 215  SER A CA  1 
ATOM   1635 C C   . SER A 1 215 ? 1.486   58.269 40.919 1.00 39.63  ? 215  SER A C   1 
ATOM   1636 O O   . SER A 1 215 ? 1.485   59.455 40.624 1.00 39.63  ? 215  SER A O   1 
ATOM   1637 C CB  . SER A 1 215 ? 0.681   57.951 43.238 1.00 39.42  ? 215  SER A CB  1 
ATOM   1638 O OG  . SER A 1 215 ? -0.427  57.707 44.087 1.00 39.42  ? 215  SER A OG  1 
ATOM   1639 N N   . ARG A 1 216 ? 2.434   57.427 40.531 1.00 37.04  ? 216  ARG A N   1 
ATOM   1640 C CA  . ARG A 1 216 ? 3.610   57.857 39.778 1.00 37.04  ? 216  ARG A CA  1 
ATOM   1641 C C   . ARG A 1 216 ? 3.414   58.839 38.625 1.00 37.04  ? 216  ARG A C   1 
ATOM   1642 O O   . ARG A 1 216 ? 4.210   59.761 38.460 1.00 37.04  ? 216  ARG A O   1 
ATOM   1643 C CB  . ARG A 1 216 ? 4.384   56.628 39.270 1.00 38.69  ? 216  ARG A CB  1 
ATOM   1644 C CG  . ARG A 1 216 ? 4.345   55.436 40.232 1.00 38.69  ? 216  ARG A CG  1 
ATOM   1645 C CD  . ARG A 1 216 ? 5.716   54.903 40.592 1.00 38.69  ? 216  ARG A CD  1 
ATOM   1646 N NE  . ARG A 1 216 ? 6.212   53.924 39.636 1.00 38.69  ? 216  ARG A NE  1 
ATOM   1647 C CZ  . ARG A 1 216 ? 6.406   52.635 39.906 1.00 38.69  ? 216  ARG A CZ  1 
ATOM   1648 N NH1 . ARG A 1 216 ? 6.149   52.148 41.115 1.00 38.69  ? 216  ARG A NH1 1 
ATOM   1649 N NH2 . ARG A 1 216 ? 6.858   51.829 38.953 1.00 38.69  ? 216  ARG A NH2 1 
ATOM   1650 N N   . ASP A 1 217 ? 2.359   58.673 37.840 1.00 42.23  ? 217  ASP A N   1 
ATOM   1651 C CA  . ASP A 1 217 ? 2.172   59.552 36.685 1.00 42.23  ? 217  ASP A CA  1 
ATOM   1652 C C   . ASP A 1 217 ? 1.524   60.901 36.981 1.00 42.23  ? 217  ASP A C   1 
ATOM   1653 O O   . ASP A 1 217 ? 1.342   61.706 36.070 1.00 42.23  ? 217  ASP A O   1 
ATOM   1654 C CB  . ASP A 1 217 ? 1.347   58.836 35.597 1.00 48.08  ? 217  ASP A CB  1 
ATOM   1655 C CG  . ASP A 1 217 ? 1.819   57.393 35.322 1.00 48.08  ? 217  ASP A CG  1 
ATOM   1656 O OD1 . ASP A 1 217 ? 2.996   57.070 35.610 1.00 48.08  ? 217  ASP A OD1 1 
ATOM   1657 O OD2 . ASP A 1 217 ? 1.010   56.581 34.794 1.00 48.08  ? 217  ASP A OD2 1 
ATOM   1658 N N   . LEU A 1 218 ? 1.193   61.159 38.244 1.00 38.31  ? 218  LEU A N   1 
ATOM   1659 C CA  . LEU A 1 218 ? 0.512   62.396 38.604 1.00 38.31  ? 218  LEU A CA  1 
ATOM   1660 C C   . LEU A 1 218 ? 1.353   63.581 39.026 1.00 38.31  ? 218  LEU A C   1 
ATOM   1661 O O   . LEU A 1 218 ? 0.807   64.626 39.370 1.00 38.31  ? 218  LEU A O   1 
ATOM   1662 C CB  . LEU A 1 218 ? -0.525  62.122 39.688 1.00 38.73  ? 218  LEU A CB  1 
ATOM   1663 C CG  . LEU A 1 218 ? -1.648  61.195 39.222 1.00 38.73  ? 218  LEU A CG  1 
ATOM   1664 C CD1 . LEU A 1 218 ? -2.676  60.998 40.333 1.00 38.73  ? 218  LEU A CD1 1 
ATOM   1665 C CD2 . LEU A 1 218 ? -2.287  61.787 37.980 1.00 38.73  ? 218  LEU A CD2 1 
ATOM   1666 N N   . PHE A 1 219 ? 2.670   63.425 39.014 1.00 29.71  ? 219  PHE A N   1 
ATOM   1667 C CA  . PHE A 1 219 ? 3.559   64.513 39.382 1.00 29.71  ? 219  PHE A CA  1 
ATOM   1668 C C   . PHE A 1 219 ? 4.895   64.314 38.696 1.00 29.71  ? 219  PHE A C   1 
ATOM   1669 O O   . PHE A 1 219 ? 5.201   63.226 38.225 1.00 29.71  ? 219  PHE A O   1 
ATOM   1670 C CB  . PHE A 1 219 ? 3.735   64.610 40.905 1.00 26.60  ? 219  PHE A CB  1 
ATOM   1671 C CG  . PHE A 1 219 ? 4.354   63.404 41.532 1.00 26.60  ? 219  PHE A CG  1 
ATOM   1672 C CD1 . PHE A 1 219 ? 3.582   62.285 41.835 1.00 26.60  ? 219  PHE A CD1 1 
ATOM   1673 C CD2 . PHE A 1 219 ? 5.712   63.380 41.815 1.00 26.60  ? 219  PHE A CD2 1 
ATOM   1674 C CE1 . PHE A 1 219 ? 4.161   61.154 42.415 1.00 26.60  ? 219  PHE A CE1 1 
ATOM   1675 C CE2 . PHE A 1 219 ? 6.306   62.260 42.394 1.00 26.60  ? 219  PHE A CE2 1 
ATOM   1676 C CZ  . PHE A 1 219 ? 5.530   61.142 42.695 1.00 26.60  ? 219  PHE A CZ  1 
ATOM   1677 N N   . ARG A 1 220 ? 5.680   65.380 38.645 1.00 31.42  ? 220  ARG A N   1 
ATOM   1678 C CA  . ARG A 1 220 ? 6.972   65.385 37.984 1.00 31.42  ? 220  ARG A CA  1 
ATOM   1679 C C   . ARG A 1 220 ? 8.157   65.193 38.934 1.00 31.42  ? 220  ARG A C   1 
ATOM   1680 O O   . ARG A 1 220 ? 9.014   64.337 38.706 1.00 31.42  ? 220  ARG A O   1 
ATOM   1681 C CB  . ARG A 1 220 ? 7.113   66.715 37.237 1.00 44.38  ? 220  ARG A CB  1 
ATOM   1682 C CG  . ARG A 1 220 ? 8.447   66.976 36.585 1.00 44.38  ? 220  ARG A CG  1 
ATOM   1683 C CD  . ARG A 1 220 ? 8.658   66.088 35.385 1.00 44.38  ? 220  ARG A CD  1 
ATOM   1684 N NE  . ARG A 1 220 ? 9.753   66.565 34.538 1.00 44.38  ? 220  ARG A NE  1 
ATOM   1685 C CZ  . ARG A 1 220 ? 9.602   67.429 33.538 1.00 44.38  ? 220  ARG A CZ  1 
ATOM   1686 N NH1 . ARG A 1 220 ? 8.403   67.922 33.251 1.00 44.38  ? 220  ARG A NH1 1 
ATOM   1687 N NH2 . ARG A 1 220 ? 10.649  67.784 32.809 1.00 44.38  ? 220  ARG A NH2 1 
ATOM   1688 N N   . ARG A 1 221 ? 8.196   65.997 39.992 1.00 32.71  ? 221  ARG A N   1 
ATOM   1689 C CA  . ARG A 1 221 ? 9.278   65.964 40.963 1.00 32.71  ? 221  ARG A CA  1 
ATOM   1690 C C   . ARG A 1 221 ? 8.767   65.882 42.389 1.00 32.71  ? 221  ARG A C   1 
ATOM   1691 O O   . ARG A 1 221 ? 7.572   66.048 42.631 1.00 32.71  ? 221  ARG A O   1 
ATOM   1692 C CB  . ARG A 1 221 ? 10.140  67.211 40.810 1.00 38.77  ? 221  ARG A CB  1 
ATOM   1693 C CG  . ARG A 1 221 ? 11.197  67.076 39.761 1.00 38.77  ? 221  ARG A CG  1 
ATOM   1694 C CD  . ARG A 1 221 ? 12.028  68.321 39.698 1.00 38.77  ? 221  ARG A CD  1 
ATOM   1695 N NE  . ARG A 1 221 ? 11.403  69.314 38.850 1.00 38.77  ? 221  ARG A NE  1 
ATOM   1696 C CZ  . ARG A 1 221 ? 11.527  69.341 37.531 1.00 38.77  ? 221  ARG A CZ  1 
ATOM   1697 N NH1 . ARG A 1 221 ? 12.262  68.430 36.908 1.00 38.77  ? 221  ARG A NH1 1 
ATOM   1698 N NH2 . ARG A 1 221 ? 10.900  70.277 36.835 1.00 38.77  ? 221  ARG A NH2 1 
ATOM   1699 N N   . ALA A 1 222 ? 9.680   65.651 43.333 1.00 33.30  ? 222  ALA A N   1 
ATOM   1700 C CA  . ALA A 1 222 ? 9.292   65.526 44.732 1.00 33.30  ? 222  ALA A CA  1 
ATOM   1701 C C   . ALA A 1 222 ? 10.306  66.034 45.740 1.00 33.30  ? 222  ALA A C   1 
ATOM   1702 O O   . ALA A 1 222 ? 11.509  65.870 45.576 1.00 33.30  ? 222  ALA A O   1 
ATOM   1703 C CB  . ALA A 1 222 ? 8.954   64.070 45.040 1.00 24.73  ? 222  ALA A CB  1 
ATOM   1704 N N   . ILE A 1 223 ? 9.789   66.654 46.793 1.00 34.77  ? 223  ILE A N   1 
ATOM   1705 C CA  . ILE A 1 223 ? 10.607  67.174 47.878 1.00 34.77  ? 223  ILE A CA  1 
ATOM   1706 C C   . ILE A 1 223 ? 10.131  66.508 49.170 1.00 34.77  ? 223  ILE A C   1 
ATOM   1707 O O   . ILE A 1 223 ? 8.943   66.531 49.483 1.00 34.77  ? 223  ILE A O   1 
ATOM   1708 C CB  . ILE A 1 223 ? 10.468  68.702 48.002 1.00 27.43  ? 223  ILE A CB  1 
ATOM   1709 C CG1 . ILE A 1 223 ? 10.984  69.372 46.731 1.00 27.43  ? 223  ILE A CG1 1 
ATOM   1710 C CG2 . ILE A 1 223 ? 11.271  69.203 49.187 1.00 27.43  ? 223  ILE A CG2 1 
ATOM   1711 C CD1 . ILE A 1 223 ? 10.782  70.867 46.709 1.00 27.43  ? 223  ILE A CD1 1 
ATOM   1712 N N   . LEU A 1 224 ? 11.056  65.894 49.902 1.00 30.63  ? 224  LEU A N   1 
ATOM   1713 C CA  . LEU A 1 224 ? 10.718  65.214 51.151 1.00 30.63  ? 224  LEU A CA  1 
ATOM   1714 C C   . LEU A 1 224 ? 11.433  65.834 52.345 1.00 30.63  ? 224  LEU A C   1 
ATOM   1715 O O   . LEU A 1 224 ? 12.658  65.810 52.421 1.00 30.63  ? 224  LEU A O   1 
ATOM   1716 C CB  . LEU A 1 224 ? 11.086  63.729 51.074 1.00 25.92  ? 224  LEU A CB  1 
ATOM   1717 C CG  . LEU A 1 224 ? 10.371  62.820 50.076 1.00 25.92  ? 224  LEU A CG  1 
ATOM   1718 C CD1 . LEU A 1 224 ? 10.930  63.011 48.668 1.00 25.92  ? 224  LEU A CD1 1 
ATOM   1719 C CD2 . LEU A 1 224 ? 10.555  61.385 50.531 1.00 25.92  ? 224  LEU A CD2 1 
ATOM   1720 N N   . GLN A 1 225 ? 10.669  66.379 53.284 1.00 30.83  ? 225  GLN A N   1 
ATOM   1721 C CA  . GLN A 1 225 ? 11.255  67.001 54.466 1.00 30.83  ? 225  GLN A CA  1 
ATOM   1722 C C   . GLN A 1 225 ? 11.031  66.182 55.736 1.00 30.83  ? 225  GLN A C   1 
ATOM   1723 O O   . GLN A 1 225 ? 9.905   65.967 56.160 1.00 30.83  ? 225  GLN A O   1 
ATOM   1724 C CB  . GLN A 1 225 ? 10.683  68.406 54.655 1.00 40.12  ? 225  GLN A CB  1 
ATOM   1725 C CG  . GLN A 1 225 ? 10.786  69.271 53.413 1.00 40.12  ? 225  GLN A CG  1 
ATOM   1726 C CD  . GLN A 1 225 ? 10.141  70.633 53.582 1.00 40.12  ? 225  GLN A CD  1 
ATOM   1727 O OE1 . GLN A 1 225 ? 9.748   71.277 52.606 1.00 40.12  ? 225  GLN A OE1 1 
ATOM   1728 N NE2 . GLN A 1 225 ? 10.040  71.086 54.824 1.00 40.12  ? 225  GLN A NE2 1 
ATOM   1729 N N   . SER A 1 226 ? 12.120  65.700 56.318 1.00 38.42  ? 226  SER A N   1 
ATOM   1730 C CA  . SER A 1 226 ? 12.069  64.943 57.567 1.00 38.42  ? 226  SER A CA  1 
ATOM   1731 C C   . SER A 1 226 ? 11.108  63.767 57.575 1.00 38.42  ? 226  SER A C   1 
ATOM   1732 O O   . SER A 1 226 ? 10.383  63.561 58.550 1.00 38.42  ? 226  SER A O   1 
ATOM   1733 C CB  . SER A 1 226 ? 11.703  65.884 58.722 1.00 41.90  ? 226  SER A CB  1 
ATOM   1734 O OG  . SER A 1 226 ? 12.611  66.969 58.812 1.00 41.90  ? 226  SER A OG  1 
ATOM   1735 N N   . GLY A 1 227 ? 11.103  62.987 56.505 1.00 36.46  ? 227  GLY A N   1 
ATOM   1736 C CA  . GLY A 1 227 ? 10.199  61.857 56.461 1.00 36.46  ? 227  GLY A CA  1 
ATOM   1737 C C   . GLY A 1 227 ? 10.403  61.058 55.206 1.00 36.46  ? 227  GLY A C   1 
ATOM   1738 O O   . GLY A 1 227 ? 10.674  61.614 54.151 1.00 36.46  ? 227  GLY A O   1 
ATOM   1739 N N   . SER A 1 228 ? 10.300  59.745 55.319 1.00 34.47  ? 228  SER A N   1 
ATOM   1740 C CA  . SER A 1 228 ? 10.460  58.883 54.161 1.00 34.47  ? 228  SER A CA  1 
ATOM   1741 C C   . SER A 1 228 ? 9.509   57.718 54.336 1.00 34.47  ? 228  SER A C   1 
ATOM   1742 O O   . SER A 1 228 ? 9.125   57.390 55.444 1.00 34.47  ? 228  SER A O   1 
ATOM   1743 C CB  . SER A 1 228 ? 11.903  58.401 54.042 1.00 37.65  ? 228  SER A CB  1 
ATOM   1744 O OG  . SER A 1 228 ? 12.273  57.654 55.169 1.00 37.65  ? 228  SER A OG  1 
ATOM   1745 N N   . PRO A 1 229 ? 9.123   57.075 53.237 1.00 36.26  ? 229  PRO A N   1 
ATOM   1746 C CA  . PRO A 1 229 ? 8.196   55.938 53.259 1.00 36.26  ? 229  PRO A CA  1 
ATOM   1747 C C   . PRO A 1 229 ? 8.574   54.745 54.125 1.00 36.26  ? 229  PRO A C   1 
ATOM   1748 O O   . PRO A 1 229 ? 7.704   54.024 54.597 1.00 36.26  ? 229  PRO A O   1 
ATOM   1749 C CB  . PRO A 1 229 ? 8.079   55.568 51.783 1.00 34.80  ? 229  PRO A CB  1 
ATOM   1750 C CG  . PRO A 1 229 ? 9.430   55.942 51.239 1.00 34.80  ? 229  PRO A CG  1 
ATOM   1751 C CD  . PRO A 1 229 ? 9.680   57.277 51.888 1.00 34.80  ? 229  PRO A CD  1 
ATOM   1752 N N   . ASN A 1 230 ? 9.866   54.547 54.349 1.00 34.87  ? 230  ASN A N   1 
ATOM   1753 C CA  . ASN A 1 230 ? 10.332  53.413 55.134 1.00 34.87  ? 230  ASN A CA  1 
ATOM   1754 C C   . ASN A 1 230 ? 10.615  53.705 56.604 1.00 34.87  ? 230  ASN A C   1 
ATOM   1755 O O   . ASN A 1 230 ? 11.401  53.001 57.232 1.00 34.87  ? 230  ASN A O   1 
ATOM   1756 C CB  . ASN A 1 230 ? 11.579  52.824 54.477 1.00 42.21  ? 230  ASN A CB  1 
ATOM   1757 C CG  . ASN A 1 230 ? 12.717  53.821 54.404 1.00 42.21  ? 230  ASN A CG  1 
ATOM   1758 O OD1 . ASN A 1 230 ? 12.499  55.010 54.158 1.00 42.21  ? 230  ASN A OD1 1 
ATOM   1759 N ND2 . ASN A 1 230 ? 13.942  53.343 54.608 1.00 42.21  ? 230  ASN A ND2 1 
ATOM   1760 N N   . CYS A 1 231 ? 9.984   54.734 57.161 1.00 31.85  ? 231  CYS A N   1 
ATOM   1761 C CA  . CYS A 1 231 ? 10.188  55.045 58.572 1.00 31.85  ? 231  CYS A CA  1 
ATOM   1762 C C   . CYS A 1 231 ? 9.448   53.997 59.421 1.00 31.85  ? 231  CYS A C   1 
ATOM   1763 O O   . CYS A 1 231 ? 8.348   53.589 59.082 1.00 31.85  ? 231  CYS A O   1 
ATOM   1764 C CB  . CYS A 1 231 ? 9.671   56.454 58.888 1.00 38.63  ? 231  CYS A CB  1 
ATOM   1765 S SG  . CYS A 1 231 ? 10.716  57.833 58.305 1.00 38.63  ? 231  CYS A SG  1 
ATOM   1766 N N   . PRO A 1 232 ? 10.045  53.556 60.540 1.00 36.51  ? 232  PRO A N   1 
ATOM   1767 C CA  . PRO A 1 232 ? 9.405   52.550 61.401 1.00 36.51  ? 232  PRO A CA  1 
ATOM   1768 C C   . PRO A 1 232 ? 7.997   52.900 61.920 1.00 36.51  ? 232  PRO A C   1 
ATOM   1769 O O   . PRO A 1 232 ? 7.292   52.035 62.437 1.00 36.51  ? 232  PRO A O   1 
ATOM   1770 C CB  . PRO A 1 232 ? 10.428  52.360 62.529 1.00 25.85  ? 232  PRO A CB  1 
ATOM   1771 C CG  . PRO A 1 232 ? 11.076  53.695 62.637 1.00 25.85  ? 232  PRO A CG  1 
ATOM   1772 C CD  . PRO A 1 232 ? 11.260  54.100 61.180 1.00 25.85  ? 232  PRO A CD  1 
ATOM   1773 N N   . TRP A 1 233 ? 7.584   54.155 61.760 1.00 35.90  ? 233  TRP A N   1 
ATOM   1774 C CA  . TRP A 1 233 ? 6.267   54.605 62.219 1.00 35.90  ? 233  TRP A CA  1 
ATOM   1775 C C   . TRP A 1 233 ? 5.257   54.839 61.099 1.00 35.90  ? 233  TRP A C   1 
ATOM   1776 O O   . TRP A 1 233 ? 4.062   54.913 61.356 1.00 35.90  ? 233  TRP A O   1 
ATOM   1777 C CB  . TRP A 1 233 ? 6.395   55.915 63.004 1.00 28.55  ? 233  TRP A CB  1 
ATOM   1778 C CG  . TRP A 1 233 ? 7.194   56.971 62.279 1.00 28.55  ? 233  TRP A CG  1 
ATOM   1779 C CD1 . TRP A 1 233 ? 8.533   57.204 62.391 1.00 28.55  ? 233  TRP A CD1 1 
ATOM   1780 C CD2 . TRP A 1 233 ? 6.713   57.894 61.298 1.00 28.55  ? 233  TRP A CD2 1 
ATOM   1781 N NE1 . TRP A 1 233 ? 8.916   58.212 61.545 1.00 28.55  ? 233  TRP A NE1 1 
ATOM   1782 C CE2 . TRP A 1 233 ? 7.818   58.654 60.860 1.00 28.55  ? 233  TRP A CE2 1 
ATOM   1783 C CE3 . TRP A 1 233 ? 5.454   58.154 60.744 1.00 28.55  ? 233  TRP A CE3 1 
ATOM   1784 C CZ2 . TRP A 1 233 ? 7.704   59.657 59.893 1.00 28.55  ? 233  TRP A CZ2 1 
ATOM   1785 C CZ3 . TRP A 1 233 ? 5.340   59.152 59.782 1.00 28.55  ? 233  TRP A CZ3 1 
ATOM   1786 C CH2 . TRP A 1 233 ? 6.460   59.891 59.368 1.00 28.55  ? 233  TRP A CH2 1 
ATOM   1787 N N   . ALA A 1 234 ? 5.731   54.953 59.865 1.00 30.21  ? 234  ALA A N   1 
ATOM   1788 C CA  . ALA A 1 234 ? 4.857   55.240 58.735 1.00 30.21  ? 234  ALA A CA  1 
ATOM   1789 C C   . ALA A 1 234 ? 3.999   54.119 58.160 1.00 30.21  ? 234  ALA A C   1 
ATOM   1790 O O   . ALA A 1 234 ? 3.154   54.382 57.312 1.00 30.21  ? 234  ALA A O   1 
ATOM   1791 C CB  . ALA A 1 234 ? 5.665   55.874 57.624 1.00 21.89  ? 234  ALA A CB  1 
ATOM   1792 N N   . SER A 1 235 ? 4.194   52.879 58.589 1.00 34.75  ? 235  SER A N   1 
ATOM   1793 C CA  . SER A 1 235 ? 3.363   51.807 58.052 1.00 34.75  ? 235  SER A CA  1 
ATOM   1794 C C   . SER A 1 235 ? 3.364   50.529 58.867 1.00 34.75  ? 235  SER A C   1 
ATOM   1795 O O   . SER A 1 235 ? 4.267   50.287 59.645 1.00 34.75  ? 235  SER A O   1 
ATOM   1796 C CB  . SER A 1 235 ? 3.764   51.488 56.615 1.00 36.10  ? 235  SER A CB  1 
ATOM   1797 O OG  . SER A 1 235 ? 4.985   50.793 56.577 1.00 36.10  ? 235  SER A OG  1 
ATOM   1798 N N   . VAL A 1 236 ? 2.332   49.714 58.671 1.00 34.48  ? 236  VAL A N   1 
ATOM   1799 C CA  . VAL A 1 236 ? 2.186   48.452 59.380 1.00 34.48  ? 236  VAL A CA  1 
ATOM   1800 C C   . VAL A 1 236 ? 1.768   47.339 58.427 1.00 34.48  ? 236  VAL A C   1 
ATOM   1801 O O   . VAL A 1 236 ? 1.399   47.590 57.284 1.00 34.48  ? 236  VAL A O   1 
ATOM   1802 C CB  . VAL A 1 236 ? 1.113   48.547 60.504 1.00 30.97  ? 236  VAL A CB  1 
ATOM   1803 C CG1 . VAL A 1 236 ? 1.511   49.612 61.519 1.00 30.97  ? 236  VAL A CG1 1 
ATOM   1804 C CG2 . VAL A 1 236 ? -0.259  48.843 59.904 1.00 30.97  ? 236  VAL A CG2 1 
ATOM   1805 N N   . SER A 1 237 ? 1.828   46.105 58.912 1.00 31.14  ? 237  SER A N   1 
ATOM   1806 C CA  . SER A 1 237 ? 1.440   44.950 58.117 1.00 31.14  ? 237  SER A CA  1 
ATOM   1807 C C   . SER A 1 237 ? -0.080  44.855 58.125 1.00 31.14  ? 237  SER A C   1 
ATOM   1808 O O   . SER A 1 237 ? -0.738  45.455 58.972 1.00 31.14  ? 237  SER A O   1 
ATOM   1809 C CB  . SER A 1 237 ? 2.029   43.675 58.722 1.00 31.20  ? 237  SER A CB  1 
ATOM   1810 O OG  . SER A 1 237 ? 1.473   43.426 60.006 1.00 31.20  ? 237  SER A OG  1 
ATOM   1811 N N   . VAL A 1 238 ? -0.640  44.099 57.190 1.00 32.83  ? 238  VAL A N   1 
ATOM   1812 C CA  . VAL A 1 238 ? -2.083  43.958 57.148 1.00 32.83  ? 238  VAL A CA  1 
ATOM   1813 C C   . VAL A 1 238 ? -2.552  43.323 58.446 1.00 32.83  ? 238  VAL A C   1 
ATOM   1814 O O   . VAL A 1 238 ? -3.640  43.623 58.929 1.00 32.83  ? 238  VAL A O   1 
ATOM   1815 C CB  . VAL A 1 238 ? -2.530  43.103 55.962 1.00 38.34  ? 238  VAL A CB  1 
ATOM   1816 C CG1 . VAL A 1 238 ? -2.083  43.748 54.674 1.00 38.34  ? 238  VAL A CG1 1 
ATOM   1817 C CG2 . VAL A 1 238 ? -1.950  41.725 56.075 1.00 38.34  ? 238  VAL A CG2 1 
ATOM   1818 N N   . ALA A 1 239 ? -1.713  42.466 59.020 1.00 36.39  ? 239  ALA A N   1 
ATOM   1819 C CA  . ALA A 1 239 ? -2.027  41.783 60.277 1.00 36.39  ? 239  ALA A CA  1 
ATOM   1820 C C   . ALA A 1 239 ? -2.097  42.738 61.463 1.00 36.39  ? 239  ALA A C   1 
ATOM   1821 O O   . ALA A 1 239 ? -3.014  42.656 62.274 1.00 36.39  ? 239  ALA A O   1 
ATOM   1822 C CB  . ALA A 1 239 ? -0.990  40.692 60.560 1.00 30.75  ? 239  ALA A CB  1 
ATOM   1823 N N   . GLU A 1 240 ? -1.111  43.622 61.586 1.00 38.65  ? 240  GLU A N   1 
ATOM   1824 C CA  . GLU A 1 240 ? -1.109  44.588 62.685 1.00 38.65  ? 240  GLU A CA  1 
ATOM   1825 C C   . GLU A 1 240 ? -2.246  45.580 62.450 1.00 38.65  ? 240  GLU A C   1 
ATOM   1826 O O   . GLU A 1 240 ? -2.839  46.092 63.394 1.00 38.65  ? 240  GLU A O   1 
ATOM   1827 C CB  . GLU A 1 240 ? 0.245   45.306 62.768 1.00 51.31  ? 240  GLU A CB  1 
ATOM   1828 C CG  . GLU A 1 240 ? 0.378   46.344 63.909 1.00 51.31  ? 240  GLU A CG  1 
ATOM   1829 C CD  . GLU A 1 240 ? -0.048  45.827 65.297 1.00 51.31  ? 240  GLU A CD  1 
ATOM   1830 O OE1 . GLU A 1 240 ? -0.131  44.598 65.503 1.00 51.31  ? 240  GLU A OE1 1 
ATOM   1831 O OE2 . GLU A 1 240 ? -0.289  46.664 66.194 1.00 51.31  ? 240  GLU A OE2 1 
ATOM   1832 N N   . GLY A 1 241 ? -2.559  45.829 61.183 1.00 32.42  ? 241  GLY A N   1 
ATOM   1833 C CA  . GLY A 1 241 ? -3.649  46.732 60.857 1.00 32.42  ? 241  GLY A CA  1 
ATOM   1834 C C   . GLY A 1 241 ? -4.954  46.125 61.333 1.00 32.42  ? 241  GLY A C   1 
ATOM   1835 O O   . GLY A 1 241 ? -5.781  46.785 61.960 1.00 32.42  ? 241  GLY A O   1 
ATOM   1836 N N   . ARG A 1 242 ? -5.131  44.844 61.034 1.00 37.45  ? 242  ARG A N   1 
ATOM   1837 C CA  . ARG A 1 242 ? -6.323  44.122 61.434 1.00 37.45  ? 242  ARG A CA  1 
ATOM   1838 C C   . ARG A 1 242 ? -6.403  44.040 62.962 1.00 37.45  ? 242  ARG A C   1 
ATOM   1839 O O   . ARG A 1 242 ? -7.461  44.248 63.554 1.00 37.45  ? 242  ARG A O   1 
ATOM   1840 C CB  . ARG A 1 242 ? -6.306  42.723 60.810 1.00 43.99  ? 242  ARG A CB  1 
ATOM   1841 C CG  . ARG A 1 242 ? -7.450  41.809 61.252 1.00 43.99  ? 242  ARG A CG  1 
ATOM   1842 C CD  . ARG A 1 242 ? -7.597  40.612 60.315 1.00 43.99  ? 242  ARG A CD  1 
ATOM   1843 N NE  . ARG A 1 242 ? -8.170  40.997 59.026 1.00 43.99  ? 242  ARG A NE  1 
ATOM   1844 C CZ  . ARG A 1 242 ? -9.466  41.225 58.815 1.00 43.99  ? 242  ARG A CZ  1 
ATOM   1845 N NH1 . ARG A 1 242 ? -10.343 41.104 59.811 1.00 43.99  ? 242  ARG A NH1 1 
ATOM   1846 N NH2 . ARG A 1 242 ? -9.891  41.579 57.605 1.00 43.99  ? 242  ARG A NH2 1 
ATOM   1847 N N   . ARG A 1 243 ? -5.274  43.763 63.596 1.00 35.48  ? 243  ARG A N   1 
ATOM   1848 C CA  . ARG A 1 243 ? -5.224  43.657 65.039 1.00 35.48  ? 243  ARG A CA  1 
ATOM   1849 C C   . ARG A 1 243 ? -5.652  44.958 65.728 1.00 35.48  ? 243  ARG A C   1 
ATOM   1850 O O   . ARG A 1 243 ? -6.423  44.929 66.687 1.00 35.48  ? 243  ARG A O   1 
ATOM   1851 C CB  . ARG A 1 243 ? -3.814  43.265 65.464 1.00 44.98  ? 243  ARG A CB  1 
ATOM   1852 C CG  . ARG A 1 243 ? -3.685  42.835 66.898 1.00 44.98  ? 243  ARG A CG  1 
ATOM   1853 C CD  . ARG A 1 243 ? -2.520  43.547 67.553 1.00 44.98  ? 243  ARG A CD  1 
ATOM   1854 N NE  . ARG A 1 243 ? -3.005  44.369 68.653 1.00 44.98  ? 243  ARG A NE  1 
ATOM   1855 C CZ  . ARG A 1 243 ? -2.478  45.531 69.020 1.00 44.98  ? 243  ARG A CZ  1 
ATOM   1856 N NH1 . ARG A 1 243 ? -1.434  46.028 68.367 1.00 44.98  ? 243  ARG A NH1 1 
ATOM   1857 N NH2 . ARG A 1 243 ? -2.999  46.192 70.048 1.00 44.98  ? 243  ARG A NH2 1 
ATOM   1858 N N   . ARG A 1 244 ? -5.168  46.098 65.240 1.00 37.52  ? 244  ARG A N   1 
ATOM   1859 C CA  . ARG A 1 244 ? -5.523  47.391 65.835 1.00 37.52  ? 244  ARG A CA  1 
ATOM   1860 C C   . ARG A 1 244 ? -6.966  47.804 65.573 1.00 37.52  ? 244  ARG A C   1 
ATOM   1861 O O   . ARG A 1 244 ? -7.587  48.453 66.411 1.00 37.52  ? 244  ARG A O   1 
ATOM   1862 C CB  . ARG A 1 244 ? -4.594  48.506 65.328 1.00 31.66  ? 244  ARG A CB  1 
ATOM   1863 C CG  . ARG A 1 244 ? -3.151  48.357 65.749 1.00 31.66  ? 244  ARG A CG  1 
ATOM   1864 C CD  . ARG A 1 244 ? -2.292  49.464 65.193 1.00 31.66  ? 244  ARG A CD  1 
ATOM   1865 N NE  . ARG A 1 244 ? -0.877  49.164 65.373 1.00 31.66  ? 244  ARG A NE  1 
ATOM   1866 C CZ  . ARG A 1 244 ? 0.116   50.011 65.129 1.00 31.66  ? 244  ARG A CZ  1 
ATOM   1867 N NH1 . ARG A 1 244 ? -0.130  51.237 64.688 1.00 31.66  ? 244  ARG A NH1 1 
ATOM   1868 N NH2 . ARG A 1 244 ? 1.361   49.626 65.336 1.00 31.66  ? 244  ARG A NH2 1 
ATOM   1869 N N   . ALA A 1 245 ? -7.489  47.443 64.407 1.00 35.29  ? 245  ALA A N   1 
ATOM   1870 C CA  . ALA A 1 245 ? -8.864  47.771 64.044 1.00 35.29  ? 245  ALA A CA  1 
ATOM   1871 C C   . ALA A 1 245 ? -9.833  47.077 64.995 1.00 35.29  ? 245  ALA A C   1 
ATOM   1872 O O   . ALA A 1 245 ? -10.814 47.665 65.447 1.00 35.29  ? 245  ALA A O   1 
ATOM   1873 C CB  . ALA A 1 245 ? -9.135  47.328 62.625 1.00 40.45  ? 245  ALA A CB  1 
ATOM   1874 N N   . VAL A 1 246 ? -9.541  45.814 65.281 1.00 39.81  ? 246  VAL A N   1 
ATOM   1875 C CA  . VAL A 1 246 ? -10.348 45.001 66.173 1.00 39.81  ? 246  VAL A CA  1 
ATOM   1876 C C   . VAL A 1 246 ? -10.290 45.519 67.604 1.00 39.81  ? 246  VAL A C   1 
ATOM   1877 O O   . VAL A 1 246 ? -11.315 45.614 68.280 1.00 39.81  ? 246  VAL A O   1 
ATOM   1878 C CB  . VAL A 1 246 ? -9.867  43.544 66.149 1.00 31.83  ? 246  VAL A CB  1 
ATOM   1879 C CG1 . VAL A 1 246 ? -10.575 42.740 67.237 1.00 31.83  ? 246  VAL A CG1 1 
ATOM   1880 C CG2 . VAL A 1 246 ? -10.133 42.944 64.775 1.00 31.83  ? 246  VAL A CG2 1 
ATOM   1881 N N   . GLU A 1 247 ? -9.084  45.849 68.057 1.00 36.90  ? 247  GLU A N   1 
ATOM   1882 C CA  . GLU A 1 247 ? -8.880  46.364 69.402 1.00 36.90  ? 247  GLU A CA  1 
ATOM   1883 C C   . GLU A 1 247 ? -9.614  47.691 69.517 1.00 36.90  ? 247  GLU A C   1 
ATOM   1884 O O   . GLU A 1 247 ? -10.140 48.018 70.578 1.00 36.90  ? 247  GLU A O   1 
ATOM   1885 C CB  . GLU A 1 247 ? -7.386  46.545 69.671 1.00 66.00  ? 247  GLU A CB  1 
ATOM   1886 C CG  . GLU A 1 247 ? -6.985  46.625 71.141 1.00 66.00  ? 247  GLU A CG  1 
ATOM   1887 C CD  . GLU A 1 247 ? -7.497  45.436 71.975 1.00 66.00  ? 247  GLU A CD  1 
ATOM   1888 O OE1 . GLU A 1 247 ? -7.498  44.289 71.448 1.00 66.00  ? 247  GLU A OE1 1 
ATOM   1889 O OE2 . GLU A 1 247 ? -7.888  45.655 73.158 1.00 66.00  ? 247  GLU A OE2 1 
ATOM   1890 N N   . LEU A 1 248 ? -9.666  48.451 68.425 1.00 36.51  ? 248  LEU A N   1 
ATOM   1891 C CA  . LEU A 1 248 ? -10.382 49.722 68.447 1.00 36.51  ? 248  LEU A CA  1 
ATOM   1892 C C   . LEU A 1 248 ? -11.838 49.386 68.735 1.00 36.51  ? 248  LEU A C   1 
ATOM   1893 O O   . LEU A 1 248 ? -12.484 50.021 69.571 1.00 36.51  ? 248  LEU A O   1 
ATOM   1894 C CB  . LEU A 1 248 ? -10.285 50.445 67.101 1.00 28.90  ? 248  LEU A CB  1 
ATOM   1895 C CG  . LEU A 1 248 ? -11.168 51.699 66.988 1.00 28.90  ? 248  LEU A CG  1 
ATOM   1896 C CD1 . LEU A 1 248 ? -10.656 52.750 67.945 1.00 28.90  ? 248  LEU A CD1 1 
ATOM   1897 C CD2 . LEU A 1 248 ? -11.170 52.242 65.569 1.00 28.90  ? 248  LEU A CD2 1 
ATOM   1898 N N   . GLY A 1 249 ? -12.343 48.366 68.045 1.00 41.74  ? 249  GLY A N   1 
ATOM   1899 C CA  . GLY A 1 249 ? -13.719 47.952 68.239 1.00 41.74  ? 249  GLY A CA  1 
ATOM   1900 C C   . GLY A 1 249 ? -13.991 47.446 69.641 1.00 41.74  ? 249  GLY A C   1 
ATOM   1901 O O   . GLY A 1 249 ? -15.087 47.612 70.168 1.00 41.74  ? 249  GLY A O   1 
ATOM   1902 N N   . ARG A 1 250 ? -12.990 46.833 70.256 1.00 48.37  ? 250  ARG A N   1 
ATOM   1903 C CA  . ARG A 1 250 ? -13.155 46.305 71.600 1.00 48.37  ? 250  ARG A CA  1 
ATOM   1904 C C   . ARG A 1 250 ? -13.269 47.417 72.659 1.00 48.37  ? 250  ARG A C   1 
ATOM   1905 O O   . ARG A 1 250 ? -13.941 47.250 73.680 1.00 48.37  ? 250  ARG A O   1 
ATOM   1906 C CB  . ARG A 1 250 ? -11.985 45.385 71.931 1.00 57.81  ? 250  ARG A CB  1 
ATOM   1907 C CG  . ARG A 1 250 ? -12.225 44.501 73.128 1.00 57.81  ? 250  ARG A CG  1 
ATOM   1908 C CD  . ARG A 1 250 ? -10.941 43.835 73.556 1.00 57.81  ? 250  ARG A CD  1 
ATOM   1909 N NE  . ARG A 1 250 ? -10.280 43.188 72.427 1.00 57.81  ? 250  ARG A NE  1 
ATOM   1910 C CZ  . ARG A 1 250 ? -10.719 42.085 71.831 1.00 57.81  ? 250  ARG A CZ  1 
ATOM   1911 N NH1 . ARG A 1 250 ? -11.835 41.496 72.257 1.00 57.81  ? 250  ARG A NH1 1 
ATOM   1912 N NH2 . ARG A 1 250 ? -10.031 41.560 70.817 1.00 57.81  ? 250  ARG A NH2 1 
ATOM   1913 N N   . ASN A 1 251 ? -12.613 48.549 72.411 1.00 47.13  ? 251  ASN A N   1 
ATOM   1914 C CA  . ASN A 1 251 ? -12.640 49.687 73.332 1.00 47.13  ? 251  ASN A CA  1 
ATOM   1915 C C   . ASN A 1 251 ? -13.982 50.414 73.292 1.00 47.13  ? 251  ASN A C   1 
ATOM   1916 O O   . ASN A 1 251 ? -14.329 51.171 74.208 1.00 47.13  ? 251  ASN A O   1 
ATOM   1917 C CB  . ASN A 1 251 ? -11.524 50.669 72.973 1.00 44.79  ? 251  ASN A CB  1 
ATOM   1918 C CG  . ASN A 1 251 ? -10.197 50.321 73.627 1.00 44.79  ? 251  ASN A CG  1 
ATOM   1919 O OD1 . ASN A 1 251 ? -9.821  50.929 74.628 1.00 44.79  ? 251  ASN A OD1 1 
ATOM   1920 N ND2 . ASN A 1 251 ? -9.483  49.340 73.066 1.00 44.79  ? 251  ASN A ND2 1 
ATOM   1921 N N   . LEU A 1 252 ? -14.724 50.200 72.213 1.00 56.77  ? 252  LEU A N   1 
ATOM   1922 C CA  . LEU A 1 252 ? -16.032 50.823 72.041 1.00 56.77  ? 252  LEU A CA  1 
ATOM   1923 C C   . LEU A 1 252 ? -17.139 49.767 72.164 1.00 56.77  ? 252  LEU A C   1 
ATOM   1924 O O   . LEU A 1 252 ? -18.278 49.994 71.764 1.00 56.77  ? 252  LEU A O   1 
ATOM   1925 C CB  . LEU A 1 252 ? -16.101 51.522 70.680 1.00 49.17  ? 252  LEU A CB  1 
ATOM   1926 C CG  . LEU A 1 252 ? -15.073 52.654 70.542 1.00 49.17  ? 252  LEU A CG  1 
ATOM   1927 C CD1 . LEU A 1 252 ? -14.991 53.131 69.096 1.00 49.17  ? 252  LEU A CD1 1 
ATOM   1928 C CD2 . LEU A 1 252 ? -15.457 53.804 71.467 1.00 49.17  ? 252  LEU A CD2 1 
ATOM   1929 N N   . ASN A 1 253 ? -16.787 48.615 72.726 1.00 57.30  ? 253  ASN A N   1 
ATOM   1930 C CA  . ASN A 1 253 ? -17.741 47.528 72.922 1.00 57.30  ? 253  ASN A CA  1 
ATOM   1931 C C   . ASN A 1 253 ? -18.514 47.252 71.644 1.00 57.30  ? 253  ASN A C   1 
ATOM   1932 O O   . ASN A 1 253 ? -19.730 47.431 71.609 1.00 57.30  ? 253  ASN A O   1 
ATOM   1933 C CB  . ASN A 1 253 ? -18.734 47.903 74.025 1.00 83.28  ? 253  ASN A CB  1 
ATOM   1934 C CG  . ASN A 1 253 ? -18.061 48.559 75.222 1.00 83.28  ? 253  ASN A CG  1 
ATOM   1935 O OD1 . ASN A 1 253 ? -17.261 47.926 75.940 1.00 83.28  ? 253  ASN A OD1 1 
ATOM   1936 N ND2 . ASN A 1 253 ? -18.373 49.841 75.444 1.00 83.28  ? 253  ASN A ND2 1 
ATOM   1937 N N   . CYS A 1 254 ? -17.825 46.827 70.593 1.00 48.96  ? 254  CYS A N   1 
ATOM   1938 C CA  . CYS A 1 254 ? -18.501 46.548 69.335 1.00 48.96  ? 254  CYS A CA  1 
ATOM   1939 C C   . CYS A 1 254 ? -18.552 45.049 69.099 1.00 48.96  ? 254  CYS A C   1 
ATOM   1940 O O   . CYS A 1 254 ? -17.732 44.299 69.633 1.00 48.96  ? 254  CYS A O   1 
ATOM   1941 C CB  . CYS A 1 254 ? -17.779 47.244 68.178 1.00 50.74  ? 254  CYS A CB  1 
ATOM   1942 N N   . ASN A 1 255 ? -19.526 44.606 68.312 1.00 52.61  ? 255  ASN A N   1 
ATOM   1943 C CA  . ASN A 1 255 ? -19.647 43.187 68.007 1.00 52.61  ? 255  ASN A CA  1 
ATOM   1944 C C   . ASN A 1 255 ? -18.448 42.830 67.145 1.00 52.61  ? 255  ASN A C   1 
ATOM   1945 O O   . ASN A 1 255 ? -18.256 43.415 66.077 1.00 52.61  ? 255  ASN A O   1 
ATOM   1946 C CB  . ASN A 1 255 ? -20.931 42.923 67.233 1.00 66.92  ? 255  ASN A CB  1 
ATOM   1947 C CG  . ASN A 1 255 ? -21.148 41.448 66.962 1.00 66.92  ? 255  ASN A CG  1 
ATOM   1948 O OD1 . ASN A 1 255 ? -20.191 40.688 66.738 1.00 66.92  ? 255  ASN A OD1 1 
ATOM   1949 N ND2 . ASN A 1 255 ? -22.413 41.033 66.956 1.00 66.92  ? 255  ASN A ND2 1 
ATOM   1950 N N   . LEU A 1 256 ? -17.650 41.866 67.587 1.00 53.82  ? 256  LEU A N   1 
ATOM   1951 C CA  . LEU A 1 256 ? -16.460 41.491 66.829 1.00 53.82  ? 256  LEU A CA  1 
ATOM   1952 C C   . LEU A 1 256 ? -16.535 40.189 66.025 1.00 53.82  ? 256  LEU A C   1 
ATOM   1953 O O   . LEU A 1 256 ? -15.493 39.674 65.607 1.00 53.82  ? 256  LEU A O   1 
ATOM   1954 C CB  . LEU A 1 256 ? -15.257 41.413 67.778 1.00 42.21  ? 256  LEU A CB  1 
ATOM   1955 C CG  . LEU A 1 256 ? -15.085 42.571 68.770 1.00 42.21  ? 256  LEU A CG  1 
ATOM   1956 C CD1 . LEU A 1 256 ? -13.833 42.344 69.605 1.00 42.21  ? 256  LEU A CD1 1 
ATOM   1957 C CD2 . LEU A 1 256 ? -14.988 43.894 68.017 1.00 42.21  ? 256  LEU A CD2 1 
ATOM   1958 N N   . ASN A 1 257 ? -17.735 39.655 65.785 1.00 59.10  ? 257  ASN A N   1 
ATOM   1959 C CA  . ASN A 1 257 ? -17.851 38.388 65.042 1.00 59.10  ? 257  ASN A CA  1 
ATOM   1960 C C   . ASN A 1 257 ? -17.470 38.427 63.560 1.00 59.10  ? 257  ASN A C   1 
ATOM   1961 O O   . ASN A 1 257 ? -17.185 37.387 62.960 1.00 59.10  ? 257  ASN A O   1 
ATOM   1962 C CB  . ASN A 1 257 ? -19.272 37.829 65.152 1.00 89.14  ? 257  ASN A CB  1 
ATOM   1963 C CG  . ASN A 1 257 ? -19.652 37.487 66.578 1.00 89.14  ? 257  ASN A CG  1 
ATOM   1964 O OD1 . ASN A 1 257 ? -18.885 36.826 67.292 1.00 89.14  ? 257  ASN A OD1 1 
ATOM   1965 N ND2 . ASN A 1 257 ? -20.844 37.929 67.005 1.00 89.14  ? 257  ASN A ND2 1 
ATOM   1966 N N   . SER A 1 258 ? -17.488 39.605 62.954 1.00 55.42  ? 258  SER A N   1 
ATOM   1967 C CA  . SER A 1 258 ? -17.136 39.707 61.540 1.00 55.42  ? 258  SER A CA  1 
ATOM   1968 C C   . SER A 1 258 ? -16.778 41.140 61.164 1.00 55.42  ? 258  SER A C   1 
ATOM   1969 O O   . SER A 1 258 ? -17.213 42.096 61.814 1.00 55.42  ? 258  SER A O   1 
ATOM   1970 C CB  . SER A 1 258 ? -18.308 39.249 60.668 1.00 50.88  ? 258  SER A CB  1 
ATOM   1971 O OG  . SER A 1 258 ? -19.390 40.176 60.753 1.00 50.88  ? 258  SER A OG  1 
ATOM   1972 N N   . ASP A 1 259 ? -15.989 41.291 60.108 1.00 57.35  ? 259  ASP A N   1 
ATOM   1973 C CA  . ASP A 1 259 ? -15.616 42.621 59.652 1.00 57.35  ? 259  ASP A CA  1 
ATOM   1974 C C   . ASP A 1 259 ? -16.871 43.493 59.486 1.00 57.35  ? 259  ASP A C   1 
ATOM   1975 O O   . ASP A 1 259 ? -16.881 44.654 59.907 1.00 57.35  ? 259  ASP A O   1 
ATOM   1976 C CB  . ASP A 1 259 ? -14.835 42.520 58.335 1.00 66.55  ? 259  ASP A CB  1 
ATOM   1977 C CG  . ASP A 1 259 ? -13.449 41.877 58.524 1.00 66.55  ? 259  ASP A CG  1 
ATOM   1978 O OD1 . ASP A 1 259 ? -13.083 41.554 59.685 1.00 66.55  ? 259  ASP A OD1 1 
ATOM   1979 O OD2 . ASP A 1 259 ? -12.719 41.698 57.513 1.00 66.55  ? 259  ASP A OD2 1 
ATOM   1980 N N   . GLU A 1 260 ? -17.929 42.927 58.903 1.00 48.79  ? 260  GLU A N   1 
ATOM   1981 C CA  . GLU A 1 260 ? -19.184 43.651 58.683 1.00 48.79  ? 260  GLU A CA  1 
ATOM   1982 C C   . GLU A 1 260 ? -19.772 44.153 59.991 1.00 48.79  ? 260  GLU A C   1 
ATOM   1983 O O   . GLU A 1 260 ? -20.253 45.285 60.089 1.00 48.79  ? 260  GLU A O   1 
ATOM   1984 C CB  . GLU A 1 260 ? -20.215 42.740 58.013 1.00 92.10  ? 260  GLU A CB  1 
ATOM   1985 C CG  . GLU A 1 260 ? -19.808 42.212 56.634 1.00 92.10  ? 260  GLU A CG  1 
ATOM   1986 C CD  . GLU A 1 260 ? -18.450 41.503 56.647 1.00 92.10  ? 260  GLU A CD  1 
ATOM   1987 O OE1 . GLU A 1 260 ? -18.213 40.665 57.558 1.00 92.10  ? 260  GLU A OE1 1 
ATOM   1988 O OE2 . GLU A 1 260 ? -17.628 41.785 55.740 1.00 92.10  ? 260  GLU A OE2 1 
ATOM   1989 N N   . GLU A 1 261 ? -19.750 43.283 60.988 1.00 53.17  ? 261  GLU A N   1 
ATOM   1990 C CA  . GLU A 1 261 ? -20.269 43.597 62.313 1.00 53.17  ? 261  GLU A CA  1 
ATOM   1991 C C   . GLU A 1 261 ? -19.483 44.777 62.900 1.00 53.17  ? 261  GLU A C   1 
ATOM   1992 O O   . GLU A 1 261 ? -20.067 45.761 63.366 1.00 53.17  ? 261  GLU A O   1 
ATOM   1993 C CB  . GLU A 1 261 ? -20.105 42.373 63.224 1.00 97.79  ? 261  GLU A CB  1 
ATOM   1994 C CG  . GLU A 1 261 ? -21.335 41.988 64.041 1.00 97.79  ? 261  GLU A CG  1 
ATOM   1995 C CD  . GLU A 1 261 ? -22.386 41.283 63.205 1.00 97.79  ? 261  GLU A CD  1 
ATOM   1996 O OE1 . GLU A 1 261 ? -21.985 40.448 62.346 1.00 97.79  ? 261  GLU A OE1 1 
ATOM   1997 O OE2 . GLU A 1 261 ? -23.602 41.547 63.420 1.00 97.79  ? 261  GLU A OE2 1 
ATOM   1998 N N   . LEU A 1 262 ? -18.156 44.661 62.870 1.00 43.75  ? 262  LEU A N   1 
ATOM   1999 C CA  . LEU A 1 262 ? -17.268 45.687 63.406 1.00 43.75  ? 262  LEU A CA  1 
ATOM   2000 C C   . LEU A 1 262 ? -17.389 47.015 62.672 1.00 43.75  ? 262  LEU A C   1 
ATOM   2001 O O   . LEU A 1 262 ? -17.632 48.057 63.286 1.00 43.75  ? 262  LEU A O   1 
ATOM   2002 C CB  . LEU A 1 262 ? -15.818 45.199 63.346 1.00 38.05  ? 262  LEU A CB  1 
ATOM   2003 C CG  . LEU A 1 262 ? -14.689 46.159 63.727 1.00 38.05  ? 262  LEU A CG  1 
ATOM   2004 C CD1 . LEU A 1 262 ? -14.886 46.674 65.124 1.00 38.05  ? 262  LEU A CD1 1 
ATOM   2005 C CD2 . LEU A 1 262 ? -13.366 45.425 63.634 1.00 38.05  ? 262  LEU A CD2 1 
ATOM   2006 N N   . ILE A 1 263 ? -17.220 46.978 61.356 1.00 43.17  ? 263  ILE A N   1 
ATOM   2007 C CA  . ILE A 1 263 ? -17.306 48.194 60.560 1.00 43.17  ? 263  ILE A CA  1 
ATOM   2008 C C   . ILE A 1 263 ? -18.620 48.934 60.792 1.00 43.17  ? 263  ILE A C   1 
ATOM   2009 O O   . ILE A 1 263 ? -18.615 50.138 61.036 1.00 43.17  ? 263  ILE A O   1 
ATOM   2010 C CB  . ILE A 1 263 ? -17.169 47.895 59.054 1.00 42.66  ? 263  ILE A CB  1 
ATOM   2011 C CG1 . ILE A 1 263 ? -15.819 47.232 58.772 1.00 42.66  ? 263  ILE A CG1 1 
ATOM   2012 C CG2 . ILE A 1 263 ? -17.300 49.187 58.259 1.00 42.66  ? 263  ILE A CG2 1 
ATOM   2013 C CD1 . ILE A 1 263 ? -15.691 46.712 57.355 1.00 42.66  ? 263  ILE A CD1 1 
ATOM   2014 N N   . HIS A 1 264 ? -19.741 48.218 60.717 1.00 52.09  ? 264  HIS A N   1 
ATOM   2015 C CA  . HIS A 1 264 ? -21.050 48.841 60.920 1.00 52.09  ? 264  HIS A CA  1 
ATOM   2016 C C   . HIS A 1 264 ? -21.111 49.538 62.275 1.00 52.09  ? 264  HIS A C   1 
ATOM   2017 O O   . HIS A 1 264 ? -21.586 50.668 62.378 1.00 52.09  ? 264  HIS A O   1 
ATOM   2018 C CB  . HIS A 1 264 ? -22.173 47.798 60.808 1.00 68.45  ? 264  HIS A CB  1 
ATOM   2019 C CG  . HIS A 1 264 ? -23.528 48.323 61.179 1.00 68.45  ? 264  HIS A CG  1 
ATOM   2020 N ND1 . HIS A 1 264 ? -23.899 48.579 62.486 1.00 68.45  ? 264  HIS A ND1 1 
ATOM   2021 C CD2 . HIS A 1 264 ? -24.591 48.672 60.413 1.00 68.45  ? 264  HIS A CD2 1 
ATOM   2022 C CE1 . HIS A 1 264 ? -25.128 49.067 62.509 1.00 68.45  ? 264  HIS A CE1 1 
ATOM   2023 N NE2 . HIS A 1 264 ? -25.571 49.135 61.264 1.00 68.45  ? 264  HIS A NE2 1 
ATOM   2024 N N   . CYS A 1 265 ? -20.621 48.872 63.316 1.00 50.82  ? 265  CYS A N   1 
ATOM   2025 C CA  . CYS A 1 265 ? -20.632 49.465 64.651 1.00 50.82  ? 265  CYS A CA  1 
ATOM   2026 C C   . CYS A 1 265 ? -19.776 50.736 64.688 1.00 50.82  ? 265  CYS A C   1 
ATOM   2027 O O   . CYS A 1 265 ? -20.153 51.721 65.312 1.00 50.82  ? 265  CYS A O   1 
ATOM   2028 C CB  . CYS A 1 265 ? -20.133 48.444 65.698 1.00 44.31  ? 265  CYS A CB  1 
ATOM   2029 N N   . LEU A 1 266 ? -18.629 50.714 64.013 1.00 49.48  ? 266  LEU A N   1 
ATOM   2030 C CA  . LEU A 1 266 ? -17.742 51.878 63.987 1.00 49.48  ? 266  LEU A CA  1 
ATOM   2031 C C   . LEU A 1 266 ? -18.330 53.036 63.181 1.00 49.48  ? 266  LEU A C   1 
ATOM   2032 O O   . LEU A 1 266 ? -17.985 54.199 63.407 1.00 49.48  ? 266  LEU A O   1 
ATOM   2033 C CB  . LEU A 1 266 ? -16.372 51.493 63.423 1.00 33.60  ? 266  LEU A CB  1 
ATOM   2034 C CG  . LEU A 1 266 ? -15.522 50.571 64.302 1.00 33.60  ? 266  LEU A CG  1 
ATOM   2035 C CD1 . LEU A 1 266 ? -14.372 50.021 63.500 1.00 33.60  ? 266  LEU A CD1 1 
ATOM   2036 C CD2 . LEU A 1 266 ? -15.018 51.326 65.509 1.00 33.60  ? 266  LEU A CD2 1 
ATOM   2037 N N   . ARG A 1 267 ? -19.225 52.728 62.251 1.00 44.58  ? 267  ARG A N   1 
ATOM   2038 C CA  . ARG A 1 267 ? -19.841 53.773 61.447 1.00 44.58  ? 267  ARG A CA  1 
ATOM   2039 C C   . ARG A 1 267 ? -20.980 54.475 62.177 1.00 44.58  ? 267  ARG A C   1 
ATOM   2040 O O   . ARG A 1 267 ? -21.367 55.579 61.791 1.00 44.58  ? 267  ARG A O   1 
ATOM   2041 C CB  . ARG A 1 267 ? -20.344 53.208 60.111 1.00 45.34  ? 267  ARG A CB  1 
ATOM   2042 C CG  . ARG A 1 267 ? -19.224 52.904 59.150 1.00 45.34  ? 267  ARG A CG  1 
ATOM   2043 C CD  . ARG A 1 267 ? -19.717 52.549 57.771 1.00 45.34  ? 267  ARG A CD  1 
ATOM   2044 N NE  . ARG A 1 267 ? -18.590 52.306 56.875 1.00 45.34  ? 267  ARG A NE  1 
ATOM   2045 C CZ  . ARG A 1 267 ? -18.679 51.660 55.717 1.00 45.34  ? 267  ARG A CZ  1 
ATOM   2046 N NH1 . ARG A 1 267 ? -19.850 51.188 55.305 1.00 45.34  ? 267  ARG A NH1 1 
ATOM   2047 N NH2 . ARG A 1 267 ? -17.591 51.475 54.975 1.00 45.34  ? 267  ARG A NH2 1 
ATOM   2048 N N   . GLU A 1 268 ? -21.516 53.844 63.223 1.00 51.14  ? 268  GLU A N   1 
ATOM   2049 C CA  . GLU A 1 268 ? -22.600 54.450 64.005 1.00 51.14  ? 268  GLU A CA  1 
ATOM   2050 C C   . GLU A 1 268 ? -22.048 55.346 65.110 1.00 51.14  ? 268  GLU A C   1 
ATOM   2051 O O   . GLU A 1 268 ? -22.794 56.085 65.755 1.00 51.14  ? 268  GLU A O   1 
ATOM   2052 C CB  . GLU A 1 268 ? -23.492 53.376 64.647 1.00 99.50  ? 268  GLU A CB  1 
ATOM   2053 C CG  . GLU A 1 268 ? -24.281 52.563 63.639 1.00 99.50  ? 268  GLU A CG  1 
ATOM   2054 C CD  . GLU A 1 268 ? -24.999 53.460 62.628 1.00 99.50  ? 268  GLU A CD  1 
ATOM   2055 O OE1 . GLU A 1 268 ? -25.976 54.155 63.029 1.00 99.50  ? 268  GLU A OE1 1 
ATOM   2056 O OE2 . GLU A 1 268 ? -24.568 53.479 61.443 1.00 99.50  ? 268  GLU A OE2 1 
ATOM   2057 N N   . LYS A 1 269 ? -20.742 55.278 65.328 1.00 40.19  ? 269  LYS A N   1 
ATOM   2058 C CA  . LYS A 1 269 ? -20.114 56.076 66.364 1.00 40.19  ? 269  LYS A CA  1 
ATOM   2059 C C   . LYS A 1 269 ? -19.824 57.518 65.944 1.00 40.19  ? 269  LYS A C   1 
ATOM   2060 O O   . LYS A 1 269 ? -19.497 57.794 64.790 1.00 40.19  ? 269  LYS A O   1 
ATOM   2061 C CB  . LYS A 1 269 ? -18.816 55.408 66.794 1.00 56.09  ? 269  LYS A CB  1 
ATOM   2062 C CG  . LYS A 1 269 ? -18.991 54.004 67.336 1.00 56.09  ? 269  LYS A CG  1 
ATOM   2063 C CD  . LYS A 1 269 ? -19.785 54.023 68.620 1.00 56.09  ? 269  LYS A CD  1 
ATOM   2064 C CE  . LYS A 1 269 ? -19.890 52.634 69.211 1.00 56.09  ? 269  LYS A CE  1 
ATOM   2065 N NZ  . LYS A 1 269 ? -20.481 52.694 70.582 1.00 56.09  ? 269  LYS A NZ  1 
ATOM   2066 N N   . LYS A 1 270 ? -19.955 58.436 66.895 1.00 43.54  ? 270  LYS A N   1 
ATOM   2067 C CA  . LYS A 1 270 ? -19.667 59.844 66.653 1.00 43.54  ? 270  LYS A CA  1 
ATOM   2068 C C   . LYS A 1 270 ? -18.149 59.965 66.470 1.00 43.54  ? 270  LYS A C   1 
ATOM   2069 O O   . LYS A 1 270 ? -17.391 59.191 67.050 1.00 43.54  ? 270  LYS A O   1 
ATOM   2070 C CB  . LYS A 1 270 ? -20.101 60.688 67.858 1.00 79.13  ? 270  LYS A CB  1 
ATOM   2071 C CG  . LYS A 1 270 ? -21.612 60.876 68.013 1.00 79.13  ? 270  LYS A CG  1 
ATOM   2072 C CD  . LYS A 1 270 ? -21.961 61.367 69.438 1.00 79.13  ? 270  LYS A CD  1 
ATOM   2073 C CE  . LYS A 1 270 ? -23.448 61.713 69.576 1.00 79.13  ? 270  LYS A CE  1 
ATOM   2074 N NZ  . LYS A 1 270 ? -24.330 60.659 68.972 1.00 79.13  ? 270  LYS A NZ  1 
ATOM   2075 N N   . PRO A 1 271 ? -17.690 60.936 65.671 1.00 37.66  ? 271  PRO A N   1 
ATOM   2076 C CA  . PRO A 1 271 ? -16.252 61.118 65.446 1.00 37.66  ? 271  PRO A CA  1 
ATOM   2077 C C   . PRO A 1 271 ? -15.391 61.123 66.715 1.00 37.66  ? 271  PRO A C   1 
ATOM   2078 O O   . PRO A 1 271 ? -14.417 60.388 66.808 1.00 37.66  ? 271  PRO A O   1 
ATOM   2079 C CB  . PRO A 1 271 ? -16.187 62.456 64.703 1.00 45.09  ? 271  PRO A CB  1 
ATOM   2080 C CG  . PRO A 1 271 ? -17.447 62.436 63.895 1.00 45.09  ? 271  PRO A CG  1 
ATOM   2081 C CD  . PRO A 1 271 ? -18.472 61.910 64.891 1.00 45.09  ? 271  PRO A CD  1 
ATOM   2082 N N   . GLN A 1 272 ? -15.754 61.947 67.692 1.00 39.90  ? 272  GLN A N   1 
ATOM   2083 C CA  . GLN A 1 272 ? -14.979 62.047 68.929 1.00 39.90  ? 272  GLN A CA  1 
ATOM   2084 C C   . GLN A 1 272 ? -14.939 60.764 69.756 1.00 39.90  ? 272  GLN A C   1 
ATOM   2085 O O   . GLN A 1 272 ? -14.094 60.615 70.648 1.00 39.90  ? 272  GLN A O   1 
ATOM   2086 C CB  . GLN A 1 272 ? -15.505 63.202 69.789 1.00 47.33  ? 272  GLN A CB  1 
ATOM   2087 C CG  . GLN A 1 272 ? -14.569 63.618 70.934 1.00 47.33  ? 272  GLN A CG  1 
ATOM   2088 C CD  . GLN A 1 272 ? -13.135 63.878 70.463 1.00 47.33  ? 272  GLN A CD  1 
ATOM   2089 O OE1 . GLN A 1 272 ? -12.905 64.601 69.488 1.00 47.33  ? 272  GLN A OE1 1 
ATOM   2090 N NE2 . GLN A 1 272 ? -12.166 63.286 71.162 1.00 47.33  ? 272  GLN A NE2 1 
ATOM   2091 N N   . GLU A 1 273 ? -15.834 59.829 69.463 1.00 43.68  ? 273  GLU A N   1 
ATOM   2092 C CA  . GLU A 1 273 ? -15.846 58.577 70.211 1.00 43.68  ? 273  GLU A CA  1 
ATOM   2093 C C   . GLU A 1 273 ? -14.696 57.671 69.780 1.00 43.68  ? 273  GLU A C   1 
ATOM   2094 O O   . GLU A 1 273 ? -14.151 56.927 70.597 1.00 43.68  ? 273  GLU A O   1 
ATOM   2095 C CB  . GLU A 1 273 ? -17.183 57.851 70.025 1.00 89.18  ? 273  GLU A CB  1 
ATOM   2096 C CG  . GLU A 1 273 ? -18.392 58.767 70.165 1.00 89.18  ? 273  GLU A CG  1 
ATOM   2097 C CD  . GLU A 1 273 ? -19.686 57.994 70.365 1.00 89.18  ? 273  GLU A CD  1 
ATOM   2098 O OE1 . GLU A 1 273 ? -19.815 57.348 71.435 1.00 89.18  ? 273  GLU A OE1 1 
ATOM   2099 O OE2 . GLU A 1 273 ? -20.562 58.027 69.461 1.00 89.18  ? 273  GLU A OE2 1 
ATOM   2100 N N   . LEU A 1 274 ? -14.340 57.720 68.498 1.00 40.60  ? 274  LEU A N   1 
ATOM   2101 C CA  . LEU A 1 274 ? -13.240 56.907 67.997 1.00 40.60  ? 274  LEU A CA  1 
ATOM   2102 C C   . LEU A 1 274 ? -11.926 57.573 68.364 1.00 40.60  ? 274  LEU A C   1 
ATOM   2103 O O   . LEU A 1 274 ? -10.941 56.902 68.644 1.00 40.60  ? 274  LEU A O   1 
ATOM   2104 C CB  . LEU A 1 274 ? -13.312 56.732 66.475 1.00 45.34  ? 274  LEU A CB  1 
ATOM   2105 C CG  . LEU A 1 274 ? -14.348 55.749 65.926 1.00 45.34  ? 274  LEU A CG  1 
ATOM   2106 C CD1 . LEU A 1 274 ? -15.737 56.205 66.327 1.00 45.34  ? 274  LEU A CD1 1 
ATOM   2107 C CD2 . LEU A 1 274 ? -14.253 55.679 64.418 1.00 45.34  ? 274  LEU A CD2 1 
ATOM   2108 N N   . ILE A 1 275 ? -11.918 58.898 68.361 1.00 41.83  ? 275  ILE A N   1 
ATOM   2109 C CA  . ILE A 1 275 ? -10.715 59.641 68.701 1.00 41.83  ? 275  ILE A CA  1 
ATOM   2110 C C   . ILE A 1 275 ? -10.341 59.498 70.185 1.00 41.83  ? 275  ILE A C   1 
ATOM   2111 O O   . ILE A 1 275 ? -9.168  59.435 70.520 1.00 41.83  ? 275  ILE A O   1 
ATOM   2112 C CB  . ILE A 1 275 ? -10.887 61.127 68.334 1.00 44.57  ? 275  ILE A CB  1 
ATOM   2113 C CG1 . ILE A 1 275 ? -10.997 61.259 66.812 1.00 44.57  ? 275  ILE A CG1 1 
ATOM   2114 C CG2 . ILE A 1 275 ? -9.725  61.955 68.889 1.00 44.57  ? 275  ILE A CG2 1 
ATOM   2115 C CD1 . ILE A 1 275 ? -11.279 62.658 66.338 1.00 44.57  ? 275  ILE A CD1 1 
ATOM   2116 N N   . ASP A 1 276 ? -11.335 59.426 71.066 1.00 41.42  ? 276  ASP A N   1 
ATOM   2117 C CA  . ASP A 1 276 ? -11.080 59.284 72.502 1.00 41.42  ? 276  ASP A CA  1 
ATOM   2118 C C   . ASP A 1 276 ? -10.333 58.009 72.886 1.00 41.42  ? 276  ASP A C   1 
ATOM   2119 O O   . ASP A 1 276 ? -9.664  57.979 73.915 1.00 41.42  ? 276  ASP A O   1 
ATOM   2120 C CB  . ASP A 1 276 ? -12.391 59.307 73.304 1.00 63.12  ? 276  ASP A CB  1 
ATOM   2121 C CG  . ASP A 1 276 ? -12.962 60.711 73.479 1.00 63.12  ? 276  ASP A CG  1 
ATOM   2122 O OD1 . ASP A 1 276 ? -12.170 61.679 73.563 1.00 63.12  ? 276  ASP A OD1 1 
ATOM   2123 O OD2 . ASP A 1 276 ? -14.204 60.848 73.556 1.00 63.12  ? 276  ASP A OD2 1 
ATOM   2124 N N   . VAL A 1 277 ? -10.448 56.957 72.077 1.00 38.04  ? 277  VAL A N   1 
ATOM   2125 C CA  . VAL A 1 277 ? -9.795  55.688 72.398 1.00 38.04  ? 277  VAL A CA  1 
ATOM   2126 C C   . VAL A 1 277 ? -8.749  55.249 71.380 1.00 38.04  ? 277  VAL A C   1 
ATOM   2127 O O   . VAL A 1 277 ? -8.174  54.167 71.489 1.00 38.04  ? 277  VAL A O   1 
ATOM   2128 C CB  . VAL A 1 277 ? -10.842 54.567 72.555 1.00 38.76  ? 277  VAL A CB  1 
ATOM   2129 C CG1 . VAL A 1 277 ? -11.782 54.894 73.704 1.00 38.76  ? 277  VAL A CG1 1 
ATOM   2130 C CG2 . VAL A 1 277 ? -11.634 54.411 71.265 1.00 38.76  ? 277  VAL A CG2 1 
ATOM   2131 N N   . GLU A 1 278 ? -8.506  56.106 70.399 1.00 35.83  ? 278  GLU A N   1 
ATOM   2132 C CA  . GLU A 1 278 ? -7.533  55.862 69.337 1.00 35.83  ? 278  GLU A CA  1 
ATOM   2133 C C   . GLU A 1 278 ? -6.138  55.441 69.836 1.00 35.83  ? 278  GLU A C   1 
ATOM   2134 O O   . GLU A 1 278 ? -5.542  54.523 69.294 1.00 35.83  ? 278  GLU A O   1 
ATOM   2135 C CB  . GLU A 1 278 ? -7.459  57.130 68.458 1.00 67.83  ? 278  GLU A CB  1 
ATOM   2136 C CG  . GLU A 1 278 ? -6.171  57.374 67.661 1.00 67.83  ? 278  GLU A CG  1 
ATOM   2137 C CD  . GLU A 1 278 ? -6.287  58.571 66.684 1.00 67.83  ? 278  GLU A CD  1 
ATOM   2138 O OE1 . GLU A 1 278 ? -6.740  59.674 67.098 1.00 67.83  ? 278  GLU A OE1 1 
ATOM   2139 O OE2 . GLU A 1 278 ? -5.920  58.409 65.496 1.00 67.83  ? 278  GLU A OE2 1 
ATOM   2140 N N   . TRP A 1 279 ? -5.624  56.086 70.876 1.00 40.48  ? 279  TRP A N   1 
ATOM   2141 C CA  . TRP A 1 279 ? -4.295  55.742 71.377 1.00 40.48  ? 279  TRP A CA  1 
ATOM   2142 C C   . TRP A 1 279 ? -4.203  54.469 72.198 1.00 40.48  ? 279  TRP A C   1 
ATOM   2143 O O   . TRP A 1 279 ? -3.109  54.054 72.560 1.00 40.48  ? 279  TRP A O   1 
ATOM   2144 C CB  . TRP A 1 279 ? -3.703  56.897 72.188 1.00 48.31  ? 279  TRP A CB  1 
ATOM   2145 C CG  . TRP A 1 279 ? -3.507  58.132 71.382 1.00 48.31  ? 279  TRP A CG  1 
ATOM   2146 C CD1 . TRP A 1 279 ? -4.383  59.159 71.242 1.00 48.31  ? 279  TRP A CD1 1 
ATOM   2147 C CD2 . TRP A 1 279 ? -2.379  58.451 70.565 1.00 48.31  ? 279  TRP A CD2 1 
ATOM   2148 N NE1 . TRP A 1 279 ? -3.877  60.107 70.389 1.00 48.31  ? 279  TRP A NE1 1 
ATOM   2149 C CE2 . TRP A 1 279 ? -2.645  59.697 69.956 1.00 48.31  ? 279  TRP A CE2 1 
ATOM   2150 C CE3 . TRP A 1 279 ? -1.166  57.804 70.286 1.00 48.31  ? 279  TRP A CE3 1 
ATOM   2151 C CZ2 . TRP A 1 279 ? -1.738  60.320 69.078 1.00 48.31  ? 279  TRP A CZ2 1 
ATOM   2152 C CZ3 . TRP A 1 279 ? -0.259  58.417 69.413 1.00 48.31  ? 279  TRP A CZ3 1 
ATOM   2153 C CH2 . TRP A 1 279 ? -0.555  59.669 68.819 1.00 48.31  ? 279  TRP A CH2 1 
ATOM   2154 N N   . ASN A 1 280 ? -5.334  53.838 72.486 1.00 36.79  ? 280  ASN A N   1 
ATOM   2155 C CA  . ASN A 1 280 ? -5.309  52.612 73.270 1.00 36.79  ? 280  ASN A CA  1 
ATOM   2156 C C   . ASN A 1 280 ? -4.953  51.362 72.481 1.00 36.79  ? 280  ASN A C   1 
ATOM   2157 O O   . ASN A 1 280 ? -4.867  50.288 73.055 1.00 36.79  ? 280  ASN A O   1 
ATOM   2158 C CB  . ASN A 1 280 ? -6.664  52.364 73.934 1.00 41.37  ? 280  ASN A CB  1 
ATOM   2159 C CG  . ASN A 1 280 ? -7.042  53.441 74.925 1.00 41.37  ? 280  ASN A CG  1 
ATOM   2160 O OD1 . ASN A 1 280 ? -6.209  54.246 75.348 1.00 41.37  ? 280  ASN A OD1 1 
ATOM   2161 N ND2 . ASN A 1 280 ? -8.306  53.453 75.312 1.00 41.37  ? 280  ASN A ND2 1 
ATOM   2162 N N   . VAL A 1 281 ? -4.734  51.475 71.181 1.00 32.93  ? 281  VAL A N   1 
ATOM   2163 C CA  . VAL A 1 281 ? -4.450  50.272 70.416 1.00 32.93  ? 281  VAL A CA  1 
ATOM   2164 C C   . VAL A 1 281 ? -3.004  49.991 70.077 1.00 32.93  ? 281  VAL A C   1 
ATOM   2165 O O   . VAL A 1 281 ? -2.714  48.974 69.452 1.00 32.93  ? 281  VAL A O   1 
ATOM   2166 C CB  . VAL A 1 281 ? -5.266  50.236 69.096 1.00 33.09  ? 281  VAL A CB  1 
ATOM   2167 C CG1 . VAL A 1 281 ? -6.752  50.450 69.401 1.00 33.09  ? 281  VAL A CG1 1 
ATOM   2168 C CG2 . VAL A 1 281 ? -4.730  51.284 68.110 1.00 33.09  ? 281  VAL A CG2 1 
ATOM   2169 N N   . LEU A 1 282 ? -2.093  50.874 70.474 1.00 36.21  ? 282  LEU A N   1 
ATOM   2170 C CA  . LEU A 1 282 ? -0.679  50.648 70.188 1.00 36.21  ? 282  LEU A CA  1 
ATOM   2171 C C   . LEU A 1 282 ? -0.209  49.358 70.856 1.00 36.21  ? 282  LEU A C   1 
ATOM   2172 O O   . LEU A 1 282 ? -0.595  49.050 71.986 1.00 36.21  ? 282  LEU A O   1 
ATOM   2173 C CB  . LEU A 1 282 ? 0.162   51.829 70.667 1.00 32.92  ? 282  LEU A CB  1 
ATOM   2174 C CG  . LEU A 1 282 ? 0.051   53.089 69.802 1.00 32.92  ? 282  LEU A CG  1 
ATOM   2175 C CD1 . LEU A 1 282 ? 0.933   54.176 70.387 1.00 32.92  ? 282  LEU A CD1 1 
ATOM   2176 C CD2 . LEU A 1 282 ? 0.473   52.787 68.373 1.00 32.92  ? 282  LEU A CD2 1 
ATOM   2177 N N   . PRO A 1 283 ? 0.640   48.584 70.167 1.00 41.72  ? 283  PRO A N   1 
ATOM   2178 C CA  . PRO A 1 283 ? 1.117   47.328 70.751 1.00 41.72  ? 283  PRO A CA  1 
ATOM   2179 C C   . PRO A 1 283 ? 2.108   47.461 71.900 1.00 41.72  ? 283  PRO A C   1 
ATOM   2180 O O   . PRO A 1 283 ? 2.179   46.581 72.755 1.00 41.72  ? 283  PRO A O   1 
ATOM   2181 C CB  . PRO A 1 283 ? 1.710   46.601 69.552 1.00 29.31  ? 283  PRO A CB  1 
ATOM   2182 C CG  . PRO A 1 283 ? 2.277   47.713 68.761 1.00 29.31  ? 283  PRO A CG  1 
ATOM   2183 C CD  . PRO A 1 283 ? 1.189   48.774 68.813 1.00 29.31  ? 283  PRO A CD  1 
ATOM   2184 N N   . PHE A 1 284 ? 2.865   48.553 71.930 1.00 38.96  ? 284  PHE A N   1 
ATOM   2185 C CA  . PHE A 1 284 ? 3.849   48.731 72.986 1.00 38.96  ? 284  PHE A CA  1 
ATOM   2186 C C   . PHE A 1 284 ? 3.795   50.102 73.626 1.00 38.96  ? 284  PHE A C   1 
ATOM   2187 O O   . PHE A 1 284 ? 3.209   51.039 73.092 1.00 38.96  ? 284  PHE A O   1 
ATOM   2188 C CB  . PHE A 1 284 ? 5.264   48.546 72.441 1.00 45.27  ? 284  PHE A CB  1 
ATOM   2189 C CG  . PHE A 1 284 ? 5.442   47.322 71.590 1.00 45.27  ? 284  PHE A CG  1 
ATOM   2190 C CD1 . PHE A 1 284 ? 5.448   46.054 72.159 1.00 45.27  ? 284  PHE A CD1 1 
ATOM   2191 C CD2 . PHE A 1 284 ? 5.645   47.445 70.211 1.00 45.27  ? 284  PHE A CD2 1 
ATOM   2192 C CE1 . PHE A 1 284 ? 5.659   44.916 71.371 1.00 45.27  ? 284  PHE A CE1 1 
ATOM   2193 C CE2 . PHE A 1 284 ? 5.856   46.320 69.412 1.00 45.27  ? 284  PHE A CE2 1 
ATOM   2194 C CZ  . PHE A 1 284 ? 5.865   45.048 69.993 1.00 45.27  ? 284  PHE A CZ  1 
ATOM   2195 N N   . ASP A 1 285 ? 4.420   50.195 74.791 1.00 37.73  ? 285  ASP A N   1 
ATOM   2196 C CA  . ASP A 1 285 ? 4.535   51.442 75.518 1.00 37.73  ? 285  ASP A CA  1 
ATOM   2197 C C   . ASP A 1 285 ? 5.572   52.085 74.616 1.00 37.73  ? 285  ASP A C   1 
ATOM   2198 O O   . ASP A 1 285 ? 6.673   51.569 74.472 1.00 37.73  ? 285  ASP A O   1 
ATOM   2199 C CB  . ASP A 1 285 ? 5.110   51.158 76.899 1.00 59.76  ? 285  ASP A CB  1 
ATOM   2200 C CG  . ASP A 1 285 ? 5.267   52.405 77.742 1.00 59.76  ? 285  ASP A CG  1 
ATOM   2201 O OD1 . ASP A 1 285 ? 5.057   53.527 77.206 1.00 59.76  ? 285  ASP A OD1 1 
ATOM   2202 O OD2 . ASP A 1 285 ? 5.611   52.250 78.945 1.00 59.76  ? 285  ASP A OD2 1 
ATOM   2203 N N   . SER A 1 286 ? 5.241   53.197 73.991 1.00 37.07  ? 286  SER A N   1 
ATOM   2204 C CA  . SER A 1 286 ? 6.201   53.759 73.064 1.00 37.07  ? 286  SER A CA  1 
ATOM   2205 C C   . SER A 1 286 ? 6.185   55.259 72.871 1.00 37.07  ? 286  SER A C   1 
ATOM   2206 O O   . SER A 1 286 ? 5.317   55.972 73.365 1.00 37.07  ? 286  SER A O   1 
ATOM   2207 C CB  . SER A 1 286 ? 5.993   53.105 71.709 1.00 45.95  ? 286  SER A CB  1 
ATOM   2208 O OG  . SER A 1 286 ? 4.654   53.336 71.283 1.00 45.95  ? 286  SER A OG  1 
ATOM   2209 N N   . ILE A 1 287 ? 7.159   55.712 72.098 1.00 34.55  ? 287  ILE A N   1 
ATOM   2210 C CA  . ILE A 1 287 ? 7.328   57.114 71.780 1.00 34.55  ? 287  ILE A CA  1 
ATOM   2211 C C   . ILE A 1 287 ? 7.476   57.114 70.256 1.00 34.55  ? 287  ILE A C   1 
ATOM   2212 O O   . ILE A 1 287 ? 8.023   56.177 69.687 1.00 34.55  ? 287  ILE A O   1 
ATOM   2213 C CB  . ILE A 1 287 ? 8.594   57.644 72.505 1.00 47.30  ? 287  ILE A CB  1 
ATOM   2214 C CG1 . ILE A 1 287 ? 8.693   59.151 72.413 1.00 47.30  ? 287  ILE A CG1 1 
ATOM   2215 C CG2 . ILE A 1 287 ? 9.845   57.047 71.902 1.00 47.30  ? 287  ILE A CG2 1 
ATOM   2216 C CD1 . ILE A 1 287 ? 9.988   59.668 73.039 1.00 47.30  ? 287  ILE A CD1 1 
ATOM   2217 N N   . PHE A 1 288 ? 6.938   58.126 69.594 1.00 35.27  ? 288  PHE A N   1 
ATOM   2218 C CA  . PHE A 1 288 ? 7.022   58.227 68.139 1.00 35.27  ? 288  PHE A CA  1 
ATOM   2219 C C   . PHE A 1 288 ? 6.364   57.069 67.370 1.00 35.27  ? 288  PHE A C   1 
ATOM   2220 O O   . PHE A 1 288 ? 6.923   56.556 66.399 1.00 35.27  ? 288  PHE A O   1 
ATOM   2221 C CB  . PHE A 1 288 ? 8.485   58.349 67.705 1.00 28.83  ? 288  PHE A CB  1 
ATOM   2222 C CG  . PHE A 1 288 ? 8.692   59.247 66.520 1.00 28.83  ? 288  PHE A CG  1 
ATOM   2223 C CD1 . PHE A 1 288 ? 7.917   59.105 65.371 1.00 28.83  ? 288  PHE A CD1 1 
ATOM   2224 C CD2 . PHE A 1 288 ? 9.659   60.248 66.555 1.00 28.83  ? 288  PHE A CD2 1 
ATOM   2225 C CE1 . PHE A 1 288 ? 8.100   59.949 64.278 1.00 28.83  ? 288  PHE A CE1 1 
ATOM   2226 C CE2 . PHE A 1 288 ? 9.846   61.090 65.466 1.00 28.83  ? 288  PHE A CE2 1 
ATOM   2227 C CZ  . PHE A 1 288 ? 9.064   60.940 64.326 1.00 28.83  ? 288  PHE A CZ  1 
ATOM   2228 N N   . ARG A 1 289 ? 5.183   56.654 67.807 1.00 33.31  ? 289  ARG A N   1 
ATOM   2229 C CA  . ARG A 1 289 ? 4.445   55.588 67.139 1.00 33.31  ? 289  ARG A CA  1 
ATOM   2230 C C   . ARG A 1 289 ? 2.987   56.015 67.128 1.00 33.31  ? 289  ARG A C   1 
ATOM   2231 O O   . ARG A 1 289 ? 2.506   56.634 68.078 1.00 33.31  ? 289  ARG A O   1 
ATOM   2232 C CB  . ARG A 1 289 ? 4.613   54.255 67.870 1.00 26.23  ? 289  ARG A CB  1 
ATOM   2233 C CG  . ARG A 1 289 ? 6.005   53.647 67.755 1.00 26.23  ? 289  ARG A CG  1 
ATOM   2234 C CD  . ARG A 1 289 ? 6.342   53.227 66.325 1.00 26.23  ? 289  ARG A CD  1 
ATOM   2235 N NE  . ARG A 1 289 ? 7.618   52.508 66.221 1.00 26.23  ? 289  ARG A NE  1 
ATOM   2236 C CZ  . ARG A 1 289 ? 8.821   53.081 66.185 1.00 26.23  ? 289  ARG A CZ  1 
ATOM   2237 N NH1 . ARG A 1 289 ? 8.937   54.396 66.243 1.00 26.23  ? 289  ARG A NH1 1 
ATOM   2238 N NH2 . ARG A 1 289 ? 9.907   52.337 66.080 1.00 26.23  ? 289  ARG A NH2 1 
ATOM   2239 N N   . PHE A 1 290 ? 2.287   55.691 66.050 1.00 30.44  ? 290  PHE A N   1 
ATOM   2240 C CA  . PHE A 1 290 ? 0.901   56.092 65.911 1.00 30.44  ? 290  PHE A CA  1 
ATOM   2241 C C   . PHE A 1 290 ? -0.012  54.940 65.542 1.00 30.44  ? 290  PHE A C   1 
ATOM   2242 O O   . PHE A 1 290 ? 0.381   54.003 64.859 1.00 30.44  ? 290  PHE A O   1 
ATOM   2243 C CB  . PHE A 1 290 ? 0.845   57.220 64.894 1.00 32.83  ? 290  PHE A CB  1 
ATOM   2244 C CG  . PHE A 1 290 ? 1.961   58.206 65.063 1.00 32.83  ? 290  PHE A CG  1 
ATOM   2245 C CD1 . PHE A 1 290 ? 2.056   58.973 66.223 1.00 32.83  ? 290  PHE A CD1 1 
ATOM   2246 C CD2 . PHE A 1 290 ? 2.969   58.310 64.112 1.00 32.83  ? 290  PHE A CD2 1 
ATOM   2247 C CE1 . PHE A 1 290 ? 3.130   59.817 66.437 1.00 32.83  ? 290  PHE A CE1 1 
ATOM   2248 C CE2 . PHE A 1 290 ? 4.051   59.157 64.318 1.00 32.83  ? 290  PHE A CE2 1 
ATOM   2249 C CZ  . PHE A 1 290 ? 4.130   59.911 65.487 1.00 32.83  ? 290  PHE A CZ  1 
ATOM   2250 N N   . SER A 1 291 ? -1.247  55.030 66.000 1.00 37.04  ? 291  SER A N   1 
ATOM   2251 C CA  . SER A 1 291 ? -2.235  53.985 65.798 1.00 37.04  ? 291  SER A CA  1 
ATOM   2252 C C   . SER A 1 291 ? -2.614  53.578 64.383 1.00 37.04  ? 291  SER A C   1 
ATOM   2253 O O   . SER A 1 291 ? -2.433  52.424 63.998 1.00 37.04  ? 291  SER A O   1 
ATOM   2254 C CB  . SER A 1 291 ? -3.494  54.349 66.563 1.00 41.47  ? 291  SER A CB  1 
ATOM   2255 O OG  . SER A 1 291 ? -3.185  54.487 67.931 1.00 41.47  ? 291  SER A OG  1 
ATOM   2256 N N   . PHE A 1 292 ? -3.151  54.514 63.616 1.00 34.03  ? 292  PHE A N   1 
ATOM   2257 C CA  . PHE A 1 292 ? -3.586  54.203 62.267 1.00 34.03  ? 292  PHE A CA  1 
ATOM   2258 C C   . PHE A 1 292 ? -2.760  54.899 61.213 1.00 34.03  ? 292  PHE A C   1 
ATOM   2259 O O   . PHE A 1 292 ? -2.843  56.113 61.026 1.00 34.03  ? 292  PHE A O   1 
ATOM   2260 C CB  . PHE A 1 292 ? -5.057  54.549 62.147 1.00 36.78  ? 292  PHE A CB  1 
ATOM   2261 C CG  . PHE A 1 292 ? -5.880  53.903 63.208 1.00 36.78  ? 292  PHE A CG  1 
ATOM   2262 C CD1 . PHE A 1 292 ? -6.214  52.557 63.118 1.00 36.78  ? 292  PHE A CD1 1 
ATOM   2263 C CD2 . PHE A 1 292 ? -6.227  54.605 64.355 1.00 36.78  ? 292  PHE A CD2 1 
ATOM   2264 C CE1 . PHE A 1 292 ? -6.874  51.919 64.159 1.00 36.78  ? 292  PHE A CE1 1 
ATOM   2265 C CE2 . PHE A 1 292 ? -6.884  53.975 65.398 1.00 36.78  ? 292  PHE A CE2 1 
ATOM   2266 C CZ  . PHE A 1 292 ? -7.208  52.631 65.303 1.00 36.78  ? 292  PHE A CZ  1 
ATOM   2267 N N   . VAL A 1 293 ? -1.958  54.096 60.531 1.00 30.01  ? 293  VAL A N   1 
ATOM   2268 C CA  . VAL A 1 293 ? -1.059  54.578 59.509 1.00 30.01  ? 293  VAL A CA  1 
ATOM   2269 C C   . VAL A 1 293 ? -1.177  53.700 58.272 1.00 30.01  ? 293  VAL A C   1 
ATOM   2270 O O   . VAL A 1 293 ? -1.872  52.688 58.294 1.00 30.01  ? 293  VAL A O   1 
ATOM   2271 C CB  . VAL A 1 293 ? 0.406   54.538 60.032 1.00 24.67  ? 293  VAL A CB  1 
ATOM   2272 C CG1 . VAL A 1 293 ? 0.569   55.501 61.200 1.00 24.67  ? 293  VAL A CG1 1 
ATOM   2273 C CG2 . VAL A 1 293 ? 0.780   53.117 60.455 1.00 24.67  ? 293  VAL A CG2 1 
ATOM   2274 N N   . PRO A 1 294 ? -0.513  54.083 57.173 1.00 30.77  ? 294  PRO A N   1 
ATOM   2275 C CA  . PRO A 1 294 ? -0.580  53.278 55.956 1.00 30.77  ? 294  PRO A CA  1 
ATOM   2276 C C   . PRO A 1 294 ? -0.196  51.819 56.212 1.00 30.77  ? 294  PRO A C   1 
ATOM   2277 O O   . PRO A 1 294 ? 0.559   51.519 57.129 1.00 30.77  ? 294  PRO A O   1 
ATOM   2278 C CB  . PRO A 1 294 ? 0.401   53.991 55.030 1.00 28.76  ? 294  PRO A CB  1 
ATOM   2279 C CG  . PRO A 1 294 ? 0.205   55.412 55.397 1.00 28.76  ? 294  PRO A CG  1 
ATOM   2280 C CD  . PRO A 1 294 ? 0.174   55.359 56.912 1.00 28.76  ? 294  PRO A CD  1 
ATOM   2281 N N   . VAL A 1 295 ? -0.726  50.920 55.392 1.00 35.66  ? 295  VAL A N   1 
ATOM   2282 C CA  . VAL A 1 295 ? -0.452  49.495 55.520 1.00 35.66  ? 295  VAL A CA  1 
ATOM   2283 C C   . VAL A 1 295 ? -0.058  48.831 54.198 1.00 35.66  ? 295  VAL A C   1 
ATOM   2284 O O   . VAL A 1 295 ? -0.662  49.083 53.161 1.00 35.66  ? 295  VAL A O   1 
ATOM   2285 C CB  . VAL A 1 295 ? -1.674  48.761 56.086 1.00 41.33  ? 295  VAL A CB  1 
ATOM   2286 C CG1 . VAL A 1 295 ? -2.910  49.170 55.330 1.00 41.33  ? 295  VAL A CG1 1 
ATOM   2287 C CG2 . VAL A 1 295 ? -1.473  47.262 55.970 1.00 41.33  ? 295  VAL A CG2 1 
ATOM   2288 N N   . ILE A 1 296 ? 0.960   47.980 54.254 1.00 40.12  ? 296  ILE A N   1 
ATOM   2289 C CA  . ILE A 1 296 ? 1.456   47.258 53.086 1.00 40.12  ? 296  ILE A CA  1 
ATOM   2290 C C   . ILE A 1 296 ? 0.385   46.239 52.706 1.00 40.12  ? 296  ILE A C   1 
ATOM   2291 O O   . ILE A 1 296 ? 0.364   45.130 53.238 1.00 40.12  ? 296  ILE A O   1 
ATOM   2292 C CB  . ILE A 1 296 ? 2.760   46.527 53.434 1.00 28.97  ? 296  ILE A CB  1 
ATOM   2293 C CG1 . ILE A 1 296 ? 3.693   47.481 54.191 1.00 28.97  ? 296  ILE A CG1 1 
ATOM   2294 C CG2 . ILE A 1 296 ? 3.416   45.997 52.169 1.00 28.97  ? 296  ILE A CG2 1 
ATOM   2295 C CD1 . ILE A 1 296 ? 4.055   48.755 53.419 1.00 28.97  ? 296  ILE A CD1 1 
ATOM   2296 N N   . ASP A 1 297 ? -0.482  46.620 51.768 1.00 56.44  ? 297  ASP A N   1 
ATOM   2297 C CA  . ASP A 1 297 ? -1.616  45.801 51.348 1.00 56.44  ? 297  ASP A CA  1 
ATOM   2298 C C   . ASP A 1 297 ? -1.510  45.027 50.040 1.00 56.44  ? 297  ASP A C   1 
ATOM   2299 O O   . ASP A 1 297 ? -2.404  44.240 49.721 1.00 56.44  ? 297  ASP A O   1 
ATOM   2300 C CB  . ASP A 1 297 ? -2.857  46.692 51.261 1.00 53.16  ? 297  ASP A CB  1 
ATOM   2301 C CG  . ASP A 1 297 ? -2.688  47.817 50.238 1.00 53.16  ? 297  ASP A CG  1 
ATOM   2302 O OD1 . ASP A 1 297 ? -1.575  47.943 49.669 1.00 53.16  ? 297  ASP A OD1 1 
ATOM   2303 O OD2 . ASP A 1 297 ? -3.657  48.580 50.002 1.00 53.16  ? 297  ASP A OD2 1 
ATOM   2304 N N   . GLY A 1 298 ? -0.457  45.245 49.265 1.00 57.68  ? 298  GLY A N   1 
ATOM   2305 C CA  . GLY A 1 298 ? -0.357  44.534 47.996 1.00 57.68  ? 298  GLY A CA  1 
ATOM   2306 C C   . GLY A 1 298 ? -1.116  45.227 46.865 1.00 57.68  ? 298  GLY A C   1 
ATOM   2307 O O   . GLY A 1 298 ? -1.183  44.717 45.740 1.00 57.68  ? 298  GLY A O   1 
ATOM   2308 N N   . GLU A 1 299 ? -1.696  46.389 47.153 1.00 44.94  ? 299  GLU A N   1 
ATOM   2309 C CA  . GLU A 1 299 ? -2.433  47.146 46.142 1.00 44.94  ? 299  GLU A CA  1 
ATOM   2310 C C   . GLU A 1 299 ? -1.767  48.496 45.935 1.00 44.94  ? 299  GLU A C   1 
ATOM   2311 O O   . GLU A 1 299 ? -1.133  48.727 44.906 1.00 44.94  ? 299  GLU A O   1 
ATOM   2312 C CB  . GLU A 1 299 ? -3.877  47.343 46.586 1.00 101.70 ? 299  GLU A CB  1 
ATOM   2313 C CG  . GLU A 1 299 ? -4.699  46.071 46.515 1.00 101.70 ? 299  GLU A CG  1 
ATOM   2314 C CD  . GLU A 1 299 ? -5.945  46.139 47.382 1.00 101.70 ? 299  GLU A CD  1 
ATOM   2315 O OE1 . GLU A 1 299 ? -6.718  47.127 47.240 1.00 101.70 ? 299  GLU A OE1 1 
ATOM   2316 O OE2 . GLU A 1 299 ? -6.144  45.201 48.198 1.00 101.70 ? 299  GLU A OE2 1 
ATOM   2317 N N   . PHE A 1 300 ? -1.920  49.388 46.912 1.00 39.11  ? 300  PHE A N   1 
ATOM   2318 C CA  . PHE A 1 300 ? -1.292  50.696 46.840 1.00 39.11  ? 300  PHE A CA  1 
ATOM   2319 C C   . PHE A 1 300 ? 0.209   50.406 46.738 1.00 39.11  ? 300  PHE A C   1 
ATOM   2320 O O   . PHE A 1 300 ? 0.912   50.976 45.907 1.00 39.11  ? 300  PHE A O   1 
ATOM   2321 C CB  . PHE A 1 300 ? -1.621  51.502 48.100 1.00 40.84  ? 300  PHE A CB  1 
ATOM   2322 C CG  . PHE A 1 300 ? -1.332  52.976 47.975 1.00 40.84  ? 300  PHE A CG  1 
ATOM   2323 C CD1 . PHE A 1 300 ? -0.034  53.464 48.117 1.00 40.84  ? 300  PHE A CD1 1 
ATOM   2324 C CD2 . PHE A 1 300 ? -2.354  53.871 47.685 1.00 40.84  ? 300  PHE A CD2 1 
ATOM   2325 C CE1 . PHE A 1 300 ? 0.238   54.820 47.969 1.00 40.84  ? 300  PHE A CE1 1 
ATOM   2326 C CE2 . PHE A 1 300 ? -2.096  55.224 47.534 1.00 40.84  ? 300  PHE A CE2 1 
ATOM   2327 C CZ  . PHE A 1 300 ? -0.800  55.703 47.675 1.00 40.84  ? 300  PHE A CZ  1 
ATOM   2328 N N   . PHE A 1 301 ? 0.684   49.492 47.578 1.00 48.14  ? 301  PHE A N   1 
ATOM   2329 C CA  . PHE A 1 301 ? 2.084   49.081 47.574 1.00 48.14  ? 301  PHE A CA  1 
ATOM   2330 C C   . PHE A 1 301 ? 2.101   47.635 47.071 1.00 48.14  ? 301  PHE A C   1 
ATOM   2331 O O   . PHE A 1 301 ? 1.634   46.731 47.758 1.00 48.14  ? 301  PHE A O   1 
ATOM   2332 C CB  . PHE A 1 301 ? 2.665   49.141 48.989 1.00 36.35  ? 301  PHE A CB  1 
ATOM   2333 C CG  . PHE A 1 301 ? 2.551   50.493 49.636 1.00 36.35  ? 301  PHE A CG  1 
ATOM   2334 C CD1 . PHE A 1 301 ? 3.309   51.569 49.174 1.00 36.35  ? 301  PHE A CD1 1 
ATOM   2335 C CD2 . PHE A 1 301 ? 1.670   50.698 50.696 1.00 36.35  ? 301  PHE A CD2 1 
ATOM   2336 C CE1 . PHE A 1 301 ? 3.193   52.829 49.756 1.00 36.35  ? 301  PHE A CE1 1 
ATOM   2337 C CE2 . PHE A 1 301 ? 1.544   51.954 51.288 1.00 36.35  ? 301  PHE A CE2 1 
ATOM   2338 C CZ  . PHE A 1 301 ? 2.309   53.027 50.816 1.00 36.35  ? 301  PHE A CZ  1 
ATOM   2339 N N   . PRO A 1 302 ? 2.624   47.403 45.855 1.00 46.46  ? 302  PRO A N   1 
ATOM   2340 C CA  . PRO A 1 302 ? 2.697   46.064 45.257 1.00 46.46  ? 302  PRO A CA  1 
ATOM   2341 C C   . PRO A 1 302 ? 3.318   44.996 46.155 1.00 46.46  ? 302  PRO A C   1 
ATOM   2342 O O   . PRO A 1 302 ? 2.722   43.939 46.366 1.00 46.46  ? 302  PRO A O   1 
ATOM   2343 C CB  . PRO A 1 302 ? 3.509   46.306 43.991 1.00 44.44  ? 302  PRO A CB  1 
ATOM   2344 C CG  . PRO A 1 302 ? 3.081   47.690 43.602 1.00 44.44  ? 302  PRO A CG  1 
ATOM   2345 C CD  . PRO A 1 302 ? 3.136   48.417 44.916 1.00 44.44  ? 302  PRO A CD  1 
ATOM   2346 N N   . THR A 1 303 ? 4.512   45.269 46.676 1.00 41.98  ? 303  THR A N   1 
ATOM   2347 C CA  . THR A 1 303 ? 5.206   44.327 47.553 1.00 41.98  ? 303  THR A CA  1 
ATOM   2348 C C   . THR A 1 303 ? 5.725   45.061 48.786 1.00 41.98  ? 303  THR A C   1 
ATOM   2349 O O   . THR A 1 303 ? 5.294   46.174 49.072 1.00 41.98  ? 303  THR A O   1 
ATOM   2350 C CB  . THR A 1 303 ? 6.402   43.677 46.827 1.00 55.66  ? 303  THR A CB  1 
ATOM   2351 O OG1 . THR A 1 303 ? 7.389   44.677 46.530 1.00 55.66  ? 303  THR A OG1 1 
ATOM   2352 C CG2 . THR A 1 303 ? 5.945   43.048 45.525 1.00 55.66  ? 303  THR A CG2 1 
ATOM   2353 N N   . SER A 1 304 ? 6.644   44.450 49.522 1.00 41.53  ? 304  SER A N   1 
ATOM   2354 C CA  . SER A 1 304 ? 7.189   45.108 50.703 1.00 41.53  ? 304  SER A CA  1 
ATOM   2355 C C   . SER A 1 304 ? 7.984   46.308 50.210 1.00 41.53  ? 304  SER A C   1 
ATOM   2356 O O   . SER A 1 304 ? 8.494   46.294 49.092 1.00 41.53  ? 304  SER A O   1 
ATOM   2357 C CB  . SER A 1 304 ? 8.112   44.168 51.470 1.00 42.38  ? 304  SER A CB  1 
ATOM   2358 O OG  . SER A 1 304 ? 9.308   43.953 50.751 1.00 42.38  ? 304  SER A OG  1 
ATOM   2359 N N   . LEU A 1 305 ? 8.102   47.341 51.033 1.00 40.28  ? 305  LEU A N   1 
ATOM   2360 C CA  . LEU A 1 305 ? 8.826   48.526 50.613 1.00 40.28  ? 305  LEU A CA  1 
ATOM   2361 C C   . LEU A 1 305 ? 10.311  48.283 50.349 1.00 40.28  ? 305  LEU A C   1 
ATOM   2362 O O   . LEU A 1 305 ? 10.870  48.807 49.377 1.00 40.28  ? 305  LEU A O   1 
ATOM   2363 C CB  . LEU A 1 305 ? 8.647   49.644 51.644 1.00 42.51  ? 305  LEU A CB  1 
ATOM   2364 C CG  . LEU A 1 305 ? 7.204   50.139 51.833 1.00 42.51  ? 305  LEU A CG  1 
ATOM   2365 C CD1 . LEU A 1 305 ? 7.170   51.203 52.938 1.00 42.51  ? 305  LEU A CD1 1 
ATOM   2366 C CD2 . LEU A 1 305 ? 6.654   50.709 50.520 1.00 42.51  ? 305  LEU A CD2 1 
ATOM   2367 N N   . GLU A 1 306 ? 10.953  47.475 51.187 1.00 41.19  ? 306  GLU A N   1 
ATOM   2368 C CA  . GLU A 1 306 ? 12.378  47.230 51.006 1.00 41.19  ? 306  GLU A CA  1 
ATOM   2369 C C   . GLU A 1 306 ? 12.710  46.551 49.686 1.00 41.19  ? 306  GLU A C   1 
ATOM   2370 O O   . GLU A 1 306 ? 13.767  46.812 49.099 1.00 41.19  ? 306  GLU A O   1 
ATOM   2371 C CB  . GLU A 1 306 ? 12.948  46.402 52.156 1.00 86.39  ? 306  GLU A CB  1 
ATOM   2372 C CG  . GLU A 1 306 ? 14.485  46.419 52.185 1.00 86.39  ? 306  GLU A CG  1 
ATOM   2373 C CD  . GLU A 1 306 ? 15.073  47.850 52.086 1.00 86.39  ? 306  GLU A CD  1 
ATOM   2374 O OE1 . GLU A 1 306 ? 14.593  48.754 52.827 1.00 86.39  ? 306  GLU A OE1 1 
ATOM   2375 O OE2 . GLU A 1 306 ? 16.016  48.068 51.275 1.00 86.39  ? 306  GLU A OE2 1 
ATOM   2376 N N   . SER A 1 307 ? 11.823  45.676 49.215 1.00 45.84  ? 307  SER A N   1 
ATOM   2377 C CA  . SER A 1 307 ? 12.069  45.000 47.943 1.00 45.84  ? 307  SER A CA  1 
ATOM   2378 C C   . SER A 1 307 ? 11.763  45.952 46.785 1.00 45.84  ? 307  SER A C   1 
ATOM   2379 O O   . SER A 1 307 ? 12.335  45.830 45.702 1.00 45.84  ? 307  SER A O   1 
ATOM   2380 C CB  . SER A 1 307 ? 11.231  43.722 47.828 1.00 50.52  ? 307  SER A CB  1 
ATOM   2381 O OG  . SER A 1 307 ? 9.848   44.010 47.789 1.00 50.52  ? 307  SER A OG  1 
ATOM   2382 N N   . MET A 1 308 ? 10.867  46.906 47.004 1.00 38.95  ? 308  MET A N   1 
ATOM   2383 C CA  . MET A 1 308 ? 10.571  47.862 45.953 1.00 38.95  ? 308  MET A CA  1 
ATOM   2384 C C   . MET A 1 308 ? 11.796  48.757 45.796 1.00 38.95  ? 308  MET A C   1 
ATOM   2385 O O   . MET A 1 308 ? 12.231  49.031 44.681 1.00 38.95  ? 308  MET A O   1 
ATOM   2386 C CB  . MET A 1 308 ? 9.341   48.702 46.303 1.00 48.18  ? 308  MET A CB  1 
ATOM   2387 C CG  . MET A 1 308 ? 8.051   47.910 46.320 1.00 48.18  ? 308  MET A CG  1 
ATOM   2388 S SD  . MET A 1 308 ? 6.597   48.963 46.465 1.00 48.18  ? 308  MET A SD  1 
ATOM   2389 C CE  . MET A 1 308 ? 6.513   49.651 44.747 1.00 48.18  ? 308  MET A CE  1 
ATOM   2390 N N   . LEU A 1 309 ? 12.367  49.190 46.917 1.00 39.55  ? 309  LEU A N   1 
ATOM   2391 C CA  . LEU A 1 309 ? 13.546  50.045 46.872 1.00 39.55  ? 309  LEU A CA  1 
ATOM   2392 C C   . LEU A 1 309 ? 14.779  49.360 46.268 1.00 39.55  ? 309  LEU A C   1 
ATOM   2393 O O   . LEU A 1 309 ? 15.627  50.018 45.667 1.00 39.55  ? 309  LEU A O   1 
ATOM   2394 C CB  . LEU A 1 309 ? 13.881  50.563 48.271 1.00 37.82  ? 309  LEU A CB  1 
ATOM   2395 C CG  . LEU A 1 309 ? 12.892  51.576 48.848 1.00 37.82  ? 309  LEU A CG  1 
ATOM   2396 C CD1 . LEU A 1 309 ? 13.303  51.943 50.257 1.00 37.82  ? 309  LEU A CD1 1 
ATOM   2397 C CD2 . LEU A 1 309 ? 12.841  52.811 47.967 1.00 37.82  ? 309  LEU A CD2 1 
ATOM   2398 N N   . ASN A 1 310 ? 14.884  48.043 46.422 1.00 45.49  ? 310  ASN A N   1 
ATOM   2399 C CA  . ASN A 1 310 ? 16.028  47.317 45.873 1.00 45.49  ? 310  ASN A CA  1 
ATOM   2400 C C   . ASN A 1 310 ? 15.906  46.964 44.407 1.00 45.49  ? 310  ASN A C   1 
ATOM   2401 O O   . ASN A 1 310 ? 16.911  46.853 43.711 1.00 45.49  ? 310  ASN A O   1 
ATOM   2402 C CB  . ASN A 1 310 ? 16.294  46.042 46.673 1.00 74.81  ? 310  ASN A CB  1 
ATOM   2403 C CG  . ASN A 1 310 ? 17.140  46.308 47.903 1.00 74.81  ? 310  ASN A CG  1 
ATOM   2404 O OD1 . ASN A 1 310 ? 18.158  47.007 47.819 1.00 74.81  ? 310  ASN A OD1 1 
ATOM   2405 N ND2 . ASN A 1 310 ? 16.735  45.759 49.049 1.00 74.81  ? 310  ASN A ND2 1 
ATOM   2406 N N   . SER A 1 311 ? 14.677  46.790 43.935 1.00 41.37  ? 311  SER A N   1 
ATOM   2407 C CA  . SER A 1 311 ? 14.440  46.435 42.541 1.00 41.37  ? 311  SER A CA  1 
ATOM   2408 C C   . SER A 1 311 ? 14.245  47.649 41.628 1.00 41.37  ? 311  SER A C   1 
ATOM   2409 O O   . SER A 1 311 ? 14.054  47.492 40.424 1.00 41.37  ? 311  SER A O   1 
ATOM   2410 C CB  . SER A 1 311 ? 13.217  45.518 42.438 1.00 50.28  ? 311  SER A CB  1 
ATOM   2411 O OG  . SER A 1 311 ? 12.049  46.139 42.964 1.00 50.28  ? 311  SER A OG  1 
ATOM   2412 N N   . GLY A 1 312 ? 14.292  48.851 42.199 1.00 36.92  ? 312  GLY A N   1 
ATOM   2413 C CA  . GLY A 1 312 ? 14.114  50.056 41.403 1.00 36.92  ? 312  GLY A CA  1 
ATOM   2414 C C   . GLY A 1 312 ? 12.671  50.222 40.967 1.00 36.92  ? 312  GLY A C   1 
ATOM   2415 O O   . GLY A 1 312 ? 12.359  50.920 40.008 1.00 36.92  ? 312  GLY A O   1 
ATOM   2416 N N   . ASN A 1 313 ? 11.779  49.557 41.680 1.00 37.50  ? 313  ASN A N   1 
ATOM   2417 C CA  . ASN A 1 313 ? 10.364  49.627 41.371 1.00 37.50  ? 313  ASN A CA  1 
ATOM   2418 C C   . ASN A 1 313 ? 9.764   50.922 41.936 1.00 37.50  ? 313  ASN A C   1 
ATOM   2419 O O   . ASN A 1 313 ? 9.096   50.920 42.974 1.00 37.50  ? 313  ASN A O   1 
ATOM   2420 C CB  . ASN A 1 313 ? 9.660   48.401 41.957 1.00 40.75  ? 313  ASN A CB  1 
ATOM   2421 C CG  . ASN A 1 313 ? 8.242   48.273 41.485 1.00 40.75  ? 313  ASN A CG  1 
ATOM   2422 O OD1 . ASN A 1 313 ? 7.769   49.096 40.702 1.00 40.75  ? 313  ASN A OD1 1 
ATOM   2423 N ND2 . ASN A 1 313 ? 7.543   47.245 41.960 1.00 40.75  ? 313  ASN A ND2 1 
ATOM   2424 N N   . PHE A 1 314 ? 10.042  52.032 41.263 1.00 38.99  ? 314  PHE A N   1 
ATOM   2425 C CA  . PHE A 1 314 ? 9.533   53.336 41.678 1.00 38.99  ? 314  PHE A CA  1 
ATOM   2426 C C   . PHE A 1 314 ? 9.769   54.424 40.635 1.00 38.99  ? 314  PHE A C   1 
ATOM   2427 O O   . PHE A 1 314 ? 10.580  54.267 39.728 1.00 38.99  ? 314  PHE A O   1 
ATOM   2428 C CB  . PHE A 1 314 ? 10.125  53.751 43.040 1.00 32.82  ? 314  PHE A CB  1 
ATOM   2429 C CG  . PHE A 1 314 ? 11.630  53.662 43.126 1.00 32.82  ? 314  PHE A CG  1 
ATOM   2430 C CD1 . PHE A 1 314 ? 12.437  54.640 42.564 1.00 32.82  ? 314  PHE A CD1 1 
ATOM   2431 C CD2 . PHE A 1 314 ? 12.239  52.592 43.782 1.00 32.82  ? 314  PHE A CD2 1 
ATOM   2432 C CE1 . PHE A 1 314 ? 13.825  54.554 42.652 1.00 32.82  ? 314  PHE A CE1 1 
ATOM   2433 C CE2 . PHE A 1 314 ? 13.627  52.502 43.873 1.00 32.82  ? 314  PHE A CE2 1 
ATOM   2434 C CZ  . PHE A 1 314 ? 14.419  53.482 43.307 1.00 32.82  ? 314  PHE A CZ  1 
ATOM   2435 N N   . LYS A 1 315 ? 9.041   55.525 40.760 1.00 36.56  ? 315  LYS A N   1 
ATOM   2436 C CA  . LYS A 1 315 ? 9.176   56.623 39.819 1.00 36.56  ? 315  LYS A CA  1 
ATOM   2437 C C   . LYS A 1 315 ? 10.589  57.194 39.834 1.00 36.56  ? 315  LYS A C   1 
ATOM   2438 O O   . LYS A 1 315 ? 11.087  57.593 40.884 1.00 36.56  ? 315  LYS A O   1 
ATOM   2439 C CB  . LYS A 1 315 ? 8.178   57.721 40.167 1.00 32.72  ? 315  LYS A CB  1 
ATOM   2440 C CG  . LYS A 1 315 ? 8.150   58.881 39.197 1.00 32.72  ? 315  LYS A CG  1 
ATOM   2441 C CD  . LYS A 1 315 ? 7.401   60.056 39.814 1.00 32.72  ? 315  LYS A CD  1 
ATOM   2442 C CE  . LYS A 1 315 ? 7.336   61.220 38.865 1.00 32.72  ? 315  LYS A CE  1 
ATOM   2443 N NZ  . LYS A 1 315 ? 6.747   60.788 37.567 1.00 32.72  ? 315  LYS A NZ  1 
ATOM   2444 N N   . LYS A 1 316 ? 11.237  57.209 38.673 1.00 40.16  ? 316  LYS A N   1 
ATOM   2445 C CA  . LYS A 1 316 ? 12.583  57.763 38.548 1.00 40.16  ? 316  LYS A CA  1 
ATOM   2446 C C   . LYS A 1 316 ? 12.469  59.228 38.149 1.00 40.16  ? 316  LYS A C   1 
ATOM   2447 O O   . LYS A 1 316 ? 11.876  59.548 37.124 1.00 40.16  ? 316  LYS A O   1 
ATOM   2448 C CB  . LYS A 1 316 ? 13.382  57.036 37.473 1.00 48.67  ? 316  LYS A CB  1 
ATOM   2449 C CG  . LYS A 1 316 ? 13.975  55.719 37.900 1.00 48.67  ? 316  LYS A CG  1 
ATOM   2450 C CD  . LYS A 1 316 ? 12.980  54.603 37.805 1.00 48.67  ? 316  LYS A CD  1 
ATOM   2451 C CE  . LYS A 1 316 ? 13.662  53.267 38.047 1.00 48.67  ? 316  LYS A CE  1 
ATOM   2452 N NZ  . LYS A 1 316 ? 12.753  52.137 37.729 1.00 48.67  ? 316  LYS A NZ  1 
ATOM   2453 N N   . THR A 1 317 ? 13.030  60.118 38.954 1.00 35.82  ? 317  THR A N   1 
ATOM   2454 C CA  . THR A 1 317 ? 12.971  61.546 38.664 1.00 35.82  ? 317  THR A CA  1 
ATOM   2455 C C   . THR A 1 317 ? 13.980  62.235 39.579 1.00 35.82  ? 317  THR A C   1 
ATOM   2456 O O   . THR A 1 317 ? 14.891  61.585 40.077 1.00 35.82  ? 317  THR A O   1 
ATOM   2457 C CB  . THR A 1 317 ? 11.518  62.090 38.890 1.00 39.44  ? 317  THR A CB  1 
ATOM   2458 O OG1 . THR A 1 317 ? 11.495  63.511 38.698 1.00 39.44  ? 317  THR A OG1 1 
ATOM   2459 C CG2 . THR A 1 317 ? 11.013  61.737 40.285 1.00 39.44  ? 317  THR A CG2 1 
ATOM   2460 N N   . GLN A 1 318 ? 13.855  63.536 39.789 1.00 31.79  ? 318  GLN A N   1 
ATOM   2461 C CA  . GLN A 1 318 ? 14.782  64.208 40.685 1.00 31.79  ? 318  GLN A CA  1 
ATOM   2462 C C   . GLN A 1 318 ? 14.079  64.375 42.029 1.00 31.79  ? 318  GLN A C   1 
ATOM   2463 O O   . GLN A 1 318 ? 12.867  64.494 42.072 1.00 31.79  ? 318  GLN A O   1 
ATOM   2464 C CB  . GLN A 1 318 ? 15.170  65.592 40.150 1.00 35.82  ? 318  GLN A CB  1 
ATOM   2465 C CG  . GLN A 1 318 ? 15.740  65.631 38.739 1.00 35.82  ? 318  GLN A CG  1 
ATOM   2466 C CD  . GLN A 1 318 ? 14.654  65.598 37.671 1.00 35.82  ? 318  GLN A CD  1 
ATOM   2467 O OE1 . GLN A 1 318 ? 13.615  66.252 37.808 1.00 35.82  ? 318  GLN A OE1 1 
ATOM   2468 N NE2 . GLN A 1 318 ? 14.892  64.841 36.598 1.00 35.82  ? 318  GLN A NE2 1 
ATOM   2469 N N   . ILE A 1 319 ? 14.824  64.349 43.124 1.00 31.83  ? 319  ILE A N   1 
ATOM   2470 C CA  . ILE A 1 319 ? 14.222  64.560 44.432 1.00 31.83  ? 319  ILE A CA  1 
ATOM   2471 C C   . ILE A 1 319 ? 15.166  65.406 45.261 1.00 31.83  ? 319  ILE A C   1 
ATOM   2472 O O   . ILE A 1 319 ? 16.385  65.346 45.100 1.00 31.83  ? 319  ILE A O   1 
ATOM   2473 C CB  . ILE A 1 319 ? 13.953  63.253 45.229 1.00 31.80  ? 319  ILE A CB  1 
ATOM   2474 C CG1 . ILE A 1 319 ? 15.234  62.442 45.357 1.00 31.80  ? 319  ILE A CG1 1 
ATOM   2475 C CG2 . ILE A 1 319 ? 12.841  62.452 44.590 1.00 31.80  ? 319  ILE A CG2 1 
ATOM   2476 C CD1 . ILE A 1 319 ? 15.077  61.230 46.221 1.00 31.80  ? 319  ILE A CD1 1 
ATOM   2477 N N   . LEU A 1 320 ? 14.584  66.207 46.139 1.00 32.77  ? 320  LEU A N   1 
ATOM   2478 C CA  . LEU A 1 320 ? 15.340  67.066 47.019 1.00 32.77  ? 320  LEU A CA  1 
ATOM   2479 C C   . LEU A 1 320 ? 14.809  66.753 48.419 1.00 32.77  ? 320  LEU A C   1 
ATOM   2480 O O   . LEU A 1 320 ? 13.603  66.830 48.658 1.00 32.77  ? 320  LEU A O   1 
ATOM   2481 C CB  . LEU A 1 320 ? 15.095  68.527 46.640 1.00 29.08  ? 320  LEU A CB  1 
ATOM   2482 C CG  . LEU A 1 320 ? 15.917  69.586 47.365 1.00 29.08  ? 320  LEU A CG  1 
ATOM   2483 C CD1 . LEU A 1 320 ? 15.994  70.825 46.497 1.00 29.08  ? 320  LEU A CD1 1 
ATOM   2484 C CD2 . LEU A 1 320 ? 15.303  69.894 48.708 1.00 29.08  ? 320  LEU A CD2 1 
ATOM   2485 N N   . LEU A 1 321 ? 15.697  66.381 49.336 1.00 29.94  ? 321  LEU A N   1 
ATOM   2486 C CA  . LEU A 1 321 ? 15.266  66.040 50.682 1.00 29.94  ? 321  LEU A CA  1 
ATOM   2487 C C   . LEU A 1 321 ? 16.328  66.274 51.754 1.00 29.94  ? 321  LEU A C   1 
ATOM   2488 O O   . LEU A 1 321 ? 17.506  66.459 51.462 1.00 29.94  ? 321  LEU A O   1 
ATOM   2489 C CB  . LEU A 1 321 ? 14.785  64.580 50.717 1.00 35.84  ? 321  LEU A CB  1 
ATOM   2490 C CG  . LEU A 1 321 ? 15.808  63.457 50.541 1.00 35.84  ? 321  LEU A CG  1 
ATOM   2491 C CD1 . LEU A 1 321 ? 15.100  62.113 50.479 1.00 35.84  ? 321  LEU A CD1 1 
ATOM   2492 C CD2 . LEU A 1 321 ? 16.590  63.684 49.272 1.00 35.84  ? 321  LEU A CD2 1 
ATOM   2493 N N   . GLY A 1 322 ? 15.889  66.265 53.007 1.00 31.96  ? 322  GLY A N   1 
ATOM   2494 C CA  . GLY A 1 322 ? 16.796  66.494 54.107 1.00 31.96  ? 322  GLY A CA  1 
ATOM   2495 C C   . GLY A 1 322 ? 16.117  66.304 55.443 1.00 31.96  ? 322  GLY A C   1 
ATOM   2496 O O   . GLY A 1 322 ? 14.975  65.853 55.512 1.00 31.96  ? 322  GLY A O   1 
ATOM   2497 N N   . VAL A 1 323 ? 16.820  66.666 56.507 1.00 31.89  ? 323  VAL A N   1 
ATOM   2498 C CA  . VAL A 1 323 ? 16.312  66.501 57.853 1.00 31.89  ? 323  VAL A CA  1 
ATOM   2499 C C   . VAL A 1 323 ? 16.727  67.666 58.738 1.00 31.89  ? 323  VAL A C   1 
ATOM   2500 O O   . VAL A 1 323 ? 17.550  68.488 58.350 1.00 31.89  ? 323  VAL A O   1 
ATOM   2501 C CB  . VAL A 1 323 ? 16.883  65.204 58.491 1.00 32.43  ? 323  VAL A CB  1 
ATOM   2502 C CG1 . VAL A 1 323 ? 16.525  63.996 57.654 1.00 32.43  ? 323  VAL A CG1 1 
ATOM   2503 C CG2 . VAL A 1 323 ? 18.390  65.314 58.628 1.00 32.43  ? 323  VAL A CG2 1 
ATOM   2504 N N   . ASN A 1 324 ? 16.149  67.718 59.933 1.00 37.62  ? 324  ASN A N   1 
ATOM   2505 C CA  . ASN A 1 324 ? 16.480  68.737 60.925 1.00 37.62  ? 324  ASN A CA  1 
ATOM   2506 C C   . ASN A 1 324 ? 17.455  68.137 61.942 1.00 37.62  ? 324  ASN A C   1 
ATOM   2507 O O   . ASN A 1 324 ? 17.434  66.937 62.200 1.00 37.62  ? 324  ASN A O   1 
ATOM   2508 C CB  . ASN A 1 324 ? 15.223  69.209 61.651 1.00 41.13  ? 324  ASN A CB  1 
ATOM   2509 C CG  . ASN A 1 324 ? 14.332  70.044 60.775 1.00 41.13  ? 324  ASN A CG  1 
ATOM   2510 O OD1 . ASN A 1 324 ? 14.652  70.311 59.610 1.00 41.13  ? 324  ASN A OD1 1 
ATOM   2511 N ND2 . ASN A 1 324 ? 13.203  70.471 61.323 1.00 41.13  ? 324  ASN A ND2 1 
ATOM   2512 N N   . LYS A 1 325 ? 18.294  68.979 62.528 1.00 38.89  ? 325  LYS A N   1 
ATOM   2513 C CA  . LYS A 1 325 ? 19.287  68.536 63.501 1.00 38.89  ? 325  LYS A CA  1 
ATOM   2514 C C   . LYS A 1 325 ? 18.725  67.770 64.696 1.00 38.89  ? 325  LYS A C   1 
ATOM   2515 O O   . LYS A 1 325 ? 19.268  66.736 65.078 1.00 38.89  ? 325  LYS A O   1 
ATOM   2516 C CB  . LYS A 1 325 ? 20.080  69.744 64.013 1.00 42.30  ? 325  LYS A CB  1 
ATOM   2517 C CG  . LYS A 1 325 ? 21.277  69.410 64.884 1.00 42.30  ? 325  LYS A CG  1 
ATOM   2518 C CD  . LYS A 1 325 ? 21.928  70.688 65.403 1.00 42.30  ? 325  LYS A CD  1 
ATOM   2519 C CE  . LYS A 1 325 ? 23.306  70.437 65.990 1.00 42.30  ? 325  LYS A CE  1 
ATOM   2520 N NZ  . LYS A 1 325 ? 23.288  69.498 67.150 1.00 42.30  ? 325  LYS A NZ  1 
ATOM   2521 N N   . ASP A 1 326 ? 17.642  68.268 65.283 1.00 41.87  ? 326  ASP A N   1 
ATOM   2522 C CA  . ASP A 1 326 ? 17.077  67.625 66.462 1.00 41.87  ? 326  ASP A CA  1 
ATOM   2523 C C   . ASP A 1 326 ? 15.636  67.119 66.304 1.00 41.87  ? 326  ASP A C   1 
ATOM   2524 O O   . ASP A 1 326 ? 14.723  67.528 67.018 1.00 41.87  ? 326  ASP A O   1 
ATOM   2525 C CB  . ASP A 1 326 ? 17.192  68.588 67.650 1.00 47.19  ? 326  ASP A CB  1 
ATOM   2526 C CG  . ASP A 1 326 ? 18.634  69.089 67.865 1.00 47.19  ? 326  ASP A CG  1 
ATOM   2527 O OD1 . ASP A 1 326 ? 19.520  68.274 68.227 1.00 47.19  ? 326  ASP A OD1 1 
ATOM   2528 O OD2 . ASP A 1 326 ? 18.887  70.303 67.658 1.00 47.19  ? 326  ASP A OD2 1 
ATOM   2529 N N   . GLU A 1 327 ? 15.459  66.194 65.373 1.00 48.28  ? 327  GLU A N   1 
ATOM   2530 C CA  . GLU A 1 327 ? 14.168  65.596 65.074 1.00 48.28  ? 327  GLU A CA  1 
ATOM   2531 C C   . GLU A 1 327 ? 13.430  64.927 66.243 1.00 48.28  ? 327  GLU A C   1 
ATOM   2532 O O   . GLU A 1 327 ? 12.209  64.804 66.201 1.00 48.28  ? 327  GLU A O   1 
ATOM   2533 C CB  . GLU A 1 327 ? 14.345  64.550 63.963 1.00 69.06  ? 327  GLU A CB  1 
ATOM   2534 C CG  . GLU A 1 327 ? 14.915  65.083 62.650 1.00 69.06  ? 327  GLU A CG  1 
ATOM   2535 C CD  . GLU A 1 327 ? 13.881  65.830 61.822 1.00 69.06  ? 327  GLU A CD  1 
ATOM   2536 O OE1 . GLU A 1 327 ? 12.751  66.035 62.324 1.00 69.06  ? 327  GLU A OE1 1 
ATOM   2537 O OE2 . GLU A 1 327 ? 14.196  66.212 60.669 1.00 69.06  ? 327  GLU A OE2 1 
ATOM   2538 N N   . GLY A 1 328 ? 14.136  64.494 67.282 1.00 40.97  ? 328  GLY A N   1 
ATOM   2539 C CA  . GLY A 1 328 ? 13.445  63.798 68.359 1.00 40.97  ? 328  GLY A CA  1 
ATOM   2540 C C   . GLY A 1 328 ? 12.964  64.503 69.622 1.00 40.97  ? 328  GLY A C   1 
ATOM   2541 O O   . GLY A 1 328 ? 12.044  64.022 70.288 1.00 40.97  ? 328  GLY A O   1 
ATOM   2542 N N   . SER A 1 329 ? 13.559  65.639 69.963 1.00 41.82  ? 329  SER A N   1 
ATOM   2543 C CA  . SER A 1 329 ? 13.180  66.334 71.184 1.00 41.82  ? 329  SER A CA  1 
ATOM   2544 C C   . SER A 1 329 ? 11.680  66.520 71.408 1.00 41.82  ? 329  SER A C   1 
ATOM   2545 O O   . SER A 1 329 ? 11.219  66.502 72.543 1.00 41.82  ? 329  SER A O   1 
ATOM   2546 C CB  . SER A 1 329 ? 13.885  67.685 71.245 1.00 34.66  ? 329  SER A CB  1 
ATOM   2547 O OG  . SER A 1 329 ? 13.487  68.486 70.166 1.00 34.66  ? 329  SER A OG  1 
ATOM   2548 N N   . PHE A 1 330 ? 10.909  66.679 70.344 1.00 40.12  ? 330  PHE A N   1 
ATOM   2549 C CA  . PHE A 1 330 ? 9.476   66.891 70.506 1.00 40.12  ? 330  PHE A CA  1 
ATOM   2550 C C   . PHE A 1 330 ? 8.727   65.701 71.107 1.00 40.12  ? 330  PHE A C   1 
ATOM   2551 O O   . PHE A 1 330 ? 7.836   65.877 71.938 1.00 40.12  ? 330  PHE A O   1 
ATOM   2552 C CB  . PHE A 1 330 ? 8.854   67.260 69.166 1.00 62.26  ? 330  PHE A CB  1 
ATOM   2553 C CG  . PHE A 1 330 ? 7.704   68.204 69.287 1.00 62.26  ? 330  PHE A CG  1 
ATOM   2554 C CD1 . PHE A 1 330 ? 6.477   67.768 69.769 1.00 62.26  ? 330  PHE A CD1 1 
ATOM   2555 C CD2 . PHE A 1 330 ? 7.865   69.554 68.979 1.00 62.26  ? 330  PHE A CD2 1 
ATOM   2556 C CE1 . PHE A 1 330 ? 5.420   68.666 69.950 1.00 62.26  ? 330  PHE A CE1 1 
ATOM   2557 C CE2 . PHE A 1 330 ? 6.816   70.465 69.157 1.00 62.26  ? 330  PHE A CE2 1 
ATOM   2558 C CZ  . PHE A 1 330 ? 5.595   70.019 69.644 1.00 62.26  ? 330  PHE A CZ  1 
ATOM   2559 N N   . PHE A 1 331 ? 9.096   64.490 70.707 1.00 35.79  ? 331  PHE A N   1 
ATOM   2560 C CA  . PHE A 1 331 ? 8.430   63.294 71.198 1.00 35.79  ? 331  PHE A CA  1 
ATOM   2561 C C   . PHE A 1 331 ? 8.917   62.866 72.564 1.00 35.79  ? 331  PHE A C   1 
ATOM   2562 O O   . PHE A 1 331 ? 8.261   62.077 73.239 1.00 35.79  ? 331  PHE A O   1 
ATOM   2563 C CB  . PHE A 1 331 ? 8.596   62.161 70.190 1.00 35.56  ? 331  PHE A CB  1 
ATOM   2564 C CG  . PHE A 1 331 ? 8.209   62.554 68.802 1.00 35.56  ? 331  PHE A CG  1 
ATOM   2565 C CD1 . PHE A 1 331 ? 9.037   63.387 68.050 1.00 35.56  ? 331  PHE A CD1 1 
ATOM   2566 C CD2 . PHE A 1 331 ? 6.990   62.164 68.272 1.00 35.56  ? 331  PHE A CD2 1 
ATOM   2567 C CE1 . PHE A 1 331 ? 8.651   63.829 66.791 1.00 35.56  ? 331  PHE A CE1 1 
ATOM   2568 C CE2 . PHE A 1 331 ? 6.594   62.598 67.012 1.00 35.56  ? 331  PHE A CE2 1 
ATOM   2569 C CZ  . PHE A 1 331 ? 7.426   63.434 66.270 1.00 35.56  ? 331  PHE A CZ  1 
ATOM   2570 N N   . LEU A 1 332 ? 10.073  63.372 72.969 1.00 39.03  ? 332  LEU A N   1 
ATOM   2571 C CA  . LEU A 1 332 ? 10.600  63.053 74.285 1.00 39.03  ? 332  LEU A CA  1 
ATOM   2572 C C   . LEU A 1 332 ? 9.901   63.969 75.291 1.00 39.03  ? 332  LEU A C   1 
ATOM   2573 O O   . LEU A 1 332 ? 9.573   63.562 76.400 1.00 39.03  ? 332  LEU A O   1 
ATOM   2574 C CB  . LEU A 1 332 ? 12.114  63.273 74.323 1.00 34.20  ? 332  LEU A CB  1 
ATOM   2575 C CG  . LEU A 1 332 ? 12.955  62.166 73.697 1.00 34.20  ? 332  LEU A CG  1 
ATOM   2576 C CD1 . LEU A 1 332 ? 14.332  62.684 73.359 1.00 34.20  ? 332  LEU A CD1 1 
ATOM   2577 C CD2 . LEU A 1 332 ? 13.038  61.015 74.660 1.00 34.20  ? 332  LEU A CD2 1 
ATOM   2578 N N   . LEU A 1 333 ? 9.669   65.210 74.885 1.00 37.36  ? 333  LEU A N   1 
ATOM   2579 C CA  . LEU A 1 333 ? 9.002   66.179 75.737 1.00 37.36  ? 333  LEU A CA  1 
ATOM   2580 C C   . LEU A 1 333 ? 7.615   65.688 76.140 1.00 37.36  ? 333  LEU A C   1 
ATOM   2581 O O   . LEU A 1 333 ? 7.245   65.735 77.312 1.00 37.36  ? 333  LEU A O   1 
ATOM   2582 C CB  . LEU A 1 333 ? 8.871   67.519 75.008 1.00 37.60  ? 333  LEU A CB  1 
ATOM   2583 C CG  . LEU A 1 333 ? 7.971   68.551 75.688 1.00 37.60  ? 333  LEU A CG  1 
ATOM   2584 C CD1 . LEU A 1 333 ? 8.562   68.944 77.036 1.00 37.60  ? 333  LEU A CD1 1 
ATOM   2585 C CD2 . LEU A 1 333 ? 7.822   69.773 74.774 1.00 37.60  ? 333  LEU A CD2 1 
ATOM   2586 N N   . TYR A 1 334 ? 6.848   65.217 75.163 1.00 45.54  ? 334  TYR A N   1 
ATOM   2587 C CA  . TYR A 1 334 ? 5.506   64.737 75.436 1.00 45.54  ? 334  TYR A CA  1 
ATOM   2588 C C   . TYR A 1 334 ? 5.453   63.350 76.044 1.00 45.54  ? 334  TYR A C   1 
ATOM   2589 O O   . TYR A 1 334 ? 4.543   63.069 76.822 1.00 45.54  ? 334  TYR A O   1 
ATOM   2590 C CB  . TYR A 1 334 ? 4.651   64.731 74.161 1.00 36.00  ? 334  TYR A CB  1 
ATOM   2591 C CG  . TYR A 1 334 ? 4.136   66.085 73.730 1.00 36.00  ? 334  TYR A CG  1 
ATOM   2592 C CD1 . TYR A 1 334 ? 5.018   67.110 73.410 1.00 36.00  ? 334  TYR A CD1 1 
ATOM   2593 C CD2 . TYR A 1 334 ? 2.766   66.344 73.646 1.00 36.00  ? 334  TYR A CD2 1 
ATOM   2594 C CE1 . TYR A 1 334 ? 4.554   68.364 73.017 1.00 36.00  ? 334  TYR A CE1 1 
ATOM   2595 C CE2 . TYR A 1 334 ? 2.289   67.598 73.250 1.00 36.00  ? 334  TYR A CE2 1 
ATOM   2596 C CZ  . TYR A 1 334 ? 3.193   68.604 72.936 1.00 36.00  ? 334  TYR A CZ  1 
ATOM   2597 O OH  . TYR A 1 334 ? 2.771   69.850 72.531 1.00 36.00  ? 334  TYR A OH  1 
ATOM   2598 N N   . GLY A 1 335 ? 6.413   62.482 75.736 1.00 43.78  ? 335  GLY A N   1 
ATOM   2599 C CA  . GLY A 1 335 ? 6.302   61.136 76.269 1.00 43.78  ? 335  GLY A CA  1 
ATOM   2600 C C   . GLY A 1 335 ? 7.372   60.423 77.073 1.00 43.78  ? 335  GLY A C   1 
ATOM   2601 O O   . GLY A 1 335 ? 7.136   59.290 77.505 1.00 43.78  ? 335  GLY A O   1 
ATOM   2602 N N   . ALA A 1 336 ? 8.533   61.026 77.292 1.00 37.56  ? 336  ALA A N   1 
ATOM   2603 C CA  . ALA A 1 336 ? 9.559   60.329 78.065 1.00 37.56  ? 336  ALA A CA  1 
ATOM   2604 C C   . ALA A 1 336 ? 9.751   60.914 79.461 1.00 37.56  ? 336  ALA A C   1 
ATOM   2605 O O   . ALA A 1 336 ? 9.830   62.128 79.636 1.00 37.56  ? 336  ALA A O   1 
ATOM   2606 C CB  . ALA A 1 336 ? 10.872  60.337 77.315 1.00 28.34  ? 336  ALA A CB  1 
ATOM   2607 N N   . PRO A 1 337 ? 9.845   60.051 80.477 1.00 45.47  ? 337  PRO A N   1 
ATOM   2608 C CA  . PRO A 1 337 ? 10.033  60.556 81.840 1.00 45.47  ? 337  PRO A CA  1 
ATOM   2609 C C   . PRO A 1 337 ? 11.336  61.346 81.973 1.00 45.47  ? 337  PRO A C   1 
ATOM   2610 O O   . PRO A 1 337 ? 12.379  60.937 81.452 1.00 45.47  ? 337  PRO A O   1 
ATOM   2611 C CB  . PRO A 1 337 ? 10.051  59.281 82.674 1.00 49.40  ? 337  PRO A CB  1 
ATOM   2612 C CG  . PRO A 1 337 ? 10.743  58.307 81.732 1.00 49.40  ? 337  PRO A CG  1 
ATOM   2613 C CD  . PRO A 1 337 ? 10.038  58.590 80.422 1.00 49.40  ? 337  PRO A CD  1 
ATOM   2614 N N   . GLY A 1 338 ? 11.269  62.485 82.658 1.00 41.52  ? 338  GLY A N   1 
ATOM   2615 C CA  . GLY A 1 338 ? 12.461  63.288 82.853 1.00 41.52  ? 338  GLY A CA  1 
ATOM   2616 C C   . GLY A 1 338 ? 12.499  64.591 82.086 1.00 41.52  ? 338  GLY A C   1 
ATOM   2617 O O   . GLY A 1 338 ? 13.178  65.521 82.511 1.00 41.52  ? 338  GLY A O   1 
ATOM   2618 N N   . PHE A 1 339 ? 11.780  64.671 80.968 1.00 39.73  ? 339  PHE A N   1 
ATOM   2619 C CA  . PHE A 1 339 ? 11.779  65.887 80.157 1.00 39.73  ? 339  PHE A CA  1 
ATOM   2620 C C   . PHE A 1 339 ? 10.652  66.829 80.532 1.00 39.73  ? 339  PHE A C   1 
ATOM   2621 O O   . PHE A 1 339 ? 9.548   66.392 80.832 1.00 39.73  ? 339  PHE A O   1 
ATOM   2622 C CB  . PHE A 1 339 ? 11.688  65.549 78.665 1.00 30.89  ? 339  PHE A CB  1 
ATOM   2623 C CG  . PHE A 1 339 ? 12.838  64.732 78.160 1.00 30.89  ? 339  PHE A CG  1 
ATOM   2624 C CD1 . PHE A 1 339 ? 12.953  63.385 78.491 1.00 30.89  ? 339  PHE A CD1 1 
ATOM   2625 C CD2 . PHE A 1 339 ? 13.807  65.305 77.343 1.00 30.89  ? 339  PHE A CD2 1 
ATOM   2626 C CE1 . PHE A 1 339 ? 14.014  62.618 78.014 1.00 30.89  ? 339  PHE A CE1 1 
ATOM   2627 C CE2 . PHE A 1 339 ? 14.879  64.548 76.858 1.00 30.89  ? 339  PHE A CE2 1 
ATOM   2628 C CZ  . PHE A 1 339 ? 14.979  63.201 77.195 1.00 30.89  ? 339  PHE A CZ  1 
ATOM   2629 N N   . SER A 1 340 ? 10.939  68.125 80.516 1.00 38.78  ? 340  SER A N   1 
ATOM   2630 C CA  . SER A 1 340 ? 9.946   69.133 80.865 1.00 38.78  ? 340  SER A CA  1 
ATOM   2631 C C   . SER A 1 340 ? 10.129  70.375 80.016 1.00 38.78  ? 340  SER A C   1 
ATOM   2632 O O   . SER A 1 340 ? 11.249  70.746 79.677 1.00 38.78  ? 340  SER A O   1 
ATOM   2633 C CB  . SER A 1 340 ? 10.068  69.521 82.342 1.00 56.02  ? 340  SER A CB  1 
ATOM   2634 O OG  . SER A 1 340 ? 9.707   68.439 83.184 1.00 56.02  ? 340  SER A OG  1 
ATOM   2635 N N   . LYS A 1 341 ? 9.025   71.027 79.687 1.00 37.97  ? 341  LYS A N   1 
ATOM   2636 C CA  . LYS A 1 341 ? 9.100   72.221 78.874 1.00 37.97  ? 341  LYS A CA  1 
ATOM   2637 C C   . LYS A 1 341 ? 9.807   73.351 79.600 1.00 37.97  ? 341  LYS A C   1 
ATOM   2638 O O   . LYS A 1 341 ? 10.470  74.168 78.973 1.00 37.97  ? 341  LYS A O   1 
ATOM   2639 C CB  . LYS A 1 341 ? 7.702   72.690 78.462 1.00 46.58  ? 341  LYS A CB  1 
ATOM   2640 C CG  . LYS A 1 341 ? 7.751   73.813 77.426 1.00 46.58  ? 341  LYS A CG  1 
ATOM   2641 C CD  . LYS A 1 341 ? 6.368   74.283 76.969 1.00 46.58  ? 341  LYS A CD  1 
ATOM   2642 C CE  . LYS A 1 341 ? 5.667   75.060 78.067 1.00 46.58  ? 341  LYS A CE  1 
ATOM   2643 N NZ  . LYS A 1 341 ? 6.482   76.216 78.562 1.00 46.58  ? 341  LYS A NZ  1 
ATOM   2644 N N   . ASP A 1 342 ? 9.689   73.391 80.922 1.00 38.96  ? 342  ASP A N   1 
ATOM   2645 C CA  . ASP A 1 342 ? 10.293  74.478 81.676 1.00 38.96  ? 342  ASP A CA  1 
ATOM   2646 C C   . ASP A 1 342 ? 11.606  74.223 82.421 1.00 38.96  ? 342  ASP A C   1 
ATOM   2647 O O   . ASP A 1 342 ? 11.926  74.946 83.357 1.00 38.96  ? 342  ASP A O   1 
ATOM   2648 C CB  . ASP A 1 342 ? 9.256   75.054 82.653 1.00 57.18  ? 342  ASP A CB  1 
ATOM   2649 C CG  . ASP A 1 342 ? 8.023   75.633 81.946 1.00 57.18  ? 342  ASP A CG  1 
ATOM   2650 O OD1 . ASP A 1 342 ? 8.057   75.848 80.710 1.00 57.18  ? 342  ASP A OD1 1 
ATOM   2651 O OD2 . ASP A 1 342 ? 7.010   75.890 82.638 1.00 57.18  ? 342  ASP A OD2 1 
ATOM   2652 N N   . SER A 1 343 ? 12.368  73.209 82.028 1.00 41.23  ? 343  SER A N   1 
ATOM   2653 C CA  . SER A 1 343 ? 13.651  72.941 82.680 1.00 41.23  ? 343  SER A CA  1 
ATOM   2654 C C   . SER A 1 343 ? 14.661  72.445 81.654 1.00 41.23  ? 343  SER A C   1 
ATOM   2655 O O   . SER A 1 343 ? 14.296  72.128 80.520 1.00 41.23  ? 343  SER A O   1 
ATOM   2656 C CB  . SER A 1 343 ? 13.507  71.891 83.779 1.00 50.63  ? 343  SER A CB  1 
ATOM   2657 O OG  . SER A 1 343 ? 13.395  70.588 83.233 1.00 50.63  ? 343  SER A OG  1 
ATOM   2658 N N   . GLU A 1 344 ? 15.927  72.377 82.058 1.00 40.37  ? 344  GLU A N   1 
ATOM   2659 C CA  . GLU A 1 344 ? 17.001  71.920 81.180 1.00 40.37  ? 344  GLU A CA  1 
ATOM   2660 C C   . GLU A 1 344 ? 16.881  70.431 80.892 1.00 40.37  ? 344  GLU A C   1 
ATOM   2661 O O   . GLU A 1 344 ? 17.614  69.885 80.059 1.00 40.37  ? 344  GLU A O   1 
ATOM   2662 C CB  . GLU A 1 344 ? 18.359  72.153 81.827 1.00 78.10  ? 344  GLU A CB  1 
ATOM   2663 C CG  . GLU A 1 344 ? 18.819  73.584 81.933 1.00 78.10  ? 344  GLU A CG  1 
ATOM   2664 C CD  . GLU A 1 344 ? 20.219  73.649 82.527 1.00 78.10  ? 344  GLU A CD  1 
ATOM   2665 O OE1 . GLU A 1 344 ? 20.398  73.201 83.698 1.00 78.10  ? 344  GLU A OE1 1 
ATOM   2666 O OE2 . GLU A 1 344 ? 21.138  74.129 81.813 1.00 78.10  ? 344  GLU A OE2 1 
ATOM   2667 N N   . SER A 1 345 ? 15.984  69.773 81.616 1.00 42.69  ? 345  SER A N   1 
ATOM   2668 C CA  . SER A 1 345 ? 15.751  68.348 81.451 1.00 42.69  ? 345  SER A CA  1 
ATOM   2669 C C   . SER A 1 345 ? 17.024  67.493 81.442 1.00 42.69  ? 345  SER A C   1 
ATOM   2670 O O   . SER A 1 345 ? 17.277  66.734 80.497 1.00 42.69  ? 345  SER A O   1 
ATOM   2671 C CB  . SER A 1 345 ? 14.958  68.101 80.164 1.00 35.30  ? 345  SER A CB  1 
ATOM   2672 O OG  . SER A 1 345 ? 13.686  68.721 80.217 1.00 35.30  ? 345  SER A OG  1 
ATOM   2673 N N   . LYS A 1 346 ? 17.845  67.613 82.473 1.00 40.16  ? 346  LYS A N   1 
ATOM   2674 C CA  . LYS A 1 346 ? 19.037  66.782 82.521 1.00 40.16  ? 346  LYS A CA  1 
ATOM   2675 C C   . LYS A 1 346 ? 18.510  65.395 82.888 1.00 40.16  ? 346  LYS A C   1 
ATOM   2676 O O   . LYS A 1 346 ? 17.692  65.259 83.790 1.00 40.16  ? 346  LYS A O   1 
ATOM   2677 C CB  . LYS A 1 346 ? 20.002  67.318 83.570 1.00 68.56  ? 346  LYS A CB  1 
ATOM   2678 C CG  . LYS A 1 346 ? 20.574  68.686 83.216 1.00 68.56  ? 346  LYS A CG  1 
ATOM   2679 C CD  . LYS A 1 346 ? 21.355  69.264 84.392 1.00 68.56  ? 346  LYS A CD  1 
ATOM   2680 C CE  . LYS A 1 346 ? 21.988  70.608 84.036 1.00 68.56  ? 346  LYS A CE  1 
ATOM   2681 N NZ  . LYS A 1 346 ? 22.849  71.112 85.152 1.00 68.56  ? 346  LYS A NZ  1 
ATOM   2682 N N   . ILE A 1 347 ? 18.963  64.367 82.183 1.00 48.48  ? 347  ILE A N   1 
ATOM   2683 C CA  . ILE A 1 347 ? 18.458  63.017 82.412 1.00 48.48  ? 347  ILE A CA  1 
ATOM   2684 C C   . ILE A 1 347 ? 19.413  62.080 83.159 1.00 48.48  ? 347  ILE A C   1 
ATOM   2685 O O   . ILE A 1 347 ? 20.607  62.009 82.860 1.00 48.48  ? 347  ILE A O   1 
ATOM   2686 C CB  . ILE A 1 347 ? 18.039  62.382 81.046 1.00 42.50  ? 347  ILE A CB  1 
ATOM   2687 C CG1 . ILE A 1 347 ? 16.987  63.263 80.375 1.00 42.50  ? 347  ILE A CG1 1 
ATOM   2688 C CG2 . ILE A 1 347 ? 17.442  61.005 81.247 1.00 42.50  ? 347  ILE A CG2 1 
ATOM   2689 C CD1 . ILE A 1 347 ? 15.717  63.388 81.186 1.00 42.50  ? 347  ILE A CD1 1 
ATOM   2690 N N   . SER A 1 348 ? 18.868  61.359 84.132 1.00 49.88  ? 348  SER A N   1 
ATOM   2691 C CA  . SER A 1 348 ? 19.639  60.416 84.938 1.00 49.88  ? 348  SER A CA  1 
ATOM   2692 C C   . SER A 1 348 ? 19.875  59.141 84.137 1.00 49.88  ? 348  SER A C   1 
ATOM   2693 O O   . SER A 1 348 ? 19.289  58.964 83.069 1.00 49.88  ? 348  SER A O   1 
ATOM   2694 C CB  . SER A 1 348 ? 18.853  60.053 86.184 1.00 46.77  ? 348  SER A CB  1 
ATOM   2695 O OG  . SER A 1 348 ? 17.726  59.268 85.817 1.00 46.77  ? 348  SER A OG  1 
ATOM   2696 N N   . ARG A 1 349 ? 20.729  58.253 84.641 1.00 56.35  ? 349  ARG A N   1 
ATOM   2697 C CA  . ARG A 1 349 ? 20.977  56.998 83.941 1.00 56.35  ? 349  ARG A CA  1 
ATOM   2698 C C   . ARG A 1 349 ? 19.647  56.266 83.918 1.00 56.35  ? 349  ARG A C   1 
ATOM   2699 O O   . ARG A 1 349 ? 19.293  55.655 82.915 1.00 56.35  ? 349  ARG A O   1 
ATOM   2700 C CB  . ARG A 1 349 ? 22.008  56.140 84.683 1.00 51.71  ? 349  ARG A CB  1 
ATOM   2701 C CG  . ARG A 1 349 ? 23.430  56.234 84.154 1.00 51.71  ? 349  ARG A CG  1 
ATOM   2702 C CD  . ARG A 1 349 ? 23.614  55.403 82.890 1.00 51.71  ? 349  ARG A CD  1 
ATOM   2703 N NE  . ARG A 1 349 ? 23.736  56.250 81.710 1.00 51.71  ? 349  ARG A NE  1 
ATOM   2704 C CZ  . ARG A 1 349 ? 23.831  55.796 80.463 1.00 51.71  ? 349  ARG A CZ  1 
ATOM   2705 N NH1 . ARG A 1 349 ? 23.819  54.489 80.227 1.00 51.71  ? 349  ARG A NH1 1 
ATOM   2706 N NH2 . ARG A 1 349 ? 23.928  56.653 79.448 1.00 51.71  ? 349  ARG A NH2 1 
ATOM   2707 N N   . GLU A 1 350 ? 18.910  56.347 85.025 1.00 50.65  ? 350  GLU A N   1 
ATOM   2708 C CA  . GLU A 1 350 ? 17.607  55.687 85.159 1.00 50.65  ? 350  GLU A CA  1 
ATOM   2709 C C   . GLU A 1 350 ? 16.712  56.026 83.985 1.00 50.65  ? 350  GLU A C   1 
ATOM   2710 O O   . GLU A 1 350 ? 16.316  55.146 83.218 1.00 50.65  ? 350  GLU A O   1 
ATOM   2711 C CB  . GLU A 1 350 ? 16.871  56.148 86.424 1.00 101.70 ? 350  GLU A CB  1 
ATOM   2712 C CG  . GLU A 1 350 ? 17.759  56.557 87.582 1.00 101.70 ? 350  GLU A CG  1 
ATOM   2713 C CD  . GLU A 1 350 ? 18.375  55.365 88.263 1.00 101.70 ? 350  GLU A CD  1 
ATOM   2714 O OE1 . GLU A 1 350 ? 19.086  54.594 87.571 1.00 101.70 ? 350  GLU A OE1 1 
ATOM   2715 O OE2 . GLU A 1 350 ? 18.139  55.203 89.487 1.00 101.70 ? 350  GLU A OE2 1 
ATOM   2716 N N   . ASP A 1 351 ? 16.382  57.311 83.861 1.00 46.34  ? 351  ASP A N   1 
ATOM   2717 C CA  . ASP A 1 351 ? 15.509  57.776 82.783 1.00 46.34  ? 351  ASP A CA  1 
ATOM   2718 C C   . ASP A 1 351 ? 16.081  57.569 81.376 1.00 46.34  ? 351  ASP A C   1 
ATOM   2719 O O   . ASP A 1 351 ? 15.328  57.392 80.413 1.00 46.34  ? 351  ASP A O   1 
ATOM   2720 C CB  . ASP A 1 351 ? 15.140  59.248 82.997 1.00 79.74  ? 351  ASP A CB  1 
ATOM   2721 C CG  . ASP A 1 351 ? 14.356  59.475 84.300 1.00 79.74  ? 351  ASP A CG  1 
ATOM   2722 O OD1 . ASP A 1 351 ? 13.534  58.597 84.683 1.00 79.74  ? 351  ASP A OD1 1 
ATOM   2723 O OD2 . ASP A 1 351 ? 14.550  60.538 84.943 1.00 79.74  ? 351  ASP A OD2 1 
ATOM   2724 N N   . PHE A 1 352 ? 17.404  57.569 81.254 1.00 49.01  ? 352  PHE A N   1 
ATOM   2725 C CA  . PHE A 1 352 ? 18.011  57.363 79.950 1.00 49.01  ? 352  PHE A CA  1 
ATOM   2726 C C   . PHE A 1 352 ? 17.601  56.001 79.413 1.00 49.01  ? 352  PHE A C   1 
ATOM   2727 O O   . PHE A 1 352 ? 17.018  55.893 78.328 1.00 49.01  ? 352  PHE A O   1 
ATOM   2728 C CB  . PHE A 1 352 ? 19.526  57.409 80.038 1.00 32.46  ? 352  PHE A CB  1 
ATOM   2729 C CG  . PHE A 1 352 ? 20.202  57.184 78.725 1.00 32.46  ? 352  PHE A CG  1 
ATOM   2730 C CD1 . PHE A 1 352 ? 20.214  58.178 77.760 1.00 32.46  ? 352  PHE A CD1 1 
ATOM   2731 C CD2 . PHE A 1 352 ? 20.787  55.958 78.434 1.00 32.46  ? 352  PHE A CD2 1 
ATOM   2732 C CE1 . PHE A 1 352 ? 20.796  57.953 76.523 1.00 32.46  ? 352  PHE A CE1 1 
ATOM   2733 C CE2 . PHE A 1 352 ? 21.372  55.717 77.200 1.00 32.46  ? 352  PHE A CE2 1 
ATOM   2734 C CZ  . PHE A 1 352 ? 21.378  56.717 76.240 1.00 32.46  ? 352  PHE A CZ  1 
ATOM   2735 N N   . MET A 1 353 ? 17.908  54.960 80.179 1.00 53.08  ? 353  MET A N   1 
ATOM   2736 C CA  . MET A 1 353 ? 17.582  53.598 79.775 1.00 53.08  ? 353  MET A CA  1 
ATOM   2737 C C   . MET A 1 353 ? 16.078  53.405 79.686 1.00 53.08  ? 353  MET A C   1 
ATOM   2738 O O   . MET A 1 353 ? 15.589  52.568 78.921 1.00 53.08  ? 353  MET A O   1 
ATOM   2739 C CB  . MET A 1 353 ? 18.183  52.599 80.760 1.00 77.22  ? 353  MET A CB  1 
ATOM   2740 C CG  . MET A 1 353 ? 19.701  52.628 80.791 1.00 77.22  ? 353  MET A CG  1 
ATOM   2741 S SD  . MET A 1 353 ? 20.317  51.332 81.888 1.00 77.22  ? 353  MET A SD  1 
ATOM   2742 C CE  . MET A 1 353 ? 19.691  51.953 83.528 1.00 77.22  ? 353  MET A CE  1 
ATOM   2743 N N   . SER A 1 354 ? 15.345  54.179 80.475 1.00 43.43  ? 354  SER A N   1 
ATOM   2744 C CA  . SER A 1 354 ? 13.895  54.101 80.453 1.00 43.43  ? 354  SER A CA  1 
ATOM   2745 C C   . SER A 1 354 ? 13.396  54.658 79.109 1.00 43.43  ? 354  SER A C   1 
ATOM   2746 O O   . SER A 1 354 ? 12.459  54.119 78.503 1.00 43.43  ? 354  SER A O   1 
ATOM   2747 C CB  . SER A 1 354 ? 13.329  54.925 81.596 1.00 61.31  ? 354  SER A CB  1 
ATOM   2748 O OG  . SER A 1 354 ? 12.335  54.187 82.271 1.00 61.31  ? 354  SER A OG  1 
ATOM   2749 N N   . GLY A 1 355 ? 14.045  55.732 78.651 1.00 34.23  ? 355  GLY A N   1 
ATOM   2750 C CA  . GLY A 1 355 ? 13.682  56.359 77.395 1.00 34.23  ? 355  GLY A CA  1 
ATOM   2751 C C   . GLY A 1 355 ? 14.067  55.498 76.209 1.00 34.23  ? 355  GLY A C   1 
ATOM   2752 O O   . GLY A 1 355 ? 13.389  55.487 75.183 1.00 34.23  ? 355  GLY A O   1 
ATOM   2753 N N   . VAL A 1 356 ? 15.166  54.771 76.350 1.00 39.74  ? 356  VAL A N   1 
ATOM   2754 C CA  . VAL A 1 356 ? 15.621  53.894 75.282 1.00 39.74  ? 356  VAL A CA  1 
ATOM   2755 C C   . VAL A 1 356 ? 14.595  52.784 75.062 1.00 39.74  ? 356  VAL A C   1 
ATOM   2756 O O   . VAL A 1 356 ? 14.326  52.392 73.931 1.00 39.74  ? 356  VAL A O   1 
ATOM   2757 C CB  . VAL A 1 356 ? 16.992  53.273 75.618 1.00 32.72  ? 356  VAL A CB  1 
ATOM   2758 C CG1 . VAL A 1 356 ? 17.320  52.168 74.634 1.00 32.72  ? 356  VAL A CG1 1 
ATOM   2759 C CG2 . VAL A 1 356 ? 18.058  54.346 75.581 1.00 32.72  ? 356  VAL A CG2 1 
ATOM   2760 N N   . LYS A 1 357 ? 14.014  52.289 76.148 1.00 43.42  ? 357  LYS A N   1 
ATOM   2761 C CA  . LYS A 1 357 ? 13.013  51.230 76.054 1.00 43.42  ? 357  LYS A CA  1 
ATOM   2762 C C   . LYS A 1 357 ? 11.782  51.753 75.312 1.00 43.42  ? 357  LYS A C   1 
ATOM   2763 O O   . LYS A 1 357 ? 11.149  51.015 74.567 1.00 43.42  ? 357  LYS A O   1 
ATOM   2764 C CB  . LYS A 1 357 ? 12.634  50.741 77.465 1.00 65.37  ? 357  LYS A CB  1 
ATOM   2765 C CG  . LYS A 1 357 ? 11.589  49.619 77.528 1.00 65.37  ? 357  LYS A CG  1 
ATOM   2766 C CD  . LYS A 1 357 ? 12.065  48.333 76.865 1.00 65.37  ? 357  LYS A CD  1 
ATOM   2767 C CE  . LYS A 1 357 ? 10.971  47.264 76.841 1.00 65.37  ? 357  LYS A CE  1 
ATOM   2768 N NZ  . LYS A 1 357 ? 11.366  46.082 75.978 1.00 65.37  ? 357  LYS A NZ  1 
ATOM   2769 N N   . LEU A 1 358 ? 11.464  53.030 75.508 1.00 34.53  ? 358  LEU A N   1 
ATOM   2770 C CA  . LEU A 1 358 ? 10.318  53.674 74.865 1.00 34.53  ? 358  LEU A CA  1 
ATOM   2771 C C   . LEU A 1 358 ? 10.571  54.032 73.388 1.00 34.53  ? 358  LEU A C   1 
ATOM   2772 O O   . LEU A 1 358 ? 9.634   54.125 72.594 1.00 34.53  ? 358  LEU A O   1 
ATOM   2773 C CB  . LEU A 1 358 ? 9.963   54.951 75.633 1.00 32.77  ? 358  LEU A CB  1 
ATOM   2774 C CG  . LEU A 1 358 ? 8.760   55.078 76.576 1.00 32.77  ? 358  LEU A CG  1 
ATOM   2775 C CD1 . LEU A 1 358 ? 8.490   53.819 77.343 1.00 32.77  ? 358  LEU A CD1 1 
ATOM   2776 C CD2 . LEU A 1 358 ? 9.037   56.215 77.529 1.00 32.77  ? 358  LEU A CD2 1 
ATOM   2777 N N   . SER A 1 359 ? 11.837  54.225 73.020 1.00 39.20  ? 359  SER A N   1 
ATOM   2778 C CA  . SER A 1 359 ? 12.192  54.603 71.653 1.00 39.20  ? 359  SER A CA  1 
ATOM   2779 C C   . SER A 1 359 ? 12.361  53.439 70.696 1.00 39.20  ? 359  SER A C   1 
ATOM   2780 O O   . SER A 1 359 ? 12.147  53.581 69.497 1.00 39.20  ? 359  SER A O   1 
ATOM   2781 C CB  . SER A 1 359 ? 13.477  55.416 71.658 1.00 38.18  ? 359  SER A CB  1 
ATOM   2782 O OG  . SER A 1 359 ? 13.415  56.429 72.639 1.00 38.18  ? 359  SER A OG  1 
ATOM   2783 N N   . VAL A 1 360 ? 12.763  52.292 71.219 1.00 39.48  ? 360  VAL A N   1 
ATOM   2784 C CA  . VAL A 1 360 ? 12.950  51.121 70.384 1.00 39.48  ? 360  VAL A CA  1 
ATOM   2785 C C   . VAL A 1 360 ? 12.092  50.050 71.024 1.00 39.48  ? 360  VAL A C   1 
ATOM   2786 O O   . VAL A 1 360 ? 12.594  49.057 71.535 1.00 39.48  ? 360  VAL A O   1 
ATOM   2787 C CB  . VAL A 1 360 ? 14.416  50.680 70.389 1.00 36.34  ? 360  VAL A CB  1 
ATOM   2788 C CG1 . VAL A 1 360 ? 14.631  49.581 69.361 1.00 36.34  ? 360  VAL A CG1 1 
ATOM   2789 C CG2 . VAL A 1 360 ? 15.316  51.885 70.113 1.00 36.34  ? 360  VAL A CG2 1 
ATOM   2790 N N   . PRO A 1 361 ? 10.770  50.238 70.975 1.00 45.64  ? 361  PRO A N   1 
ATOM   2791 C CA  . PRO A 1 361 ? 9.754   49.348 71.539 1.00 45.64  ? 361  PRO A CA  1 
ATOM   2792 C C   . PRO A 1 361 ? 9.780   47.889 71.099 1.00 45.64  ? 361  PRO A C   1 
ATOM   2793 O O   . PRO A 1 361 ? 9.441   46.991 71.876 1.00 45.64  ? 361  PRO A O   1 
ATOM   2794 C CB  . PRO A 1 361 ? 8.462   50.048 71.156 1.00 43.72  ? 361  PRO A CB  1 
ATOM   2795 C CG  . PRO A 1 361 ? 8.797   50.636 69.821 1.00 43.72  ? 361  PRO A CG  1 
ATOM   2796 C CD  . PRO A 1 361 ? 10.154  51.223 70.065 1.00 43.72  ? 361  PRO A CD  1 
ATOM   2797 N N   . HIS A 1 362 ? 10.191  47.650 69.861 1.00 65.83  ? 362  HIS A N   1 
ATOM   2798 C CA  . HIS A 1 362 ? 10.232  46.293 69.318 1.00 65.83  ? 362  HIS A CA  1 
ATOM   2799 C C   . HIS A 1 362 ? 11.557  45.571 69.548 1.00 65.83  ? 362  HIS A C   1 
ATOM   2800 O O   . HIS A 1 362 ? 11.845  44.587 68.860 1.00 65.83  ? 362  HIS A O   1 
ATOM   2801 C CB  . HIS A 1 362 ? 9.987   46.346 67.810 1.00 67.75  ? 362  HIS A CB  1 
ATOM   2802 C CG  . HIS A 1 362 ? 11.001  47.165 67.071 1.00 67.75  ? 362  HIS A CG  1 
ATOM   2803 N ND1 . HIS A 1 362 ? 11.140  48.526 67.262 1.00 67.75  ? 362  HIS A ND1 1 
ATOM   2804 C CD2 . HIS A 1 362 ? 11.929  46.818 66.145 1.00 67.75  ? 362  HIS A CD2 1 
ATOM   2805 C CE1 . HIS A 1 362 ? 12.107  48.983 66.483 1.00 67.75  ? 362  HIS A CE1 1 
ATOM   2806 N NE2 . HIS A 1 362 ? 12.603  47.967 65.794 1.00 67.75  ? 362  HIS A NE2 1 
ATOM   2807 N N   . ALA A 1 363 ? 12.357  46.032 70.503 1.00 48.58  ? 363  ALA A N   1 
ATOM   2808 C CA  . ALA A 1 363 ? 13.661  45.416 70.719 1.00 48.58  ? 363  ALA A CA  1 
ATOM   2809 C C   . ALA A 1 363 ? 13.798  44.545 71.959 1.00 48.58  ? 363  ALA A C   1 
ATOM   2810 O O   . ALA A 1 363 ? 13.325  44.910 73.030 1.00 48.58  ? 363  ALA A O   1 
ATOM   2811 C CB  . ALA A 1 363 ? 14.730  46.504 70.744 1.00 38.74  ? 363  ALA A CB  1 
ATOM   2812 N N   . ASN A 1 364 ? 14.462  43.399 71.812 1.00 44.37  ? 364  ASN A N   1 
ATOM   2813 C CA  . ASN A 1 364 ? 14.685  42.518 72.952 1.00 44.37  ? 364  ASN A CA  1 
ATOM   2814 C C   . ASN A 1 364 ? 15.755  43.167 73.835 1.00 44.37  ? 364  ASN A C   1 
ATOM   2815 O O   . ASN A 1 364 ? 16.316  44.209 73.478 1.00 44.37  ? 364  ASN A O   1 
ATOM   2816 C CB  . ASN A 1 364 ? 15.149  41.125 72.502 1.00 50.30  ? 364  ASN A CB  1 
ATOM   2817 C CG  . ASN A 1 364 ? 16.379  41.169 71.613 1.00 50.30  ? 364  ASN A CG  1 
ATOM   2818 O OD1 . ASN A 1 364 ? 17.179  42.105 71.685 1.00 50.30  ? 364  ASN A OD1 1 
ATOM   2819 N ND2 . ASN A 1 364 ? 16.546  40.147 70.779 1.00 50.30  ? 364  ASN A ND2 1 
ATOM   2820 N N   . ASP A 1 365 ? 16.045  42.560 74.980 1.00 43.86  ? 365  ASP A N   1 
ATOM   2821 C CA  . ASP A 1 365 ? 17.030  43.129 75.889 1.00 43.86  ? 365  ASP A CA  1 
ATOM   2822 C C   . ASP A 1 365 ? 18.426  43.269 75.274 1.00 43.86  ? 365  ASP A C   1 
ATOM   2823 O O   . ASP A 1 365 ? 19.139  44.242 75.538 1.00 43.86  ? 365  ASP A O   1 
ATOM   2824 C CB  . ASP A 1 365 ? 17.065  42.312 77.181 1.00 100.09 ? 365  ASP A CB  1 
ATOM   2825 C CG  . ASP A 1 365 ? 15.887  42.650 78.117 1.00 100.09 ? 365  ASP A CG  1 
ATOM   2826 O OD1 . ASP A 1 365 ? 14.925  43.328 77.656 1.00 100.09 ? 365  ASP A OD1 1 
ATOM   2827 O OD2 . ASP A 1 365 ? 15.919  42.240 79.314 1.00 100.09 ? 365  ASP A OD2 1 
ATOM   2828 N N   . LEU A 1 366 ? 18.816  42.311 74.446 1.00 37.22  ? 366  LEU A N   1 
ATOM   2829 C CA  . LEU A 1 366 ? 20.113  42.392 73.807 1.00 37.22  ? 366  LEU A CA  1 
ATOM   2830 C C   . LEU A 1 366 ? 20.147  43.656 72.946 1.00 37.22  ? 366  LEU A C   1 
ATOM   2831 O O   . LEU A 1 366 ? 21.139  44.381 72.929 1.00 37.22  ? 366  LEU A O   1 
ATOM   2832 C CB  . LEU A 1 366 ? 20.349  41.159 72.939 1.00 48.50  ? 366  LEU A CB  1 
ATOM   2833 C CG  . LEU A 1 366 ? 21.669  41.171 72.169 1.00 48.50  ? 366  LEU A CG  1 
ATOM   2834 C CD1 . LEU A 1 366 ? 22.832  41.334 73.137 1.00 48.50  ? 366  LEU A CD1 1 
ATOM   2835 C CD2 . LEU A 1 366 ? 21.799  39.887 71.372 1.00 48.50  ? 366  LEU A CD2 1 
ATOM   2836 N N   . GLY A 1 367 ? 19.052  43.918 72.235 1.00 35.06  ? 367  GLY A N   1 
ATOM   2837 C CA  . GLY A 1 367 ? 18.974  45.096 71.384 1.00 35.06  ? 367  GLY A CA  1 
ATOM   2838 C C   . GLY A 1 367 ? 19.009  46.401 72.156 1.00 35.06  ? 367  GLY A C   1 
ATOM   2839 O O   . GLY A 1 367 ? 19.672  47.353 71.755 1.00 35.06  ? 367  GLY A O   1 
ATOM   2840 N N   . LEU A 1 368 ? 18.284  46.449 73.265 1.00 36.45  ? 368  LEU A N   1 
ATOM   2841 C CA  . LEU A 1 368 ? 18.262  47.641 74.092 1.00 36.45  ? 368  LEU A CA  1 
ATOM   2842 C C   . LEU A 1 368 ? 19.680  47.914 74.542 1.00 36.45  ? 368  LEU A C   1 
ATOM   2843 O O   . LEU A 1 368 ? 20.114  49.061 74.579 1.00 36.45  ? 368  LEU A O   1 
ATOM   2844 C CB  . LEU A 1 368 ? 17.357  47.434 75.306 1.00 36.15  ? 368  LEU A CB  1 
ATOM   2845 C CG  . LEU A 1 368 ? 15.876  47.326 74.939 1.00 36.15  ? 368  LEU A CG  1 
ATOM   2846 C CD1 . LEU A 1 368 ? 15.053  46.939 76.152 1.00 36.15  ? 368  LEU A CD1 1 
ATOM   2847 C CD2 . LEU A 1 368 ? 15.412  48.657 74.370 1.00 36.15  ? 368  LEU A CD2 1 
ATOM   2848 N N   . ASP A 1 369 ? 20.410  46.854 74.877 1.00 43.59  ? 369  ASP A N   1 
ATOM   2849 C CA  . ASP A 1 369 ? 21.794  47.019 75.307 1.00 43.59  ? 369  ASP A CA  1 
ATOM   2850 C C   . ASP A 1 369 ? 22.682  47.519 74.166 1.00 43.59  ? 369  ASP A C   1 
ATOM   2851 O O   . ASP A 1 369 ? 23.579  48.330 74.395 1.00 43.59  ? 369  ASP A O   1 
ATOM   2852 C CB  . ASP A 1 369 ? 22.353  45.715 75.902 1.00 74.49  ? 369  ASP A CB  1 
ATOM   2853 C CG  . ASP A 1 369 ? 21.800  45.431 77.303 1.00 74.49  ? 369  ASP A CG  1 
ATOM   2854 O OD1 . ASP A 1 369 ? 21.496  46.419 78.027 1.00 74.49  ? 369  ASP A OD1 1 
ATOM   2855 O OD2 . ASP A 1 369 ? 21.679  44.234 77.694 1.00 74.49  ? 369  ASP A OD2 1 
ATOM   2856 N N   . ALA A 1 370 ? 22.433  47.057 72.946 1.00 37.09  ? 370  ALA A N   1 
ATOM   2857 C CA  . ALA A 1 370 ? 23.232  47.519 71.816 1.00 37.09  ? 370  ALA A CA  1 
ATOM   2858 C C   . ALA A 1 370 ? 23.057  49.030 71.656 1.00 37.09  ? 370  ALA A C   1 
ATOM   2859 O O   . ALA A 1 370 ? 24.042  49.757 71.549 1.00 37.09  ? 370  ALA A O   1 
ATOM   2860 C CB  . ALA A 1 370 ? 22.824  46.802 70.539 1.00 31.18  ? 370  ALA A CB  1 
ATOM   2861 N N   . VAL A 1 371 ? 21.813  49.504 71.654 1.00 31.27  ? 371  VAL A N   1 
ATOM   2862 C CA  . VAL A 1 371 ? 21.537  50.937 71.517 1.00 31.27  ? 371  VAL A CA  1 
ATOM   2863 C C   . VAL A 1 371 ? 22.207  51.757 72.623 1.00 31.27  ? 371  VAL A C   1 
ATOM   2864 O O   . VAL A 1 371 ? 22.879  52.755 72.349 1.00 31.27  ? 371  VAL A O   1 
ATOM   2865 C CB  . VAL A 1 371 ? 20.024  51.221 71.558 1.00 29.64  ? 371  VAL A CB  1 
ATOM   2866 C CG1 . VAL A 1 371 ? 19.777  52.718 71.531 1.00 29.64  ? 371  VAL A CG1 1 
ATOM   2867 C CG2 . VAL A 1 371 ? 19.331  50.541 70.383 1.00 29.64  ? 371  VAL A CG2 1 
ATOM   2868 N N   . THR A 1 372 ? 22.014  51.330 73.869 1.00 34.97  ? 372  THR A N   1 
ATOM   2869 C CA  . THR A 1 372 ? 22.591  52.004 75.029 1.00 34.97  ? 372  THR A CA  1 
ATOM   2870 C C   . THR A 1 372 ? 24.111  52.121 74.920 1.00 34.97  ? 372  THR A C   1 
ATOM   2871 O O   . THR A 1 372 ? 24.690  53.156 75.239 1.00 34.97  ? 372  THR A O   1 
ATOM   2872 C CB  . THR A 1 372 ? 22.232  51.260 76.339 1.00 42.52  ? 372  THR A CB  1 
ATOM   2873 O OG1 . THR A 1 372 ? 20.825  51.393 76.603 1.00 42.52  ? 372  THR A OG1 1 
ATOM   2874 C CG2 . THR A 1 372 ? 23.025  51.822 77.508 1.00 42.52  ? 372  THR A CG2 1 
ATOM   2875 N N   . LEU A 1 373 ? 24.759  51.057 74.468 1.00 40.37  ? 373  LEU A N   1 
ATOM   2876 C CA  . LEU A 1 373 ? 26.205  51.085 74.303 1.00 40.37  ? 373  LEU A CA  1 
ATOM   2877 C C   . LEU A 1 373 ? 26.609  52.061 73.194 1.00 40.37  ? 373  LEU A C   1 
ATOM   2878 O O   . LEU A 1 373 ? 27.585  52.794 73.326 1.00 40.37  ? 373  LEU A O   1 
ATOM   2879 C CB  . LEU A 1 373 ? 26.732  49.685 73.970 1.00 47.26  ? 373  LEU A CB  1 
ATOM   2880 C CG  . LEU A 1 373 ? 28.223  49.588 73.636 1.00 47.26  ? 373  LEU A CG  1 
ATOM   2881 C CD1 . LEU A 1 373 ? 29.048  50.297 74.711 1.00 47.26  ? 373  LEU A CD1 1 
ATOM   2882 C CD2 . LEU A 1 373 ? 28.633  48.128 73.536 1.00 47.26  ? 373  LEU A CD2 1 
ATOM   2883 N N   . GLN A 1 374 ? 25.848  52.072 72.106 1.00 33.25  ? 374  GLN A N   1 
ATOM   2884 C CA  . GLN A 1 374 ? 26.130  52.944 70.966 1.00 33.25  ? 374  GLN A CA  1 
ATOM   2885 C C   . GLN A 1 374 ? 25.975  54.436 71.247 1.00 33.25  ? 374  GLN A C   1 
ATOM   2886 O O   . GLN A 1 374 ? 26.589  55.254 70.581 1.00 33.25  ? 374  GLN A O   1 
ATOM   2887 C CB  . GLN A 1 374 ? 25.206  52.581 69.803 1.00 46.38  ? 374  GLN A CB  1 
ATOM   2888 C CG  . GLN A 1 374 ? 25.675  53.089 68.466 1.00 46.38  ? 374  GLN A CG  1 
ATOM   2889 C CD  . GLN A 1 374 ? 26.905  52.337 67.977 1.00 46.38  ? 374  GLN A CD  1 
ATOM   2890 O OE1 . GLN A 1 374 ? 27.441  52.639 66.909 1.00 46.38  ? 374  GLN A OE1 1 
ATOM   2891 N NE2 . GLN A 1 374 ? 27.355  51.347 68.757 1.00 46.38  ? 374  GLN A NE2 1 
ATOM   2892 N N   . TYR A 1 375 ? 25.157  54.782 72.238 1.00 41.89  ? 375  TYR A N   1 
ATOM   2893 C CA  . TYR A 1 375 ? 24.881  56.178 72.566 1.00 41.89  ? 375  TYR A CA  1 
ATOM   2894 C C   . TYR A 1 375 ? 25.313  56.657 73.949 1.00 41.89  ? 375  TYR A C   1 
ATOM   2895 O O   . TYR A 1 375 ? 24.871  57.707 74.420 1.00 41.89  ? 375  TYR A O   1 
ATOM   2896 C CB  . TYR A 1 375 ? 23.382  56.434 72.388 1.00 30.91  ? 375  TYR A CB  1 
ATOM   2897 C CG  . TYR A 1 375 ? 22.965  56.556 70.946 1.00 30.91  ? 375  TYR A CG  1 
ATOM   2898 C CD1 . TYR A 1 375 ? 23.058  57.777 70.278 1.00 30.91  ? 375  TYR A CD1 1 
ATOM   2899 C CD2 . TYR A 1 375 ? 22.490  55.450 70.240 1.00 30.91  ? 375  TYR A CD2 1 
ATOM   2900 C CE1 . TYR A 1 375 ? 22.686  57.897 68.944 1.00 30.91  ? 375  TYR A CE1 1 
ATOM   2901 C CE2 . TYR A 1 375 ? 22.119  55.559 68.909 1.00 30.91  ? 375  TYR A CE2 1 
ATOM   2902 C CZ  . TYR A 1 375 ? 22.221  56.786 68.273 1.00 30.91  ? 375  TYR A CZ  1 
ATOM   2903 O OH  . TYR A 1 375 ? 21.867  56.901 66.963 1.00 30.91  ? 375  TYR A OH  1 
ATOM   2904 N N   . THR A 1 376 ? 26.173  55.894 74.605 1.00 40.62  ? 376  THR A N   1 
ATOM   2905 C CA  . THR A 1 376 ? 26.647  56.269 75.927 1.00 40.62  ? 376  THR A CA  1 
ATOM   2906 C C   . THR A 1 376 ? 28.139  56.548 75.896 1.00 40.62  ? 376  THR A C   1 
ATOM   2907 O O   . THR A 1 376 ? 28.890  55.885 75.192 1.00 40.62  ? 376  THR A O   1 
ATOM   2908 C CB  . THR A 1 376 ? 26.406  55.146 76.942 1.00 35.74  ? 376  THR A CB  1 
ATOM   2909 O OG1 . THR A 1 376 ? 25.002  54.926 77.094 1.00 35.74  ? 376  THR A OG1 1 
ATOM   2910 C CG2 . THR A 1 376 ? 26.987  55.508 78.272 1.00 35.74  ? 376  THR A CG2 1 
ATOM   2911 N N   . ASP A 1 377 ? 28.558  57.551 76.653 1.00 43.96  ? 377  ASP A N   1 
ATOM   2912 C CA  . ASP A 1 377 ? 29.965  57.909 76.770 1.00 43.96  ? 377  ASP A CA  1 
ATOM   2913 C C   . ASP A 1 377 ? 30.327  57.402 78.157 1.00 43.96  ? 377  ASP A C   1 
ATOM   2914 O O   . ASP A 1 377 ? 30.034  58.073 79.150 1.00 43.96  ? 377  ASP A O   1 
ATOM   2915 C CB  . ASP A 1 377 ? 30.130  59.425 76.731 1.00 60.78  ? 377  ASP A CB  1 
ATOM   2916 C CG  . ASP A 1 377 ? 31.544  59.864 77.053 1.00 60.78  ? 377  ASP A CG  1 
ATOM   2917 O OD1 . ASP A 1 377 ? 32.354  59.015 77.507 1.00 60.78  ? 377  ASP A OD1 1 
ATOM   2918 O OD2 . ASP A 1 377 ? 31.845  61.066 76.861 1.00 60.78  ? 377  ASP A OD2 1 
ATOM   2919 N N   . TRP A 1 378 ? 30.952  56.228 78.237 1.00 46.43  ? 378  TRP A N   1 
ATOM   2920 C CA  . TRP A 1 378 ? 31.293  55.664 79.534 1.00 46.43  ? 378  TRP A CA  1 
ATOM   2921 C C   . TRP A 1 378 ? 32.367  56.393 80.329 1.00 46.43  ? 378  TRP A C   1 
ATOM   2922 O O   . TRP A 1 378 ? 32.729  55.956 81.425 1.00 46.43  ? 378  TRP A O   1 
ATOM   2923 C CB  . TRP A 1 378 ? 31.636  54.179 79.400 1.00 49.56  ? 378  TRP A CB  1 
ATOM   2924 C CG  . TRP A 1 378 ? 30.466  53.380 78.861 1.00 49.56  ? 378  TRP A CG  1 
ATOM   2925 C CD1 . TRP A 1 378 ? 30.283  52.965 77.569 1.00 49.56  ? 378  TRP A CD1 1 
ATOM   2926 C CD2 . TRP A 1 378 ? 29.274  53.009 79.572 1.00 49.56  ? 378  TRP A CD2 1 
ATOM   2927 N NE1 . TRP A 1 378 ? 29.051  52.368 77.434 1.00 49.56  ? 378  TRP A NE1 1 
ATOM   2928 C CE2 . TRP A 1 378 ? 28.413  52.383 78.647 1.00 49.56  ? 378  TRP A CE2 1 
ATOM   2929 C CE3 . TRP A 1 378 ? 28.850  53.153 80.900 1.00 49.56  ? 378  TRP A CE3 1 
ATOM   2930 C CZ2 . TRP A 1 378 ? 27.151  51.900 79.003 1.00 49.56  ? 378  TRP A CZ2 1 
ATOM   2931 C CZ3 . TRP A 1 378 ? 27.590  52.672 81.260 1.00 49.56  ? 378  TRP A CZ3 1 
ATOM   2932 C CH2 . TRP A 1 378 ? 26.759  52.055 80.313 1.00 49.56  ? 378  TRP A CH2 1 
ATOM   2933 N N   . MET A 1 379 ? 32.878  57.502 79.801 1.00 48.67  ? 379  MET A N   1 
ATOM   2934 C CA  . MET A 1 379 ? 33.866  58.278 80.548 1.00 48.67  ? 379  MET A CA  1 
ATOM   2935 C C   . MET A 1 379 ? 33.111  59.342 81.329 1.00 48.67  ? 379  MET A C   1 
ATOM   2936 O O   . MET A 1 379 ? 33.690  60.008 82.188 1.00 48.67  ? 379  MET A O   1 
ATOM   2937 C CB  . MET A 1 379 ? 34.852  59.003 79.627 1.00 65.11  ? 379  MET A CB  1 
ATOM   2938 C CG  . MET A 1 379 ? 35.819  58.126 78.863 1.00 65.11  ? 379  MET A CG  1 
ATOM   2939 S SD  . MET A 1 379 ? 37.127  59.147 78.100 1.00 65.11  ? 379  MET A SD  1 
ATOM   2940 C CE  . MET A 1 379 ? 36.394  59.574 76.471 1.00 65.11  ? 379  MET A CE  1 
ATOM   2941 N N   . ASP A 1 380 ? 31.820  59.502 81.029 1.00 55.23  ? 380  ASP A N   1 
ATOM   2942 C CA  . ASP A 1 380 ? 30.988  60.531 81.676 1.00 55.23  ? 380  ASP A CA  1 
ATOM   2943 C C   . ASP A 1 380 ? 29.511  60.104 81.642 1.00 55.23  ? 380  ASP A C   1 
ATOM   2944 O O   . ASP A 1 380 ? 28.624  60.888 81.273 1.00 55.23  ? 380  ASP A O   1 
ATOM   2945 C CB  . ASP A 1 380 ? 31.199  61.858 80.921 1.00 62.15  ? 380  ASP A CB  1 
ATOM   2946 C CG  . ASP A 1 380 ? 30.695  63.071 81.685 1.00 62.15  ? 380  ASP A CG  1 
ATOM   2947 O OD1 . ASP A 1 380 ? 30.769  63.077 82.942 1.00 62.15  ? 380  ASP A OD1 1 
ATOM   2948 O OD2 . ASP A 1 380 ? 30.245  64.033 81.018 1.00 62.15  ? 380  ASP A OD2 1 
ATOM   2949 N N   . ASP A 1 381 ? 29.263  58.861 82.055 1.00 53.49  ? 381  ASP A N   1 
ATOM   2950 C CA  . ASP A 1 381 ? 27.926  58.266 82.037 1.00 53.49  ? 381  ASP A CA  1 
ATOM   2951 C C   . ASP A 1 381 ? 26.821  58.883 82.898 1.00 53.49  ? 381  ASP A C   1 
ATOM   2952 O O   . ASP A 1 381 ? 25.636  58.582 82.696 1.00 53.49  ? 381  ASP A O   1 
ATOM   2953 C CB  . ASP A 1 381 ? 28.031  56.765 82.338 1.00 69.14  ? 381  ASP A CB  1 
ATOM   2954 C CG  . ASP A 1 381 ? 28.546  56.480 83.738 1.00 69.14  ? 381  ASP A CG  1 
ATOM   2955 O OD1 . ASP A 1 381 ? 29.658  56.957 84.100 1.00 69.14  ? 381  ASP A OD1 1 
ATOM   2956 O OD2 . ASP A 1 381 ? 27.831  55.761 84.478 1.00 69.14  ? 381  ASP A OD2 1 
ATOM   2957 N N   . ASN A 1 382 ? 27.177  59.725 83.862 1.00 66.04  ? 382  ASN A N   1 
ATOM   2958 C CA  . ASN A 1 382 ? 26.141  60.357 84.685 1.00 66.04  ? 382  ASN A CA  1 
ATOM   2959 C C   . ASN A 1 382 ? 25.983  61.833 84.371 1.00 66.04  ? 382  ASN A C   1 
ATOM   2960 O O   . ASN A 1 382 ? 25.435  62.597 85.170 1.00 66.04  ? 382  ASN A O   1 
ATOM   2961 C CB  . ASN A 1 382 ? 26.422  60.176 86.172 1.00 67.91  ? 382  ASN A CB  1 
ATOM   2962 C CG  . ASN A 1 382 ? 26.119  58.776 86.635 1.00 67.91  ? 382  ASN A CG  1 
ATOM   2963 O OD1 . ASN A 1 382 ? 25.063  58.214 86.304 1.00 67.91  ? 382  ASN A OD1 1 
ATOM   2964 N ND2 . ASN A 1 382 ? 27.040  58.192 87.403 1.00 67.91  ? 382  ASN A ND2 1 
ATOM   2965 N N   . ASN A 1 383 ? 26.475  62.225 83.201 1.00 42.99  ? 383  ASN A N   1 
ATOM   2966 C CA  . ASN A 1 383 ? 26.365  63.598 82.755 1.00 42.99  ? 383  ASN A CA  1 
ATOM   2967 C C   . ASN A 1 383 ? 24.933  63.770 82.245 1.00 42.99  ? 383  ASN A C   1 
ATOM   2968 O O   . ASN A 1 383 ? 24.552  63.210 81.215 1.00 42.99  ? 383  ASN A O   1 
ATOM   2969 C CB  . ASN A 1 383 ? 27.383  63.856 81.647 1.00 51.47  ? 383  ASN A CB  1 
ATOM   2970 C CG  . ASN A 1 383 ? 27.294  65.253 81.086 1.00 51.47  ? 383  ASN A CG  1 
ATOM   2971 O OD1 . ASN A 1 383 ? 28.296  65.816 80.644 1.00 51.47  ? 383  ASN A OD1 1 
ATOM   2972 N ND2 . ASN A 1 383 ? 26.090  65.817 81.076 1.00 51.47  ? 383  ASN A ND2 1 
ATOM   2973 N N   . GLY A 1 384 ? 24.147  64.537 82.996 1.00 43.85  ? 384  GLY A N   1 
ATOM   2974 C CA  . GLY A 1 384 ? 22.763  64.782 82.645 1.00 43.85  ? 384  GLY A CA  1 
ATOM   2975 C C   . GLY A 1 384 ? 22.541  65.371 81.267 1.00 43.85  ? 384  GLY A C   1 
ATOM   2976 O O   . GLY A 1 384 ? 21.557  65.033 80.613 1.00 43.85  ? 384  GLY A O   1 
ATOM   2977 N N   . ILE A 1 385 ? 23.431  66.248 80.815 1.00 36.53  ? 385  ILE A N   1 
ATOM   2978 C CA  . ILE A 1 385 ? 23.263  66.846 79.495 1.00 36.53  ? 385  ILE A CA  1 
ATOM   2979 C C   . ILE A 1 385 ? 23.644  65.890 78.372 1.00 36.53  ? 385  ILE A C   1 
ATOM   2980 O O   . ILE A 1 385 ? 23.120  65.989 77.267 1.00 36.53  ? 385  ILE A O   1 
ATOM   2981 C CB  . ILE A 1 385 ? 24.078  68.154 79.355 1.00 37.13  ? 385  ILE A CB  1 
ATOM   2982 C CG1 . ILE A 1 385 ? 23.461  69.237 80.239 1.00 37.13  ? 385  ILE A CG1 1 
ATOM   2983 C CG2 . ILE A 1 385 ? 24.072  68.635 77.921 1.00 37.13  ? 385  ILE A CG2 1 
ATOM   2984 C CD1 . ILE A 1 385 ? 24.187  70.554 80.167 1.00 37.13  ? 385  ILE A CD1 1 
ATOM   2985 N N   . LYS A 1 386 ? 24.553  64.959 78.641 1.00 43.85  ? 386  LYS A N   1 
ATOM   2986 C CA  . LYS A 1 386 ? 24.947  64.008 77.610 1.00 43.85  ? 386  LYS A CA  1 
ATOM   2987 C C   . LYS A 1 386 ? 23.895  62.915 77.425 1.00 43.85  ? 386  LYS A C   1 
ATOM   2988 O O   . LYS A 1 386 ? 23.676  62.438 76.308 1.00 43.85  ? 386  LYS A O   1 
ATOM   2989 C CB  . LYS A 1 386 ? 26.322  63.413 77.923 1.00 46.14  ? 386  LYS A CB  1 
ATOM   2990 C CG  . LYS A 1 386 ? 27.452  64.281 77.382 1.00 46.14  ? 386  LYS A CG  1 
ATOM   2991 C CD  . LYS A 1 386 ? 28.832  63.756 77.755 1.00 46.14  ? 386  LYS A CD  1 
ATOM   2992 C CE  . LYS A 1 386 ? 29.933  64.566 77.068 1.00 46.14  ? 386  LYS A CE  1 
ATOM   2993 N NZ  . LYS A 1 386 ? 31.285  64.161 77.561 1.00 46.14  ? 386  LYS A NZ  1 
ATOM   2994 N N   . ASN A 1 387 ? 23.239  62.525 78.512 1.00 36.47  ? 387  ASN A N   1 
ATOM   2995 C CA  . ASN A 1 387 ? 22.194  61.526 78.410 1.00 36.47  ? 387  ASN A CA  1 
ATOM   2996 C C   . ASN A 1 387 ? 20.964  62.139 77.722 1.00 36.47  ? 387  ASN A C   1 
ATOM   2997 O O   . ASN A 1 387 ? 20.263  61.463 76.966 1.00 36.47  ? 387  ASN A O   1 
ATOM   2998 C CB  . ASN A 1 387 ? 21.837  60.982 79.795 1.00 45.54  ? 387  ASN A CB  1 
ATOM   2999 C CG  . ASN A 1 387 ? 22.991  60.216 80.429 1.00 45.54  ? 387  ASN A CG  1 
ATOM   3000 O OD1 . ASN A 1 387 ? 23.784  59.591 79.727 1.00 45.54  ? 387  ASN A OD1 1 
ATOM   3001 N ND2 . ASN A 1 387 ? 23.083  60.250 81.757 1.00 45.54  ? 387  ASN A ND2 1 
ATOM   3002 N N   . ARG A 1 388 ? 20.707  63.420 77.971 1.00 38.93  ? 388  ARG A N   1 
ATOM   3003 C CA  . ARG A 1 388 ? 19.575  64.086 77.338 1.00 38.93  ? 388  ARG A CA  1 
ATOM   3004 C C   . ARG A 1 388 ? 19.764  64.141 75.819 1.00 38.93  ? 388  ARG A C   1 
ATOM   3005 O O   . ARG A 1 388 ? 18.908  63.691 75.057 1.00 38.93  ? 388  ARG A O   1 
ATOM   3006 C CB  . ARG A 1 388 ? 19.411  65.504 77.870 1.00 36.46  ? 388  ARG A CB  1 
ATOM   3007 C CG  . ARG A 1 388 ? 18.249  66.247 77.245 1.00 36.46  ? 388  ARG A CG  1 
ATOM   3008 C CD  . ARG A 1 388 ? 18.712  67.548 76.619 1.00 36.46  ? 388  ARG A CD  1 
ATOM   3009 N NE  . ARG A 1 388 ? 18.887  68.595 77.614 1.00 36.46  ? 388  ARG A NE  1 
ATOM   3010 C CZ  . ARG A 1 388 ? 19.805  69.550 77.542 1.00 36.46  ? 388  ARG A CZ  1 
ATOM   3011 N NH1 . ARG A 1 388 ? 20.646  69.594 76.521 1.00 36.46  ? 388  ARG A NH1 1 
ATOM   3012 N NH2 . ARG A 1 388 ? 19.866  70.466 78.493 1.00 36.46  ? 388  ARG A NH2 1 
ATOM   3013 N N   . ASP A 1 389 ? 20.890  64.689 75.376 1.00 39.69  ? 389  ASP A N   1 
ATOM   3014 C CA  . ASP A 1 389 ? 21.158  64.777 73.950 1.00 39.69  ? 389  ASP A CA  1 
ATOM   3015 C C   . ASP A 1 389 ? 21.310  63.389 73.318 1.00 39.69  ? 389  ASP A C   1 
ATOM   3016 O O   . ASP A 1 389 ? 20.990  63.198 72.139 1.00 39.69  ? 389  ASP A O   1 
ATOM   3017 C CB  . ASP A 1 389 ? 22.413  65.613 73.700 1.00 46.74  ? 389  ASP A CB  1 
ATOM   3018 C CG  . ASP A 1 389 ? 22.302  67.024 74.271 1.00 46.74  ? 389  ASP A CG  1 
ATOM   3019 O OD1 . ASP A 1 389 ? 21.188  67.596 74.282 1.00 46.74  ? 389  ASP A OD1 1 
ATOM   3020 O OD2 . ASP A 1 389 ? 23.339  67.569 74.700 1.00 46.74  ? 389  ASP A OD2 1 
ATOM   3021 N N   . GLY A 1 390 ? 21.792  62.425 74.101 1.00 36.45  ? 390  GLY A N   1 
ATOM   3022 C CA  . GLY A 1 390 ? 21.955  61.071 73.597 1.00 36.45  ? 390  GLY A CA  1 
ATOM   3023 C C   . GLY A 1 390 ? 20.601  60.460 73.268 1.00 36.45  ? 390  GLY A C   1 
ATOM   3024 O O   . GLY A 1 390 ? 20.422  59.795 72.245 1.00 36.45  ? 390  GLY A O   1 
ATOM   3025 N N   . LEU A 1 391 ? 19.638  60.705 74.148 1.00 37.23  ? 391  LEU A N   1 
ATOM   3026 C CA  . LEU A 1 391 ? 18.282  60.207 73.988 1.00 37.23  ? 391  LEU A CA  1 
ATOM   3027 C C   . LEU A 1 391 ? 17.638  60.952 72.814 1.00 37.23  ? 391  LEU A C   1 
ATOM   3028 O O   . LEU A 1 391 ? 16.863  60.395 72.033 1.00 37.23  ? 391  LEU A O   1 
ATOM   3029 C CB  . LEU A 1 391 ? 17.514  60.462 75.281 1.00 37.28  ? 391  LEU A CB  1 
ATOM   3030 C CG  . LEU A 1 391 ? 16.487  59.443 75.768 1.00 37.28  ? 391  LEU A CG  1 
ATOM   3031 C CD1 . LEU A 1 391 ? 16.996  58.030 75.535 1.00 37.28  ? 391  LEU A CD1 1 
ATOM   3032 C CD2 . LEU A 1 391 ? 16.205  59.678 77.259 1.00 37.28  ? 391  LEU A CD2 1 
ATOM   3033 N N   . ASP A 1 392 ? 17.984  62.223 72.687 1.00 36.28  ? 392  ASP A N   1 
ATOM   3034 C CA  . ASP A 1 392 ? 17.451  63.036 71.616 1.00 36.28  ? 392  ASP A CA  1 
ATOM   3035 C C   . ASP A 1 392 ? 17.958  62.515 70.271 1.00 36.28  ? 392  ASP A C   1 
ATOM   3036 O O   . ASP A 1 392 ? 17.195  62.418 69.317 1.00 36.28  ? 392  ASP A O   1 
ATOM   3037 C CB  . ASP A 1 392 ? 17.871  64.485 71.824 1.00 65.16  ? 392  ASP A CB  1 
ATOM   3038 C CG  . ASP A 1 392 ? 17.055  65.454 71.003 1.00 65.16  ? 392  ASP A CG  1 
ATOM   3039 O OD1 . ASP A 1 392 ? 16.950  65.275 69.763 1.00 65.16  ? 392  ASP A OD1 1 
ATOM   3040 O OD2 . ASP A 1 392 ? 16.522  66.413 71.603 1.00 65.16  ? 392  ASP A OD2 1 
ATOM   3041 N N   . ASP A 1 393 ? 19.244  62.180 70.187 1.00 32.20  ? 393  ASP A N   1 
ATOM   3042 C CA  . ASP A 1 393 ? 19.802  61.657 68.937 1.00 32.20  ? 393  ASP A CA  1 
ATOM   3043 C C   . ASP A 1 393 ? 19.176  60.318 68.564 1.00 32.20  ? 393  ASP A C   1 
ATOM   3044 O O   . ASP A 1 393 ? 18.856  60.085 67.409 1.00 32.20  ? 393  ASP A O   1 
ATOM   3045 C CB  . ASP A 1 393 ? 21.317  61.478 69.038 1.00 63.46  ? 393  ASP A CB  1 
ATOM   3046 C CG  . ASP A 1 393 ? 22.071  62.777 68.877 1.00 63.46  ? 393  ASP A CG  1 
ATOM   3047 O OD1 . ASP A 1 393 ? 21.515  63.703 68.241 1.00 63.46  ? 393  ASP A OD1 1 
ATOM   3048 O OD2 . ASP A 1 393 ? 23.227  62.875 69.364 1.00 63.46  ? 393  ASP A OD2 1 
ATOM   3049 N N   . ILE A 1 394 ? 19.015  59.439 69.549 1.00 29.79  ? 394  ILE A N   1 
ATOM   3050 C CA  . ILE A 1 394 ? 18.424  58.128 69.314 1.00 29.79  ? 394  ILE A CA  1 
ATOM   3051 C C   . ILE A 1 394 ? 17.055  58.236 68.645 1.00 29.79  ? 394  ILE A C   1 
ATOM   3052 O O   . ILE A 1 394 ? 16.813  57.629 67.616 1.00 29.79  ? 394  ILE A O   1 
ATOM   3053 C CB  . ILE A 1 394 ? 18.259  57.350 70.638 1.00 27.46  ? 394  ILE A CB  1 
ATOM   3054 C CG1 . ILE A 1 394 ? 19.620  56.880 71.139 1.00 27.46  ? 394  ILE A CG1 1 
ATOM   3055 C CG2 . ILE A 1 394 ? 17.324  56.168 70.443 1.00 27.46  ? 394  ILE A CG2 1 
ATOM   3056 C CD1 . ILE A 1 394 ? 19.570  56.186 72.487 1.00 27.46  ? 394  ILE A CD1 1 
ATOM   3057 N N   . VAL A 1 395 ? 16.164  59.018 69.236 1.00 30.08  ? 395  VAL A N   1 
ATOM   3058 C CA  . VAL A 1 395 ? 14.827  59.175 68.707 1.00 30.08  ? 395  VAL A CA  1 
ATOM   3059 C C   . VAL A 1 395 ? 14.827  59.712 67.276 1.00 30.08  ? 395  VAL A C   1 
ATOM   3060 O O   . VAL A 1 395 ? 14.083  59.217 66.427 1.00 30.08  ? 395  VAL A O   1 
ATOM   3061 C CB  . VAL A 1 395 ? 13.993  60.080 69.634 1.00 26.28  ? 395  VAL A CB  1 
ATOM   3062 C CG1 . VAL A 1 395 ? 12.569  60.164 69.148 1.00 26.28  ? 395  VAL A CG1 1 
ATOM   3063 C CG2 . VAL A 1 395 ? 14.023  59.525 71.033 1.00 26.28  ? 395  VAL A CG2 1 
ATOM   3064 N N   . GLY A 1 396 ? 15.670  60.709 67.008 1.00 29.25  ? 396  GLY A N   1 
ATOM   3065 C CA  . GLY A 1 396 ? 15.755  61.272 65.672 1.00 29.25  ? 396  GLY A CA  1 
ATOM   3066 C C   . GLY A 1 396 ? 16.417  60.347 64.658 1.00 29.25  ? 396  GLY A C   1 
ATOM   3067 O O   . GLY A 1 396 ? 15.934  60.196 63.536 1.00 29.25  ? 396  GLY A O   1 
ATOM   3068 N N   . ASP A 1 397 ? 17.522  59.721 65.051 1.00 28.03  ? 397  ASP A N   1 
ATOM   3069 C CA  . ASP A 1 397 ? 18.246  58.812 64.170 1.00 28.03  ? 397  ASP A CA  1 
ATOM   3070 C C   . ASP A 1 397 ? 17.394  57.620 63.755 1.00 28.03  ? 397  ASP A C   1 
ATOM   3071 O O   . ASP A 1 397 ? 17.238  57.341 62.577 1.00 28.03  ? 397  ASP A O   1 
ATOM   3072 C CB  . ASP A 1 397 ? 19.523  58.299 64.844 1.00 33.62  ? 397  ASP A CB  1 
ATOM   3073 C CG  . ASP A 1 397 ? 20.607  59.362 64.952 1.00 33.62  ? 397  ASP A CG  1 
ATOM   3074 O OD1 . ASP A 1 397 ? 20.481  60.448 64.338 1.00 33.62  ? 397  ASP A OD1 1 
ATOM   3075 O OD2 . ASP A 1 397 ? 21.605  59.103 65.653 1.00 33.62  ? 397  ASP A OD2 1 
ATOM   3076 N N   . HIS A 1 398 ? 16.843  56.920 64.733 1.00 34.24  ? 398  HIS A N   1 
ATOM   3077 C CA  . HIS A 1 398 ? 16.017  55.753 64.466 1.00 34.24  ? 398  HIS A CA  1 
ATOM   3078 C C   . HIS A 1 398 ? 14.703  56.045 63.722 1.00 34.24  ? 398  HIS A C   1 
ATOM   3079 O O   . HIS A 1 398 ? 14.278  55.271 62.873 1.00 34.24  ? 398  HIS A O   1 
ATOM   3080 C CB  . HIS A 1 398 ? 15.699  55.048 65.782 1.00 29.61  ? 398  HIS A CB  1 
ATOM   3081 C CG  . HIS A 1 398 ? 14.616  54.021 65.672 1.00 29.61  ? 398  HIS A CG  1 
ATOM   3082 N ND1 . HIS A 1 398 ? 14.749  52.873 64.921 1.00 29.61  ? 398  HIS A ND1 1 
ATOM   3083 C CD2 . HIS A 1 398 ? 13.382  53.967 66.226 1.00 29.61  ? 398  HIS A CD2 1 
ATOM   3084 C CE1 . HIS A 1 398 ? 13.645  52.157 65.019 1.00 29.61  ? 398  HIS A CE1 1 
ATOM   3085 N NE2 . HIS A 1 398 ? 12.800  52.798 65.805 1.00 29.61  ? 398  HIS A NE2 1 
ATOM   3086 N N   . ASN A 1 399 ? 14.072  57.162 64.041 1.00 28.25  ? 399  ASN A N   1 
ATOM   3087 C CA  . ASN A 1 399 ? 12.808  57.503 63.429 1.00 28.25  ? 399  ASN A CA  1 
ATOM   3088 C C   . ASN A 1 399 ? 12.822  58.369 62.185 1.00 28.25  ? 399  ASN A C   1 
ATOM   3089 O O   . ASN A 1 399 ? 11.926  58.260 61.358 1.00 28.25  ? 399  ASN A O   1 
ATOM   3090 C CB  . ASN A 1 399 ? 11.916  58.147 64.478 1.00 26.11  ? 399  ASN A CB  1 
ATOM   3091 C CG  . ASN A 1 399 ? 11.466  57.160 65.522 1.00 26.11  ? 399  ASN A CG  1 
ATOM   3092 O OD1 . ASN A 1 399 ? 10.677  56.268 65.234 1.00 26.11  ? 399  ASN A OD1 1 
ATOM   3093 N ND2 . ASN A 1 399 ? 11.974  57.300 66.733 1.00 26.11  ? 399  ASN A ND2 1 
ATOM   3094 N N   . VAL A 1 400 ? 13.832  59.213 62.026 1.00 32.01  ? 400  VAL A N   1 
ATOM   3095 C CA  . VAL A 1 400 ? 13.845  60.100 60.881 1.00 32.01  ? 400  VAL A CA  1 
ATOM   3096 C C   . VAL A 1 400 ? 15.104  60.080 60.031 1.00 32.01  ? 400  VAL A C   1 
ATOM   3097 O O   . VAL A 1 400 ? 15.048  59.773 58.843 1.00 32.01  ? 400  VAL A O   1 
ATOM   3098 C CB  . VAL A 1 400 ? 13.570  61.552 61.344 1.00 23.14  ? 400  VAL A CB  1 
ATOM   3099 C CG1 . VAL A 1 400 ? 13.581  62.496 60.169 1.00 23.14  ? 400  VAL A CG1 1 
ATOM   3100 C CG2 . VAL A 1 400 ? 12.237  61.616 62.071 1.00 23.14  ? 400  VAL A CG2 1 
ATOM   3101 N N   . ILE A 1 401 ? 16.241  60.386 60.641 1.00 34.50  ? 401  ILE A N   1 
ATOM   3102 C CA  . ILE A 1 401 ? 17.489  60.456 59.902 1.00 34.50  ? 401  ILE A CA  1 
ATOM   3103 C C   . ILE A 1 401 ? 18.026  59.166 59.289 1.00 34.50  ? 401  ILE A C   1 
ATOM   3104 O O   . ILE A 1 401 ? 18.281  59.128 58.086 1.00 34.50  ? 401  ILE A O   1 
ATOM   3105 C CB  . ILE A 1 401 ? 18.589  61.129 60.753 1.00 26.23  ? 401  ILE A CB  1 
ATOM   3106 C CG1 . ILE A 1 401 ? 18.105  62.514 61.188 1.00 26.23  ? 401  ILE A CG1 1 
ATOM   3107 C CG2 . ILE A 1 401 ? 19.870  61.267 59.945 1.00 26.23  ? 401  ILE A CG2 1 
ATOM   3108 C CD1 . ILE A 1 401 ? 18.984  63.204 62.204 1.00 26.23  ? 401  ILE A CD1 1 
ATOM   3109 N N   . CYS A 1 402 ? 18.206  58.113 60.077 1.00 29.99  ? 402  CYS A N   1 
ATOM   3110 C CA  . CYS A 1 402 ? 18.733  56.887 59.494 1.00 29.99  ? 402  CYS A CA  1 
ATOM   3111 C C   . CYS A 1 402 ? 17.773  56.284 58.454 1.00 29.99  ? 402  CYS A C   1 
ATOM   3112 O O   . CYS A 1 402 ? 18.215  55.712 57.466 1.00 29.99  ? 402  CYS A O   1 
ATOM   3113 C CB  . CYS A 1 402 ? 19.089  55.873 60.594 1.00 33.72  ? 402  CYS A CB  1 
ATOM   3114 N N   . PRO A 1 403 ? 16.447  56.388 58.667 1.00 38.58  ? 403  PRO A N   1 
ATOM   3115 C CA  . PRO A 1 403 ? 15.529  55.829 57.667 1.00 38.58  ? 403  PRO A CA  1 
ATOM   3116 C C   . PRO A 1 403 ? 15.561  56.632 56.352 1.00 38.58  ? 403  PRO A C   1 
ATOM   3117 O O   . PRO A 1 403 ? 15.447  56.061 55.269 1.00 38.58  ? 403  PRO A O   1 
ATOM   3118 C CB  . PRO A 1 403 ? 14.170  55.920 58.353 1.00 30.06  ? 403  PRO A CB  1 
ATOM   3119 C CG  . PRO A 1 403 ? 14.509  55.763 59.776 1.00 30.06  ? 403  PRO A CG  1 
ATOM   3120 C CD  . PRO A 1 403 ? 15.735  56.619 59.934 1.00 30.06  ? 403  PRO A CD  1 
ATOM   3121 N N   . LEU A 1 404 ? 15.710  57.951 56.442 1.00 30.76  ? 404  LEU A N   1 
ATOM   3122 C CA  . LEU A 1 404 ? 15.757  58.764 55.235 1.00 30.76  ? 404  LEU A CA  1 
ATOM   3123 C C   . LEU A 1 404 ? 17.063  58.531 54.461 1.00 30.76  ? 404  LEU A C   1 
ATOM   3124 O O   . LEU A 1 404 ? 17.079  58.554 53.226 1.00 30.76  ? 404  LEU A O   1 
ATOM   3125 C CB  . LEU A 1 404 ? 15.584  60.250 55.579 1.00 36.82  ? 404  LEU A CB  1 
ATOM   3126 C CG  . LEU A 1 404 ? 15.460  61.255 54.421 1.00 36.82  ? 404  LEU A CG  1 
ATOM   3127 C CD1 . LEU A 1 404 ? 14.466  62.357 54.770 1.00 36.82  ? 404  LEU A CD1 1 
ATOM   3128 C CD2 . LEU A 1 404 ? 16.819  61.849 54.112 1.00 36.82  ? 404  LEU A CD2 1 
ATOM   3129 N N   . MET A 1 405 ? 18.155  58.297 55.181 1.00 31.02  ? 405  MET A N   1 
ATOM   3130 C CA  . MET A 1 405 ? 19.427  58.039 54.530 1.00 31.02  ? 405  MET A CA  1 
ATOM   3131 C C   . MET A 1 405 ? 19.396  56.708 53.785 1.00 31.02  ? 405  MET A C   1 
ATOM   3132 O O   . MET A 1 405 ? 20.047  56.548 52.758 1.00 31.02  ? 405  MET A O   1 
ATOM   3133 C CB  . MET A 1 405 ? 20.581  58.048 55.540 1.00 34.61  ? 405  MET A CB  1 
ATOM   3134 C CG  . MET A 1 405 ? 20.966  59.445 56.028 1.00 34.61  ? 405  MET A CG  1 
ATOM   3135 S SD  . MET A 1 405 ? 21.163  60.664 54.692 1.00 34.61  ? 405  MET A SD  1 
ATOM   3136 C CE  . MET A 1 405 ? 22.627  60.062 53.874 1.00 34.61  ? 405  MET A CE  1 
ATOM   3137 N N   . HIS A 1 406 ? 18.631  55.752 54.296 1.00 39.30  ? 406  HIS A N   1 
ATOM   3138 C CA  . HIS A 1 406 ? 18.519  54.455 53.635 1.00 39.30  ? 406  HIS A CA  1 
ATOM   3139 C C   . HIS A 1 406 ? 17.739  54.646 52.320 1.00 39.30  ? 406  HIS A C   1 
ATOM   3140 O O   . HIS A 1 406 ? 18.055  54.045 51.296 1.00 39.30  ? 406  HIS A O   1 
ATOM   3141 C CB  . HIS A 1 406 ? 17.795  53.462 54.550 1.00 47.56  ? 406  HIS A CB  1 
ATOM   3142 C CG  . HIS A 1 406 ? 17.666  52.086 53.973 1.00 47.56  ? 406  HIS A CG  1 
ATOM   3143 N ND1 . HIS A 1 406 ? 18.738  51.226 53.847 1.00 47.56  ? 406  HIS A ND1 1 
ATOM   3144 C CD2 . HIS A 1 406 ? 16.589  51.417 53.493 1.00 47.56  ? 406  HIS A CD2 1 
ATOM   3145 C CE1 . HIS A 1 406 ? 18.326  50.088 53.317 1.00 47.56  ? 406  HIS A CE1 1 
ATOM   3146 N NE2 . HIS A 1 406 ? 17.027  50.176 53.092 1.00 47.56  ? 406  HIS A NE2 1 
ATOM   3147 N N   . PHE A 1 407 ? 16.721  55.496 52.360 1.00 37.25  ? 407  PHE A N   1 
ATOM   3148 C CA  . PHE A 1 407 ? 15.907  55.772 51.184 1.00 37.25  ? 407  PHE A CA  1 
ATOM   3149 C C   . PHE A 1 407 ? 16.728  56.495 50.111 1.00 37.25  ? 407  PHE A C   1 
ATOM   3150 O O   . PHE A 1 407 ? 16.784  56.047 48.971 1.00 37.25  ? 407  PHE A O   1 
ATOM   3151 C CB  . PHE A 1 407 ? 14.698  56.631 51.575 1.00 30.51  ? 407  PHE A CB  1 
ATOM   3152 C CG  . PHE A 1 407 ? 13.862  57.064 50.412 1.00 30.51  ? 407  PHE A CG  1 
ATOM   3153 C CD1 . PHE A 1 407 ? 12.989  56.175 49.797 1.00 30.51  ? 407  PHE A CD1 1 
ATOM   3154 C CD2 . PHE A 1 407 ? 13.946  58.362 49.929 1.00 30.51  ? 407  PHE A CD2 1 
ATOM   3155 C CE1 . PHE A 1 407 ? 12.209  56.570 48.716 1.00 30.51  ? 407  PHE A CE1 1 
ATOM   3156 C CE2 . PHE A 1 407 ? 13.169  58.767 48.845 1.00 30.51  ? 407  PHE A CE2 1 
ATOM   3157 C CZ  . PHE A 1 407 ? 12.296  57.861 48.239 1.00 30.51  ? 407  PHE A CZ  1 
ATOM   3158 N N   . VAL A 1 408 ? 17.364  57.604 50.489 1.00 36.49  ? 408  VAL A N   1 
ATOM   3159 C CA  . VAL A 1 408 ? 18.162  58.388 49.560 1.00 36.49  ? 408  VAL A CA  1 
ATOM   3160 C C   . VAL A 1 408 ? 19.254  57.564 48.915 1.00 36.49  ? 408  VAL A C   1 
ATOM   3161 O O   . VAL A 1 408 ? 19.559  57.749 47.742 1.00 36.49  ? 408  VAL A O   1 
ATOM   3162 C CB  . VAL A 1 408 ? 18.823  59.609 50.248 1.00 45.25  ? 408  VAL A CB  1 
ATOM   3163 C CG1 . VAL A 1 408 ? 19.694  59.154 51.384 1.00 45.25  ? 408  VAL A CG1 1 
ATOM   3164 C CG2 . VAL A 1 408 ? 19.664  60.391 49.236 1.00 45.25  ? 408  VAL A CG2 1 
ATOM   3165 N N   . ASN A 1 409 ? 19.860  56.663 49.674 1.00 39.88  ? 409  ASN A N   1 
ATOM   3166 C CA  . ASN A 1 409 ? 20.912  55.838 49.112 1.00 39.88  ? 409  ASN A CA  1 
ATOM   3167 C C   . ASN A 1 409 ? 20.354  54.783 48.179 1.00 39.88  ? 409  ASN A C   1 
ATOM   3168 O O   . ASN A 1 409 ? 20.973  54.462 47.171 1.00 39.88  ? 409  ASN A O   1 
ATOM   3169 C CB  . ASN A 1 409 ? 21.750  55.202 50.215 1.00 38.37  ? 409  ASN A CB  1 
ATOM   3170 C CG  . ASN A 1 409 ? 22.892  56.105 50.655 1.00 38.37  ? 409  ASN A CG  1 
ATOM   3171 O OD1 . ASN A 1 409 ? 23.741  56.476 49.846 1.00 38.37  ? 409  ASN A OD1 1 
ATOM   3172 N ND2 . ASN A 1 409 ? 22.915  56.467 51.929 1.00 38.37  ? 409  ASN A ND2 1 
ATOM   3173 N N   . LYS A 1 410 ? 19.180  54.247 48.497 1.00 43.05  ? 410  LYS A N   1 
ATOM   3174 C CA  . LYS A 1 410 ? 18.560  53.248 47.632 1.00 43.05  ? 410  LYS A CA  1 
ATOM   3175 C C   . LYS A 1 410 ? 18.005  53.901 46.354 1.00 43.05  ? 410  LYS A C   1 
ATOM   3176 O O   . LYS A 1 410 ? 18.094  53.337 45.260 1.00 43.05  ? 410  LYS A O   1 
ATOM   3177 C CB  . LYS A 1 410 ? 17.417  52.552 48.367 1.00 50.05  ? 410  LYS A CB  1 
ATOM   3178 C CG  . LYS A 1 410 ? 17.847  51.569 49.423 1.00 50.05  ? 410  LYS A CG  1 
ATOM   3179 C CD  . LYS A 1 410 ? 18.543  50.409 48.782 1.00 50.05  ? 410  LYS A CD  1 
ATOM   3180 C CE  . LYS A 1 410 ? 18.957  49.379 49.806 1.00 50.05  ? 410  LYS A CE  1 
ATOM   3181 N NZ  . LYS A 1 410 ? 19.811  48.348 49.138 1.00 50.05  ? 410  LYS A NZ  1 
ATOM   3182 N N   . TYR A 1 411 ? 17.443  55.097 46.509 1.00 38.18  ? 411  TYR A N   1 
ATOM   3183 C CA  . TYR A 1 411 ? 16.844  55.831 45.406 1.00 38.18  ? 411  TYR A CA  1 
ATOM   3184 C C   . TYR A 1 411 ? 17.864  56.336 44.396 1.00 38.18  ? 411  TYR A C   1 
ATOM   3185 O O   . TYR A 1 411 ? 17.711  56.162 43.187 1.00 38.18  ? 411  TYR A O   1 
ATOM   3186 C CB  . TYR A 1 411 ? 16.046  57.028 45.940 1.00 33.05  ? 411  TYR A CB  1 
ATOM   3187 C CG  . TYR A 1 411 ? 15.240  57.716 44.868 1.00 33.05  ? 411  TYR A CG  1 
ATOM   3188 C CD1 . TYR A 1 411 ? 13.956  57.275 44.554 1.00 33.05  ? 411  TYR A CD1 1 
ATOM   3189 C CD2 . TYR A 1 411 ? 15.790  58.753 44.110 1.00 33.05  ? 411  TYR A CD2 1 
ATOM   3190 C CE1 . TYR A 1 411 ? 13.235  57.839 43.510 1.00 33.05  ? 411  TYR A CE1 1 
ATOM   3191 C CE2 . TYR A 1 411 ? 15.081  59.326 43.058 1.00 33.05  ? 411  TYR A CE2 1 
ATOM   3192 C CZ  . TYR A 1 411 ? 13.799  58.860 42.762 1.00 33.05  ? 411  TYR A CZ  1 
ATOM   3193 O OH  . TYR A 1 411 ? 13.094  59.390 41.709 1.00 33.05  ? 411  TYR A OH  1 
ATOM   3194 N N   . THR A 1 412 ? 18.894  56.985 44.909 1.00 35.85  ? 412  THR A N   1 
ATOM   3195 C CA  . THR A 1 412 ? 19.942  57.543 44.083 1.00 35.85  ? 412  THR A CA  1 
ATOM   3196 C C   . THR A 1 412 ? 20.548  56.533 43.109 1.00 35.85  ? 412  THR A C   1 
ATOM   3197 O O   . THR A 1 412 ? 21.114  56.912 42.091 1.00 35.85  ? 412  THR A O   1 
ATOM   3198 C CB  . THR A 1 412 ? 21.018  58.174 44.985 1.00 35.07  ? 412  THR A CB  1 
ATOM   3199 O OG1 . THR A 1 412 ? 20.455  59.328 45.622 1.00 35.07  ? 412  THR A OG1 1 
ATOM   3200 C CG2 . THR A 1 412 ? 22.240  58.586 44.192 1.00 35.07  ? 412  THR A CG2 1 
ATOM   3201 N N   . LYS A 1 413 ? 20.417  55.247 43.402 1.00 45.10  ? 413  LYS A N   1 
ATOM   3202 C CA  . LYS A 1 413 ? 20.954  54.245 42.494 1.00 45.10  ? 413  LYS A CA  1 
ATOM   3203 C C   . LYS A 1 413 ? 20.152  54.176 41.184 1.00 45.10  ? 413  LYS A C   1 
ATOM   3204 O O   . LYS A 1 413 ? 20.679  53.739 40.169 1.00 45.10  ? 413  LYS A O   1 
ATOM   3205 C CB  . LYS A 1 413 ? 20.983  52.862 43.149 1.00 69.74  ? 413  LYS A CB  1 
ATOM   3206 C CG  . LYS A 1 413 ? 21.533  51.791 42.206 1.00 69.74  ? 413  LYS A CG  1 
ATOM   3207 C CD  . LYS A 1 413 ? 21.428  50.375 42.795 1.00 69.74  ? 413  LYS A CD  1 
ATOM   3208 C CE  . LYS A 1 413 ? 22.007  49.341 41.826 1.00 69.74  ? 413  LYS A CE  1 
ATOM   3209 N NZ  . LYS A 1 413 ? 21.506  49.558 40.413 1.00 69.74  ? 413  LYS A NZ  1 
ATOM   3210 N N   . PHE A 1 414 ? 18.884  54.598 41.201 1.00 44.67  ? 414  PHE A N   1 
ATOM   3211 C CA  . PHE A 1 414 ? 18.067  54.582 39.979 1.00 44.67  ? 414  PHE A CA  1 
ATOM   3212 C C   . PHE A 1 414 ? 17.487  55.942 39.569 1.00 44.67  ? 414  PHE A C   1 
ATOM   3213 O O   . PHE A 1 414 ? 16.978  56.088 38.454 1.00 44.67  ? 414  PHE A O   1 
ATOM   3214 C CB  . PHE A 1 414 ? 16.895  53.616 40.106 1.00 37.66  ? 414  PHE A CB  1 
ATOM   3215 C CG  . PHE A 1 414 ? 17.285  52.203 40.405 1.00 37.66  ? 414  PHE A CG  1 
ATOM   3216 C CD1 . PHE A 1 414 ? 17.571  51.812 41.701 1.00 37.66  ? 414  PHE A CD1 1 
ATOM   3217 C CD2 . PHE A 1 414 ? 17.290  51.242 39.393 1.00 37.66  ? 414  PHE A CD2 1 
ATOM   3218 C CE1 . PHE A 1 414 ? 17.847  50.482 41.999 1.00 37.66  ? 414  PHE A CE1 1 
ATOM   3219 C CE2 . PHE A 1 414 ? 17.566  49.904 39.676 1.00 37.66  ? 414  PHE A CE2 1 
ATOM   3220 C CZ  . PHE A 1 414 ? 17.844  49.523 40.984 1.00 37.66  ? 414  PHE A CZ  1 
ATOM   3221 N N   . GLY A 1 415 ? 17.555  56.929 40.457 1.00 32.45  ? 415  GLY A N   1 
ATOM   3222 C CA  . GLY A 1 415 ? 16.996  58.240 40.150 1.00 32.45  ? 415  GLY A CA  1 
ATOM   3223 C C   . GLY A 1 415 ? 17.762  59.055 39.126 1.00 32.45  ? 415  GLY A C   1 
ATOM   3224 O O   . GLY A 1 415 ? 18.809  58.632 38.644 1.00 32.45  ? 415  GLY A O   1 
ATOM   3225 N N   . ASN A 1 416 ? 17.249  60.238 38.806 1.00 34.35  ? 416  ASN A N   1 
ATOM   3226 C CA  . ASN A 1 416 ? 17.889  61.107 37.825 1.00 34.35  ? 416  ASN A CA  1 
ATOM   3227 C C   . ASN A 1 416 ? 18.414  62.393 38.475 1.00 34.35  ? 416  ASN A C   1 
ATOM   3228 O O   . ASN A 1 416 ? 18.572  63.416 37.814 1.00 34.35  ? 416  ASN A O   1 
ATOM   3229 C CB  . ASN A 1 416 ? 16.881  61.406 36.694 1.00 39.43  ? 416  ASN A CB  1 
ATOM   3230 C CG  . ASN A 1 416 ? 17.448  62.291 35.589 1.00 39.43  ? 416  ASN A CG  1 
ATOM   3231 O OD1 . ASN A 1 416 ? 16.952  63.407 35.366 1.00 39.43  ? 416  ASN A OD1 1 
ATOM   3232 N ND2 . ASN A 1 416 ? 18.470  61.802 34.881 1.00 39.43  ? 416  ASN A ND2 1 
ATOM   3233 N N   . GLY A 1 417 ? 18.697  62.331 39.776 1.00 36.90  ? 417  GLY A N   1 
ATOM   3234 C CA  . GLY A 1 417 ? 19.219  63.493 40.481 1.00 36.90  ? 417  GLY A CA  1 
ATOM   3235 C C   . GLY A 1 417 ? 18.724  63.663 41.906 1.00 36.90  ? 417  GLY A C   1 
ATOM   3236 O O   . GLY A 1 417 ? 17.522  63.805 42.140 1.00 36.90  ? 417  GLY A O   1 
ATOM   3237 N N   . THR A 1 418 ? 19.651  63.667 42.856 1.00 30.70  ? 418  THR A N   1 
ATOM   3238 C CA  . THR A 1 418 ? 19.306  63.812 44.262 1.00 30.70  ? 418  THR A CA  1 
ATOM   3239 C C   . THR A 1 418 ? 20.026  65.004 44.896 1.00 30.70  ? 418  THR A C   1 
ATOM   3240 O O   . THR A 1 418 ? 21.212  65.228 44.631 1.00 30.70  ? 418  THR A O   1 
ATOM   3241 C CB  . THR A 1 418 ? 19.694  62.535 45.059 1.00 36.93  ? 418  THR A CB  1 
ATOM   3242 O OG1 . THR A 1 418 ? 19.085  61.381 44.463 1.00 36.93  ? 418  THR A OG1 1 
ATOM   3243 C CG2 . THR A 1 418 ? 19.245  62.651 46.504 1.00 36.93  ? 418  THR A CG2 1 
ATOM   3244 N N   . TYR A 1 419 ? 19.304  65.760 45.728 1.00 30.42  ? 419  TYR A N   1 
ATOM   3245 C CA  . TYR A 1 419 ? 19.852  66.924 46.442 1.00 30.42  ? 419  TYR A CA  1 
ATOM   3246 C C   . TYR A 1 419 ? 19.510  66.803 47.932 1.00 30.42  ? 419  TYR A C   1 
ATOM   3247 O O   . TYR A 1 419 ? 18.340  66.778 48.308 1.00 30.42  ? 419  TYR A O   1 
ATOM   3248 C CB  . TYR A 1 419 ? 19.279  68.222 45.872 1.00 37.59  ? 419  TYR A CB  1 
ATOM   3249 C CG  . TYR A 1 419 ? 19.715  68.498 44.446 1.00 37.59  ? 419  TYR A CG  1 
ATOM   3250 C CD1 . TYR A 1 419 ? 20.942  69.104 44.173 1.00 37.59  ? 419  TYR A CD1 1 
ATOM   3251 C CD2 . TYR A 1 419 ? 18.919  68.110 43.368 1.00 37.59  ? 419  TYR A CD2 1 
ATOM   3252 C CE1 . TYR A 1 419 ? 21.359  69.315 42.866 1.00 37.59  ? 419  TYR A CE1 1 
ATOM   3253 C CE2 . TYR A 1 419 ? 19.331  68.313 42.069 1.00 37.59  ? 419  TYR A CE2 1 
ATOM   3254 C CZ  . TYR A 1 419 ? 20.552  68.916 41.819 1.00 37.59  ? 419  TYR A CZ  1 
ATOM   3255 O OH  . TYR A 1 419 ? 20.955  69.114 40.513 1.00 37.59  ? 419  TYR A OH  1 
ATOM   3256 N N   . LEU A 1 420 ? 20.536  66.746 48.775 1.00 29.58  ? 420  LEU A N   1 
ATOM   3257 C CA  . LEU A 1 420 ? 20.344  66.560 50.207 1.00 29.58  ? 420  LEU A CA  1 
ATOM   3258 C C   . LEU A 1 420 ? 20.792  67.717 51.098 1.00 29.58  ? 420  LEU A C   1 
ATOM   3259 O O   . LEU A 1 420 ? 21.820  68.338 50.861 1.00 29.58  ? 420  LEU A O   1 
ATOM   3260 C CB  . LEU A 1 420 ? 21.057  65.273 50.622 1.00 28.34  ? 420  LEU A CB  1 
ATOM   3261 C CG  . LEU A 1 420 ? 20.981  64.790 52.066 1.00 28.34  ? 420  LEU A CG  1 
ATOM   3262 C CD1 . LEU A 1 420 ? 19.525  64.635 52.472 1.00 28.34  ? 420  LEU A CD1 1 
ATOM   3263 C CD2 . LEU A 1 420 ? 21.711  63.464 52.205 1.00 28.34  ? 420  LEU A CD2 1 
ATOM   3264 N N   . TYR A 1 421 ? 20.010  67.990 52.136 1.00 29.02  ? 421  TYR A N   1 
ATOM   3265 C CA  . TYR A 1 421 ? 20.320  69.069 53.069 1.00 29.02  ? 421  TYR A CA  1 
ATOM   3266 C C   . TYR A 1 421 ? 20.181  68.636 54.532 1.00 29.02  ? 421  TYR A C   1 
ATOM   3267 O O   . TYR A 1 421 ? 19.546  67.629 54.848 1.00 29.02  ? 421  TYR A O   1 
ATOM   3268 C CB  . TYR A 1 421 ? 19.394  70.268 52.817 1.00 33.80  ? 421  TYR A CB  1 
ATOM   3269 C CG  . TYR A 1 421 ? 17.962  70.075 53.300 1.00 33.80  ? 421  TYR A CG  1 
ATOM   3270 C CD1 . TYR A 1 421 ? 17.614  70.293 54.641 1.00 33.80  ? 421  TYR A CD1 1 
ATOM   3271 C CD2 . TYR A 1 421 ? 16.962  69.646 52.424 1.00 33.80  ? 421  TYR A CD2 1 
ATOM   3272 C CE1 . TYR A 1 421 ? 16.304  70.084 55.089 1.00 33.80  ? 421  TYR A CE1 1 
ATOM   3273 C CE2 . TYR A 1 421 ? 15.656  69.435 52.862 1.00 33.80  ? 421  TYR A CE2 1 
ATOM   3274 C CZ  . TYR A 1 421 ? 15.332  69.654 54.190 1.00 33.80  ? 421  TYR A CZ  1 
ATOM   3275 O OH  . TYR A 1 421 ? 14.041  69.438 54.617 1.00 33.80  ? 421  TYR A OH  1 
ATOM   3276 N N   . PHE A 1 422 ? 20.784  69.427 55.411 1.00 34.19  ? 422  PHE A N   1 
ATOM   3277 C CA  . PHE A 1 422 ? 20.743  69.206 56.847 1.00 34.19  ? 422  PHE A CA  1 
ATOM   3278 C C   . PHE A 1 422 ? 20.432  70.590 57.402 1.00 34.19  ? 422  PHE A C   1 
ATOM   3279 O O   . PHE A 1 422 ? 21.270  71.486 57.339 1.00 34.19  ? 422  PHE A O   1 
ATOM   3280 C CB  . PHE A 1 422 ? 22.105  68.730 57.349 1.00 32.03  ? 422  PHE A CB  1 
ATOM   3281 C CG  . PHE A 1 422 ? 22.134  68.373 58.817 1.00 32.03  ? 422  PHE A CG  1 
ATOM   3282 C CD1 . PHE A 1 422 ? 21.481  67.237 59.287 1.00 32.03  ? 422  PHE A CD1 1 
ATOM   3283 C CD2 . PHE A 1 422 ? 22.862  69.148 59.717 1.00 32.03  ? 422  PHE A CD2 1 
ATOM   3284 C CE1 . PHE A 1 422 ? 21.555  66.868 60.633 1.00 32.03  ? 422  PHE A CE1 1 
ATOM   3285 C CE2 . PHE A 1 422 ? 22.944  68.795 61.060 1.00 32.03  ? 422  PHE A CE2 1 
ATOM   3286 C CZ  . PHE A 1 422 ? 22.289  67.648 61.523 1.00 32.03  ? 422  PHE A CZ  1 
ATOM   3287 N N   . PHE A 1 423 ? 19.222  70.767 57.916 1.00 31.82  ? 423  PHE A N   1 
ATOM   3288 C CA  . PHE A 1 423 ? 18.793  72.045 58.458 1.00 31.82  ? 423  PHE A CA  1 
ATOM   3289 C C   . PHE A 1 423 ? 19.175  72.158 59.930 1.00 31.82  ? 423  PHE A C   1 
ATOM   3290 O O   . PHE A 1 423 ? 18.611  71.474 60.784 1.00 31.82  ? 423  PHE A O   1 
ATOM   3291 C CB  . PHE A 1 423 ? 17.282  72.177 58.299 1.00 31.85  ? 423  PHE A CB  1 
ATOM   3292 C CG  . PHE A 1 423 ? 16.751  73.509 58.693 1.00 31.85  ? 423  PHE A CG  1 
ATOM   3293 C CD1 . PHE A 1 423 ? 16.868  74.591 57.843 1.00 31.85  ? 423  PHE A CD1 1 
ATOM   3294 C CD2 . PHE A 1 423 ? 16.144  73.687 59.935 1.00 31.85  ? 423  PHE A CD2 1 
ATOM   3295 C CE1 . PHE A 1 423 ? 16.391  75.839 58.218 1.00 31.85  ? 423  PHE A CE1 1 
ATOM   3296 C CE2 . PHE A 1 423 ? 15.662  74.933 60.323 1.00 31.85  ? 423  PHE A CE2 1 
ATOM   3297 C CZ  . PHE A 1 423 ? 15.786  76.012 59.462 1.00 31.85  ? 423  PHE A CZ  1 
ATOM   3298 N N   . ASN A 1 424 ? 20.125  73.032 60.237 1.00 43.68  ? 424  ASN A N   1 
ATOM   3299 C CA  . ASN A 1 424 ? 20.552  73.169 61.617 1.00 43.68  ? 424  ASN A CA  1 
ATOM   3300 C C   . ASN A 1 424 ? 20.553  74.592 62.152 1.00 43.68  ? 424  ASN A C   1 
ATOM   3301 O O   . ASN A 1 424 ? 21.481  75.002 62.845 1.00 43.68  ? 424  ASN A O   1 
ATOM   3302 C CB  . ASN A 1 424 ? 21.935  72.532 61.803 1.00 35.82  ? 424  ASN A CB  1 
ATOM   3303 C CG  . ASN A 1 424 ? 22.984  73.149 60.912 1.00 35.82  ? 424  ASN A CG  1 
ATOM   3304 O OD1 . ASN A 1 424 ? 22.665  73.814 59.930 1.00 35.82  ? 424  ASN A OD1 1 
ATOM   3305 N ND2 . ASN A 1 424 ? 24.248  72.917 61.239 1.00 35.82  ? 424  ASN A ND2 1 
ATOM   3306 N N   . HIS A 1 425 ? 19.514  75.352 61.833 1.00 43.10  ? 425  HIS A N   1 
ATOM   3307 C CA  . HIS A 1 425 ? 19.416  76.712 62.347 1.00 43.10  ? 425  HIS A CA  1 
ATOM   3308 C C   . HIS A 1 425 ? 18.225  76.805 63.281 1.00 43.10  ? 425  HIS A C   1 
ATOM   3309 O O   . HIS A 1 425 ? 17.095  76.502 62.886 1.00 43.10  ? 425  HIS A O   1 
ATOM   3310 C CB  . HIS A 1 425 ? 19.220  77.740 61.230 1.00 43.70  ? 425  HIS A CB  1 
ATOM   3311 C CG  . HIS A 1 425 ? 18.935  79.120 61.744 1.00 43.70  ? 425  HIS A CG  1 
ATOM   3312 N ND1 . HIS A 1 425 ? 19.877  79.872 62.415 1.00 43.70  ? 425  HIS A ND1 1 
ATOM   3313 C CD2 . HIS A 1 425 ? 17.784  79.833 61.796 1.00 43.70  ? 425  HIS A CD2 1 
ATOM   3314 C CE1 . HIS A 1 425 ? 19.319  80.981 62.867 1.00 43.70  ? 425  HIS A CE1 1 
ATOM   3315 N NE2 . HIS A 1 425 ? 18.048  80.981 62.507 1.00 43.70  ? 425  HIS A NE2 1 
ATOM   3316 N N   . ARG A 1 426 ? 18.466  77.216 64.518 1.00 39.95  ? 426  ARG A N   1 
ATOM   3317 C CA  . ARG A 1 426 ? 17.365  77.366 65.452 1.00 39.95  ? 426  ARG A CA  1 
ATOM   3318 C C   . ARG A 1 426 ? 16.848  78.807 65.345 1.00 39.95  ? 426  ARG A C   1 
ATOM   3319 O O   . ARG A 1 426 ? 17.597  79.755 65.564 1.00 39.95  ? 426  ARG A O   1 
ATOM   3320 C CB  . ARG A 1 426 ? 17.815  77.071 66.889 1.00 43.33  ? 426  ARG A CB  1 
ATOM   3321 C CG  . ARG A 1 426 ? 16.649  77.073 67.888 1.00 43.33  ? 426  ARG A CG  1 
ATOM   3322 C CD  . ARG A 1 426 ? 17.146  76.948 69.307 1.00 43.33  ? 426  ARG A CD  1 
ATOM   3323 N NE  . ARG A 1 426 ? 16.228  77.550 70.272 1.00 43.33  ? 426  ARG A NE  1 
ATOM   3324 C CZ  . ARG A 1 426 ? 15.232  76.910 70.877 1.00 43.33  ? 426  ARG A CZ  1 
ATOM   3325 N NH1 . ARG A 1 426 ? 15.000  75.625 70.627 1.00 43.33  ? 426  ARG A NH1 1 
ATOM   3326 N NH2 . ARG A 1 426 ? 14.472  77.559 71.752 1.00 43.33  ? 426  ARG A NH2 1 
ATOM   3327 N N   . ALA A 1 427 ? 15.573  78.962 64.996 1.00 49.51  ? 427  ALA A N   1 
ATOM   3328 C CA  . ALA A 1 427 ? 14.965  80.286 64.859 1.00 49.51  ? 427  ALA A CA  1 
ATOM   3329 C C   . ALA A 1 427 ? 15.098  81.090 66.149 1.00 49.51  ? 427  ALA A C   1 
ATOM   3330 O O   . ALA A 1 427 ? 14.923  80.551 67.248 1.00 49.51  ? 427  ALA A O   1 
ATOM   3331 C CB  . ALA A 1 427 ? 13.491  80.151 64.474 1.00 29.80  ? 427  ALA A CB  1 
ATOM   3332 N N   . SER A 1 428 ? 15.390  82.381 66.015 1.00 51.19  ? 428  SER A N   1 
ATOM   3333 C CA  . SER A 1 428 ? 15.559  83.258 67.174 1.00 51.19  ? 428  SER A CA  1 
ATOM   3334 C C   . SER A 1 428 ? 14.273  83.527 67.955 1.00 51.19  ? 428  SER A C   1 
ATOM   3335 O O   . SER A 1 428 ? 14.332  83.942 69.117 1.00 51.19  ? 428  SER A O   1 
ATOM   3336 C CB  . SER A 1 428 ? 16.165  84.601 66.739 1.00 56.86  ? 428  SER A CB  1 
ATOM   3337 O OG  . SER A 1 428 ? 15.319  85.259 65.796 1.00 56.86  ? 428  SER A OG  1 
ATOM   3338 N N   . ASN A 1 429 ? 13.117  83.294 67.334 1.00 48.74  ? 429  ASN A N   1 
ATOM   3339 C CA  . ASN A 1 429 ? 11.839  83.552 68.004 1.00 48.74  ? 429  ASN A CA  1 
ATOM   3340 C C   . ASN A 1 429 ? 11.117  82.303 68.521 1.00 48.74  ? 429  ASN A C   1 
ATOM   3341 O O   . ASN A 1 429 ? 9.924   82.369 68.845 1.00 48.74  ? 429  ASN A O   1 
ATOM   3342 C CB  . ASN A 1 429 ? 10.889  84.327 67.069 1.00 47.96  ? 429  ASN A CB  1 
ATOM   3343 C CG  . ASN A 1 429 ? 10.779  83.695 65.676 1.00 47.96  ? 429  ASN A CG  1 
ATOM   3344 O OD1 . ASN A 1 429 ? 10.970  82.486 65.510 1.00 47.96  ? 429  ASN A OD1 1 
ATOM   3345 N ND2 . ASN A 1 429 ? 10.457  84.514 64.672 1.00 47.96  ? 429  ASN A ND2 1 
ATOM   3346 N N   . LEU A 1 430 ? 11.820  81.174 68.611 1.00 42.95  ? 430  LEU A N   1 
ATOM   3347 C CA  . LEU A 1 430 ? 11.175  79.950 69.080 1.00 42.95  ? 430  LEU A CA  1 
ATOM   3348 C C   . LEU A 1 430 ? 10.746  80.065 70.539 1.00 42.95  ? 430  LEU A C   1 
ATOM   3349 O O   . LEU A 1 430 ? 11.487  80.578 71.378 1.00 42.95  ? 430  LEU A O   1 
ATOM   3350 C CB  . LEU A 1 430 ? 12.108  78.744 68.904 1.00 54.66  ? 430  LEU A CB  1 
ATOM   3351 C CG  . LEU A 1 430 ? 11.796  77.782 67.744 1.00 54.66  ? 430  LEU A CG  1 
ATOM   3352 C CD1 . LEU A 1 430 ? 12.891  76.732 67.654 1.00 54.66  ? 430  LEU A CD1 1 
ATOM   3353 C CD2 . LEU A 1 430 ? 10.453  77.090 67.960 1.00 54.66  ? 430  LEU A CD2 1 
ATOM   3354 N N   . VAL A 1 431 ? 9.546   79.583 70.840 1.00 40.33  ? 431  VAL A N   1 
ATOM   3355 C CA  . VAL A 1 431 ? 9.038   79.642 72.205 1.00 40.33  ? 431  VAL A CA  1 
ATOM   3356 C C   . VAL A 1 431 ? 9.383   78.400 73.033 1.00 40.33  ? 431  VAL A C   1 
ATOM   3357 O O   . VAL A 1 431 ? 9.282   78.424 74.261 1.00 40.33  ? 431  VAL A O   1 
ATOM   3358 C CB  . VAL A 1 431 ? 7.510   79.861 72.211 1.00 44.36  ? 431  VAL A CB  1 
ATOM   3359 C CG1 . VAL A 1 431 ? 7.185   81.202 71.582 1.00 44.36  ? 431  VAL A CG1 1 
ATOM   3360 C CG2 . VAL A 1 431 ? 6.817   78.747 71.450 1.00 44.36  ? 431  VAL A CG2 1 
ATOM   3361 N N   . TRP A 1 432 ? 9.782   77.319 72.362 1.00 41.98  ? 432  TRP A N   1 
ATOM   3362 C CA  . TRP A 1 432 ? 10.169  76.080 73.039 1.00 41.98  ? 432  TRP A CA  1 
ATOM   3363 C C   . TRP A 1 432 ? 11.542  76.259 73.714 1.00 41.98  ? 432  TRP A C   1 
ATOM   3364 O O   . TRP A 1 432 ? 12.353  77.080 73.285 1.00 41.98  ? 432  TRP A O   1 
ATOM   3365 C CB  . TRP A 1 432 ? 10.243  74.917 72.041 1.00 34.12  ? 432  TRP A CB  1 
ATOM   3366 C CG  . TRP A 1 432 ? 8.940   74.602 71.357 1.00 34.12  ? 432  TRP A CG  1 
ATOM   3367 C CD1 . TRP A 1 432 ? 8.559   74.979 70.101 1.00 34.12  ? 432  TRP A CD1 1 
ATOM   3368 C CD2 . TRP A 1 432 ? 7.848   73.855 71.899 1.00 34.12  ? 432  TRP A CD2 1 
ATOM   3369 N NE1 . TRP A 1 432 ? 7.301   74.514 69.827 1.00 34.12  ? 432  TRP A NE1 1 
ATOM   3370 C CE2 . TRP A 1 432 ? 6.838   73.819 70.912 1.00 34.12  ? 432  TRP A CE2 1 
ATOM   3371 C CE3 . TRP A 1 432 ? 7.622   73.214 73.124 1.00 34.12  ? 432  TRP A CE3 1 
ATOM   3372 C CZ2 . TRP A 1 432 ? 5.615   73.165 71.112 1.00 34.12  ? 432  TRP A CZ2 1 
ATOM   3373 C CZ3 . TRP A 1 432 ? 6.402   72.562 73.327 1.00 34.12  ? 432  TRP A CZ3 1 
ATOM   3374 C CH2 . TRP A 1 432 ? 5.417   72.544 72.323 1.00 34.12  ? 432  TRP A CH2 1 
ATOM   3375 N N   . PRO A 1 433 ? 11.821  75.484 74.775 1.00 37.05  ? 433  PRO A N   1 
ATOM   3376 C CA  . PRO A 1 433 ? 13.114  75.618 75.454 1.00 37.05  ? 433  PRO A CA  1 
ATOM   3377 C C   . PRO A 1 433 ? 14.302  75.337 74.544 1.00 37.05  ? 433  PRO A C   1 
ATOM   3378 O O   . PRO A 1 433 ? 14.147  74.750 73.475 1.00 37.05  ? 433  PRO A O   1 
ATOM   3379 C CB  . PRO A 1 433 ? 13.004  74.625 76.608 1.00 33.61  ? 433  PRO A CB  1 
ATOM   3380 C CG  . PRO A 1 433 ? 12.059  73.584 76.068 1.00 33.61  ? 433  PRO A CG  1 
ATOM   3381 C CD  . PRO A 1 433 ? 11.016  74.404 75.372 1.00 33.61  ? 433  PRO A CD  1 
ATOM   3382 N N   . GLU A 1 434 ? 15.486  75.756 74.982 1.00 39.10  ? 434  GLU A N   1 
ATOM   3383 C CA  . GLU A 1 434 ? 16.712  75.580 74.212 1.00 39.10  ? 434  GLU A CA  1 
ATOM   3384 C C   . GLU A 1 434 ? 17.132  74.128 74.058 1.00 39.10  ? 434  GLU A C   1 
ATOM   3385 O O   . GLU A 1 434 ? 17.584  73.730 72.988 1.00 39.10  ? 434  GLU A O   1 
ATOM   3386 C CB  . GLU A 1 434 ? 17.884  76.347 74.848 1.00 84.05  ? 434  GLU A CB  1 
ATOM   3387 C CG  . GLU A 1 434 ? 17.728  77.868 74.941 1.00 84.05  ? 434  GLU A CG  1 
ATOM   3388 C CD  . GLU A 1 434 ? 17.617  78.561 73.579 1.00 84.05  ? 434  GLU A CD  1 
ATOM   3389 O OE1 . GLU A 1 434 ? 18.543  78.435 72.736 1.00 84.05  ? 434  GLU A OE1 1 
ATOM   3390 O OE2 . GLU A 1 434 ? 16.591  79.251 73.354 1.00 84.05  ? 434  GLU A OE2 1 
ATOM   3391 N N   . TRP A 1 435 ? 16.993  73.328 75.110 1.00 36.49  ? 435  TRP A N   1 
ATOM   3392 C CA  . TRP A 1 435 ? 17.437  71.941 75.013 1.00 36.49  ? 435  TRP A CA  1 
ATOM   3393 C C   . TRP A 1 435 ? 16.787  71.176 73.860 1.00 36.49  ? 435  TRP A C   1 
ATOM   3394 O O   . TRP A 1 435 ? 17.271  70.122 73.455 1.00 36.49  ? 435  TRP A O   1 
ATOM   3395 C CB  . TRP A 1 435 ? 17.232  71.195 76.341 1.00 36.33  ? 435  TRP A CB  1 
ATOM   3396 C CG  . TRP A 1 435 ? 15.822  70.964 76.726 1.00 36.33  ? 435  TRP A CG  1 
ATOM   3397 C CD1 . TRP A 1 435 ? 15.070  71.722 77.565 1.00 36.33  ? 435  TRP A CD1 1 
ATOM   3398 C CD2 . TRP A 1 435 ? 14.974  69.906 76.270 1.00 36.33  ? 435  TRP A CD2 1 
ATOM   3399 N NE1 . TRP A 1 435 ? 13.798  71.207 77.662 1.00 36.33  ? 435  TRP A NE1 1 
ATOM   3400 C CE2 . TRP A 1 435 ? 13.714  70.091 76.876 1.00 36.33  ? 435  TRP A CE2 1 
ATOM   3401 C CE3 . TRP A 1 435 ? 15.156  68.820 75.404 1.00 36.33  ? 435  TRP A CE3 1 
ATOM   3402 C CZ2 . TRP A 1 435 ? 12.641  69.234 76.645 1.00 36.33  ? 435  TRP A CZ2 1 
ATOM   3403 C CZ3 . TRP A 1 435 ? 14.088  67.969 75.173 1.00 36.33  ? 435  TRP A CZ3 1 
ATOM   3404 C CH2 . TRP A 1 435 ? 12.847  68.182 75.791 1.00 36.33  ? 435  TRP A CH2 1 
ATOM   3405 N N   . MET A 1 436 ? 15.707  71.717 73.311 1.00 39.00  ? 436  MET A N   1 
ATOM   3406 C CA  . MET A 1 436 ? 15.036  71.043 72.209 1.00 39.00  ? 436  MET A CA  1 
ATOM   3407 C C   . MET A 1 436 ? 15.702  71.303 70.856 1.00 39.00  ? 436  MET A C   1 
ATOM   3408 O O   . MET A 1 436 ? 15.449  70.585 69.901 1.00 39.00  ? 436  MET A O   1 
ATOM   3409 C CB  . MET A 1 436 ? 13.553  71.431 72.179 1.00 38.75  ? 436  MET A CB  1 
ATOM   3410 C CG  . MET A 1 436 ? 12.770  70.881 73.367 1.00 38.75  ? 436  MET A CG  1 
ATOM   3411 S SD  . MET A 1 436 ? 11.021  71.346 73.375 1.00 38.75  ? 436  MET A SD  1 
ATOM   3412 C CE  . MET A 1 436 ? 10.346  70.199 72.169 1.00 38.75  ? 436  MET A CE  1 
ATOM   3413 N N   . GLY A 1 437 ? 16.551  72.326 70.783 1.00 34.95  ? 437  GLY A N   1 
ATOM   3414 C CA  . GLY A 1 437 ? 17.273  72.648 69.554 1.00 34.95  ? 437  GLY A CA  1 
ATOM   3415 C C   . GLY A 1 437 ? 16.496  72.977 68.286 1.00 34.95  ? 437  GLY A C   1 
ATOM   3416 O O   . GLY A 1 437 ? 15.513  73.708 68.317 1.00 34.95  ? 437  GLY A O   1 
ATOM   3417 N N   . VAL A 1 438 ? 16.973  72.457 67.159 1.00 33.57  ? 438  VAL A N   1 
ATOM   3418 C CA  . VAL A 1 438 ? 16.326  72.657 65.864 1.00 33.57  ? 438  VAL A CA  1 
ATOM   3419 C C   . VAL A 1 438 ? 15.224  71.606 65.785 1.00 33.57  ? 438  VAL A C   1 
ATOM   3420 O O   . VAL A 1 438 ? 15.435  70.483 65.318 1.00 33.57  ? 438  VAL A O   1 
ATOM   3421 C CB  . VAL A 1 438 ? 17.319  72.443 64.722 1.00 27.82  ? 438  VAL A CB  1 
ATOM   3422 C CG1 . VAL A 1 438 ? 16.683  72.831 63.399 1.00 27.82  ? 438  VAL A CG1 1 
ATOM   3423 C CG2 . VAL A 1 438 ? 18.572  73.245 64.988 1.00 27.82  ? 438  VAL A CG2 1 
ATOM   3424 N N   . ILE A 1 439 ? 14.048  72.003 66.256 1.00 39.32  ? 439  ILE A N   1 
ATOM   3425 C CA  . ILE A 1 439 ? 12.873  71.144 66.353 1.00 39.32  ? 439  ILE A CA  1 
ATOM   3426 C C   . ILE A 1 439 ? 12.186  70.649 65.086 1.00 39.32  ? 439  ILE A C   1 
ATOM   3427 O O   . ILE A 1 439 ? 12.128  71.327 64.059 1.00 39.32  ? 439  ILE A O   1 
ATOM   3428 C CB  . ILE A 1 439 ? 11.797  71.828 67.208 1.00 38.07  ? 439  ILE A CB  1 
ATOM   3429 C CG1 . ILE A 1 439 ? 12.397  72.244 68.544 1.00 38.07  ? 439  ILE A CG1 1 
ATOM   3430 C CG2 . ILE A 1 439 ? 10.606  70.890 67.424 1.00 38.07  ? 439  ILE A CG2 1 
ATOM   3431 C CD1 . ILE A 1 439 ? 11.423  73.011 69.404 1.00 38.07  ? 439  ILE A CD1 1 
ATOM   3432 N N   . HIS A 1 440 ? 11.647  69.444 65.208 1.00 45.64  ? 440  HIS A N   1 
ATOM   3433 C CA  . HIS A 1 440 ? 10.901  68.775 64.158 1.00 45.64  ? 440  HIS A CA  1 
ATOM   3434 C C   . HIS A 1 440 ? 9.860   69.744 63.602 1.00 45.64  ? 440  HIS A C   1 
ATOM   3435 O O   . HIS A 1 440 ? 9.112   70.352 64.359 1.00 45.64  ? 440  HIS A O   1 
ATOM   3436 C CB  . HIS A 1 440 ? 10.208  67.565 64.775 1.00 50.11  ? 440  HIS A CB  1 
ATOM   3437 C CG  . HIS A 1 440 ? 9.480   66.705 63.795 1.00 50.11  ? 440  HIS A CG  1 
ATOM   3438 N ND1 . HIS A 1 440 ? 10.116  66.055 62.756 1.00 50.11  ? 440  HIS A ND1 1 
ATOM   3439 C CD2 . HIS A 1 440 ? 8.176   66.336 63.732 1.00 50.11  ? 440  HIS A CD2 1 
ATOM   3440 C CE1 . HIS A 1 440 ? 9.236   65.318 62.100 1.00 50.11  ? 440  HIS A CE1 1 
ATOM   3441 N NE2 . HIS A 1 440 ? 8.051   65.470 62.673 1.00 50.11  ? 440  HIS A NE2 1 
ATOM   3442 N N   . GLY A 1 441 ? 9.828   69.905 62.284 1.00 45.07  ? 441  GLY A N   1 
ATOM   3443 C CA  . GLY A 1 441 ? 8.842   70.781 61.674 1.00 45.07  ? 441  GLY A CA  1 
ATOM   3444 C C   . GLY A 1 441 ? 9.057   72.289 61.685 1.00 45.07  ? 441  GLY A C   1 
ATOM   3445 O O   . GLY A 1 441 ? 8.210   73.042 61.196 1.00 45.07  ? 441  GLY A O   1 
ATOM   3446 N N   . TYR A 1 442 ? 10.179  72.754 62.211 1.00 46.88  ? 442  TYR A N   1 
ATOM   3447 C CA  . TYR A 1 442 ? 10.406  74.186 62.241 1.00 46.88  ? 442  TYR A CA  1 
ATOM   3448 C C   . TYR A 1 442 ? 11.233  74.746 61.092 1.00 46.88  ? 442  TYR A C   1 
ATOM   3449 O O   . TYR A 1 442 ? 11.719  75.880 61.157 1.00 46.88  ? 442  TYR A O   1 
ATOM   3450 C CB  . TYR A 1 442 ? 10.978  74.596 63.601 1.00 38.13  ? 442  TYR A CB  1 
ATOM   3451 C CG  . TYR A 1 442 ? 9.878   74.692 64.627 1.00 38.13  ? 442  TYR A CG  1 
ATOM   3452 C CD1 . TYR A 1 442 ? 9.399   73.556 65.275 1.00 38.13  ? 442  TYR A CD1 1 
ATOM   3453 C CD2 . TYR A 1 442 ? 9.241   75.906 64.876 1.00 38.13  ? 442  TYR A CD2 1 
ATOM   3454 C CE1 . TYR A 1 442 ? 8.309   73.628 66.141 1.00 38.13  ? 442  TYR A CE1 1 
ATOM   3455 C CE2 . TYR A 1 442 ? 8.148   75.984 65.737 1.00 38.13  ? 442  TYR A CE2 1 
ATOM   3456 C CZ  . TYR A 1 442 ? 7.689   74.844 66.362 1.00 38.13  ? 442  TYR A CZ  1 
ATOM   3457 O OH  . TYR A 1 442 ? 6.597   74.923 67.197 1.00 38.13  ? 442  TYR A OH  1 
ATOM   3458 N N   . GLU A 1 443 ? 11.390  73.950 60.039 1.00 39.80  ? 443  GLU A N   1 
ATOM   3459 C CA  . GLU A 1 443 ? 12.103  74.403 58.850 1.00 39.80  ? 443  GLU A CA  1 
ATOM   3460 C C   . GLU A 1 443 ? 10.995  74.819 57.900 1.00 39.80  ? 443  GLU A C   1 
ATOM   3461 O O   . GLU A 1 443 ? 11.229  75.492 56.906 1.00 39.80  ? 443  GLU A O   1 
ATOM   3462 C CB  . GLU A 1 443 ? 12.928  73.276 58.209 1.00 50.46  ? 443  GLU A CB  1 
ATOM   3463 C CG  . GLU A 1 443 ? 12.149  72.266 57.346 1.00 50.46  ? 443  GLU A CG  1 
ATOM   3464 C CD  . GLU A 1 443 ? 11.137  71.415 58.131 1.00 50.46  ? 443  GLU A CD  1 
ATOM   3465 O OE1 . GLU A 1 443 ? 11.275  71.259 59.370 1.00 50.46  ? 443  GLU A OE1 1 
ATOM   3466 O OE2 . GLU A 1 443 ? 10.203  70.882 57.497 1.00 50.46  ? 443  GLU A OE2 1 
ATOM   3467 N N   . ILE A 1 444 ? 9.779   74.393 58.233 1.00 37.69  ? 444  ILE A N   1 
ATOM   3468 C CA  . ILE A 1 444 ? 8.595   74.687 57.447 1.00 37.69  ? 444  ILE A CA  1 
ATOM   3469 C C   . ILE A 1 444 ? 8.394   76.188 57.284 1.00 37.69  ? 444  ILE A C   1 
ATOM   3470 O O   . ILE A 1 444 ? 8.176   76.663 56.176 1.00 37.69  ? 444  ILE A O   1 
ATOM   3471 C CB  . ILE A 1 444 ? 7.323   74.080 58.115 1.00 39.03  ? 444  ILE A CB  1 
ATOM   3472 C CG1 . ILE A 1 444 ? 7.327   72.554 57.978 1.00 39.03  ? 444  ILE A CG1 1 
ATOM   3473 C CG2 . ILE A 1 444 ? 6.067   74.654 57.481 1.00 39.03  ? 444  ILE A CG2 1 
ATOM   3474 C CD1 . ILE A 1 444 ? 6.122   71.871 58.619 1.00 39.03  ? 444  ILE A CD1 1 
ATOM   3475 N N   . GLU A 1 445 ? 8.471   76.930 58.384 1.00 42.09  ? 445  GLU A N   1 
ATOM   3476 C CA  . GLU A 1 445 ? 8.268   78.376 58.346 1.00 42.09  ? 445  GLU A CA  1 
ATOM   3477 C C   . GLU A 1 445 ? 9.214   79.122 57.411 1.00 42.09  ? 445  GLU A C   1 
ATOM   3478 O O   . GLU A 1 445 ? 8.874   80.201 56.921 1.00 42.09  ? 445  GLU A O   1 
ATOM   3479 C CB  . GLU A 1 445 ? 8.334   78.967 59.763 1.00 60.46  ? 445  GLU A CB  1 
ATOM   3480 C CG  . GLU A 1 445 ? 9.536   78.553 60.605 1.00 60.46  ? 445  GLU A CG  1 
ATOM   3481 C CD  . GLU A 1 445 ? 9.291   78.779 62.108 1.00 60.46  ? 445  GLU A CD  1 
ATOM   3482 O OE1 . GLU A 1 445 ? 8.486   78.021 62.706 1.00 60.46  ? 445  GLU A OE1 1 
ATOM   3483 O OE2 . GLU A 1 445 ? 9.891   79.716 62.694 1.00 60.46  ? 445  GLU A OE2 1 
ATOM   3484 N N   . PHE A 1 446 ? 10.390  78.550 57.156 1.00 38.14  ? 446  PHE A N   1 
ATOM   3485 C CA  . PHE A 1 446 ? 11.338  79.175 56.245 1.00 38.14  ? 446  PHE A CA  1 
ATOM   3486 C C   . PHE A 1 446 ? 10.948  78.827 54.821 1.00 38.14  ? 446  PHE A C   1 
ATOM   3487 O O   . PHE A 1 446 ? 11.146  79.619 53.901 1.00 38.14  ? 446  PHE A O   1 
ATOM   3488 C CB  . PHE A 1 446 ? 12.766  78.706 56.514 1.00 34.02  ? 446  PHE A CB  1 
ATOM   3489 C CG  . PHE A 1 446 ? 13.354  79.262 57.780 1.00 34.02  ? 446  PHE A CG  1 
ATOM   3490 C CD1 . PHE A 1 446 ? 13.017  78.725 59.016 1.00 34.02  ? 446  PHE A CD1 1 
ATOM   3491 C CD2 . PHE A 1 446 ? 14.229  80.347 57.734 1.00 34.02  ? 446  PHE A CD2 1 
ATOM   3492 C CE1 . PHE A 1 446 ? 13.536  79.255 60.185 1.00 34.02  ? 446  PHE A CE1 1 
ATOM   3493 C CE2 . PHE A 1 446 ? 14.754  80.883 58.896 1.00 34.02  ? 446  PHE A CE2 1 
ATOM   3494 C CZ  . PHE A 1 446 ? 14.407  80.336 60.128 1.00 34.02  ? 446  PHE A CZ  1 
ATOM   3495 N N   . VAL A 1 447 ? 10.382  77.640 54.639 1.00 34.40  ? 447  VAL A N   1 
ATOM   3496 C CA  . VAL A 1 447 ? 9.961   77.214 53.318 1.00 34.40  ? 447  VAL A CA  1 
ATOM   3497 C C   . VAL A 1 447 ? 8.787   78.050 52.833 1.00 34.40  ? 447  VAL A C   1 
ATOM   3498 O O   . VAL A 1 447 ? 8.723   78.395 51.658 1.00 34.40  ? 447  VAL A O   1 
ATOM   3499 C CB  . VAL A 1 447 ? 9.554   75.729 53.307 1.00 29.85  ? 447  VAL A CB  1 
ATOM   3500 C CG1 . VAL A 1 447 ? 8.845   75.395 52.008 1.00 29.85  ? 447  VAL A CG1 1 
ATOM   3501 C CG2 . VAL A 1 447 ? 10.785  74.855 53.477 1.00 29.85  ? 447  VAL A CG2 1 
ATOM   3502 N N   . PHE A 1 448 ? 7.864   78.378 53.737 1.00 40.65  ? 448  PHE A N   1 
ATOM   3503 C CA  . PHE A 1 448 ? 6.693   79.173 53.360 1.00 40.65  ? 448  PHE A CA  1 
ATOM   3504 C C   . PHE A 1 448 ? 6.899   80.677 53.464 1.00 40.65  ? 448  PHE A C   1 
ATOM   3505 O O   . PHE A 1 448 ? 5.974   81.455 53.238 1.00 40.65  ? 448  PHE A O   1 
ATOM   3506 C CB  . PHE A 1 448 ? 5.465   78.764 54.167 1.00 34.64  ? 448  PHE A CB  1 
ATOM   3507 C CG  . PHE A 1 448 ? 4.843   77.479 53.707 1.00 34.64  ? 448  PHE A CG  1 
ATOM   3508 C CD1 . PHE A 1 448 ? 5.376   76.254 54.086 1.00 34.64  ? 448  PHE A CD1 1 
ATOM   3509 C CD2 . PHE A 1 448 ? 3.720   77.494 52.882 1.00 34.64  ? 448  PHE A CD2 1 
ATOM   3510 C CE1 . PHE A 1 448 ? 4.795   75.057 53.650 1.00 34.64  ? 448  PHE A CE1 1 
ATOM   3511 C CE2 . PHE A 1 448 ? 3.129   76.300 52.438 1.00 34.64  ? 448  PHE A CE2 1 
ATOM   3512 C CZ  . PHE A 1 448 ? 3.666   75.084 52.823 1.00 34.64  ? 448  PHE A CZ  1 
ATOM   3513 N N   . GLY A 1 449 ? 8.116   81.073 53.820 1.00 43.93  ? 449  GLY A N   1 
ATOM   3514 C CA  . GLY A 1 449 ? 8.458   82.479 53.894 1.00 43.93  ? 449  GLY A CA  1 
ATOM   3515 C C   . GLY A 1 449 ? 7.976   83.353 55.027 1.00 43.93  ? 449  GLY A C   1 
ATOM   3516 O O   . GLY A 1 449 ? 7.980   84.568 54.870 1.00 43.93  ? 449  GLY A O   1 
ATOM   3517 N N   . LEU A 1 450 ? 7.583   82.780 56.160 1.00 46.21  ? 450  LEU A N   1 
ATOM   3518 C CA  . LEU A 1 450 ? 7.121   83.597 57.284 1.00 46.21  ? 450  LEU A CA  1 
ATOM   3519 C C   . LEU A 1 450 ? 8.150   84.646 57.736 1.00 46.21  ? 450  LEU A C   1 
ATOM   3520 O O   . LEU A 1 450 ? 7.780   85.684 58.267 1.00 46.21  ? 450  LEU A O   1 
ATOM   3521 C CB  . LEU A 1 450 ? 6.724   82.717 58.483 1.00 41.26  ? 450  LEU A CB  1 
ATOM   3522 C CG  . LEU A 1 450 ? 5.420   81.902 58.405 1.00 41.26  ? 450  LEU A CG  1 
ATOM   3523 C CD1 . LEU A 1 450 ? 4.222   82.822 58.404 1.00 41.26  ? 450  LEU A CD1 1 
ATOM   3524 C CD2 . LEU A 1 450 ? 5.412   81.046 57.148 1.00 41.26  ? 450  LEU A CD2 1 
ATOM   3525 N N   . PRO A 1 451 ? 9.452   84.391 57.542 1.00 46.42  ? 451  PRO A N   1 
ATOM   3526 C CA  . PRO A 1 451 ? 10.432  85.395 57.969 1.00 46.42  ? 451  PRO A CA  1 
ATOM   3527 C C   . PRO A 1 451 ? 10.397  86.717 57.179 1.00 46.42  ? 451  PRO A C   1 
ATOM   3528 O O   . PRO A 1 451 ? 11.025  87.697 57.585 1.00 46.42  ? 451  PRO A O   1 
ATOM   3529 C CB  . PRO A 1 451 ? 11.764  84.667 57.796 1.00 42.13  ? 451  PRO A CB  1 
ATOM   3530 C CG  . PRO A 1 451 ? 11.397  83.253 58.063 1.00 42.13  ? 451  PRO A CG  1 
ATOM   3531 C CD  . PRO A 1 451 ? 10.123  83.109 57.273 1.00 42.13  ? 451  PRO A CD  1 
ATOM   3532 N N   . LEU A 1 452 ? 9.689   86.742 56.050 1.00 48.49  ? 452  LEU A N   1 
ATOM   3533 C CA  . LEU A 1 452 ? 9.611   87.957 55.250 1.00 48.49  ? 452  LEU A CA  1 
ATOM   3534 C C   . LEU A 1 452 ? 8.631   88.955 55.847 1.00 48.49  ? 452  LEU A C   1 
ATOM   3535 O O   . LEU A 1 452 ? 8.618   90.120 55.450 1.00 48.49  ? 452  LEU A O   1 
ATOM   3536 C CB  . LEU A 1 452 ? 9.168   87.666 53.816 1.00 44.33  ? 452  LEU A CB  1 
ATOM   3537 C CG  . LEU A 1 452 ? 9.804   86.541 53.010 1.00 44.33  ? 452  LEU A CG  1 
ATOM   3538 C CD1 . LEU A 1 452 ? 9.414   86.727 51.545 1.00 44.33  ? 452  LEU A CD1 1 
ATOM   3539 C CD2 . LEU A 1 452 ? 11.307  86.556 53.157 1.00 44.33  ? 452  LEU A CD2 1 
ATOM   3540 N N   . VAL A 1 453 ? 7.794   88.510 56.777 1.00 45.06  ? 453  VAL A N   1 
ATOM   3541 C CA  . VAL A 1 453 ? 6.843   89.420 57.394 1.00 45.06  ? 453  VAL A CA  1 
ATOM   3542 C C   . VAL A 1 453 ? 7.390   89.953 58.727 1.00 45.06  ? 453  VAL A C   1 
ATOM   3543 O O   . VAL A 1 453 ? 7.506   89.226 59.728 1.00 45.06  ? 453  VAL A O   1 
ATOM   3544 C CB  . VAL A 1 453 ? 5.467   88.741 57.583 1.00 54.43  ? 453  VAL A CB  1 
ATOM   3545 C CG1 . VAL A 1 453 ? 5.643   87.380 58.190 1.00 54.43  ? 453  VAL A CG1 1 
ATOM   3546 C CG2 . VAL A 1 453 ? 4.577   89.592 58.470 1.00 54.43  ? 453  VAL A CG2 1 
ATOM   3547 N N   . LYS A 1 454 ? 7.721   91.244 58.722 1.00 60.06  ? 454  LYS A N   1 
ATOM   3548 C CA  . LYS A 1 454 ? 8.296   91.929 59.885 1.00 60.06  ? 454  LYS A CA  1 
ATOM   3549 C C   . LYS A 1 454 ? 7.637   91.629 61.235 1.00 60.06  ? 454  LYS A C   1 
ATOM   3550 O O   . LYS A 1 454 ? 8.314   91.272 62.209 1.00 60.06  ? 454  LYS A O   1 
ATOM   3551 C CB  . LYS A 1 454 ? 8.262   93.448 59.658 1.00 85.03  ? 454  LYS A CB  1 
ATOM   3552 C CG  . LYS A 1 454 ? 8.620   93.905 58.238 1.00 85.03  ? 454  LYS A CG  1 
ATOM   3553 C CD  . LYS A 1 454 ? 10.057  93.570 57.839 1.00 85.03  ? 454  LYS A CD  1 
ATOM   3554 C CE  . LYS A 1 454 ? 10.356  94.072 56.416 1.00 85.03  ? 454  LYS A CE  1 
ATOM   3555 N NZ  . LYS A 1 454 ? 11.735  93.727 55.958 1.00 85.03  ? 454  LYS A NZ  1 
ATOM   3556 N N   . GLU A 1 455 ? 6.321   91.788 61.293 1.00 51.45  ? 455  GLU A N   1 
ATOM   3557 C CA  . GLU A 1 455 ? 5.580   91.584 62.534 1.00 51.45  ? 455  GLU A CA  1 
ATOM   3558 C C   . GLU A 1 455 ? 5.765   90.235 63.222 1.00 51.45  ? 455  GLU A C   1 
ATOM   3559 O O   . GLU A 1 455 ? 5.362   90.068 64.374 1.00 51.45  ? 455  GLU A O   1 
ATOM   3560 C CB  . GLU A 1 455 ? 4.080   91.850 62.315 1.00 89.09  ? 455  GLU A CB  1 
ATOM   3561 C CG  . GLU A 1 455 ? 3.601   91.834 60.850 1.00 89.09  ? 455  GLU A CG  1 
ATOM   3562 C CD  . GLU A 1 455 ? 4.358   92.823 59.945 1.00 89.09  ? 455  GLU A CD  1 
ATOM   3563 O OE1 . GLU A 1 455 ? 4.894   93.835 60.466 1.00 89.09  ? 455  GLU A OE1 1 
ATOM   3564 O OE2 . GLU A 1 455 ? 4.410   92.593 58.709 1.00 89.09  ? 455  GLU A OE2 1 
ATOM   3565 N N   . LEU A 1 456 ? 6.370   89.267 62.541 1.00 59.84  ? 456  LEU A N   1 
ATOM   3566 C CA  . LEU A 1 456 ? 6.573   87.973 63.174 1.00 59.84  ? 456  LEU A CA  1 
ATOM   3567 C C   . LEU A 1 456 ? 7.882   87.949 63.962 1.00 59.84  ? 456  LEU A C   1 
ATOM   3568 O O   . LEU A 1 456 ? 8.157   87.009 64.717 1.00 59.84  ? 456  LEU A O   1 
ATOM   3569 C CB  . LEU A 1 456 ? 6.519   86.859 62.133 1.00 53.01  ? 456  LEU A CB  1 
ATOM   3570 C CG  . LEU A 1 456 ? 5.115   86.703 61.530 1.00 53.01  ? 456  LEU A CG  1 
ATOM   3571 C CD1 . LEU A 1 456 ? 5.077   85.469 60.628 1.00 53.01  ? 456  LEU A CD1 1 
ATOM   3572 C CD2 . LEU A 1 456 ? 4.081   86.579 62.647 1.00 53.01  ? 456  LEU A CD2 1 
ATOM   3573 N N   . ASN A 1 457 ? 8.693   88.988 63.774 1.00 61.30  ? 457  ASN A N   1 
ATOM   3574 C CA  . ASN A 1 457 ? 9.935   89.135 64.522 1.00 61.30  ? 457  ASN A CA  1 
ATOM   3575 C C   . ASN A 1 457 ? 11.129  88.232 64.232 1.00 61.30  ? 457  ASN A C   1 
ATOM   3576 O O   . ASN A 1 457 ? 11.748  87.734 65.173 1.00 61.30  ? 457  ASN A O   1 
ATOM   3577 C CB  . ASN A 1 457 ? 9.647   89.059 66.037 1.00 62.52  ? 457  ASN A CB  1 
ATOM   3578 C CG  . ASN A 1 457 ? 8.719   90.177 66.524 1.00 62.52  ? 457  ASN A CG  1 
ATOM   3579 O OD1 . ASN A 1 457 ? 8.691   91.278 65.953 1.00 62.52  ? 457  ASN A OD1 1 
ATOM   3580 N ND2 . ASN A 1 457 ? 7.972   89.904 67.597 1.00 62.52  ? 457  ASN A ND2 1 
ATOM   3581 N N   . TYR A 1 458 ? 11.469  88.013 62.968 1.00 47.21  ? 458  TYR A N   1 
ATOM   3582 C CA  . TYR A 1 458 ? 12.652  87.204 62.677 1.00 47.21  ? 458  TYR A CA  1 
ATOM   3583 C C   . TYR A 1 458 ? 13.801  88.191 62.477 1.00 47.21  ? 458  TYR A C   1 
ATOM   3584 O O   . TYR A 1 458 ? 13.573  89.397 62.404 1.00 47.21  ? 458  TYR A O   1 
ATOM   3585 C CB  . TYR A 1 458 ? 12.471  86.360 61.409 1.00 37.89  ? 458  TYR A CB  1 
ATOM   3586 C CG  . TYR A 1 458 ? 11.513  85.201 61.565 1.00 37.89  ? 458  TYR A CG  1 
ATOM   3587 C CD1 . TYR A 1 458 ? 10.135  85.377 61.396 1.00 37.89  ? 458  TYR A CD1 1 
ATOM   3588 C CD2 . TYR A 1 458 ? 11.981  83.928 61.897 1.00 37.89  ? 458  TYR A CD2 1 
ATOM   3589 C CE1 . TYR A 1 458 ? 9.245   84.316 61.552 1.00 37.89  ? 458  TYR A CE1 1 
ATOM   3590 C CE2 . TYR A 1 458 ? 11.100  82.860 62.061 1.00 37.89  ? 458  TYR A CE2 1 
ATOM   3591 C CZ  . TYR A 1 458 ? 9.734   83.059 61.885 1.00 37.89  ? 458  TYR A CZ  1 
ATOM   3592 O OH  . TYR A 1 458 ? 8.860   82.004 62.039 1.00 37.89  ? 458  TYR A OH  1 
ATOM   3593 N N   . THR A 1 459 ? 15.029  87.690 62.391 1.00 47.03  ? 459  THR A N   1 
ATOM   3594 C CA  . THR A 1 459 ? 16.190  88.552 62.196 1.00 47.03  ? 459  THR A CA  1 
ATOM   3595 C C   . THR A 1 459 ? 16.411  88.789 60.709 1.00 47.03  ? 459  THR A C   1 
ATOM   3596 O O   . THR A 1 459 ? 15.723  88.201 59.869 1.00 47.03  ? 459  THR A O   1 
ATOM   3597 C CB  . THR A 1 459 ? 17.461  87.903 62.750 1.00 40.61  ? 459  THR A CB  1 
ATOM   3598 O OG1 . THR A 1 459 ? 17.735  86.706 62.012 1.00 40.61  ? 459  THR A OG1 1 
ATOM   3599 C CG2 . THR A 1 459 ? 17.288  87.563 64.229 1.00 40.61  ? 459  THR A CG2 1 
ATOM   3600 N N   . ALA A 1 460 ? 17.385  89.635 60.377 1.00 53.78  ? 460  ALA A N   1 
ATOM   3601 C CA  . ALA A 1 460 ? 17.677  89.913 58.974 1.00 53.78  ? 460  ALA A CA  1 
ATOM   3602 C C   . ALA A 1 460 ? 18.286  88.676 58.323 1.00 53.78  ? 460  ALA A C   1 
ATOM   3603 O O   . ALA A 1 460 ? 17.954  88.352 57.179 1.00 53.78  ? 460  ALA A O   1 
ATOM   3604 C CB  . ALA A 1 460 ? 18.633  91.096 58.849 1.00 47.56  ? 460  ALA A CB  1 
ATOM   3605 N N   . GLU A 1 461 ? 19.183  87.987 59.029 1.00 46.32  ? 461  GLU A N   1 
ATOM   3606 C CA  . GLU A 1 461 ? 19.791  86.789 58.455 1.00 46.32  ? 461  GLU A CA  1 
ATOM   3607 C C   . GLU A 1 461 ? 18.764  85.675 58.270 1.00 46.32  ? 461  GLU A C   1 
ATOM   3608 O O   . GLU A 1 461 ? 18.877  84.882 57.341 1.00 46.32  ? 461  GLU A O   1 
ATOM   3609 C CB  . GLU A 1 461 ? 20.960  86.281 59.305 1.00 82.37  ? 461  GLU A CB  1 
ATOM   3610 C CG  . GLU A 1 461 ? 20.911  86.693 60.759 1.00 82.37  ? 461  GLU A CG  1 
ATOM   3611 C CD  . GLU A 1 461 ? 21.382  88.121 60.960 1.00 82.37  ? 461  GLU A CD  1 
ATOM   3612 O OE1 . GLU A 1 461 ? 22.541  88.411 60.577 1.00 82.37  ? 461  GLU A OE1 1 
ATOM   3613 O OE2 . GLU A 1 461 ? 20.603  88.948 61.498 1.00 82.37  ? 461  GLU A OE2 1 
ATOM   3614 N N   . GLU A 1 462 ? 17.759  85.626 59.140 1.00 50.71  ? 462  GLU A N   1 
ATOM   3615 C CA  . GLU A 1 462 ? 16.719  84.615 59.020 1.00 50.71  ? 462  GLU A CA  1 
ATOM   3616 C C   . GLU A 1 462 ? 15.825  84.905 57.804 1.00 50.71  ? 462  GLU A C   1 
ATOM   3617 O O   . GLU A 1 462 ? 15.319  83.973 57.168 1.00 50.71  ? 462  GLU A O   1 
ATOM   3618 C CB  . GLU A 1 462 ? 15.887  84.546 60.302 1.00 46.41  ? 462  GLU A CB  1 
ATOM   3619 C CG  . GLU A 1 462 ? 16.679  84.025 61.486 1.00 46.41  ? 462  GLU A CG  1 
ATOM   3620 C CD  . GLU A 1 462 ? 15.869  83.940 62.765 1.00 46.41  ? 462  GLU A CD  1 
ATOM   3621 O OE1 . GLU A 1 462 ? 15.141  84.906 63.086 1.00 46.41  ? 462  GLU A OE1 1 
ATOM   3622 O OE2 . GLU A 1 462 ? 15.974  82.909 63.463 1.00 46.41  ? 462  GLU A OE2 1 
ATOM   3623 N N   . GLU A 1 463 ? 15.631  86.183 57.472 1.00 43.88  ? 463  GLU A N   1 
ATOM   3624 C CA  . GLU A 1 463 ? 14.821  86.532 56.305 1.00 43.88  ? 463  GLU A CA  1 
ATOM   3625 C C   . GLU A 1 463 ? 15.593  86.156 55.056 1.00 43.88  ? 463  GLU A C   1 
ATOM   3626 O O   . GLU A 1 463 ? 15.018  85.699 54.066 1.00 43.88  ? 463  GLU A O   1 
ATOM   3627 C CB  . GLU A 1 463 ? 14.521  88.037 56.234 1.00 71.24  ? 463  GLU A CB  1 
ATOM   3628 C CG  . GLU A 1 463 ? 13.582  88.390 55.073 1.00 71.24  ? 463  GLU A CG  1 
ATOM   3629 C CD  . GLU A 1 463 ? 13.465  89.889 54.786 1.00 71.24  ? 463  GLU A CD  1 
ATOM   3630 O OE1 . GLU A 1 463 ? 13.507  90.710 55.738 1.00 71.24  ? 463  GLU A OE1 1 
ATOM   3631 O OE2 . GLU A 1 463 ? 13.301  90.251 53.593 1.00 71.24  ? 463  GLU A OE2 1 
ATOM   3632 N N   . ALA A 1 464 ? 16.903  86.372 55.098 1.00 40.43  ? 464  ALA A N   1 
ATOM   3633 C CA  . ALA A 1 464 ? 17.745  86.053 53.953 1.00 40.43  ? 464  ALA A CA  1 
ATOM   3634 C C   . ALA A 1 464 ? 17.754  84.549 53.725 1.00 40.43  ? 464  ALA A C   1 
ATOM   3635 O O   . ALA A 1 464 ? 17.730  84.087 52.587 1.00 40.43  ? 464  ALA A O   1 
ATOM   3636 C CB  . ALA A 1 464 ? 19.168  86.560 54.180 1.00 31.62  ? 464  ALA A CB  1 
ATOM   3637 N N   . LEU A 1 465 ? 17.787  83.793 54.818 1.00 38.24  ? 465  LEU A N   1 
ATOM   3638 C CA  . LEU A 1 465 ? 17.796  82.343 54.738 1.00 38.24  ? 465  LEU A CA  1 
ATOM   3639 C C   . LEU A 1 465 ? 16.497  81.827 54.127 1.00 38.24  ? 465  LEU A C   1 
ATOM   3640 O O   . LEU A 1 465 ? 16.503  80.877 53.347 1.00 38.24  ? 465  LEU A O   1 
ATOM   3641 C CB  . LEU A 1 465 ? 17.983  81.737 56.128 1.00 33.60  ? 465  LEU A CB  1 
ATOM   3642 C CG  . LEU A 1 465 ? 17.940  80.213 56.190 1.00 33.60  ? 465  LEU A CG  1 
ATOM   3643 C CD1 . LEU A 1 465 ? 18.983  79.637 55.265 1.00 33.60  ? 465  LEU A CD1 1 
ATOM   3644 C CD2 . LEU A 1 465 ? 18.173  79.756 57.613 1.00 33.60  ? 465  LEU A CD2 1 
ATOM   3645 N N   . SER A 1 466 ? 15.388  82.462 54.477 1.00 33.08  ? 466  SER A N   1 
ATOM   3646 C CA  . SER A 1 466 ? 14.106  82.049 53.952 1.00 33.08  ? 466  SER A CA  1 
ATOM   3647 C C   . SER A 1 466 ? 14.039  82.245 52.438 1.00 33.08  ? 466  SER A C   1 
ATOM   3648 O O   . SER A 1 466 ? 13.539  81.381 51.718 1.00 33.08  ? 466  SER A O   1 
ATOM   3649 C CB  . SER A 1 466 ? 12.991  82.827 54.639 1.00 42.32  ? 466  SER A CB  1 
ATOM   3650 O OG  . SER A 1 466 ? 11.721  82.289 54.316 1.00 42.32  ? 466  SER A OG  1 
ATOM   3651 N N   . ARG A 1 467 ? 14.546  83.370 51.944 1.00 38.97  ? 467  ARG A N   1 
ATOM   3652 C CA  . ARG A 1 467 ? 14.520  83.613 50.510 1.00 38.97  ? 467  ARG A CA  1 
ATOM   3653 C C   . ARG A 1 467 ? 15.379  82.589 49.771 1.00 38.97  ? 467  ARG A C   1 
ATOM   3654 O O   . ARG A 1 467 ? 15.013  82.133 48.690 1.00 38.97  ? 467  ARG A O   1 
ATOM   3655 C CB  . ARG A 1 467 ? 14.988  85.035 50.195 1.00 40.72  ? 467  ARG A CB  1 
ATOM   3656 C CG  . ARG A 1 467 ? 13.982  86.088 50.583 1.00 40.72  ? 467  ARG A CG  1 
ATOM   3657 C CD  . ARG A 1 467 ? 14.515  87.506 50.408 1.00 40.72  ? 467  ARG A CD  1 
ATOM   3658 N NE  . ARG A 1 467 ? 13.514  88.480 50.837 1.00 40.72  ? 467  ARG A NE  1 
ATOM   3659 C CZ  . ARG A 1 467 ? 12.364  88.695 50.202 1.00 40.72  ? 467  ARG A CZ  1 
ATOM   3660 N NH1 . ARG A 1 467 ? 12.078  88.012 49.098 1.00 40.72  ? 467  ARG A NH1 1 
ATOM   3661 N NH2 . ARG A 1 467 ? 11.484  89.561 50.693 1.00 40.72  ? 467  ARG A NH2 1 
ATOM   3662 N N   . ARG A 1 468 ? 16.514  82.219 50.356 1.00 38.24  ? 468  ARG A N   1 
ATOM   3663 C CA  . ARG A 1 468 ? 17.385  81.225 49.734 1.00 38.24  ? 468  ARG A CA  1 
ATOM   3664 C C   . ARG A 1 468 ? 16.687  79.877 49.617 1.00 38.24  ? 468  ARG A C   1 
ATOM   3665 O O   . ARG A 1 468 ? 16.724  79.235 48.570 1.00 38.24  ? 468  ARG A O   1 
ATOM   3666 C CB  . ARG A 1 468 ? 18.646  81.012 50.553 1.00 48.72  ? 468  ARG A CB  1 
ATOM   3667 C CG  . ARG A 1 468 ? 19.764  81.937 50.268 1.00 48.72  ? 468  ARG A CG  1 
ATOM   3668 C CD  . ARG A 1 468 ? 20.854  81.668 51.269 1.00 48.72  ? 468  ARG A CD  1 
ATOM   3669 N NE  . ARG A 1 468 ? 21.326  80.291 51.176 1.00 48.72  ? 468  ARG A NE  1 
ATOM   3670 C CZ  . ARG A 1 468 ? 21.831  79.617 52.202 1.00 48.72  ? 468  ARG A CZ  1 
ATOM   3671 N NH1 . ARG A 1 468 ? 21.915  80.202 53.390 1.00 48.72  ? 468  ARG A NH1 1 
ATOM   3672 N NH2 . ARG A 1 468 ? 22.270  78.374 52.037 1.00 48.72  ? 468  ARG A NH2 1 
ATOM   3673 N N   . ILE A 1 469 ? 16.073  79.442 50.709 1.00 35.54  ? 469  ILE A N   1 
ATOM   3674 C CA  . ILE A 1 469 ? 15.384  78.163 50.724 1.00 35.54  ? 469  ILE A CA  1 
ATOM   3675 C C   . ILE A 1 469 ? 14.204  78.183 49.755 1.00 35.54  ? 469  ILE A C   1 
ATOM   3676 O O   . ILE A 1 469 ? 14.022  77.250 48.981 1.00 35.54  ? 469  ILE A O   1 
ATOM   3677 C CB  . ILE A 1 469 ? 14.954  77.807 52.172 1.00 29.51  ? 469  ILE A CB  1 
ATOM   3678 C CG1 . ILE A 1 469 ? 16.217  77.497 52.993 1.00 29.51  ? 469  ILE A CG1 1 
ATOM   3679 C CG2 . ILE A 1 469 ? 13.986  76.641 52.178 1.00 29.51  ? 469  ILE A CG2 1 
ATOM   3680 C CD1 . ILE A 1 469 ? 15.988  77.208 54.454 1.00 29.51  ? 469  ILE A CD1 1 
ATOM   3681 N N   . MET A 1 470 ? 13.424  79.261 49.773 1.00 41.59  ? 470  MET A N   1 
ATOM   3682 C CA  . MET A 1 470 ? 12.283  79.384 48.867 1.00 41.59  ? 470  MET A CA  1 
ATOM   3683 C C   . MET A 1 470 ? 12.739  79.350 47.411 1.00 41.59  ? 470  MET A C   1 
ATOM   3684 O O   . MET A 1 470 ? 12.065  78.778 46.552 1.00 41.59  ? 470  MET A O   1 
ATOM   3685 C CB  . MET A 1 470 ? 11.524  80.691 49.109 1.00 47.14  ? 470  MET A CB  1 
ATOM   3686 C CG  . MET A 1 470 ? 10.521  80.648 50.230 1.00 47.14  ? 470  MET A CG  1 
ATOM   3687 S SD  . MET A 1 470 ? 9.599   82.203 50.354 1.00 47.14  ? 470  MET A SD  1 
ATOM   3688 C CE  . MET A 1 470 ? 10.660  83.099 51.442 1.00 47.14  ? 470  MET A CE  1 
ATOM   3689 N N   . HIS A 1 471 ? 13.885  79.966 47.137 1.00 36.58  ? 471  HIS A N   1 
ATOM   3690 C CA  . HIS A 1 471 ? 14.396  80.000 45.781 1.00 36.58  ? 471  HIS A CA  1 
ATOM   3691 C C   . HIS A 1 471 ? 14.941  78.632 45.406 1.00 36.58  ? 471  HIS A C   1 
ATOM   3692 O O   . HIS A 1 471 ? 14.877  78.248 44.245 1.00 36.58  ? 471  HIS A O   1 
ATOM   3693 C CB  . HIS A 1 471 ? 15.484  81.065 45.626 1.00 58.17  ? 471  HIS A CB  1 
ATOM   3694 C CG  . HIS A 1 471 ? 15.881  81.313 44.202 1.00 58.17  ? 471  HIS A CG  1 
ATOM   3695 N ND1 . HIS A 1 471 ? 15.013  81.844 43.269 1.00 58.17  ? 471  HIS A ND1 1 
ATOM   3696 C CD2 . HIS A 1 471 ? 17.048  81.089 43.548 1.00 58.17  ? 471  HIS A CD2 1 
ATOM   3697 C CE1 . HIS A 1 471 ? 15.629  81.940 42.102 1.00 58.17  ? 471  HIS A CE1 1 
ATOM   3698 N NE2 . HIS A 1 471 ? 16.864  81.489 42.244 1.00 58.17  ? 471  HIS A NE2 1 
ATOM   3699 N N   . TYR A 1 472 ? 15.475  77.898 46.381 1.00 35.99  ? 472  TYR A N   1 
ATOM   3700 C CA  . TYR A 1 472 ? 15.995  76.551 46.117 1.00 35.99  ? 472  TYR A CA  1 
ATOM   3701 C C   . TYR A 1 472 ? 14.823  75.619 45.790 1.00 35.99  ? 472  TYR A C   1 
ATOM   3702 O O   . TYR A 1 472 ? 14.816  74.949 44.758 1.00 35.99  ? 472  TYR A O   1 
ATOM   3703 C CB  . TYR A 1 472 ? 16.720  75.964 47.334 1.00 39.49  ? 472  TYR A CB  1 
ATOM   3704 C CG  . TYR A 1 472 ? 18.104  76.488 47.641 1.00 39.49  ? 472  TYR A CG  1 
ATOM   3705 C CD1 . TYR A 1 472 ? 18.988  76.856 46.627 1.00 39.49  ? 472  TYR A CD1 1 
ATOM   3706 C CD2 . TYR A 1 472 ? 18.564  76.526 48.958 1.00 39.49  ? 472  TYR A CD2 1 
ATOM   3707 C CE1 . TYR A 1 472 ? 20.299  77.247 46.918 1.00 39.49  ? 472  TYR A CE1 1 
ATOM   3708 C CE2 . TYR A 1 472 ? 19.868  76.911 49.260 1.00 39.49  ? 472  TYR A CE2 1 
ATOM   3709 C CZ  . TYR A 1 472 ? 20.730  77.268 48.236 1.00 39.49  ? 472  TYR A CZ  1 
ATOM   3710 O OH  . TYR A 1 472 ? 22.021  77.640 48.545 1.00 39.49  ? 472  TYR A OH  1 
ATOM   3711 N N   . TRP A 1 473 ? 13.843  75.577 46.690 1.00 34.45  ? 473  TRP A N   1 
ATOM   3712 C CA  . TRP A 1 473 ? 12.675  74.726 46.508 1.00 34.45  ? 473  TRP A CA  1 
ATOM   3713 C C   . TRP A 1 473 ? 11.954  75.031 45.198 1.00 34.45  ? 473  TRP A C   1 
ATOM   3714 O O   . TRP A 1 473 ? 11.582  74.123 44.465 1.00 34.45  ? 473  TRP A O   1 
ATOM   3715 C CB  . TRP A 1 473 ? 11.690  74.905 47.670 1.00 33.98  ? 473  TRP A CB  1 
ATOM   3716 C CG  . TRP A 1 473 ? 11.842  73.963 48.855 1.00 33.98  ? 473  TRP A CG  1 
ATOM   3717 C CD1 . TRP A 1 473 ? 10.825  73.343 49.523 1.00 33.98  ? 473  TRP A CD1 1 
ATOM   3718 C CD2 . TRP A 1 473 ? 13.046  73.622 49.564 1.00 33.98  ? 473  TRP A CD2 1 
ATOM   3719 N NE1 . TRP A 1 473 ? 11.311  72.645 50.602 1.00 33.98  ? 473  TRP A NE1 1 
ATOM   3720 C CE2 . TRP A 1 473 ? 12.670  72.798 50.654 1.00 33.98  ? 473  TRP A CE2 1 
ATOM   3721 C CE3 . TRP A 1 473 ? 14.400  73.934 49.392 1.00 33.98  ? 473  TRP A CE3 1 
ATOM   3722 C CZ2 . TRP A 1 473 ? 13.601  72.283 51.566 1.00 33.98  ? 473  TRP A CZ2 1 
ATOM   3723 C CZ3 . TRP A 1 473 ? 15.324  73.422 50.301 1.00 33.98  ? 473  TRP A CZ3 1 
ATOM   3724 C CH2 . TRP A 1 473 ? 14.918  72.606 51.373 1.00 33.98  ? 473  TRP A CH2 1 
ATOM   3725 N N   . ALA A 1 474 ? 11.766  76.316 44.909 1.00 34.72  ? 474  ALA A N   1 
ATOM   3726 C CA  . ALA A 1 474 ? 11.065  76.752 43.701 1.00 34.72  ? 474  ALA A CA  1 
ATOM   3727 C C   . ALA A 1 474 ? 11.871  76.543 42.435 1.00 34.72  ? 474  ALA A C   1 
ATOM   3728 O O   . ALA A 1 474 ? 11.327  76.158 41.412 1.00 34.72  ? 474  ALA A O   1 
ATOM   3729 C CB  . ALA A 1 474 ? 10.670  78.221 43.832 1.00 23.66  ? 474  ALA A CB  1 
ATOM   3730 N N   . THR A 1 475 ? 13.169  76.801 42.501 1.00 40.92  ? 475  THR A N   1 
ATOM   3731 C CA  . THR A 1 475 ? 14.030  76.623 41.339 1.00 40.92  ? 475  THR A CA  1 
ATOM   3732 C C   . THR A 1 475 ? 14.173  75.143 41.013 1.00 40.92  ? 475  THR A C   1 
ATOM   3733 O O   . THR A 1 475 ? 14.391  74.761 39.855 1.00 40.92  ? 475  THR A O   1 
ATOM   3734 C CB  . THR A 1 475 ? 15.420  77.194 41.583 1.00 40.05  ? 475  THR A CB  1 
ATOM   3735 O OG1 . THR A 1 475 ? 15.310  78.593 41.874 1.00 40.05  ? 475  THR A OG1 1 
ATOM   3736 C CG2 . THR A 1 475 ? 16.303  76.988 40.354 1.00 40.05  ? 475  THR A CG2 1 
ATOM   3737 N N   . PHE A 1 476 ? 14.060  74.314 42.043 1.00 33.90  ? 476  PHE A N   1 
ATOM   3738 C CA  . PHE A 1 476 ? 14.151  72.882 41.868 1.00 33.90  ? 476  PHE A CA  1 
ATOM   3739 C C   . PHE A 1 476 ? 12.844  72.373 41.286 1.00 33.90  ? 476  PHE A C   1 
ATOM   3740 O O   . PHE A 1 476 ? 12.842  71.473 40.448 1.00 33.90  ? 476  PHE A O   1 
ATOM   3741 C CB  . PHE A 1 476 ? 14.410  72.192 43.205 1.00 32.17  ? 476  PHE A CB  1 
ATOM   3742 C CG  . PHE A 1 476 ? 14.216  70.706 43.165 1.00 32.17  ? 476  PHE A CG  1 
ATOM   3743 C CD1 . PHE A 1 476 ? 15.158  69.883 42.564 1.00 32.17  ? 476  PHE A CD1 1 
ATOM   3744 C CD2 . PHE A 1 476 ? 13.068  70.131 43.708 1.00 32.17  ? 476  PHE A CD2 1 
ATOM   3745 C CE1 . PHE A 1 476 ? 14.961  68.507 42.506 1.00 32.17  ? 476  PHE A CE1 1 
ATOM   3746 C CE2 . PHE A 1 476 ? 12.862  68.755 43.653 1.00 32.17  ? 476  PHE A CE2 1 
ATOM   3747 C CZ  . PHE A 1 476 ? 13.811  67.944 43.052 1.00 32.17  ? 476  PHE A CZ  1 
ATOM   3748 N N   . ALA A 1 477 ? 11.736  72.950 41.736 1.00 36.32  ? 477  ALA A N   1 
ATOM   3749 C CA  . ALA A 1 477 ? 10.428  72.540 41.259 1.00 36.32  ? 477  ALA A CA  1 
ATOM   3750 C C   . ALA A 1 477 ? 10.292  72.775 39.756 1.00 36.32  ? 477  ALA A C   1 
ATOM   3751 O O   . ALA A 1 477 ? 9.672   71.971 39.053 1.00 36.32  ? 477  ALA A O   1 
ATOM   3752 C CB  . ALA A 1 477 ? 9.353   73.293 42.002 1.00 20.64  ? 477  ALA A CB  1 
ATOM   3753 N N   . LYS A 1 478 ? 10.890  73.869 39.273 1.00 41.20  ? 478  LYS A N   1 
ATOM   3754 C CA  . LYS A 1 478 ? 10.829  74.253 37.866 1.00 41.20  ? 478  LYS A CA  1 
ATOM   3755 C C   . LYS A 1 478 ? 11.807  73.537 36.948 1.00 41.20  ? 478  LYS A C   1 
ATOM   3756 O O   . LYS A 1 478 ? 11.468  73.212 35.811 1.00 41.20  ? 478  LYS A O   1 
ATOM   3757 C CB  . LYS A 1 478 ? 11.099  75.758 37.703 1.00 64.21  ? 478  LYS A CB  1 
ATOM   3758 C CG  . LYS A 1 478 ? 10.125  76.677 38.404 1.00 64.21  ? 478  LYS A CG  1 
ATOM   3759 C CD  . LYS A 1 478 ? 10.748  78.065 38.643 1.00 64.21  ? 478  LYS A CD  1 
ATOM   3760 C CE  . LYS A 1 478 ? 9.832   78.952 39.509 1.00 64.21  ? 478  LYS A CE  1 
ATOM   3761 N NZ  . LYS A 1 478 ? 10.593  80.085 40.127 1.00 64.21  ? 478  LYS A NZ  1 
ATOM   3762 N N   . THR A 1 479 ? 13.019  73.302 37.441 1.00 35.15  ? 479  THR A N   1 
ATOM   3763 C CA  . THR A 1 479 ? 14.069  72.702 36.623 1.00 35.15  ? 479  THR A CA  1 
ATOM   3764 C C   . THR A 1 479 ? 14.634  71.342 37.023 1.00 35.15  ? 479  THR A C   1 
ATOM   3765 O O   . THR A 1 479 ? 15.275  70.687 36.212 1.00 35.15  ? 479  THR A O   1 
ATOM   3766 C CB  . THR A 1 479 ? 15.267  73.678 36.518 1.00 40.42  ? 479  THR A CB  1 
ATOM   3767 O OG1 . THR A 1 479 ? 16.011  73.669 37.748 1.00 40.42  ? 479  THR A OG1 1 
ATOM   3768 C CG2 . THR A 1 479 ? 14.767  75.105 36.259 1.00 40.42  ? 479  THR A CG2 1 
ATOM   3769 N N   . GLY A 1 480 ? 14.427  70.922 38.266 1.00 37.38  ? 480  GLY A N   1 
ATOM   3770 C CA  . GLY A 1 480 ? 14.977  69.647 38.695 1.00 37.38  ? 480  GLY A CA  1 
ATOM   3771 C C   . GLY A 1 480 ? 16.355  69.839 39.302 1.00 37.38  ? 480  GLY A C   1 
ATOM   3772 O O   . GLY A 1 480 ? 17.072  68.877 39.568 1.00 37.38  ? 480  GLY A O   1 
ATOM   3773 N N   . ASN A 1 481 ? 16.717  71.101 39.520 1.00 39.23  ? 481  ASN A N   1 
ATOM   3774 C CA  . ASN A 1 481 ? 18.007  71.480 40.092 1.00 39.23  ? 481  ASN A CA  1 
ATOM   3775 C C   . ASN A 1 481 ? 17.772  72.750 40.923 1.00 39.23  ? 481  ASN A C   1 
ATOM   3776 O O   . ASN A 1 481 ? 17.270  73.746 40.411 1.00 39.23  ? 481  ASN A O   1 
ATOM   3777 C CB  . ASN A 1 481 ? 18.979  71.770 38.958 1.00 41.96  ? 481  ASN A CB  1 
ATOM   3778 C CG  . ASN A 1 481 ? 20.370  72.069 39.444 1.00 41.96  ? 481  ASN A CG  1 
ATOM   3779 O OD1 . ASN A 1 481 ? 20.571  72.488 40.586 1.00 41.96  ? 481  ASN A OD1 1 
ATOM   3780 N ND2 . ASN A 1 481 ? 21.347  71.872 38.572 1.00 41.96  ? 481  ASN A ND2 1 
ATOM   3781 N N   . PRO A 1 482 ? 18.130  72.731 42.217 1.00 40.35  ? 482  PRO A N   1 
ATOM   3782 C CA  . PRO A 1 482 ? 17.928  73.901 43.076 1.00 40.35  ? 482  PRO A CA  1 
ATOM   3783 C C   . PRO A 1 482 ? 18.797  75.120 42.758 1.00 40.35  ? 482  PRO A C   1 
ATOM   3784 O O   . PRO A 1 482 ? 18.565  76.218 43.277 1.00 40.35  ? 482  PRO A O   1 
ATOM   3785 C CB  . PRO A 1 482 ? 18.202  73.346 44.471 1.00 33.99  ? 482  PRO A CB  1 
ATOM   3786 C CG  . PRO A 1 482 ? 19.261  72.325 44.211 1.00 33.99  ? 482  PRO A CG  1 
ATOM   3787 C CD  . PRO A 1 482 ? 18.744  71.627 42.977 1.00 33.99  ? 482  PRO A CD  1 
ATOM   3788 N N   . ASN A 1 483 ? 19.783  74.932 41.892 1.00 45.80  ? 483  ASN A N   1 
ATOM   3789 C CA  . ASN A 1 483 ? 20.691  76.016 41.540 1.00 45.80  ? 483  ASN A CA  1 
ATOM   3790 C C   . ASN A 1 483 ? 20.333  76.798 40.297 1.00 45.80  ? 483  ASN A C   1 
ATOM   3791 O O   . ASN A 1 483 ? 19.829  76.252 39.319 1.00 45.80  ? 483  ASN A O   1 
ATOM   3792 C CB  . ASN A 1 483 ? 22.101  75.467 41.375 1.00 44.04  ? 483  ASN A CB  1 
ATOM   3793 C CG  . ASN A 1 483 ? 22.585  74.770 42.615 1.00 44.04  ? 483  ASN A CG  1 
ATOM   3794 O OD1 . ASN A 1 483 ? 22.835  75.410 43.647 1.00 44.04  ? 483  ASN A OD1 1 
ATOM   3795 N ND2 . ASN A 1 483 ? 22.702  73.448 42.540 1.00 44.04  ? 483  ASN A ND2 1 
ATOM   3796 N N   . GLU A 1 484 ? 20.601  78.096 40.351 1.00 58.19  ? 484  GLU A N   1 
ATOM   3797 C CA  . GLU A 1 484 ? 20.363  78.972 39.216 1.00 58.19  ? 484  GLU A CA  1 
ATOM   3798 C C   . GLU A 1 484 ? 21.419  78.604 38.170 1.00 58.19  ? 484  GLU A C   1 
ATOM   3799 O O   . GLU A 1 484 ? 22.612  78.494 38.489 1.00 58.19  ? 484  GLU A O   1 
ATOM   3800 C CB  . GLU A 1 484 ? 20.518  80.427 39.652 1.00 84.54  ? 484  GLU A CB  1 
ATOM   3801 C CG  . GLU A 1 484 ? 19.290  80.966 40.347 1.00 84.54  ? 484  GLU A CG  1 
ATOM   3802 C CD  . GLU A 1 484 ? 18.214  81.322 39.338 1.00 84.54  ? 484  GLU A CD  1 
ATOM   3803 O OE1 . GLU A 1 484 ? 18.010  80.518 38.388 1.00 84.54  ? 484  GLU A OE1 1 
ATOM   3804 O OE2 . GLU A 1 484 ? 17.575  82.399 39.487 1.00 84.54  ? 484  GLU A OE2 1 
ATOM   3805 N N   . PRO A 1 485 ? 20.992  78.413 36.909 0.75 75.36  ? 485  PRO A N   1 
ATOM   3806 C CA  . PRO A 1 485 ? 21.878  78.046 35.796 0.75 75.36  ? 485  PRO A CA  1 
ATOM   3807 C C   . PRO A 1 485 ? 23.270  78.668 35.848 0.75 75.36  ? 485  PRO A C   1 
ATOM   3808 O O   . PRO A 1 485 ? 24.257  77.980 36.133 0.75 75.36  ? 485  PRO A O   1 
ATOM   3809 C CB  . PRO A 1 485 ? 21.093  78.497 34.567 0.75 69.45  ? 485  PRO A CB  1 
ATOM   3810 C CG  . PRO A 1 485 ? 19.663  78.270 34.986 0.75 69.45  ? 485  PRO A CG  1 
ATOM   3811 C CD  . PRO A 1 485 ? 19.655  78.804 36.412 0.75 69.45  ? 485  PRO A CD  1 
ATOM   3812 N N   . HIS A 1 486 ? 23.347  79.971 35.591 0.75 70.37  ? 486  HIS A N   1 
ATOM   3813 C CA  . HIS A 1 486 ? 24.633  80.667 35.578 0.75 70.37  ? 486  HIS A CA  1 
ATOM   3814 C C   . HIS A 1 486 ? 24.886  81.573 36.785 0.75 70.37  ? 486  HIS A C   1 
ATOM   3815 O O   . HIS A 1 486 ? 25.553  82.600 36.661 0.75 70.37  ? 486  HIS A O   1 
ATOM   3816 C CB  . HIS A 1 486 ? 24.747  81.506 34.300 0.75 80.78  ? 486  HIS A CB  1 
ATOM   3817 C CG  . HIS A 1 486 ? 24.522  80.730 33.039 0.75 80.78  ? 486  HIS A CG  1 
ATOM   3818 N ND1 . HIS A 1 486 ? 25.363  79.719 32.624 0.75 80.78  ? 486  HIS A ND1 1 
ATOM   3819 C CD2 . HIS A 1 486 ? 23.551  80.821 32.097 0.75 80.78  ? 486  HIS A CD2 1 
ATOM   3820 C CE1 . HIS A 1 486 ? 24.922  79.223 31.480 0.75 80.78  ? 486  HIS A CE1 1 
ATOM   3821 N NE2 . HIS A 1 486 ? 23.824  79.874 31.139 0.75 80.78  ? 486  HIS A NE2 1 
ATOM   3822 N N   . SER A 1 487 ? 24.364  81.200 37.948 0.75 48.58  ? 487  SER A N   1 
ATOM   3823 C CA  . SER A 1 487 ? 24.550  81.998 39.159 0.75 48.58  ? 487  SER A CA  1 
ATOM   3824 C C   . SER A 1 487 ? 26.020  82.119 39.573 0.75 48.58  ? 487  SER A C   1 
ATOM   3825 O O   . SER A 1 487 ? 26.890  81.425 39.037 0.75 48.58  ? 487  SER A O   1 
ATOM   3826 C CB  . SER A 1 487 ? 23.758  81.372 40.306 0.75 58.54  ? 487  SER A CB  1 
ATOM   3827 O OG  . SER A 1 487 ? 24.131  81.932 41.551 0.75 58.54  ? 487  SER A OG  1 
ATOM   3828 N N   . GLN A 1 488 ? 26.289  83.007 40.527 0.75 45.08  ? 488  GLN A N   1 
ATOM   3829 C CA  . GLN A 1 488 ? 27.643  83.202 41.042 0.75 45.08  ? 488  GLN A CA  1 
ATOM   3830 C C   . GLN A 1 488 ? 27.680  82.737 42.490 0.75 45.08  ? 488  GLN A C   1 
ATOM   3831 O O   . GLN A 1 488 ? 28.741  82.697 43.121 0.75 45.08  ? 488  GLN A O   1 
ATOM   3832 C CB  . GLN A 1 488 ? 28.046  84.677 40.985 0.75 63.54  ? 488  GLN A CB  1 
ATOM   3833 C CG  . GLN A 1 488 ? 28.173  85.237 39.583 0.75 63.54  ? 488  GLN A CG  1 
ATOM   3834 C CD  . GLN A 1 488 ? 29.057  84.375 38.705 0.75 63.54  ? 488  GLN A CD  1 
ATOM   3835 O OE1 . GLN A 1 488 ? 30.227  84.136 39.015 0.75 63.54  ? 488  GLN A OE1 1 
ATOM   3836 N NE2 . GLN A 1 488 ? 28.498  83.898 37.602 0.75 63.54  ? 488  GLN A NE2 1 
ATOM   3837 N N   . GLU A 1 489 ? 26.506  82.396 43.013 0.75 49.67  ? 489  GLU A N   1 
ATOM   3838 C CA  . GLU A 1 489 ? 26.381  81.930 44.391 0.75 49.67  ? 489  GLU A CA  1 
ATOM   3839 C C   . GLU A 1 489 ? 26.993  80.543 44.535 0.75 49.67  ? 489  GLU A C   1 
ATOM   3840 O O   . GLU A 1 489 ? 27.429  79.947 43.554 0.75 49.67  ? 489  GLU A O   1 
ATOM   3841 C CB  . GLU A 1 489 ? 24.908  81.876 44.803 0.75 84.97  ? 489  GLU A CB  1 
ATOM   3842 C CG  . GLU A 1 489 ? 24.175  83.207 44.728 0.75 84.97  ? 489  GLU A CG  1 
ATOM   3843 C CD  . GLU A 1 489 ? 24.802  84.270 45.614 0.75 84.97  ? 489  GLU A CD  1 
ATOM   3844 O OE1 . GLU A 1 489 ? 24.995  84.016 46.825 0.75 84.97  ? 489  GLU A OE1 1 
ATOM   3845 O OE2 . GLU A 1 489 ? 25.100  85.368 45.098 0.75 84.97  ? 489  GLU A OE2 1 
ATOM   3846 N N   . SER A 1 490 ? 27.027  80.042 45.768 1.00 68.41  ? 490  SER A N   1 
ATOM   3847 C CA  . SER A 1 490 ? 27.567  78.707 46.047 1.00 68.41  ? 490  SER A CA  1 
ATOM   3848 C C   . SER A 1 490 ? 26.639  77.640 45.483 1.00 68.41  ? 490  SER A C   1 
ATOM   3849 O O   . SER A 1 490 ? 25.409  77.775 45.558 1.00 68.41  ? 490  SER A O   1 
ATOM   3850 C CB  . SER A 1 490 ? 27.726  78.491 47.553 1.00 57.50  ? 490  SER A CB  1 
ATOM   3851 O OG  . SER A 1 490 ? 28.994  78.944 47.999 1.00 57.50  ? 490  SER A OG  1 
ATOM   3852 N N   . LYS A 1 491 ? 27.230  76.589 44.918 1.00 44.33  ? 491  LYS A N   1 
ATOM   3853 C CA  . LYS A 1 491 ? 26.455  75.507 44.335 1.00 44.33  ? 491  LYS A CA  1 
ATOM   3854 C C   . LYS A 1 491 ? 26.152  74.365 45.301 1.00 44.33  ? 491  LYS A C   1 
ATOM   3855 O O   . LYS A 1 491 ? 27.043  73.856 45.988 1.00 44.33  ? 491  LYS A O   1 
ATOM   3856 C CB  . LYS A 1 491 ? 27.176  74.947 43.112 1.00 67.79  ? 491  LYS A CB  1 
ATOM   3857 C CG  . LYS A 1 491 ? 27.392  75.976 42.011 1.00 67.79  ? 491  LYS A CG  1 
ATOM   3858 C CD  . LYS A 1 491 ? 26.069  76.612 41.565 1.00 67.79  ? 491  LYS A CD  1 
ATOM   3859 C CE  . LYS A 1 491 ? 26.301  77.695 40.516 1.00 67.79  ? 491  LYS A CE  1 
ATOM   3860 N NZ  . LYS A 1 491 ? 25.012  78.171 39.922 1.00 67.79  ? 491  LYS A NZ  1 
ATOM   3861 N N   . TRP A 1 492 ? 24.876  73.988 45.349 1.00 37.12  ? 492  TRP A N   1 
ATOM   3862 C CA  . TRP A 1 492 ? 24.393  72.887 46.172 1.00 37.12  ? 492  TRP A CA  1 
ATOM   3863 C C   . TRP A 1 492 ? 24.798  71.679 45.345 1.00 37.12  ? 492  TRP A C   1 
ATOM   3864 O O   . TRP A 1 492 ? 24.143  71.350 44.366 1.00 37.12  ? 492  TRP A O   1 
ATOM   3865 C CB  . TRP A 1 492 ? 22.868  72.957 46.267 1.00 28.95  ? 492  TRP A CB  1 
ATOM   3866 C CG  . TRP A 1 492 ? 22.213  71.943 47.166 1.00 28.95  ? 492  TRP A CG  1 
ATOM   3867 C CD1 . TRP A 1 492 ? 22.688  70.706 47.504 1.00 28.95  ? 492  TRP A CD1 1 
ATOM   3868 C CD2 . TRP A 1 492 ? 20.925  72.053 47.775 1.00 28.95  ? 492  TRP A CD2 1 
ATOM   3869 N NE1 . TRP A 1 492 ? 21.775  70.041 48.282 1.00 28.95  ? 492  TRP A NE1 1 
ATOM   3870 C CE2 . TRP A 1 492 ? 20.683  70.845 48.464 1.00 28.95  ? 492  TRP A CE2 1 
ATOM   3871 C CE3 . TRP A 1 492 ? 19.951  73.054 47.806 1.00 28.95  ? 492  TRP A CE3 1 
ATOM   3872 C CZ2 . TRP A 1 492 ? 19.504  70.613 49.173 1.00 28.95  ? 492  TRP A CZ2 1 
ATOM   3873 C CZ3 . TRP A 1 492 ? 18.782  72.823 48.508 1.00 28.95  ? 492  TRP A CZ3 1 
ATOM   3874 C CH2 . TRP A 1 492 ? 18.569  71.611 49.183 1.00 28.95  ? 492  TRP A CH2 1 
ATOM   3875 N N   . PRO A 1 493 ? 25.887  71.002 45.717 1.00 38.85  ? 493  PRO A N   1 
ATOM   3876 C CA  . PRO A 1 493 ? 26.285  69.844 44.918 1.00 38.85  ? 493  PRO A CA  1 
ATOM   3877 C C   . PRO A 1 493 ? 25.254  68.722 44.882 1.00 38.85  ? 493  PRO A C   1 
ATOM   3878 O O   . PRO A 1 493 ? 24.461  68.558 45.798 1.00 38.85  ? 493  PRO A O   1 
ATOM   3879 C CB  . PRO A 1 493 ? 27.590  69.418 45.573 1.00 32.66  ? 493  PRO A CB  1 
ATOM   3880 C CG  . PRO A 1 493 ? 27.333  69.717 46.994 1.00 32.66  ? 493  PRO A CG  1 
ATOM   3881 C CD  . PRO A 1 493 ? 26.698  71.090 46.940 1.00 32.66  ? 493  PRO A CD  1 
ATOM   3882 N N   . LEU A 1 494 ? 25.274  67.965 43.796 1.00 41.40  ? 494  LEU A N   1 
ATOM   3883 C CA  . LEU A 1 494 ? 24.380  66.835 43.590 1.00 41.40  ? 494  LEU A CA  1 
ATOM   3884 C C   . LEU A 1 494 ? 24.849  65.671 44.497 1.00 41.40  ? 494  LEU A C   1 
ATOM   3885 O O   . LEU A 1 494 ? 26.050  65.480 44.705 1.00 41.40  ? 494  LEU A O   1 
ATOM   3886 C CB  . LEU A 1 494 ? 24.468  66.444 42.121 1.00 34.97  ? 494  LEU A CB  1 
ATOM   3887 C CG  . LEU A 1 494 ? 23.553  65.477 41.386 1.00 34.97  ? 494  LEU A CG  1 
ATOM   3888 C CD1 . LEU A 1 494 ? 22.142  66.044 41.210 1.00 34.97  ? 494  LEU A CD1 1 
ATOM   3889 C CD2 . LEU A 1 494 ? 24.178  65.239 40.021 1.00 34.97  ? 494  LEU A CD2 1 
ATOM   3890 N N   . PHE A 1 495 ? 23.905  64.915 45.055 1.00 38.46  ? 495  PHE A N   1 
ATOM   3891 C CA  . PHE A 1 495 ? 24.250  63.784 45.910 1.00 38.46  ? 495  PHE A CA  1 
ATOM   3892 C C   . PHE A 1 495 ? 24.433  62.555 45.019 1.00 38.46  ? 495  PHE A C   1 
ATOM   3893 O O   . PHE A 1 495 ? 23.546  62.196 44.250 1.00 38.46  ? 495  PHE A O   1 
ATOM   3894 C CB  . PHE A 1 495 ? 23.143  63.563 46.953 1.00 29.52  ? 495  PHE A CB  1 
ATOM   3895 C CG  . PHE A 1 495 ? 23.312  62.318 47.803 1.00 29.52  ? 495  PHE A CG  1 
ATOM   3896 C CD1 . PHE A 1 495 ? 22.964  61.061 47.309 1.00 29.52  ? 495  PHE A CD1 1 
ATOM   3897 C CD2 . PHE A 1 495 ? 23.773  62.410 49.111 1.00 29.52  ? 495  PHE A CD2 1 
ATOM   3898 C CE1 . PHE A 1 495 ? 23.068  59.922 48.102 1.00 29.52  ? 495  PHE A CE1 1 
ATOM   3899 C CE2 . PHE A 1 495 ? 23.880  61.270 49.914 1.00 29.52  ? 495  PHE A CE2 1 
ATOM   3900 C CZ  . PHE A 1 495 ? 23.524  60.026 49.403 1.00 29.52  ? 495  PHE A CZ  1 
ATOM   3901 N N   . THR A 1 496 ? 25.594  61.921 45.119 1.00 39.79  ? 496  THR A N   1 
ATOM   3902 C CA  . THR A 1 496 ? 25.900  60.747 44.309 1.00 39.79  ? 496  THR A CA  1 
ATOM   3903 C C   . THR A 1 496 ? 26.262  59.558 45.180 1.00 39.79  ? 496  THR A C   1 
ATOM   3904 O O   . THR A 1 496 ? 26.764  59.725 46.285 1.00 39.79  ? 496  THR A O   1 
ATOM   3905 C CB  . THR A 1 496 ? 27.084  61.021 43.374 1.00 37.52  ? 496  THR A CB  1 
ATOM   3906 O OG1 . THR A 1 496 ? 28.262  61.279 44.158 1.00 37.52  ? 496  THR A OG1 1 
ATOM   3907 C CG2 . THR A 1 496 ? 26.785  62.215 42.493 1.00 37.52  ? 496  THR A CG2 1 
ATOM   3908 N N   . THR A 1 497 ? 26.018  58.357 44.668 1.00 48.95  ? 497  THR A N   1 
ATOM   3909 C CA  . THR A 1 497 ? 26.305  57.135 45.403 1.00 48.95  ? 497  THR A CA  1 
ATOM   3910 C C   . THR A 1 497 ? 27.727  57.139 45.916 1.00 48.95  ? 497  THR A C   1 
ATOM   3911 O O   . THR A 1 497 ? 27.999  56.681 47.031 1.00 48.95  ? 497  THR A O   1 
ATOM   3912 C CB  . THR A 1 497 ? 26.129  55.881 44.520 1.00 54.08  ? 497  THR A CB  1 
ATOM   3913 O OG1 . THR A 1 497 ? 24.766  55.781 44.088 1.00 54.08  ? 497  THR A OG1 1 
ATOM   3914 C CG2 . THR A 1 497 ? 26.490  54.627 45.306 1.00 54.08  ? 497  THR A CG2 1 
ATOM   3915 N N   . LYS A 1 498 ? 28.632  57.682 45.108 1.00 44.36  ? 498  LYS A N   1 
ATOM   3916 C CA  . LYS A 1 498 ? 30.035  57.717 45.472 1.00 44.36  ? 498  LYS A CA  1 
ATOM   3917 C C   . LYS A 1 498 ? 30.421  58.740 46.544 1.00 44.36  ? 498  LYS A C   1 
ATOM   3918 O O   . LYS A 1 498 ? 30.866  58.357 47.624 1.00 44.36  ? 498  LYS A O   1 
ATOM   3919 C CB  . LYS A 1 498 ? 30.877  57.931 44.214 1.00 66.54  ? 498  LYS A CB  1 
ATOM   3920 C CG  . LYS A 1 498 ? 32.385  57.758 44.436 1.00 66.54  ? 498  LYS A CG  1 
ATOM   3921 C CD  . LYS A 1 498 ? 33.159  57.901 43.127 1.00 66.54  ? 498  LYS A CD  1 
ATOM   3922 C CE  . LYS A 1 498 ? 34.666  57.946 43.360 1.00 66.54  ? 498  LYS A CE  1 
ATOM   3923 N NZ  . LYS A 1 498 ? 35.388  58.085 42.051 1.00 66.54  ? 498  LYS A NZ  1 
ATOM   3924 N N   . GLU A 1 499 ? 30.256  60.033 46.256 1.00 41.28  ? 499  GLU A N   1 
ATOM   3925 C CA  . GLU A 1 499 ? 30.637  61.082 47.210 1.00 41.28  ? 499  GLU A CA  1 
ATOM   3926 C C   . GLU A 1 499 ? 29.661  61.305 48.367 1.00 41.28  ? 499  GLU A C   1 
ATOM   3927 O O   . GLU A 1 499 ? 30.079  61.578 49.486 1.00 41.28  ? 499  GLU A O   1 
ATOM   3928 C CB  . GLU A 1 499 ? 30.834  62.413 46.484 1.00 87.29  ? 499  GLU A CB  1 
ATOM   3929 C CG  . GLU A 1 499 ? 31.514  62.324 45.128 1.00 87.29  ? 499  GLU A CG  1 
ATOM   3930 C CD  . GLU A 1 499 ? 32.838  61.598 45.190 1.00 87.29  ? 499  GLU A CD  1 
ATOM   3931 O OE1 . GLU A 1 499 ? 33.662  61.934 46.078 1.00 87.29  ? 499  GLU A OE1 1 
ATOM   3932 O OE2 . GLU A 1 499 ? 33.060  60.695 44.346 1.00 87.29  ? 499  GLU A OE2 1 
ATOM   3933 N N   . GLN A 1 500 ? 28.365  61.220 48.086 1.00 38.62  ? 500  GLN A N   1 
ATOM   3934 C CA  . GLN A 1 500 ? 27.328  61.409 49.107 1.00 38.62  ? 500  GLN A CA  1 
ATOM   3935 C C   . GLN A 1 500 ? 27.378  62.798 49.744 1.00 38.62  ? 500  GLN A C   1 
ATOM   3936 O O   . GLN A 1 500 ? 27.228  62.957 50.948 1.00 38.62  ? 500  GLN A O   1 
ATOM   3937 C CB  . GLN A 1 500 ? 27.466  60.324 50.179 1.00 49.61  ? 500  GLN A CB  1 
ATOM   3938 C CG  . GLN A 1 500 ? 27.529  58.929 49.577 1.00 49.61  ? 500  GLN A CG  1 
ATOM   3939 C CD  . GLN A 1 500 ? 27.594  57.818 50.611 1.00 49.61  ? 500  GLN A CD  1 
ATOM   3940 O OE1 . GLN A 1 500 ? 28.087  56.726 50.325 1.00 49.61  ? 500  GLN A OE1 1 
ATOM   3941 N NE2 . GLN A 1 500 ? 27.083  58.083 51.809 1.00 49.61  ? 500  GLN A NE2 1 
ATOM   3942 N N   . LYS A 1 501 ? 27.581  63.810 48.917 1.00 36.91  ? 501  LYS A N   1 
ATOM   3943 C CA  . LYS A 1 501 ? 27.665  65.172 49.404 1.00 36.91  ? 501  LYS A CA  1 
ATOM   3944 C C   . LYS A 1 501 ? 26.325  65.757 49.814 1.00 36.91  ? 501  LYS A C   1 
ATOM   3945 O O   . LYS A 1 501 ? 25.278  65.401 49.276 1.00 36.91  ? 501  LYS A O   1 
ATOM   3946 C CB  . LYS A 1 501 ? 28.289  66.066 48.331 1.00 50.50  ? 501  LYS A CB  1 
ATOM   3947 C CG  . LYS A 1 501 ? 29.750  65.739 48.006 1.00 50.50  ? 501  LYS A CG  1 
ATOM   3948 C CD  . LYS A 1 501 ? 30.270  66.592 46.848 1.00 50.50  ? 501  LYS A CD  1 
ATOM   3949 C CE  . LYS A 1 501 ? 31.753  66.337 46.616 1.00 50.50  ? 501  LYS A CE  1 
ATOM   3950 N NZ  . LYS A 1 501 ? 32.271  67.010 45.387 1.00 50.50  ? 501  LYS A NZ  1 
ATOM   3951 N N   . PHE A 1 502 ? 26.362  66.653 50.787 1.00 35.74  ? 502  PHE A N   1 
ATOM   3952 C CA  . PHE A 1 502 ? 25.159  67.330 51.215 1.00 35.74  ? 502  PHE A CA  1 
ATOM   3953 C C   . PHE A 1 502 ? 25.573  68.671 51.802 1.00 35.74  ? 502  PHE A C   1 
ATOM   3954 O O   . PHE A 1 502 ? 26.752  68.898 52.076 1.00 35.74  ? 502  PHE A O   1 
ATOM   3955 C CB  . PHE A 1 502 ? 24.385  66.499 52.237 1.00 27.36  ? 502  PHE A CB  1 
ATOM   3956 C CG  . PHE A 1 502 ? 24.963  66.526 53.620 1.00 27.36  ? 502  PHE A CG  1 
ATOM   3957 C CD1 . PHE A 1 502 ? 25.921  65.599 54.005 1.00 27.36  ? 502  PHE A CD1 1 
ATOM   3958 C CD2 . PHE A 1 502 ? 24.519  67.465 54.551 1.00 27.36  ? 502  PHE A CD2 1 
ATOM   3959 C CE1 . PHE A 1 502 ? 26.426  65.601 55.299 1.00 27.36  ? 502  PHE A CE1 1 
ATOM   3960 C CE2 . PHE A 1 502 ? 25.014  67.477 55.845 1.00 27.36  ? 502  PHE A CE2 1 
ATOM   3961 C CZ  . PHE A 1 502 ? 25.971  66.542 56.223 1.00 27.36  ? 502  PHE A CZ  1 
ATOM   3962 N N   . ILE A 1 503 ? 24.610  69.561 51.998 1.00 35.57  ? 503  ILE A N   1 
ATOM   3963 C CA  . ILE A 1 503 ? 24.919  70.871 52.535 1.00 35.57  ? 503  ILE A CA  1 
ATOM   3964 C C   . ILE A 1 503 ? 24.150  71.154 53.815 1.00 35.57  ? 503  ILE A C   1 
ATOM   3965 O O   . ILE A 1 503 ? 23.136  70.523 54.089 1.00 35.57  ? 503  ILE A O   1 
ATOM   3966 C CB  . ILE A 1 503 ? 24.538  71.975 51.541 1.00 41.26  ? 503  ILE A CB  1 
ATOM   3967 C CG1 . ILE A 1 503 ? 23.027  71.936 51.304 1.00 41.26  ? 503  ILE A CG1 1 
ATOM   3968 C CG2 . ILE A 1 503 ? 25.272  71.783 50.215 1.00 41.26  ? 503  ILE A CG2 1 
ATOM   3969 C CD1 . ILE A 1 503 ? 22.499  73.137 50.582 1.00 41.26  ? 503  ILE A CD1 1 
ATOM   3970 N N   . ASP A 1 504 ? 24.652  72.102 54.599 1.00 45.54  ? 504  ASP A N   1 
ATOM   3971 C CA  . ASP A 1 504 ? 23.967  72.527 55.811 1.00 45.54  ? 504  ASP A CA  1 
ATOM   3972 C C   . ASP A 1 504 ? 23.076  73.675 55.343 1.00 45.54  ? 504  ASP A C   1 
ATOM   3973 O O   . ASP A 1 504 ? 23.380  74.350 54.356 1.00 45.54  ? 504  ASP A O   1 
ATOM   3974 C CB  . ASP A 1 504 ? 24.935  73.075 56.864 1.00 80.01  ? 504  ASP A CB  1 
ATOM   3975 C CG  . ASP A 1 504 ? 25.810  72.001 57.481 1.00 80.01  ? 504  ASP A CG  1 
ATOM   3976 O OD1 . ASP A 1 504 ? 25.295  70.894 57.752 1.00 80.01  ? 504  ASP A OD1 1 
ATOM   3977 O OD2 . ASP A 1 504 ? 27.015  72.273 57.716 1.00 80.01  ? 504  ASP A OD2 1 
ATOM   3978 N N   . LEU A 1 505 ? 21.976  73.895 56.045 1.00 42.40  ? 505  LEU A N   1 
ATOM   3979 C CA  . LEU A 1 505 ? 21.080  74.972 55.685 1.00 42.40  ? 505  LEU A CA  1 
ATOM   3980 C C   . LEU A 1 505 ? 20.896  75.827 56.939 1.00 42.40  ? 505  LEU A C   1 
ATOM   3981 O O   . LEU A 1 505 ? 20.202  75.435 57.873 1.00 42.40  ? 505  LEU A O   1 
ATOM   3982 C CB  . LEU A 1 505 ? 19.755  74.389 55.202 1.00 35.13  ? 505  LEU A CB  1 
ATOM   3983 C CG  . LEU A 1 505 ? 19.092  74.967 53.952 1.00 35.13  ? 505  LEU A CG  1 
ATOM   3984 C CD1 . LEU A 1 505 ? 20.084  75.127 52.807 1.00 35.13  ? 505  LEU A CD1 1 
ATOM   3985 C CD2 . LEU A 1 505 ? 17.968  74.035 53.551 1.00 35.13  ? 505  LEU A CD2 1 
ATOM   3986 N N   . ASN A 1 506 ? 21.563  76.978 56.963 1.00 48.60  ? 506  ASN A N   1 
ATOM   3987 C CA  . ASN A 1 506 ? 21.488  77.912 58.086 1.00 48.60  ? 506  ASN A CA  1 
ATOM   3988 C C   . ASN A 1 506 ? 21.897  79.295 57.595 1.00 48.60  ? 506  ASN A C   1 
ATOM   3989 O O   . ASN A 1 506 ? 21.951  79.528 56.393 1.00 48.60  ? 506  ASN A O   1 
ATOM   3990 C CB  . ASN A 1 506 ? 22.420  77.477 59.208 1.00 43.17  ? 506  ASN A CB  1 
ATOM   3991 C CG  . ASN A 1 506 ? 23.832  77.316 58.735 1.00 43.17  ? 506  ASN A CG  1 
ATOM   3992 O OD1 . ASN A 1 506 ? 24.369  78.196 58.067 1.00 43.17  ? 506  ASN A OD1 1 
ATOM   3993 N ND2 . ASN A 1 506 ? 24.448  76.191 59.069 1.00 43.17  ? 506  ASN A ND2 1 
ATOM   3994 N N   . THR A 1 507 ? 22.205  80.204 58.515 1.00 49.94  ? 507  THR A N   1 
ATOM   3995 C CA  . THR A 1 507 ? 22.584  81.561 58.127 1.00 49.94  ? 507  THR A CA  1 
ATOM   3996 C C   . THR A 1 507 ? 24.088  81.785 57.932 1.00 49.94  ? 507  THR A C   1 
ATOM   3997 O O   . THR A 1 507 ? 24.540  82.920 57.788 1.00 49.94  ? 507  THR A O   1 
ATOM   3998 C CB  . THR A 1 507 ? 22.037  82.590 59.138 1.00 40.98  ? 507  THR A CB  1 
ATOM   3999 O OG1 . THR A 1 507 ? 22.507  82.273 60.452 1.00 40.98  ? 507  THR A OG1 1 
ATOM   4000 C CG2 . THR A 1 507 ? 20.520  82.561 59.144 1.00 40.98  ? 507  THR A CG2 1 
ATOM   4001 N N   . GLU A 1 508 ? 24.859  80.704 57.899 1.00 55.10  ? 508  GLU A N   1 
ATOM   4002 C CA  . GLU A 1 508 ? 26.309  80.801 57.705 1.00 55.10  ? 508  GLU A CA  1 
ATOM   4003 C C   . GLU A 1 508 ? 26.698  80.449 56.269 1.00 55.10  ? 508  GLU A C   1 
ATOM   4004 O O   . GLU A 1 508 ? 25.923  79.817 55.542 1.00 55.10  ? 508  GLU A O   1 
ATOM   4005 C CB  . GLU A 1 508 ? 27.032  79.853 58.664 1.00 90.65  ? 508  GLU A CB  1 
ATOM   4006 C CG  . GLU A 1 508 ? 26.869  80.208 60.128 1.00 90.65  ? 508  GLU A CG  1 
ATOM   4007 C CD  . GLU A 1 508 ? 27.465  79.146 61.042 1.00 90.65  ? 508  GLU A CD  1 
ATOM   4008 O OE1 . GLU A 1 508 ? 28.683  78.861 60.923 1.00 90.65  ? 508  GLU A OE1 1 
ATOM   4009 O OE2 . GLU A 1 508 ? 26.713  78.592 61.881 1.00 90.65  ? 508  GLU A OE2 1 
ATOM   4010 N N   . PRO A 1 509 ? 27.911  80.848 55.838 1.00 59.57  ? 509  PRO A N   1 
ATOM   4011 C CA  . PRO A 1 509 ? 28.355  80.546 54.472 1.00 59.57  ? 509  PRO A CA  1 
ATOM   4012 C C   . PRO A 1 509 ? 28.251  79.049 54.199 1.00 59.57  ? 509  PRO A C   1 
ATOM   4013 O O   . PRO A 1 509 ? 28.849  78.231 54.902 1.00 59.57  ? 509  PRO A O   1 
ATOM   4014 C CB  . PRO A 1 509 ? 29.798  81.041 54.461 1.00 50.49  ? 509  PRO A CB  1 
ATOM   4015 C CG  . PRO A 1 509 ? 29.742  82.211 55.406 1.00 50.49  ? 509  PRO A CG  1 
ATOM   4016 C CD  . PRO A 1 509 ? 28.922  81.650 56.552 1.00 50.49  ? 509  PRO A CD  1 
ATOM   4017 N N   . MET A 1 510 ? 27.486  78.698 53.175 1.00 56.88  ? 510  MET A N   1 
ATOM   4018 C CA  . MET A 1 510 ? 27.286  77.305 52.824 1.00 56.88  ? 510  MET A CA  1 
ATOM   4019 C C   . MET A 1 510 ? 28.541  76.458 52.929 1.00 56.88  ? 510  MET A C   1 
ATOM   4020 O O   . MET A 1 510 ? 29.633  76.900 52.580 1.00 56.88  ? 510  MET A O   1 
ATOM   4021 C CB  . MET A 1 510 ? 26.739  77.189 51.404 1.00 72.76  ? 510  MET A CB  1 
ATOM   4022 C CG  . MET A 1 510 ? 26.366  75.760 51.019 1.00 72.76  ? 510  MET A CG  1 
ATOM   4023 S SD  . MET A 1 510 ? 26.081  75.603 49.244 1.00 72.76  ? 510  MET A SD  1 
ATOM   4024 C CE  . MET A 1 510 ? 24.247  75.930 49.173 1.00 72.76  ? 510  MET A CE  1 
ATOM   4025 N N   . LYS A 1 511 ? 28.364  75.238 53.425 1.00 47.32  ? 511  LYS A N   1 
ATOM   4026 C CA  . LYS A 1 511 ? 29.447  74.277 53.560 1.00 47.32  ? 511  LYS A CA  1 
ATOM   4027 C C   . LYS A 1 511 ? 28.917  72.937 53.062 1.00 47.32  ? 511  LYS A C   1 
ATOM   4028 O O   . LYS A 1 511 ? 27.769  72.572 53.323 1.00 47.32  ? 511  LYS A O   1 
ATOM   4029 C CB  . LYS A 1 511 ? 29.873  74.128 55.017 1.00 72.24  ? 511  LYS A CB  1 
ATOM   4030 C CG  . LYS A 1 511 ? 30.324  75.412 55.692 1.00 72.24  ? 511  LYS A CG  1 
ATOM   4031 C CD  . LYS A 1 511 ? 30.893  75.097 57.083 1.00 72.24  ? 511  LYS A CD  1 
ATOM   4032 C CE  . LYS A 1 511 ? 31.231  76.355 57.891 1.00 72.24  ? 511  LYS A CE  1 
ATOM   4033 N NZ  . LYS A 1 511 ? 31.681  75.999 59.291 1.00 72.24  ? 511  LYS A NZ  1 
ATOM   4034 N N   . VAL A 1 512 ? 29.753  72.213 52.337 1.00 41.34  ? 512  VAL A N   1 
ATOM   4035 C CA  . VAL A 1 512 ? 29.382  70.915 51.818 1.00 41.34  ? 512  VAL A CA  1 
ATOM   4036 C C   . VAL A 1 512 ? 30.005  69.867 52.722 1.00 41.34  ? 512  VAL A C   1 
ATOM   4037 O O   . VAL A 1 512 ? 31.128  70.035 53.192 1.00 41.34  ? 512  VAL A O   1 
ATOM   4038 C CB  . VAL A 1 512 ? 29.914  70.715 50.380 1.00 43.49  ? 512  VAL A CB  1 
ATOM   4039 C CG1 . VAL A 1 512 ? 29.768  69.254 49.970 1.00 43.49  ? 512  VAL A CG1 1 
ATOM   4040 C CG2 . VAL A 1 512 ? 29.157  71.620 49.410 1.00 43.49  ? 512  VAL A CG2 1 
ATOM   4041 N N   . HIS A 1 513 ? 29.269  68.792 52.975 1.00 44.63  ? 513  HIS A N   1 
ATOM   4042 C CA  . HIS A 1 513 ? 29.758  67.708 53.823 1.00 44.63  ? 513  HIS A CA  1 
ATOM   4043 C C   . HIS A 1 513 ? 29.515  66.381 53.128 1.00 44.63  ? 513  HIS A C   1 
ATOM   4044 O O   . HIS A 1 513 ? 29.016  66.342 52.003 1.00 44.63  ? 513  HIS A O   1 
ATOM   4045 C CB  . HIS A 1 513 ? 29.012  67.685 55.146 1.00 55.68  ? 513  HIS A CB  1 
ATOM   4046 C CG  . HIS A 1 513 ? 29.162  68.931 55.949 1.00 55.68  ? 513  HIS A CG  1 
ATOM   4047 N ND1 . HIS A 1 513 ? 30.360  69.304 56.519 1.00 55.68  ? 513  HIS A ND1 1 
ATOM   4048 C CD2 . HIS A 1 513 ? 28.256  69.869 56.317 1.00 55.68  ? 513  HIS A CD2 1 
ATOM   4049 C CE1 . HIS A 1 513 ? 30.185  70.418 57.209 1.00 55.68  ? 513  HIS A CE1 1 
ATOM   4050 N NE2 . HIS A 1 513 ? 28.917  70.781 57.104 1.00 55.68  ? 513  HIS A NE2 1 
ATOM   4051 N N   . GLN A 1 514 ? 29.836  65.293 53.820 1.00 42.92  ? 514  GLN A N   1 
ATOM   4052 C CA  . GLN A 1 514 ? 29.643  63.966 53.266 1.00 42.92  ? 514  GLN A CA  1 
ATOM   4053 C C   . GLN A 1 514 ? 29.216  62.952 54.304 1.00 42.92  ? 514  GLN A C   1 
ATOM   4054 O O   . GLN A 1 514 ? 29.554  63.066 55.473 1.00 42.92  ? 514  GLN A O   1 
ATOM   4055 C CB  . GLN A 1 514 ? 30.925  63.482 52.609 1.00 53.23  ? 514  GLN A CB  1 
ATOM   4056 C CG  . GLN A 1 514 ? 31.220  64.135 51.290 1.00 53.23  ? 514  GLN A CG  1 
ATOM   4057 C CD  . GLN A 1 514 ? 32.568  63.710 50.752 1.00 53.23  ? 514  GLN A CD  1 
ATOM   4058 O OE1 . GLN A 1 514 ? 33.607  64.159 51.236 1.00 53.23  ? 514  GLN A OE1 1 
ATOM   4059 N NE2 . GLN A 1 514 ? 32.560  62.823 49.760 1.00 53.23  ? 514  GLN A NE2 1 
ATOM   4060 N N   . ARG A 1 515 ? 28.461  61.960 53.847 1.00 39.05  ? 515  ARG A N   1 
ATOM   4061 C CA  . ARG A 1 515 ? 27.979  60.874 54.683 1.00 39.05  ? 515  ARG A CA  1 
ATOM   4062 C C   . ARG A 1 515 ? 27.260  61.299 55.957 1.00 39.05  ? 515  ARG A C   1 
ATOM   4063 O O   . ARG A 1 515 ? 27.726  61.030 57.059 1.00 39.05  ? 515  ARG A O   1 
ATOM   4064 C CB  . ARG A 1 515 ? 29.152  59.957 55.012 1.00 58.58  ? 515  ARG A CB  1 
ATOM   4065 C CG  . ARG A 1 515 ? 29.868  59.469 53.765 1.00 58.58  ? 515  ARG A CG  1 
ATOM   4066 C CD  . ARG A 1 515 ? 30.887  58.396 54.079 1.00 58.58  ? 515  ARG A CD  1 
ATOM   4067 N NE  . ARG A 1 515 ? 31.389  57.742 52.876 1.00 58.58  ? 515  ARG A NE  1 
ATOM   4068 C CZ  . ARG A 1 515 ? 31.918  56.520 52.867 1.00 58.58  ? 515  ARG A CZ  1 
ATOM   4069 N NH1 . ARG A 1 515 ? 32.007  55.824 53.998 1.00 58.58  ? 515  ARG A NH1 1 
ATOM   4070 N NH2 . ARG A 1 515 ? 32.365  55.986 51.730 1.00 58.58  ? 515  ARG A NH2 1 
ATOM   4071 N N   . LEU A 1 516 ? 26.113  61.944 55.782 1.00 34.46  ? 516  LEU A N   1 
ATOM   4072 C CA  . LEU A 1 516 ? 25.287  62.421 56.885 1.00 34.46  ? 516  LEU A CA  1 
ATOM   4073 C C   . LEU A 1 516 ? 25.007  61.321 57.906 1.00 34.46  ? 516  LEU A C   1 
ATOM   4074 O O   . LEU A 1 516 ? 24.278  60.366 57.633 1.00 34.46  ? 516  LEU A O   1 
ATOM   4075 C CB  . LEU A 1 516 ? 23.973  62.984 56.330 1.00 38.21  ? 516  LEU A CB  1 
ATOM   4076 C CG  . LEU A 1 516 ? 22.855  63.492 57.248 1.00 38.21  ? 516  LEU A CG  1 
ATOM   4077 C CD1 . LEU A 1 516 ? 23.410  64.245 58.448 1.00 38.21  ? 516  LEU A CD1 1 
ATOM   4078 C CD2 . LEU A 1 516 ? 21.957  64.406 56.429 1.00 38.21  ? 516  LEU A CD2 1 
ATOM   4079 N N   . ARG A 1 517 ? 25.607  61.477 59.080 1.00 35.07  ? 517  ARG A N   1 
ATOM   4080 C CA  . ARG A 1 517 ? 25.481  60.544 60.194 1.00 35.07  ? 517  ARG A CA  1 
ATOM   4081 C C   . ARG A 1 517 ? 25.632  59.071 59.834 1.00 35.07  ? 517  ARG A C   1 
ATOM   4082 O O   . ARG A 1 517 ? 24.828  58.241 60.265 1.00 35.07  ? 517  ARG A O   1 
ATOM   4083 C CB  . ARG A 1 517 ? 24.157  60.796 60.951 1.00 47.05  ? 517  ARG A CB  1 
ATOM   4084 C CG  . ARG A 1 517 ? 24.140  62.164 61.643 1.00 47.05  ? 517  ARG A CG  1 
ATOM   4085 C CD  . ARG A 1 517 ? 22.915  62.419 62.505 1.00 47.05  ? 517  ARG A CD  1 
ATOM   4086 N NE  . ARG A 1 517 ? 22.943  61.686 63.767 1.00 47.05  ? 517  ARG A NE  1 
ATOM   4087 C CZ  . ARG A 1 517 ? 23.802  61.927 64.755 1.00 47.05  ? 517  ARG A CZ  1 
ATOM   4088 N NH1 . ARG A 1 517 ? 24.702  62.893 64.617 1.00 47.05  ? 517  ARG A NH1 1 
ATOM   4089 N NH2 . ARG A 1 517 ? 23.765  61.205 65.877 1.00 47.05  ? 517  ARG A NH2 1 
ATOM   4090 N N   . VAL A 1 518 ? 26.678  58.751 59.067 1.00 35.02  ? 518  VAL A N   1 
ATOM   4091 C CA  . VAL A 1 518 ? 26.955  57.370 58.649 1.00 35.02  ? 518  VAL A CA  1 
ATOM   4092 C C   . VAL A 1 518 ? 27.161  56.372 59.777 1.00 35.02  ? 518  VAL A C   1 
ATOM   4093 O O   . VAL A 1 518 ? 26.630  55.272 59.726 1.00 35.02  ? 518  VAL A O   1 
ATOM   4094 C CB  . VAL A 1 518 ? 28.218  57.246 57.769 1.00 31.42  ? 518  VAL A CB  1 
ATOM   4095 C CG1 . VAL A 1 518 ? 27.827  57.124 56.321 1.00 31.42  ? 518  VAL A CG1 1 
ATOM   4096 C CG2 . VAL A 1 518 ? 29.140  58.417 58.006 1.00 31.42  ? 518  VAL A CG2 1 
ATOM   4097 N N   . GLN A 1 519 ? 27.960  56.742 60.771 1.00 38.64  ? 519  GLN A N   1 
ATOM   4098 C CA  . GLN A 1 519 ? 28.236  55.849 61.893 1.00 38.64  ? 519  GLN A CA  1 
ATOM   4099 C C   . GLN A 1 519 ? 26.952  55.239 62.452 1.00 38.64  ? 519  GLN A C   1 
ATOM   4100 O O   . GLN A 1 519 ? 26.829  54.020 62.557 1.00 38.64  ? 519  GLN A O   1 
ATOM   4101 C CB  . GLN A 1 519 ? 28.961  56.601 63.001 1.00 42.56  ? 519  GLN A CB  1 
ATOM   4102 C CG  . GLN A 1 519 ? 29.939  55.748 63.748 1.00 42.56  ? 519  GLN A CG  1 
ATOM   4103 C CD  . GLN A 1 519 ? 31.020  55.204 62.825 1.00 42.56  ? 519  GLN A CD  1 
ATOM   4104 O OE1 . GLN A 1 519 ? 31.668  55.966 62.081 1.00 42.56  ? 519  GLN A OE1 1 
ATOM   4105 N NE2 . GLN A 1 519 ? 31.223  53.883 62.861 1.00 42.56  ? 519  GLN A NE2 1 
ATOM   4106 N N   . MET A 1 520 ? 25.998  56.103 62.789 1.00 41.90  ? 520  MET A N   1 
ATOM   4107 C CA  . MET A 1 520 ? 24.715  55.686 63.343 1.00 41.90  ? 520  MET A CA  1 
ATOM   4108 C C   . MET A 1 520 ? 23.810  55.047 62.300 1.00 41.90  ? 520  MET A C   1 
ATOM   4109 O O   . MET A 1 520 ? 23.148  54.053 62.573 1.00 41.90  ? 520  MET A O   1 
ATOM   4110 C CB  . MET A 1 520 ? 23.997  56.887 63.966 1.00 51.83  ? 520  MET A CB  1 
ATOM   4111 C CG  . MET A 1 520 ? 24.779  57.568 65.078 1.00 51.83  ? 520  MET A CG  1 
ATOM   4112 S SD  . MET A 1 520 ? 25.035  56.504 66.524 1.00 51.83  ? 520  MET A SD  1 
ATOM   4113 C CE  . MET A 1 520 ? 26.777  55.904 66.238 1.00 51.83  ? 520  MET A CE  1 
ATOM   4114 N N   . CYS A 1 521 ? 23.768  55.614 61.105 1.00 37.78  ? 521  CYS A N   1 
ATOM   4115 C CA  . CYS A 1 521 ? 22.927  55.048 60.069 1.00 37.78  ? 521  CYS A CA  1 
ATOM   4116 C C   . CYS A 1 521 ? 23.327  53.594 59.794 1.00 37.78  ? 521  CYS A C   1 
ATOM   4117 O O   . CYS A 1 521 ? 22.474  52.766 59.513 1.00 37.78  ? 521  CYS A O   1 
ATOM   4118 C CB  . CYS A 1 521 ? 23.002  55.906 58.787 1.00 40.86  ? 521  CYS A CB  1 
ATOM   4119 N N   . VAL A 1 522 ? 24.611  53.265 59.884 1.00 36.00  ? 522  VAL A N   1 
ATOM   4120 C CA  . VAL A 1 522 ? 25.022  51.878 59.660 1.00 36.00  ? 522  VAL A CA  1 
ATOM   4121 C C   . VAL A 1 522 ? 24.531  51.003 60.816 1.00 36.00  ? 522  VAL A C   1 
ATOM   4122 O O   . VAL A 1 522 ? 24.174  49.839 60.616 1.00 36.00  ? 522  VAL A O   1 
ATOM   4123 C CB  . VAL A 1 522 ? 26.564  51.736 59.519 1.00 32.39  ? 522  VAL A CB  1 
ATOM   4124 C CG1 . VAL A 1 522 ? 26.985  50.267 59.689 1.00 32.39  ? 522  VAL A CG1 1 
ATOM   4125 C CG2 . VAL A 1 522 ? 27.001  52.238 58.151 1.00 32.39  ? 522  VAL A CG2 1 
ATOM   4126 N N   . PHE A 1 523 ? 24.513  51.567 62.022 1.00 32.23  ? 523  PHE A N   1 
ATOM   4127 C CA  . PHE A 1 523 ? 24.023  50.850 63.191 1.00 32.23  ? 523  PHE A CA  1 
ATOM   4128 C C   . PHE A 1 523 ? 22.527  50.574 63.074 1.00 32.23  ? 523  PHE A C   1 
ATOM   4129 O O   . PHE A 1 523 ? 22.075  49.463 63.311 1.00 32.23  ? 523  PHE A O   1 
ATOM   4130 C CB  . PHE A 1 523 ? 24.255  51.664 64.468 1.00 30.80  ? 523  PHE A CB  1 
ATOM   4131 C CG  . PHE A 1 523 ? 23.525  51.123 65.672 1.00 30.80  ? 523  PHE A CG  1 
ATOM   4132 C CD1 . PHE A 1 523 ? 24.004  50.013 66.351 1.00 30.80  ? 523  PHE A CD1 1 
ATOM   4133 C CD2 . PHE A 1 523 ? 22.346  51.714 66.107 1.00 30.80  ? 523  PHE A CD2 1 
ATOM   4134 C CE1 . PHE A 1 523 ? 23.324  49.495 67.450 1.00 30.80  ? 523  PHE A CE1 1 
ATOM   4135 C CE2 . PHE A 1 523 ? 21.651  51.209 67.200 1.00 30.80  ? 523  PHE A CE2 1 
ATOM   4136 C CZ  . PHE A 1 523 ? 22.146  50.091 67.877 1.00 30.80  ? 523  PHE A CZ  1 
ATOM   4137 N N   . TRP A 1 524 ? 21.758  51.594 62.717 1.00 33.40  ? 524  TRP A N   1 
ATOM   4138 C CA  . TRP A 1 524 ? 20.314  51.443 62.600 1.00 33.40  ? 524  TRP A CA  1 
ATOM   4139 C C   . TRP A 1 524 ? 19.818  50.760 61.330 1.00 33.40  ? 524  TRP A C   1 
ATOM   4140 O O   . TRP A 1 524 ? 18.748  50.177 61.332 1.00 33.40  ? 524  TRP A O   1 
ATOM   4141 C CB  . TRP A 1 524 ? 19.623  52.805 62.736 1.00 27.75  ? 524  TRP A CB  1 
ATOM   4142 C CG  . TRP A 1 524 ? 19.724  53.415 64.108 1.00 27.75  ? 524  TRP A CG  1 
ATOM   4143 C CD1 . TRP A 1 524 ? 20.561  54.417 64.501 1.00 27.75  ? 524  TRP A CD1 1 
ATOM   4144 C CD2 . TRP A 1 524 ? 18.970  53.043 65.268 1.00 27.75  ? 524  TRP A CD2 1 
ATOM   4145 N NE1 . TRP A 1 524 ? 20.376  54.694 65.833 1.00 27.75  ? 524  TRP A NE1 1 
ATOM   4146 C CE2 . TRP A 1 524 ? 19.404  53.866 66.330 1.00 27.75  ? 524  TRP A CE2 1 
ATOM   4147 C CE3 . TRP A 1 524 ? 17.970  52.097 65.516 1.00 27.75  ? 524  TRP A CE3 1 
ATOM   4148 C CZ2 . TRP A 1 524 ? 18.868  53.770 67.621 1.00 27.75  ? 524  TRP A CZ2 1 
ATOM   4149 C CZ3 . TRP A 1 524 ? 17.439  52.004 66.801 1.00 27.75  ? 524  TRP A CZ3 1 
ATOM   4150 C CH2 . TRP A 1 524 ? 17.889  52.836 67.833 1.00 27.75  ? 524  TRP A CH2 1 
ATOM   4151 N N   . ASN A 1 525 ? 20.578  50.811 60.248 1.00 36.62  ? 525  ASN A N   1 
ATOM   4152 C CA  . ASN A 1 525 ? 20.103  50.183 59.026 1.00 36.62  ? 525  ASN A CA  1 
ATOM   4153 C C   . ASN A 1 525 ? 20.739  48.836 58.725 1.00 36.62  ? 525  ASN A C   1 
ATOM   4154 O O   . ASN A 1 525 ? 20.146  48.035 58.021 1.00 36.62  ? 525  ASN A O   1 
ATOM   4155 C CB  . ASN A 1 525 ? 20.282  51.116 57.819 1.00 40.01  ? 525  ASN A CB  1 
ATOM   4156 C CG  . ASN A 1 525 ? 19.476  52.405 57.945 1.00 40.01  ? 525  ASN A CG  1 
ATOM   4157 O OD1 . ASN A 1 525 ? 18.316  52.388 58.380 1.00 40.01  ? 525  ASN A OD1 1 
ATOM   4158 N ND2 . ASN A 1 525 ? 20.083  53.529 57.556 1.00 40.01  ? 525  ASN A ND2 1 
ATOM   4159 N N   . GLN A 1 526 ? 21.932  48.574 59.249 1.00 40.39  ? 526  GLN A N   1 
ATOM   4160 C CA  . GLN A 1 526 ? 22.573  47.294 58.981 1.00 40.39  ? 526  GLN A CA  1 
ATOM   4161 C C   . GLN A 1 526 ? 22.705  46.370 60.189 1.00 40.39  ? 526  GLN A C   1 
ATOM   4162 O O   . GLN A 1 526 ? 22.219  45.240 60.156 1.00 40.39  ? 526  GLN A O   1 
ATOM   4163 C CB  . GLN A 1 526 ? 23.957  47.500 58.376 1.00 73.37  ? 526  GLN A CB  1 
ATOM   4164 C CG  . GLN A 1 526 ? 23.983  48.236 57.037 1.00 73.37  ? 526  GLN A CG  1 
ATOM   4165 C CD  . GLN A 1 526 ? 25.384  48.204 56.394 1.00 73.37  ? 526  GLN A CD  1 
ATOM   4166 O OE1 . GLN A 1 526 ? 25.733  49.073 55.574 1.00 73.37  ? 526  GLN A OE1 1 
ATOM   4167 N NE2 . GLN A 1 526 ? 26.191  47.189 56.761 1.00 73.37  ? 526  GLN A NE2 1 
ATOM   4168 N N   . PHE A 1 527 ? 23.356  46.843 61.252 1.00 33.00  ? 527  PHE A N   1 
ATOM   4169 C CA  . PHE A 1 527 ? 23.568  46.020 62.437 1.00 33.00  ? 527  PHE A CA  1 
ATOM   4170 C C   . PHE A 1 527 ? 22.351  45.639 63.279 1.00 33.00  ? 527  PHE A C   1 
ATOM   4171 O O   . PHE A 1 527 ? 22.072  44.453 63.442 1.00 33.00  ? 527  PHE A O   1 
ATOM   4172 C CB  . PHE A 1 527 ? 24.614  46.656 63.361 1.00 31.96  ? 527  PHE A CB  1 
ATOM   4173 C CG  . PHE A 1 527 ? 24.969  45.795 64.550 1.00 31.96  ? 527  PHE A CG  1 
ATOM   4174 C CD1 . PHE A 1 527 ? 25.634  44.590 64.377 1.00 31.96  ? 527  PHE A CD1 1 
ATOM   4175 C CD2 . PHE A 1 527 ? 24.603  46.171 65.835 1.00 31.96  ? 527  PHE A CD2 1 
ATOM   4176 C CE1 . PHE A 1 527 ? 25.926  43.776 65.458 1.00 31.96  ? 527  PHE A CE1 1 
ATOM   4177 C CE2 . PHE A 1 527 ? 24.890  45.361 66.921 1.00 31.96  ? 527  PHE A CE2 1 
ATOM   4178 C CZ  . PHE A 1 527 ? 25.551  44.163 66.734 1.00 31.96  ? 527  PHE A CZ  1 
ATOM   4179 N N   . LEU A 1 528 ? 21.634  46.626 63.818 1.00 44.74  ? 528  LEU A N   1 
ATOM   4180 C CA  . LEU A 1 528 ? 20.482  46.336 64.677 1.00 44.74  ? 528  LEU A CA  1 
ATOM   4181 C C   . LEU A 1 528 ? 19.423  45.430 64.039 1.00 44.74  ? 528  LEU A C   1 
ATOM   4182 O O   . LEU A 1 528 ? 18.986  44.463 64.653 1.00 44.74  ? 528  LEU A O   1 
ATOM   4183 C CB  . LEU A 1 528 ? 19.836  47.637 65.185 1.00 39.05  ? 528  LEU A CB  1 
ATOM   4184 C CG  . LEU A 1 528 ? 18.804  47.454 66.311 1.00 39.05  ? 528  LEU A CG  1 
ATOM   4185 C CD1 . LEU A 1 528 ? 19.438  46.685 67.472 1.00 39.05  ? 528  LEU A CD1 1 
ATOM   4186 C CD2 . LEU A 1 528 ? 18.300  48.809 66.796 1.00 39.05  ? 528  LEU A CD2 1 
ATOM   4187 N N   . PRO A 1 529 ? 18.979  45.737 62.814 1.00 43.54  ? 529  PRO A N   1 
ATOM   4188 C CA  . PRO A 1 529 ? 17.975  44.866 62.199 1.00 43.54  ? 529  PRO A CA  1 
ATOM   4189 C C   . PRO A 1 529 ? 18.453  43.412 62.237 1.00 43.54  ? 529  PRO A C   1 
ATOM   4190 O O   . PRO A 1 529 ? 17.709  42.509 62.617 1.00 43.54  ? 529  PRO A O   1 
ATOM   4191 C CB  . PRO A 1 529 ? 17.884  45.407 60.781 1.00 43.42  ? 529  PRO A CB  1 
ATOM   4192 C CG  . PRO A 1 529 ? 18.103  46.863 60.980 1.00 43.42  ? 529  PRO A CG  1 
ATOM   4193 C CD  . PRO A 1 529 ? 19.251  46.910 61.964 1.00 43.42  ? 529  PRO A CD  1 
ATOM   4194 N N   . LYS A 1 530 ? 19.713  43.209 61.853 1.00 47.55  ? 530  LYS A N   1 
ATOM   4195 C CA  . LYS A 1 530 ? 20.344  41.889 61.836 1.00 47.55  ? 530  LYS A CA  1 
ATOM   4196 C C   . LYS A 1 530 ? 20.380  41.253 63.225 1.00 47.55  ? 530  LYS A C   1 
ATOM   4197 O O   . LYS A 1 530 ? 20.125  40.067 63.380 1.00 47.55  ? 530  LYS A O   1 
ATOM   4198 C CB  . LYS A 1 530 ? 21.769  42.012 61.287 1.00 68.86  ? 530  LYS A CB  1 
ATOM   4199 C CG  . LYS A 1 530 ? 22.616  40.761 61.439 1.00 68.86  ? 530  LYS A CG  1 
ATOM   4200 C CD  . LYS A 1 530 ? 23.796  40.759 60.448 1.00 68.86  ? 530  LYS A CD  1 
ATOM   4201 C CE  . LYS A 1 530 ? 24.601  39.454 60.571 1.00 68.86  ? 530  LYS A CE  1 
ATOM   4202 N NZ  . LYS A 1 530 ? 25.374  39.118 59.327 1.00 68.86  ? 530  LYS A NZ  1 
ATOM   4203 N N   . LEU A 1 531 ? 20.701  42.051 64.232 1.00 42.48  ? 531  LEU A N   1 
ATOM   4204 C CA  . LEU A 1 531 ? 20.759  41.557 65.592 1.00 42.48  ? 531  LEU A CA  1 
ATOM   4205 C C   . LEU A 1 531 ? 19.377  41.069 66.030 1.00 42.48  ? 531  LEU A C   1 
ATOM   4206 O O   . LEU A 1 531 ? 19.227  39.940 66.492 1.00 42.48  ? 531  LEU A O   1 
ATOM   4207 C CB  . LEU A 1 531 ? 21.266  42.669 66.512 1.00 40.83  ? 531  LEU A CB  1 
ATOM   4208 C CG  . LEU A 1 531 ? 21.354  42.399 68.012 1.00 40.83  ? 531  LEU A CG  1 
ATOM   4209 C CD1 . LEU A 1 531 ? 22.188  43.489 68.651 1.00 40.83  ? 531  LEU A CD1 1 
ATOM   4210 C CD2 . LEU A 1 531 ? 19.954  42.369 68.633 1.00 40.83  ? 531  LEU A CD2 1 
ATOM   4211 N N   . LEU A 1 532 ? 18.370  41.920 65.883 1.00 52.36  ? 532  LEU A N   1 
ATOM   4212 C CA  . LEU A 1 532 ? 17.004  41.558 66.260 1.00 52.36  ? 532  LEU A CA  1 
ATOM   4213 C C   . LEU A 1 532 ? 16.496  40.332 65.489 1.00 52.36  ? 532  LEU A C   1 
ATOM   4214 O O   . LEU A 1 532 ? 15.702  39.549 66.010 1.00 52.36  ? 532  LEU A O   1 
ATOM   4215 C CB  . LEU A 1 532 ? 16.047  42.739 66.024 1.00 40.39  ? 532  LEU A CB  1 
ATOM   4216 C CG  . LEU A 1 532 ? 16.333  44.006 66.832 1.00 40.39  ? 532  LEU A CG  1 
ATOM   4217 C CD1 . LEU A 1 532 ? 15.499  45.167 66.309 1.00 40.39  ? 532  LEU A CD1 1 
ATOM   4218 C CD2 . LEU A 1 532 ? 16.048  43.742 68.294 1.00 40.39  ? 532  LEU A CD2 1 
ATOM   4219 N N   . ASN A 1 533 ? 16.946  40.153 64.254 1.00 58.71  ? 533  ASN A N   1 
ATOM   4220 C CA  . ASN A 1 533 ? 16.486  39.004 63.482 1.00 58.71  ? 533  ASN A CA  1 
ATOM   4221 C C   . ASN A 1 533 ? 17.180  37.690 63.840 1.00 58.71  ? 533  ASN A C   1 
ATOM   4222 O O   . ASN A 1 533 ? 16.616  36.608 63.651 1.00 58.71  ? 533  ASN A O   1 
ATOM   4223 C CB  . ASN A 1 533 ? 16.647  39.252 61.986 1.00 59.07  ? 533  ASN A CB  1 
ATOM   4224 C CG  . ASN A 1 533 ? 16.163  38.082 61.158 1.00 59.07  ? 533  ASN A CG  1 
ATOM   4225 O OD1 . ASN A 1 533 ? 16.909  37.137 60.903 1.00 59.07  ? 533  ASN A OD1 1 
ATOM   4226 N ND2 . ASN A 1 533 ? 14.894  38.126 60.753 1.00 59.07  ? 533  ASN A ND2 1 
ATOM   4227 N N   . ALA A 1 534 ? 18.406  37.772 64.343 1.00 66.15  ? 534  ALA A N   1 
ATOM   4228 C CA  . ALA A 1 534 ? 19.129  36.562 64.705 1.00 66.15  ? 534  ALA A CA  1 
ATOM   4229 C C   . ALA A 1 534 ? 18.722  36.133 66.109 1.00 66.15  ? 534  ALA A C   1 
ATOM   4230 O O   . ALA A 1 534 ? 18.629  34.942 66.397 1.00 66.15  ? 534  ALA A O   1 
ATOM   4231 C CB  . ALA A 1 534 ? 20.632  36.806 64.634 1.00 56.44  ? 534  ALA A CB  1 
ATOM   4232 N N   . THR A 1 535 ? 18.460  37.111 66.974 1.00 92.96  ? 535  THR A N   1 
ATOM   4233 C CA  . THR A 1 535 ? 18.063  36.842 68.359 1.00 92.96  ? 535  THR A CA  1 
ATOM   4234 C C   . THR A 1 535 ? 16.565  37.060 68.578 1.00 92.96  ? 535  THR A C   1 
ATOM   4235 O O   . THR A 1 535 ? 15.798  36.995 67.592 1.00 92.96  ? 535  THR A O   1 
ATOM   4236 C CB  . THR A 1 535 ? 18.837  37.744 69.350 1.00 88.04  ? 535  THR A CB  1 
ATOM   4237 O OG1 . THR A 1 535 ? 18.455  39.112 69.149 1.00 88.04  ? 535  THR A OG1 1 
ATOM   4238 C CG2 . THR A 1 535 ? 20.354  37.607 69.136 1.00 88.04  ? 535  THR A CG2 1 
HETATM 4239 O O   . HOH B 2 .   ? 1.346   90.089 54.758 1.00 34.51  ? 1001 HOH A O   1 
HETATM 4240 O O   . HOH B 2 .   ? -0.760  63.455 59.087 1.00 28.92  ? 1002 HOH A O   1 
HETATM 4241 O O   . HOH B 2 .   ? 19.328  62.294 32.372 1.00 48.31  ? 1003 HOH A O   1 
HETATM 4242 O O   . HOH B 2 .   ? 3.868   69.354 57.889 1.00 42.89  ? 1004 HOH A O   1 
HETATM 4243 O O   . HOH B 2 .   ? 21.329  57.624 61.119 1.00 44.73  ? 1005 HOH A O   1 
HETATM 4244 O O   . HOH B 2 .   ? -13.502 58.023 56.648 1.00 32.63  ? 1006 HOH A O   1 
HETATM 4245 O O   . HOH B 2 .   ? -19.290 85.411 49.745 1.00 52.78  ? 1007 HOH A O   1 
HETATM 4246 O O   . HOH B 2 .   ? 0.078   69.638 59.856 1.00 32.88  ? 1008 HOH A O   1 
HETATM 4247 O O   . HOH B 2 .   ? 18.298  50.647 45.092 1.00 32.60  ? 1009 HOH A O   1 
HETATM 4248 O O   . HOH B 2 .   ? 27.835  63.561 46.017 1.00 37.83  ? 1010 HOH A O   1 
HETATM 4249 O O   . HOH B 2 .   ? 3.846   66.776 36.362 1.00 39.58  ? 1011 HOH A O   1 
HETATM 4250 O O   . HOH B 2 .   ? -10.649 66.057 68.940 1.00 43.05  ? 1012 HOH A O   1 
HETATM 4251 O O   . HOH B 2 .   ? 4.049   80.782 51.519 1.00 35.36  ? 1013 HOH A O   1 
HETATM 4252 O O   . HOH B 2 .   ? 5.237   63.525 63.185 1.00 48.69  ? 1014 HOH A O   1 
HETATM 4253 O O   . HOH B 2 .   ? 10.738  55.870 68.835 1.00 34.65  ? 1015 HOH A O   1 
HETATM 4254 O O   . HOH B 2 .   ? -4.679  70.766 34.003 1.00 38.12  ? 1016 HOH A O   1 
HETATM 4255 O O   . HOH B 2 .   ? 7.505   52.396 56.707 1.00 34.54  ? 1017 HOH A O   1 
HETATM 4256 O O   . HOH B 2 .   ? 9.130   81.126 36.966 1.00 46.86  ? 1018 HOH A O   1 
HETATM 4257 O O   . HOH B 2 .   ? 24.794  58.277 52.851 1.00 50.59  ? 1019 HOH A O   1 
HETATM 4258 O O   . HOH B 2 .   ? -6.765  61.700 65.218 1.00 33.76  ? 1020 HOH A O   1 
HETATM 4259 O O   . HOH B 2 .   ? 7.306   78.997 68.039 1.00 49.09  ? 1021 HOH A O   1 
HETATM 4260 O O   . HOH B 2 .   ? 21.398  61.962 36.335 1.00 42.47  ? 1022 HOH A O   1 
HETATM 4261 O O   . HOH B 2 .   ? -9.129  58.406 64.816 1.00 46.97  ? 1023 HOH A O   1 
HETATM 4262 O O   . HOH B 2 .   ? -0.397  69.657 62.607 1.00 37.44  ? 1024 HOH A O   1 
HETATM 4263 O O   . HOH B 2 .   ? -13.630 51.323 49.453 1.00 39.68  ? 1025 HOH A O   1 
HETATM 4264 O O   . HOH B 2 .   ? -2.259  57.651 63.155 1.00 44.11  ? 1026 HOH A O   1 
HETATM 4265 O O   . HOH B 2 .   ? -15.233 60.539 48.887 1.00 35.91  ? 1027 HOH A O   1 
HETATM 4266 O O   . HOH B 2 .   ? -1.535  70.065 52.805 1.00 40.81  ? 1028 HOH A O   1 
HETATM 4267 O O   . HOH B 2 .   ? 3.621   64.493 65.059 1.00 50.05  ? 1029 HOH A O   1 
HETATM 4268 O O   . HOH B 2 .   ? 21.130  82.823 54.067 1.00 57.66  ? 1030 HOH A O   1 
HETATM 4269 O O   . HOH B 2 .   ? -3.402  46.027 73.130 1.00 57.53  ? 1031 HOH A O   1 
HETATM 4270 O O   . HOH B 2 .   ? -15.264 66.420 52.010 1.00 36.68  ? 1032 HOH A O   1 
HETATM 4271 O O   . HOH B 2 .   ? 19.545  67.805 38.636 1.00 42.70  ? 1033 HOH A O   1 
HETATM 4272 O O   . HOH B 2 .   ? 24.854  73.571 39.306 1.00 42.87  ? 1034 HOH A O   1 
HETATM 4273 O O   . HOH B 2 .   ? -4.174  70.160 62.671 1.00 39.46  ? 1035 HOH A O   1 
HETATM 4274 O O   . HOH B 2 .   ? 19.540  84.980 63.084 1.00 51.11  ? 1036 HOH A O   1 
HETATM 4275 O O   . HOH B 2 .   ? -4.331  83.398 52.153 1.00 47.33  ? 1037 HOH A O   1 
HETATM 4276 O O   . HOH B 2 .   ? 2.986   54.081 63.774 1.00 36.01  ? 1038 HOH A O   1 
HETATM 4277 O O   . HOH B 2 .   ? 13.349  69.087 57.263 1.00 31.80  ? 1039 HOH A O   1 
HETATM 4278 O O   . HOH B 2 .   ? 4.412   68.426 61.551 1.00 46.01  ? 1040 HOH A O   1 
HETATM 4279 O O   . HOH B 2 .   ? 15.556  52.712 61.840 1.00 43.89  ? 1041 HOH A O   1 
HETATM 4280 O O   . HOH B 2 .   ? -0.586  61.235 72.582 1.00 48.80  ? 1042 HOH A O   1 
HETATM 4281 O O   . HOH B 2 .   ? -4.159  52.009 56.474 1.00 37.49  ? 1043 HOH A O   1 
HETATM 4282 O O   . HOH B 2 .   ? 25.315  61.387 52.983 1.00 39.80  ? 1044 HOH A O   1 
HETATM 4283 O O   . HOH B 2 .   ? 16.689  57.777 36.299 1.00 39.10  ? 1045 HOH A O   1 
HETATM 4284 O O   . HOH B 2 .   ? -3.589  51.125 59.932 1.00 42.28  ? 1046 HOH A O   1 
HETATM 4285 O O   . HOH B 2 .   ? -10.590 81.690 55.477 1.00 40.57  ? 1047 HOH A O   1 
HETATM 4286 O O   . HOH B 2 .   ? 2.441   62.832 70.402 1.00 47.77  ? 1048 HOH A O   1 
HETATM 4287 O O   . HOH B 2 .   ? -9.671  70.339 54.744 1.00 54.71  ? 1049 HOH A O   1 
HETATM 4288 O O   . HOH B 2 .   ? 1.408   43.511 55.157 1.00 43.93  ? 1050 HOH A O   1 
HETATM 4289 O O   . HOH B 2 .   ? 24.650  66.830 85.097 1.00 49.94  ? 1051 HOH A O   1 
HETATM 4290 O O   . HOH B 2 .   ? 23.253  67.117 47.998 1.00 32.34  ? 1052 HOH A O   1 
HETATM 4291 O O   . HOH B 2 .   ? -7.408  68.227 58.178 1.00 44.01  ? 1053 HOH A O   1 
HETATM 4292 O O   . HOH B 2 .   ? 20.699  47.215 52.102 1.00 43.58  ? 1054 HOH A O   1 
HETATM 4293 O O   . HOH B 2 .   ? -6.445  83.935 38.769 1.00 43.03  ? 1055 HOH A O   1 
HETATM 4294 O O   . HOH B 2 .   ? 24.985  58.565 55.658 1.00 45.51  ? 1056 HOH A O   1 
HETATM 4295 O O   . HOH B 2 .   ? 19.041  54.677 35.857 1.00 48.29  ? 1057 HOH A O   1 
HETATM 4296 O O   . HOH B 2 .   ? 24.713  60.280 40.104 1.00 42.99  ? 1058 HOH A O   1 
HETATM 4297 O O   . HOH B 2 .   ? -9.804  62.507 59.758 1.00 53.72  ? 1059 HOH A O   1 
HETATM 4298 O O   . HOH B 2 .   ? 31.301  58.709 50.326 1.00 50.17  ? 1060 HOH A O   1 
HETATM 4299 O O   . HOH B 2 .   ? 16.580  89.163 52.476 1.00 39.67  ? 1061 HOH A O   1 
HETATM 4300 O O   . HOH B 2 .   ? -9.993  51.981 54.973 1.00 43.84  ? 1062 HOH A O   1 
HETATM 4301 O O   . HOH B 2 .   ? 7.390   49.201 59.376 1.00 42.86  ? 1063 HOH A O   1 
HETATM 4302 O O   . HOH B 2 .   ? 3.573   46.305 61.669 1.00 42.88  ? 1064 HOH A O   1 
HETATM 4303 O O   . HOH B 2 .   ? -2.284  77.960 62.635 1.00 40.56  ? 1065 HOH A O   1 
HETATM 4304 O O   . HOH B 2 .   ? 7.381   46.850 53.938 1.00 37.45  ? 1066 HOH A O   1 
HETATM 4305 O O   . HOH B 2 .   ? 11.833  47.993 73.854 1.00 69.10  ? 1067 HOH A O   1 
HETATM 4306 O O   . HOH B 2 .   ? -6.312  49.473 61.203 1.00 38.57  ? 1068 HOH A O   1 
HETATM 4307 O O   . HOH B 2 .   ? 23.663  77.593 54.281 1.00 50.03  ? 1069 HOH A O   1 
HETATM 4308 O O   . HOH B 2 .   ? 12.663  80.029 75.519 1.00 56.58  ? 1070 HOH A O   1 
HETATM 4309 O O   . HOH B 2 .   ? 7.537   70.360 39.015 1.00 62.61  ? 1071 HOH A O   1 
HETATM 4310 O O   . HOH B 2 .   ? 21.189  71.755 68.167 1.00 47.30  ? 1072 HOH A O   1 
HETATM 4311 O O   . HOH B 2 .   ? 22.145  52.812 54.503 1.00 49.01  ? 1073 HOH A O   1 
HETATM 4312 O O   . HOH B 2 .   ? 18.702  78.790 42.671 1.00 79.17  ? 1074 HOH A O   1 
HETATM 4313 O O   . HOH B 2 .   ? -4.441  85.578 39.533 1.00 40.31  ? 1075 HOH A O   1 
HETATM 4314 O O   . HOH B 2 .   ? -6.996  50.645 49.694 1.00 48.05  ? 1076 HOH A O   1 
HETATM 4315 O O   . HOH B 2 .   ? 0.480   40.532 57.677 1.00 44.43  ? 1077 HOH A O   1 
HETATM 4316 O O   . HOH B 2 .   ? 18.900  85.438 50.547 1.00 44.77  ? 1078 HOH A O   1 
HETATM 4317 O O   . HOH B 2 .   ? 7.000   49.254 66.825 1.00 44.71  ? 1079 HOH A O   1 
HETATM 4318 O O   . HOH B 2 .   ? -0.173  66.741 37.193 1.00 48.12  ? 1080 HOH A O   1 
HETATM 4319 O O   . HOH B 2 .   ? 3.687   47.744 65.325 1.00 47.96  ? 1081 HOH A O   1 
HETATM 4320 O O   . HOH B 2 .   ? 22.619  79.528 61.714 1.00 56.01  ? 1082 HOH A O   1 
HETATM 4321 O O   . HOH B 2 .   ? -15.426 67.609 49.550 1.00 36.30  ? 1083 HOH A O   1 
HETATM 4322 O O   . HOH B 2 .   ? 4.784   50.534 62.406 1.00 42.07  ? 1084 HOH A O   1 
HETATM 4323 O O   . HOH B 2 .   ? 23.595  51.852 80.987 1.00 57.00  ? 1085 HOH A O   1 
HETATM 4324 O O   . HOH B 2 .   ? -2.445  68.638 67.253 1.00 47.08  ? 1086 HOH A O   1 
HETATM 4325 O O   . HOH B 2 .   ? -14.951 60.276 57.315 1.00 49.55  ? 1087 HOH A O   1 
HETATM 4326 O O   . HOH B 2 .   ? 18.517  67.435 73.365 1.00 49.50  ? 1088 HOH A O   1 
HETATM 4327 O O   . HOH B 2 .   ? -20.260 57.165 59.577 1.00 50.23  ? 1089 HOH A O   1 
HETATM 4328 O O   . HOH B 2 .   ? -12.942 40.115 62.663 1.00 54.71  ? 1090 HOH A O   1 
HETATM 4329 O O   . HOH B 2 .   ? 4.834   69.244 64.137 1.00 47.58  ? 1091 HOH A O   1 
HETATM 4330 O O   . HOH B 2 .   ? 11.883  64.695 35.357 1.00 49.11  ? 1092 HOH A O   1 
HETATM 4331 O O   . HOH B 2 .   ? 10.073  52.677 79.955 1.00 49.95  ? 1093 HOH A O   1 
HETATM 4332 O O   . HOH B 2 .   ? 2.611   40.109 59.465 1.00 44.80  ? 1094 HOH A O   1 
HETATM 4333 O O   . HOH B 2 .   ? -0.963  66.644 39.881 1.00 42.48  ? 1095 HOH A O   1 
HETATM 4334 O O   . HOH B 2 .   ? -5.691  44.964 57.693 1.00 39.28  ? 1096 HOH A O   1 
HETATM 4335 O O   . HOH B 2 .   ? 18.319  91.627 62.785 1.00 46.98  ? 1097 HOH A O   1 
HETATM 4336 O O   . HOH B 2 .   ? 3.557   50.772 69.756 1.00 40.48  ? 1098 HOH A O   1 
HETATM 4337 O O   . HOH B 2 .   ? -10.827 47.515 76.298 1.00 50.02  ? 1099 HOH A O   1 
HETATM 4338 O O   . HOH B 2 .   ? 18.656  60.266 42.005 1.00 39.49  ? 1100 HOH A O   1 
HETATM 4339 O O   . HOH B 2 .   ? -12.023 67.101 37.059 1.00 35.98  ? 1101 HOH A O   1 
HETATM 4340 O O   . HOH B 2 .   ? -10.385 56.060 45.239 1.00 43.00  ? 1102 HOH A O   1 
HETATM 4341 O O   . HOH B 2 .   ? 33.737  63.679 84.437 1.00 49.75  ? 1103 HOH A O   1 
HETATM 4342 O O   . HOH B 2 .   ? -9.782  65.601 32.566 1.00 41.93  ? 1104 HOH A O   1 
HETATM 4343 O O   . HOH B 2 .   ? -5.506  40.031 57.358 1.00 55.89  ? 1105 HOH A O   1 
HETATM 4344 O O   . HOH B 2 .   ? 19.087  58.879 35.217 1.00 46.42  ? 1106 HOH A O   1 
HETATM 4345 O O   . HOH B 2 .   ? 9.866   56.153 36.240 1.00 41.86  ? 1107 HOH A O   1 
HETATM 4346 O O   . HOH B 2 .   ? -20.343 77.269 47.397 1.00 50.17  ? 1108 HOH A O   1 
HETATM 4347 O O   . HOH B 2 .   ? -8.874  60.986 63.646 1.00 39.34  ? 1109 HOH A O   1 
HETATM 4348 O O   . HOH B 2 .   ? -7.798  79.783 32.058 1.00 55.54  ? 1110 HOH A O   1 
HETATM 4349 O O   . HOH B 2 .   ? 34.729  65.404 45.559 1.00 50.55  ? 1111 HOH A O   1 
HETATM 4350 O O   . HOH B 2 .   ? -24.678 44.547 60.806 1.00 60.90  ? 1112 HOH A O   1 
HETATM 4351 O O   . HOH B 2 .   ? 23.059  78.091 44.067 1.00 61.64  ? 1113 HOH A O   1 
HETATM 4352 O O   . HOH B 2 .   ? 12.560  74.204 32.486 1.00 44.86  ? 1114 HOH A O   1 
HETATM 4353 O O   . HOH B 2 .   ? -22.559 80.811 36.153 1.00 53.10  ? 1115 HOH A O   1 
HETATM 4354 O O   . HOH B 2 .   ? 30.269  76.733 45.145 1.00 55.58  ? 1116 HOH A O   1 
HETATM 4355 O O   . HOH B 2 .   ? 20.041  63.002 65.412 1.00 47.67  ? 1117 HOH A O   1 
HETATM 4356 O O   . HOH B 2 .   ? 15.787  80.473 69.869 1.00 47.46  ? 1118 HOH A O   1 
HETATM 4357 O O   . HOH B 2 .   ? 15.369  77.772 77.505 1.00 44.62  ? 1119 HOH A O   1 
HETATM 4358 O O   . HOH B 2 .   ? -1.975  51.007 73.533 1.00 66.44  ? 1120 HOH A O   1 
HETATM 4359 O O   . HOH B 2 .   ? 28.958  59.504 61.428 1.00 44.63  ? 1121 HOH A O   1 
HETATM 4360 O O   . HOH B 2 .   ? 7.449   78.326 35.551 1.00 60.02  ? 1122 HOH A O   1 
HETATM 4361 O O   . HOH B 2 .   ? -18.716 77.629 49.972 1.00 45.50  ? 1123 HOH A O   1 
HETATM 4362 O O   . HOH B 2 .   ? 9.197   88.627 48.355 1.00 45.34  ? 1124 HOH A O   1 
HETATM 4363 O O   . HOH B 2 .   ? 3.498   51.486 64.700 1.00 35.70  ? 1125 HOH A O   1 
HETATM 4364 O O   . HOH B 2 .   ? 6.195   81.692 64.700 1.00 55.82  ? 1126 HOH A O   1 
HETATM 4365 O O   . HOH B 2 .   ? -5.178  60.266 75.218 1.00 51.50  ? 1127 HOH A O   1 
HETATM 4366 O O   . HOH B 2 .   ? -5.071  47.406 76.666 1.00 47.57  ? 1128 HOH A O   1 
HETATM 4367 O O   . HOH B 2 .   ? 18.200  75.237 37.475 1.00 47.38  ? 1129 HOH A O   1 
HETATM 4368 O O   . HOH B 2 .   ? -3.426  86.595 32.809 1.00 48.63  ? 1130 HOH A O   1 
HETATM 4369 O O   . HOH B 2 .   ? -10.134 76.447 67.143 1.00 51.32  ? 1131 HOH A O   1 
HETATM 4370 O O   . HOH B 2 .   ? -20.473 75.671 37.254 1.00 40.19  ? 1132 HOH A O   1 
HETATM 4371 O O   . HOH B 2 .   ? 9.134   45.138 43.589 1.00 43.98  ? 1133 HOH A O   1 
HETATM 4372 O O   . HOH B 2 .   ? 11.448  78.064 35.630 1.00 62.24  ? 1134 HOH A O   1 
HETATM 4373 O O   . HOH B 2 .   ? 30.439  52.620 66.265 1.00 57.82  ? 1135 HOH A O   1 
HETATM 4374 O O   . HOH B 2 .   ? 14.371  51.488 56.951 1.00 50.24  ? 1136 HOH A O   1 
HETATM 4375 O O   . HOH B 2 .   ? 27.103  69.125 59.737 1.00 52.31  ? 1137 HOH A O   1 
HETATM 4376 O O   . HOH B 2 .   ? 6.889   62.712 35.284 1.00 56.59  ? 1138 HOH A O   1 
HETATM 4377 O O   . HOH B 2 .   ? 4.774   59.737 70.378 1.00 40.44  ? 1139 HOH A O   1 
HETATM 4378 O O   . HOH B 2 .   ? -13.451 62.449 56.863 1.00 48.15  ? 1140 HOH A O   1 
HETATM 4379 O O   . HOH B 2 .   ? 13.061  83.869 47.724 1.00 41.59  ? 1141 HOH A O   1 
HETATM 4380 O O   . HOH B 2 .   ? 0.258   70.255 68.580 1.00 49.61  ? 1142 HOH A O   1 
HETATM 4381 O O   . HOH B 2 .   ? -14.418 65.543 67.530 1.00 53.03  ? 1143 HOH A O   1 
HETATM 4382 O O   . HOH B 2 .   ? 21.320  84.331 56.376 1.00 48.62  ? 1144 HOH A O   1 
HETATM 4383 O O   . HOH B 2 .   ? 24.013  70.108 40.133 1.00 45.64  ? 1145 HOH A O   1 
HETATM 4384 O O   . HOH B 2 .   ? 15.763  64.236 32.530 1.00 59.15  ? 1146 HOH A O   1 
HETATM 4385 O O   . HOH B 2 .   ? -17.899 65.626 61.528 1.00 51.81  ? 1147 HOH A O   1 
HETATM 4386 O O   . HOH B 2 .   ? 4.042   43.742 55.852 1.00 45.17  ? 1148 HOH A O   1 
HETATM 4387 O O   . HOH B 2 .   ? -2.125  97.736 48.613 1.00 62.92  ? 1149 HOH A O   1 
HETATM 4388 O O   . HOH B 2 .   ? 5.067   88.504 68.351 1.00 48.99  ? 1150 HOH A O   1 
HETATM 4389 O O   . HOH B 2 .   ? -12.985 43.171 76.116 1.00 53.30  ? 1151 HOH A O   1 
HETATM 4390 O O   . HOH B 2 .   ? 21.448  58.619 38.161 1.00 60.19  ? 1152 HOH A O   1 
HETATM 4391 O O   . HOH B 2 .   ? 25.270  70.438 63.172 1.00 46.81  ? 1153 HOH A O   1 
HETATM 4392 O O   . HOH B 2 .   ? 4.828   57.454 76.368 1.00 47.03  ? 1154 HOH A O   1 
HETATM 4393 O O   . HOH B 2 .   ? -6.364  58.918 40.276 1.00 56.17  ? 1155 HOH A O   1 
HETATM 4394 O O   . HOH B 2 .   ? 11.773  56.335 84.756 1.00 64.57  ? 1156 HOH A O   1 
HETATM 4395 O O   . HOH B 2 .   ? 3.857   65.295 69.676 1.00 57.44  ? 1157 HOH A O   1 
HETATM 4396 O O   . HOH B 2 .   ? 28.874  75.821 39.261 1.00 50.59  ? 1158 HOH A O   1 
HETATM 4397 O O   . HOH B 2 .   ? -15.061 47.381 45.603 1.00 59.64  ? 1159 HOH A O   1 
HETATM 4398 O O   . HOH B 2 .   ? -10.118 65.245 38.328 1.00 43.27  ? 1160 HOH A O   1 
HETATM 4399 O O   . HOH B 2 .   ? 22.458  73.713 65.964 1.00 53.13  ? 1161 HOH A O   1 
HETATM 4400 O O   . HOH B 2 .   ? 23.534  79.266 46.876 1.00 48.64  ? 1162 HOH A O   1 
HETATM 4401 O O   . HOH B 2 .   ? 24.400  76.523 63.295 1.00 49.26  ? 1163 HOH A O   1 
HETATM 4402 O O   . HOH B 2 .   ? 5.555   54.035 80.952 1.00 46.77  ? 1164 HOH A O   1 
HETATM 4403 O O   . HOH B 2 .   ? -3.186  77.325 30.962 1.00 51.75  ? 1165 HOH A O   1 
HETATM 4404 O O   . HOH B 2 .   ? 33.322  68.658 48.396 1.00 51.70  ? 1166 HOH A O   1 
HETATM 4405 O O   . HOH B 2 .   ? -6.594  46.222 51.410 1.00 65.73  ? 1167 HOH A O   1 
HETATM 4406 O O   . HOH B 2 .   ? -21.781 46.332 67.043 1.00 53.49  ? 1168 HOH A O   1 
HETATM 4407 O O   . HOH B 2 .   ? -13.483 78.407 57.555 1.00 81.19  ? 1169 HOH A O   1 
HETATM 4408 O O   . HOH B 2 .   ? -17.738 63.889 67.483 1.00 46.69  ? 1170 HOH A O   1 
HETATM 4409 O O   . HOH B 2 .   ? 23.032  72.502 77.170 1.00 48.09  ? 1171 HOH A O   1 
HETATM 4410 O O   . HOH B 2 .   ? -3.237  67.566 31.854 1.00 46.01  ? 1172 HOH A O   1 
HETATM 4411 O O   . HOH B 2 .   ? -4.898  80.590 31.951 1.00 54.12  ? 1173 HOH A O   1 
HETATM 4412 O O   . HOH B 2 .   ? -3.764  69.269 79.894 1.00 53.98  ? 1174 HOH A O   1 
HETATM 4413 O O   . HOH B 2 .   ? 19.387  64.568 86.547 1.00 46.06  ? 1175 HOH A O   1 
HETATM 4414 O O   . HOH B 2 .   ? -15.613 57.047 72.923 1.00 66.69  ? 1176 HOH A O   1 
HETATM 4415 O O   . HOH B 2 .   ? -3.378  76.420 64.529 1.00 47.61  ? 1177 HOH A O   1 
HETATM 4416 O O   . HOH B 2 .   ? -12.104 72.622 65.864 1.00 50.97  ? 1178 HOH A O   1 
HETATM 4417 O O   . HOH B 2 .   ? 3.536   81.342 32.555 1.00 51.84  ? 1179 HOH A O   1 
HETATM 4418 O O   . HOH B 2 .   ? -2.078  65.482 77.514 1.00 67.86  ? 1180 HOH A O   1 
HETATM 4419 O O   . HOH B 2 .   ? 0.948   92.953 57.415 1.00 58.02  ? 1181 HOH A O   1 
HETATM 4420 O O   . HOH B 2 .   ? 12.173  87.262 44.809 1.00 49.56  ? 1182 HOH A O   1 
HETATM 4421 O O   . HOH B 2 .   ? 12.870  43.864 75.495 1.00 78.41  ? 1183 HOH A O   1 
HETATM 4422 O O   . HOH B 2 .   ? -0.893  51.370 42.615 1.00 55.68  ? 1184 HOH A O   1 
HETATM 4423 O O   . HOH B 2 .   ? 28.004  65.798 42.907 1.00 44.22  ? 1185 HOH A O   1 
HETATM 4424 O O   . HOH B 2 .   ? -21.790 70.200 47.913 1.00 47.75  ? 1186 HOH A O   1 
HETATM 4425 O O   . HOH B 2 .   ? 16.654  43.233 44.339 1.00 59.11  ? 1187 HOH A O   1 
HETATM 4426 O O   . HOH B 2 .   ? 30.125  74.244 46.621 1.00 47.03  ? 1188 HOH A O   1 
HETATM 4427 O O   . HOH B 2 .   ? -2.116  57.691 66.807 1.00 67.45  ? 1189 HOH A O   1 
HETATM 4428 O O   . HOH B 2 .   ? 7.692   64.106 79.535 1.00 45.85  ? 1190 HOH A O   1 
HETATM 4429 O O   . HOH B 2 .   ? 6.205   74.585 29.652 1.00 55.43  ? 1191 HOH A O   1 
HETATM 4430 O O   . HOH B 2 .   ? -18.940 72.588 51.569 1.00 49.53  ? 1192 HOH A O   1 
HETATM 4431 O O   . HOH B 2 .   ? -8.206  71.737 52.783 1.00 48.78  ? 1193 HOH A O   1 
HETATM 4432 O O   . HOH B 2 .   ? 9.160   91.052 49.984 1.00 50.10  ? 1194 HOH A O   1 
HETATM 4433 O O   . HOH B 2 .   ? 11.723  67.643 67.613 1.00 47.48  ? 1195 HOH A O   1 
HETATM 4434 O O   . HOH B 2 .   ? 23.341  69.121 36.902 1.00 49.89  ? 1196 HOH A O   1 
HETATM 4435 O O   . HOH B 2 .   ? 14.290  39.934 75.866 1.00 48.94  ? 1197 HOH A O   1 
HETATM 4436 O O   . HOH B 2 .   ? 15.147  35.957 58.669 1.00 70.15  ? 1198 HOH A O   1 
HETATM 4437 O O   . HOH B 2 .   ? 14.521  42.462 47.678 1.00 57.32  ? 1199 HOH A O   1 
HETATM 4438 O O   . HOH B 2 .   ? 4.829   46.456 40.523 1.00 52.37  ? 1200 HOH A O   1 
HETATM 4439 O O   . HOH B 2 .   ? 17.923  39.418 74.729 1.00 50.13  ? 1201 HOH A O   1 
HETATM 4440 O O   . HOH B 2 .   ? 31.675  58.688 62.323 1.00 60.92  ? 1202 HOH A O   1 
HETATM 4441 O O   . HOH B 2 .   ? 15.119  65.676 84.595 1.00 51.01  ? 1203 HOH A O   1 
HETATM 4442 O O   . HOH B 2 .   ? 9.430   80.187 65.512 1.00 57.10  ? 1204 HOH A O   1 
HETATM 4443 O O   . HOH B 2 .   ? -7.077  43.042 73.981 1.00 61.11  ? 1205 HOH A O   1 
HETATM 4444 O O   . HOH B 2 .   ? -6.122  74.607 69.948 1.00 57.40  ? 1206 HOH A O   1 
HETATM 4445 O O   . HOH B 2 .   ? 22.356  51.511 45.603 1.00 61.41  ? 1207 HOH A O   1 
HETATM 4446 O O   . HOH B 2 .   ? 6.549   90.788 69.920 1.00 60.97  ? 1208 HOH A O   1 
HETATM 4447 O O   . HOH B 2 .   ? -15.489 87.173 33.458 1.00 60.66  ? 1209 HOH A O   1 
HETATM 4448 O O   . HOH B 2 .   ? -20.469 60.475 59.030 1.00 74.74  ? 1210 HOH A O   1 
HETATM 4449 O O   . HOH B 2 .   ? 10.789  68.623 60.040 1.00 69.14  ? 1211 HOH A O   1 
HETATM 4450 O O   . HOH B 2 .   ? 9.025   50.197 37.407 1.00 51.50  ? 1212 HOH A O   1 
HETATM 4451 O O   . HOH B 2 .   ? -7.430  70.486 56.433 1.00 41.02  ? 1213 HOH A O   1 
HETATM 4452 O O   . HOH B 2 .   ? 30.294  58.468 65.873 1.00 49.60  ? 1214 HOH A O   1 
HETATM 4453 O O   . HOH B 2 .   ? 11.253  77.403 84.520 1.00 57.30  ? 1215 HOH A O   1 
HETATM 4454 O O   . HOH B 2 .   ? 10.805  84.209 72.166 1.00 51.10  ? 1216 HOH A O   1 
HETATM 4455 O O   . HOH B 2 .   ? -7.846  86.059 32.782 1.00 48.97  ? 1217 HOH A O   1 
HETATM 4456 O O   . HOH B 2 .   ? -18.685 60.082 42.022 1.00 53.43  ? 1218 HOH A O   1 
HETATM 4457 O O   . HOH B 2 .   ? 25.373  80.265 50.299 1.00 61.96  ? 1219 HOH A O   1 
HETATM 4458 O O   . HOH B 2 .   ? 10.290  47.327 38.574 1.00 59.37  ? 1220 HOH A O   1 
HETATM 4459 O O   . HOH B 2 .   ? -12.308 63.392 59.103 1.00 47.22  ? 1221 HOH A O   1 
HETATM 4460 O O   . HOH B 2 .   ? -22.240 59.110 62.932 1.00 56.24  ? 1222 HOH A O   1 
HETATM 4461 O O   . HOH B 2 .   ? 33.332  65.345 42.620 1.00 60.10  ? 1223 HOH A O   1 
HETATM 4462 O O   . HOH B 2 .   ? -15.396 72.685 54.642 1.00 58.51  ? 1224 HOH A O   1 
HETATM 4463 O O   . HOH B 2 .   ? -24.402 55.852 59.819 1.00 55.73  ? 1225 HOH A O   1 
HETATM 4464 O O   . HOH B 2 .   ? 16.222  62.724 84.809 1.00 53.63  ? 1226 HOH A O   1 
HETATM 4465 O O   . HOH B 2 .   ? 26.231  65.288 61.792 1.00 59.24  ? 1227 HOH A O   1 
HETATM 4466 O O   . HOH B 2 .   ? -15.660 75.170 50.663 1.00 48.85  ? 1228 HOH A O   1 
HETATM 4467 O O   . HOH B 2 .   ? -0.843  75.172 31.071 1.00 62.66  ? 1229 HOH A O   1 
HETATM 4468 O O   . HOH B 2 .   ? 15.910  59.127 88.154 1.00 68.59  ? 1230 HOH A O   1 
HETATM 4469 O O   . HOH B 2 .   ? 30.263  64.361 43.271 1.00 76.99  ? 1231 HOH A O   1 
HETATM 4470 O O   . HOH B 2 .   ? -24.364 80.486 41.874 1.00 48.40  ? 1232 HOH A O   1 
HETATM 4471 O O   . HOH B 2 .   ? -14.935 87.357 49.961 1.00 57.34  ? 1233 HOH A O   1 
HETATM 4472 O O   . HOH B 2 .   ? 26.101  58.243 68.798 1.00 60.48  ? 1234 HOH A O   1 
HETATM 4473 O O   . HOH B 2 .   ? 4.233   50.065 67.163 1.00 40.21  ? 1235 HOH A O   1 
HETATM 4474 O O   . HOH B 2 .   ? 5.690   58.095 35.941 1.00 54.47  ? 1236 HOH A O   1 
HETATM 4475 O O   . HOH B 2 .   ? -3.718  86.055 54.194 1.00 47.95  ? 1237 HOH A O   1 
HETATM 4476 O O   . HOH B 2 .   ? 17.277  64.149 66.991 1.00 45.62  ? 1238 HOH A O   1 
HETATM 4477 O O   . HOH B 2 .   ? -6.782  48.149 73.954 1.00 59.16  ? 1239 HOH A O   1 
HETATM 4478 O O   . HOH B 2 .   ? 12.250  67.729 83.753 1.00 53.92  ? 1240 HOH A O   1 
HETATM 4479 O O   . HOH B 2 .   ? -7.752  73.376 67.918 1.00 55.89  ? 1241 HOH A O   1 
HETATM 4480 O O   . HOH B 2 .   ? 22.196  62.109 41.898 1.00 46.40  ? 1242 HOH A O   1 
HETATM 4481 O O   . HOH B 2 .   ? 19.012  75.174 71.163 1.00 50.35  ? 1243 HOH A O   1 
HETATM 4482 O O   . HOH B 2 .   ? -6.803  89.055 42.351 1.00 54.22  ? 1244 HOH A O   1 
HETATM 4483 O O   . HOH B 2 .   ? 22.797  56.609 39.249 1.00 50.24  ? 1245 HOH A O   1 
HETATM 4484 O O   . HOH B 2 .   ? -23.495 37.765 69.664 1.00 52.52  ? 1246 HOH A O   1 
HETATM 4485 O O   . HOH B 2 .   ? 25.027  48.734 77.184 1.00 52.56  ? 1247 HOH A O   1 
HETATM 4486 O O   . HOH B 2 .   ? 12.749  81.023 41.353 1.00 77.64  ? 1248 HOH A O   1 
HETATM 4487 O O   . HOH B 2 .   ? -12.159 90.492 39.557 1.00 59.85  ? 1249 HOH A O   1 
HETATM 4488 O O   . HOH B 2 .   ? 1.382   40.764 54.703 1.00 39.62  ? 1250 HOH A O   1 
HETATM 4489 O O   . HOH B 2 .   ? 17.193  69.486 85.011 1.00 43.03  ? 1251 HOH A O   1 
HETATM 4490 O O   . HOH B 2 .   ? 27.307  63.658 59.772 1.00 43.00  ? 1252 HOH A O   1 
HETATM 4491 O O   . HOH B 2 .   ? 15.801  52.871 59.123 1.00 72.42  ? 1253 HOH A O   1 
HETATM 4492 O O   . HOH B 2 .   ? -23.222 49.351 53.011 1.00 55.20  ? 1254 HOH A O   1 
HETATM 4493 O O   . HOH B 2 .   ? 20.062  74.408 68.731 1.00 41.42  ? 1255 HOH A O   1 
HETATM 4494 O O   . HOH B 2 .   ? -7.318  69.298 29.157 1.00 56.41  ? 1256 HOH A O   1 
HETATM 4495 O O   . HOH B 2 .   ? 1.077   46.682 40.320 1.00 52.96  ? 1257 HOH A O   1 
HETATM 4496 O O   . HOH B 2 .   ? 30.175  62.485 74.467 1.00 78.41  ? 1258 HOH A O   1 
HETATM 4497 O O   . HOH B 2 .   ? 28.537  68.127 78.755 1.00 57.92  ? 1259 HOH A O   1 
HETATM 4498 O O   . HOH B 2 .   ? -17.957 40.041 70.348 1.00 57.12  ? 1260 HOH A O   1 
HETATM 4499 O O   . HOH B 2 .   ? 29.658  54.821 86.298 1.00 57.80  ? 1261 HOH A O   1 
HETATM 4500 O O   . HOH B 2 .   ? -2.092  75.717 52.831 1.00 65.10  ? 1262 HOH A O   1 
HETATM 4501 O O   . HOH B 2 .   ? -12.372 39.398 65.244 1.00 62.40  ? 1263 HOH A O   1 
HETATM 4502 O O   . HOH B 2 .   ? -18.028 68.910 48.868 1.00 59.97  ? 1264 HOH A O   1 
HETATM 4503 O O   . HOH B 2 .   ? 34.353  61.848 77.533 1.00 52.33  ? 1265 HOH A O   1 
HETATM 4504 O O   . HOH B 2 .   ? 16.354  74.735 77.830 1.00 50.54  ? 1266 HOH A O   1 
HETATM 4505 O O   . HOH B 2 .   ? 31.693  62.278 57.052 1.00 83.07  ? 1267 HOH A O   1 
HETATM 4506 O O   . HOH B 2 .   ? 8.884   59.675 35.979 1.00 59.73  ? 1268 HOH A O   1 
HETATM 4507 O O   . HOH B 2 .   ? 32.021  66.084 56.026 1.00 57.77  ? 1269 HOH A O   1 
HETATM 4508 O O   . HOH B 2 .   ? -1.289  71.984 73.466 1.00 59.69  ? 1270 HOH A O   1 
HETATM 4509 O O   . HOH B 2 .   ? 5.420   46.303 57.628 1.00 55.37  ? 1271 HOH A O   1 
HETATM 4510 O O   . HOH B 2 .   ? 31.444  67.670 78.253 1.00 58.49  ? 1272 HOH A O   1 
HETATM 4511 O O   . HOH B 2 .   ? 12.724  48.484 36.884 1.00 58.75  ? 1273 HOH A O   1 
HETATM 4512 O O   . HOH B 2 .   ? 16.597  33.697 61.443 1.00 67.33  ? 1274 HOH A O   1 
HETATM 4513 O O   . HOH B 2 .   ? 24.884  44.301 55.825 1.00 59.31  ? 1275 HOH A O   1 
HETATM 4514 O O   . HOH B 2 .   ? 10.576  76.890 78.478 1.00 44.04  ? 1276 HOH A O   1 
HETATM 4515 O O   . HOH B 2 .   ? 14.165  76.918 63.508 1.00 57.76  ? 1277 HOH A O   1 
HETATM 4516 O O   . HOH B 2 .   ? 1.955   83.525 60.889 1.00 58.87  ? 1278 HOH A O   1 
HETATM 4517 O O   . HOH B 2 .   ? 3.987   56.231 70.583 1.00 40.99  ? 1279 HOH A O   1 
HETATM 4518 O O   . HOH B 2 .   ? 4.087   86.804 41.673 1.00 59.64  ? 1280 HOH A O   1 
HETATM 4519 O O   . HOH B 2 .   ? 19.452  65.541 68.280 1.00 52.41  ? 1281 HOH A O   1 
HETATM 4520 O O   . HOH B 2 .   ? -10.695 60.576 39.837 1.00 51.67  ? 1282 HOH A O   1 
HETATM 4521 O O   . HOH B 2 .   ? 14.361  91.548 64.952 1.00 55.80  ? 1283 HOH A O   1 
HETATM 4522 O O   . HOH B 2 .   ? 14.826  80.071 38.629 1.00 59.35  ? 1284 HOH A O   1 
HETATM 4523 O O   . HOH B 2 .   ? 10.347  75.531 33.214 1.00 52.41  ? 1285 HOH A O   1 
HETATM 4524 O O   . HOH B 2 .   ? 20.336  69.965 35.771 1.00 51.19  ? 1286 HOH A O   1 
HETATM 4525 O O   . HOH B 2 .   ? 26.073  45.955 77.725 1.00 52.73  ? 1287 HOH A O   1 
HETATM 4526 O O   . HOH B 2 .   ? 18.152  89.905 66.957 1.00 59.90  ? 1288 HOH A O   1 
HETATM 4527 O O   . HOH B 2 .   ? -1.865  61.451 34.712 1.00 58.05  ? 1289 HOH A O   1 
HETATM 4528 O O   . HOH B 2 .   ? 26.631  68.689 41.061 1.00 53.91  ? 1290 HOH A O   1 
HETATM 4529 O O   . HOH B 2 .   ? -0.696  83.576 57.767 1.00 64.25  ? 1291 HOH A O   1 
HETATM 4530 O O   . HOH B 2 .   ? 13.727  76.138 80.223 1.00 64.34  ? 1292 HOH A O   1 
HETATM 4531 O O   . HOH B 2 .   ? 16.164  50.089 62.982 1.00 49.02  ? 1293 HOH A O   1 
HETATM 4532 O O   . HOH B 2 .   ? -16.165 66.012 36.685 1.00 65.55  ? 1294 HOH A O   1 
HETATM 4533 O O   . HOH B 2 .   ? 11.177  90.786 57.183 1.00 68.72  ? 1295 HOH A O   1 
HETATM 4534 O O   . HOH B 2 .   ? 19.715  45.182 56.115 1.00 56.09  ? 1296 HOH A O   1 
HETATM 4535 O O   . HOH B 2 .   ? 8.525   49.591 75.627 1.00 51.17  ? 1297 HOH A O   1 
HETATM 4536 O O   . HOH B 2 .   ? 18.573  80.019 46.521 1.00 57.25  ? 1298 HOH A O   1 
HETATM 4537 O O   . HOH B 2 .   ? 15.524  52.024 83.979 1.00 61.08  ? 1299 HOH A O   1 
HETATM 4538 O O   . HOH B 2 .   ? -20.794 83.019 35.319 1.00 57.40  ? 1300 HOH A O   1 
HETATM 4539 O O   . HOH B 2 .   ? -21.327 80.706 49.903 1.00 52.24  ? 1301 HOH A O   1 
HETATM 4540 O O   . HOH B 2 .   ? 21.036  43.905 80.251 1.00 75.74  ? 1302 HOH A O   1 
HETATM 4541 O O   . HOH B 2 .   ? -23.481 51.554 59.215 1.00 56.18  ? 1303 HOH A O   1 
HETATM 4542 O O   . HOH B 2 .   ? 2.259   87.399 37.186 1.00 63.55  ? 1304 HOH A O   1 
HETATM 4543 O O   . HOH B 2 .   ? -1.103  79.568 67.093 1.00 53.75  ? 1305 HOH A O   1 
HETATM 4544 O O   . HOH B 2 .   ? 3.522   81.820 73.688 1.00 58.34  ? 1306 HOH A O   1 
HETATM 4545 O O   . HOH B 2 .   ? -9.253  45.028 50.914 1.00 47.92  ? 1307 HOH A O   1 
HETATM 4546 O O   . HOH B 2 .   ? 19.176  34.484 60.339 1.00 60.35  ? 1308 HOH A O   1 
HETATM 4547 O O   . HOH B 2 .   ? -7.765  58.125 44.382 1.00 47.97  ? 1309 HOH A O   1 
HETATM 4548 O O   . HOH B 2 .   ? 1.574   64.716 77.087 1.00 65.47  ? 1310 HOH A O   1 
HETATM 4549 O O   . HOH B 2 .   ? -12.422 71.063 69.531 1.00 62.18  ? 1311 HOH A O   1 
HETATM 4550 O O   . HOH B 2 .   ? -20.891 47.147 57.879 1.00 58.28  ? 1312 HOH A O   1 
HETATM 4551 O O   . HOH B 2 .   ? 5.438   47.852 75.934 1.00 62.07  ? 1313 HOH A O   1 
HETATM 4552 O O   . HOH B 2 .   ? 6.772   92.909 48.150 1.00 58.89  ? 1314 HOH A O   1 
HETATM 4553 O O   . HOH B 2 .   ? 21.248  72.856 79.274 1.00 49.21  ? 1315 HOH A O   1 
HETATM 4554 O O   . HOH B 2 .   ? 12.275  60.513 86.414 1.00 61.31  ? 1316 HOH A O   1 
HETATM 4555 O O   . HOH B 2 .   ? -14.946 70.148 66.535 1.00 63.44  ? 1317 HOH A O   1 
HETATM 4556 O O   . HOH B 2 .   ? -12.681 64.687 41.771 1.00 52.99  ? 1318 HOH A O   1 
HETATM 4557 O O   . HOH B 2 .   ? -16.632 44.365 54.597 1.00 57.88  ? 1319 HOH A O   1 
HETATM 4558 O O   . HOH B 2 .   ? 21.446  65.332 64.177 1.00 56.40  ? 1320 HOH A O   1 
HETATM 4559 O O   . HOH B 2 .   ? 25.192  62.783 88.645 1.00 53.88  ? 1321 HOH A O   1 
HETATM 4560 O O   . HOH B 2 .   ? 3.306   77.148 78.920 1.00 58.75  ? 1322 HOH A O   1 
HETATM 4561 O O   . HOH B 2 .   ? 17.882  46.050 79.471 1.00 56.11  ? 1323 HOH A O   1 
HETATM 4562 O O   . HOH B 2 .   ? 11.244  42.907 52.497 1.00 61.28  ? 1324 HOH A O   1 
HETATM 4563 O O   . HOH B 2 .   ? 0.221   66.056 68.824 1.00 63.40  ? 1325 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 488 GLN GLN A . n 
A 1 489 GLU 489 489 489 GLU GLU A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   1001 1001 HOH HOH A . 
B 2 HOH 2   1002 1002 HOH HOH A . 
B 2 HOH 3   1003 1003 HOH HOH A . 
B 2 HOH 4   1004 1004 HOH HOH A . 
B 2 HOH 5   1005 1005 HOH HOH A . 
B 2 HOH 6   1006 1006 HOH HOH A . 
B 2 HOH 7   1007 1007 HOH HOH A . 
B 2 HOH 8   1008 1008 HOH HOH A . 
B 2 HOH 9   1009 1009 HOH HOH A . 
B 2 HOH 10  1010 1010 HOH HOH A . 
B 2 HOH 11  1011 1011 HOH HOH A . 
B 2 HOH 12  1012 1012 HOH HOH A . 
B 2 HOH 13  1013 1013 HOH HOH A . 
B 2 HOH 14  1014 1014 HOH HOH A . 
B 2 HOH 15  1015 1015 HOH HOH A . 
B 2 HOH 16  1016 1016 HOH HOH A . 
B 2 HOH 17  1017 1017 HOH HOH A . 
B 2 HOH 18  1018 1018 HOH HOH A . 
B 2 HOH 19  1019 1019 HOH HOH A . 
B 2 HOH 20  1020 1020 HOH HOH A . 
B 2 HOH 21  1021 1021 HOH HOH A . 
B 2 HOH 22  1022 1022 HOH HOH A . 
B 2 HOH 23  1023 1023 HOH HOH A . 
B 2 HOH 24  1024 1024 HOH HOH A . 
B 2 HOH 25  1025 1025 HOH HOH A . 
B 2 HOH 26  1026 1026 HOH HOH A . 
B 2 HOH 27  1027 1027 HOH HOH A . 
B 2 HOH 28  1028 1028 HOH HOH A . 
B 2 HOH 29  1029 1029 HOH HOH A . 
B 2 HOH 30  1030 1030 HOH HOH A . 
B 2 HOH 31  1031 1031 HOH HOH A . 
B 2 HOH 32  1032 1032 HOH HOH A . 
B 2 HOH 33  1033 1033 HOH HOH A . 
B 2 HOH 34  1034 1034 HOH HOH A . 
B 2 HOH 35  1035 1035 HOH HOH A . 
B 2 HOH 36  1036 1036 HOH HOH A . 
B 2 HOH 37  1037 1037 HOH HOH A . 
B 2 HOH 38  1038 1038 HOH HOH A . 
B 2 HOH 39  1039 1039 HOH HOH A . 
B 2 HOH 40  1040 1040 HOH HOH A . 
B 2 HOH 41  1041 1041 HOH HOH A . 
B 2 HOH 42  1042 1042 HOH HOH A . 
B 2 HOH 43  1043 1043 HOH HOH A . 
B 2 HOH 44  1044 1044 HOH HOH A . 
B 2 HOH 45  1045 1045 HOH HOH A . 
B 2 HOH 46  1046 1046 HOH HOH A . 
B 2 HOH 47  1047 1047 HOH HOH A . 
B 2 HOH 48  1048 1048 HOH HOH A . 
B 2 HOH 49  1049 1049 HOH HOH A . 
B 2 HOH 50  1050 1050 HOH HOH A . 
B 2 HOH 51  1051 1051 HOH HOH A . 
B 2 HOH 52  1052 1052 HOH HOH A . 
B 2 HOH 53  1053 1053 HOH HOH A . 
B 2 HOH 54  1054 1054 HOH HOH A . 
B 2 HOH 55  1055 1055 HOH HOH A . 
B 2 HOH 56  1056 1056 HOH HOH A . 
B 2 HOH 57  1057 1057 HOH HOH A . 
B 2 HOH 58  1058 1058 HOH HOH A . 
B 2 HOH 59  1059 1059 HOH HOH A . 
B 2 HOH 60  1060 1060 HOH HOH A . 
B 2 HOH 61  1061 1061 HOH HOH A . 
B 2 HOH 62  1062 1062 HOH HOH A . 
B 2 HOH 63  1063 1063 HOH HOH A . 
B 2 HOH 64  1064 1064 HOH HOH A . 
B 2 HOH 65  1065 1065 HOH HOH A . 
B 2 HOH 66  1066 1066 HOH HOH A . 
B 2 HOH 67  1067 1067 HOH HOH A . 
B 2 HOH 68  1068 1068 HOH HOH A . 
B 2 HOH 69  1069 1069 HOH HOH A . 
B 2 HOH 70  1070 1070 HOH HOH A . 
B 2 HOH 71  1071 1071 HOH HOH A . 
B 2 HOH 72  1072 1072 HOH HOH A . 
B 2 HOH 73  1073 1073 HOH HOH A . 
B 2 HOH 74  1074 1074 HOH HOH A . 
B 2 HOH 75  1075 1075 HOH HOH A . 
B 2 HOH 76  1076 1076 HOH HOH A . 
B 2 HOH 77  1077 1077 HOH HOH A . 
B 2 HOH 78  1078 1078 HOH HOH A . 
B 2 HOH 79  1079 1079 HOH HOH A . 
B 2 HOH 80  1080 1080 HOH HOH A . 
B 2 HOH 81  1081 1081 HOH HOH A . 
B 2 HOH 82  1082 1082 HOH HOH A . 
B 2 HOH 83  1083 1083 HOH HOH A . 
B 2 HOH 84  1084 1084 HOH HOH A . 
B 2 HOH 85  1085 1085 HOH HOH A . 
B 2 HOH 86  1086 1086 HOH HOH A . 
B 2 HOH 87  1087 1087 HOH HOH A . 
B 2 HOH 88  1088 1088 HOH HOH A . 
B 2 HOH 89  1089 1089 HOH HOH A . 
B 2 HOH 90  1090 1090 HOH HOH A . 
B 2 HOH 91  1091 1091 HOH HOH A . 
B 2 HOH 92  1092 1092 HOH HOH A . 
B 2 HOH 93  1093 1093 HOH HOH A . 
B 2 HOH 94  1094 1094 HOH HOH A . 
B 2 HOH 95  1095 1095 HOH HOH A . 
B 2 HOH 96  1096 1096 HOH HOH A . 
B 2 HOH 97  1097 1097 HOH HOH A . 
B 2 HOH 98  1098 1098 HOH HOH A . 
B 2 HOH 99  1099 1099 HOH HOH A . 
B 2 HOH 100 1100 1100 HOH HOH A . 
B 2 HOH 101 1101 1101 HOH HOH A . 
B 2 HOH 102 1102 1102 HOH HOH A . 
B 2 HOH 103 1103 1103 HOH HOH A . 
B 2 HOH 104 1104 1104 HOH HOH A . 
B 2 HOH 105 1105 1105 HOH HOH A . 
B 2 HOH 106 1106 1106 HOH HOH A . 
B 2 HOH 107 1107 1107 HOH HOH A . 
B 2 HOH 108 1108 1108 HOH HOH A . 
B 2 HOH 109 1109 1109 HOH HOH A . 
B 2 HOH 110 1110 1110 HOH HOH A . 
B 2 HOH 111 1111 1111 HOH HOH A . 
B 2 HOH 112 1112 1112 HOH HOH A . 
B 2 HOH 113 1113 1113 HOH HOH A . 
B 2 HOH 114 1114 1114 HOH HOH A . 
B 2 HOH 115 1115 1115 HOH HOH A . 
B 2 HOH 116 1116 1116 HOH HOH A . 
B 2 HOH 117 1117 1117 HOH HOH A . 
B 2 HOH 118 1118 1118 HOH HOH A . 
B 2 HOH 119 1119 1119 HOH HOH A . 
B 2 HOH 120 1120 1120 HOH HOH A . 
B 2 HOH 121 1121 1121 HOH HOH A . 
B 2 HOH 122 1122 1122 HOH HOH A . 
B 2 HOH 123 1123 1123 HOH HOH A . 
B 2 HOH 124 1124 1124 HOH HOH A . 
B 2 HOH 125 1125 1125 HOH HOH A . 
B 2 HOH 126 1126 1126 HOH HOH A . 
B 2 HOH 127 1127 1127 HOH HOH A . 
B 2 HOH 128 1128 1128 HOH HOH A . 
B 2 HOH 129 1129 1129 HOH HOH A . 
B 2 HOH 130 1130 1130 HOH HOH A . 
B 2 HOH 131 1131 1131 HOH HOH A . 
B 2 HOH 132 1132 1132 HOH HOH A . 
B 2 HOH 133 1133 1133 HOH HOH A . 
B 2 HOH 134 1134 1134 HOH HOH A . 
B 2 HOH 135 1135 1135 HOH HOH A . 
B 2 HOH 136 1136 1136 HOH HOH A . 
B 2 HOH 137 1137 1137 HOH HOH A . 
B 2 HOH 138 1138 1138 HOH HOH A . 
B 2 HOH 139 1139 1139 HOH HOH A . 
B 2 HOH 140 1140 1140 HOH HOH A . 
B 2 HOH 141 1141 1141 HOH HOH A . 
B 2 HOH 142 1142 1142 HOH HOH A . 
B 2 HOH 143 1143 1143 HOH HOH A . 
B 2 HOH 144 1144 1144 HOH HOH A . 
B 2 HOH 145 1145 1145 HOH HOH A . 
B 2 HOH 146 1146 1146 HOH HOH A . 
B 2 HOH 147 1147 1147 HOH HOH A . 
B 2 HOH 148 1148 1148 HOH HOH A . 
B 2 HOH 149 1149 1149 HOH HOH A . 
B 2 HOH 150 1150 1150 HOH HOH A . 
B 2 HOH 151 1151 1151 HOH HOH A . 
B 2 HOH 152 1152 1152 HOH HOH A . 
B 2 HOH 153 1153 1153 HOH HOH A . 
B 2 HOH 154 1154 1154 HOH HOH A . 
B 2 HOH 155 1155 1155 HOH HOH A . 
B 2 HOH 156 1156 1156 HOH HOH A . 
B 2 HOH 157 1157 1157 HOH HOH A . 
B 2 HOH 158 1158 1158 HOH HOH A . 
B 2 HOH 159 1159 1159 HOH HOH A . 
B 2 HOH 160 1160 1160 HOH HOH A . 
B 2 HOH 161 1161 1161 HOH HOH A . 
B 2 HOH 162 1162 1162 HOH HOH A . 
B 2 HOH 163 1163 1163 HOH HOH A . 
B 2 HOH 164 1164 1164 HOH HOH A . 
B 2 HOH 165 1165 1165 HOH HOH A . 
B 2 HOH 166 1166 1166 HOH HOH A . 
B 2 HOH 167 1167 1167 HOH HOH A . 
B 2 HOH 168 1168 1168 HOH HOH A . 
B 2 HOH 169 1169 1169 HOH HOH A . 
B 2 HOH 170 1170 1170 HOH HOH A . 
B 2 HOH 171 1171 1171 HOH HOH A . 
B 2 HOH 172 1172 1172 HOH HOH A . 
B 2 HOH 173 1173 1173 HOH HOH A . 
B 2 HOH 174 1174 1174 HOH HOH A . 
B 2 HOH 175 1175 1175 HOH HOH A . 
B 2 HOH 176 1176 1176 HOH HOH A . 
B 2 HOH 177 1177 1177 HOH HOH A . 
B 2 HOH 178 1178 1178 HOH HOH A . 
B 2 HOH 179 1179 1179 HOH HOH A . 
B 2 HOH 180 1180 1180 HOH HOH A . 
B 2 HOH 181 1181 1181 HOH HOH A . 
B 2 HOH 182 1182 1182 HOH HOH A . 
B 2 HOH 183 1183 1183 HOH HOH A . 
B 2 HOH 184 1184 1184 HOH HOH A . 
B 2 HOH 185 1185 1185 HOH HOH A . 
B 2 HOH 186 1186 1186 HOH HOH A . 
B 2 HOH 187 1187 1187 HOH HOH A . 
B 2 HOH 188 1188 1188 HOH HOH A . 
B 2 HOH 189 1189 1189 HOH HOH A . 
B 2 HOH 190 1190 1190 HOH HOH A . 
B 2 HOH 191 1191 1191 HOH HOH A . 
B 2 HOH 192 1192 1192 HOH HOH A . 
B 2 HOH 193 1193 1193 HOH HOH A . 
B 2 HOH 194 1194 1194 HOH HOH A . 
B 2 HOH 195 1195 1195 HOH HOH A . 
B 2 HOH 196 1196 1196 HOH HOH A . 
B 2 HOH 197 1197 1197 HOH HOH A . 
B 2 HOH 198 1198 1198 HOH HOH A . 
B 2 HOH 199 1199 1199 HOH HOH A . 
B 2 HOH 200 1200 1200 HOH HOH A . 
B 2 HOH 201 1201 1201 HOH HOH A . 
B 2 HOH 202 1202 1202 HOH HOH A . 
B 2 HOH 203 1203 1203 HOH HOH A . 
B 2 HOH 204 1204 1204 HOH HOH A . 
B 2 HOH 205 1205 1205 HOH HOH A . 
B 2 HOH 206 1206 1206 HOH HOH A . 
B 2 HOH 207 1207 1207 HOH HOH A . 
B 2 HOH 208 1208 1208 HOH HOH A . 
B 2 HOH 209 1209 1209 HOH HOH A . 
B 2 HOH 210 1210 1210 HOH HOH A . 
B 2 HOH 211 1211 1211 HOH HOH A . 
B 2 HOH 212 1212 1212 HOH HOH A . 
B 2 HOH 213 1213 1213 HOH HOH A . 
B 2 HOH 214 1214 1214 HOH HOH A . 
B 2 HOH 215 1215 1215 HOH HOH A . 
B 2 HOH 216 1216 1216 HOH HOH A . 
B 2 HOH 217 1217 1217 HOH HOH A . 
B 2 HOH 218 1218 1218 HOH HOH A . 
B 2 HOH 219 1219 1219 HOH HOH A . 
B 2 HOH 220 1220 1220 HOH HOH A . 
B 2 HOH 221 1221 1221 HOH HOH A . 
B 2 HOH 222 1222 1222 HOH HOH A . 
B 2 HOH 223 1223 1223 HOH HOH A . 
B 2 HOH 224 1224 1224 HOH HOH A . 
B 2 HOH 225 1225 1225 HOH HOH A . 
B 2 HOH 226 1226 1226 HOH HOH A . 
B 2 HOH 227 1227 1227 HOH HOH A . 
B 2 HOH 228 1228 1228 HOH HOH A . 
B 2 HOH 229 1229 1229 HOH HOH A . 
B 2 HOH 230 1230 1230 HOH HOH A . 
B 2 HOH 231 1231 1231 HOH HOH A . 
B 2 HOH 232 1232 1232 HOH HOH A . 
B 2 HOH 233 1233 1233 HOH HOH A . 
B 2 HOH 234 1234 1234 HOH HOH A . 
B 2 HOH 235 1235 1235 HOH HOH A . 
B 2 HOH 236 1236 1236 HOH HOH A . 
B 2 HOH 237 1237 1237 HOH HOH A . 
B 2 HOH 238 1238 1238 HOH HOH A . 
B 2 HOH 239 1239 1239 HOH HOH A . 
B 2 HOH 240 1240 1240 HOH HOH A . 
B 2 HOH 241 1241 1241 HOH HOH A . 
B 2 HOH 242 1242 1242 HOH HOH A . 
B 2 HOH 243 1243 1243 HOH HOH A . 
B 2 HOH 244 1244 1244 HOH HOH A . 
B 2 HOH 245 1245 1245 HOH HOH A . 
B 2 HOH 246 1246 1246 HOH HOH A . 
B 2 HOH 247 1247 1247 HOH HOH A . 
B 2 HOH 248 1248 1248 HOH HOH A . 
B 2 HOH 249 1249 1249 HOH HOH A . 
B 2 HOH 250 1250 1250 HOH HOH A . 
B 2 HOH 251 1251 1251 HOH HOH A . 
B 2 HOH 252 1252 1252 HOH HOH A . 
B 2 HOH 253 1253 1253 HOH HOH A . 
B 2 HOH 254 1254 1254 HOH HOH A . 
B 2 HOH 255 1255 1255 HOH HOH A . 
B 2 HOH 256 1256 1256 HOH HOH A . 
B 2 HOH 257 1257 1257 HOH HOH A . 
B 2 HOH 258 1258 1258 HOH HOH A . 
B 2 HOH 259 1259 1259 HOH HOH A . 
B 2 HOH 260 1260 1260 HOH HOH A . 
B 2 HOH 261 1261 1261 HOH HOH A . 
B 2 HOH 262 1262 1262 HOH HOH A . 
B 2 HOH 263 1263 1263 HOH HOH A . 
B 2 HOH 264 1264 1264 HOH HOH A . 
B 2 HOH 265 1265 1265 HOH HOH A . 
B 2 HOH 266 1266 1266 HOH HOH A . 
B 2 HOH 267 1267 1267 HOH HOH A . 
B 2 HOH 268 1268 1268 HOH HOH A . 
B 2 HOH 269 1269 1269 HOH HOH A . 
B 2 HOH 270 1270 1270 HOH HOH A . 
B 2 HOH 271 1271 1271 HOH HOH A . 
B 2 HOH 272 1272 1272 HOH HOH A . 
B 2 HOH 273 1273 1273 HOH HOH A . 
B 2 HOH 274 1274 1274 HOH HOH A . 
B 2 HOH 275 1275 1275 HOH HOH A . 
B 2 HOH 276 1276 1276 HOH HOH A . 
B 2 HOH 277 1277 1277 HOH HOH A . 
B 2 HOH 278 1278 1278 HOH HOH A . 
B 2 HOH 279 1279 1279 HOH HOH A . 
B 2 HOH 280 1280 1280 HOH HOH A . 
B 2 HOH 281 1281 1281 HOH HOH A . 
B 2 HOH 282 1282 1282 HOH HOH A . 
B 2 HOH 283 1283 1283 HOH HOH A . 
B 2 HOH 284 1284 1284 HOH HOH A . 
B 2 HOH 285 1285 1285 HOH HOH A . 
B 2 HOH 286 1286 1286 HOH HOH A . 
B 2 HOH 287 1287 1287 HOH HOH A . 
B 2 HOH 288 1288 1288 HOH HOH A . 
B 2 HOH 289 1289 1289 HOH HOH A . 
B 2 HOH 290 1290 1290 HOH HOH A . 
B 2 HOH 291 1291 1291 HOH HOH A . 
B 2 HOH 292 1292 1292 HOH HOH A . 
B 2 HOH 293 1293 1293 HOH HOH A . 
B 2 HOH 294 1294 1294 HOH HOH A . 
B 2 HOH 295 1295 1295 HOH HOH A . 
B 2 HOH 296 1296 1296 HOH HOH A . 
B 2 HOH 297 1297 1297 HOH HOH A . 
B 2 HOH 298 1298 1298 HOH HOH A . 
B 2 HOH 299 1299 1299 HOH HOH A . 
B 2 HOH 300 1300 1300 HOH HOH A . 
B 2 HOH 301 1301 1301 HOH HOH A . 
B 2 HOH 302 1302 1302 HOH HOH A . 
B 2 HOH 303 1303 1303 HOH HOH A . 
B 2 HOH 304 1304 1304 HOH HOH A . 
B 2 HOH 305 1305 1305 HOH HOH A . 
B 2 HOH 306 1306 1306 HOH HOH A . 
B 2 HOH 307 1307 1307 HOH HOH A . 
B 2 HOH 308 1308 1308 HOH HOH A . 
B 2 HOH 309 1309 1309 HOH HOH A . 
B 2 HOH 310 1310 1310 HOH HOH A . 
B 2 HOH 311 1311 1311 HOH HOH A . 
B 2 HOH 312 1312 1312 HOH HOH A . 
B 2 HOH 313 1313 1313 HOH HOH A . 
B 2 HOH 314 1314 1314 HOH HOH A . 
B 2 HOH 315 1315 1315 HOH HOH A . 
B 2 HOH 316 1316 1316 HOH HOH A . 
B 2 HOH 317 1317 1317 HOH HOH A . 
B 2 HOH 318 1318 1318 HOH HOH A . 
B 2 HOH 319 1319 1319 HOH HOH A . 
B 2 HOH 320 1320 1320 HOH HOH A . 
B 2 HOH 321 1321 1321 HOH HOH A . 
B 2 HOH 322 1322 1322 HOH HOH A . 
B 2 HOH 323 1323 1323 HOH HOH A . 
B 2 HOH 324 1324 1324 HOH HOH A . 
B 2 HOH 325 1325 1325 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1880  ? 
1 MORE         -12   ? 
1 'SSA (A^2)'  38880 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 137.9220000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-01-28 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
5 'Structure model' 1 4 2021-06-02 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
4 5 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software                  
2 5 'Structure model' pdbx_struct_assembly      
3 5 'Structure model' pdbx_struct_assembly_gen  
4 5 'Structure model' pdbx_struct_assembly_prop 
5 5 'Structure model' pdbx_struct_oper_list     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_pdbx_struct_assembly.details'             
2 5 'Structure model' '_pdbx_struct_assembly.method_details'      
3 5 'Structure model' '_pdbx_struct_assembly.oligomeric_count'    
4 5 'Structure model' '_pdbx_struct_assembly.oligomeric_details'  
5 5 'Structure model' '_pdbx_struct_assembly_gen.oper_expression' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       0.5 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
SOLVE     phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 45  ? ? 74.85   -11.21  
2  1 SER A 108 ? ? -157.10 73.38   
3  1 ALA A 164 ? ? -158.42 65.56   
4  1 ASN A 167 ? ? 52.89   13.86   
5  1 THR A 193 ? ? -141.07 52.08   
6  1 SER A 200 ? ? 60.54   -124.59 
7  1 ILE A 296 ? ? -69.69  94.84   
8  1 GLU A 299 ? ? -118.32 -72.72  
9  1 THR A 317 ? ? -166.54 -160.90 
10 1 ASP A 326 ? ? -119.14 61.42   
11 1 TRP A 378 ? ? -68.39  1.98    
12 1 ASP A 380 ? ? -154.67 49.08   
13 1 VAL A 400 ? ? -127.25 -58.93  
14 1 ASN A 457 ? ? 71.99   45.22   
15 1 PRO A 485 ? ? -35.54  -71.93  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A CYS 67  ? SG ? A CYS 67  SG 
2 1 Y 1 A CYS 94  ? SG ? A CYS 94  SG 
3 1 Y 1 A CYS 254 ? SG ? A CYS 254 SG 
4 1 Y 1 A CYS 265 ? SG ? A CYS 265 SG 
5 1 Y 1 A CYS 402 ? SG ? A CYS 402 SG 
6 1 Y 1 A CYS 521 ? SG ? A CYS 521 SG 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 1   ? A ASP 1   
2 1 Y 1 A ASP 2   ? A ASP 2   
3 1 Y 1 A HIS 3   ? A HIS 3   
4 1 Y 1 A ALA 536 ? A ALA 536 
5 1 Y 1 A CYS 537 ? A CYS 537 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#