data_1QII
# 
_entry.id   1QII 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QII         
RCSB  RCSB001189   
WWPDB D_1000001189 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1QID 'EXPERIMENTAL TIME POINT A' unspecified 
PDB 1QIE 'EXPERIMENTAL TIME POINT B' unspecified 
PDB 1QIF 'EXPERIMENTAL TIME POINT C' unspecified 
PDB 1QIG 'EXPERIMENTAL TIME POINT D' unspecified 
PDB 1QIH 'EXPERIMENTAL TIME POINT E' unspecified 
PDB 1QII 'EXPERIMENTAL TIME POINT F' unspecified 
PDB 1QIJ 'EXPERIMENTAL TIME POINT G' unspecified 
PDB 1QIK 'EXPERIMENTAL TIME POINT H' unspecified 
PDB 1QIM 'EXPERIMENTAL TIME POINT I' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QII 
_pdbx_database_status.recvd_initial_deposition_date   1999-06-14 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kryger, G.'      1 
'Weik, M.'        2 
'Ravelli, R.B.G.' 3 
# 
_citation.id                        primary 
_citation.title                     'Specific chemical and structural damage to proteins produced by synchrotron radiation.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            97 
_citation.page_first                623 
_citation.page_last                 628 
_citation.year                      2000 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10639129 
_citation.pdbx_database_id_DOI      10.1073/pnas.97.2.623 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Weik, M.'      1  
primary 'Ravelli, R.B.' 2  
primary 'Kryger, G.'    3  
primary 'McSweeney, S.' 4  
primary 'Raves, M.L.'   5  
primary 'Harel, M.'     6  
primary 'Gros, P.'      7  
primary 'Silman, I.'    8  
primary 'Kroon, J.'     9  
primary 'Sussman, J.L.' 10 
# 
_cell.entry_id           1QII 
_cell.length_a           112.124 
_cell.length_b           112.124 
_cell.length_c           137.994 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QII 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat ACETYLCHOLINESTERASE 60736.516 1   3.1.1.7 ? ? ? 
2 water   nat water                18.015    297 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'Pacific electric ray' 
_entity_src_nat.pdbx_organism_scientific   'Torpedo californica' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      Torpedo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1QII 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 537 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  558 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QII 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.8 
_exptl_crystal.density_percent_sol   68. 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_details    '30% PEG 200, 0.3 M MES, pH 5.8, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   1999-03-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9320 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             0.9320 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QII 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             36.70 
_reflns.d_resolution_high            2.65 
_reflns.number_obs                   29417 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.049 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        49.7 
_reflns.pdbx_redundancy              2.08 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1QII 
_refine.ls_number_reflns_obs                     29353 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           2227180.61 
_refine.ls_d_res_low                             36.70 
_refine.ls_d_res_high                            2.65 
_refine.ls_percent_reflns_obs                    99.0 
_refine.ls_R_factor_obs                          0.1980000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1980000 
_refine.ls_R_factor_R_free                       0.2190000 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  1421 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               46.1 
_refine.aniso_B[1][1]                            5.06 
_refine.aniso_B[2][2]                            5.06 
_refine.aniso_B[3][3]                            -10.11 
_refine.aniso_B[1][2]                            4.13 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.329 
_refine.solvent_model_param_bsol                 39.12 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;BULK SOLVENT MODEL USED. 
ONLY PARTIAL REFINEMENT DONE. 
ALL SIX CYSTEINE RESIDUES TAKING PART IN INTRACHAIN 
DISULFIDE LINKAGES,CYS 67-CYS 94, CYS 402-CYS 521 
AND CYS 254-CYS 265, WERE MODELED AND REFINED 
AS ALANINE RESIDUES.

TCACHE IS A GLYCOPROTEIN OF MR = 65,000, WHICH CONTAINS
THREE INTRACHAIN DISULFIDE BONDS. IN THE COURSE OF
CRYOGENIC DATA COLLECTION ON TRIGONAL CRYSTALS OF TCACHE ON
THE UNDULATOR BEAMLINE, ID14-EH4, AT THE ESRF IN GRENOBLE,
IN PREPARATION FOR TIME-RESOLVED STUDIES, WE COLLECTED A
SERIES OF NINE HIGH-QUALITY COMPLETE DATA SETS ON THE SAME
CRYSTAL. DATA COLLECTION UTILIZED THE UNATTENUATED BEAM,
AND THE DURATION PER DATA SET WAS CA. 19 MIN, FOR 3 H IN
TOTAL, AT 100K. ELECTRON DENSITY MAPS WERE OBTAINED FOR
EACH DATA SET BY ROUTINE REFINEMENT, STARTING FROM THE SAME
MODEL OF NATIVE TCACHE. FOR RESULTS, SEE:
HTTP://SGJS3.WEIZMANN.AC.IL/~KRYGER/RADIATION_DAMAGE
(LOWER CASE!)

THIS ENTRY IS THE 6TH TIME POINT (6 OF 9). SEE HTTP://
SGJS3.WEIZMANN.AC.IL/~KRYGER/RADIATION_DAMAGE (LOWER CASE!)
;
_refine.pdbx_starting_model                      'PDB ENTRY 1VXR' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1QII 
_refine_analyze.Luzzati_coordinate_error_obs    0.30 
_refine_analyze.Luzzati_sigma_a_obs             0.40 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.34 
_refine_analyze.Luzzati_sigma_a_free            0.41 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4238 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             297 
_refine_hist.number_atoms_total               4535 
_refine_hist.d_res_high                       2.65 
_refine_hist.d_res_low                        36.70 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.0  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.85  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             3.32  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            5.14  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             6.92  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            9.92  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.65 
_refine_ls_shell.d_res_low                        2.74 
_refine_ls_shell.number_reflns_R_work             2727 
_refine_ls_shell.R_factor_R_work                  0.2980000 
_refine_ls_shell.percent_reflns_obs               99.0 
_refine_ls_shell.R_factor_R_free                  0.2990000 
_refine_ls_shell.R_factor_R_free_error            0.024 
_refine_ls_shell.percent_reflns_R_free            5.5 
_refine_ls_shell.number_reflns_R_free             158 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP     'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER_REP.PARAM 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1QII 
_struct.title                     
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT F) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QII 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;RADIATION DAMAGE, TIME SERIES, DISULFIDE BOND, SERINE HYDROLASE, ALPHA/BETA HYDROLASE, NEUROTRANSMITTER CLEAVAGE, CATALYTIC TRIAD, GLYCOSYLATED PROTEIN, HYDROLASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 41  ? MET A 43  ? GLY A 41  MET A 43  5 ? 3  
HELX_P HELX_P2  2  SER A 79  ? TRP A 84  ? SER A 79  TRP A 84  1 ? 6  
HELX_P HELX_P3  3  ASP A 128 ? TYR A 130 ? ASP A 128 TYR A 130 5 ? 3  
HELX_P HELX_P4  4  LYS A 133 ? GLU A 139 ? LYS A 133 GLU A 139 1 ? 7  
HELX_P HELX_P5  5  GLY A 151 ? PHE A 155 ? GLY A 151 PHE A 155 1 ? 5  
HELX_P HELX_P6  6  VAL A 168 ? PHE A 187 ? VAL A 168 PHE A 187 1 ? 20 
HELX_P HELX_P7  7  ALA A 201 ? LEU A 211 ? ALA A 201 LEU A 211 1 ? 11 
HELX_P HELX_P8  8  PRO A 213 ? LEU A 218 ? PRO A 213 LEU A 218 1 ? 6  
HELX_P HELX_P9  9  VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P10 10 ASP A 259 ? GLU A 268 ? ASP A 259 GLU A 268 1 ? 10 
HELX_P HELX_P11 11 PRO A 271 ? VAL A 281 ? PRO A 271 VAL A 281 1 ? 11 
HELX_P HELX_P12 12 LEU A 305 ? SER A 311 ? LEU A 305 SER A 311 1 ? 7  
HELX_P HELX_P13 13 SER A 329 ? GLY A 335 ? SER A 329 GLY A 335 1 ? 7  
HELX_P HELX_P14 14 ARG A 349 ? SER A 359 ? ARG A 349 SER A 359 1 ? 11 
HELX_P HELX_P15 15 ASP A 365 ? GLN A 374 ? ASP A 365 GLN A 374 1 ? 10 
HELX_P HELX_P16 16 GLY A 384 ? ASN A 399 ? GLY A 384 ASN A 399 1 ? 16 
HELX_P HELX_P17 17 ILE A 401 ? PHE A 414 ? ILE A 401 PHE A 414 1 ? 14 
HELX_P HELX_P18 18 GLU A 434 ? MET A 436 ? GLU A 434 MET A 436 5 ? 3  
HELX_P HELX_P19 19 ILE A 444 ? VAL A 447 ? ILE A 444 VAL A 447 1 ? 4  
HELX_P HELX_P20 20 LEU A 450 ? LEU A 452 ? LEU A 450 LEU A 452 5 ? 3  
HELX_P HELX_P21 21 LYS A 454 ? LEU A 456 ? LYS A 454 LEU A 456 5 ? 3  
HELX_P HELX_P22 22 ALA A 460 ? THR A 479 ? ALA A 460 THR A 479 1 ? 20 
HELX_P HELX_P23 23 VAL A 518 ? ASN A 525 ? VAL A 518 ASN A 525 1 ? 8  
HELX_P HELX_P24 24 PHE A 527 ? ASN A 533 ? PHE A 527 ASN A 533 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.06 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 6   ? THR A 10  ? LEU A 6   THR A 10  
A 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
A 3  VAL A 57  ? ALA A 60  ? VAL A 57  ALA A 60  
B 1  MET A 16  ? PRO A 21  ? MET A 16  PRO A 21  
B 2  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
B 3  TYR A 96  ? PRO A 102 ? TYR A 96  PRO A 102 
B 4  VAL A 142 ? SER A 147 ? VAL A 142 SER A 147 
B 5  THR A 109 ? TYR A 116 ? THR A 109 TYR A 116 
B 6  THR A 193 ? GLU A 199 ? THR A 193 GLU A 199 
B 7  ARG A 220 ? SER A 226 ? ARG A 220 SER A 226 
B 8  GLN A 318 ? ASN A 324 ? GLN A 318 ASN A 324 
B 9  GLY A 417 ? PHE A 423 ? GLY A 417 PHE A 423 
B 10 PHE A 502 ? LEU A 505 ? PHE A 502 LEU A 505 
B 11 MET A 510 ? GLN A 514 ? MET A 510 GLN A 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O VAL A 8   ? O VAL A 8   N VAL A 15  ? N VAL A 15  
A 2  3  O LYS A 14  ? O LYS A 14  N TRP A 58  ? N TRP A 58  
B 1  2  N THR A 18  ? N THR A 18  O ALA A 29  ? O ALA A 29  
B 2  3  O PHE A 30  ? O PHE A 30  N ILE A 99  ? N ILE A 99  
B 3  4  O TRP A 100 ? O TRP A 100 N LEU A 143 ? N LEU A 143 
B 4  5  O VAL A 142 ? O VAL A 142 N MET A 112 ? N MET A 112 
B 5  6  N VAL A 113 ? N VAL A 113 O THR A 195 ? O THR A 195 
B 6  7  O ILE A 196 ? O ILE A 196 N ILE A 223 ? N ILE A 223 
B 7  8  O LEU A 224 ? O LEU A 224 N GLY A 322 ? N GLY A 322 
B 8  9  O LEU A 321 ? O LEU A 321 N TYR A 421 ? N TYR A 421 
B 9  10 O LEU A 420 ? O LEU A 420 N ILE A 503 ? N ILE A 503 
B 10 11 O PHE A 502 ? O PHE A 502 N HIS A 513 ? N HIS A 513 
# 
_struct_site.id                   CAT 
_struct_site.pdbx_evidence_code   Author 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    3 
_struct_site.details              'CATALYTIC TRIAD' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 CAT 3 SER A 200 ? SER A 200 . ? 1_555 ? 
2 CAT 3 GLU A 327 ? GLU A 327 . ? 1_555 ? 
3 CAT 3 HIS A 440 ? HIS A 440 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QII 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QII 
_atom_sites.fract_transf_matrix[1][1]   0.008919 
_atom_sites.fract_transf_matrix[1][2]   0.005149 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010298 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007247 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -13.281 87.790 34.664 1.00 55.12  ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -12.657 88.210 35.957 1.00 55.12  ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -11.507 87.302 36.402 1.00 55.12  ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -11.554 86.081 36.237 1.00 55.12  ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -13.711 88.256 37.068 1.00 54.87  ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -13.094 88.485 38.330 1.00 54.87  ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -10.484 87.912 36.990 1.00 54.39  ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -9.312  87.188 37.465 1.00 54.39  ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.616  86.234 38.630 1.00 54.39  ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.911  85.241 38.831 1.00 54.39  ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -8.234  88.186 37.895 1.00 66.18  ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.919  87.542 38.275 1.00 66.18  ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.831  88.560 38.561 1.00 66.18  ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -5.977  89.351 39.522 1.00 66.18  ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -4.824  88.566 37.820 1.00 66.18  ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.653 86.531 39.404 1.00 47.32  ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -10.982 85.679 40.526 1.00 47.32  ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -11.976 84.592 40.140 1.00 47.32  ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.351 83.770 40.973 1.00 47.32  ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.537 86.518 41.672 1.00 43.41  ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.600 87.618 42.171 1.00 43.41  ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -11.240 88.343 43.342 1.00 43.41  ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -9.266  87.008 42.581 1.00 43.41  ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.401 84.577 38.883 1.00 41.52  ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -13.354 83.571 38.430 1.00 41.52  ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.650 82.542 37.558 1.00 41.52  ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -11.944 82.891 36.616 1.00 41.52  ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.487 84.228 37.643 1.00 58.21  ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.590 83.275 37.174 1.00 58.21  ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -16.205 82.598 38.379 1.00 58.21  ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.664 84.032 36.408 1.00 58.21  ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.833 81.267 37.880 1.00 40.75  ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -12.196 80.210 37.111 1.00 40.75  ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -13.181 79.096 36.807 1.00 40.75  ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.990 78.698 37.652 1.00 40.75  ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -10.980 79.623 37.853 1.00 38.78  ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -10.389 78.475 37.057 1.00 38.78  ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -9.927  80.695 38.044 1.00 38.78  ? 8    VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -13.110 78.592 35.584 1.00 45.50  ? 9    ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -14.009 77.539 35.176 1.00 45.50  ? 9    ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -13.265 76.226 35.027 1.00 45.50  ? 9    ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -12.536 76.014 34.063 1.00 45.50  ? 9    ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -14.694 77.926 33.874 1.00 68.45  ? 9    ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -15.649 76.868 33.400 1.00 68.45  ? 9    ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -16.440 76.317 34.188 1.00 68.45  ? 9    ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -15.592 76.562 32.102 1.00 68.45  ? 9    ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -13.456 75.340 35.992 1.00 51.85  ? 10   THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -12.783 74.055 35.972 1.00 51.85  ? 10   THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -13.699 73.004 35.394 1.00 51.85  ? 10   THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -14.864 73.274 35.123 1.00 51.85  ? 10   THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -12.401 73.601 37.381 1.00 38.06  ? 10   THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -13.581 73.174 38.068 1.00 38.06  ? 10   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -11.751 74.748 38.150 1.00 38.06  ? 10   THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -13.162 71.799 35.233 1.00 41.56  ? 11   LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -13.920 70.683 34.701 1.00 41.56  ? 11   LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -14.974 70.190 35.697 1.00 41.56  ? 11   LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -15.773 69.316 35.372 1.00 41.56  ? 11   LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -12.967 69.541 34.330 1.00 37.21  ? 11   LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -11.923 69.921 33.280 1.00 37.21  ? 11   LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -10.967 68.784 33.008 1.00 37.21  ? 11   LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -9.931  69.182 31.966 1.00 37.21  ? 11   LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -8.862  68.160 31.774 1.00 37.21  ? 11   LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -14.979 70.744 36.906 1.00 47.96  ? 12   SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -15.957 70.349 37.917 1.00 47.96  ? 12   SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -17.001 71.441 38.120 1.00 47.96  ? 12   SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -18.034 71.217 38.771 1.00 47.96  ? 12   SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -15.268 70.053 39.253 1.00 53.49  ? 12   SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -14.623 68.791 39.233 1.00 53.49  ? 12   SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -16.735 72.620 37.560 1.00 42.06  ? 13   GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -17.662 73.730 37.698 1.00 42.06  ? 13   GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -16.913 75.034 37.872 1.00 42.06  ? 13   GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -15.680 75.026 37.881 1.00 42.06  ? 13   GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -17.637 76.147 38.005 1.00 38.19  ? 14   LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -16.995 77.449 38.180 1.00 38.19  ? 14   LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -16.604 77.685 39.633 1.00 38.19  ? 14   LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -17.273 77.216 40.560 1.00 38.19  ? 14   LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -17.908 78.585 37.728 1.00 55.31  ? 14   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -18.262 78.577 36.255 1.00 55.31  ? 14   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -18.451 80.003 35.762 1.00 55.31  ? 14   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -19.075 80.056 34.377 1.00 55.31  ? 14   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -20.528 79.689 34.393 1.00 55.31  ? 14   LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -15.527 78.436 39.824 1.00 40.40  ? 15   VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -15.022 78.723 41.153 1.00 40.40  ? 15   VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -14.740 80.211 41.326 1.00 40.40  ? 15   VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -14.142 80.835 40.455 1.00 40.40  ? 15   VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -13.730 77.905 41.406 1.00 35.96  ? 15   VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -13.001 78.425 42.618 1.00 35.96  ? 15   VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -14.084 76.436 41.614 1.00 35.96  ? 15   VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -15.181 80.780 42.442 1.00 38.02  ? 16   MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -14.954 82.199 42.714 1.00 38.02  ? 16   MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -13.956 82.407 43.848 1.00 38.02  ? 16   MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -14.254 82.155 45.020 1.00 38.02  ? 16   MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -16.261 82.911 43.074 1.00 71.86  ? 16   MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -16.088 84.397 43.433 1.00 71.86  ? 16   MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -16.309 85.579 42.045 1.00 71.86  ? 16   MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -14.630 85.765 41.451 1.00 71.86  ? 16   MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -12.774 82.883 43.487 1.00 42.14  ? 17   GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -11.753 83.122 44.479 1.00 42.14  ? 17   GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -11.852 84.505 45.082 1.00 42.14  ? 17   GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -12.840 85.213 44.900 1.00 42.14  ? 17   GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -10.801 84.885 45.796 1.00 42.14  ? 18   THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -10.718 86.174 46.456 1.00 42.14  ? 18   THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -9.304  86.738 46.400 1.00 42.14  ? 18   THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -8.329  85.990 46.456 1.00 42.14  ? 18   THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -11.104 86.052 47.925 1.00 53.26  ? 18   THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -10.610 87.194 48.630 1.00 53.26  ? 18   THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -10.502 84.802 48.534 1.00 53.26  ? 18   THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -9.194  88.059 46.296 1.00 44.55  ? 19   ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -7.893  88.718 46.251 1.00 44.55  ? 19   ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -7.355  88.869 47.680 1.00 44.55  ? 19   ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -8.101  89.206 48.604 1.00 44.55  ? 19   ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -8.025  90.073 45.552 1.00 63.85  ? 19   ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -6.955  91.084 45.912 1.00 63.85  ? 19   ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -6.849  92.220 44.876 1.00 63.85  ? 19   ARG A CD  1 
ATOM   115  N NE  . ARG A 1 19  ? -6.044  91.813 43.723 1.00 63.85  ? 19   ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 19  ? -5.110  92.567 43.140 1.00 63.85  ? 19   ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 19  ? -4.852  93.791 43.590 1.00 63.85  ? 19   ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 19  ? -4.413  92.086 42.115 1.00 63.85  ? 19   ARG A NH2 1 
ATOM   119  N N   . VAL A 1 20  ? -6.070  88.583 47.875 1.00 44.03  ? 20   VAL A N   1 
ATOM   120  C CA  . VAL A 1 20  ? -5.493  88.699 49.210 1.00 44.03  ? 20   VAL A CA  1 
ATOM   121  C C   . VAL A 1 20  ? -4.196  89.489 49.220 1.00 44.03  ? 20   VAL A C   1 
ATOM   122  O O   . VAL A 1 20  ? -3.391  89.402 48.296 1.00 44.03  ? 20   VAL A O   1 
ATOM   123  C CB  . VAL A 1 20  ? -5.211  87.308 49.846 1.00 52.43  ? 20   VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 20  ? -6.496  86.511 49.961 1.00 52.43  ? 20   VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 20  ? -4.204  86.553 49.010 1.00 52.43  ? 20   VAL A CG2 1 
ATOM   126  N N   . PRO A 1 21  ? -3.979  90.275 50.278 1.00 41.40  ? 21   PRO A N   1 
ATOM   127  C CA  . PRO A 1 21  ? -2.760  91.074 50.384 1.00 41.40  ? 21   PRO A CA  1 
ATOM   128  C C   . PRO A 1 21  ? -1.579  90.229 50.862 1.00 41.40  ? 21   PRO A C   1 
ATOM   129  O O   . PRO A 1 21  ? -1.731  89.367 51.733 1.00 41.40  ? 21   PRO A O   1 
ATOM   130  C CB  . PRO A 1 21  ? -3.152  92.150 51.387 1.00 34.41  ? 21   PRO A CB  1 
ATOM   131  C CG  . PRO A 1 21  ? -4.053  91.408 52.317 1.00 34.41  ? 21   PRO A CG  1 
ATOM   132  C CD  . PRO A 1 21  ? -4.914  90.585 51.377 1.00 34.41  ? 21   PRO A CD  1 
ATOM   133  N N   . VAL A 1 22  ? -0.409  90.482 50.277 1.00 39.45  ? 22   VAL A N   1 
ATOM   134  C CA  . VAL A 1 22  ? 0.810   89.777 50.631 1.00 39.45  ? 22   VAL A CA  1 
ATOM   135  C C   . VAL A 1 22  ? 2.003   90.693 50.379 1.00 39.45  ? 22   VAL A C   1 
ATOM   136  O O   . VAL A 1 22  ? 2.122   91.262 49.296 1.00 39.45  ? 22   VAL A O   1 
ATOM   137  C CB  . VAL A 1 22  ? 0.966   88.470 49.800 1.00 37.90  ? 22   VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 22  ? 0.918   88.777 48.314 1.00 37.90  ? 22   VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 22  ? 2.272   87.782 50.155 1.00 37.90  ? 22   VAL A CG2 1 
ATOM   140  N N   . LEU A 1 23  ? 2.879   90.827 51.380 1.00 55.23  ? 23   LEU A N   1 
ATOM   141  C CA  . LEU A 1 23  ? 4.078   91.682 51.294 1.00 55.23  ? 23   LEU A CA  1 
ATOM   142  C C   . LEU A 1 23  ? 3.817   93.004 50.550 1.00 55.23  ? 23   LEU A C   1 
ATOM   143  O O   . LEU A 1 23  ? 4.560   93.388 49.625 1.00 55.23  ? 23   LEU A O   1 
ATOM   144  C CB  . LEU A 1 23  ? 5.233   90.923 50.620 1.00 46.64  ? 23   LEU A CB  1 
ATOM   145  C CG  . LEU A 1 23  ? 5.794   89.707 51.374 1.00 46.64  ? 23   LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 23  ? 7.043   89.197 50.669 1.00 46.64  ? 23   LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 23  ? 6.135   90.102 52.810 1.00 46.64  ? 23   LEU A CD2 1 
ATOM   148  N N   . SER A 1 24  ? 2.755   93.689 50.983 1.00 68.36  ? 24   SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? 2.298   94.959 50.406 1.00 68.36  ? 24   SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? 2.104   94.833 48.882 1.00 68.36  ? 24   SER A C   1 
ATOM   151  O O   . SER A 1 24  ? 2.712   95.552 48.088 1.00 68.36  ? 24   SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? 3.276   96.097 50.753 1.00 67.31  ? 24   SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? 4.547   95.898 50.156 1.00 67.31  ? 24   SER A OG  1 
ATOM   154  N N   . SER A 1 25  ? 1.252   93.884 48.502 1.00 47.73  ? 25   SER A N   1 
ATOM   155  C CA  . SER A 1 25  ? 0.905   93.603 47.115 1.00 47.73  ? 25   SER A CA  1 
ATOM   156  C C   . SER A 1 25  ? -0.293  92.662 47.170 1.00 47.73  ? 25   SER A C   1 
ATOM   157  O O   . SER A 1 25  ? -0.938  92.543 48.215 1.00 47.73  ? 25   SER A O   1 
ATOM   158  C CB  . SER A 1 25  ? 2.065   92.933 46.390 1.00 52.37  ? 25   SER A CB  1 
ATOM   159  O OG  . SER A 1 25  ? 1.734   92.718 45.025 1.00 52.37  ? 25   SER A OG  1 
ATOM   160  N N   . HIS A 1 26  ? -0.608  91.992 46.071 1.00 50.65  ? 26   HIS A N   1 
ATOM   161  C CA  . HIS A 1 26  ? -1.756  91.092 46.094 1.00 50.65  ? 26   HIS A CA  1 
ATOM   162  C C   . HIS A 1 26  ? -1.620  89.882 45.183 1.00 50.65  ? 26   HIS A C   1 
ATOM   163  O O   . HIS A 1 26  ? -0.837  89.895 44.233 1.00 50.65  ? 26   HIS A O   1 
ATOM   164  C CB  . HIS A 1 26  ? -3.047  91.845 45.718 1.00 72.73  ? 26   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 26  ? -3.441  92.909 46.698 1.00 72.73  ? 26   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 26  ? -3.076  94.232 46.551 1.00 72.73  ? 26   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 26  ? -4.156  92.843 47.850 1.00 72.73  ? 26   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 26  ? -3.549  94.934 47.568 1.00 72.73  ? 26   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 26  ? -4.210  94.116 48.371 1.00 72.73  ? 26   HIS A NE2 1 
ATOM   170  N N   . ILE A 1 27  ? -2.381  88.836 45.496 1.00 40.60  ? 27   ILE A N   1 
ATOM   171  C CA  . ILE A 1 27  ? -2.411  87.617 44.701 1.00 40.60  ? 27   ILE A CA  1 
ATOM   172  C C   . ILE A 1 27  ? -3.815  87.049 44.846 1.00 40.60  ? 27   ILE A C   1 
ATOM   173  O O   . ILE A 1 27  ? -4.598  87.531 45.669 1.00 40.60  ? 27   ILE A O   1 
ATOM   174  C CB  . ILE A 1 27  ? -1.346  86.568 45.160 1.00 44.64  ? 27   ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 27  ? -1.576  86.166 46.605 1.00 44.64  ? 27   ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 27  ? 0.050   87.130 45.005 1.00 44.64  ? 27   ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 27  ? -2.451  84.961 46.750 1.00 44.64  ? 27   ILE A CD1 1 
ATOM   178  N N   . SER A 1 28  ? -4.146  86.048 44.036 1.00 37.39  ? 28   SER A N   1 
ATOM   179  C CA  . SER A 1 28  ? -5.465  85.436 44.094 1.00 37.39  ? 28   SER A CA  1 
ATOM   180  C C   . SER A 1 28  ? -5.395  84.200 44.966 1.00 37.39  ? 28   SER A C   1 
ATOM   181  O O   . SER A 1 28  ? -4.359  83.554 45.060 1.00 37.39  ? 28   SER A O   1 
ATOM   182  C CB  . SER A 1 28  ? -5.935  85.030 42.701 1.00 40.60  ? 28   SER A CB  1 
ATOM   183  O OG  . SER A 1 28  ? -5.879  86.117 41.804 1.00 40.60  ? 28   SER A OG  1 
ATOM   184  N N   . ALA A 1 29  ? -6.508  83.878 45.603 1.00 39.43  ? 29   ALA A N   1 
ATOM   185  C CA  . ALA A 1 29  ? -6.582  82.714 46.457 1.00 39.43  ? 29   ALA A CA  1 
ATOM   186  C C   . ALA A 1 29  ? -7.921  82.052 46.232 1.00 39.43  ? 29   ALA A C   1 
ATOM   187  O O   . ALA A 1 29  ? -8.957  82.718 46.249 1.00 39.43  ? 29   ALA A O   1 
ATOM   188  C CB  . ALA A 1 29  ? -6.445  83.118 47.915 1.00 30.29  ? 29   ALA A CB  1 
ATOM   189  N N   . PHE A 1 30  ? -7.894  80.746 45.989 1.00 41.40  ? 30   PHE A N   1 
ATOM   190  C CA  . PHE A 1 30  ? -9.113  79.969 45.799 1.00 41.40  ? 30   PHE A CA  1 
ATOM   191  C C   . PHE A 1 30  ? -9.075  78.975 46.933 1.00 41.40  ? 30   PHE A C   1 
ATOM   192  O O   . PHE A 1 30  ? -8.383  77.973 46.855 1.00 41.40  ? 30   PHE A O   1 
ATOM   193  C CB  . PHE A 1 30  ? -9.102  79.243 44.450 1.00 34.99  ? 30   PHE A CB  1 
ATOM   194  C CG  . PHE A 1 30  ? -9.086  80.168 43.269 1.00 34.99  ? 30   PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 30  ? -7.912  80.791 42.877 1.00 34.99  ? 30   PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 30  ? -10.257 80.443 42.573 1.00 34.99  ? 30   PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 30  ? -7.899  81.672 41.813 1.00 34.99  ? 30   PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 30  ? -10.259 81.324 41.505 1.00 34.99  ? 30   PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 30  ? -9.076  81.940 41.124 1.00 34.99  ? 30   PHE A CZ  1 
ATOM   200  N N   . LEU A 1 31  ? -9.811  79.265 47.996 1.00 40.96  ? 31   LEU A N   1 
ATOM   201  C CA  . LEU A 1 31  ? -9.818  78.410 49.170 1.00 40.96  ? 31   LEU A CA  1 
ATOM   202  C C   . LEU A 1 31  ? -11.022 77.481 49.278 1.00 40.96  ? 31   LEU A C   1 
ATOM   203  O O   . LEU A 1 31  ? -12.148 77.847 48.947 1.00 40.96  ? 31   LEU A O   1 
ATOM   204  C CB  . LEU A 1 31  ? -9.726  79.287 50.417 1.00 31.14  ? 31   LEU A CB  1 
ATOM   205  C CG  . LEU A 1 31  ? -8.611  80.335 50.351 1.00 31.14  ? 31   LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 31  ? -8.622  81.193 51.604 1.00 31.14  ? 31   LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 31  ? -7.273  79.644 50.195 1.00 31.14  ? 31   LEU A CD2 1 
ATOM   208  N N   . GLY A 1 32  ? -10.762 76.266 49.743 1.00 42.78  ? 32   GLY A N   1 
ATOM   209  C CA  . GLY A 1 32  ? -11.814 75.284 49.927 1.00 42.78  ? 32   GLY A CA  1 
ATOM   210  C C   . GLY A 1 32  ? -12.481 74.707 48.692 1.00 42.78  ? 32   GLY A C   1 
ATOM   211  O O   . GLY A 1 32  ? -13.694 74.534 48.693 1.00 42.78  ? 32   GLY A O   1 
ATOM   212  N N   . ILE A 1 33  ? -11.718 74.411 47.641 1.00 42.79  ? 33   ILE A N   1 
ATOM   213  C CA  . ILE A 1 33  ? -12.308 73.826 46.442 1.00 42.79  ? 33   ILE A CA  1 
ATOM   214  C C   . ILE A 1 33  ? -12.427 72.328 46.727 1.00 42.79  ? 33   ILE A C   1 
ATOM   215  O O   . ILE A 1 33  ? -11.447 71.694 47.124 1.00 42.79  ? 33   ILE A O   1 
ATOM   216  C CB  . ILE A 1 33  ? -11.414 74.019 45.212 1.00 38.70  ? 33   ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 33  ? -11.069 75.496 45.032 1.00 38.70  ? 33   ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 33  ? -12.129 73.484 43.985 1.00 38.70  ? 33   ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 33  ? -10.168 75.775 43.847 1.00 38.70  ? 33   ILE A CD1 1 
ATOM   220  N N   . PRO A 1 34  ? -13.623 71.741 46.541 1.00 42.61  ? 34   PRO A N   1 
ATOM   221  C CA  . PRO A 1 34  ? -13.782 70.309 46.811 1.00 42.61  ? 34   PRO A CA  1 
ATOM   222  C C   . PRO A 1 34  ? -13.239 69.397 45.709 1.00 42.61  ? 34   PRO A C   1 
ATOM   223  O O   . PRO A 1 34  ? -13.348 69.723 44.528 1.00 42.61  ? 34   PRO A O   1 
ATOM   224  C CB  . PRO A 1 34  ? -15.291 70.173 47.003 1.00 39.89  ? 34   PRO A CB  1 
ATOM   225  C CG  . PRO A 1 34  ? -15.832 71.170 46.035 1.00 39.89  ? 34   PRO A CG  1 
ATOM   226  C CD  . PRO A 1 34  ? -14.922 72.366 46.228 1.00 39.89  ? 34   PRO A CD  1 
ATOM   227  N N   . PHE A 1 35  ? -12.650 68.259 46.090 1.00 37.89  ? 35   PHE A N   1 
ATOM   228  C CA  . PHE A 1 35  ? -12.114 67.314 45.102 1.00 37.89  ? 35   PHE A CA  1 
ATOM   229  C C   . PHE A 1 35  ? -12.664 65.895 45.268 1.00 37.89  ? 35   PHE A C   1 
ATOM   230  O O   . PHE A 1 35  ? -12.319 64.993 44.512 1.00 37.89  ? 35   PHE A O   1 
ATOM   231  C CB  . PHE A 1 35  ? -10.572 67.295 45.139 1.00 36.40  ? 35   PHE A CB  1 
ATOM   232  C CG  . PHE A 1 35  ? -9.984  66.830 46.453 1.00 36.40  ? 35   PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 35  ? -10.027 65.490 46.820 1.00 36.40  ? 35   PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 35  ? -9.375  67.734 47.314 1.00 36.40  ? 35   PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 35  ? -9.474  65.060 48.020 1.00 36.40  ? 35   PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 35  ? -8.818  67.309 48.520 1.00 36.40  ? 35   PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 35  ? -8.869  65.973 48.873 1.00 36.40  ? 35   PHE A CZ  1 
ATOM   238  N N   . ALA A 1 36  ? -13.529 65.708 46.256 1.00 36.80  ? 36   ALA A N   1 
ATOM   239  C CA  . ALA A 1 36  ? -14.129 64.407 46.517 1.00 36.80  ? 36   ALA A CA  1 
ATOM   240  C C   . ALA A 1 36  ? -15.463 64.603 47.218 1.00 36.80  ? 36   ALA A C   1 
ATOM   241  O O   . ALA A 1 36  ? -15.709 65.653 47.816 1.00 36.80  ? 36   ALA A O   1 
ATOM   242  C CB  . ALA A 1 36  ? -13.211 63.581 47.396 1.00 34.99  ? 36   ALA A CB  1 
ATOM   243  N N   . GLU A 1 37  ? -16.329 63.599 47.144 1.00 47.31  ? 37   GLU A N   1 
ATOM   244  C CA  . GLU A 1 37  ? -17.625 63.675 47.814 1.00 47.31  ? 37   GLU A CA  1 
ATOM   245  C C   . GLU A 1 37  ? -17.386 63.577 49.321 1.00 47.31  ? 37   GLU A C   1 
ATOM   246  O O   . GLU A 1 37  ? -16.454 62.905 49.762 1.00 47.31  ? 37   GLU A O   1 
ATOM   247  C CB  . GLU A 1 37  ? -18.529 62.526 47.351 1.00 67.15  ? 37   GLU A CB  1 
ATOM   248  C CG  . GLU A 1 37  ? -19.049 62.683 45.921 1.00 67.15  ? 37   GLU A CG  1 
ATOM   249  C CD  . GLU A 1 37  ? -20.101 63.793 45.799 1.00 67.15  ? 37   GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 37  ? -21.192 63.631 46.392 1.00 67.15  ? 37   GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 37  ? -19.839 64.824 45.121 1.00 67.15  ? 37   GLU A OE2 1 
ATOM   252  N N   . PRO A 1 38  ? -18.205 64.269 50.129 1.00 50.26  ? 38   PRO A N   1 
ATOM   253  C CA  . PRO A 1 38  ? -18.027 64.210 51.583 1.00 50.26  ? 38   PRO A CA  1 
ATOM   254  C C   . PRO A 1 38  ? -18.088 62.763 52.063 1.00 50.26  ? 38   PRO A C   1 
ATOM   255  O O   . PRO A 1 38  ? -19.110 62.099 51.916 1.00 50.26  ? 38   PRO A O   1 
ATOM   256  C CB  . PRO A 1 38  ? -19.188 65.052 52.099 1.00 40.39  ? 38   PRO A CB  1 
ATOM   257  C CG  . PRO A 1 38  ? -19.303 66.096 51.053 1.00 40.39  ? 38   PRO A CG  1 
ATOM   258  C CD  . PRO A 1 38  ? -19.205 65.290 49.771 1.00 40.39  ? 38   PRO A CD  1 
ATOM   259  N N   . PRO A 1 39  ? -16.983 62.253 52.634 1.00 51.33  ? 39   PRO A N   1 
ATOM   260  C CA  . PRO A 1 39  ? -16.897 60.878 53.135 1.00 51.33  ? 39   PRO A CA  1 
ATOM   261  C C   . PRO A 1 39  ? -17.644 60.653 54.435 1.00 51.33  ? 39   PRO A C   1 
ATOM   262  O O   . PRO A 1 39  ? -17.072 60.150 55.402 1.00 51.33  ? 39   PRO A O   1 
ATOM   263  C CB  . PRO A 1 39  ? -15.397 60.680 53.305 1.00 44.33  ? 39   PRO A CB  1 
ATOM   264  C CG  . PRO A 1 39  ? -14.959 62.024 53.753 1.00 44.33  ? 39   PRO A CG  1 
ATOM   265  C CD  . PRO A 1 39  ? -15.681 62.928 52.779 1.00 44.33  ? 39   PRO A CD  1 
ATOM   266  N N   . VAL A 1 40  ? -18.917 61.015 54.464 1.00 55.22  ? 40   VAL A N   1 
ATOM   267  C CA  . VAL A 1 40  ? -19.700 60.843 55.680 1.00 55.22  ? 40   VAL A CA  1 
ATOM   268  C C   . VAL A 1 40  ? -20.589 59.612 55.656 1.00 55.22  ? 40   VAL A C   1 
ATOM   269  O O   . VAL A 1 40  ? -20.615 58.857 54.681 1.00 55.22  ? 40   VAL A O   1 
ATOM   270  C CB  . VAL A 1 40  ? -20.574 62.071 55.939 1.00 47.36  ? 40   VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 40  ? -19.700 63.252 56.315 1.00 47.36  ? 40   VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 40  ? -21.368 62.401 54.687 1.00 47.36  ? 40   VAL A CG2 1 
ATOM   273  N N   . GLY A 1 41  ? -21.314 59.415 56.749 1.00 59.92  ? 41   GLY A N   1 
ATOM   274  C CA  . GLY A 1 41  ? -22.211 58.279 56.865 1.00 59.92  ? 41   GLY A CA  1 
ATOM   275  C C   . GLY A 1 41  ? -21.605 56.956 56.438 1.00 59.92  ? 41   GLY A C   1 
ATOM   276  O O   . GLY A 1 41  ? -20.534 56.560 56.919 1.00 59.92  ? 41   GLY A O   1 
ATOM   277  N N   . ASN A 1 42  ? -22.303 56.276 55.529 1.00 50.14  ? 42   ASN A N   1 
ATOM   278  C CA  . ASN A 1 42  ? -21.877 54.987 55.010 1.00 50.14  ? 42   ASN A CA  1 
ATOM   279  C C   . ASN A 1 42  ? -20.561 55.042 54.268 1.00 50.14  ? 42   ASN A C   1 
ATOM   280  O O   . ASN A 1 42  ? -19.947 54.004 54.014 1.00 50.14  ? 42   ASN A O   1 
ATOM   281  C CB  . ASN A 1 42  ? -22.958 54.413 54.097 1.00 94.75  ? 42   ASN A CB  1 
ATOM   282  C CG  . ASN A 1 42  ? -23.740 53.305 54.772 1.00 94.75  ? 42   ASN A CG  1 
ATOM   283  O OD1 . ASN A 1 42  ? -24.114 53.422 55.956 1.00 94.75  ? 42   ASN A OD1 1 
ATOM   284  N ND2 . ASN A 1 42  ? -23.994 52.214 54.033 1.00 94.75  ? 42   ASN A ND2 1 
ATOM   285  N N   . MET A 1 43  ? -20.126 56.245 53.918 1.00 48.54  ? 43   MET A N   1 
ATOM   286  C CA  . MET A 1 43  ? -18.865 56.381 53.210 1.00 48.54  ? 43   MET A CA  1 
ATOM   287  C C   . MET A 1 43  ? -17.624 56.368 54.122 1.00 48.54  ? 43   MET A C   1 
ATOM   288  O O   . MET A 1 43  ? -16.502 56.244 53.635 1.00 48.54  ? 43   MET A O   1 
ATOM   289  C CB  . MET A 1 43  ? -18.878 57.643 52.339 1.00 68.56  ? 43   MET A CB  1 
ATOM   290  C CG  . MET A 1 43  ? -19.648 57.480 51.039 1.00 68.56  ? 43   MET A CG  1 
ATOM   291  S SD  . MET A 1 43  ? -19.375 58.878 49.887 1.00 68.56  ? 43   MET A SD  1 
ATOM   292  C CE  . MET A 1 43  ? -17.638 58.500 49.283 1.00 68.56  ? 43   MET A CE  1 
ATOM   293  N N   . ARG A 1 44  ? -17.820 56.472 55.434 1.00 39.19  ? 44   ARG A N   1 
ATOM   294  C CA  . ARG A 1 44  ? -16.693 56.458 56.373 1.00 39.19  ? 44   ARG A CA  1 
ATOM   295  C C   . ARG A 1 44  ? -15.838 55.195 56.198 1.00 39.19  ? 44   ARG A C   1 
ATOM   296  O O   . ARG A 1 44  ? -16.362 54.094 56.048 1.00 39.19  ? 44   ARG A O   1 
ATOM   297  C CB  . ARG A 1 44  ? -17.202 56.554 57.822 1.00 28.41  ? 44   ARG A CB  1 
ATOM   298  C CG  . ARG A 1 44  ? -16.095 56.629 58.858 1.00 28.41  ? 44   ARG A CG  1 
ATOM   299  C CD  . ARG A 1 44  ? -16.608 56.577 60.284 1.00 28.41  ? 44   ARG A CD  1 
ATOM   300  N NE  . ARG A 1 44  ? -17.252 57.813 60.704 1.00 28.41  ? 44   ARG A NE  1 
ATOM   301  C CZ  . ARG A 1 44  ? -17.899 57.956 61.856 1.00 28.41  ? 44   ARG A CZ  1 
ATOM   302  N NH1 . ARG A 1 44  ? -17.993 56.940 62.702 1.00 28.41  ? 44   ARG A NH1 1 
ATOM   303  N NH2 . ARG A 1 44  ? -18.456 59.113 62.166 1.00 28.41  ? 44   ARG A NH2 1 
ATOM   304  N N   . PHE A 1 45  ? -14.521 55.372 56.209 1.00 41.08  ? 45   PHE A N   1 
ATOM   305  C CA  . PHE A 1 45  ? -13.545 54.284 56.046 1.00 41.08  ? 45   PHE A CA  1 
ATOM   306  C C   . PHE A 1 45  ? -13.435 53.807 54.611 1.00 41.08  ? 45   PHE A C   1 
ATOM   307  O O   . PHE A 1 45  ? -12.488 53.113 54.252 1.00 41.08  ? 45   PHE A O   1 
ATOM   308  C CB  . PHE A 1 45  ? -13.881 53.084 56.934 1.00 43.75  ? 45   PHE A CB  1 
ATOM   309  C CG  . PHE A 1 45  ? -13.994 53.415 58.399 1.00 43.75  ? 45   PHE A CG  1 
ATOM   310  C CD1 . PHE A 1 45  ? -13.030 54.199 59.028 1.00 43.75  ? 45   PHE A CD1 1 
ATOM   311  C CD2 . PHE A 1 45  ? -15.062 52.926 59.154 1.00 43.75  ? 45   PHE A CD2 1 
ATOM   312  C CE1 . PHE A 1 45  ? -13.123 54.494 60.393 1.00 43.75  ? 45   PHE A CE1 1 
ATOM   313  C CE2 . PHE A 1 45  ? -15.167 53.214 60.519 1.00 43.75  ? 45   PHE A CE2 1 
ATOM   314  C CZ  . PHE A 1 45  ? -14.192 54.003 61.140 1.00 43.75  ? 45   PHE A CZ  1 
ATOM   315  N N   . ARG A 1 46  ? -14.404 54.193 53.791 1.00 50.57  ? 46   ARG A N   1 
ATOM   316  C CA  . ARG A 1 46  ? -14.445 53.791 52.386 1.00 50.57  ? 46   ARG A CA  1 
ATOM   317  C C   . ARG A 1 46  ? -13.529 54.655 51.502 1.00 50.57  ? 46   ARG A C   1 
ATOM   318  O O   . ARG A 1 46  ? -13.103 55.731 51.910 1.00 50.57  ? 46   ARG A O   1 
ATOM   319  C CB  . ARG A 1 46  ? -15.897 53.871 51.897 1.00 83.57  ? 46   ARG A CB  1 
ATOM   320  C CG  . ARG A 1 46  ? -16.175 53.160 50.588 1.00 83.57  ? 46   ARG A CG  1 
ATOM   321  C CD  . ARG A 1 46  ? -17.662 53.194 50.247 1.00 83.57  ? 46   ARG A CD  1 
ATOM   322  N NE  . ARG A 1 46  ? -18.477 52.428 51.191 1.00 83.57  ? 46   ARG A NE  1 
ATOM   323  C CZ  . ARG A 1 46  ? -19.813 52.356 51.152 1.00 83.57  ? 46   ARG A CZ  1 
ATOM   324  N NH1 . ARG A 1 46  ? -20.497 53.012 50.208 1.00 83.57  ? 46   ARG A NH1 1 
ATOM   325  N NH2 . ARG A 1 46  ? -20.472 51.623 52.056 1.00 83.57  ? 46   ARG A NH2 1 
ATOM   326  N N   . ARG A 1 47  ? -13.207 54.177 50.305 1.00 45.23  ? 47   ARG A N   1 
ATOM   327  C CA  . ARG A 1 47  ? -12.365 54.942 49.386 1.00 45.23  ? 47   ARG A CA  1 
ATOM   328  C C   . ARG A 1 47  ? -13.113 56.200 48.914 1.00 45.23  ? 47   ARG A C   1 
ATOM   329  O O   . ARG A 1 47  ? -14.335 56.189 48.753 1.00 45.23  ? 47   ARG A O   1 
ATOM   330  C CB  . ARG A 1 47  ? -11.993 54.093 48.170 1.00 58.28  ? 47   ARG A CB  1 
ATOM   331  C CG  . ARG A 1 47  ? -11.077 52.922 48.460 1.00 58.28  ? 47   ARG A CG  1 
ATOM   332  C CD  . ARG A 1 47  ? -10.711 52.202 47.161 1.00 58.28  ? 47   ARG A CD  1 
ATOM   333  N NE  . ARG A 1 47  ? -9.660  51.192 47.323 1.00 58.28  ? 47   ARG A NE  1 
ATOM   334  C CZ  . ARG A 1 47  ? -9.869  49.927 47.685 1.00 58.28  ? 47   ARG A CZ  1 
ATOM   335  N NH1 . ARG A 1 47  ? -11.106 49.490 47.934 1.00 58.28  ? 47   ARG A NH1 1 
ATOM   336  N NH2 . ARG A 1 47  ? -8.832  49.092 47.774 1.00 58.28  ? 47   ARG A NH2 1 
ATOM   337  N N   . PRO A 1 48  ? -12.383 57.294 48.661 1.00 41.89  ? 48   PRO A N   1 
ATOM   338  C CA  . PRO A 1 48  ? -13.028 58.530 48.214 1.00 41.89  ? 48   PRO A CA  1 
ATOM   339  C C   . PRO A 1 48  ? -13.605 58.449 46.802 1.00 41.89  ? 48   PRO A C   1 
ATOM   340  O O   . PRO A 1 48  ? -13.068 57.751 45.936 1.00 41.89  ? 48   PRO A O   1 
ATOM   341  C CB  . PRO A 1 48  ? -11.903 59.544 48.305 1.00 35.40  ? 48   PRO A CB  1 
ATOM   342  C CG  . PRO A 1 48  ? -10.719 58.728 47.881 1.00 35.40  ? 48   PRO A CG  1 
ATOM   343  C CD  . PRO A 1 48  ? -10.913 57.430 48.633 1.00 35.40  ? 48   PRO A CD  1 
ATOM   344  N N   . GLU A 1 49  ? -14.703 59.166 46.577 1.00 41.45  ? 49   GLU A N   1 
ATOM   345  C CA  . GLU A 1 49  ? -15.328 59.198 45.266 1.00 41.45  ? 49   GLU A CA  1 
ATOM   346  C C   . GLU A 1 49  ? -15.155 60.599 44.683 1.00 41.45  ? 49   GLU A C   1 
ATOM   347  O O   . GLU A 1 49  ? -15.137 61.586 45.410 1.00 41.45  ? 49   GLU A O   1 
ATOM   348  C CB  . GLU A 1 49  ? -16.814 58.839 45.372 1.00 99.93  ? 49   GLU A CB  1 
ATOM   349  C CG  . GLU A 1 49  ? -17.110 57.371 45.775 1.00 99.93  ? 49   GLU A CG  1 
ATOM   350  C CD  . GLU A 1 49  ? -16.435 56.323 44.862 1.00 99.93  ? 49   GLU A CD  1 
ATOM   351  O OE1 . GLU A 1 49  ? -16.441 56.493 43.613 1.00 99.93  ? 49   GLU A OE1 1 
ATOM   352  O OE2 . GLU A 1 49  ? -15.905 55.317 45.396 1.00 99.93  ? 49   GLU A OE2 1 
ATOM   353  N N   . PRO A 1 50  ? -15.012 60.703 43.356 1.00 49.27  ? 50   PRO A N   1 
ATOM   354  C CA  . PRO A 1 50  ? -14.838 62.017 42.725 1.00 49.27  ? 50   PRO A CA  1 
ATOM   355  C C   . PRO A 1 50  ? -16.004 62.963 43.018 1.00 49.27  ? 50   PRO A C   1 
ATOM   356  O O   . PRO A 1 50  ? -17.166 62.545 43.033 1.00 49.27  ? 50   PRO A O   1 
ATOM   357  C CB  . PRO A 1 50  ? -14.745 61.678 41.233 1.00 42.27  ? 50   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 50  ? -14.270 60.235 41.215 1.00 42.27  ? 50   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 50  ? -15.061 59.632 42.343 1.00 42.27  ? 50   PRO A CD  1 
ATOM   360  N N   . LYS A 1 51  ? -15.702 64.236 43.252 1.00 43.92  ? 51   LYS A N   1 
ATOM   361  C CA  . LYS A 1 51  ? -16.760 65.208 43.517 1.00 43.92  ? 51   LYS A CA  1 
ATOM   362  C C   . LYS A 1 51  ? -17.629 65.362 42.275 1.00 43.92  ? 51   LYS A C   1 
ATOM   363  O O   . LYS A 1 51  ? -17.114 65.456 41.157 1.00 43.92  ? 51   LYS A O   1 
ATOM   364  C CB  . LYS A 1 51  ? -16.161 66.564 43.875 1.00 44.15  ? 51   LYS A CB  1 
ATOM   365  C CG  . LYS A 1 51  ? -17.178 67.665 44.098 1.00 44.15  ? 51   LYS A CG  1 
ATOM   366  C CD  . LYS A 1 51  ? -18.005 67.442 45.344 1.00 44.15  ? 51   LYS A CD  1 
ATOM   367  C CE  . LYS A 1 51  ? -18.897 68.642 45.609 1.00 44.15  ? 51   LYS A CE  1 
ATOM   368  N NZ  . LYS A 1 51  ? -19.753 68.431 46.805 1.00 44.15  ? 51   LYS A NZ  1 
ATOM   369  N N   . LYS A 1 52  ? -18.945 65.382 42.462 1.00 45.92  ? 52   LYS A N   1 
ATOM   370  C CA  . LYS A 1 52  ? -19.844 65.538 41.325 1.00 45.92  ? 52   LYS A CA  1 
ATOM   371  C C   . LYS A 1 52  ? -19.846 66.990 40.865 1.00 45.92  ? 52   LYS A C   1 
ATOM   372  O O   . LYS A 1 52  ? -19.829 67.917 41.681 1.00 45.92  ? 52   LYS A O   1 
ATOM   373  C CB  . LYS A 1 52  ? -21.261 65.120 41.697 1.00 68.12  ? 52   LYS A CB  1 
ATOM   374  C CG  . LYS A 1 52  ? -21.411 63.644 41.969 1.00 68.12  ? 52   LYS A CG  1 
ATOM   375  C CD  . LYS A 1 52  ? -22.882 63.292 42.176 1.00 68.12  ? 52   LYS A CD  1 
ATOM   376  C CE  . LYS A 1 52  ? -23.073 61.792 42.450 1.00 68.12  ? 52   LYS A CE  1 
ATOM   377  N NZ  . LYS A 1 52  ? -22.577 61.365 43.804 1.00 68.12  ? 52   LYS A NZ  1 
ATOM   378  N N   . PRO A 1 53  ? -19.858 67.210 39.546 1.00 48.34  ? 53   PRO A N   1 
ATOM   379  C CA  . PRO A 1 53  ? -19.861 68.586 39.045 1.00 48.34  ? 53   PRO A CA  1 
ATOM   380  C C   . PRO A 1 53  ? -21.024 69.381 39.638 1.00 48.34  ? 53   PRO A C   1 
ATOM   381  O O   . PRO A 1 53  ? -22.068 68.822 39.992 1.00 48.34  ? 53   PRO A O   1 
ATOM   382  C CB  . PRO A 1 53  ? -19.969 68.396 37.538 1.00 36.32  ? 53   PRO A CB  1 
ATOM   383  C CG  . PRO A 1 53  ? -19.207 67.111 37.321 1.00 36.32  ? 53   PRO A CG  1 
ATOM   384  C CD  . PRO A 1 53  ? -19.756 66.246 38.437 1.00 36.32  ? 53   PRO A CD  1 
ATOM   385  N N   . TRP A 1 54  ? -20.830 70.685 39.763 1.00 50.44  ? 54   TRP A N   1 
ATOM   386  C CA  . TRP A 1 54  ? -21.858 71.537 40.327 1.00 50.44  ? 54   TRP A CA  1 
ATOM   387  C C   . TRP A 1 54  ? -22.174 72.689 39.381 1.00 50.44  ? 54   TRP A C   1 
ATOM   388  O O   . TRP A 1 54  ? -21.326 73.114 38.587 1.00 50.44  ? 54   TRP A O   1 
ATOM   389  C CB  . TRP A 1 54  ? -21.380 72.085 41.671 1.00 37.45  ? 54   TRP A CB  1 
ATOM   390  C CG  . TRP A 1 54  ? -20.155 72.919 41.546 1.00 37.45  ? 54   TRP A CG  1 
ATOM   391  C CD1 . TRP A 1 54  ? -20.088 74.225 41.152 1.00 37.45  ? 54   TRP A CD1 1 
ATOM   392  C CD2 . TRP A 1 54  ? -18.806 72.490 41.744 1.00 37.45  ? 54   TRP A CD2 1 
ATOM   393  N NE1 . TRP A 1 54  ? -18.778 74.634 41.090 1.00 37.45  ? 54   TRP A NE1 1 
ATOM   394  C CE2 . TRP A 1 54  ? -17.971 73.587 41.450 1.00 37.45  ? 54   TRP A CE2 1 
ATOM   395  C CE3 . TRP A 1 54  ? -18.221 71.283 42.140 1.00 37.45  ? 54   TRP A CE3 1 
ATOM   396  C CZ2 . TRP A 1 54  ? -16.581 73.513 41.540 1.00 37.45  ? 54   TRP A CZ2 1 
ATOM   397  C CZ3 . TRP A 1 54  ? -16.839 71.209 42.229 1.00 37.45  ? 54   TRP A CZ3 1 
ATOM   398  C CH2 . TRP A 1 54  ? -16.035 72.318 41.931 1.00 37.45  ? 54   TRP A CH2 1 
ATOM   399  N N   . SER A 1 55  ? -23.401 73.191 39.467 1.00 70.71  ? 55   SER A N   1 
ATOM   400  C CA  . SER A 1 55  ? -23.814 74.315 38.636 1.00 70.71  ? 55   SER A CA  1 
ATOM   401  C C   . SER A 1 55  ? -23.639 75.594 39.443 1.00 70.71  ? 55   SER A C   1 
ATOM   402  O O   . SER A 1 55  ? -23.520 75.547 40.671 1.00 70.71  ? 55   SER A O   1 
ATOM   403  C CB  . SER A 1 55  ? -25.271 74.155 38.214 1.00 75.37  ? 55   SER A CB  1 
ATOM   404  O OG  . SER A 1 55  ? -25.398 73.085 37.287 1.00 75.37  ? 55   SER A OG  1 
ATOM   405  N N   . GLY A 1 56  ? -23.625 76.738 38.771 1.00 55.16  ? 56   GLY A N   1 
ATOM   406  C CA  . GLY A 1 56  ? -23.446 77.974 39.506 1.00 55.16  ? 56   GLY A CA  1 
ATOM   407  C C   . GLY A 1 56  ? -21.980 78.131 39.857 1.00 55.16  ? 56   GLY A C   1 
ATOM   408  O O   . GLY A 1 56  ? -21.143 77.357 39.391 1.00 55.16  ? 56   GLY A O   1 
ATOM   409  N N   . VAL A 1 57  ? -21.667 79.120 40.686 1.00 41.87  ? 57   VAL A N   1 
ATOM   410  C CA  . VAL A 1 57  ? -20.290 79.391 41.068 1.00 41.87  ? 57   VAL A CA  1 
ATOM   411  C C   . VAL A 1 57  ? -19.994 78.962 42.492 1.00 41.87  ? 57   VAL A C   1 
ATOM   412  O O   . VAL A 1 57  ? -20.715 79.322 43.419 1.00 41.87  ? 57   VAL A O   1 
ATOM   413  C CB  . VAL A 1 57  ? -19.984 80.890 40.955 1.00 40.23  ? 57   VAL A CB  1 
ATOM   414  C CG1 . VAL A 1 57  ? -18.487 81.134 41.135 1.00 40.23  ? 57   VAL A CG1 1 
ATOM   415  C CG2 . VAL A 1 57  ? -20.484 81.415 39.613 1.00 40.23  ? 57   VAL A CG2 1 
ATOM   416  N N   . TRP A 1 58  ? -18.926 78.196 42.674 1.00 42.35  ? 58   TRP A N   1 
ATOM   417  C CA  . TRP A 1 58  ? -18.575 77.758 44.014 1.00 42.35  ? 58   TRP A CA  1 
ATOM   418  C C   . TRP A 1 58  ? -17.820 78.890 44.696 1.00 42.35  ? 58   TRP A C   1 
ATOM   419  O O   . TRP A 1 58  ? -16.898 79.452 44.121 1.00 42.35  ? 58   TRP A O   1 
ATOM   420  C CB  . TRP A 1 58  ? -17.717 76.496 43.952 1.00 38.22  ? 58   TRP A CB  1 
ATOM   421  C CG  . TRP A 1 58  ? -17.341 75.986 45.298 1.00 38.22  ? 58   TRP A CG  1 
ATOM   422  C CD1 . TRP A 1 58  ? -16.364 76.478 46.127 1.00 38.22  ? 58   TRP A CD1 1 
ATOM   423  C CD2 . TRP A 1 58  ? -17.965 74.918 46.005 1.00 38.22  ? 58   TRP A CD2 1 
ATOM   424  N NE1 . TRP A 1 58  ? -16.349 75.781 47.301 1.00 38.22  ? 58   TRP A NE1 1 
ATOM   425  C CE2 . TRP A 1 58  ? -17.322 74.815 47.256 1.00 38.22  ? 58   TRP A CE2 1 
ATOM   426  C CE3 . TRP A 1 58  ? -19.009 74.036 45.707 1.00 38.22  ? 58   TRP A CE3 1 
ATOM   427  C CZ2 . TRP A 1 58  ? -17.692 73.859 48.211 1.00 38.22  ? 58   TRP A CZ2 1 
ATOM   428  C CZ3 . TRP A 1 58  ? -19.379 73.084 46.660 1.00 38.22  ? 58   TRP A CZ3 1 
ATOM   429  C CH2 . TRP A 1 58  ? -18.720 73.006 47.894 1.00 38.22  ? 58   TRP A CH2 1 
ATOM   430  N N   . ASN A 1 59  ? -18.227 79.231 45.915 1.00 50.83  ? 59   ASN A N   1 
ATOM   431  C CA  . ASN A 1 59  ? -17.585 80.310 46.668 1.00 50.83  ? 59   ASN A CA  1 
ATOM   432  C C   . ASN A 1 59  ? -16.316 79.791 47.350 1.00 50.83  ? 59   ASN A C   1 
ATOM   433  O O   . ASN A 1 59  ? -16.393 79.120 48.383 1.00 50.83  ? 59   ASN A O   1 
ATOM   434  C CB  . ASN A 1 59  ? -18.553 80.864 47.728 1.00 52.29  ? 59   ASN A CB  1 
ATOM   435  C CG  . ASN A 1 59  ? -18.002 82.090 48.449 1.00 52.29  ? 59   ASN A CG  1 
ATOM   436  O OD1 . ASN A 1 59  ? -16.787 82.231 48.594 1.00 52.29  ? 59   ASN A OD1 1 
ATOM   437  N ND2 . ASN A 1 59  ? -18.895 82.974 48.921 1.00 52.29  ? 59   ASN A ND2 1 
ATOM   438  N N   . ALA A 1 60  ? -15.155 80.107 46.777 1.00 40.44  ? 60   ALA A N   1 
ATOM   439  C CA  . ALA A 1 60  ? -13.876 79.665 47.331 1.00 40.44  ? 60   ALA A CA  1 
ATOM   440  C C   . ALA A 1 60  ? -13.084 80.824 47.929 1.00 40.44  ? 60   ALA A C   1 
ATOM   441  O O   . ALA A 1 60  ? -11.911 81.023 47.599 1.00 40.44  ? 60   ALA A O   1 
ATOM   442  C CB  . ALA A 1 60  ? -13.050 78.979 46.247 1.00 38.75  ? 60   ALA A CB  1 
ATOM   443  N N   . SER A 1 61  ? -13.716 81.580 48.819 1.00 44.74  ? 61   SER A N   1 
ATOM   444  C CA  . SER A 1 61  ? -13.051 82.727 49.428 1.00 44.74  ? 61   SER A CA  1 
ATOM   445  C C   . SER A 1 61  ? -12.696 82.540 50.898 1.00 44.74  ? 61   SER A C   1 
ATOM   446  O O   . SER A 1 61  ? -12.068 83.412 51.495 1.00 44.74  ? 61   SER A O   1 
ATOM   447  C CB  . SER A 1 61  ? -13.914 83.975 49.272 1.00 49.23  ? 61   SER A CB  1 
ATOM   448  O OG  . SER A 1 61  ? -15.100 83.847 50.037 1.00 49.23  ? 61   SER A OG  1 
ATOM   449  N N   . THR A 1 62  ? -13.102 81.412 51.479 1.00 39.60  ? 62   THR A N   1 
ATOM   450  C CA  . THR A 1 62  ? -12.793 81.115 52.875 1.00 39.60  ? 62   THR A CA  1 
ATOM   451  C C   . THR A 1 62  ? -12.296 79.679 53.072 1.00 39.60  ? 62   THR A C   1 
ATOM   452  O O   . THR A 1 62  ? -12.724 78.763 52.375 1.00 39.60  ? 62   THR A O   1 
ATOM   453  C CB  . THR A 1 62  ? -14.016 81.300 53.754 1.00 58.73  ? 62   THR A CB  1 
ATOM   454  O OG1 . THR A 1 62  ? -15.015 80.344 53.375 1.00 58.73  ? 62   THR A OG1 1 
ATOM   455  C CG2 . THR A 1 62  ? -14.568 82.704 53.594 1.00 58.73  ? 62   THR A CG2 1 
ATOM   456  N N   . TYR A 1 63  ? -11.397 79.488 54.032 1.00 42.74  ? 63   TYR A N   1 
ATOM   457  C CA  . TYR A 1 63  ? -10.858 78.159 54.318 1.00 42.74  ? 63   TYR A CA  1 
ATOM   458  C C   . TYR A 1 63  ? -11.946 77.123 54.606 1.00 42.74  ? 63   TYR A C   1 
ATOM   459  O O   . TYR A 1 63  ? -13.032 77.453 55.074 1.00 42.74  ? 63   TYR A O   1 
ATOM   460  C CB  . TYR A 1 63  ? -9.910  78.203 55.511 1.00 41.72  ? 63   TYR A CB  1 
ATOM   461  C CG  . TYR A 1 63  ? -8.493  78.629 55.205 1.00 41.72  ? 63   TYR A CG  1 
ATOM   462  C CD1 . TYR A 1 63  ? -7.818  78.158 54.077 1.00 41.72  ? 63   TYR A CD1 1 
ATOM   463  C CD2 . TYR A 1 63  ? -7.780  79.412 56.117 1.00 41.72  ? 63   TYR A CD2 1 
ATOM   464  C CE1 . TYR A 1 63  ? -6.459  78.448 53.875 1.00 41.72  ? 63   TYR A CE1 1 
ATOM   465  C CE2 . TYR A 1 63  ? -6.429  79.708 55.928 1.00 41.72  ? 63   TYR A CE2 1 
ATOM   466  C CZ  . TYR A 1 63  ? -5.774  79.221 54.816 1.00 41.72  ? 63   TYR A CZ  1 
ATOM   467  O OH  . TYR A 1 63  ? -4.429  79.479 54.692 1.00 41.72  ? 63   TYR A OH  1 
ATOM   468  N N   . PRO A 1 64  ? -11.658 75.847 54.329 1.00 38.83  ? 64   PRO A N   1 
ATOM   469  C CA  . PRO A 1 64  ? -12.620 74.773 54.564 1.00 38.83  ? 64   PRO A CA  1 
ATOM   470  C C   . PRO A 1 64  ? -12.475 74.271 55.986 1.00 38.83  ? 64   PRO A C   1 
ATOM   471  O O   . PRO A 1 64  ? -11.642 74.766 56.738 1.00 38.83  ? 64   PRO A O   1 
ATOM   472  C CB  . PRO A 1 64  ? -12.182 73.718 53.565 1.00 36.68  ? 64   PRO A CB  1 
ATOM   473  C CG  . PRO A 1 64  ? -10.692 73.816 53.679 1.00 36.68  ? 64   PRO A CG  1 
ATOM   474  C CD  . PRO A 1 64  ? -10.454 75.323 53.655 1.00 36.68  ? 64   PRO A CD  1 
ATOM   475  N N   . ASN A 1 65  ? -13.279 73.283 56.352 1.00 34.36  ? 65   ASN A N   1 
ATOM   476  C CA  . ASN A 1 65  ? -13.179 72.702 57.677 1.00 34.36  ? 65   ASN A CA  1 
ATOM   477  C C   . ASN A 1 65  ? -11.938 71.802 57.751 1.00 34.36  ? 65   ASN A C   1 
ATOM   478  O O   . ASN A 1 65  ? -11.291 71.520 56.744 1.00 34.36  ? 65   ASN A O   1 
ATOM   479  C CB  . ASN A 1 65  ? -14.429 71.887 57.984 1.00 60.47  ? 65   ASN A CB  1 
ATOM   480  C CG  . ASN A 1 65  ? -15.668 72.752 58.124 1.00 60.47  ? 65   ASN A CG  1 
ATOM   481  O OD1 . ASN A 1 65  ? -15.761 73.590 59.027 1.00 60.47  ? 65   ASN A OD1 1 
ATOM   482  N ND2 . ASN A 1 65  ? -16.628 72.554 57.229 1.00 60.47  ? 65   ASN A ND2 1 
ATOM   483  N N   . ASN A 1 66  ? -11.594 71.369 58.953 1.00 42.39  ? 66   ASN A N   1 
ATOM   484  C CA  . ASN A 1 66  ? -10.447 70.492 59.136 1.00 42.39  ? 66   ASN A CA  1 
ATOM   485  C C   . ASN A 1 66  ? -10.969 69.085 59.400 1.00 42.39  ? 66   ASN A C   1 
ATOM   486  O O   . ASN A 1 66  ? -12.045 68.915 59.969 1.00 42.39  ? 66   ASN A O   1 
ATOM   487  C CB  . ASN A 1 66  ? -9.595  70.958 60.323 1.00 46.22  ? 66   ASN A CB  1 
ATOM   488  C CG  . ASN A 1 66  ? -8.946  72.311 60.088 1.00 46.22  ? 66   ASN A CG  1 
ATOM   489  O OD1 . ASN A 1 66  ? -8.554  72.996 61.032 1.00 46.22  ? 66   ASN A OD1 1 
ATOM   490  N ND2 . ASN A 1 66  ? -8.817  72.697 58.824 1.00 46.22  ? 66   ASN A ND2 1 
ATOM   491  N N   . CYS A 1 67  ? -10.209 68.084 58.976 1.00 32.27  ? 67   CYS A N   1 
ATOM   492  C CA  . CYS A 1 67  ? -10.598 66.703 59.190 1.00 32.27  ? 67   CYS A CA  1 
ATOM   493  C C   . CYS A 1 67  ? -10.737 66.431 60.683 1.00 32.27  ? 67   CYS A C   1 
ATOM   494  O O   . CYS A 1 67  ? -10.077 67.069 61.496 1.00 32.27  ? 67   CYS A O   1 
ATOM   495  C CB  . CYS A 1 67  ? -9.545  65.770 58.576 1.00 37.61  ? 67   CYS A CB  1 
ATOM   496  N N   . GLN A 1 68  ? -11.616 65.502 61.049 1.00 39.55  ? 68   GLN A N   1 
ATOM   497  C CA  . GLN A 1 68  ? -11.792 65.132 62.457 1.00 39.55  ? 68   GLN A CA  1 
ATOM   498  C C   . GLN A 1 68  ? -10.458 64.569 62.949 1.00 39.55  ? 68   GLN A C   1 
ATOM   499  O O   . GLN A 1 68  ? -9.895  63.664 62.323 1.00 39.55  ? 68   GLN A O   1 
ATOM   500  C CB  . GLN A 1 68  ? -12.866 64.060 62.590 1.00 41.16  ? 68   GLN A CB  1 
ATOM   501  C CG  . GLN A 1 68  ? -14.269 64.583 62.478 1.00 41.16  ? 68   GLN A CG  1 
ATOM   502  C CD  . GLN A 1 68  ? -14.691 65.341 63.715 1.00 41.16  ? 68   GLN A CD  1 
ATOM   503  O OE1 . GLN A 1 68  ? -15.796 65.877 63.783 1.00 41.16  ? 68   GLN A OE1 1 
ATOM   504  N NE2 . GLN A 1 68  ? -13.814 65.386 64.709 1.00 41.16  ? 68   GLN A NE2 1 
ATOM   505  N N   . GLN A 1 69  ? -9.948  65.097 64.059 1.00 45.22  ? 69   GLN A N   1 
ATOM   506  C CA  . GLN A 1 69  ? -8.660  64.632 64.578 1.00 45.22  ? 69   GLN A CA  1 
ATOM   507  C C   . GLN A 1 69  ? -8.453  64.816 66.078 1.00 45.22  ? 69   GLN A C   1 
ATOM   508  O O   . GLN A 1 69  ? -9.229  65.490 66.767 1.00 45.22  ? 69   GLN A O   1 
ATOM   509  C CB  . GLN A 1 69  ? -7.516  65.336 63.837 1.00 36.64  ? 69   GLN A CB  1 
ATOM   510  C CG  . GLN A 1 69  ? -7.646  66.862 63.812 1.00 36.64  ? 69   GLN A CG  1 
ATOM   511  C CD  . GLN A 1 69  ? -6.579  67.553 62.960 1.00 36.64  ? 69   GLN A CD  1 
ATOM   512  O OE1 . GLN A 1 69  ? -5.458  67.805 63.417 1.00 36.64  ? 69   GLN A OE1 1 
ATOM   513  N NE2 . GLN A 1 69  ? -6.926  67.853 61.714 1.00 36.64  ? 69   GLN A NE2 1 
ATOM   514  N N   . TYR A 1 70  ? -7.390  64.189 66.567 1.00 44.48  ? 70   TYR A N   1 
ATOM   515  C CA  . TYR A 1 70  ? -7.001  64.286 67.963 1.00 44.48  ? 70   TYR A CA  1 
ATOM   516  C C   . TYR A 1 70  ? -6.441  65.695 68.106 1.00 44.48  ? 70   TYR A C   1 
ATOM   517  O O   . TYR A 1 70  ? -5.805  66.201 67.187 1.00 44.48  ? 70   TYR A O   1 
ATOM   518  C CB  . TYR A 1 70  ? -5.919  63.262 68.264 1.00 52.24  ? 70   TYR A CB  1 
ATOM   519  C CG  . TYR A 1 70  ? -5.345  63.386 69.644 1.00 52.24  ? 70   TYR A CG  1 
ATOM   520  C CD1 . TYR A 1 70  ? -6.026  62.876 70.763 1.00 52.24  ? 70   TYR A CD1 1 
ATOM   521  C CD2 . TYR A 1 70  ? -4.136  64.056 69.849 1.00 52.24  ? 70   TYR A CD2 1 
ATOM   522  C CE1 . TYR A 1 70  ? -5.510  63.041 72.049 1.00 52.24  ? 70   TYR A CE1 1 
ATOM   523  C CE2 . TYR A 1 70  ? -3.617  64.224 71.119 1.00 52.24  ? 70   TYR A CE2 1 
ATOM   524  C CZ  . TYR A 1 70  ? -4.302  63.720 72.215 1.00 52.24  ? 70   TYR A CZ  1 
ATOM   525  O OH  . TYR A 1 70  ? -3.765  63.909 73.472 1.00 52.24  ? 70   TYR A OH  1 
ATOM   526  N N   . VAL A 1 71  ? -6.686  66.338 69.241 1.00 34.98  ? 71   VAL A N   1 
ATOM   527  C CA  . VAL A 1 71  ? -6.202  67.693 69.450 1.00 34.98  ? 71   VAL A CA  1 
ATOM   528  C C   . VAL A 1 71  ? -5.328  67.772 70.679 1.00 34.98  ? 71   VAL A C   1 
ATOM   529  O O   . VAL A 1 71  ? -5.745  67.424 71.780 1.00 34.98  ? 71   VAL A O   1 
ATOM   530  C CB  . VAL A 1 71  ? -7.357  68.693 69.622 1.00 31.72  ? 71   VAL A CB  1 
ATOM   531  C CG1 . VAL A 1 71  ? -6.801  70.069 69.885 1.00 31.72  ? 71   VAL A CG1 1 
ATOM   532  C CG2 . VAL A 1 71  ? -8.220  68.708 68.389 1.00 31.72  ? 71   VAL A CG2 1 
ATOM   533  N N   . ASP A 1 72  ? -4.109  68.252 70.482 1.00 43.66  ? 72   ASP A N   1 
ATOM   534  C CA  . ASP A 1 72  ? -3.157  68.373 71.567 1.00 43.66  ? 72   ASP A CA  1 
ATOM   535  C C   . ASP A 1 72  ? -3.550  69.438 72.572 1.00 43.66  ? 72   ASP A C   1 
ATOM   536  O O   . ASP A 1 72  ? -3.823  70.583 72.212 1.00 43.66  ? 72   ASP A O   1 
ATOM   537  C CB  . ASP A 1 72  ? -1.776  68.661 71.000 1.00 57.30  ? 72   ASP A CB  1 
ATOM   538  C CG  . ASP A 1 72  ? -0.769  68.991 72.068 1.00 57.30  ? 72   ASP A CG  1 
ATOM   539  O OD1 . ASP A 1 72  ? -0.915  68.491 73.205 1.00 57.30  ? 72   ASP A OD1 1 
ATOM   540  O OD2 . ASP A 1 72  ? 0.183   69.745 71.760 1.00 57.30  ? 72   ASP A OD2 1 
ATOM   541  N N   . GLU A 1 73  ? -3.590  69.037 73.839 1.00 50.19  ? 73   GLU A N   1 
ATOM   542  C CA  . GLU A 1 73  ? -3.950  69.931 74.927 1.00 50.19  ? 73   GLU A CA  1 
ATOM   543  C C   . GLU A 1 73  ? -2.916  69.822 76.042 1.00 50.19  ? 73   GLU A C   1 
ATOM   544  O O   . GLU A 1 73  ? -3.199  70.092 77.207 1.00 50.19  ? 73   GLU A O   1 
ATOM   545  C CB  . GLU A 1 73  ? -5.338  69.579 75.458 1.00 69.67  ? 73   GLU A CB  1 
ATOM   546  C CG  . GLU A 1 73  ? -6.477  70.208 74.672 1.00 69.67  ? 73   GLU A CG  1 
ATOM   547  C CD  . GLU A 1 73  ? -7.852  69.629 75.040 1.00 69.67  ? 73   GLU A CD  1 
ATOM   548  O OE1 . GLU A 1 73  ? -8.256  69.716 76.233 1.00 69.67  ? 73   GLU A OE1 1 
ATOM   549  O OE2 . GLU A 1 73  ? -8.529  69.084 74.126 1.00 69.67  ? 73   GLU A OE2 1 
ATOM   550  N N   . GLN A 1 74  ? -1.708  69.419 75.679 1.00 49.12  ? 74   GLN A N   1 
ATOM   551  C CA  . GLN A 1 74  ? -0.646  69.291 76.656 1.00 49.12  ? 74   GLN A CA  1 
ATOM   552  C C   . GLN A 1 74  ? -0.226  70.662 77.216 1.00 49.12  ? 74   GLN A C   1 
ATOM   553  O O   . GLN A 1 74  ? 0.246   70.749 78.344 1.00 49.12  ? 74   GLN A O   1 
ATOM   554  C CB  . GLN A 1 74  ? 0.560   68.594 76.022 1.00 65.56  ? 74   GLN A CB  1 
ATOM   555  C CG  . GLN A 1 74  ? 1.684   68.311 77.003 1.00 65.56  ? 74   GLN A CG  1 
ATOM   556  C CD  . GLN A 1 74  ? 1.222   67.414 78.128 1.00 65.56  ? 74   GLN A CD  1 
ATOM   557  O OE1 . GLN A 1 74  ? 1.859   67.319 79.188 1.00 65.56  ? 74   GLN A OE1 1 
ATOM   558  N NE2 . GLN A 1 74  ? 0.103   66.736 77.902 1.00 65.56  ? 74   GLN A NE2 1 
ATOM   559  N N   . PHE A 1 75  ? -0.404  71.727 76.436 1.00 41.51  ? 75   PHE A N   1 
ATOM   560  C CA  . PHE A 1 75  ? -0.017  73.071 76.873 1.00 41.51  ? 75   PHE A CA  1 
ATOM   561  C C   . PHE A 1 75  ? -1.029  74.131 76.433 1.00 41.51  ? 75   PHE A C   1 
ATOM   562  O O   . PHE A 1 75  ? -0.745  74.938 75.549 1.00 41.51  ? 75   PHE A O   1 
ATOM   563  C CB  . PHE A 1 75  ? 1.358   73.426 76.302 1.00 41.55  ? 75   PHE A CB  1 
ATOM   564  C CG  . PHE A 1 75  ? 2.443   72.456 76.673 1.00 41.55  ? 75   PHE A CG  1 
ATOM   565  C CD1 . PHE A 1 75  ? 2.980   72.450 77.955 1.00 41.55  ? 75   PHE A CD1 1 
ATOM   566  C CD2 . PHE A 1 75  ? 2.921   71.541 75.739 1.00 41.55  ? 75   PHE A CD2 1 
ATOM   567  C CE1 . PHE A 1 75  ? 3.980   71.547 78.306 1.00 41.55  ? 75   PHE A CE1 1 
ATOM   568  C CE2 . PHE A 1 75  ? 3.922   70.628 76.075 1.00 41.55  ? 75   PHE A CE2 1 
ATOM   569  C CZ  . PHE A 1 75  ? 4.454   70.629 77.361 1.00 41.55  ? 75   PHE A CZ  1 
ATOM   570  N N   . PRO A 1 76  ? -2.221  74.147 77.058 1.00 56.19  ? 76   PRO A N   1 
ATOM   571  C CA  . PRO A 1 76  ? -3.272  75.113 76.720 1.00 56.19  ? 76   PRO A CA  1 
ATOM   572  C C   . PRO A 1 76  ? -2.732  76.540 76.662 1.00 56.19  ? 76   PRO A C   1 
ATOM   573  O O   . PRO A 1 76  ? -2.020  76.982 77.580 1.00 56.19  ? 76   PRO A O   1 
ATOM   574  C CB  . PRO A 1 76  ? -4.282  74.931 77.849 1.00 44.15  ? 76   PRO A CB  1 
ATOM   575  C CG  . PRO A 1 76  ? -4.121  73.495 78.221 1.00 44.15  ? 76   PRO A CG  1 
ATOM   576  C CD  . PRO A 1 76  ? -2.620  73.335 78.224 1.00 44.15  ? 76   PRO A CD  1 
ATOM   577  N N   . GLY A 1 77  ? -3.076  77.255 75.589 1.00 60.16  ? 77   GLY A N   1 
ATOM   578  C CA  . GLY A 1 77  ? -2.617  78.625 75.428 1.00 60.16  ? 77   GLY A CA  1 
ATOM   579  C C   . GLY A 1 77  ? -1.276  78.742 74.711 1.00 60.16  ? 77   GLY A C   1 
ATOM   580  O O   . GLY A 1 77  ? -1.095  79.607 73.848 1.00 60.16  ? 77   GLY A O   1 
ATOM   581  N N   . PHE A 1 78  ? -0.336  77.872 75.066 1.00 41.87  ? 78   PHE A N   1 
ATOM   582  C CA  . PHE A 1 78  ? 1.001   77.861 74.470 1.00 41.87  ? 78   PHE A CA  1 
ATOM   583  C C   . PHE A 1 78  ? 0.964   77.924 72.940 1.00 41.87  ? 78   PHE A C   1 
ATOM   584  O O   . PHE A 1 78  ? 0.486   77.012 72.275 1.00 41.87  ? 78   PHE A O   1 
ATOM   585  C CB  . PHE A 1 78  ? 1.732   76.601 74.921 1.00 40.62  ? 78   PHE A CB  1 
ATOM   586  C CG  . PHE A 1 78  ? 3.200   76.642 74.687 1.00 40.62  ? 78   PHE A CG  1 
ATOM   587  C CD1 . PHE A 1 78  ? 3.956   77.715 75.152 1.00 40.62  ? 78   PHE A CD1 1 
ATOM   588  C CD2 . PHE A 1 78  ? 3.838   75.603 74.014 1.00 40.62  ? 78   PHE A CD2 1 
ATOM   589  C CE1 . PHE A 1 78  ? 5.326   77.755 74.952 1.00 40.62  ? 78   PHE A CE1 1 
ATOM   590  C CE2 . PHE A 1 78  ? 5.209   75.626 73.806 1.00 40.62  ? 78   PHE A CE2 1 
ATOM   591  C CZ  . PHE A 1 78  ? 5.956   76.705 74.275 1.00 40.62  ? 78   PHE A CZ  1 
ATOM   592  N N   . SER A 1 79  ? 1.466   79.007 72.372 1.00 49.44  ? 79   SER A N   1 
ATOM   593  C CA  . SER A 1 79  ? 1.453   79.130 70.919 1.00 49.44  ? 79   SER A CA  1 
ATOM   594  C C   . SER A 1 79  ? 2.263   78.006 70.288 1.00 49.44  ? 79   SER A C   1 
ATOM   595  O O   . SER A 1 79  ? 1.885   77.452 69.253 1.00 49.44  ? 79   SER A O   1 
ATOM   596  C CB  . SER A 1 79  ? 2.044   80.470 70.495 1.00 41.76  ? 79   SER A CB  1 
ATOM   597  O OG  . SER A 1 79  ? 3.359   80.608 71.001 1.00 41.76  ? 79   SER A OG  1 
ATOM   598  N N   . GLY A 1 80  ? 3.376   77.671 70.935 1.00 48.21  ? 80   GLY A N   1 
ATOM   599  C CA  . GLY A 1 80  ? 4.264   76.643 70.433 1.00 48.21  ? 80   GLY A CA  1 
ATOM   600  C C   . GLY A 1 80  ? 3.604   75.356 69.998 1.00 48.21  ? 80   GLY A C   1 
ATOM   601  O O   . GLY A 1 80  ? 4.053   74.724 69.041 1.00 48.21  ? 80   GLY A O   1 
ATOM   602  N N   . SER A 1 81  ? 2.540   74.963 70.692 1.00 48.24  ? 81   SER A N   1 
ATOM   603  C CA  . SER A 1 81  ? 1.842   73.723 70.371 1.00 48.24  ? 81   SER A CA  1 
ATOM   604  C C   . SER A 1 81  ? 0.494   73.929 69.688 1.00 48.24  ? 81   SER A C   1 
ATOM   605  O O   . SER A 1 81  ? 0.075   73.109 68.871 1.00 48.24  ? 81   SER A O   1 
ATOM   606  C CB  . SER A 1 81  ? 1.648   72.891 71.642 1.00 50.32  ? 81   SER A CB  1 
ATOM   607  O OG  . SER A 1 81  ? 0.886   73.605 72.591 1.00 50.32  ? 81   SER A OG  1 
ATOM   608  N N   . GLU A 1 82  ? -0.186  75.019 70.018 1.00 48.58  ? 82   GLU A N   1 
ATOM   609  C CA  . GLU A 1 82  ? -1.484  75.279 69.417 1.00 48.58  ? 82   GLU A CA  1 
ATOM   610  C C   . GLU A 1 82  ? -1.402  75.686 67.957 1.00 48.58  ? 82   GLU A C   1 
ATOM   611  O O   . GLU A 1 82  ? -2.338  75.459 67.196 1.00 48.58  ? 82   GLU A O   1 
ATOM   612  C CB  . GLU A 1 82  ? -2.245  76.318 70.245 1.00 77.18  ? 82   GLU A CB  1 
ATOM   613  C CG  . GLU A 1 82  ? -2.967  75.668 71.426 1.00 77.18  ? 82   GLU A CG  1 
ATOM   614  C CD  . GLU A 1 82  ? -3.389  76.660 72.503 1.00 77.18  ? 82   GLU A CD  1 
ATOM   615  O OE1 . GLU A 1 82  ? -2.910  77.824 72.457 1.00 77.18  ? 82   GLU A OE1 1 
ATOM   616  O OE2 . GLU A 1 82  ? -4.187  76.271 73.403 1.00 77.18  ? 82   GLU A OE2 1 
ATOM   617  N N   . MET A 1 83  ? -0.276  76.259 67.552 1.00 40.59  ? 83   MET A N   1 
ATOM   618  C CA  . MET A 1 83  ? -0.109  76.662 66.160 1.00 40.59  ? 83   MET A CA  1 
ATOM   619  C C   . MET A 1 83  ? -0.171  75.455 65.225 1.00 40.59  ? 83   MET A C   1 
ATOM   620  O O   . MET A 1 83  ? -0.093  75.612 64.004 1.00 40.59  ? 83   MET A O   1 
ATOM   621  C CB  . MET A 1 83  ? 1.229   77.348 65.955 1.00 58.84  ? 83   MET A CB  1 
ATOM   622  C CG  . MET A 1 83  ? 2.384   76.398 66.082 1.00 58.84  ? 83   MET A CG  1 
ATOM   623  S SD  . MET A 1 83  ? 3.883   77.055 65.364 1.00 58.84  ? 83   MET A SD  1 
ATOM   624  C CE  . MET A 1 83  ? 4.891   77.429 66.917 1.00 58.84  ? 83   MET A CE  1 
ATOM   625  N N   . TRP A 1 84  ? -0.272  74.255 65.797 1.00 37.66  ? 84   TRP A N   1 
ATOM   626  C CA  . TRP A 1 84  ? -0.362  73.037 64.998 1.00 37.66  ? 84   TRP A CA  1 
ATOM   627  C C   . TRP A 1 84  ? -1.759  72.430 65.077 1.00 37.66  ? 84   TRP A C   1 
ATOM   628  O O   . TRP A 1 84  ? -2.116  71.605 64.252 1.00 37.66  ? 84   TRP A O   1 
ATOM   629  C CB  . TRP A 1 84  ? 0.672   71.992 65.443 1.00 37.07  ? 84   TRP A CB  1 
ATOM   630  C CG  . TRP A 1 84  ? 2.101   72.454 65.364 1.00 37.07  ? 84   TRP A CG  1 
ATOM   631  C CD1 . TRP A 1 84  ? 2.909   72.797 66.412 1.00 37.07  ? 84   TRP A CD1 1 
ATOM   632  C CD2 . TRP A 1 84  ? 2.886   72.646 64.176 1.00 37.07  ? 84   TRP A CD2 1 
ATOM   633  N NE1 . TRP A 1 84  ? 4.146   73.190 65.951 1.00 37.07  ? 84   TRP A NE1 1 
ATOM   634  C CE2 . TRP A 1 84  ? 4.160   73.107 64.585 1.00 37.07  ? 84   TRP A CE2 1 
ATOM   635  C CE3 . TRP A 1 84  ? 2.638   72.473 62.808 1.00 37.07  ? 84   TRP A CE3 1 
ATOM   636  C CZ2 . TRP A 1 84  ? 5.182   73.397 63.676 1.00 37.07  ? 84   TRP A CZ2 1 
ATOM   637  C CZ3 . TRP A 1 84  ? 3.658   72.763 61.903 1.00 37.07  ? 84   TRP A CZ3 1 
ATOM   638  C CH2 . TRP A 1 84  ? 4.914   73.220 62.344 1.00 37.07  ? 84   TRP A CH2 1 
ATOM   639  N N   . ASN A 1 85  ? -2.544  72.833 66.072 1.00 38.91  ? 85   ASN A N   1 
ATOM   640  C CA  . ASN A 1 85  ? -3.906  72.318 66.223 1.00 38.91  ? 85   ASN A CA  1 
ATOM   641  C C   . ASN A 1 85  ? -4.797  72.857 65.116 1.00 38.91  ? 85   ASN A C   1 
ATOM   642  O O   . ASN A 1 85  ? -4.467  73.855 64.475 1.00 38.91  ? 85   ASN A O   1 
ATOM   643  C CB  . ASN A 1 85  ? -4.535  72.757 67.551 1.00 49.00  ? 85   ASN A CB  1 
ATOM   644  C CG  . ASN A 1 85  ? -3.862  72.150 68.761 1.00 49.00  ? 85   ASN A CG  1 
ATOM   645  O OD1 . ASN A 1 85  ? -3.534  70.959 68.787 1.00 49.00  ? 85   ASN A OD1 1 
ATOM   646  N ND2 . ASN A 1 85  ? -3.677  72.967 69.789 1.00 49.00  ? 85   ASN A ND2 1 
ATOM   647  N N   . PRO A 1 86  ? -5.953  72.210 64.885 1.00 39.80  ? 86   PRO A N   1 
ATOM   648  C CA  . PRO A 1 86  ? -6.885  72.657 63.848 1.00 39.80  ? 86   PRO A CA  1 
ATOM   649  C C   . PRO A 1 86  ? -7.424  74.035 64.232 1.00 39.80  ? 86   PRO A C   1 
ATOM   650  O O   . PRO A 1 86  ? -7.854  74.236 65.366 1.00 39.80  ? 86   PRO A O   1 
ATOM   651  C CB  . PRO A 1 86  ? -7.981  71.597 63.890 1.00 32.48  ? 86   PRO A CB  1 
ATOM   652  C CG  . PRO A 1 86  ? -7.287  70.404 64.372 1.00 32.48  ? 86   PRO A CG  1 
ATOM   653  C CD  . PRO A 1 86  ? -6.408  70.939 65.467 1.00 32.48  ? 86   PRO A CD  1 
ATOM   654  N N   . ASN A 1 87  ? -7.403  74.977 63.296 1.00 41.58  ? 87   ASN A N   1 
ATOM   655  C CA  . ASN A 1 87  ? -7.895  76.317 63.563 1.00 41.58  ? 87   ASN A CA  1 
ATOM   656  C C   . ASN A 1 87  ? -9.242  76.555 62.887 1.00 41.58  ? 87   ASN A C   1 
ATOM   657  O O   . ASN A 1 87  ? -9.615  77.689 62.602 1.00 41.58  ? 87   ASN A O   1 
ATOM   658  C CB  . ASN A 1 87  ? -6.867  77.343 63.091 1.00 43.11  ? 87   ASN A CB  1 
ATOM   659  C CG  . ASN A 1 87  ? -6.594  77.250 61.610 1.00 43.11  ? 87   ASN A CG  1 
ATOM   660  O OD1 . ASN A 1 87  ? -6.803  76.207 60.988 1.00 43.11  ? 87   ASN A OD1 1 
ATOM   661  N ND2 . ASN A 1 87  ? -6.112  78.335 61.035 1.00 43.11  ? 87   ASN A ND2 1 
ATOM   662  N N   . ARG A 1 88  ? -9.973  75.476 62.637 1.00 43.57  ? 88   ARG A N   1 
ATOM   663  C CA  . ARG A 1 88  ? -11.284 75.551 62.003 1.00 43.57  ? 88   ARG A CA  1 
ATOM   664  C C   . ARG A 1 88  ? -12.152 74.464 62.585 1.00 43.57  ? 88   ARG A C   1 
ATOM   665  O O   . ARG A 1 88  ? -11.650 73.513 63.184 1.00 43.57  ? 88   ARG A O   1 
ATOM   666  C CB  . ARG A 1 88  ? -11.186 75.290 60.505 1.00 57.01  ? 88   ARG A CB  1 
ATOM   667  C CG  . ARG A 1 88  ? -10.390 76.292 59.749 1.00 57.01  ? 88   ARG A CG  1 
ATOM   668  C CD  . ARG A 1 88  ? -11.195 77.530 59.556 1.00 57.01  ? 88   ARG A CD  1 
ATOM   669  N NE  . ARG A 1 88  ? -10.303 78.668 59.417 1.00 57.01  ? 88   ARG A NE  1 
ATOM   670  C CZ  . ARG A 1 88  ? -10.714 79.909 59.205 1.00 57.01  ? 88   ARG A CZ  1 
ATOM   671  N NH1 . ARG A 1 88  ? -12.015 80.162 59.110 1.00 57.01  ? 88   ARG A NH1 1 
ATOM   672  N NH2 . ARG A 1 88  ? -9.823  80.885 59.083 1.00 57.01  ? 88   ARG A NH2 1 
ATOM   673  N N   . GLU A 1 89  ? -13.456 74.594 62.384 1.00 46.52  ? 89   GLU A N   1 
ATOM   674  C CA  . GLU A 1 89  ? -14.406 73.600 62.855 1.00 46.52  ? 89   GLU A CA  1 
ATOM   675  C C   . GLU A 1 89  ? -13.974 72.240 62.292 1.00 46.52  ? 89   GLU A C   1 
ATOM   676  O O   . GLU A 1 89  ? -13.665 72.137 61.111 1.00 46.52  ? 89   GLU A O   1 
ATOM   677  C CB  . GLU A 1 89  ? -15.787 73.931 62.306 1.00 94.00  ? 89   GLU A CB  1 
ATOM   678  C CG  . GLU A 1 89  ? -16.920 73.592 63.235 1.00 94.00  ? 89   GLU A CG  1 
ATOM   679  C CD  . GLU A 1 89  ? -17.088 74.642 64.315 1.00 94.00  ? 89   GLU A CD  1 
ATOM   680  O OE1 . GLU A 1 89  ? -17.253 75.840 63.959 1.00 94.00  ? 89   GLU A OE1 1 
ATOM   681  O OE2 . GLU A 1 89  ? -17.060 74.275 65.514 1.00 94.00  ? 89   GLU A OE2 1 
ATOM   682  N N   . MET A 1 90  ? -13.935 71.200 63.113 1.00 36.15  ? 90   MET A N   1 
ATOM   683  C CA  . MET A 1 90  ? -13.570 69.892 62.586 1.00 36.15  ? 90   MET A CA  1 
ATOM   684  C C   . MET A 1 90  ? -14.835 69.246 62.068 1.00 36.15  ? 90   MET A C   1 
ATOM   685  O O   . MET A 1 90  ? -15.916 69.475 62.603 1.00 36.15  ? 90   MET A O   1 
ATOM   686  C CB  . MET A 1 90  ? -12.939 69.006 63.660 1.00 47.31  ? 90   MET A CB  1 
ATOM   687  C CG  . MET A 1 90  ? -11.530 69.417 64.032 1.00 47.31  ? 90   MET A CG  1 
ATOM   688  S SD  . MET A 1 90  ? -10.797 68.268 65.192 1.00 47.31  ? 90   MET A SD  1 
ATOM   689  C CE  . MET A 1 90  ? -11.667 68.715 66.753 1.00 47.31  ? 90   MET A CE  1 
ATOM   690  N N   . SER A 1 91  ? -14.699 68.432 61.029 1.00 37.47  ? 91   SER A N   1 
ATOM   691  C CA  . SER A 1 91  ? -15.850 67.772 60.414 1.00 37.47  ? 91   SER A CA  1 
ATOM   692  C C   . SER A 1 91  ? -15.399 66.632 59.514 1.00 37.47  ? 91   SER A C   1 
ATOM   693  O O   . SER A 1 91  ? -14.318 66.689 58.935 1.00 37.47  ? 91   SER A O   1 
ATOM   694  C CB  . SER A 1 91  ? -16.635 68.796 59.582 1.00 34.49  ? 91   SER A CB  1 
ATOM   695  O OG  . SER A 1 91  ? -17.496 68.172 58.655 1.00 34.49  ? 91   SER A OG  1 
ATOM   696  N N   . GLU A 1 92  ? -16.221 65.595 59.391 1.00 53.15  ? 92   GLU A N   1 
ATOM   697  C CA  . GLU A 1 92  ? -15.865 64.486 58.518 1.00 53.15  ? 92   GLU A CA  1 
ATOM   698  C C   . GLU A 1 92  ? -15.859 64.933 57.057 1.00 53.15  ? 92   GLU A C   1 
ATOM   699  O O   . GLU A 1 92  ? -15.195 64.318 56.212 1.00 53.15  ? 92   GLU A O   1 
ATOM   700  C CB  . GLU A 1 92  ? -16.819 63.319 58.716 1.00 52.33  ? 92   GLU A CB  1 
ATOM   701  C CG  . GLU A 1 92  ? -16.432 62.442 59.891 1.00 52.33  ? 92   GLU A CG  1 
ATOM   702  C CD  . GLU A 1 92  ? -17.190 61.123 59.904 1.00 52.33  ? 92   GLU A CD  1 
ATOM   703  O OE1 . GLU A 1 92  ? -18.356 61.099 60.360 1.00 52.33  ? 92   GLU A OE1 1 
ATOM   704  O OE2 . GLU A 1 92  ? -16.615 60.108 59.439 1.00 52.33  ? 92   GLU A OE2 1 
ATOM   705  N N   . ASP A 1 93  ? -16.594 66.004 56.764 1.00 43.05  ? 93   ASP A N   1 
ATOM   706  C CA  . ASP A 1 93  ? -16.646 66.572 55.415 1.00 43.05  ? 93   ASP A CA  1 
ATOM   707  C C   . ASP A 1 93  ? -15.464 67.546 55.342 1.00 43.05  ? 93   ASP A C   1 
ATOM   708  O O   . ASP A 1 93  ? -15.617 68.758 55.534 1.00 43.05  ? 93   ASP A O   1 
ATOM   709  C CB  . ASP A 1 93  ? -17.986 67.294 55.220 1.00 53.36  ? 93   ASP A CB  1 
ATOM   710  C CG  . ASP A 1 93  ? -18.043 68.119 53.932 1.00 53.36  ? 93   ASP A CG  1 
ATOM   711  O OD1 . ASP A 1 93  ? -17.248 67.876 52.983 1.00 53.36  ? 93   ASP A OD1 1 
ATOM   712  O OD2 . ASP A 1 93  ? -18.914 69.014 53.873 1.00 53.36  ? 93   ASP A OD2 1 
ATOM   713  N N   . CYS A 1 94  ? -14.289 66.990 55.049 1.00 46.97  ? 94   CYS A N   1 
ATOM   714  C CA  . CYS A 1 94  ? -13.035 67.738 55.026 1.00 46.97  ? 94   CYS A CA  1 
ATOM   715  C C   . CYS A 1 94  ? -12.201 67.731 53.752 1.00 46.97  ? 94   CYS A C   1 
ATOM   716  O O   . CYS A 1 94  ? -11.191 68.428 53.697 1.00 46.97  ? 94   CYS A O   1 
ATOM   717  C CB  . CYS A 1 94  ? -12.157 67.235 56.167 1.00 31.46  ? 94   CYS A CB  1 
ATOM   718  N N   . LEU A 1 95  ? -12.587 66.967 52.737 1.00 42.30  ? 95   LEU A N   1 
ATOM   719  C CA  . LEU A 1 95  ? -11.762 66.890 51.529 1.00 42.30  ? 95   LEU A CA  1 
ATOM   720  C C   . LEU A 1 95  ? -11.780 68.060 50.538 1.00 42.30  ? 95   LEU A C   1 
ATOM   721  O O   . LEU A 1 95  ? -12.444 68.005 49.504 1.00 42.30  ? 95   LEU A O   1 
ATOM   722  C CB  . LEU A 1 95  ? -12.069 65.587 50.796 1.00 30.70  ? 95   LEU A CB  1 
ATOM   723  C CG  . LEU A 1 95  ? -11.858 64.385 51.710 1.00 30.70  ? 95   LEU A CG  1 
ATOM   724  C CD1 . LEU A 1 95  ? -12.085 63.094 50.946 1.00 30.70  ? 95   LEU A CD1 1 
ATOM   725  C CD2 . LEU A 1 95  ? -10.454 64.431 52.273 1.00 30.70  ? 95   LEU A CD2 1 
ATOM   726  N N   . TYR A 1 96  ? -11.023 69.105 50.847 1.00 31.56  ? 96   TYR A N   1 
ATOM   727  C CA  . TYR A 1 96  ? -10.941 70.275 49.979 1.00 31.56  ? 96   TYR A CA  1 
ATOM   728  C C   . TYR A 1 96  ? -9.490  70.676 49.747 1.00 31.56  ? 96   TYR A C   1 
ATOM   729  O O   . TYR A 1 96  ? -8.606  70.248 50.478 1.00 31.56  ? 96   TYR A O   1 
ATOM   730  C CB  . TYR A 1 96  ? -11.677 71.461 50.604 1.00 38.06  ? 96   TYR A CB  1 
ATOM   731  C CG  . TYR A 1 96  ? -13.100 71.173 50.971 1.00 38.06  ? 96   TYR A CG  1 
ATOM   732  C CD1 . TYR A 1 96  ? -13.408 70.526 52.160 1.00 38.06  ? 96   TYR A CD1 1 
ATOM   733  C CD2 . TYR A 1 96  ? -14.136 71.521 50.117 1.00 38.06  ? 96   TYR A CD2 1 
ATOM   734  C CE1 . TYR A 1 96  ? -14.715 70.230 52.491 1.00 38.06  ? 96   TYR A CE1 1 
ATOM   735  C CE2 . TYR A 1 96  ? -15.443 71.230 50.434 1.00 38.06  ? 96   TYR A CE2 1 
ATOM   736  C CZ  . TYR A 1 96  ? -15.729 70.583 51.621 1.00 38.06  ? 96   TYR A CZ  1 
ATOM   737  O OH  . TYR A 1 96  ? -17.028 70.277 51.938 1.00 38.06  ? 96   TYR A OH  1 
ATOM   738  N N   . LEU A 1 97  ? -9.246  71.499 48.733 1.00 30.84  ? 97   LEU A N   1 
ATOM   739  C CA  . LEU A 1 97  ? -7.892  71.950 48.453 1.00 30.84  ? 97   LEU A CA  1 
ATOM   740  C C   . LEU A 1 97  ? -7.834  73.474 48.296 1.00 30.84  ? 97   LEU A C   1 
ATOM   741  O O   . LEU A 1 97  ? -8.836  74.109 47.991 1.00 30.84  ? 97   LEU A O   1 
ATOM   742  C CB  . LEU A 1 97  ? -7.339  71.224 47.219 1.00 32.92  ? 97   LEU A CB  1 
ATOM   743  C CG  . LEU A 1 97  ? -7.980  71.398 45.846 1.00 32.92  ? 97   LEU A CG  1 
ATOM   744  C CD1 . LEU A 1 97  ? -7.579  72.736 45.261 1.00 32.92  ? 97   LEU A CD1 1 
ATOM   745  C CD2 . LEU A 1 97  ? -7.521  70.282 44.933 1.00 32.92  ? 97   LEU A CD2 1 
ATOM   746  N N   . ASN A 1 98  ? -6.662  74.053 48.532 1.00 37.85  ? 98   ASN A N   1 
ATOM   747  C CA  . ASN A 1 98  ? -6.474  75.494 48.451 1.00 37.85  ? 98   ASN A CA  1 
ATOM   748  C C   . ASN A 1 98  ? -5.451  75.863 47.382 1.00 37.85  ? 98   ASN A C   1 
ATOM   749  O O   . ASN A 1 98  ? -4.398  75.232 47.290 1.00 37.85  ? 98   ASN A O   1 
ATOM   750  C CB  . ASN A 1 98  ? -5.989  76.031 49.800 1.00 42.36  ? 98   ASN A CB  1 
ATOM   751  C CG  . ASN A 1 98  ? -6.838  75.550 50.970 1.00 42.36  ? 98   ASN A CG  1 
ATOM   752  O OD1 . ASN A 1 98  ? -8.013  75.893 51.089 1.00 42.36  ? 98   ASN A OD1 1 
ATOM   753  N ND2 . ASN A 1 98  ? -6.236  74.752 51.845 1.00 42.36  ? 98   ASN A ND2 1 
ATOM   754  N N   . ILE A 1 99  ? -5.747  76.895 46.592 1.00 38.49  ? 99   ILE A N   1 
ATOM   755  C CA  . ILE A 1 99  ? -4.838  77.340 45.533 1.00 38.49  ? 99   ILE A CA  1 
ATOM   756  C C   . ILE A 1 99  ? -4.463  78.824 45.624 1.00 38.49  ? 99   ILE A C   1 
ATOM   757  O O   . ILE A 1 99  ? -5.334  79.675 45.749 1.00 38.49  ? 99   ILE A O   1 
ATOM   758  C CB  . ILE A 1 99  ? -5.454  77.119 44.136 1.00 37.05  ? 99   ILE A CB  1 
ATOM   759  C CG1 . ILE A 1 99  ? -5.900  75.664 43.975 1.00 37.05  ? 99   ILE A CG1 1 
ATOM   760  C CG2 . ILE A 1 99  ? -4.440  77.491 43.071 1.00 37.05  ? 99   ILE A CG2 1 
ATOM   761  C CD1 . ILE A 1 99  ? -6.514  75.343 42.616 1.00 37.05  ? 99   ILE A CD1 1 
ATOM   762  N N   . TRP A 1 100 ? -3.172  79.132 45.549 1.00 33.73  ? 100  TRP A N   1 
ATOM   763  C CA  . TRP A 1 100 ? -2.717  80.518 45.585 1.00 33.73  ? 100  TRP A CA  1 
ATOM   764  C C   . TRP A 1 100 ? -2.133  80.800 44.226 1.00 33.73  ? 100  TRP A C   1 
ATOM   765  O O   . TRP A 1 100 ? -1.158  80.171 43.835 1.00 33.73  ? 100  TRP A O   1 
ATOM   766  C CB  . TRP A 1 100 ? -1.658  80.718 46.665 1.00 31.79  ? 100  TRP A CB  1 
ATOM   767  C CG  . TRP A 1 100 ? -2.247  80.871 48.015 1.00 31.79  ? 100  TRP A CG  1 
ATOM   768  C CD1 . TRP A 1 100 ? -2.756  82.008 48.561 1.00 31.79  ? 100  TRP A CD1 1 
ATOM   769  C CD2 . TRP A 1 100 ? -2.444  79.838 48.981 1.00 31.79  ? 100  TRP A CD2 1 
ATOM   770  N NE1 . TRP A 1 100 ? -3.258  81.751 49.810 1.00 31.79  ? 100  TRP A NE1 1 
ATOM   771  C CE2 . TRP A 1 100 ? -3.079  80.424 50.093 1.00 31.79  ? 100  TRP A CE2 1 
ATOM   772  C CE3 . TRP A 1 100 ? -2.148  78.470 49.015 1.00 31.79  ? 100  TRP A CE3 1 
ATOM   773  C CZ2 . TRP A 1 100 ? -3.422  79.691 51.230 1.00 31.79  ? 100  TRP A CZ2 1 
ATOM   774  C CZ3 . TRP A 1 100 ? -2.492  77.738 50.151 1.00 31.79  ? 100  TRP A CZ3 1 
ATOM   775  C CH2 . TRP A 1 100 ? -3.121  78.354 51.240 1.00 31.79  ? 100  TRP A CH2 1 
ATOM   776  N N   . VAL A 1 101 ? -2.734  81.734 43.497 1.00 38.44  ? 101  VAL A N   1 
ATOM   777  C CA  . VAL A 1 101 ? -2.272  82.052 42.149 1.00 38.44  ? 101  VAL A CA  1 
ATOM   778  C C   . VAL A 1 101 ? -1.722  83.464 42.031 1.00 38.44  ? 101  VAL A C   1 
ATOM   779  O O   . VAL A 1 101 ? -2.323  84.420 42.513 1.00 38.44  ? 101  VAL A O   1 
ATOM   780  C CB  . VAL A 1 101 ? -3.415  81.909 41.107 1.00 31.88  ? 101  VAL A CB  1 
ATOM   781  C CG1 . VAL A 1 101 ? -2.851  82.016 39.700 1.00 31.88  ? 101  VAL A CG1 1 
ATOM   782  C CG2 . VAL A 1 101 ? -4.145  80.600 41.296 1.00 31.88  ? 101  VAL A CG2 1 
ATOM   783  N N   . PRO A 1 102 ? -0.561  83.611 41.384 1.00 43.94  ? 102  PRO A N   1 
ATOM   784  C CA  . PRO A 1 102 ? 0.054   84.928 41.208 1.00 43.94  ? 102  PRO A CA  1 
ATOM   785  C C   . PRO A 1 102 ? -0.851  85.884 40.419 1.00 43.94  ? 102  PRO A C   1 
ATOM   786  O O   . PRO A 1 102 ? -1.807  85.464 39.758 1.00 43.94  ? 102  PRO A O   1 
ATOM   787  C CB  . PRO A 1 102 ? 1.338   84.604 40.451 1.00 34.70  ? 102  PRO A CB  1 
ATOM   788  C CG  . PRO A 1 102 ? 1.694   83.245 40.961 1.00 34.70  ? 102  PRO A CG  1 
ATOM   789  C CD  . PRO A 1 102 ? 0.358   82.540 40.956 1.00 34.70  ? 102  PRO A CD  1 
ATOM   790  N N   . SER A 1 103 ? -0.555  87.175 40.494 1.00 52.29  ? 103  SER A N   1 
ATOM   791  C CA  . SER A 1 103 ? -1.341  88.169 39.764 1.00 52.29  ? 103  SER A CA  1 
ATOM   792  C C   . SER A 1 103 ? -0.391  89.121 39.065 1.00 52.29  ? 103  SER A C   1 
ATOM   793  O O   . SER A 1 103 ? 0.494   89.686 39.694 1.00 52.29  ? 103  SER A O   1 
ATOM   794  C CB  . SER A 1 103 ? -2.241  88.962 40.714 1.00 57.35  ? 103  SER A CB  1 
ATOM   795  O OG  . SER A 1 103 ? -2.983  89.935 39.992 1.00 57.35  ? 103  SER A OG  1 
ATOM   796  N N   . PRO A 1 104 ? -0.562  89.313 37.752 1.00 54.11  ? 104  PRO A N   1 
ATOM   797  C CA  . PRO A 1 104 ? -1.591  88.687 36.911 1.00 54.11  ? 104  PRO A CA  1 
ATOM   798  C C   . PRO A 1 104 ? -1.433  87.164 36.758 1.00 54.11  ? 104  PRO A C   1 
ATOM   799  O O   . PRO A 1 104 ? -0.318  86.639 36.813 1.00 54.11  ? 104  PRO A O   1 
ATOM   800  C CB  . PRO A 1 104 ? -1.434  89.430 35.584 1.00 48.86  ? 104  PRO A CB  1 
ATOM   801  C CG  . PRO A 1 104 ? 0.045   89.658 35.522 1.00 48.86  ? 104  PRO A CG  1 
ATOM   802  C CD  . PRO A 1 104 ? 0.349   90.136 36.933 1.00 48.86  ? 104  PRO A CD  1 
ATOM   803  N N   . ARG A 1 105 ? -2.561  86.480 36.556 1.00 47.43  ? 105  ARG A N   1 
ATOM   804  C CA  . ARG A 1 105 ? -2.616  85.021 36.389 1.00 47.43  ? 105  ARG A CA  1 
ATOM   805  C C   . ARG A 1 105 ? -1.604  84.560 35.354 1.00 47.43  ? 105  ARG A C   1 
ATOM   806  O O   . ARG A 1 105 ? -1.523  85.116 34.254 1.00 47.43  ? 105  ARG A O   1 
ATOM   807  C CB  . ARG A 1 105 ? -4.026  84.590 35.952 1.00 40.97  ? 105  ARG A CB  1 
ATOM   808  C CG  . ARG A 1 105 ? -4.242  83.083 35.869 1.00 40.97  ? 105  ARG A CG  1 
ATOM   809  C CD  . ARG A 1 105 ? -5.606  82.709 35.266 1.00 40.97  ? 105  ARG A CD  1 
ATOM   810  N NE  . ARG A 1 105 ? -6.737  83.115 36.100 1.00 40.97  ? 105  ARG A NE  1 
ATOM   811  C CZ  . ARG A 1 105 ? -8.010  83.074 35.710 1.00 40.97  ? 105  ARG A CZ  1 
ATOM   812  N NH1 . ARG A 1 105 ? -8.330  82.645 34.499 1.00 40.97  ? 105  ARG A NH1 1 
ATOM   813  N NH2 . ARG A 1 105 ? -8.969  83.483 36.523 1.00 40.97  ? 105  ARG A NH2 1 
ATOM   814  N N   . PRO A 1 106 ? -0.810  83.535 35.693 1.00 49.15  ? 106  PRO A N   1 
ATOM   815  C CA  . PRO A 1 106 ? 0.202   83.013 34.766 1.00 49.15  ? 106  PRO A CA  1 
ATOM   816  C C   . PRO A 1 106 ? -0.485  82.288 33.618 1.00 49.15  ? 106  PRO A C   1 
ATOM   817  O O   . PRO A 1 106 ? -1.701  82.093 33.639 1.00 49.15  ? 106  PRO A O   1 
ATOM   818  C CB  . PRO A 1 106 ? 1.007   82.041 35.630 1.00 43.40  ? 106  PRO A CB  1 
ATOM   819  C CG  . PRO A 1 106 ? 0.702   82.467 37.050 1.00 43.40  ? 106  PRO A CG  1 
ATOM   820  C CD  . PRO A 1 106 ? -0.746  82.839 36.986 1.00 43.40  ? 106  PRO A CD  1 
ATOM   821  N N   . LYS A 1 107 ? 0.288   81.890 32.619 1.00 58.22  ? 107  LYS A N   1 
ATOM   822  C CA  . LYS A 1 107 ? -0.272  81.159 31.494 1.00 58.22  ? 107  LYS A CA  1 
ATOM   823  C C   . LYS A 1 107 ? 0.053   79.684 31.689 1.00 58.22  ? 107  LYS A C   1 
ATOM   824  O O   . LYS A 1 107 ? -0.796  78.821 31.480 1.00 58.22  ? 107  LYS A O   1 
ATOM   825  C CB  . LYS A 1 107 ? 0.318   81.657 30.176 1.00 54.39  ? 107  LYS A CB  1 
ATOM   826  C CG  . LYS A 1 107 ? 0.046   83.119 29.906 1.00 54.39  ? 107  LYS A CG  1 
ATOM   827  C CD  . LYS A 1 107 ? -1.439  83.414 30.036 1.00 54.39  ? 107  LYS A CD  1 
ATOM   828  C CE  . LYS A 1 107 ? -1.730  84.905 29.880 1.00 54.39  ? 107  LYS A CE  1 
ATOM   829  N NZ  . LYS A 1 107 ? -3.198  85.178 29.983 1.00 54.39  ? 107  LYS A NZ  1 
ATOM   830  N N   . SER A 1 108 ? 1.277   79.387 32.109 1.00 54.00  ? 108  SER A N   1 
ATOM   831  C CA  . SER A 1 108 ? 1.657   77.999 32.321 1.00 54.00  ? 108  SER A CA  1 
ATOM   832  C C   . SER A 1 108 ? 2.880   77.931 33.230 1.00 54.00  ? 108  SER A C   1 
ATOM   833  O O   . SER A 1 108 ? 3.955   77.519 32.808 1.00 54.00  ? 108  SER A O   1 
ATOM   834  C CB  . SER A 1 108 ? 1.954   77.351 30.967 1.00 54.82  ? 108  SER A CB  1 
ATOM   835  O OG  . SER A 1 108 ? 2.075   75.946 31.081 1.00 54.82  ? 108  SER A OG  1 
ATOM   836  N N   . THR A 1 109 ? 2.713   78.332 34.482 1.00 40.43  ? 109  THR A N   1 
ATOM   837  C CA  . THR A 1 109 ? 3.822   78.336 35.421 1.00 40.43  ? 109  THR A CA  1 
ATOM   838  C C   . THR A 1 109 ? 3.940   77.055 36.264 1.00 40.43  ? 109  THR A C   1 
ATOM   839  O O   . THR A 1 109 ? 3.047   76.206 36.261 1.00 40.43  ? 109  THR A O   1 
ATOM   840  C CB  . THR A 1 109 ? 3.717   79.563 36.361 1.00 46.26  ? 109  THR A CB  1 
ATOM   841  O OG1 . THR A 1 109 ? 4.935   79.705 37.101 1.00 46.26  ? 109  THR A OG1 1 
ATOM   842  C CG2 . THR A 1 109 ? 2.565   79.397 37.343 1.00 46.26  ? 109  THR A CG2 1 
ATOM   843  N N   . THR A 1 110 ? 5.048   76.934 36.992 1.00 42.11  ? 110  THR A N   1 
ATOM   844  C CA  . THR A 1 110 ? 5.318   75.779 37.847 1.00 42.11  ? 110  THR A CA  1 
ATOM   845  C C   . THR A 1 110 ? 4.343   75.619 39.010 1.00 42.11  ? 110  THR A C   1 
ATOM   846  O O   . THR A 1 110 ? 3.973   76.595 39.658 1.00 42.11  ? 110  THR A O   1 
ATOM   847  C CB  . THR A 1 110 ? 6.717   75.863 38.435 1.00 47.10  ? 110  THR A CB  1 
ATOM   848  O OG1 . THR A 1 110 ? 7.663   75.999 37.371 1.00 47.10  ? 110  THR A OG1 1 
ATOM   849  C CG2 . THR A 1 110 ? 7.029   74.615 39.248 1.00 47.10  ? 110  THR A CG2 1 
ATOM   850  N N   . VAL A 1 111 ? 3.949   74.374 39.277 1.00 40.78  ? 111  VAL A N   1 
ATOM   851  C CA  . VAL A 1 111 ? 3.015   74.063 40.355 1.00 40.78  ? 111  VAL A CA  1 
ATOM   852  C C   . VAL A 1 111 ? 3.679   73.312 41.519 1.00 40.78  ? 111  VAL A C   1 
ATOM   853  O O   . VAL A 1 111 ? 4.537   72.453 41.315 1.00 40.78  ? 111  VAL A O   1 
ATOM   854  C CB  . VAL A 1 111 ? 1.844   73.202 39.825 1.00 32.02  ? 111  VAL A CB  1 
ATOM   855  C CG1 . VAL A 1 111 ? 0.867   72.880 40.950 1.00 32.02  ? 111  VAL A CG1 1 
ATOM   856  C CG2 . VAL A 1 111 ? 1.144   73.928 38.700 1.00 32.02  ? 111  VAL A CG2 1 
ATOM   857  N N   . MET A 1 112 ? 3.278   73.647 42.740 1.00 34.34  ? 112  MET A N   1 
ATOM   858  C CA  . MET A 1 112 ? 3.803   72.985 43.925 1.00 34.34  ? 112  MET A CA  1 
ATOM   859  C C   . MET A 1 112 ? 2.640   72.552 44.788 1.00 34.34  ? 112  MET A C   1 
ATOM   860  O O   . MET A 1 112 ? 1.822   73.371 45.189 1.00 34.34  ? 112  MET A O   1 
ATOM   861  C CB  . MET A 1 112 ? 4.721   73.919 44.702 1.00 38.75  ? 112  MET A CB  1 
ATOM   862  C CG  . MET A 1 112 ? 5.975   74.262 43.932 1.00 38.75  ? 112  MET A CG  1 
ATOM   863  S SD  . MET A 1 112 ? 7.197   75.148 44.891 1.00 38.75  ? 112  MET A SD  1 
ATOM   864  C CE  . MET A 1 112 ? 7.951   73.829 45.788 1.00 38.75  ? 112  MET A CE  1 
ATOM   865  N N   . VAL A 1 113 ? 2.546   71.254 45.049 1.00 32.12  ? 113  VAL A N   1 
ATOM   866  C CA  . VAL A 1 113 ? 1.466   70.729 45.870 1.00 32.12  ? 113  VAL A CA  1 
ATOM   867  C C   . VAL A 1 113 ? 2.031   70.307 47.215 1.00 32.12  ? 113  VAL A C   1 
ATOM   868  O O   . VAL A 1 113 ? 2.913   69.463 47.282 1.00 32.12  ? 113  VAL A O   1 
ATOM   869  C CB  . VAL A 1 113 ? 0.779   69.525 45.183 1.00 23.64  ? 113  VAL A CB  1 
ATOM   870  C CG1 . VAL A 1 113 ? -0.365  69.018 46.037 1.00 23.64  ? 113  VAL A CG1 1 
ATOM   871  C CG2 . VAL A 1 113 ? 0.272   69.935 43.812 1.00 23.64  ? 113  VAL A CG2 1 
ATOM   872  N N   . TRP A 1 114 ? 1.513   70.905 48.284 1.00 37.15  ? 114  TRP A N   1 
ATOM   873  C CA  . TRP A 1 114 ? 1.965   70.623 49.645 1.00 37.15  ? 114  TRP A CA  1 
ATOM   874  C C   . TRP A 1 114 ? 1.081   69.639 50.404 1.00 37.15  ? 114  TRP A C   1 
ATOM   875  O O   . TRP A 1 114 ? -0.142  69.771 50.411 1.00 37.15  ? 114  TRP A O   1 
ATOM   876  C CB  . TRP A 1 114 ? 2.074   71.944 50.423 1.00 32.61  ? 114  TRP A CB  1 
ATOM   877  C CG  . TRP A 1 114 ? 2.170   71.821 51.918 1.00 32.61  ? 114  TRP A CG  1 
ATOM   878  C CD1 . TRP A 1 114 ? 1.154   71.969 52.823 1.00 32.61  ? 114  TRP A CD1 1 
ATOM   879  C CD2 . TRP A 1 114 ? 3.346   71.535 52.684 1.00 32.61  ? 114  TRP A CD2 1 
ATOM   880  N NE1 . TRP A 1 114 ? 1.623   71.796 54.102 1.00 32.61  ? 114  TRP A NE1 1 
ATOM   881  C CE2 . TRP A 1 114 ? 2.967   71.526 54.046 1.00 32.61  ? 114  TRP A CE2 1 
ATOM   882  C CE3 . TRP A 1 114 ? 4.683   71.287 52.354 1.00 32.61  ? 114  TRP A CE3 1 
ATOM   883  C CZ2 . TRP A 1 114 ? 3.883   71.277 55.077 1.00 32.61  ? 114  TRP A CZ2 1 
ATOM   884  C CZ3 . TRP A 1 114 ? 5.590   71.043 53.372 1.00 32.61  ? 114  TRP A CZ3 1 
ATOM   885  C CH2 . TRP A 1 114 ? 5.186   71.039 54.719 1.00 32.61  ? 114  TRP A CH2 1 
ATOM   886  N N   . ILE A 1 115 ? 1.713   68.646 51.030 1.00 32.76  ? 115  ILE A N   1 
ATOM   887  C CA  . ILE A 1 115 ? 1.013   67.639 51.825 1.00 32.76  ? 115  ILE A CA  1 
ATOM   888  C C   . ILE A 1 115 ? 1.469   67.771 53.285 1.00 32.76  ? 115  ILE A C   1 
ATOM   889  O O   . ILE A 1 115 ? 2.615   67.461 53.614 1.00 32.76  ? 115  ILE A O   1 
ATOM   890  C CB  . ILE A 1 115 ? 1.325   66.222 51.322 1.00 36.08  ? 115  ILE A CB  1 
ATOM   891  C CG1 . ILE A 1 115 ? 1.097   66.153 49.808 1.00 36.08  ? 115  ILE A CG1 1 
ATOM   892  C CG2 . ILE A 1 115 ? 0.440   65.215 52.043 1.00 36.08  ? 115  ILE A CG2 1 
ATOM   893  C CD1 . ILE A 1 115 ? 1.377   64.802 49.172 1.00 36.08  ? 115  ILE A CD1 1 
ATOM   894  N N   . TYR A 1 116 ? 0.573   68.230 54.159 1.00 31.08  ? 116  TYR A N   1 
ATOM   895  C CA  . TYR A 1 116 ? 0.918   68.432 55.563 1.00 31.08  ? 116  TYR A CA  1 
ATOM   896  C C   . TYR A 1 116 ? 1.251   67.157 56.310 1.00 31.08  ? 116  TYR A C   1 
ATOM   897  O O   . TYR A 1 116 ? 0.830   66.064 55.925 1.00 31.08  ? 116  TYR A O   1 
ATOM   898  C CB  . TYR A 1 116 ? -0.197  69.195 56.304 1.00 33.43  ? 116  TYR A CB  1 
ATOM   899  C CG  . TYR A 1 116 ? -1.556  68.517 56.346 1.00 33.43  ? 116  TYR A CG  1 
ATOM   900  C CD1 . TYR A 1 116 ? -1.777  67.368 57.116 1.00 33.43  ? 116  TYR A CD1 1 
ATOM   901  C CD2 . TYR A 1 116 ? -2.621  69.022 55.605 1.00 33.43  ? 116  TYR A CD2 1 
ATOM   902  C CE1 . TYR A 1 116 ? -3.028  66.744 57.139 1.00 33.43  ? 116  TYR A CE1 1 
ATOM   903  C CE2 . TYR A 1 116 ? -3.866  68.410 55.621 1.00 33.43  ? 116  TYR A CE2 1 
ATOM   904  C CZ  . TYR A 1 116 ? -4.066  67.277 56.384 1.00 33.43  ? 116  TYR A CZ  1 
ATOM   905  O OH  . TYR A 1 116 ? -5.311  66.689 56.383 1.00 33.43  ? 116  TYR A OH  1 
ATOM   906  N N   . GLY A 1 117 ? 2.027   67.315 57.379 1.00 38.71  ? 117  GLY A N   1 
ATOM   907  C CA  . GLY A 1 117 ? 2.413   66.184 58.199 1.00 38.71  ? 117  GLY A CA  1 
ATOM   908  C C   . GLY A 1 117 ? 1.535   66.129 59.431 1.00 38.71  ? 117  GLY A C   1 
ATOM   909  O O   . GLY A 1 117 ? 0.548   66.854 59.513 1.00 38.71  ? 117  GLY A O   1 
ATOM   910  N N   . GLY A 1 118 ? 1.883   65.279 60.392 1.00 38.57  ? 118  GLY A N   1 
ATOM   911  C CA  . GLY A 1 118 ? 1.078   65.174 61.595 1.00 38.57  ? 118  GLY A CA  1 
ATOM   912  C C   . GLY A 1 118 ? 0.976   63.751 62.095 1.00 38.57  ? 118  GLY A C   1 
ATOM   913  O O   . GLY A 1 118 ? 0.032   63.402 62.795 1.00 38.57  ? 118  GLY A O   1 
ATOM   914  N N   . GLY A 1 119 ? 1.953   62.926 61.728 1.00 37.03  ? 119  GLY A N   1 
ATOM   915  C CA  . GLY A 1 119 ? 1.957   61.543 62.164 1.00 37.03  ? 119  GLY A CA  1 
ATOM   916  C C   . GLY A 1 119 ? 0.784   60.733 61.663 1.00 37.03  ? 119  GLY A C   1 
ATOM   917  O O   . GLY A 1 119 ? 0.478   59.683 62.215 1.00 37.03  ? 119  GLY A O   1 
ATOM   918  N N   . PHE A 1 120 ? 0.128   61.216 60.615 1.00 39.32  ? 120  PHE A N   1 
ATOM   919  C CA  . PHE A 1 120 ? -1.024  60.529 60.040 1.00 39.32  ? 120  PHE A CA  1 
ATOM   920  C C   . PHE A 1 120 ? -2.231  60.532 60.978 1.00 39.32  ? 120  PHE A C   1 
ATOM   921  O O   . PHE A 1 120 ? -3.219  59.850 60.712 1.00 39.32  ? 120  PHE A O   1 
ATOM   922  C CB  . PHE A 1 120 ? -0.674  59.076 59.673 1.00 24.75  ? 120  PHE A CB  1 
ATOM   923  C CG  . PHE A 1 120 ? 0.243   58.943 58.491 1.00 24.75  ? 120  PHE A CG  1 
ATOM   924  C CD1 . PHE A 1 120 ? -0.123  59.443 57.247 1.00 24.75  ? 120  PHE A CD1 1 
ATOM   925  C CD2 . PHE A 1 120 ? 1.477   58.313 58.619 1.00 24.75  ? 120  PHE A CD2 1 
ATOM   926  C CE1 . PHE A 1 120 ? 0.723   59.318 56.155 1.00 24.75  ? 120  PHE A CE1 1 
ATOM   927  C CE2 . PHE A 1 120 ? 2.334   58.185 57.525 1.00 24.75  ? 120  PHE A CE2 1 
ATOM   928  C CZ  . PHE A 1 120 ? 1.954   58.689 56.293 1.00 24.75  ? 120  PHE A CZ  1 
ATOM   929  N N   . TYR A 1 121 ? -2.162  61.292 62.066 1.00 34.23  ? 121  TYR A N   1 
ATOM   930  C CA  . TYR A 1 121 ? -3.282  61.351 63.001 1.00 34.23  ? 121  TYR A CA  1 
ATOM   931  C C   . TYR A 1 121 ? -3.776  62.776 63.229 1.00 34.23  ? 121  TYR A C   1 
ATOM   932  O O   . TYR A 1 121 ? -4.730  63.000 63.968 1.00 34.23  ? 121  TYR A O   1 
ATOM   933  C CB  . TYR A 1 121 ? -2.891  60.735 64.347 1.00 33.26  ? 121  TYR A CB  1 
ATOM   934  C CG  . TYR A 1 121 ? -1.945  61.574 65.166 1.00 33.26  ? 121  TYR A CG  1 
ATOM   935  C CD1 . TYR A 1 121 ? -2.405  62.661 65.907 1.00 33.26  ? 121  TYR A CD1 1 
ATOM   936  C CD2 . TYR A 1 121 ? -0.585  61.279 65.198 1.00 33.26  ? 121  TYR A CD2 1 
ATOM   937  C CE1 . TYR A 1 121 ? -1.533  63.433 66.663 1.00 33.26  ? 121  TYR A CE1 1 
ATOM   938  C CE2 . TYR A 1 121 ? 0.299   62.039 65.946 1.00 33.26  ? 121  TYR A CE2 1 
ATOM   939  C CZ  . TYR A 1 121 ? -0.178  63.114 66.679 1.00 33.26  ? 121  TYR A CZ  1 
ATOM   940  O OH  . TYR A 1 121 ? 0.709   63.861 67.423 1.00 33.26  ? 121  TYR A OH  1 
ATOM   941  N N   . SER A 1 122 ? -3.121  63.736 62.594 1.00 29.35  ? 122  SER A N   1 
ATOM   942  C CA  . SER A 1 122 ? -3.490  65.126 62.746 1.00 29.35  ? 122  SER A CA  1 
ATOM   943  C C   . SER A 1 122 ? -2.993  65.890 61.553 1.00 29.35  ? 122  SER A C   1 
ATOM   944  O O   . SER A 1 122 ? -2.404  65.308 60.658 1.00 29.35  ? 122  SER A O   1 
ATOM   945  C CB  . SER A 1 122 ? -2.861  65.683 64.006 1.00 44.79  ? 122  SER A CB  1 
ATOM   946  O OG  . SER A 1 122 ? -1.491  65.333 64.054 1.00 44.79  ? 122  SER A OG  1 
ATOM   947  N N   . GLY A 1 123 ? -3.234  67.195 61.548 1.00 38.64  ? 123  GLY A N   1 
ATOM   948  C CA  . GLY A 1 123 ? -2.801  68.031 60.442 1.00 38.64  ? 123  GLY A CA  1 
ATOM   949  C C   . GLY A 1 123 ? -3.935  68.757 59.739 1.00 38.64  ? 123  GLY A C   1 
ATOM   950  O O   . GLY A 1 123 ? -5.038  68.240 59.625 1.00 38.64  ? 123  GLY A O   1 
ATOM   951  N N   . SER A 1 124 ? -3.660  69.960 59.257 1.00 36.02  ? 124  SER A N   1 
ATOM   952  C CA  . SER A 1 124 ? -4.657  70.757 58.565 1.00 36.02  ? 124  SER A CA  1 
ATOM   953  C C   . SER A 1 124 ? -3.943  71.543 57.480 1.00 36.02  ? 124  SER A C   1 
ATOM   954  O O   . SER A 1 124 ? -2.757  71.822 57.600 1.00 36.02  ? 124  SER A O   1 
ATOM   955  C CB  . SER A 1 124 ? -5.317  71.727 59.540 1.00 47.85  ? 124  SER A CB  1 
ATOM   956  O OG  . SER A 1 124 ? -5.879  71.040 60.648 1.00 47.85  ? 124  SER A OG  1 
ATOM   957  N N   . SER A 1 125 ? -4.647  71.902 56.416 1.00 50.76  ? 125  SER A N   1 
ATOM   958  C CA  . SER A 1 125 ? -4.022  72.665 55.340 1.00 50.76  ? 125  SER A CA  1 
ATOM   959  C C   . SER A 1 125 ? -4.186  74.157 55.613 1.00 50.76  ? 125  SER A C   1 
ATOM   960  O O   . SER A 1 125 ? -3.558  74.999 54.969 1.00 50.76  ? 125  SER A O   1 
ATOM   961  C CB  . SER A 1 125 ? -4.688  72.334 54.004 1.00 43.75  ? 125  SER A CB  1 
ATOM   962  O OG  . SER A 1 125 ? -6.025  72.808 53.980 1.00 43.75  ? 125  SER A OG  1 
ATOM   963  N N   . THR A 1 126 ? -5.023  74.465 56.593 1.00 45.22  ? 126  THR A N   1 
ATOM   964  C CA  . THR A 1 126 ? -5.349  75.832 56.937 1.00 45.22  ? 126  THR A CA  1 
ATOM   965  C C   . THR A 1 126 ? -4.537  76.488 58.053 1.00 45.22  ? 126  THR A C   1 
ATOM   966  O O   . THR A 1 126 ? -4.888  77.574 58.516 1.00 45.22  ? 126  THR A O   1 
ATOM   967  C CB  . THR A 1 126 ? -6.830  75.890 57.292 1.00 41.71  ? 126  THR A CB  1 
ATOM   968  O OG1 . THR A 1 126 ? -7.074  75.063 58.442 1.00 41.71  ? 126  THR A OG1 1 
ATOM   969  C CG2 . THR A 1 126 ? -7.662  75.356 56.128 1.00 41.71  ? 126  THR A CG2 1 
ATOM   970  N N   . LEU A 1 127 ? -3.459  75.853 58.496 1.00 40.12  ? 127  LEU A N   1 
ATOM   971  C CA  . LEU A 1 127 ? -2.647  76.440 59.555 1.00 40.12  ? 127  LEU A CA  1 
ATOM   972  C C   . LEU A 1 127 ? -1.953  77.690 59.030 1.00 40.12  ? 127  LEU A C   1 
ATOM   973  O O   . LEU A 1 127 ? -1.668  77.786 57.839 1.00 40.12  ? 127  LEU A O   1 
ATOM   974  C CB  . LEU A 1 127 ? -1.588  75.453 60.030 1.00 44.23  ? 127  LEU A CB  1 
ATOM   975  C CG  . LEU A 1 127 ? -2.094  74.114 60.555 1.00 44.23  ? 127  LEU A CG  1 
ATOM   976  C CD1 . LEU A 1 127 ? -0.915  73.282 61.055 1.00 44.23  ? 127  LEU A CD1 1 
ATOM   977  C CD2 . LEU A 1 127 ? -3.098  74.358 61.668 1.00 44.23  ? 127  LEU A CD2 1 
ATOM   978  N N   . ASP A 1 128 ? -1.673  78.641 59.917 1.00 45.15  ? 128  ASP A N   1 
ATOM   979  C CA  . ASP A 1 128 ? -1.001  79.876 59.513 1.00 45.15  ? 128  ASP A CA  1 
ATOM   980  C C   . ASP A 1 128 ? 0.357   79.556 58.881 1.00 45.15  ? 128  ASP A C   1 
ATOM   981  O O   . ASP A 1 128 ? 0.734   80.123 57.854 1.00 45.15  ? 128  ASP A O   1 
ATOM   982  C CB  . ASP A 1 128 ? -0.803  80.809 60.720 1.00 69.99  ? 128  ASP A CB  1 
ATOM   983  C CG  . ASP A 1 128 ? -2.130  81.212 61.392 1.00 69.99  ? 128  ASP A CG  1 
ATOM   984  O OD1 . ASP A 1 128 ? -3.170  81.245 60.686 1.00 69.99  ? 128  ASP A OD1 1 
ATOM   985  O OD2 . ASP A 1 128 ? -2.131  81.512 62.622 1.00 69.99  ? 128  ASP A OD2 1 
ATOM   986  N N   . VAL A 1 129 ? 1.083   78.638 59.503 1.00 49.32  ? 129  VAL A N   1 
ATOM   987  C CA  . VAL A 1 129 ? 2.395   78.221 59.027 1.00 49.32  ? 129  VAL A CA  1 
ATOM   988  C C   . VAL A 1 129 ? 2.370   77.711 57.586 1.00 49.32  ? 129  VAL A C   1 
ATOM   989  O O   . VAL A 1 129 ? 3.407   77.693 56.920 1.00 49.32  ? 129  VAL A O   1 
ATOM   990  C CB  . VAL A 1 129 ? 2.951   77.080 59.891 1.00 45.75  ? 129  VAL A CB  1 
ATOM   991  C CG1 . VAL A 1 129 ? 4.428   77.270 60.101 1.00 45.75  ? 129  VAL A CG1 1 
ATOM   992  C CG2 . VAL A 1 129 ? 2.197   77.009 61.208 1.00 45.75  ? 129  VAL A CG2 1 
ATOM   993  N N   . TYR A 1 130 ? 1.203   77.279 57.108 1.00 42.97  ? 130  TYR A N   1 
ATOM   994  C CA  . TYR A 1 130 ? 1.098   76.740 55.751 1.00 42.97  ? 130  TYR A CA  1 
ATOM   995  C C   . TYR A 1 130 ? 0.506   77.693 54.721 1.00 42.97  ? 130  TYR A C   1 
ATOM   996  O O   . TYR A 1 130 ? 0.057   77.253 53.669 1.00 42.97  ? 130  TYR A O   1 
ATOM   997  C CB  . TYR A 1 130 ? 0.267   75.445 55.743 1.00 35.53  ? 130  TYR A CB  1 
ATOM   998  C CG  . TYR A 1 130 ? 0.796   74.318 56.612 1.00 35.53  ? 130  TYR A CG  1 
ATOM   999  C CD1 . TYR A 1 130 ? 2.164   74.106 56.774 1.00 35.53  ? 130  TYR A CD1 1 
ATOM   1000 C CD2 . TYR A 1 130 ? -0.079  73.452 57.260 1.00 35.53  ? 130  TYR A CD2 1 
ATOM   1001 C CE1 . TYR A 1 130 ? 2.643   73.065 57.564 1.00 35.53  ? 130  TYR A CE1 1 
ATOM   1002 C CE2 . TYR A 1 130 ? 0.387   72.406 58.050 1.00 35.53  ? 130  TYR A CE2 1 
ATOM   1003 C CZ  . TYR A 1 130 ? 1.743   72.217 58.200 1.00 35.53  ? 130  TYR A CZ  1 
ATOM   1004 O OH  . TYR A 1 130 ? 2.193   71.181 58.989 1.00 35.53  ? 130  TYR A OH  1 
ATOM   1005 N N   . ASN A 1 131 ? 0.506   78.992 55.011 1.00 51.25  ? 131  ASN A N   1 
ATOM   1006 C CA  . ASN A 1 131 ? -0.060  79.984 54.088 1.00 51.25  ? 131  ASN A CA  1 
ATOM   1007 C C   . ASN A 1 131 ? 0.755   80.078 52.798 1.00 51.25  ? 131  ASN A C   1 
ATOM   1008 O O   . ASN A 1 131 ? 1.876   80.592 52.790 1.00 51.25  ? 131  ASN A O   1 
ATOM   1009 C CB  . ASN A 1 131 ? -0.115  81.356 54.754 1.00 50.66  ? 131  ASN A CB  1 
ATOM   1010 C CG  . ASN A 1 131 ? -1.158  82.262 54.129 1.00 50.66  ? 131  ASN A CG  1 
ATOM   1011 O OD1 . ASN A 1 131 ? -1.408  82.204 52.916 1.00 50.66  ? 131  ASN A OD1 1 
ATOM   1012 N ND2 . ASN A 1 131 ? -1.769  83.117 54.954 1.00 50.66  ? 131  ASN A ND2 1 
ATOM   1013 N N   . GLY A 1 132 ? 0.177   79.602 51.702 1.00 39.04  ? 132  GLY A N   1 
ATOM   1014 C CA  . GLY A 1 132 ? 0.893   79.609 50.440 1.00 39.04  ? 132  GLY A CA  1 
ATOM   1015 C C   . GLY A 1 132 ? 1.137   80.936 49.745 1.00 39.04  ? 132  GLY A C   1 
ATOM   1016 O O   . GLY A 1 132 ? 1.943   81.000 48.819 1.00 39.04  ? 132  GLY A O   1 
ATOM   1017 N N   . LYS A 1 133 ? 0.474   81.997 50.186 1.00 50.69  ? 133  LYS A N   1 
ATOM   1018 C CA  . LYS A 1 133 ? 0.635   83.288 49.529 1.00 50.69  ? 133  LYS A CA  1 
ATOM   1019 C C   . LYS A 1 133 ? 2.055   83.861 49.469 1.00 50.69  ? 133  LYS A C   1 
ATOM   1020 O O   . LYS A 1 133 ? 2.458   84.383 48.424 1.00 50.69  ? 133  LYS A O   1 
ATOM   1021 C CB  . LYS A 1 133 ? -0.306  84.318 50.148 1.00 48.43  ? 133  LYS A CB  1 
ATOM   1022 C CG  . LYS A 1 133 ? 0.068   84.744 51.539 1.00 48.43  ? 133  LYS A CG  1 
ATOM   1023 C CD  . LYS A 1 133 ? -0.923  85.773 52.023 1.00 48.43  ? 133  LYS A CD  1 
ATOM   1024 C CE  . LYS A 1 133 ? -0.499  86.400 53.329 1.00 48.43  ? 133  LYS A CE  1 
ATOM   1025 N NZ  . LYS A 1 133 ? -1.437  87.503 53.703 1.00 48.43  ? 133  LYS A NZ  1 
ATOM   1026 N N   . TYR A 1 134 ? 2.818   83.771 50.556 1.00 40.50  ? 134  TYR A N   1 
ATOM   1027 C CA  . TYR A 1 134 ? 4.172   84.318 50.546 1.00 40.50  ? 134  TYR A CA  1 
ATOM   1028 C C   . TYR A 1 134 ? 5.028   83.648 49.489 1.00 40.50  ? 134  TYR A C   1 
ATOM   1029 O O   . TYR A 1 134 ? 5.740   84.313 48.745 1.00 40.50  ? 134  TYR A O   1 
ATOM   1030 C CB  . TYR A 1 134 ? 4.852   84.149 51.907 1.00 41.00  ? 134  TYR A CB  1 
ATOM   1031 C CG  . TYR A 1 134 ? 4.102   84.766 53.054 1.00 41.00  ? 134  TYR A CG  1 
ATOM   1032 C CD1 . TYR A 1 134 ? 3.942   86.150 53.149 1.00 41.00  ? 134  TYR A CD1 1 
ATOM   1033 C CD2 . TYR A 1 134 ? 3.514   83.961 54.028 1.00 41.00  ? 134  TYR A CD2 1 
ATOM   1034 C CE1 . TYR A 1 134 ? 3.203   86.721 54.191 1.00 41.00  ? 134  TYR A CE1 1 
ATOM   1035 C CE2 . TYR A 1 134 ? 2.771   84.515 55.073 1.00 41.00  ? 134  TYR A CE2 1 
ATOM   1036 C CZ  . TYR A 1 134 ? 2.617   85.895 55.149 1.00 41.00  ? 134  TYR A CZ  1 
ATOM   1037 O OH  . TYR A 1 134 ? 1.863   86.429 56.170 1.00 41.00  ? 134  TYR A OH  1 
ATOM   1038 N N   . LEU A 1 135 ? 4.953   82.327 49.419 1.00 35.83  ? 135  LEU A N   1 
ATOM   1039 C CA  . LEU A 1 135 ? 5.746   81.564 48.464 1.00 35.83  ? 135  LEU A CA  1 
ATOM   1040 C C   . LEU A 1 135 ? 5.249   81.758 47.032 1.00 35.83  ? 135  LEU A C   1 
ATOM   1041 O O   . LEU A 1 135 ? 6.043   81.947 46.106 1.00 35.83  ? 135  LEU A O   1 
ATOM   1042 C CB  . LEU A 1 135 ? 5.716   80.082 48.861 1.00 39.16  ? 135  LEU A CB  1 
ATOM   1043 C CG  . LEU A 1 135 ? 6.558   79.042 48.121 1.00 39.16  ? 135  LEU A CG  1 
ATOM   1044 C CD1 . LEU A 1 135 ? 8.027   79.453 48.109 1.00 39.16  ? 135  LEU A CD1 1 
ATOM   1045 C CD2 . LEU A 1 135 ? 6.376   77.696 48.810 1.00 39.16  ? 135  LEU A CD2 1 
ATOM   1046 N N   . ALA A 1 136 ? 3.933   81.714 46.847 1.00 49.57  ? 136  ALA A N   1 
ATOM   1047 C CA  . ALA A 1 136 ? 3.351   81.894 45.522 1.00 49.57  ? 136  ALA A CA  1 
ATOM   1048 C C   . ALA A 1 136 ? 3.795   83.252 45.003 1.00 49.57  ? 136  ALA A C   1 
ATOM   1049 O O   . ALA A 1 136 ? 4.230   83.393 43.859 1.00 49.57  ? 136  ALA A O   1 
ATOM   1050 C CB  . ALA A 1 136 ? 1.828   81.830 45.602 1.00 36.62  ? 136  ALA A CB  1 
ATOM   1051 N N   . TYR A 1 137 ? 3.696   84.253 45.866 1.00 50.87  ? 137  TYR A N   1 
ATOM   1052 C CA  . TYR A 1 137 ? 4.081   85.602 45.508 1.00 50.87  ? 137  TYR A CA  1 
ATOM   1053 C C   . TYR A 1 137 ? 5.569   85.724 45.212 1.00 50.87  ? 137  TYR A C   1 
ATOM   1054 O O   . TYR A 1 137 ? 5.954   86.067 44.100 1.00 50.87  ? 137  TYR A O   1 
ATOM   1055 C CB  . TYR A 1 137 ? 3.718   86.561 46.635 1.00 52.68  ? 137  TYR A CB  1 
ATOM   1056 C CG  . TYR A 1 137 ? 4.107   87.981 46.338 1.00 52.68  ? 137  TYR A CG  1 
ATOM   1057 C CD1 . TYR A 1 137 ? 3.452   88.701 45.339 1.00 52.68  ? 137  TYR A CD1 1 
ATOM   1058 C CD2 . TYR A 1 137 ? 5.134   88.610 47.048 1.00 52.68  ? 137  TYR A CD2 1 
ATOM   1059 C CE1 . TYR A 1 137 ? 3.804   90.021 45.050 1.00 52.68  ? 137  TYR A CE1 1 
ATOM   1060 C CE2 . TYR A 1 137 ? 5.502   89.932 46.771 1.00 52.68  ? 137  TYR A CE2 1 
ATOM   1061 C CZ  . TYR A 1 137 ? 4.829   90.630 45.771 1.00 52.68  ? 137  TYR A CZ  1 
ATOM   1062 O OH  . TYR A 1 137 ? 5.164   91.936 45.484 1.00 52.68  ? 137  TYR A OH  1 
ATOM   1063 N N   . THR A 1 138 ? 6.403   85.428 46.202 1.00 49.90  ? 138  THR A N   1 
ATOM   1064 C CA  . THR A 1 138 ? 7.848   85.562 46.047 1.00 49.90  ? 138  THR A CA  1 
ATOM   1065 C C   . THR A 1 138 ? 8.521   84.780 44.925 1.00 49.90  ? 138  THR A C   1 
ATOM   1066 O O   . THR A 1 138 ? 9.422   85.308 44.279 1.00 49.90  ? 138  THR A O   1 
ATOM   1067 C CB  . THR A 1 138 ? 8.577   85.254 47.370 1.00 43.03  ? 138  THR A CB  1 
ATOM   1068 O OG1 . THR A 1 138 ? 8.088   86.134 48.389 1.00 43.03  ? 138  THR A OG1 1 
ATOM   1069 C CG2 . THR A 1 138 ? 10.077  85.470 47.218 1.00 43.03  ? 138  THR A CG2 1 
ATOM   1070 N N   . GLU A 1 139 ? 8.101   83.542 44.677 1.00 51.43  ? 139  GLU A N   1 
ATOM   1071 C CA  . GLU A 1 139 ? 8.726   82.747 43.616 1.00 51.43  ? 139  GLU A CA  1 
ATOM   1072 C C   . GLU A 1 139 ? 7.893   82.655 42.329 1.00 51.43  ? 139  GLU A C   1 
ATOM   1073 O O   . GLU A 1 139 ? 8.358   82.119 41.318 1.00 51.43  ? 139  GLU A O   1 
ATOM   1074 C CB  . GLU A 1 139 ? 9.042   81.335 44.119 1.00 56.75  ? 139  GLU A CB  1 
ATOM   1075 C CG  . GLU A 1 139 ? 10.125  81.262 45.191 1.00 56.75  ? 139  GLU A CG  1 
ATOM   1076 C CD  . GLU A 1 139 ? 11.476  81.830 44.729 1.00 56.75  ? 139  GLU A CD  1 
ATOM   1077 O OE1 . GLU A 1 139 ? 12.004  81.395 43.669 1.00 56.75  ? 139  GLU A OE1 1 
ATOM   1078 O OE2 . GLU A 1 139 ? 12.019  82.712 45.432 1.00 56.75  ? 139  GLU A OE2 1 
ATOM   1079 N N   . GLU A 1 140 ? 6.666   83.173 42.364 1.00 51.71  ? 140  GLU A N   1 
ATOM   1080 C CA  . GLU A 1 140 ? 5.793   83.152 41.191 1.00 51.71  ? 140  GLU A CA  1 
ATOM   1081 C C   . GLU A 1 140 ? 5.436   81.726 40.761 1.00 51.71  ? 140  GLU A C   1 
ATOM   1082 O O   . GLU A 1 140 ? 5.717   81.316 39.630 1.00 51.71  ? 140  GLU A O   1 
ATOM   1083 C CB  . GLU A 1 140 ? 6.469   83.869 40.012 1.00 94.33  ? 140  GLU A CB  1 
ATOM   1084 C CG  . GLU A 1 140 ? 7.017   85.261 40.334 1.00 94.33  ? 140  GLU A CG  1 
ATOM   1085 C CD  . GLU A 1 140 ? 7.876   85.833 39.199 1.00 94.33  ? 140  GLU A CD  1 
ATOM   1086 O OE1 . GLU A 1 140 ? 7.307   86.099 38.111 1.00 94.33  ? 140  GLU A OE1 1 
ATOM   1087 O OE2 . GLU A 1 140 ? 9.113   86.008 39.393 1.00 94.33  ? 140  GLU A OE2 1 
ATOM   1088 N N   . VAL A 1 141 ? 4.826   80.965 41.657 1.00 37.55  ? 141  VAL A N   1 
ATOM   1089 C CA  . VAL A 1 141 ? 4.430   79.608 41.325 1.00 37.55  ? 141  VAL A CA  1 
ATOM   1090 C C   . VAL A 1 141 ? 2.999   79.431 41.813 1.00 37.55  ? 141  VAL A C   1 
ATOM   1091 O O   . VAL A 1 141 ? 2.541   80.186 42.668 1.00 37.55  ? 141  VAL A O   1 
ATOM   1092 C CB  . VAL A 1 141 ? 5.348   78.556 42.023 1.00 44.94  ? 141  VAL A CB  1 
ATOM   1093 C CG1 . VAL A 1 141 ? 6.814   78.910 41.812 1.00 44.94  ? 141  VAL A CG1 1 
ATOM   1094 C CG2 . VAL A 1 141 ? 5.048   78.482 43.508 1.00 44.94  ? 141  VAL A CG2 1 
ATOM   1095 N N   . VAL A 1 142 ? 2.281   78.466 41.250 1.00 35.80  ? 142  VAL A N   1 
ATOM   1096 C CA  . VAL A 1 142 ? 0.924   78.187 41.700 1.00 35.80  ? 142  VAL A CA  1 
ATOM   1097 C C   . VAL A 1 142 ? 1.098   77.239 42.892 1.00 35.80  ? 142  VAL A C   1 
ATOM   1098 O O   . VAL A 1 142 ? 1.659   76.159 42.746 1.00 35.80  ? 142  VAL A O   1 
ATOM   1099 C CB  . VAL A 1 142 ? 0.097   77.494 40.602 1.00 28.10  ? 142  VAL A CB  1 
ATOM   1100 C CG1 . VAL A 1 142 ? -1.142  76.862 41.200 1.00 28.10  ? 142  VAL A CG1 1 
ATOM   1101 C CG2 . VAL A 1 142 ? -0.307  78.500 39.560 1.00 28.10  ? 142  VAL A CG2 1 
ATOM   1102 N N   . LEU A 1 143 ? 0.635   77.654 44.069 1.00 40.44  ? 143  LEU A N   1 
ATOM   1103 C CA  . LEU A 1 143 ? 0.768   76.847 45.283 1.00 40.44  ? 143  LEU A CA  1 
ATOM   1104 C C   . LEU A 1 143 ? -0.541  76.156 45.675 1.00 40.44  ? 143  LEU A C   1 
ATOM   1105 O O   . LEU A 1 143 ? -1.562  76.807 45.902 1.00 40.44  ? 143  LEU A O   1 
ATOM   1106 C CB  . LEU A 1 143 ? 1.257   77.735 46.439 1.00 44.96  ? 143  LEU A CB  1 
ATOM   1107 C CG  . LEU A 1 143 ? 2.175   77.128 47.509 1.00 44.96  ? 143  LEU A CG  1 
ATOM   1108 C CD1 . LEU A 1 143 ? 1.458   76.054 48.304 1.00 44.96  ? 143  LEU A CD1 1 
ATOM   1109 C CD2 . LEU A 1 143 ? 3.401   76.547 46.827 1.00 44.96  ? 143  LEU A CD2 1 
ATOM   1110 N N   . VAL A 1 144 ? -0.507  74.831 45.755 1.00 30.66  ? 144  VAL A N   1 
ATOM   1111 C CA  . VAL A 1 144 ? -1.694  74.070 46.124 1.00 30.66  ? 144  VAL A CA  1 
ATOM   1112 C C   . VAL A 1 144 ? -1.465  73.302 47.408 1.00 30.66  ? 144  VAL A C   1 
ATOM   1113 O O   . VAL A 1 144 ? -0.420  72.688 47.584 1.00 30.66  ? 144  VAL A O   1 
ATOM   1114 C CB  . VAL A 1 144 ? -2.067  73.008 45.057 1.00 26.01  ? 144  VAL A CB  1 
ATOM   1115 C CG1 . VAL A 1 144 ? -3.331  72.278 45.475 1.00 26.01  ? 144  VAL A CG1 1 
ATOM   1116 C CG2 . VAL A 1 144 ? -2.237  73.647 43.704 1.00 26.01  ? 144  VAL A CG2 1 
ATOM   1117 N N   . SER A 1 145 ? -2.429  73.344 48.315 1.00 33.86  ? 145  SER A N   1 
ATOM   1118 C CA  . SER A 1 145 ? -2.310  72.550 49.522 1.00 33.86  ? 145  SER A CA  1 
ATOM   1119 C C   . SER A 1 145 ? -3.595  71.729 49.601 1.00 33.86  ? 145  SER A C   1 
ATOM   1120 O O   . SER A 1 145 ? -4.699  72.254 49.518 1.00 33.86  ? 145  SER A O   1 
ATOM   1121 C CB  . SER A 1 145 ? -2.116  73.418 50.771 1.00 36.92  ? 145  SER A CB  1 
ATOM   1122 O OG  . SER A 1 145 ? -3.314  74.021 51.211 1.00 36.92  ? 145  SER A OG  1 
ATOM   1123 N N   . LEU A 1 146 ? -3.443  70.421 49.711 1.00 37.39  ? 146  LEU A N   1 
ATOM   1124 C CA  . LEU A 1 146 ? -4.594  69.548 49.788 1.00 37.39  ? 146  LEU A CA  1 
ATOM   1125 C C   . LEU A 1 146 ? -4.776  69.082 51.221 1.00 37.39  ? 146  LEU A C   1 
ATOM   1126 O O   . LEU A 1 146 ? -4.011  69.443 52.100 1.00 37.39  ? 146  LEU A O   1 
ATOM   1127 C CB  . LEU A 1 146 ? -4.389  68.344 48.864 1.00 32.03  ? 146  LEU A CB  1 
ATOM   1128 C CG  . LEU A 1 146 ? -3.041  67.631 48.989 1.00 32.03  ? 146  LEU A CG  1 
ATOM   1129 C CD1 . LEU A 1 146 ? -2.958  66.886 50.304 1.00 32.03  ? 146  LEU A CD1 1 
ATOM   1130 C CD2 . LEU A 1 146 ? -2.874  66.663 47.848 1.00 32.03  ? 146  LEU A CD2 1 
ATOM   1131 N N   . SER A 1 147 ? -5.800  68.279 51.445 1.00 38.99  ? 147  SER A N   1 
ATOM   1132 C CA  . SER A 1 147 ? -6.055  67.742 52.758 1.00 38.99  ? 147  SER A CA  1 
ATOM   1133 C C   . SER A 1 147 ? -6.409  66.279 52.550 1.00 38.99  ? 147  SER A C   1 
ATOM   1134 O O   . SER A 1 147 ? -6.653  65.854 51.425 1.00 38.99  ? 147  SER A O   1 
ATOM   1135 C CB  . SER A 1 147 ? -7.200  68.485 53.425 1.00 48.27  ? 147  SER A CB  1 
ATOM   1136 O OG  . SER A 1 147 ? -8.383  68.292 52.694 1.00 48.27  ? 147  SER A OG  1 
ATOM   1137 N N   . TYR A 1 148 ? -6.416  65.509 53.627 1.00 36.41  ? 148  TYR A N   1 
ATOM   1138 C CA  . TYR A 1 148 ? -6.722  64.092 53.540 1.00 36.41  ? 148  TYR A CA  1 
ATOM   1139 C C   . TYR A 1 148 ? -7.153  63.607 54.909 1.00 36.41  ? 148  TYR A C   1 
ATOM   1140 O O   . TYR A 1 148 ? -6.822  64.220 55.913 1.00 36.41  ? 148  TYR A O   1 
ATOM   1141 C CB  . TYR A 1 148 ? -5.491  63.312 53.069 1.00 29.17  ? 148  TYR A CB  1 
ATOM   1142 C CG  . TYR A 1 148 ? -4.265  63.461 53.943 1.00 29.17  ? 148  TYR A CG  1 
ATOM   1143 C CD1 . TYR A 1 148 ? -3.405  64.545 53.809 1.00 29.17  ? 148  TYR A CD1 1 
ATOM   1144 C CD2 . TYR A 1 148 ? -3.958  62.500 54.900 1.00 29.17  ? 148  TYR A CD2 1 
ATOM   1145 C CE1 . TYR A 1 148 ? -2.267  64.662 54.605 1.00 29.17  ? 148  TYR A CE1 1 
ATOM   1146 C CE2 . TYR A 1 148 ? -2.821  62.610 55.705 1.00 29.17  ? 148  TYR A CE2 1 
ATOM   1147 C CZ  . TYR A 1 148 ? -1.981  63.686 55.552 1.00 29.17  ? 148  TYR A CZ  1 
ATOM   1148 O OH  . TYR A 1 148 ? -0.854  63.761 56.340 1.00 29.17  ? 148  TYR A OH  1 
ATOM   1149 N N   . ARG A 1 149 ? -7.899  62.515 54.956 1.00 35.43  ? 149  ARG A N   1 
ATOM   1150 C CA  . ARG A 1 149 ? -8.351  62.000 56.232 1.00 35.43  ? 149  ARG A CA  1 
ATOM   1151 C C   . ARG A 1 149 ? -7.214  61.383 57.030 1.00 35.43  ? 149  ARG A C   1 
ATOM   1152 O O   . ARG A 1 149 ? -6.368  60.681 56.482 1.00 35.43  ? 149  ARG A O   1 
ATOM   1153 C CB  . ARG A 1 149 ? -9.454  60.970 56.017 1.00 32.82  ? 149  ARG A CB  1 
ATOM   1154 C CG  . ARG A 1 149 ? -10.737 61.564 55.496 1.00 32.82  ? 149  ARG A CG  1 
ATOM   1155 C CD  . ARG A 1 149 ? -11.685 60.486 55.037 1.00 32.82  ? 149  ARG A CD  1 
ATOM   1156 N NE  . ARG A 1 149 ? -11.285 59.911 53.761 1.00 32.82  ? 149  ARG A NE  1 
ATOM   1157 C CZ  . ARG A 1 149 ? -11.854 58.841 53.222 1.00 32.82  ? 149  ARG A CZ  1 
ATOM   1158 N NH1 . ARG A 1 149 ? -12.840 58.230 53.860 1.00 32.82  ? 149  ARG A NH1 1 
ATOM   1159 N NH2 . ARG A 1 149 ? -11.457 58.395 52.036 1.00 32.82  ? 149  ARG A NH2 1 
ATOM   1160 N N   . VAL A 1 150 ? -7.208  61.656 58.333 1.00 39.18  ? 150  VAL A N   1 
ATOM   1161 C CA  . VAL A 1 150 ? -6.197  61.130 59.243 1.00 39.18  ? 150  VAL A CA  1 
ATOM   1162 C C   . VAL A 1 150 ? -6.832  60.241 60.322 1.00 39.18  ? 150  VAL A C   1 
ATOM   1163 O O   . VAL A 1 150 ? -8.053  60.085 60.382 1.00 39.18  ? 150  VAL A O   1 
ATOM   1164 C CB  . VAL A 1 150 ? -5.414  62.278 59.940 1.00 30.57  ? 150  VAL A CB  1 
ATOM   1165 C CG1 . VAL A 1 150 ? -4.778  63.164 58.902 1.00 30.57  ? 150  VAL A CG1 1 
ATOM   1166 C CG2 . VAL A 1 150 ? -6.335  63.087 60.842 1.00 30.57  ? 150  VAL A CG2 1 
ATOM   1167 N N   . GLY A 1 151 ? -5.991  59.660 61.173 1.00 34.45  ? 151  GLY A N   1 
ATOM   1168 C CA  . GLY A 1 151 ? -6.482  58.807 62.237 1.00 34.45  ? 151  GLY A CA  1 
ATOM   1169 C C   . GLY A 1 151 ? -7.243  57.603 61.720 1.00 34.45  ? 151  GLY A C   1 
ATOM   1170 O O   . GLY A 1 151 ? -6.991  57.130 60.618 1.00 34.45  ? 151  GLY A O   1 
ATOM   1171 N N   . ALA A 1 152 ? -8.182  57.102 62.513 1.00 39.73  ? 152  ALA A N   1 
ATOM   1172 C CA  . ALA A 1 152 ? -8.959  55.941 62.105 1.00 39.73  ? 152  ALA A CA  1 
ATOM   1173 C C   . ALA A 1 152 ? -9.754  56.239 60.835 1.00 39.73  ? 152  ALA A C   1 
ATOM   1174 O O   . ALA A 1 152 ? -9.914  55.383 59.967 1.00 39.73  ? 152  ALA A O   1 
ATOM   1175 C CB  . ALA A 1 152 ? -9.902  55.527 63.230 1.00 40.95  ? 152  ALA A CB  1 
ATOM   1176 N N   . PHE A 1 153 ? -10.234 57.470 60.731 1.00 39.71  ? 153  PHE A N   1 
ATOM   1177 C CA  . PHE A 1 153 ? -11.033 57.895 59.599 1.00 39.71  ? 153  PHE A CA  1 
ATOM   1178 C C   . PHE A 1 153 ? -10.344 57.704 58.259 1.00 39.71  ? 153  PHE A C   1 
ATOM   1179 O O   . PHE A 1 153 ? -11.011 57.489 57.239 1.00 39.71  ? 153  PHE A O   1 
ATOM   1180 C CB  . PHE A 1 153 ? -11.417 59.358 59.788 1.00 39.20  ? 153  PHE A CB  1 
ATOM   1181 C CG  . PHE A 1 153 ? -12.162 59.621 61.061 1.00 39.20  ? 153  PHE A CG  1 
ATOM   1182 C CD1 . PHE A 1 153 ? -13.474 59.183 61.216 1.00 39.20  ? 153  PHE A CD1 1 
ATOM   1183 C CD2 . PHE A 1 153 ? -11.541 60.273 62.124 1.00 39.20  ? 153  PHE A CD2 1 
ATOM   1184 C CE1 . PHE A 1 153 ? -14.159 59.387 62.408 1.00 39.20  ? 153  PHE A CE1 1 
ATOM   1185 C CE2 . PHE A 1 153 ? -12.217 60.485 63.329 1.00 39.20  ? 153  PHE A CE2 1 
ATOM   1186 C CZ  . PHE A 1 153 ? -13.528 60.042 63.470 1.00 39.20  ? 153  PHE A CZ  1 
ATOM   1187 N N   . GLY A 1 154 ? -9.016  57.771 58.255 1.00 33.72  ? 154  GLY A N   1 
ATOM   1188 C CA  . GLY A 1 154 ? -8.292  57.625 57.007 1.00 33.72  ? 154  GLY A CA  1 
ATOM   1189 C C   . GLY A 1 154 ? -7.349  56.441 56.900 1.00 33.72  ? 154  GLY A C   1 
ATOM   1190 O O   . GLY A 1 154 ? -6.808  56.178 55.822 1.00 33.72  ? 154  GLY A O   1 
ATOM   1191 N N   . PHE A 1 155 ? -7.162  55.702 57.990 1.00 31.39  ? 155  PHE A N   1 
ATOM   1192 C CA  . PHE A 1 155 ? -6.235  54.588 57.950 1.00 31.39  ? 155  PHE A CA  1 
ATOM   1193 C C   . PHE A 1 155 ? -6.655  53.269 58.593 1.00 31.39  ? 155  PHE A C   1 
ATOM   1194 O O   . PHE A 1 155 ? -5.845  52.345 58.705 1.00 31.39  ? 155  PHE A O   1 
ATOM   1195 C CB  . PHE A 1 155 ? -4.890  55.072 58.487 1.00 23.98  ? 155  PHE A CB  1 
ATOM   1196 C CG  . PHE A 1 155 ? -4.258  56.119 57.622 1.00 23.98  ? 155  PHE A CG  1 
ATOM   1197 C CD1 . PHE A 1 155 ? -3.629  55.766 56.434 1.00 23.98  ? 155  PHE A CD1 1 
ATOM   1198 C CD2 . PHE A 1 155 ? -4.385  57.460 57.931 1.00 23.98  ? 155  PHE A CD2 1 
ATOM   1199 C CE1 . PHE A 1 155 ? -3.145  56.733 55.568 1.00 23.98  ? 155  PHE A CE1 1 
ATOM   1200 C CE2 . PHE A 1 155 ? -3.908  58.433 57.071 1.00 23.98  ? 155  PHE A CE2 1 
ATOM   1201 C CZ  . PHE A 1 155 ? -3.287  58.070 55.885 1.00 23.98  ? 155  PHE A CZ  1 
ATOM   1202 N N   . LEU A 1 156 ? -7.921  53.170 58.996 1.00 36.80  ? 156  LEU A N   1 
ATOM   1203 C CA  . LEU A 1 156 ? -8.443  51.927 59.571 1.00 36.80  ? 156  LEU A CA  1 
ATOM   1204 C C   . LEU A 1 156 ? -8.275  50.872 58.485 1.00 36.80  ? 156  LEU A C   1 
ATOM   1205 O O   . LEU A 1 156 ? -8.694  51.076 57.354 1.00 36.80  ? 156  LEU A O   1 
ATOM   1206 C CB  . LEU A 1 156 ? -9.930  52.057 59.898 1.00 42.02  ? 156  LEU A CB  1 
ATOM   1207 C CG  . LEU A 1 156 ? -10.549 50.891 60.673 1.00 42.02  ? 156  LEU A CG  1 
ATOM   1208 C CD1 . LEU A 1 156 ? -10.215 51.052 62.148 1.00 42.02  ? 156  LEU A CD1 1 
ATOM   1209 C CD2 . LEU A 1 156 ? -12.059 50.875 60.494 1.00 42.02  ? 156  LEU A CD2 1 
ATOM   1210 N N   . ALA A 1 157 ? -7.672  49.740 58.808 1.00 45.84  ? 157  ALA A N   1 
ATOM   1211 C CA  . ALA A 1 157 ? -7.476  48.737 57.777 1.00 45.84  ? 157  ALA A CA  1 
ATOM   1212 C C   . ALA A 1 157 ? -7.915  47.316 58.123 1.00 45.84  ? 157  ALA A C   1 
ATOM   1213 O O   . ALA A 1 157 ? -7.349  46.675 59.011 1.00 45.84  ? 157  ALA A O   1 
ATOM   1214 C CB  . ALA A 1 157 ? -6.014  48.736 57.354 1.00 33.76  ? 157  ALA A CB  1 
ATOM   1215 N N   . LEU A 1 158 ? -8.930  46.834 57.410 1.00 51.22  ? 158  LEU A N   1 
ATOM   1216 C CA  . LEU A 1 158 ? -9.438  45.472 57.565 1.00 51.22  ? 158  LEU A CA  1 
ATOM   1217 C C   . LEU A 1 158 ? -9.241  44.836 56.193 1.00 51.22  ? 158  LEU A C   1 
ATOM   1218 O O   . LEU A 1 158 ? -10.197 44.657 55.442 1.00 51.22  ? 158  LEU A O   1 
ATOM   1219 C CB  . LEU A 1 158 ? -10.920 45.493 57.938 1.00 37.95  ? 158  LEU A CB  1 
ATOM   1220 C CG  . LEU A 1 158 ? -11.138 45.949 59.381 1.00 37.95  ? 158  LEU A CG  1 
ATOM   1221 C CD1 . LEU A 1 158 ? -12.613 46.132 59.682 1.00 37.95  ? 158  LEU A CD1 1 
ATOM   1222 C CD2 . LEU A 1 158 ? -10.514 44.911 60.308 1.00 37.95  ? 158  LEU A CD2 1 
ATOM   1223 N N   . HIS A 1 159 ? -7.992  44.521 55.857 1.00 49.64  ? 159  HIS A N   1 
ATOM   1224 C CA  . HIS A 1 159 ? -7.673  43.937 54.554 1.00 49.64  ? 159  HIS A CA  1 
ATOM   1225 C C   . HIS A 1 159 ? -8.634  42.830 54.197 1.00 49.64  ? 159  HIS A C   1 
ATOM   1226 O O   . HIS A 1 159 ? -9.047  42.061 55.068 1.00 49.64  ? 159  HIS A O   1 
ATOM   1227 C CB  . HIS A 1 159 ? -6.263  43.368 54.539 1.00 51.65  ? 159  HIS A CB  1 
ATOM   1228 C CG  . HIS A 1 159 ? -5.781  43.001 53.170 1.00 51.65  ? 159  HIS A CG  1 
ATOM   1229 N ND1 . HIS A 1 159 ? -5.638  43.931 52.159 1.00 51.65  ? 159  HIS A ND1 1 
ATOM   1230 C CD2 . HIS A 1 159 ? -5.377  41.815 52.652 1.00 51.65  ? 159  HIS A CD2 1 
ATOM   1231 C CE1 . HIS A 1 159 ? -5.160  43.336 51.080 1.00 51.65  ? 159  HIS A CE1 1 
ATOM   1232 N NE2 . HIS A 1 159 ? -4.992  42.052 51.353 1.00 51.65  ? 159  HIS A NE2 1 
ATOM   1233 N N   . GLY A 1 160 ? -8.991  42.741 52.919 1.00 63.57  ? 160  GLY A N   1 
ATOM   1234 C CA  . GLY A 1 160 ? -9.909  41.696 52.501 1.00 63.57  ? 160  GLY A CA  1 
ATOM   1235 C C   . GLY A 1 160 ? -11.330 42.175 52.263 1.00 63.57  ? 160  GLY A C   1 
ATOM   1236 O O   . GLY A 1 160 ? -12.063 41.573 51.471 1.00 63.57  ? 160  GLY A O   1 
ATOM   1237 N N   . SER A 1 161 ? -11.738 43.241 52.948 1.00 67.45  ? 161  SER A N   1 
ATOM   1238 C CA  . SER A 1 161 ? -13.084 43.774 52.762 1.00 67.45  ? 161  SER A CA  1 
ATOM   1239 C C   . SER A 1 161 ? -12.955 45.043 51.925 1.00 67.45  ? 161  SER A C   1 
ATOM   1240 O O   . SER A 1 161 ? -11.848 45.561 51.739 1.00 67.45  ? 161  SER A O   1 
ATOM   1241 C CB  . SER A 1 161 ? -13.733 44.108 54.109 1.00 70.38  ? 161  SER A CB  1 
ATOM   1242 O OG  . SER A 1 161 ? -13.331 45.391 54.560 1.00 70.38  ? 161  SER A OG  1 
ATOM   1243 N N   . GLN A 1 162 ? -14.075 45.548 51.422 1.00 59.13  ? 162  GLN A N   1 
ATOM   1244 C CA  . GLN A 1 162 ? -14.037 46.753 50.606 1.00 59.13  ? 162  GLN A CA  1 
ATOM   1245 C C   . GLN A 1 162 ? -14.649 47.922 51.363 1.00 59.13  ? 162  GLN A C   1 
ATOM   1246 O O   . GLN A 1 162 ? -14.746 49.034 50.838 1.00 59.13  ? 162  GLN A O   1 
ATOM   1247 C CB  . GLN A 1 162 ? -14.787 46.528 49.288 1.00 78.59  ? 162  GLN A CB  1 
ATOM   1248 C CG  . GLN A 1 162 ? -14.209 45.414 48.403 1.00 78.59  ? 162  GLN A CG  1 
ATOM   1249 C CD  . GLN A 1 162 ? -12.711 45.586 48.110 1.00 78.59  ? 162  GLN A CD  1 
ATOM   1250 O OE1 . GLN A 1 162 ? -12.231 46.705 47.856 1.00 78.59  ? 162  GLN A OE1 1 
ATOM   1251 N NE2 . GLN A 1 162 ? -11.970 44.472 48.127 1.00 78.59  ? 162  GLN A NE2 1 
ATOM   1252 N N   . GLU A 1 163 ? -15.057 47.667 52.600 1.00 54.50  ? 163  GLU A N   1 
ATOM   1253 C CA  . GLU A 1 163 ? -15.653 48.706 53.424 1.00 54.50  ? 163  GLU A CA  1 
ATOM   1254 C C   . GLU A 1 163 ? -14.617 49.540 54.199 1.00 54.50  ? 163  GLU A C   1 
ATOM   1255 O O   . GLU A 1 163 ? -14.945 50.599 54.745 1.00 54.50  ? 163  GLU A O   1 
ATOM   1256 C CB  . GLU A 1 163 ? -16.662 48.077 54.389 1.00 85.98  ? 163  GLU A CB  1 
ATOM   1257 C CG  . GLU A 1 163 ? -17.937 47.624 53.697 1.00 85.98  ? 163  GLU A CG  1 
ATOM   1258 C CD  . GLU A 1 163 ? -18.442 48.672 52.700 1.00 85.98  ? 163  GLU A CD  1 
ATOM   1259 O OE1 . GLU A 1 163 ? -18.524 49.876 53.076 1.00 85.98  ? 163  GLU A OE1 1 
ATOM   1260 O OE2 . GLU A 1 163 ? -18.756 48.290 51.539 1.00 85.98  ? 163  GLU A OE2 1 
ATOM   1261 N N   . ALA A 1 164 ? -13.380 49.048 54.244 1.00 52.03  ? 164  ALA A N   1 
ATOM   1262 C CA  . ALA A 1 164 ? -12.256 49.713 54.923 1.00 52.03  ? 164  ALA A CA  1 
ATOM   1263 C C   . ALA A 1 164 ? -10.999 48.983 54.444 1.00 52.03  ? 164  ALA A C   1 
ATOM   1264 O O   . ALA A 1 164 ? -10.324 48.287 55.209 1.00 52.03  ? 164  ALA A O   1 
ATOM   1265 C CB  . ALA A 1 164 ? -12.394 49.600 56.447 1.00 19.67  ? 164  ALA A CB  1 
ATOM   1266 N N   . PRO A 1 165 ? -10.674 49.134 53.155 1.00 50.04  ? 165  PRO A N   1 
ATOM   1267 C CA  . PRO A 1 165 ? -9.503  48.472 52.587 1.00 50.04  ? 165  PRO A CA  1 
ATOM   1268 C C   . PRO A 1 165 ? -8.203  48.937 53.205 1.00 50.04  ? 165  PRO A C   1 
ATOM   1269 O O   . PRO A 1 165 ? -7.241  48.172 53.301 1.00 50.04  ? 165  PRO A O   1 
ATOM   1270 C CB  . PRO A 1 165 ? -9.608  48.808 51.099 1.00 37.76  ? 165  PRO A CB  1 
ATOM   1271 C CG  . PRO A 1 165 ? -10.233 50.155 51.101 1.00 37.76  ? 165  PRO A CG  1 
ATOM   1272 C CD  . PRO A 1 165 ? -11.294 50.048 52.178 1.00 37.76  ? 165  PRO A CD  1 
ATOM   1273 N N   . GLY A 1 166 ? -8.191  50.191 53.640 1.00 41.79  ? 166  GLY A N   1 
ATOM   1274 C CA  . GLY A 1 166 ? -6.993  50.761 54.225 1.00 41.79  ? 166  GLY A CA  1 
ATOM   1275 C C   . GLY A 1 166 ? -6.445  51.794 53.261 1.00 41.79  ? 166  GLY A C   1 
ATOM   1276 O O   . GLY A 1 166 ? -6.943  51.932 52.148 1.00 41.79  ? 166  GLY A O   1 
ATOM   1277 N N   . ASN A 1 167 ? -5.439  52.534 53.703 1.00 34.54  ? 167  ASN A N   1 
ATOM   1278 C CA  . ASN A 1 167 ? -4.800  53.554 52.892 1.00 34.54  ? 167  ASN A CA  1 
ATOM   1279 C C   . ASN A 1 167 ? -5.744  54.525 52.208 1.00 34.54  ? 167  ASN A C   1 
ATOM   1280 O O   . ASN A 1 167 ? -5.342  55.229 51.289 1.00 34.54  ? 167  ASN A O   1 
ATOM   1281 C CB  . ASN A 1 167 ? -3.913  52.890 51.843 1.00 39.50  ? 167  ASN A CB  1 
ATOM   1282 C CG  . ASN A 1 167 ? -2.863  51.992 52.462 1.00 39.50  ? 167  ASN A CG  1 
ATOM   1283 O OD1 . ASN A 1 167 ? -2.324  52.302 53.519 1.00 39.50  ? 167  ASN A OD1 1 
ATOM   1284 N ND2 . ASN A 1 167 ? -2.557  50.883 51.802 1.00 39.50  ? 167  ASN A ND2 1 
ATOM   1285 N N   . VAL A 1 168 ? -6.990  54.592 52.648 1.00 42.29  ? 168  VAL A N   1 
ATOM   1286 C CA  . VAL A 1 168 ? -7.918  55.498 51.984 1.00 42.29  ? 168  VAL A CA  1 
ATOM   1287 C C   . VAL A 1 168 ? -7.471  56.945 52.158 1.00 42.29  ? 168  VAL A C   1 
ATOM   1288 O O   . VAL A 1 168 ? -7.897  57.835 51.420 1.00 42.29  ? 168  VAL A O   1 
ATOM   1289 C CB  . VAL A 1 168 ? -9.385  55.307 52.485 1.00 36.48  ? 168  VAL A CB  1 
ATOM   1290 C CG1 . VAL A 1 168 ? -9.727  53.820 52.511 1.00 36.48  ? 168  VAL A CG1 1 
ATOM   1291 C CG2 . VAL A 1 168 ? -9.590  55.948 53.841 1.00 36.48  ? 168  VAL A CG2 1 
ATOM   1292 N N   . GLY A 1 169 ? -6.594  57.176 53.127 1.00 30.80  ? 169  GLY A N   1 
ATOM   1293 C CA  . GLY A 1 169 ? -6.091  58.518 53.351 1.00 30.80  ? 169  GLY A CA  1 
ATOM   1294 C C   . GLY A 1 169 ? -5.098  58.900 52.267 1.00 30.80  ? 169  GLY A C   1 
ATOM   1295 O O   . GLY A 1 169 ? -4.968  60.070 51.926 1.00 30.80  ? 169  GLY A O   1 
ATOM   1296 N N   . LEU A 1 170 ? -4.387  57.908 51.731 1.00 33.04  ? 170  LEU A N   1 
ATOM   1297 C CA  . LEU A 1 170 ? -3.419  58.153 50.674 1.00 33.04  ? 170  LEU A CA  1 
ATOM   1298 C C   . LEU A 1 170 ? -4.183  58.300 49.376 1.00 33.04  ? 170  LEU A C   1 
ATOM   1299 O O   . LEU A 1 170 ? -3.780  59.061 48.495 1.00 33.04  ? 170  LEU A O   1 
ATOM   1300 C CB  . LEU A 1 170 ? -2.416  57.010 50.582 1.00 28.55  ? 170  LEU A CB  1 
ATOM   1301 C CG  . LEU A 1 170 ? -1.467  56.924 51.777 1.00 28.55  ? 170  LEU A CG  1 
ATOM   1302 C CD1 . LEU A 1 170 ? -0.573  55.716 51.643 1.00 28.55  ? 170  LEU A CD1 1 
ATOM   1303 C CD2 . LEU A 1 170 ? -0.641  58.184 51.858 1.00 28.55  ? 170  LEU A CD2 1 
ATOM   1304 N N   . LEU A 1 171 ? -5.301  57.581 49.268 1.00 40.73  ? 171  LEU A N   1 
ATOM   1305 C CA  . LEU A 1 171 ? -6.138  57.679 48.080 1.00 40.73  ? 171  LEU A CA  1 
ATOM   1306 C C   . LEU A 1 171 ? -6.732  59.082 48.019 1.00 40.73  ? 171  LEU A C   1 
ATOM   1307 O O   . LEU A 1 171 ? -6.960  59.607 46.933 1.00 40.73  ? 171  LEU A O   1 
ATOM   1308 C CB  . LEU A 1 171 ? -7.251  56.639 48.111 1.00 35.18  ? 171  LEU A CB  1 
ATOM   1309 C CG  . LEU A 1 171 ? -6.775  55.189 48.008 1.00 35.18  ? 171  LEU A CG  1 
ATOM   1310 C CD1 . LEU A 1 171 ? -7.985  54.300 47.907 1.00 35.18  ? 171  LEU A CD1 1 
ATOM   1311 C CD2 . LEU A 1 171 ? -5.878  55.001 46.793 1.00 35.18  ? 171  LEU A CD2 1 
ATOM   1312 N N   . ASP A 1 172 ? -6.985  59.680 49.189 1.00 40.16  ? 172  ASP A N   1 
ATOM   1313 C CA  . ASP A 1 172 ? -7.508  61.045 49.269 1.00 40.16  ? 172  ASP A CA  1 
ATOM   1314 C C   . ASP A 1 172 ? -6.508  61.985 48.586 1.00 40.16  ? 172  ASP A C   1 
ATOM   1315 O O   . ASP A 1 172 ? -6.875  62.791 47.737 1.00 40.16  ? 172  ASP A O   1 
ATOM   1316 C CB  . ASP A 1 172 ? -7.673  61.508 50.733 1.00 51.46  ? 172  ASP A CB  1 
ATOM   1317 C CG  . ASP A 1 172 ? -8.990  61.050 51.377 1.00 51.46  ? 172  ASP A CG  1 
ATOM   1318 O OD1 . ASP A 1 172 ? -9.983  60.859 50.644 1.00 51.46  ? 172  ASP A OD1 1 
ATOM   1319 O OD2 . ASP A 1 172 ? -9.037  60.910 52.626 1.00 51.46  ? 172  ASP A OD2 1 
ATOM   1320 N N   . GLN A 1 173 ? -5.239  61.874 48.963 1.00 40.92  ? 173  GLN A N   1 
ATOM   1321 C CA  . GLN A 1 173 ? -4.197  62.729 48.399 1.00 40.92  ? 173  GLN A CA  1 
ATOM   1322 C C   . GLN A 1 173 ? -4.070  62.519 46.903 1.00 40.92  ? 173  GLN A C   1 
ATOM   1323 O O   . GLN A 1 173 ? -3.901  63.474 46.145 1.00 40.92  ? 173  GLN A O   1 
ATOM   1324 C CB  . GLN A 1 173 ? -2.850  62.433 49.047 1.00 29.77  ? 173  GLN A CB  1 
ATOM   1325 C CG  . GLN A 1 173 ? -2.833  62.514 50.546 1.00 29.77  ? 173  GLN A CG  1 
ATOM   1326 C CD  . GLN A 1 173 ? -1.551  61.965 51.110 1.00 29.77  ? 173  GLN A CD  1 
ATOM   1327 O OE1 . GLN A 1 173 ? -0.696  61.481 50.374 1.00 29.77  ? 173  GLN A OE1 1 
ATOM   1328 N NE2 . GLN A 1 173 ? -1.408  62.029 52.422 1.00 29.77  ? 173  GLN A NE2 1 
ATOM   1329 N N   . ARG A 1 174 ? -4.142  61.259 46.484 1.00 34.55  ? 174  ARG A N   1 
ATOM   1330 C CA  . ARG A 1 174 ? -4.025  60.923 45.077 1.00 34.55  ? 174  ARG A CA  1 
ATOM   1331 C C   . ARG A 1 174 ? -5.172  61.552 44.325 1.00 34.55  ? 174  ARG A C   1 
ATOM   1332 O O   . ARG A 1 174 ? -5.031  61.954 43.176 1.00 34.55  ? 174  ARG A O   1 
ATOM   1333 C CB  . ARG A 1 174 ? -4.055  59.414 44.871 1.00 38.81  ? 174  ARG A CB  1 
ATOM   1334 C CG  . ARG A 1 174 ? -4.045  59.053 43.409 1.00 38.81  ? 174  ARG A CG  1 
ATOM   1335 C CD  . ARG A 1 174 ? -4.227  57.584 43.192 1.00 38.81  ? 174  ARG A CD  1 
ATOM   1336 N NE  . ARG A 1 174 ? -3.081  56.823 43.658 1.00 38.81  ? 174  ARG A NE  1 
ATOM   1337 C CZ  . ARG A 1 174 ? -3.083  55.503 43.778 1.00 38.81  ? 174  ARG A CZ  1 
ATOM   1338 N NH1 . ARG A 1 174 ? -4.171  54.819 43.468 1.00 38.81  ? 174  ARG A NH1 1 
ATOM   1339 N NH2 . ARG A 1 174 ? -2.001  54.871 44.205 1.00 38.81  ? 174  ARG A NH2 1 
ATOM   1340 N N   . MET A 1 175 ? -6.315  61.634 44.989 1.00 38.00  ? 175  MET A N   1 
ATOM   1341 C CA  . MET A 1 175 ? -7.491  62.215 44.375 1.00 38.00  ? 175  MET A CA  1 
ATOM   1342 C C   . MET A 1 175 ? -7.222  63.679 44.113 1.00 38.00  ? 175  MET A C   1 
ATOM   1343 O O   . MET A 1 175 ? -7.450  64.174 43.017 1.00 38.00  ? 175  MET A O   1 
ATOM   1344 C CB  . MET A 1 175 ? -8.696  62.073 45.296 1.00 56.12  ? 175  MET A CB  1 
ATOM   1345 C CG  . MET A 1 175 ? -9.978  62.605 44.699 1.00 56.12  ? 175  MET A CG  1 
ATOM   1346 S SD  . MET A 1 175 ? -11.046 61.292 44.114 1.00 56.12  ? 175  MET A SD  1 
ATOM   1347 C CE  . MET A 1 175 ? -12.277 61.363 45.352 1.00 56.12  ? 175  MET A CE  1 
ATOM   1348 N N   . ALA A 1 176 ? -6.740  64.369 45.136 1.00 33.54  ? 176  ALA A N   1 
ATOM   1349 C CA  . ALA A 1 176 ? -6.429  65.775 45.013 1.00 33.54  ? 176  ALA A CA  1 
ATOM   1350 C C   . ALA A 1 176 ? -5.391  65.970 43.913 1.00 33.54  ? 176  ALA A C   1 
ATOM   1351 O O   . ALA A 1 176 ? -5.474  66.919 43.142 1.00 33.54  ? 176  ALA A O   1 
ATOM   1352 C CB  . ALA A 1 176 ? -5.915  66.303 46.328 1.00 26.41  ? 176  ALA A CB  1 
ATOM   1353 N N   . LEU A 1 177 ? -4.414  65.073 43.831 1.00 29.58  ? 177  LEU A N   1 
ATOM   1354 C CA  . LEU A 1 177 ? -3.391  65.186 42.797 1.00 29.58  ? 177  LEU A CA  1 
ATOM   1355 C C   . LEU A 1 177 ? -3.996  64.996 41.410 1.00 29.58  ? 177  LEU A C   1 
ATOM   1356 O O   . LEU A 1 177 ? -3.594  65.639 40.451 1.00 29.58  ? 177  LEU A O   1 
ATOM   1357 C CB  . LEU A 1 177 ? -2.284  64.157 43.020 1.00 41.14  ? 177  LEU A CB  1 
ATOM   1358 C CG  . LEU A 1 177 ? -1.331  64.447 44.183 1.00 41.14  ? 177  LEU A CG  1 
ATOM   1359 C CD1 . LEU A 1 177 ? -0.411  63.246 44.408 1.00 41.14  ? 177  LEU A CD1 1 
ATOM   1360 C CD2 . LEU A 1 177 ? -0.522  65.714 43.895 1.00 41.14  ? 177  LEU A CD2 1 
ATOM   1361 N N   . GLN A 1 178 ? -4.972  64.106 41.316 1.00 34.22  ? 178  GLN A N   1 
ATOM   1362 C CA  . GLN A 1 178 ? -5.639  63.836 40.056 1.00 34.22  ? 178  GLN A CA  1 
ATOM   1363 C C   . GLN A 1 178 ? -6.376  65.086 39.599 1.00 34.22  ? 178  GLN A C   1 
ATOM   1364 O O   . GLN A 1 178 ? -6.426  65.377 38.415 1.00 34.22  ? 178  GLN A O   1 
ATOM   1365 C CB  . GLN A 1 178 ? -6.620  62.669 40.216 1.00 47.28  ? 178  GLN A CB  1 
ATOM   1366 C CG  . GLN A 1 178 ? -7.320  62.223 38.931 1.00 47.28  ? 178  GLN A CG  1 
ATOM   1367 C CD  . GLN A 1 178 ? -6.368  61.608 37.922 1.00 47.28  ? 178  GLN A CD  1 
ATOM   1368 O OE1 . GLN A 1 178 ? -5.710  60.604 38.205 1.00 47.28  ? 178  GLN A OE1 1 
ATOM   1369 N NE2 . GLN A 1 178 ? -6.288  62.210 36.735 1.00 47.28  ? 178  GLN A NE2 1 
ATOM   1370 N N   . TRP A 1 179 ? -6.940  65.829 40.542 1.00 36.49  ? 179  TRP A N   1 
ATOM   1371 C CA  . TRP A 1 179 ? -7.660  67.048 40.203 1.00 36.49  ? 179  TRP A CA  1 
ATOM   1372 C C   . TRP A 1 179 ? -6.663  68.105 39.716 1.00 36.49  ? 179  TRP A C   1 
ATOM   1373 O O   . TRP A 1 179 ? -6.887  68.735 38.692 1.00 36.49  ? 179  TRP A O   1 
ATOM   1374 C CB  . TRP A 1 179 ? -8.424  67.556 41.419 1.00 30.06  ? 179  TRP A CB  1 
ATOM   1375 C CG  . TRP A 1 179 ? -9.532  68.498 41.112 1.00 30.06  ? 179  TRP A CG  1 
ATOM   1376 C CD1 . TRP A 1 179 ? -10.817 68.178 40.795 1.00 30.06  ? 179  TRP A CD1 1 
ATOM   1377 C CD2 . TRP A 1 179 ? -9.461  69.924 41.122 1.00 30.06  ? 179  TRP A CD2 1 
ATOM   1378 N NE1 . TRP A 1 179 ? -11.558 69.321 40.611 1.00 30.06  ? 179  TRP A NE1 1 
ATOM   1379 C CE2 . TRP A 1 179 ? -10.746 70.407 40.805 1.00 30.06  ? 179  TRP A CE2 1 
ATOM   1380 C CE3 . TRP A 1 179 ? -8.438  70.841 41.368 1.00 30.06  ? 179  TRP A CE3 1 
ATOM   1381 C CZ2 . TRP A 1 179 ? -11.032 71.767 40.729 1.00 30.06  ? 179  TRP A CZ2 1 
ATOM   1382 C CZ3 . TRP A 1 179 ? -8.725  72.197 41.292 1.00 30.06  ? 179  TRP A CZ3 1 
ATOM   1383 C CH2 . TRP A 1 179 ? -10.012 72.644 40.975 1.00 30.06  ? 179  TRP A CH2 1 
ATOM   1384 N N   . VAL A 1 180 ? -5.558  68.295 40.437 1.00 40.62  ? 180  VAL A N   1 
ATOM   1385 C CA  . VAL A 1 180 ? -4.551  69.265 40.017 1.00 40.62  ? 180  VAL A CA  1 
ATOM   1386 C C   . VAL A 1 180 ? -4.109  68.905 38.599 1.00 40.62  ? 180  VAL A C   1 
ATOM   1387 O O   . VAL A 1 180 ? -3.906  69.771 37.748 1.00 40.62  ? 180  VAL A O   1 
ATOM   1388 C CB  . VAL A 1 180 ? -3.306  69.231 40.931 1.00 30.09  ? 180  VAL A CB  1 
ATOM   1389 C CG1 . VAL A 1 180 ? -2.220  70.155 40.395 1.00 30.09  ? 180  VAL A CG1 1 
ATOM   1390 C CG2 . VAL A 1 180 ? -3.691  69.645 42.329 1.00 30.09  ? 180  VAL A CG2 1 
ATOM   1391 N N   . HIS A 1 181 ? -3.961  67.616 38.344 1.00 37.75  ? 181  HIS A N   1 
ATOM   1392 C CA  . HIS A 1 181 ? -3.540  67.179 37.036 1.00 37.75  ? 181  HIS A CA  1 
ATOM   1393 C C   . HIS A 1 181 ? -4.571  67.505 35.967 1.00 37.75  ? 181  HIS A C   1 
ATOM   1394 O O   . HIS A 1 181 ? -4.215  67.868 34.856 1.00 37.75  ? 181  HIS A O   1 
ATOM   1395 C CB  . HIS A 1 181 ? -3.265  65.682 37.055 1.00 48.24  ? 181  HIS A CB  1 
ATOM   1396 C CG  . HIS A 1 181 ? -2.738  65.159 35.758 1.00 48.24  ? 181  HIS A CG  1 
ATOM   1397 N ND1 . HIS A 1 181 ? -3.560  64.681 34.758 1.00 48.24  ? 181  HIS A ND1 1 
ATOM   1398 C CD2 . HIS A 1 181 ? -1.475  65.088 35.276 1.00 48.24  ? 181  HIS A CD2 1 
ATOM   1399 C CE1 . HIS A 1 181 ? -2.826  64.337 33.716 1.00 48.24  ? 181  HIS A CE1 1 
ATOM   1400 N NE2 . HIS A 1 181 ? -1.558  64.574 34.004 1.00 48.24  ? 181  HIS A NE2 1 
ATOM   1401 N N   . ASP A 1 182 ? -5.849  67.390 36.305 1.00 44.64  ? 182  ASP A N   1 
ATOM   1402 C CA  . ASP A 1 182 ? -6.913  67.653 35.345 1.00 44.64  ? 182  ASP A CA  1 
ATOM   1403 C C   . ASP A 1 182 ? -7.416  69.094 35.293 1.00 44.64  ? 182  ASP A C   1 
ATOM   1404 O O   . ASP A 1 182 ? -8.136  69.455 34.368 1.00 44.64  ? 182  ASP A O   1 
ATOM   1405 C CB  . ASP A 1 182 ? -8.117  66.744 35.626 1.00 66.37  ? 182  ASP A CB  1 
ATOM   1406 C CG  . ASP A 1 182 ? -7.778  65.253 35.534 1.00 66.37  ? 182  ASP A CG  1 
ATOM   1407 O OD1 . ASP A 1 182 ? -6.909  64.883 34.698 1.00 66.37  ? 182  ASP A OD1 1 
ATOM   1408 O OD2 . ASP A 1 182 ? -8.395  64.444 36.284 1.00 66.37  ? 182  ASP A OD2 1 
ATOM   1409 N N   . ASN A 1 183 ? -7.035  69.931 36.249 1.00 36.05  ? 183  ASN A N   1 
ATOM   1410 C CA  . ASN A 1 183 ? -7.568  71.286 36.261 1.00 36.05  ? 183  ASN A CA  1 
ATOM   1411 C C   . ASN A 1 183 ? -6.633  72.461 36.513 1.00 36.05  ? 183  ASN A C   1 
ATOM   1412 O O   . ASN A 1 183 ? -6.987  73.604 36.209 1.00 36.05  ? 183  ASN A O   1 
ATOM   1413 C CB  . ASN A 1 183 ? -8.694  71.348 37.289 1.00 39.91  ? 183  ASN A CB  1 
ATOM   1414 C CG  . ASN A 1 183 ? -9.812  70.369 36.988 1.00 39.91  ? 183  ASN A CG  1 
ATOM   1415 O OD1 . ASN A 1 183 ? -10.592 70.570 36.054 1.00 39.91  ? 183  ASN A OD1 1 
ATOM   1416 N ND2 . ASN A 1 183 ? -9.893  69.301 37.771 1.00 39.91  ? 183  ASN A ND2 1 
ATOM   1417 N N   . ILE A 1 184 ? -5.447  72.202 37.056 1.00 41.04  ? 184  ILE A N   1 
ATOM   1418 C CA  . ILE A 1 184 ? -4.536  73.291 37.375 1.00 41.04  ? 184  ILE A CA  1 
ATOM   1419 C C   . ILE A 1 184 ? -4.201  74.176 36.179 1.00 41.04  ? 184  ILE A C   1 
ATOM   1420 O O   . ILE A 1 184 ? -3.778  75.319 36.350 1.00 41.04  ? 184  ILE A O   1 
ATOM   1421 C CB  . ILE A 1 184 ? -3.237  72.760 38.053 1.00 26.63  ? 184  ILE A CB  1 
ATOM   1422 C CG1 . ILE A 1 184 ? -2.622  73.861 38.919 1.00 26.63  ? 184  ILE A CG1 1 
ATOM   1423 C CG2 . ILE A 1 184 ? -2.246  72.261 37.021 1.00 26.63  ? 184  ILE A CG2 1 
ATOM   1424 C CD1 . ILE A 1 184 ? -3.524  74.320 40.048 1.00 26.63  ? 184  ILE A CD1 1 
ATOM   1425 N N   . GLN A 1 185 ? -4.418  73.670 34.970 1.00 40.71  ? 185  GLN A N   1 
ATOM   1426 C CA  . GLN A 1 185 ? -4.120  74.449 33.778 1.00 40.71  ? 185  GLN A CA  1 
ATOM   1427 C C   . GLN A 1 185 ? -5.041  75.655 33.708 1.00 40.71  ? 185  GLN A C   1 
ATOM   1428 O O   . GLN A 1 185 ? -4.671  76.690 33.167 1.00 40.71  ? 185  GLN A O   1 
ATOM   1429 C CB  . GLN A 1 185 ? -4.289  73.596 32.519 1.00 48.02  ? 185  GLN A CB  1 
ATOM   1430 C CG  . GLN A 1 185 ? -5.733  73.339 32.142 1.00 48.02  ? 185  GLN A CG  1 
ATOM   1431 C CD  . GLN A 1 185 ? -5.905  72.159 31.191 1.00 48.02  ? 185  GLN A CD  1 
ATOM   1432 O OE1 . GLN A 1 185 ? -5.708  71.001 31.573 1.00 48.02  ? 185  GLN A OE1 1 
ATOM   1433 N NE2 . GLN A 1 185 ? -6.276  72.449 29.945 1.00 48.02  ? 185  GLN A NE2 1 
ATOM   1434 N N   . PHE A 1 186 ? -6.240  75.535 34.262 1.00 44.59  ? 186  PHE A N   1 
ATOM   1435 C CA  . PHE A 1 186 ? -7.184  76.649 34.221 1.00 44.59  ? 186  PHE A CA  1 
ATOM   1436 C C   . PHE A 1 186 ? -6.867  77.736 35.249 1.00 44.59  ? 186  PHE A C   1 
ATOM   1437 O O   . PHE A 1 186 ? -7.506  78.791 35.261 1.00 44.59  ? 186  PHE A O   1 
ATOM   1438 C CB  . PHE A 1 186 ? -8.611  76.131 34.414 1.00 31.41  ? 186  PHE A CB  1 
ATOM   1439 C CG  . PHE A 1 186 ? -8.994  75.075 33.425 1.00 31.41  ? 186  PHE A CG  1 
ATOM   1440 C CD1 . PHE A 1 186 ? -8.996  75.353 32.065 1.00 31.41  ? 186  PHE A CD1 1 
ATOM   1441 C CD2 . PHE A 1 186 ? -9.277  73.781 33.843 1.00 31.41  ? 186  PHE A CD2 1 
ATOM   1442 C CE1 . PHE A 1 186 ? -9.267  74.358 31.134 1.00 31.41  ? 186  PHE A CE1 1 
ATOM   1443 C CE2 . PHE A 1 186 ? -9.546  72.780 32.921 1.00 31.41  ? 186  PHE A CE2 1 
ATOM   1444 C CZ  . PHE A 1 186 ? -9.540  73.069 31.560 1.00 31.41  ? 186  PHE A CZ  1 
ATOM   1445 N N   . PHE A 1 187 ? -5.880  77.474 36.105 1.00 39.38  ? 187  PHE A N   1 
ATOM   1446 C CA  . PHE A 1 187 ? -5.467  78.435 37.124 1.00 39.38  ? 187  PHE A CA  1 
ATOM   1447 C C   . PHE A 1 187 ? -4.111  79.033 36.747 1.00 39.38  ? 187  PHE A C   1 
ATOM   1448 O O   . PHE A 1 187 ? -3.534  79.804 37.507 1.00 39.38  ? 187  PHE A O   1 
ATOM   1449 C CB  . PHE A 1 187 ? -5.364  77.767 38.503 1.00 25.60  ? 187  PHE A CB  1 
ATOM   1450 C CG  . PHE A 1 187 ? -6.685  77.322 39.073 1.00 25.60  ? 187  PHE A CG  1 
ATOM   1451 C CD1 . PHE A 1 187 ? -7.194  76.063 38.792 1.00 25.60  ? 187  PHE A CD1 1 
ATOM   1452 C CD2 . PHE A 1 187 ? -7.418  78.170 39.904 1.00 25.60  ? 187  PHE A CD2 1 
ATOM   1453 C CE1 . PHE A 1 187 ? -8.409  75.653 39.330 1.00 25.60  ? 187  PHE A CE1 1 
ATOM   1454 C CE2 . PHE A 1 187 ? -8.641  77.768 40.447 1.00 25.60  ? 187  PHE A CE2 1 
ATOM   1455 C CZ  . PHE A 1 187 ? -9.136  76.509 40.160 1.00 25.60  ? 187  PHE A CZ  1 
ATOM   1456 N N   . GLY A 1 188 ? -3.609  78.663 35.572 1.00 42.94  ? 188  GLY A N   1 
ATOM   1457 C CA  . GLY A 1 188 ? -2.325  79.169 35.119 1.00 42.94  ? 188  GLY A CA  1 
ATOM   1458 C C   . GLY A 1 188 ? -1.158  78.213 35.341 1.00 42.94  ? 188  GLY A C   1 
ATOM   1459 O O   . GLY A 1 188 ? -0.036  78.454 34.874 1.00 42.94  ? 188  GLY A O   1 
ATOM   1460 N N   . GLY A 1 189 ? -1.423  77.122 36.054 1.00 41.97  ? 189  GLY A N   1 
ATOM   1461 C CA  . GLY A 1 189 ? -0.382  76.157 36.334 1.00 41.97  ? 189  GLY A CA  1 
ATOM   1462 C C   . GLY A 1 189 ? -0.119  75.203 35.192 1.00 41.97  ? 189  GLY A C   1 
ATOM   1463 O O   . GLY A 1 189 ? -0.983  74.989 34.340 1.00 41.97  ? 189  GLY A O   1 
ATOM   1464 N N   . ASP A 1 190 ? 1.087   74.638 35.166 1.00 45.47  ? 190  ASP A N   1 
ATOM   1465 C CA  . ASP A 1 190 ? 1.464   73.681 34.134 1.00 45.47  ? 190  ASP A CA  1 
ATOM   1466 C C   . ASP A 1 190 ? 1.385   72.277 34.736 1.00 45.47  ? 190  ASP A C   1 
ATOM   1467 O O   . ASP A 1 190 ? 2.219   71.893 35.548 1.00 45.47  ? 190  ASP A O   1 
ATOM   1468 C CB  . ASP A 1 190 ? 2.880   73.970 33.619 1.00 53.45  ? 190  ASP A CB  1 
ATOM   1469 C CG  . ASP A 1 190 ? 3.393   72.883 32.674 1.00 53.45  ? 190  ASP A CG  1 
ATOM   1470 O OD1 . ASP A 1 190 ? 2.565   72.071 32.188 1.00 53.45  ? 190  ASP A OD1 1 
ATOM   1471 O OD2 . ASP A 1 190 ? 4.621   72.838 32.412 1.00 53.45  ? 190  ASP A OD2 1 
ATOM   1472 N N   . PRO A 1 191 ? 0.380   71.490 34.328 1.00 41.98  ? 191  PRO A N   1 
ATOM   1473 C CA  . PRO A 1 191 ? 0.200   70.131 34.841 1.00 41.98  ? 191  PRO A CA  1 
ATOM   1474 C C   . PRO A 1 191 ? 1.383   69.180 34.657 1.00 41.98  ? 191  PRO A C   1 
ATOM   1475 O O   . PRO A 1 191 ? 1.477   68.186 35.366 1.00 41.98  ? 191  PRO A O   1 
ATOM   1476 C CB  . PRO A 1 191 ? -1.049  69.659 34.108 1.00 34.18  ? 191  PRO A CB  1 
ATOM   1477 C CG  . PRO A 1 191 ? -0.946  70.364 32.802 1.00 34.18  ? 191  PRO A CG  1 
ATOM   1478 C CD  . PRO A 1 191 ? -0.549  71.752 33.216 1.00 34.18  ? 191  PRO A CD  1 
ATOM   1479 N N   . LYS A 1 192 ? 2.283   69.476 33.719 1.00 50.29  ? 192  LYS A N   1 
ATOM   1480 C CA  . LYS A 1 192 ? 3.436   68.607 33.481 1.00 50.29  ? 192  LYS A CA  1 
ATOM   1481 C C   . LYS A 1 192 ? 4.663   69.064 34.296 1.00 50.29  ? 192  LYS A C   1 
ATOM   1482 O O   . LYS A 1 192 ? 5.797   68.615 34.072 1.00 50.29  ? 192  LYS A O   1 
ATOM   1483 C CB  . LYS A 1 192 ? 3.772   68.556 31.977 1.00 63.98  ? 192  LYS A CB  1 
ATOM   1484 C CG  . LYS A 1 192 ? 4.272   69.895 31.398 1.00 63.98  ? 192  LYS A CG  1 
ATOM   1485 C CD  . LYS A 1 192 ? 4.722   69.827 29.902 1.00 63.98  ? 192  LYS A CD  1 
ATOM   1486 C CE  . LYS A 1 192 ? 3.596   69.416 28.915 1.00 63.98  ? 192  LYS A CE  1 
ATOM   1487 N NZ  . LYS A 1 192 ? 3.609   67.950 28.505 1.00 63.98  ? 192  LYS A NZ  1 
ATOM   1488 N N   . THR A 1 193 ? 4.435   69.957 35.252 1.00 40.53  ? 193  THR A N   1 
ATOM   1489 C CA  . THR A 1 193 ? 5.528   70.429 36.088 1.00 40.53  ? 193  THR A CA  1 
ATOM   1490 C C   . THR A 1 193 ? 5.053   70.678 37.510 1.00 40.53  ? 193  THR A C   1 
ATOM   1491 O O   . THR A 1 193 ? 5.159   71.779 38.047 1.00 40.53  ? 193  THR A O   1 
ATOM   1492 C CB  . THR A 1 193 ? 6.165   71.695 35.495 1.00 57.08  ? 193  THR A CB  1 
ATOM   1493 O OG1 . THR A 1 193 ? 6.622   71.398 34.173 1.00 57.08  ? 193  THR A OG1 1 
ATOM   1494 C CG2 . THR A 1 193 ? 7.369   72.140 36.311 1.00 57.08  ? 193  THR A CG2 1 
ATOM   1495 N N   . VAL A 1 194 ? 4.512   69.630 38.111 1.00 30.08  ? 194  VAL A N   1 
ATOM   1496 C CA  . VAL A 1 194 ? 4.034   69.709 39.476 1.00 30.08  ? 194  VAL A CA  1 
ATOM   1497 C C   . VAL A 1 194 ? 4.977   68.962 40.398 1.00 30.08  ? 194  VAL A C   1 
ATOM   1498 O O   . VAL A 1 194 ? 5.333   67.818 40.151 1.00 30.08  ? 194  VAL A O   1 
ATOM   1499 C CB  . VAL A 1 194 ? 2.603   69.135 39.608 1.00 42.17  ? 194  VAL A CB  1 
ATOM   1500 C CG1 . VAL A 1 194 ? 2.385   68.084 38.558 1.00 42.17  ? 194  VAL A CG1 1 
ATOM   1501 C CG2 . VAL A 1 194 ? 2.389   68.537 40.991 1.00 42.17  ? 194  VAL A CG2 1 
ATOM   1502 N N   . THR A 1 195 ? 5.395   69.649 41.452 1.00 38.61  ? 195  THR A N   1 
ATOM   1503 C CA  . THR A 1 195 ? 6.281   69.098 42.463 1.00 38.61  ? 195  THR A CA  1 
ATOM   1504 C C   . THR A 1 195 ? 5.444   68.886 43.719 1.00 38.61  ? 195  THR A C   1 
ATOM   1505 O O   . THR A 1 195 ? 4.772   69.810 44.171 1.00 38.61  ? 195  THR A O   1 
ATOM   1506 C CB  . THR A 1 195 ? 7.400   70.097 42.839 1.00 34.50  ? 195  THR A CB  1 
ATOM   1507 O OG1 . THR A 1 195 ? 8.112   70.488 41.666 1.00 34.50  ? 195  THR A OG1 1 
ATOM   1508 C CG2 . THR A 1 195 ? 8.361   69.478 43.824 1.00 34.50  ? 195  THR A CG2 1 
ATOM   1509 N N   . ILE A 1 196 ? 5.441   67.679 44.268 1.00 29.72  ? 196  ILE A N   1 
ATOM   1510 C CA  . ILE A 1 196 ? 4.715   67.480 45.508 1.00 29.72  ? 196  ILE A CA  1 
ATOM   1511 C C   . ILE A 1 196 ? 5.790   67.549 46.588 1.00 29.72  ? 196  ILE A C   1 
ATOM   1512 O O   . ILE A 1 196 ? 6.927   67.154 46.351 1.00 29.72  ? 196  ILE A O   1 
ATOM   1513 C CB  . ILE A 1 196 ? 3.982   66.123 45.548 1.00 32.84  ? 196  ILE A CB  1 
ATOM   1514 C CG1 . ILE A 1 196 ? 4.959   64.977 45.367 1.00 32.84  ? 196  ILE A CG1 1 
ATOM   1515 C CG2 . ILE A 1 196 ? 2.945   66.068 44.455 1.00 32.84  ? 196  ILE A CG2 1 
ATOM   1516 C CD1 . ILE A 1 196 ? 4.293   63.632 45.391 1.00 32.84  ? 196  ILE A CD1 1 
ATOM   1517 N N   . PHE A 1 197 ? 5.459   68.105 47.748 1.00 28.66  ? 197  PHE A N   1 
ATOM   1518 C CA  . PHE A 1 197 ? 6.424   68.196 48.842 1.00 28.66  ? 197  PHE A CA  1 
ATOM   1519 C C   . PHE A 1 197 ? 5.715   68.179 50.182 1.00 28.66  ? 197  PHE A C   1 
ATOM   1520 O O   . PHE A 1 197 ? 4.620   68.700 50.306 1.00 28.66  ? 197  PHE A O   1 
ATOM   1521 C CB  . PHE A 1 197 ? 7.325   69.446 48.699 1.00 34.11  ? 197  PHE A CB  1 
ATOM   1522 C CG  . PHE A 1 197 ? 6.637   70.770 48.952 1.00 34.11  ? 197  PHE A CG  1 
ATOM   1523 C CD1 . PHE A 1 197 ? 5.532   71.162 48.214 1.00 34.11  ? 197  PHE A CD1 1 
ATOM   1524 C CD2 . PHE A 1 197 ? 7.145   71.653 49.901 1.00 34.11  ? 197  PHE A CD2 1 
ATOM   1525 C CE1 . PHE A 1 197 ? 4.946   72.415 48.416 1.00 34.11  ? 197  PHE A CE1 1 
ATOM   1526 C CE2 . PHE A 1 197 ? 6.564   72.905 50.106 1.00 34.11  ? 197  PHE A CE2 1 
ATOM   1527 C CZ  . PHE A 1 197 ? 5.466   73.284 49.362 1.00 34.11  ? 197  PHE A CZ  1 
ATOM   1528 N N   . GLY A 1 198 ? 6.326   67.550 51.178 1.00 27.47  ? 198  GLY A N   1 
ATOM   1529 C CA  . GLY A 1 198 ? 5.694   67.469 52.477 1.00 27.47  ? 198  GLY A CA  1 
ATOM   1530 C C   . GLY A 1 198 ? 6.671   67.332 53.618 1.00 27.47  ? 198  GLY A C   1 
ATOM   1531 O O   . GLY A 1 198 ? 7.869   67.261 53.405 1.00 27.47  ? 198  GLY A O   1 
ATOM   1532 N N   . GLU A 1 199 ? 6.141   67.283 54.833 1.00 35.87  ? 199  GLU A N   1 
ATOM   1533 C CA  . GLU A 1 199 ? 6.950   67.177 56.040 1.00 35.87  ? 199  GLU A CA  1 
ATOM   1534 C C   . GLU A 1 199 ? 6.414   66.083 56.960 1.00 35.87  ? 199  GLU A C   1 
ATOM   1535 O O   . GLU A 1 199 ? 5.212   65.879 57.021 1.00 35.87  ? 199  GLU A O   1 
ATOM   1536 C CB  . GLU A 1 199 ? 6.907   68.520 56.761 1.00 76.74  ? 199  GLU A CB  1 
ATOM   1537 C CG  . GLU A 1 199 ? 8.186   68.941 57.446 1.00 76.74  ? 199  GLU A CG  1 
ATOM   1538 C CD  . GLU A 1 199 ? 8.181   68.666 58.941 1.00 76.74  ? 199  GLU A CD  1 
ATOM   1539 O OE1 . GLU A 1 199 ? 7.069   68.540 59.534 1.00 76.74  ? 199  GLU A OE1 1 
ATOM   1540 O OE2 . GLU A 1 199 ? 9.300   68.593 59.523 1.00 76.74  ? 199  GLU A OE2 1 
ATOM   1541 N N   . SER A 1 200 ? 7.303   65.387 57.672 1.00 39.63  ? 200  SER A N   1 
ATOM   1542 C CA  . SER A 1 200 ? 6.919   64.319 58.615 1.00 39.63  ? 200  SER A CA  1 
ATOM   1543 C C   . SER A 1 200 ? 6.051   63.310 57.860 1.00 39.63  ? 200  SER A C   1 
ATOM   1544 O O   . SER A 1 200 ? 6.506   62.729 56.887 1.00 39.63  ? 200  SER A O   1 
ATOM   1545 C CB  . SER A 1 200 ? 6.176   64.927 59.830 1.00 47.34  ? 200  SER A CB  1 
ATOM   1546 O OG  . SER A 1 200 ? 5.872   63.974 60.849 1.00 47.34  ? 200  SER A OG  1 
ATOM   1547 N N   . ALA A 1 201 ? 4.810   63.106 58.283 1.00 33.11  ? 201  ALA A N   1 
ATOM   1548 C CA  . ALA A 1 201 ? 3.928   62.169 57.592 1.00 33.11  ? 201  ALA A CA  1 
ATOM   1549 C C   . ALA A 1 201 ? 3.711   62.585 56.134 1.00 33.11  ? 201  ALA A C   1 
ATOM   1550 O O   . ALA A 1 201 ? 3.400   61.759 55.285 1.00 33.11  ? 201  ALA A O   1 
ATOM   1551 C CB  . ALA A 1 201 ? 2.584   62.077 58.314 1.00 35.99  ? 201  ALA A CB  1 
ATOM   1552 N N   . GLY A 1 202 ? 3.865   63.875 55.857 1.00 36.03  ? 202  GLY A N   1 
ATOM   1553 C CA  . GLY A 1 202 ? 3.694   64.375 54.506 1.00 36.03  ? 202  GLY A CA  1 
ATOM   1554 C C   . GLY A 1 202 ? 4.897   64.006 53.671 1.00 36.03  ? 202  GLY A C   1 
ATOM   1555 O O   . GLY A 1 202 ? 4.778   63.771 52.477 1.00 36.03  ? 202  GLY A O   1 
ATOM   1556 N N   . GLY A 1 203 ? 6.065   63.964 54.304 1.00 35.53  ? 203  GLY A N   1 
ATOM   1557 C CA  . GLY A 1 203 ? 7.279   63.599 53.601 1.00 35.53  ? 203  GLY A CA  1 
ATOM   1558 C C   . GLY A 1 203 ? 7.216   62.114 53.317 1.00 35.53  ? 203  GLY A C   1 
ATOM   1559 O O   . GLY A 1 203 ? 7.704   61.644 52.296 1.00 35.53  ? 203  GLY A O   1 
ATOM   1560 N N   . ALA A 1 204 ? 6.608   61.372 54.238 1.00 35.19  ? 204  ALA A N   1 
ATOM   1561 C CA  . ALA A 1 204 ? 6.452   59.934 54.087 1.00 35.19  ? 204  ALA A CA  1 
ATOM   1562 C C   . ALA A 1 204 ? 5.402   59.656 52.995 1.00 35.19  ? 204  ALA A C   1 
ATOM   1563 O O   . ALA A 1 204 ? 5.504   58.682 52.250 1.00 35.19  ? 204  ALA A O   1 
ATOM   1564 C CB  . ALA A 1 204 ? 6.030   59.317 55.415 1.00 26.38  ? 204  ALA A CB  1 
ATOM   1565 N N   . SER A 1 205 ? 4.394   60.517 52.909 1.00 34.86  ? 205  SER A N   1 
ATOM   1566 C CA  . SER A 1 205 ? 3.369   60.383 51.887 1.00 34.86  ? 205  SER A CA  1 
ATOM   1567 C C   . SER A 1 205 ? 3.977   60.612 50.488 1.00 34.86  ? 205  SER A C   1 
ATOM   1568 O O   . SER A 1 205 ? 3.704   59.856 49.557 1.00 34.86  ? 205  SER A O   1 
ATOM   1569 C CB  . SER A 1 205 ? 2.245   61.394 52.127 1.00 32.01  ? 205  SER A CB  1 
ATOM   1570 O OG  . SER A 1 205 ? 1.448   61.013 53.226 1.00 32.01  ? 205  SER A OG  1 
ATOM   1571 N N   . VAL A 1 206 ? 4.794   61.656 50.350 1.00 31.60  ? 206  VAL A N   1 
ATOM   1572 C CA  . VAL A 1 206 ? 5.432   61.966 49.076 1.00 31.60  ? 206  VAL A CA  1 
ATOM   1573 C C   . VAL A 1 206 ? 6.250   60.773 48.611 1.00 31.60  ? 206  VAL A C   1 
ATOM   1574 O O   . VAL A 1 206 ? 6.250   60.426 47.437 1.00 31.60  ? 206  VAL A O   1 
ATOM   1575 C CB  . VAL A 1 206 ? 6.354   63.217 49.189 1.00 30.09  ? 206  VAL A CB  1 
ATOM   1576 C CG1 . VAL A 1 206 ? 7.436   63.182 48.132 1.00 30.09  ? 206  VAL A CG1 1 
ATOM   1577 C CG2 . VAL A 1 206 ? 5.534   64.481 49.023 1.00 30.09  ? 206  VAL A CG2 1 
ATOM   1578 N N   . GLY A 1 207 ? 6.942   60.143 49.548 1.00 32.94  ? 207  GLY A N   1 
ATOM   1579 C CA  . GLY A 1 207 ? 7.746   58.989 49.215 1.00 32.94  ? 207  GLY A CA  1 
ATOM   1580 C C   . GLY A 1 207 ? 6.898   57.794 48.835 1.00 32.94  ? 207  GLY A C   1 
ATOM   1581 O O   . GLY A 1 207 ? 7.360   56.904 48.125 1.00 32.94  ? 207  GLY A O   1 
ATOM   1582 N N   . MET A 1 208 ? 5.654   57.773 49.296 1.00 41.76  ? 208  MET A N   1 
ATOM   1583 C CA  . MET A 1 208 ? 4.765   56.666 48.986 1.00 41.76  ? 208  MET A CA  1 
ATOM   1584 C C   . MET A 1 208 ? 4.102   56.805 47.619 1.00 41.76  ? 208  MET A C   1 
ATOM   1585 O O   . MET A 1 208 ? 3.682   55.811 47.035 1.00 41.76  ? 208  MET A O   1 
ATOM   1586 C CB  . MET A 1 208 ? 3.727   56.499 50.095 1.00 38.17  ? 208  MET A CB  1 
ATOM   1587 C CG  . MET A 1 208 ? 4.314   55.859 51.341 1.00 38.17  ? 208  MET A CG  1 
ATOM   1588 S SD  . MET A 1 208 ? 3.251   55.918 52.775 1.00 38.17  ? 208  MET A SD  1 
ATOM   1589 C CE  . MET A 1 208 ? 4.363   55.440 54.072 1.00 38.17  ? 208  MET A CE  1 
ATOM   1590 N N   . HIS A 1 209 ? 4.021   58.022 47.092 1.00 39.11  ? 209  HIS A N   1 
ATOM   1591 C CA  . HIS A 1 209 ? 3.429   58.201 45.777 1.00 39.11  ? 209  HIS A CA  1 
ATOM   1592 C C   . HIS A 1 209 ? 4.512   57.908 44.769 1.00 39.11  ? 209  HIS A C   1 
ATOM   1593 O O   . HIS A 1 209 ? 4.235   57.571 43.626 1.00 39.11  ? 209  HIS A O   1 
ATOM   1594 C CB  . HIS A 1 209 ? 2.906   59.617 45.600 1.00 38.62  ? 209  HIS A CB  1 
ATOM   1595 C CG  . HIS A 1 209 ? 1.731   59.925 46.466 1.00 38.62  ? 209  HIS A CG  1 
ATOM   1596 N ND1 . HIS A 1 209 ? 0.540   59.241 46.365 1.00 38.62  ? 209  HIS A ND1 1 
ATOM   1597 C CD2 . HIS A 1 209 ? 1.573   60.816 47.472 1.00 38.62  ? 209  HIS A CD2 1 
ATOM   1598 C CE1 . HIS A 1 209 ? -0.303  59.699 47.274 1.00 38.62  ? 209  HIS A CE1 1 
ATOM   1599 N NE2 . HIS A 1 209 ? 0.300   60.654 47.959 1.00 38.62  ? 209  HIS A NE2 1 
ATOM   1600 N N   . ILE A 1 210 ? 5.757   58.036 45.207 1.00 36.49  ? 210  ILE A N   1 
ATOM   1601 C CA  . ILE A 1 210 ? 6.898   57.748 44.356 1.00 36.49  ? 210  ILE A CA  1 
ATOM   1602 C C   . ILE A 1 210 ? 6.998   56.232 44.182 1.00 36.49  ? 210  ILE A C   1 
ATOM   1603 O O   . ILE A 1 210 ? 7.431   55.756 43.139 1.00 36.49  ? 210  ILE A O   1 
ATOM   1604 C CB  . ILE A 1 210 ? 8.199   58.284 44.991 1.00 30.25  ? 210  ILE A CB  1 
ATOM   1605 C CG1 . ILE A 1 210 ? 8.257   59.790 44.813 1.00 30.25  ? 210  ILE A CG1 1 
ATOM   1606 C CG2 . ILE A 1 210 ? 9.417   57.634 44.375 1.00 30.25  ? 210  ILE A CG2 1 
ATOM   1607 C CD1 . ILE A 1 210 ? 9.341   60.424 45.593 1.00 30.25  ? 210  ILE A CD1 1 
ATOM   1608 N N   . LEU A 1 211 ? 6.583   55.487 45.208 1.00 47.03  ? 211  LEU A N   1 
ATOM   1609 C CA  . LEU A 1 211 ? 6.630   54.026 45.191 1.00 47.03  ? 211  LEU A CA  1 
ATOM   1610 C C   . LEU A 1 211 ? 5.377   53.375 44.600 1.00 47.03  ? 211  LEU A C   1 
ATOM   1611 O O   . LEU A 1 211 ? 5.473   52.405 43.857 1.00 47.03  ? 211  LEU A O   1 
ATOM   1612 C CB  . LEU A 1 211 ? 6.834   53.482 46.609 1.00 36.17  ? 211  LEU A CB  1 
ATOM   1613 C CG  . LEU A 1 211 ? 8.061   53.916 47.404 1.00 36.17  ? 211  LEU A CG  1 
ATOM   1614 C CD1 . LEU A 1 211 ? 8.035   53.269 48.764 1.00 36.17  ? 211  LEU A CD1 1 
ATOM   1615 C CD2 . LEU A 1 211 ? 9.307   53.516 46.673 1.00 36.17  ? 211  LEU A CD2 1 
ATOM   1616 N N   . SER A 1 212 ? 4.207   53.901 44.943 1.00 47.60  ? 212  SER A N   1 
ATOM   1617 C CA  . SER A 1 212 ? 2.936   53.364 44.461 1.00 47.60  ? 212  SER A CA  1 
ATOM   1618 C C   . SER A 1 212 ? 2.663   53.585 42.968 1.00 47.60  ? 212  SER A C   1 
ATOM   1619 O O   . SER A 1 212 ? 2.541   54.727 42.513 1.00 47.60  ? 212  SER A O   1 
ATOM   1620 C CB  . SER A 1 212 ? 1.799   53.980 45.261 1.00 47.95  ? 212  SER A CB  1 
ATOM   1621 O OG  . SER A 1 212 ? 0.565   53.802 44.596 1.00 47.95  ? 212  SER A OG  1 
ATOM   1622 N N   . PRO A 1 213 ? 2.530   52.493 42.194 1.00 44.25  ? 213  PRO A N   1 
ATOM   1623 C CA  . PRO A 1 213 ? 2.269   52.584 40.750 1.00 44.25  ? 213  PRO A CA  1 
ATOM   1624 C C   . PRO A 1 213 ? 1.123   53.510 40.357 1.00 44.25  ? 213  PRO A C   1 
ATOM   1625 O O   . PRO A 1 213 ? 1.223   54.243 39.374 1.00 44.25  ? 213  PRO A O   1 
ATOM   1626 C CB  . PRO A 1 213 ? 2.000   51.138 40.362 1.00 34.36  ? 213  PRO A CB  1 
ATOM   1627 C CG  . PRO A 1 213 ? 2.917   50.389 41.296 1.00 34.36  ? 213  PRO A CG  1 
ATOM   1628 C CD  . PRO A 1 213 ? 2.688   51.089 42.613 1.00 34.36  ? 213  PRO A CD  1 
ATOM   1629 N N   . GLY A 1 214 ? 0.035   53.488 41.121 1.00 40.63  ? 214  GLY A N   1 
ATOM   1630 C CA  . GLY A 1 214 ? -1.096  54.339 40.791 1.00 40.63  ? 214  GLY A CA  1 
ATOM   1631 C C   . GLY A 1 214 ? -0.887  55.845 40.880 1.00 40.63  ? 214  GLY A C   1 
ATOM   1632 O O   . GLY A 1 214 ? -1.641  56.606 40.284 1.00 40.63  ? 214  GLY A O   1 
ATOM   1633 N N   . SER A 1 215 ? 0.133   56.297 41.604 1.00 44.55  ? 215  SER A N   1 
ATOM   1634 C CA  . SER A 1 215 ? 0.358   57.731 41.760 1.00 44.55  ? 215  SER A CA  1 
ATOM   1635 C C   . SER A 1 215 ? 1.498   58.299 40.930 1.00 44.55  ? 215  SER A C   1 
ATOM   1636 O O   . SER A 1 215 ? 1.531   59.493 40.653 1.00 44.55  ? 215  SER A O   1 
ATOM   1637 C CB  . SER A 1 215 ? 0.636   58.056 43.234 1.00 44.00  ? 215  SER A CB  1 
ATOM   1638 O OG  . SER A 1 215 ? -0.394  57.591 44.086 1.00 44.00  ? 215  SER A OG  1 
ATOM   1639 N N   . ARG A 1 216 ? 2.428   57.443 40.533 1.00 42.01  ? 216  ARG A N   1 
ATOM   1640 C CA  . ARG A 1 216 ? 3.611   57.867 39.793 1.00 42.01  ? 216  ARG A CA  1 
ATOM   1641 C C   . ARG A 1 216 ? 3.411   58.855 38.645 1.00 42.01  ? 216  ARG A C   1 
ATOM   1642 O O   . ARG A 1 216 ? 4.178   59.803 38.504 1.00 42.01  ? 216  ARG A O   1 
ATOM   1643 C CB  . ARG A 1 216 ? 4.372   56.634 39.280 1.00 41.10  ? 216  ARG A CB  1 
ATOM   1644 C CG  . ARG A 1 216 ? 4.314   55.430 40.221 1.00 41.10  ? 216  ARG A CG  1 
ATOM   1645 C CD  . ARG A 1 216 ? 5.689   54.911 40.605 1.00 41.10  ? 216  ARG A CD  1 
ATOM   1646 N NE  . ARG A 1 216 ? 6.216   53.913 39.680 1.00 41.10  ? 216  ARG A NE  1 
ATOM   1647 C CZ  . ARG A 1 216 ? 6.405   52.629 39.980 1.00 41.10  ? 216  ARG A CZ  1 
ATOM   1648 N NH1 . ARG A 1 216 ? 6.112   52.165 41.188 1.00 41.10  ? 216  ARG A NH1 1 
ATOM   1649 N NH2 . ARG A 1 216 ? 6.889   51.806 39.060 1.00 41.10  ? 216  ARG A NH2 1 
ATOM   1650 N N   . ASP A 1 217 ? 2.382   58.664 37.834 1.00 44.10  ? 217  ASP A N   1 
ATOM   1651 C CA  . ASP A 1 217 ? 2.191   59.555 36.690 1.00 44.10  ? 217  ASP A CA  1 
ATOM   1652 C C   . ASP A 1 217 ? 1.567   60.918 37.001 1.00 44.10  ? 217  ASP A C   1 
ATOM   1653 O O   . ASP A 1 217 ? 1.423   61.746 36.099 1.00 44.10  ? 217  ASP A O   1 
ATOM   1654 C CB  . ASP A 1 217 ? 1.347   58.852 35.607 1.00 58.34  ? 217  ASP A CB  1 
ATOM   1655 C CG  . ASP A 1 217 ? 1.812   57.400 35.316 1.00 58.34  ? 217  ASP A CG  1 
ATOM   1656 O OD1 . ASP A 1 217 ? 3.000   57.076 35.574 1.00 58.34  ? 217  ASP A OD1 1 
ATOM   1657 O OD2 . ASP A 1 217 ? 0.990   56.586 34.810 1.00 58.34  ? 217  ASP A OD2 1 
ATOM   1658 N N   . LEU A 1 218 ? 1.223   61.168 38.265 1.00 41.84  ? 218  LEU A N   1 
ATOM   1659 C CA  . LEU A 1 218 ? 0.569   62.425 38.640 1.00 41.84  ? 218  LEU A CA  1 
ATOM   1660 C C   . LEU A 1 218 ? 1.422   63.610 39.088 1.00 41.84  ? 218  LEU A C   1 
ATOM   1661 O O   . LEU A 1 218 ? 0.876   64.633 39.493 1.00 41.84  ? 218  LEU A O   1 
ATOM   1662 C CB  . LEU A 1 218 ? -0.494  62.161 39.705 1.00 39.59  ? 218  LEU A CB  1 
ATOM   1663 C CG  . LEU A 1 218 ? -1.650  61.256 39.265 1.00 39.59  ? 218  LEU A CG  1 
ATOM   1664 C CD1 . LEU A 1 218 ? -2.689  61.125 40.378 1.00 39.59  ? 218  LEU A CD1 1 
ATOM   1665 C CD2 . LEU A 1 218 ? -2.282  61.830 38.014 1.00 39.59  ? 218  LEU A CD2 1 
ATOM   1666 N N   . PHE A 1 219 ? 2.742   63.479 39.036 1.00 26.90  ? 219  PHE A N   1 
ATOM   1667 C CA  . PHE A 1 219 ? 3.624   64.573 39.407 1.00 26.90  ? 219  PHE A CA  1 
ATOM   1668 C C   . PHE A 1 219 ? 4.961   64.392 38.709 1.00 26.90  ? 219  PHE A C   1 
ATOM   1669 O O   . PHE A 1 219 ? 5.256   63.323 38.200 1.00 26.90  ? 219  PHE A O   1 
ATOM   1670 C CB  . PHE A 1 219 ? 3.806   64.672 40.931 1.00 32.89  ? 219  PHE A CB  1 
ATOM   1671 C CG  . PHE A 1 219 ? 4.388   63.451 41.561 1.00 32.89  ? 219  PHE A CG  1 
ATOM   1672 C CD1 . PHE A 1 219 ? 3.584   62.357 41.866 1.00 32.89  ? 219  PHE A CD1 1 
ATOM   1673 C CD2 . PHE A 1 219 ? 5.746   63.383 41.833 1.00 32.89  ? 219  PHE A CD2 1 
ATOM   1674 C CE1 . PHE A 1 219 ? 4.128   61.207 42.433 1.00 32.89  ? 219  PHE A CE1 1 
ATOM   1675 C CE2 . PHE A 1 219 ? 6.302   62.241 42.398 1.00 32.89  ? 219  PHE A CE2 1 
ATOM   1676 C CZ  . PHE A 1 219 ? 5.491   61.148 42.699 1.00 32.89  ? 219  PHE A CZ  1 
ATOM   1677 N N   . ARG A 1 220 ? 5.758   65.451 38.682 1.00 35.43  ? 220  ARG A N   1 
ATOM   1678 C CA  . ARG A 1 220 ? 7.049   65.449 38.010 1.00 35.43  ? 220  ARG A CA  1 
ATOM   1679 C C   . ARG A 1 220 ? 8.215   65.223 38.972 1.00 35.43  ? 220  ARG A C   1 
ATOM   1680 O O   . ARG A 1 220 ? 9.038   64.329 38.773 1.00 35.43  ? 220  ARG A O   1 
ATOM   1681 C CB  . ARG A 1 220 ? 7.208   66.788 37.284 1.00 44.28  ? 220  ARG A CB  1 
ATOM   1682 C CG  . ARG A 1 220 ? 8.516   67.027 36.570 1.00 44.28  ? 220  ARG A CG  1 
ATOM   1683 C CD  . ARG A 1 220 ? 8.656   66.151 35.353 1.00 44.28  ? 220  ARG A CD  1 
ATOM   1684 N NE  . ARG A 1 220 ? 9.719   66.610 34.458 1.00 44.28  ? 220  ARG A NE  1 
ATOM   1685 C CZ  . ARG A 1 220 ? 9.553   67.510 33.492 1.00 44.28  ? 220  ARG A CZ  1 
ATOM   1686 N NH1 . ARG A 1 220 ? 8.364   68.065 33.282 1.00 44.28  ? 220  ARG A NH1 1 
ATOM   1687 N NH2 . ARG A 1 220 ? 10.574  67.836 32.713 1.00 44.28  ? 220  ARG A NH2 1 
ATOM   1688 N N   . ARG A 1 221 ? 8.274   66.037 40.018 1.00 31.84  ? 221  ARG A N   1 
ATOM   1689 C CA  . ARG A 1 221 ? 9.337   65.955 41.003 1.00 31.84  ? 221  ARG A CA  1 
ATOM   1690 C C   . ARG A 1 221 ? 8.788   65.885 42.410 1.00 31.84  ? 221  ARG A C   1 
ATOM   1691 O O   . ARG A 1 221 ? 7.592   66.075 42.630 1.00 31.84  ? 221  ARG A O   1 
ATOM   1692 C CB  . ARG A 1 221 ? 10.241  67.170 40.885 1.00 40.09  ? 221  ARG A CB  1 
ATOM   1693 C CG  . ARG A 1 221 ? 11.172  67.115 39.724 1.00 40.09  ? 221  ARG A CG  1 
ATOM   1694 C CD  . ARG A 1 221 ? 12.019  68.342 39.706 1.00 40.09  ? 221  ARG A CD  1 
ATOM   1695 N NE  . ARG A 1 221 ? 11.445  69.357 38.846 1.00 40.09  ? 221  ARG A NE  1 
ATOM   1696 C CZ  . ARG A 1 221 ? 11.572  69.361 37.527 1.00 40.09  ? 221  ARG A CZ  1 
ATOM   1697 N NH1 . ARG A 1 221 ? 12.256  68.408 36.914 1.00 40.09  ? 221  ARG A NH1 1 
ATOM   1698 N NH2 . ARG A 1 221 ? 11.003  70.318 36.823 1.00 40.09  ? 221  ARG A NH2 1 
ATOM   1699 N N   . ALA A 1 222 ? 9.679   65.639 43.367 1.00 35.14  ? 222  ALA A N   1 
ATOM   1700 C CA  . ALA A 1 222 ? 9.276   65.524 44.755 1.00 35.14  ? 222  ALA A CA  1 
ATOM   1701 C C   . ALA A 1 222 ? 10.303  66.055 45.738 1.00 35.14  ? 222  ALA A C   1 
ATOM   1702 O O   . ALA A 1 222 ? 11.503  65.948 45.519 1.00 35.14  ? 222  ALA A O   1 
ATOM   1703 C CB  . ALA A 1 222 ? 8.973   64.073 45.071 1.00 22.84  ? 222  ALA A CB  1 
ATOM   1704 N N   . ILE A 1 223 ? 9.802   66.635 46.824 1.00 36.20  ? 223  ILE A N   1 
ATOM   1705 C CA  . ILE A 1 223 ? 10.632  67.160 47.900 1.00 36.20  ? 223  ILE A CA  1 
ATOM   1706 C C   . ILE A 1 223 ? 10.139  66.507 49.191 1.00 36.20  ? 223  ILE A C   1 
ATOM   1707 O O   . ILE A 1 223 ? 8.947   66.533 49.485 1.00 36.20  ? 223  ILE A O   1 
ATOM   1708 C CB  . ILE A 1 223 ? 10.496  68.684 48.025 1.00 28.40  ? 223  ILE A CB  1 
ATOM   1709 C CG1 . ILE A 1 223 ? 10.933  69.349 46.725 1.00 28.40  ? 223  ILE A CG1 1 
ATOM   1710 C CG2 . ILE A 1 223 ? 11.357  69.189 49.161 1.00 28.40  ? 223  ILE A CG2 1 
ATOM   1711 C CD1 . ILE A 1 223 ? 10.671  70.824 46.691 1.00 28.40  ? 223  ILE A CD1 1 
ATOM   1712 N N   . LEU A 1 224 ? 11.052  65.900 49.944 1.00 30.25  ? 224  LEU A N   1 
ATOM   1713 C CA  . LEU A 1 224 ? 10.698  65.236 51.197 1.00 30.25  ? 224  LEU A CA  1 
ATOM   1714 C C   . LEU A 1 224 ? 11.421  65.865 52.375 1.00 30.25  ? 224  LEU A C   1 
ATOM   1715 O O   . LEU A 1 224 ? 12.643  65.908 52.401 1.00 30.25  ? 224  LEU A O   1 
ATOM   1716 C CB  . LEU A 1 224 ? 11.062  63.748 51.146 1.00 27.22  ? 224  LEU A CB  1 
ATOM   1717 C CG  . LEU A 1 224 ? 10.346  62.814 50.173 1.00 27.22  ? 224  LEU A CG  1 
ATOM   1718 C CD1 . LEU A 1 224 ? 10.828  63.050 48.748 1.00 27.22  ? 224  LEU A CD1 1 
ATOM   1719 C CD2 . LEU A 1 224 ? 10.618  61.384 50.601 1.00 27.22  ? 224  LEU A CD2 1 
ATOM   1720 N N   . GLN A 1 225 ? 10.669  66.336 53.362 1.00 31.90  ? 225  GLN A N   1 
ATOM   1721 C CA  . GLN A 1 225 ? 11.270  66.960 54.535 1.00 31.90  ? 225  GLN A CA  1 
ATOM   1722 C C   . GLN A 1 225 ? 11.061  66.151 55.811 1.00 31.90  ? 225  GLN A C   1 
ATOM   1723 O O   . GLN A 1 225 ? 9.940   65.876 56.215 1.00 31.90  ? 225  GLN A O   1 
ATOM   1724 C CB  . GLN A 1 225 ? 10.701  68.365 54.718 1.00 38.58  ? 225  GLN A CB  1 
ATOM   1725 C CG  . GLN A 1 225 ? 10.803  69.228 53.476 1.00 38.58  ? 225  GLN A CG  1 
ATOM   1726 C CD  . GLN A 1 225 ? 10.127  70.573 53.640 1.00 38.58  ? 225  GLN A CD  1 
ATOM   1727 O OE1 . GLN A 1 225 ? 9.788   71.240 52.661 1.00 38.58  ? 225  GLN A OE1 1 
ATOM   1728 N NE2 . GLN A 1 225 ? 9.931   70.984 54.885 1.00 38.58  ? 225  GLN A NE2 1 
ATOM   1729 N N   . SER A 1 226 ? 12.157  65.745 56.432 1.00 43.92  ? 226  SER A N   1 
ATOM   1730 C CA  . SER A 1 226 ? 12.097  65.006 57.689 1.00 43.92  ? 226  SER A CA  1 
ATOM   1731 C C   . SER A 1 226 ? 11.149  63.815 57.683 1.00 43.92  ? 226  SER A C   1 
ATOM   1732 O O   . SER A 1 226 ? 10.413  63.603 58.647 1.00 43.92  ? 226  SER A O   1 
ATOM   1733 C CB  . SER A 1 226 ? 11.689  65.954 58.825 1.00 49.80  ? 226  SER A CB  1 
ATOM   1734 O OG  . SER A 1 226 ? 12.559  67.072 58.916 1.00 49.80  ? 226  SER A OG  1 
ATOM   1735 N N   . GLY A 1 227 ? 11.162  63.033 56.613 1.00 39.64  ? 227  GLY A N   1 
ATOM   1736 C CA  . GLY A 1 227 ? 10.275  61.888 56.566 1.00 39.64  ? 227  GLY A CA  1 
ATOM   1737 C C   . GLY A 1 227 ? 10.424  61.109 55.287 1.00 39.64  ? 227  GLY A C   1 
ATOM   1738 O O   . GLY A 1 227 ? 10.618  61.692 54.234 1.00 39.64  ? 227  GLY A O   1 
ATOM   1739 N N   . SER A 1 228 ? 10.349  59.789 55.380 1.00 39.49  ? 228  SER A N   1 
ATOM   1740 C CA  . SER A 1 228 ? 10.461  58.940 54.205 1.00 39.49  ? 228  SER A CA  1 
ATOM   1741 C C   . SER A 1 228 ? 9.523   57.755 54.383 1.00 39.49  ? 228  SER A C   1 
ATOM   1742 O O   . SER A 1 228 ? 9.162   57.407 55.496 1.00 39.49  ? 228  SER A O   1 
ATOM   1743 C CB  . SER A 1 228 ? 11.900  58.472 54.019 1.00 37.69  ? 228  SER A CB  1 
ATOM   1744 O OG  . SER A 1 228 ? 12.295  57.651 55.085 1.00 37.69  ? 228  SER A OG  1 
ATOM   1745 N N   . PRO A 1 229 ? 9.128   57.110 53.282 1.00 37.66  ? 229  PRO A N   1 
ATOM   1746 C CA  . PRO A 1 229 ? 8.214   55.961 53.311 1.00 37.66  ? 229  PRO A CA  1 
ATOM   1747 C C   . PRO A 1 229 ? 8.590   54.778 54.196 1.00 37.66  ? 229  PRO A C   1 
ATOM   1748 O O   . PRO A 1 229 ? 7.722   54.140 54.784 1.00 37.66  ? 229  PRO A O   1 
ATOM   1749 C CB  . PRO A 1 229 ? 8.117   55.571 51.839 1.00 38.21  ? 229  PRO A CB  1 
ATOM   1750 C CG  . PRO A 1 229 ? 9.488   55.945 51.309 1.00 38.21  ? 229  PRO A CG  1 
ATOM   1751 C CD  . PRO A 1 229 ? 9.704   57.294 51.936 1.00 38.21  ? 229  PRO A CD  1 
ATOM   1752 N N   . ASN A 1 230 ? 9.881   54.491 54.296 1.00 36.39  ? 230  ASN A N   1 
ATOM   1753 C CA  . ASN A 1 230 ? 10.353  53.363 55.089 1.00 36.39  ? 230  ASN A CA  1 
ATOM   1754 C C   . ASN A 1 230 ? 10.617  53.662 56.563 1.00 36.39  ? 230  ASN A C   1 
ATOM   1755 O O   . ASN A 1 230 ? 11.388  52.956 57.207 1.00 36.39  ? 230  ASN A O   1 
ATOM   1756 C CB  . ASN A 1 230 ? 11.615  52.783 54.448 1.00 45.25  ? 230  ASN A CB  1 
ATOM   1757 C CG  . ASN A 1 230 ? 12.738  53.794 54.368 1.00 45.25  ? 230  ASN A CG  1 
ATOM   1758 O OD1 . ASN A 1 230 ? 12.513  54.955 54.034 1.00 45.25  ? 230  ASN A OD1 1 
ATOM   1759 N ND2 . ASN A 1 230 ? 13.961  53.356 54.666 1.00 45.25  ? 230  ASN A ND2 1 
ATOM   1760 N N   . CYS A 1 231 ? 9.982   54.696 57.103 1.00 37.35  ? 231  CYS A N   1 
ATOM   1761 C CA  . CYS A 1 231 ? 10.164  55.031 58.514 1.00 37.35  ? 231  CYS A CA  1 
ATOM   1762 C C   . CYS A 1 231 ? 9.431   54.000 59.383 1.00 37.35  ? 231  CYS A C   1 
ATOM   1763 O O   . CYS A 1 231 ? 8.321   53.594 59.061 1.00 37.35  ? 231  CYS A O   1 
ATOM   1764 C CB  . CYS A 1 231 ? 9.627   56.441 58.804 1.00 43.83  ? 231  CYS A CB  1 
ATOM   1765 S SG  . CYS A 1 231 ? 10.706  57.829 58.304 1.00 43.83  ? 231  CYS A SG  1 
ATOM   1766 N N   . PRO A 1 232 ? 10.037  53.573 60.503 1.00 34.26  ? 232  PRO A N   1 
ATOM   1767 C CA  . PRO A 1 232 ? 9.403   52.582 61.384 1.00 34.26  ? 232  PRO A CA  1 
ATOM   1768 C C   . PRO A 1 232 ? 7.996   52.927 61.912 1.00 34.26  ? 232  PRO A C   1 
ATOM   1769 O O   . PRO A 1 232 ? 7.293   52.053 62.426 1.00 34.26  ? 232  PRO A O   1 
ATOM   1770 C CB  . PRO A 1 232 ? 10.433  52.416 62.507 1.00 20.61  ? 232  PRO A CB  1 
ATOM   1771 C CG  . PRO A 1 232 ? 11.064  53.751 62.594 1.00 20.61  ? 232  PRO A CG  1 
ATOM   1772 C CD  . PRO A 1 232 ? 11.254  54.123 61.131 1.00 20.61  ? 232  PRO A CD  1 
ATOM   1773 N N   . TRP A 1 233 ? 7.577   54.184 61.772 1.00 34.12  ? 233  TRP A N   1 
ATOM   1774 C CA  . TRP A 1 233 ? 6.261   54.611 62.249 1.00 34.12  ? 233  TRP A CA  1 
ATOM   1775 C C   . TRP A 1 233 ? 5.242   54.852 61.143 1.00 34.12  ? 233  TRP A C   1 
ATOM   1776 O O   . TRP A 1 233 ? 4.057   54.947 61.413 1.00 34.12  ? 233  TRP A O   1 
ATOM   1777 C CB  . TRP A 1 233 ? 6.380   55.906 63.051 1.00 35.25  ? 233  TRP A CB  1 
ATOM   1778 C CG  . TRP A 1 233 ? 7.169   56.963 62.336 1.00 35.25  ? 233  TRP A CG  1 
ATOM   1779 C CD1 . TRP A 1 233 ? 8.505   57.212 62.464 1.00 35.25  ? 233  TRP A CD1 1 
ATOM   1780 C CD2 . TRP A 1 233 ? 6.693   57.863 61.336 1.00 35.25  ? 233  TRP A CD2 1 
ATOM   1781 N NE1 . TRP A 1 233 ? 8.889   58.209 61.608 1.00 35.25  ? 233  TRP A NE1 1 
ATOM   1782 C CE2 . TRP A 1 233 ? 7.796   58.627 60.901 1.00 35.25  ? 233  TRP A CE2 1 
ATOM   1783 C CE3 . TRP A 1 233 ? 5.440   58.100 60.763 1.00 35.25  ? 233  TRP A CE3 1 
ATOM   1784 C CZ2 . TRP A 1 233 ? 7.686   59.611 59.916 1.00 35.25  ? 233  TRP A CZ2 1 
ATOM   1785 C CZ3 . TRP A 1 233 ? 5.330   59.081 59.782 1.00 35.25  ? 233  TRP A CZ3 1 
ATOM   1786 C CH2 . TRP A 1 233 ? 6.448   59.823 59.370 1.00 35.25  ? 233  TRP A CH2 1 
ATOM   1787 N N   . ALA A 1 234 ? 5.705   54.942 59.904 1.00 28.83  ? 234  ALA A N   1 
ATOM   1788 C CA  . ALA A 1 234 ? 4.833   55.239 58.783 1.00 28.83  ? 234  ALA A CA  1 
ATOM   1789 C C   . ALA A 1 234 ? 3.993   54.120 58.186 1.00 28.83  ? 234  ALA A C   1 
ATOM   1790 O O   . ALA A 1 234 ? 3.127   54.391 57.369 1.00 28.83  ? 234  ALA A O   1 
ATOM   1791 C CB  . ALA A 1 234 ? 5.638   55.906 57.697 1.00 20.87  ? 234  ALA A CB  1 
ATOM   1792 N N   . SER A 1 235 ? 4.231   52.868 58.559 1.00 39.44  ? 235  SER A N   1 
ATOM   1793 C CA  . SER A 1 235 ? 3.408   51.793 58.013 1.00 39.44  ? 235  SER A CA  1 
ATOM   1794 C C   . SER A 1 235 ? 3.384   50.519 58.842 1.00 39.44  ? 235  SER A C   1 
ATOM   1795 O O   . SER A 1 235 ? 4.245   50.298 59.679 1.00 39.44  ? 235  SER A O   1 
ATOM   1796 C CB  . SER A 1 235 ? 3.830   51.466 56.582 1.00 40.63  ? 235  SER A CB  1 
ATOM   1797 O OG  . SER A 1 235 ? 5.057   50.776 56.549 1.00 40.63  ? 235  SER A OG  1 
ATOM   1798 N N   . VAL A 1 236 ? 2.375   49.688 58.604 1.00 37.54  ? 236  VAL A N   1 
ATOM   1799 C CA  . VAL A 1 236 ? 2.211   48.432 59.323 1.00 37.54  ? 236  VAL A CA  1 
ATOM   1800 C C   . VAL A 1 236 ? 1.760   47.311 58.395 1.00 37.54  ? 236  VAL A C   1 
ATOM   1801 O O   . VAL A 1 236 ? 1.365   47.546 57.261 1.00 37.54  ? 236  VAL A O   1 
ATOM   1802 C CB  . VAL A 1 236 ? 1.157   48.557 60.464 1.00 34.21  ? 236  VAL A CB  1 
ATOM   1803 C CG1 . VAL A 1 236 ? 1.623   49.557 61.506 1.00 34.21  ? 236  VAL A CG1 1 
ATOM   1804 C CG2 . VAL A 1 236 ? -0.189  48.962 59.891 1.00 34.21  ? 236  VAL A CG2 1 
ATOM   1805 N N   . SER A 1 237 ? 1.819   46.087 58.895 1.00 31.87  ? 237  SER A N   1 
ATOM   1806 C CA  . SER A 1 237 ? 1.407   44.922 58.129 1.00 31.87  ? 237  SER A CA  1 
ATOM   1807 C C   . SER A 1 237 ? -0.112  44.844 58.164 1.00 31.87  ? 237  SER A C   1 
ATOM   1808 O O   . SER A 1 237 ? -0.746  45.465 59.014 1.00 31.87  ? 237  SER A O   1 
ATOM   1809 C CB  . SER A 1 237 ? 1.990   43.657 58.754 1.00 33.06  ? 237  SER A CB  1 
ATOM   1810 O OG  . SER A 1 237 ? 1.456   43.451 60.057 1.00 33.06  ? 237  SER A OG  1 
ATOM   1811 N N   . VAL A 1 238 ? -0.698  44.076 57.255 1.00 35.22  ? 238  VAL A N   1 
ATOM   1812 C CA  . VAL A 1 238 ? -2.141  43.952 57.235 1.00 35.22  ? 238  VAL A CA  1 
ATOM   1813 C C   . VAL A 1 238 ? -2.598  43.276 58.511 1.00 35.22  ? 238  VAL A C   1 
ATOM   1814 O O   . VAL A 1 238 ? -3.712  43.502 58.976 1.00 35.22  ? 238  VAL A O   1 
ATOM   1815 C CB  . VAL A 1 238 ? -2.606  43.145 56.037 1.00 39.72  ? 238  VAL A CB  1 
ATOM   1816 C CG1 . VAL A 1 238 ? -2.159  43.824 54.769 1.00 39.72  ? 238  VAL A CG1 1 
ATOM   1817 C CG2 . VAL A 1 238 ? -2.036  41.772 56.099 1.00 39.72  ? 238  VAL A CG2 1 
ATOM   1818 N N   . ALA A 1 239 ? -1.723  42.457 59.088 1.00 38.34  ? 239  ALA A N   1 
ATOM   1819 C CA  . ALA A 1 239 ? -2.033  41.753 60.330 1.00 38.34  ? 239  ALA A CA  1 
ATOM   1820 C C   . ALA A 1 239 ? -2.131  42.709 61.507 1.00 38.34  ? 239  ALA A C   1 
ATOM   1821 O O   . ALA A 1 239 ? -3.073  42.628 62.290 1.00 38.34  ? 239  ALA A O   1 
ATOM   1822 C CB  . ALA A 1 239 ? -0.978  40.701 60.618 1.00 23.97  ? 239  ALA A CB  1 
ATOM   1823 N N   . GLU A 1 240 ? -1.153  43.604 61.646 1.00 41.87  ? 240  GLU A N   1 
ATOM   1824 C CA  . GLU A 1 240 ? -1.173  44.564 62.751 1.00 41.87  ? 240  GLU A CA  1 
ATOM   1825 C C   . GLU A 1 240 ? -2.285  45.578 62.513 1.00 41.87  ? 240  GLU A C   1 
ATOM   1826 O O   . GLU A 1 240 ? -2.888  46.086 63.457 1.00 41.87  ? 240  GLU A O   1 
ATOM   1827 C CB  . GLU A 1 240 ? 0.183   45.267 62.887 1.00 59.72  ? 240  GLU A CB  1 
ATOM   1828 C CG  . GLU A 1 240 ? 0.275   46.317 64.027 1.00 59.72  ? 240  GLU A CG  1 
ATOM   1829 C CD  . GLU A 1 240 ? -0.129  45.791 65.422 1.00 59.72  ? 240  GLU A CD  1 
ATOM   1830 O OE1 . GLU A 1 240 ? -0.202  44.558 65.619 1.00 59.72  ? 240  GLU A OE1 1 
ATOM   1831 O OE2 . GLU A 1 240 ? -0.366  46.623 66.330 1.00 59.72  ? 240  GLU A OE2 1 
ATOM   1832 N N   . GLY A 1 241 ? -2.569  45.853 61.245 1.00 39.34  ? 241  GLY A N   1 
ATOM   1833 C CA  . GLY A 1 241 ? -3.634  46.783 60.921 1.00 39.34  ? 241  GLY A CA  1 
ATOM   1834 C C   . GLY A 1 241 ? -4.951  46.178 61.356 1.00 39.34  ? 241  GLY A C   1 
ATOM   1835 O O   . GLY A 1 241 ? -5.798  46.845 61.943 1.00 39.34  ? 241  GLY A O   1 
ATOM   1836 N N   . ARG A 1 242 ? -5.121  44.896 61.063 1.00 41.21  ? 242  ARG A N   1 
ATOM   1837 C CA  . ARG A 1 242 ? -6.332  44.190 61.441 1.00 41.21  ? 242  ARG A CA  1 
ATOM   1838 C C   . ARG A 1 242 ? -6.423  44.089 62.967 1.00 41.21  ? 242  ARG A C   1 
ATOM   1839 O O   . ARG A 1 242 ? -7.482  44.307 63.558 1.00 41.21  ? 242  ARG A O   1 
ATOM   1840 C CB  . ARG A 1 242 ? -6.339  42.796 60.807 1.00 48.32  ? 242  ARG A CB  1 
ATOM   1841 C CG  . ARG A 1 242 ? -7.533  41.931 61.208 1.00 48.32  ? 242  ARG A CG  1 
ATOM   1842 C CD  . ARG A 1 242 ? -7.649  40.691 60.325 1.00 48.32  ? 242  ARG A CD  1 
ATOM   1843 N NE  . ARG A 1 242 ? -8.205  40.999 59.007 1.00 48.32  ? 242  ARG A NE  1 
ATOM   1844 C CZ  . ARG A 1 242 ? -9.496  41.242 58.772 1.00 48.32  ? 242  ARG A CZ  1 
ATOM   1845 N NH1 . ARG A 1 242 ? -10.382 41.216 59.768 1.00 48.32  ? 242  ARG A NH1 1 
ATOM   1846 N NH2 . ARG A 1 242 ? -9.907  41.507 57.533 1.00 48.32  ? 242  ARG A NH2 1 
ATOM   1847 N N   . ARG A 1 243 ? -5.301  43.779 63.600 1.00 33.19  ? 243  ARG A N   1 
ATOM   1848 C CA  . ARG A 1 243 ? -5.250  43.648 65.041 1.00 33.19  ? 243  ARG A CA  1 
ATOM   1849 C C   . ARG A 1 243 ? -5.652  44.942 65.753 1.00 33.19  ? 243  ARG A C   1 
ATOM   1850 O O   . ARG A 1 243 ? -6.326  44.907 66.780 1.00 33.19  ? 243  ARG A O   1 
ATOM   1851 C CB  . ARG A 1 243 ? -3.843  43.231 65.455 1.00 45.99  ? 243  ARG A CB  1 
ATOM   1852 C CG  . ARG A 1 243 ? -3.707  42.850 66.904 1.00 45.99  ? 243  ARG A CG  1 
ATOM   1853 C CD  . ARG A 1 243 ? -2.536  43.583 67.531 1.00 45.99  ? 243  ARG A CD  1 
ATOM   1854 N NE  . ARG A 1 243 ? -2.993  44.327 68.694 1.00 45.99  ? 243  ARG A NE  1 
ATOM   1855 C CZ  . ARG A 1 243 ? -2.535  45.517 69.056 1.00 45.99  ? 243  ARG A CZ  1 
ATOM   1856 N NH1 . ARG A 1 243 ? -1.589  46.116 68.343 1.00 45.99  ? 243  ARG A NH1 1 
ATOM   1857 N NH2 . ARG A 1 243 ? -3.038  46.114 70.131 1.00 45.99  ? 243  ARG A NH2 1 
ATOM   1858 N N   . ARG A 1 244 ? -5.245  46.083 65.207 1.00 37.20  ? 244  ARG A N   1 
ATOM   1859 C CA  . ARG A 1 244 ? -5.583  47.370 65.809 1.00 37.20  ? 244  ARG A CA  1 
ATOM   1860 C C   . ARG A 1 244 ? -7.019  47.795 65.525 1.00 37.20  ? 244  ARG A C   1 
ATOM   1861 O O   . ARG A 1 244 ? -7.630  48.486 66.334 1.00 37.20  ? 244  ARG A O   1 
ATOM   1862 C CB  . ARG A 1 244 ? -4.626  48.471 65.329 1.00 35.62  ? 244  ARG A CB  1 
ATOM   1863 C CG  . ARG A 1 244 ? -3.190  48.312 65.795 1.00 35.62  ? 244  ARG A CG  1 
ATOM   1864 C CD  . ARG A 1 244 ? -2.332  49.464 65.322 1.00 35.62  ? 244  ARG A CD  1 
ATOM   1865 N NE  . ARG A 1 244 ? -0.913  49.180 65.484 1.00 35.62  ? 244  ARG A NE  1 
ATOM   1866 C CZ  . ARG A 1 244 ? 0.066   50.012 65.144 1.00 35.62  ? 244  ARG A CZ  1 
ATOM   1867 N NH1 . ARG A 1 244 ? -0.203  51.198 64.615 1.00 35.62  ? 244  ARG A NH1 1 
ATOM   1868 N NH2 . ARG A 1 244 ? 1.321   49.652 65.335 1.00 35.62  ? 244  ARG A NH2 1 
ATOM   1869 N N   . ALA A 1 245 ? -7.554  47.398 64.375 1.00 38.23  ? 245  ALA A N   1 
ATOM   1870 C CA  . ALA A 1 245 ? -8.930  47.743 64.023 1.00 38.23  ? 245  ALA A CA  1 
ATOM   1871 C C   . ALA A 1 245 ? -9.874  47.050 65.004 1.00 38.23  ? 245  ALA A C   1 
ATOM   1872 O O   . ALA A 1 245 ? -10.842 47.635 65.486 1.00 38.23  ? 245  ALA A O   1 
ATOM   1873 C CB  . ALA A 1 245 ? -9.226  47.288 62.624 1.00 40.95  ? 245  ALA A CB  1 
ATOM   1874 N N   . VAL A 1 246 ? -9.568  45.792 65.293 1.00 44.81  ? 246  VAL A N   1 
ATOM   1875 C CA  . VAL A 1 246 ? -10.353 44.997 66.216 1.00 44.81  ? 246  VAL A CA  1 
ATOM   1876 C C   . VAL A 1 246 ? -10.319 45.559 67.637 1.00 44.81  ? 246  VAL A C   1 
ATOM   1877 O O   . VAL A 1 246 ? -11.367 45.728 68.272 1.00 44.81  ? 246  VAL A O   1 
ATOM   1878 C CB  . VAL A 1 246 ? -9.846  43.561 66.230 1.00 32.26  ? 246  VAL A CB  1 
ATOM   1879 C CG1 . VAL A 1 246 ? -10.544 42.775 67.322 1.00 32.26  ? 246  VAL A CG1 1 
ATOM   1880 C CG2 . VAL A 1 246 ? -10.084 42.934 64.867 1.00 32.26  ? 246  VAL A CG2 1 
ATOM   1881 N N   . GLU A 1 247 ? -9.116  45.848 68.126 1.00 40.46  ? 247  GLU A N   1 
ATOM   1882 C CA  . GLU A 1 247 ? -8.939  46.397 69.464 1.00 40.46  ? 247  GLU A CA  1 
ATOM   1883 C C   . GLU A 1 247 ? -9.659  47.736 69.559 1.00 40.46  ? 247  GLU A C   1 
ATOM   1884 O O   . GLU A 1 247 ? -10.211 48.077 70.602 1.00 40.46  ? 247  GLU A O   1 
ATOM   1885 C CB  . GLU A 1 247 ? -7.453  46.570 69.766 1.00 69.48  ? 247  GLU A CB  1 
ATOM   1886 C CG  . GLU A 1 247 ? -7.102  46.703 71.247 1.00 69.48  ? 247  GLU A CG  1 
ATOM   1887 C CD  . GLU A 1 247 ? -7.580  45.509 72.105 1.00 69.48  ? 247  GLU A CD  1 
ATOM   1888 O OE1 . GLU A 1 247 ? -7.506  44.344 71.620 1.00 69.48  ? 247  GLU A OE1 1 
ATOM   1889 O OE2 . GLU A 1 247 ? -8.013  45.747 73.270 1.00 69.48  ? 247  GLU A OE2 1 
ATOM   1890 N N   . LEU A 1 248 ? -9.661  48.501 68.473 1.00 40.25  ? 248  LEU A N   1 
ATOM   1891 C CA  . LEU A 1 248 ? -10.368 49.774 68.491 1.00 40.25  ? 248  LEU A CA  1 
ATOM   1892 C C   . LEU A 1 248 ? -11.834 49.453 68.775 1.00 40.25  ? 248  LEU A C   1 
ATOM   1893 O O   . LEU A 1 248 ? -12.470 50.094 69.610 1.00 40.25  ? 248  LEU A O   1 
ATOM   1894 C CB  . LEU A 1 248 ? -10.257 50.495 67.145 1.00 28.46  ? 248  LEU A CB  1 
ATOM   1895 C CG  . LEU A 1 248 ? -11.162 51.731 67.047 1.00 28.46  ? 248  LEU A CG  1 
ATOM   1896 C CD1 . LEU A 1 248 ? -10.705 52.759 68.056 1.00 28.46  ? 248  LEU A CD1 1 
ATOM   1897 C CD2 . LEU A 1 248 ? -11.139 52.315 65.647 1.00 28.46  ? 248  LEU A CD2 1 
ATOM   1898 N N   . GLY A 1 249 ? -12.354 48.441 68.082 1.00 44.60  ? 249  GLY A N   1 
ATOM   1899 C CA  . GLY A 1 249 ? -13.737 48.038 68.260 1.00 44.60  ? 249  GLY A CA  1 
ATOM   1900 C C   . GLY A 1 249 ? -14.017 47.462 69.632 1.00 44.60  ? 249  GLY A C   1 
ATOM   1901 O O   . GLY A 1 249 ? -15.127 47.577 70.152 1.00 44.60  ? 249  GLY A O   1 
ATOM   1902 N N   . ARG A 1 250 ? -13.012 46.836 70.225 1.00 46.37  ? 250  ARG A N   1 
ATOM   1903 C CA  . ARG A 1 250 ? -13.173 46.256 71.546 1.00 46.37  ? 250  ARG A CA  1 
ATOM   1904 C C   . ARG A 1 250 ? -13.312 47.379 72.594 1.00 46.37  ? 250  ARG A C   1 
ATOM   1905 O O   . ARG A 1 250 ? -14.033 47.244 73.589 1.00 46.37  ? 250  ARG A O   1 
ATOM   1906 C CB  . ARG A 1 250 ? -11.963 45.375 71.859 1.00 55.70  ? 250  ARG A CB  1 
ATOM   1907 C CG  . ARG A 1 250 ? -12.124 44.499 73.083 1.00 55.70  ? 250  ARG A CG  1 
ATOM   1908 C CD  . ARG A 1 250 ? -10.833 43.770 73.398 1.00 55.70  ? 250  ARG A CD  1 
ATOM   1909 N NE  . ARG A 1 250 ? -10.334 43.045 72.232 1.00 55.70  ? 250  ARG A NE  1 
ATOM   1910 C CZ  . ARG A 1 250 ? -10.899 41.954 71.720 1.00 55.70  ? 250  ARG A CZ  1 
ATOM   1911 N NH1 . ARG A 1 250 ? -12.000 41.444 72.270 1.00 55.70  ? 250  ARG A NH1 1 
ATOM   1912 N NH2 . ARG A 1 250 ? -10.358 41.369 70.656 1.00 55.70  ? 250  ARG A NH2 1 
ATOM   1913 N N   . ASN A 1 251 ? -12.620 48.491 72.356 1.00 51.99  ? 251  ASN A N   1 
ATOM   1914 C CA  . ASN A 1 251 ? -12.645 49.647 73.254 1.00 51.99  ? 251  ASN A CA  1 
ATOM   1915 C C   . ASN A 1 251 ? -13.990 50.386 73.245 1.00 51.99  ? 251  ASN A C   1 
ATOM   1916 O O   . ASN A 1 251 ? -14.342 51.081 74.209 1.00 51.99  ? 251  ASN A O   1 
ATOM   1917 C CB  . ASN A 1 251 ? -11.527 50.616 72.857 1.00 47.83  ? 251  ASN A CB  1 
ATOM   1918 C CG  . ASN A 1 251 ? -10.243 50.380 73.625 1.00 47.83  ? 251  ASN A CG  1 
ATOM   1919 O OD1 . ASN A 1 251 ? -10.016 51.006 74.661 1.00 47.83  ? 251  ASN A OD1 1 
ATOM   1920 N ND2 . ASN A 1 251 ? -9.398  49.474 73.129 1.00 47.83  ? 251  ASN A ND2 1 
ATOM   1921 N N   . LEU A 1 252 ? -14.730 50.253 72.147 1.00 58.86  ? 252  LEU A N   1 
ATOM   1922 C CA  . LEU A 1 252 ? -16.033 50.904 72.016 1.00 58.86  ? 252  LEU A CA  1 
ATOM   1923 C C   . LEU A 1 252 ? -17.157 49.870 72.117 1.00 58.86  ? 252  LEU A C   1 
ATOM   1924 O O   . LEU A 1 252 ? -18.285 50.113 71.689 1.00 58.86  ? 252  LEU A O   1 
ATOM   1925 C CB  . LEU A 1 252 ? -16.114 51.656 70.683 1.00 47.89  ? 252  LEU A CB  1 
ATOM   1926 C CG  . LEU A 1 252 ? -15.098 52.795 70.553 1.00 47.89  ? 252  LEU A CG  1 
ATOM   1927 C CD1 . LEU A 1 252 ? -15.045 53.286 69.116 1.00 47.89  ? 252  LEU A CD1 1 
ATOM   1928 C CD2 . LEU A 1 252 ? -15.473 53.932 71.492 1.00 47.89  ? 252  LEU A CD2 1 
ATOM   1929 N N   . ASN A 1 253 ? -16.831 48.717 72.691 1.00 54.31  ? 253  ASN A N   1 
ATOM   1930 C CA  . ASN A 1 253 ? -17.792 47.640 72.877 1.00 54.31  ? 253  ASN A CA  1 
ATOM   1931 C C   . ASN A 1 253 ? -18.556 47.342 71.601 1.00 54.31  ? 253  ASN A C   1 
ATOM   1932 O O   . ASN A 1 253 ? -19.773 47.507 71.555 1.00 54.31  ? 253  ASN A O   1 
ATOM   1933 C CB  . ASN A 1 253 ? -18.783 48.022 73.975 1.00 89.58  ? 253  ASN A CB  1 
ATOM   1934 C CG  . ASN A 1 253 ? -18.112 48.730 75.142 1.00 89.58  ? 253  ASN A CG  1 
ATOM   1935 O OD1 . ASN A 1 253 ? -17.191 48.186 75.780 1.00 89.58  ? 253  ASN A OD1 1 
ATOM   1936 N ND2 . ASN A 1 253 ? -18.564 49.954 75.428 1.00 89.58  ? 253  ASN A ND2 1 
ATOM   1937 N N   . CYS A 1 254 ? -17.851 46.900 70.566 1.00 49.13  ? 254  CYS A N   1 
ATOM   1938 C CA  . CYS A 1 254 ? -18.502 46.586 69.299 1.00 49.13  ? 254  CYS A CA  1 
ATOM   1939 C C   . CYS A 1 254 ? -18.556 45.077 69.081 1.00 49.13  ? 254  CYS A C   1 
ATOM   1940 O O   . CYS A 1 254 ? -17.707 44.340 69.579 1.00 49.13  ? 254  CYS A O   1 
ATOM   1941 C CB  . CYS A 1 254 ? -17.756 47.261 68.143 1.00 41.94  ? 254  CYS A CB  1 
ATOM   1942 N N   . ASN A 1 255 ? -19.566 44.618 68.347 1.00 52.16  ? 255  ASN A N   1 
ATOM   1943 C CA  . ASN A 1 255 ? -19.714 43.194 68.048 1.00 52.16  ? 255  ASN A CA  1 
ATOM   1944 C C   . ASN A 1 255 ? -18.533 42.836 67.157 1.00 52.16  ? 255  ASN A C   1 
ATOM   1945 O O   . ASN A 1 255 ? -18.402 43.377 66.058 1.00 52.16  ? 255  ASN A O   1 
ATOM   1946 C CB  . ASN A 1 255 ? -21.021 42.953 67.295 1.00 66.12  ? 255  ASN A CB  1 
ATOM   1947 C CG  . ASN A 1 255 ? -21.272 41.478 67.008 1.00 66.12  ? 255  ASN A CG  1 
ATOM   1948 O OD1 . ASN A 1 255 ? -20.334 40.695 66.769 1.00 66.12  ? 255  ASN A OD1 1 
ATOM   1949 N ND2 . ASN A 1 255 ? -22.548 41.093 67.001 1.00 66.12  ? 255  ASN A ND2 1 
ATOM   1950 N N   . LEU A 1 256 ? -17.684 41.922 67.616 1.00 59.99  ? 256  LEU A N   1 
ATOM   1951 C CA  . LEU A 1 256 ? -16.498 41.550 66.844 1.00 59.99  ? 256  LEU A CA  1 
ATOM   1952 C C   . LEU A 1 256 ? -16.572 40.231 66.070 1.00 59.99  ? 256  LEU A C   1 
ATOM   1953 O O   . LEU A 1 256 ? -15.527 39.659 65.729 1.00 59.99  ? 256  LEU A O   1 
ATOM   1954 C CB  . LEU A 1 256 ? -15.278 41.506 67.771 1.00 49.51  ? 256  LEU A CB  1 
ATOM   1955 C CG  . LEU A 1 256 ? -15.119 42.667 68.762 1.00 49.51  ? 256  LEU A CG  1 
ATOM   1956 C CD1 . LEU A 1 256 ? -13.821 42.490 69.544 1.00 49.51  ? 256  LEU A CD1 1 
ATOM   1957 C CD2 . LEU A 1 256 ? -15.114 44.002 68.021 1.00 49.51  ? 256  LEU A CD2 1 
ATOM   1958 N N   . ASN A 1 257 ? -17.778 39.746 65.776 1.00 62.65  ? 257  ASN A N   1 
ATOM   1959 C CA  . ASN A 1 257 ? -17.913 38.474 65.051 1.00 62.65  ? 257  ASN A CA  1 
ATOM   1960 C C   . ASN A 1 257 ? -17.458 38.494 63.600 1.00 62.65  ? 257  ASN A C   1 
ATOM   1961 O O   . ASN A 1 257 ? -17.046 37.468 63.064 1.00 62.65  ? 257  ASN A O   1 
ATOM   1962 C CB  . ASN A 1 257 ? -19.358 37.977 65.086 1.00 90.13  ? 257  ASN A CB  1 
ATOM   1963 C CG  . ASN A 1 257 ? -19.773 37.514 66.461 1.00 90.13  ? 257  ASN A CG  1 
ATOM   1964 O OD1 . ASN A 1 257 ? -19.005 36.825 67.150 1.00 90.13  ? 257  ASN A OD1 1 
ATOM   1965 N ND2 . ASN A 1 257 ? -20.991 37.879 66.875 1.00 90.13  ? 257  ASN A ND2 1 
ATOM   1966 N N   . SER A 1 258 ? -17.553 39.646 62.953 1.00 62.10  ? 258  SER A N   1 
ATOM   1967 C CA  . SER A 1 258 ? -17.141 39.744 61.554 1.00 62.10  ? 258  SER A CA  1 
ATOM   1968 C C   . SER A 1 258 ? -16.786 41.178 61.169 1.00 62.10  ? 258  SER A C   1 
ATOM   1969 O O   . SER A 1 258 ? -17.163 42.143 61.847 1.00 62.10  ? 258  SER A O   1 
ATOM   1970 C CB  . SER A 1 258 ? -18.264 39.248 60.642 1.00 56.50  ? 258  SER A CB  1 
ATOM   1971 O OG  . SER A 1 258 ? -19.418 40.069 60.780 1.00 56.50  ? 258  SER A OG  1 
ATOM   1972 N N   . ASP A 1 259 ? -16.057 41.318 60.071 1.00 61.58  ? 259  ASP A N   1 
ATOM   1973 C CA  . ASP A 1 259 ? -15.687 42.642 59.604 1.00 61.58  ? 259  ASP A CA  1 
ATOM   1974 C C   . ASP A 1 259 ? -16.933 43.523 59.448 1.00 61.58  ? 259  ASP A C   1 
ATOM   1975 O O   . ASP A 1 259 ? -16.923 44.686 59.856 1.00 61.58  ? 259  ASP A O   1 
ATOM   1976 C CB  . ASP A 1 259 ? -14.912 42.523 58.290 1.00 79.23  ? 259  ASP A CB  1 
ATOM   1977 C CG  . ASP A 1 259 ? -13.546 41.849 58.485 1.00 79.23  ? 259  ASP A CG  1 
ATOM   1978 O OD1 . ASP A 1 259 ? -13.269 41.383 59.619 1.00 79.23  ? 259  ASP A OD1 1 
ATOM   1979 O OD2 . ASP A 1 259 ? -12.746 41.782 57.514 1.00 79.23  ? 259  ASP A OD2 1 
ATOM   1980 N N   . GLU A 1 260 ? -18.009 42.965 58.895 1.00 51.76  ? 260  GLU A N   1 
ATOM   1981 C CA  . GLU A 1 260 ? -19.247 43.720 58.703 1.00 51.76  ? 260  GLU A CA  1 
ATOM   1982 C C   . GLU A 1 260 ? -19.783 44.167 60.050 1.00 51.76  ? 260  GLU A C   1 
ATOM   1983 O O   . GLU A 1 260 ? -20.239 45.299 60.219 1.00 51.76  ? 260  GLU A O   1 
ATOM   1984 C CB  . GLU A 1 260 ? -20.311 42.858 58.023 1.00 94.82  ? 260  GLU A CB  1 
ATOM   1985 C CG  . GLU A 1 260 ? -19.906 42.280 56.663 1.00 94.82  ? 260  GLU A CG  1 
ATOM   1986 C CD  . GLU A 1 260 ? -18.659 41.386 56.739 1.00 94.82  ? 260  GLU A CD  1 
ATOM   1987 O OE1 . GLU A 1 260 ? -18.576 40.523 57.659 1.00 94.82  ? 260  GLU A OE1 1 
ATOM   1988 O OE2 . GLU A 1 260 ? -17.769 41.549 55.867 1.00 94.82  ? 260  GLU A OE2 1 
ATOM   1989 N N   . GLU A 1 261 ? -19.741 43.248 61.004 1.00 50.50  ? 261  GLU A N   1 
ATOM   1990 C CA  . GLU A 1 261 ? -20.208 43.514 62.357 1.00 50.50  ? 261  GLU A CA  1 
ATOM   1991 C C   . GLU A 1 261 ? -19.457 44.729 62.912 1.00 50.50  ? 261  GLU A C   1 
ATOM   1992 O O   . GLU A 1 261 ? -20.062 45.713 63.342 1.00 50.50  ? 261  GLU A O   1 
ATOM   1993 C CB  . GLU A 1 261 ? -19.919 42.294 63.238 1.00 101.53 ? 261  GLU A CB  1 
ATOM   1994 C CG  . GLU A 1 261 ? -21.072 41.839 64.103 1.00 101.53 ? 261  GLU A CG  1 
ATOM   1995 C CD  . GLU A 1 261 ? -22.238 41.329 63.276 1.00 101.53 ? 261  GLU A CD  1 
ATOM   1996 O OE1 . GLU A 1 261 ? -21.991 40.521 62.336 1.00 101.53 ? 261  GLU A OE1 1 
ATOM   1997 O OE2 . GLU A 1 261 ? -23.395 41.729 63.579 1.00 101.53 ? 261  GLU A OE2 1 
ATOM   1998 N N   . LEU A 1 262 ? -18.129 44.636 62.891 1.00 45.93  ? 262  LEU A N   1 
ATOM   1999 C CA  . LEU A 1 262 ? -17.247 45.683 63.393 1.00 45.93  ? 262  LEU A CA  1 
ATOM   2000 C C   . LEU A 1 262 ? -17.396 47.025 62.677 1.00 45.93  ? 262  LEU A C   1 
ATOM   2001 O O   . LEU A 1 262 ? -17.668 48.048 63.306 1.00 45.93  ? 262  LEU A O   1 
ATOM   2002 C CB  . LEU A 1 262 ? -15.796 45.208 63.292 1.00 37.40  ? 262  LEU A CB  1 
ATOM   2003 C CG  . LEU A 1 262 ? -14.675 46.161 63.693 1.00 37.40  ? 262  LEU A CG  1 
ATOM   2004 C CD1 . LEU A 1 262 ? -14.853 46.621 65.116 1.00 37.40  ? 262  LEU A CD1 1 
ATOM   2005 C CD2 . LEU A 1 262 ? -13.353 45.439 63.537 1.00 37.40  ? 262  LEU A CD2 1 
ATOM   2006 N N   . ILE A 1 263 ? -17.214 47.018 61.364 1.00 45.51  ? 263  ILE A N   1 
ATOM   2007 C CA  . ILE A 1 263 ? -17.313 48.239 60.571 1.00 45.51  ? 263  ILE A CA  1 
ATOM   2008 C C   . ILE A 1 263 ? -18.631 48.975 60.780 1.00 45.51  ? 263  ILE A C   1 
ATOM   2009 O O   . ILE A 1 263 ? -18.642 50.187 60.984 1.00 45.51  ? 263  ILE A O   1 
ATOM   2010 C CB  . ILE A 1 263 ? -17.158 47.943 59.063 1.00 40.55  ? 263  ILE A CB  1 
ATOM   2011 C CG1 . ILE A 1 263 ? -15.815 47.251 58.801 1.00 40.55  ? 263  ILE A CG1 1 
ATOM   2012 C CG2 . ILE A 1 263 ? -17.272 49.239 58.273 1.00 40.55  ? 263  ILE A CG2 1 
ATOM   2013 C CD1 . ILE A 1 263 ? -15.632 46.804 57.367 1.00 40.55  ? 263  ILE A CD1 1 
ATOM   2014 N N   . HIS A 1 264 ? -19.743 48.249 60.720 1.00 53.48  ? 264  HIS A N   1 
ATOM   2015 C CA  . HIS A 1 264 ? -21.047 48.871 60.906 1.00 53.48  ? 264  HIS A CA  1 
ATOM   2016 C C   . HIS A 1 264 ? -21.147 49.554 62.268 1.00 53.48  ? 264  HIS A C   1 
ATOM   2017 O O   . HIS A 1 264 ? -21.694 50.655 62.375 1.00 53.48  ? 264  HIS A O   1 
ATOM   2018 C CB  . HIS A 1 264 ? -22.171 47.836 60.754 1.00 77.08  ? 264  HIS A CB  1 
ATOM   2019 C CG  . HIS A 1 264 ? -23.515 48.343 61.187 1.00 77.08  ? 264  HIS A CG  1 
ATOM   2020 N ND1 . HIS A 1 264 ? -23.876 48.459 62.517 1.00 77.08  ? 264  HIS A ND1 1 
ATOM   2021 C CD2 . HIS A 1 264 ? -24.555 48.838 60.472 1.00 77.08  ? 264  HIS A CD2 1 
ATOM   2022 C CE1 . HIS A 1 264 ? -25.076 49.009 62.601 1.00 77.08  ? 264  HIS A CE1 1 
ATOM   2023 N NE2 . HIS A 1 264 ? -25.510 49.249 61.375 1.00 77.08  ? 264  HIS A NE2 1 
ATOM   2024 N N   . CYS A 1 265 ? -20.619 48.910 63.308 1.00 46.87  ? 265  CYS A N   1 
ATOM   2025 C CA  . CYS A 1 265 ? -20.672 49.482 64.654 1.00 46.87  ? 265  CYS A CA  1 
ATOM   2026 C C   . CYS A 1 265 ? -19.810 50.736 64.727 1.00 46.87  ? 265  CYS A C   1 
ATOM   2027 O O   . CYS A 1 265 ? -20.176 51.710 65.384 1.00 46.87  ? 265  CYS A O   1 
ATOM   2028 C CB  . CYS A 1 265 ? -20.211 48.447 65.705 1.00 34.60  ? 265  CYS A CB  1 
ATOM   2029 N N   . LEU A 1 266 ? -18.669 50.710 64.044 1.00 49.01  ? 266  LEU A N   1 
ATOM   2030 C CA  . LEU A 1 266 ? -17.766 51.855 64.036 1.00 49.01  ? 266  LEU A CA  1 
ATOM   2031 C C   . LEU A 1 266 ? -18.354 53.015 63.233 1.00 49.01  ? 266  LEU A C   1 
ATOM   2032 O O   . LEU A 1 266 ? -18.022 54.176 63.468 1.00 49.01  ? 266  LEU A O   1 
ATOM   2033 C CB  . LEU A 1 266 ? -16.397 51.457 63.466 1.00 33.24  ? 266  LEU A CB  1 
ATOM   2034 C CG  . LEU A 1 266 ? -15.504 50.580 64.348 1.00 33.24  ? 266  LEU A CG  1 
ATOM   2035 C CD1 . LEU A 1 266 ? -14.290 50.131 63.568 1.00 33.24  ? 266  LEU A CD1 1 
ATOM   2036 C CD2 . LEU A 1 266 ? -15.080 51.349 65.580 1.00 33.24  ? 266  LEU A CD2 1 
ATOM   2037 N N   . ARG A 1 267 ? -19.240 52.712 62.294 1.00 52.37  ? 267  ARG A N   1 
ATOM   2038 C CA  . ARG A 1 267 ? -19.847 53.771 61.497 1.00 52.37  ? 267  ARG A CA  1 
ATOM   2039 C C   . ARG A 1 267 ? -20.965 54.490 62.242 1.00 52.37  ? 267  ARG A C   1 
ATOM   2040 O O   . ARG A 1 267 ? -21.264 55.645 61.937 1.00 52.37  ? 267  ARG A O   1 
ATOM   2041 C CB  . ARG A 1 267 ? -20.360 53.223 60.159 1.00 46.69  ? 267  ARG A CB  1 
ATOM   2042 C CG  . ARG A 1 267 ? -19.241 52.928 59.194 1.00 46.69  ? 267  ARG A CG  1 
ATOM   2043 C CD  . ARG A 1 267 ? -19.730 52.504 57.835 1.00 46.69  ? 267  ARG A CD  1 
ATOM   2044 N NE  . ARG A 1 267 ? -18.599 52.231 56.950 1.00 46.69  ? 267  ARG A NE  1 
ATOM   2045 C CZ  . ARG A 1 267 ? -18.702 51.674 55.748 1.00 46.69  ? 267  ARG A CZ  1 
ATOM   2046 N NH1 . ARG A 1 267 ? -19.891 51.325 55.270 1.00 46.69  ? 267  ARG A NH1 1 
ATOM   2047 N NH2 . ARG A 1 267 ? -17.612 51.454 55.025 1.00 46.69  ? 267  ARG A NH2 1 
ATOM   2048 N N   . GLU A 1 268 ? -21.571 53.821 63.221 1.00 55.99  ? 268  GLU A N   1 
ATOM   2049 C CA  . GLU A 1 268 ? -22.645 54.434 64.012 1.00 55.99  ? 268  GLU A CA  1 
ATOM   2050 C C   . GLU A 1 268 ? -22.086 55.314 65.128 1.00 55.99  ? 268  GLU A C   1 
ATOM   2051 O O   . GLU A 1 268 ? -22.840 55.986 65.837 1.00 55.99  ? 268  GLU A O   1 
ATOM   2052 C CB  . GLU A 1 268 ? -23.548 53.360 64.640 1.00 100.04 ? 268  GLU A CB  1 
ATOM   2053 C CG  . GLU A 1 268 ? -24.319 52.551 63.613 1.00 100.04 ? 268  GLU A CG  1 
ATOM   2054 C CD  . GLU A 1 268 ? -24.999 53.453 62.580 1.00 100.04 ? 268  GLU A CD  1 
ATOM   2055 O OE1 . GLU A 1 268 ? -25.932 54.207 62.972 1.00 100.04 ? 268  GLU A OE1 1 
ATOM   2056 O OE2 . GLU A 1 268 ? -24.591 53.415 61.386 1.00 100.04 ? 268  GLU A OE2 1 
ATOM   2057 N N   . LYS A 1 269 ? -20.767 55.309 65.279 1.00 45.93  ? 269  LYS A N   1 
ATOM   2058 C CA  . LYS A 1 269 ? -20.131 56.092 66.320 1.00 45.93  ? 269  LYS A CA  1 
ATOM   2059 C C   . LYS A 1 269 ? -19.869 57.543 65.930 1.00 45.93  ? 269  LYS A C   1 
ATOM   2060 O O   . LYS A 1 269 ? -19.632 57.861 64.761 1.00 45.93  ? 269  LYS A O   1 
ATOM   2061 C CB  . LYS A 1 269 ? -18.815 55.436 66.714 1.00 55.51  ? 269  LYS A CB  1 
ATOM   2062 C CG  . LYS A 1 269 ? -18.960 54.027 67.252 1.00 55.51  ? 269  LYS A CG  1 
ATOM   2063 C CD  . LYS A 1 269 ? -19.794 54.021 68.512 1.00 55.51  ? 269  LYS A CD  1 
ATOM   2064 C CE  . LYS A 1 269 ? -19.766 52.663 69.162 1.00 55.51  ? 269  LYS A CE  1 
ATOM   2065 N NZ  . LYS A 1 269 ? -20.441 52.718 70.489 1.00 55.51  ? 269  LYS A NZ  1 
ATOM   2066 N N   . LYS A 1 270 ? -19.921 58.425 66.923 1.00 48.24  ? 270  LYS A N   1 
ATOM   2067 C CA  . LYS A 1 270 ? -19.650 59.839 66.698 1.00 48.24  ? 270  LYS A CA  1 
ATOM   2068 C C   . LYS A 1 270 ? -18.133 59.969 66.538 1.00 48.24  ? 270  LYS A C   1 
ATOM   2069 O O   . LYS A 1 270 ? -17.374 59.270 67.210 1.00 48.24  ? 270  LYS A O   1 
ATOM   2070 C CB  . LYS A 1 270 ? -20.101 60.677 67.899 1.00 80.86  ? 270  LYS A CB  1 
ATOM   2071 C CG  . LYS A 1 270 ? -21.605 60.759 68.135 1.00 80.86  ? 270  LYS A CG  1 
ATOM   2072 C CD  . LYS A 1 270 ? -21.889 61.714 69.323 1.00 80.86  ? 270  LYS A CD  1 
ATOM   2073 C CE  . LYS A 1 270 ? -23.389 61.915 69.589 1.00 80.86  ? 270  LYS A CE  1 
ATOM   2074 N NZ  . LYS A 1 270 ? -24.043 60.689 70.137 1.00 80.86  ? 270  LYS A NZ  1 
ATOM   2075 N N   . PRO A 1 271 ? -17.674 60.872 65.665 1.00 41.42  ? 271  PRO A N   1 
ATOM   2076 C CA  . PRO A 1 271 ? -16.238 61.068 65.437 1.00 41.42  ? 271  PRO A CA  1 
ATOM   2077 C C   . PRO A 1 271 ? -15.382 61.113 66.709 1.00 41.42  ? 271  PRO A C   1 
ATOM   2078 O O   . PRO A 1 271 ? -14.367 60.431 66.809 1.00 41.42  ? 271  PRO A O   1 
ATOM   2079 C CB  . PRO A 1 271 ? -16.190 62.391 64.673 1.00 45.80  ? 271  PRO A CB  1 
ATOM   2080 C CG  . PRO A 1 271 ? -17.471 62.373 63.907 1.00 45.80  ? 271  PRO A CG  1 
ATOM   2081 C CD  . PRO A 1 271 ? -18.461 61.878 64.935 1.00 45.80  ? 271  PRO A CD  1 
ATOM   2082 N N   . GLN A 1 272 ? -15.804 61.911 67.683 1.00 38.94  ? 272  GLN A N   1 
ATOM   2083 C CA  . GLN A 1 272 ? -15.053 62.069 68.926 1.00 38.94  ? 272  GLN A CA  1 
ATOM   2084 C C   . GLN A 1 272 ? -14.945 60.811 69.788 1.00 38.94  ? 272  GLN A C   1 
ATOM   2085 O O   . GLN A 1 272 ? -14.138 60.751 70.722 1.00 38.94  ? 272  GLN A O   1 
ATOM   2086 C CB  . GLN A 1 272 ? -15.656 63.211 69.748 1.00 49.34  ? 272  GLN A CB  1 
ATOM   2087 C CG  . GLN A 1 272 ? -14.739 63.737 70.844 1.00 49.34  ? 272  GLN A CG  1 
ATOM   2088 C CD  . GLN A 1 272 ? -13.317 63.957 70.348 1.00 49.34  ? 272  GLN A CD  1 
ATOM   2089 O OE1 . GLN A 1 272 ? -13.094 64.536 69.271 1.00 49.34  ? 272  GLN A OE1 1 
ATOM   2090 N NE2 . GLN A 1 272 ? -12.343 63.493 71.131 1.00 49.34  ? 272  GLN A NE2 1 
ATOM   2091 N N   . GLU A 1 273 ? -15.740 59.799 69.473 1.00 49.56  ? 273  GLU A N   1 
ATOM   2092 C CA  . GLU A 1 273 ? -15.697 58.567 70.249 1.00 49.56  ? 273  GLU A CA  1 
ATOM   2093 C C   . GLU A 1 273 ? -14.574 57.654 69.789 1.00 49.56  ? 273  GLU A C   1 
ATOM   2094 O O   . GLU A 1 273 ? -13.983 56.944 70.600 1.00 49.56  ? 273  GLU A O   1 
ATOM   2095 C CB  . GLU A 1 273 ? -17.038 57.847 70.156 1.00 90.94  ? 273  GLU A CB  1 
ATOM   2096 C CG  . GLU A 1 273 ? -18.201 58.795 70.361 1.00 90.94  ? 273  GLU A CG  1 
ATOM   2097 C CD  . GLU A 1 273 ? -19.516 58.073 70.515 1.00 90.94  ? 273  GLU A CD  1 
ATOM   2098 O OE1 . GLU A 1 273 ? -19.622 57.269 71.473 1.00 90.94  ? 273  GLU A OE1 1 
ATOM   2099 O OE2 . GLU A 1 273 ? -20.434 58.309 69.684 1.00 90.94  ? 273  GLU A OE2 1 
ATOM   2100 N N   . LEU A 1 274 ? -14.290 57.658 68.489 1.00 48.42  ? 274  LEU A N   1 
ATOM   2101 C CA  . LEU A 1 274 ? -13.210 56.839 67.961 1.00 48.42  ? 274  LEU A CA  1 
ATOM   2102 C C   . LEU A 1 274 ? -11.910 57.507 68.352 1.00 48.42  ? 274  LEU A C   1 
ATOM   2103 O O   . LEU A 1 274 ? -10.914 56.842 68.601 1.00 48.42  ? 274  LEU A O   1 
ATOM   2104 C CB  . LEU A 1 274 ? -13.284 56.726 66.436 1.00 48.60  ? 274  LEU A CB  1 
ATOM   2105 C CG  . LEU A 1 274 ? -14.291 55.729 65.858 1.00 48.60  ? 274  LEU A CG  1 
ATOM   2106 C CD1 . LEU A 1 274 ? -15.659 55.993 66.452 1.00 48.60  ? 274  LEU A CD1 1 
ATOM   2107 C CD2 . LEU A 1 274 ? -14.355 55.859 64.348 1.00 48.60  ? 274  LEU A CD2 1 
ATOM   2108 N N   . ILE A 1 275 ? -11.930 58.830 68.413 1.00 42.80  ? 275  ILE A N   1 
ATOM   2109 C CA  . ILE A 1 275 ? -10.743 59.588 68.775 1.00 42.80  ? 275  ILE A CA  1 
ATOM   2110 C C   . ILE A 1 275 ? -10.418 59.503 70.275 1.00 42.80  ? 275  ILE A C   1 
ATOM   2111 O O   . ILE A 1 275 ? -9.256  59.559 70.660 1.00 42.80  ? 275  ILE A O   1 
ATOM   2112 C CB  . ILE A 1 275 ? -10.898 61.069 68.362 1.00 38.07  ? 275  ILE A CB  1 
ATOM   2113 C CG1 . ILE A 1 275 ? -11.012 61.167 66.841 1.00 38.07  ? 275  ILE A CG1 1 
ATOM   2114 C CG2 . ILE A 1 275 ? -9.725  61.890 68.881 1.00 38.07  ? 275  ILE A CG2 1 
ATOM   2115 C CD1 . ILE A 1 275 ? -11.240 62.570 66.338 1.00 38.07  ? 275  ILE A CD1 1 
ATOM   2116 N N   . ASP A 1 276 ? -11.429 59.356 71.124 1.00 41.18  ? 276  ASP A N   1 
ATOM   2117 C CA  . ASP A 1 276 ? -11.167 59.271 72.559 1.00 41.18  ? 276  ASP A CA  1 
ATOM   2118 C C   . ASP A 1 276 ? -10.405 58.011 72.973 1.00 41.18  ? 276  ASP A C   1 
ATOM   2119 O O   . ASP A 1 276 ? -9.743  58.010 74.007 1.00 41.18  ? 276  ASP A O   1 
ATOM   2120 C CB  . ASP A 1 276 ? -12.474 59.349 73.375 1.00 72.50  ? 276  ASP A CB  1 
ATOM   2121 C CG  . ASP A 1 276 ? -13.029 60.775 73.480 1.00 72.50  ? 276  ASP A CG  1 
ATOM   2122 O OD1 . ASP A 1 276 ? -12.218 61.730 73.524 1.00 72.50  ? 276  ASP A OD1 1 
ATOM   2123 O OD2 . ASP A 1 276 ? -14.271 60.949 73.538 1.00 72.50  ? 276  ASP A OD2 1 
ATOM   2124 N N   . VAL A 1 277 ? -10.490 56.946 72.175 1.00 40.55  ? 277  VAL A N   1 
ATOM   2125 C CA  . VAL A 1 277 ? -9.821  55.686 72.507 1.00 40.55  ? 277  VAL A CA  1 
ATOM   2126 C C   . VAL A 1 277 ? -8.773  55.239 71.491 1.00 40.55  ? 277  VAL A C   1 
ATOM   2127 O O   . VAL A 1 277 ? -8.178  54.171 71.625 1.00 40.55  ? 277  VAL A O   1 
ATOM   2128 C CB  . VAL A 1 277 ? -10.851 54.547 72.671 1.00 39.45  ? 277  VAL A CB  1 
ATOM   2129 C CG1 . VAL A 1 277 ? -11.753 54.824 73.871 1.00 39.45  ? 277  VAL A CG1 1 
ATOM   2130 C CG2 . VAL A 1 277 ? -11.686 54.415 71.406 1.00 39.45  ? 277  VAL A CG2 1 
ATOM   2131 N N   . GLU A 1 278 ? -8.551  56.069 70.481 1.00 41.52  ? 278  GLU A N   1 
ATOM   2132 C CA  . GLU A 1 278 ? -7.587  55.798 69.422 1.00 41.52  ? 278  GLU A CA  1 
ATOM   2133 C C   . GLU A 1 278 ? -6.185  55.388 69.901 1.00 41.52  ? 278  GLU A C   1 
ATOM   2134 O O   . GLU A 1 278 ? -5.588  54.476 69.343 1.00 41.52  ? 278  GLU A O   1 
ATOM   2135 C CB  . GLU A 1 278 ? -7.513  57.034 68.507 1.00 72.34  ? 278  GLU A CB  1 
ATOM   2136 C CG  . GLU A 1 278 ? -6.248  57.189 67.660 1.00 72.34  ? 278  GLU A CG  1 
ATOM   2137 C CD  . GLU A 1 278 ? -6.285  58.428 66.742 1.00 72.34  ? 278  GLU A CD  1 
ATOM   2138 O OE1 . GLU A 1 278 ? -6.661  59.533 67.212 1.00 72.34  ? 278  GLU A OE1 1 
ATOM   2139 O OE2 . GLU A 1 278 ? -5.926  58.299 65.549 1.00 72.34  ? 278  GLU A OE2 1 
ATOM   2140 N N   . TRP A 1 279 ? -5.658  56.044 70.929 1.00 45.16  ? 279  TRP A N   1 
ATOM   2141 C CA  . TRP A 1 279 ? -4.320  55.707 71.410 1.00 45.16  ? 279  TRP A CA  1 
ATOM   2142 C C   . TRP A 1 279 ? -4.221  54.435 72.236 1.00 45.16  ? 279  TRP A C   1 
ATOM   2143 O O   . TRP A 1 279 ? -3.118  54.009 72.575 1.00 45.16  ? 279  TRP A O   1 
ATOM   2144 C CB  . TRP A 1 279 ? -3.714  56.867 72.214 1.00 51.17  ? 279  TRP A CB  1 
ATOM   2145 C CG  . TRP A 1 279 ? -3.527  58.108 71.409 1.00 51.17  ? 279  TRP A CG  1 
ATOM   2146 C CD1 . TRP A 1 279 ? -4.430  59.117 71.245 1.00 51.17  ? 279  TRP A CD1 1 
ATOM   2147 C CD2 . TRP A 1 279 ? -2.389  58.455 70.612 1.00 51.17  ? 279  TRP A CD2 1 
ATOM   2148 N NE1 . TRP A 1 279 ? -3.928  60.071 70.396 1.00 51.17  ? 279  TRP A NE1 1 
ATOM   2149 C CE2 . TRP A 1 279 ? -2.676  59.692 69.991 1.00 51.17  ? 279  TRP A CE2 1 
ATOM   2150 C CE3 . TRP A 1 279 ? -1.155  57.840 70.359 1.00 51.17  ? 279  TRP A CE3 1 
ATOM   2151 C CZ2 . TRP A 1 279 ? -1.768  60.335 69.126 1.00 51.17  ? 279  TRP A CZ2 1 
ATOM   2152 C CZ3 . TRP A 1 279 ? -0.247  58.475 69.499 1.00 51.17  ? 279  TRP A CZ3 1 
ATOM   2153 C CH2 . TRP A 1 279 ? -0.564  59.715 68.893 1.00 51.17  ? 279  TRP A CH2 1 
ATOM   2154 N N   . ASN A 1 280 ? -5.353  53.820 72.558 1.00 37.73  ? 280  ASN A N   1 
ATOM   2155 C CA  . ASN A 1 280 ? -5.329  52.597 73.351 1.00 37.73  ? 280  ASN A CA  1 
ATOM   2156 C C   . ASN A 1 280 ? -4.973  51.345 72.565 1.00 37.73  ? 280  ASN A C   1 
ATOM   2157 O O   . ASN A 1 280 ? -4.907  50.269 73.142 1.00 37.73  ? 280  ASN A O   1 
ATOM   2158 C CB  . ASN A 1 280 ? -6.686  52.345 74.012 1.00 46.70  ? 280  ASN A CB  1 
ATOM   2159 C CG  . ASN A 1 280 ? -7.097  53.450 74.954 1.00 46.70  ? 280  ASN A CG  1 
ATOM   2160 O OD1 . ASN A 1 280 ? -6.259  54.180 75.491 1.00 46.70  ? 280  ASN A OD1 1 
ATOM   2161 N ND2 . ASN A 1 280 ? -8.396  53.571 75.176 1.00 46.70  ? 280  ASN A ND2 1 
ATOM   2162 N N   . VAL A 1 281 ? -4.739  51.456 71.266 1.00 34.63  ? 281  VAL A N   1 
ATOM   2163 C CA  . VAL A 1 281 ? -4.458  50.252 70.498 1.00 34.63  ? 281  VAL A CA  1 
ATOM   2164 C C   . VAL A 1 281 ? -3.008  49.969 70.167 1.00 34.63  ? 281  VAL A C   1 
ATOM   2165 O O   . VAL A 1 281 ? -2.709  48.944 69.562 1.00 34.63  ? 281  VAL A O   1 
ATOM   2166 C CB  . VAL A 1 281 ? -5.264  50.230 69.174 1.00 37.73  ? 281  VAL A CB  1 
ATOM   2167 C CG1 . VAL A 1 281 ? -6.754  50.416 69.467 1.00 37.73  ? 281  VAL A CG1 1 
ATOM   2168 C CG2 . VAL A 1 281 ? -4.740  51.304 68.222 1.00 37.73  ? 281  VAL A CG2 1 
ATOM   2169 N N   . LEU A 1 282 ? -2.104  50.862 70.550 1.00 43.70  ? 282  LEU A N   1 
ATOM   2170 C CA  . LEU A 1 282 ? -0.690  50.643 70.272 1.00 43.70  ? 282  LEU A CA  1 
ATOM   2171 C C   . LEU A 1 282 ? -0.189  49.379 70.966 1.00 43.70  ? 282  LEU A C   1 
ATOM   2172 O O   . LEU A 1 282 ? -0.476  49.141 72.139 1.00 43.70  ? 282  LEU A O   1 
ATOM   2173 C CB  . LEU A 1 282 ? 0.123   51.850 70.713 1.00 35.05  ? 282  LEU A CB  1 
ATOM   2174 C CG  . LEU A 1 282 ? -0.064  53.043 69.780 1.00 35.05  ? 282  LEU A CG  1 
ATOM   2175 C CD1 . LEU A 1 282 ? 0.655   54.248 70.351 1.00 35.05  ? 282  LEU A CD1 1 
ATOM   2176 C CD2 . LEU A 1 282 ? 0.475   52.700 68.397 1.00 35.05  ? 282  LEU A CD2 1 
ATOM   2177 N N   . PRO A 1 283 ? 0.581   48.551 70.247 1.00 42.42  ? 283  PRO A N   1 
ATOM   2178 C CA  . PRO A 1 283 ? 1.103   47.308 70.819 1.00 42.42  ? 283  PRO A CA  1 
ATOM   2179 C C   . PRO A 1 283 ? 2.112   47.460 71.950 1.00 42.42  ? 283  PRO A C   1 
ATOM   2180 O O   . PRO A 1 283 ? 2.184   46.610 72.832 1.00 42.42  ? 283  PRO A O   1 
ATOM   2181 C CB  . PRO A 1 283 ? 1.696   46.601 69.609 1.00 29.72  ? 283  PRO A CB  1 
ATOM   2182 C CG  . PRO A 1 283 ? 2.196   47.727 68.802 1.00 29.72  ? 283  PRO A CG  1 
ATOM   2183 C CD  . PRO A 1 283 ? 1.072   48.737 68.871 1.00 29.72  ? 283  PRO A CD  1 
ATOM   2184 N N   . PHE A 1 284 ? 2.893   48.532 71.931 1.00 45.07  ? 284  PHE A N   1 
ATOM   2185 C CA  . PHE A 1 284 ? 3.890   48.719 72.969 1.00 45.07  ? 284  PHE A CA  1 
ATOM   2186 C C   . PHE A 1 284 ? 3.797   50.076 73.620 1.00 45.07  ? 284  PHE A C   1 
ATOM   2187 O O   . PHE A 1 284 ? 3.120   50.978 73.139 1.00 45.07  ? 284  PHE A O   1 
ATOM   2188 C CB  . PHE A 1 284 ? 5.302   48.575 72.399 1.00 50.61  ? 284  PHE A CB  1 
ATOM   2189 C CG  . PHE A 1 284 ? 5.511   47.331 71.583 1.00 50.61  ? 284  PHE A CG  1 
ATOM   2190 C CD1 . PHE A 1 284 ? 5.522   46.076 72.187 1.00 50.61  ? 284  PHE A CD1 1 
ATOM   2191 C CD2 . PHE A 1 284 ? 5.708   47.415 70.200 1.00 50.61  ? 284  PHE A CD2 1 
ATOM   2192 C CE1 . PHE A 1 284 ? 5.727   44.915 71.431 1.00 50.61  ? 284  PHE A CE1 1 
ATOM   2193 C CE2 . PHE A 1 284 ? 5.915   46.268 69.432 1.00 50.61  ? 284  PHE A CE2 1 
ATOM   2194 C CZ  . PHE A 1 284 ? 5.925   45.011 70.049 1.00 50.61  ? 284  PHE A CZ  1 
ATOM   2195 N N   . ASP A 1 285 ? 4.484   50.191 74.746 1.00 43.43  ? 285  ASP A N   1 
ATOM   2196 C CA  . ASP A 1 285 ? 4.572   51.433 75.478 1.00 43.43  ? 285  ASP A CA  1 
ATOM   2197 C C   . ASP A 1 285 ? 5.619   52.077 74.590 1.00 43.43  ? 285  ASP A C   1 
ATOM   2198 O O   . ASP A 1 285 ? 6.716   51.551 74.439 1.00 43.43  ? 285  ASP A O   1 
ATOM   2199 C CB  . ASP A 1 285 ? 5.122   51.143 76.865 1.00 66.58  ? 285  ASP A CB  1 
ATOM   2200 C CG  . ASP A 1 285 ? 5.270   52.388 77.711 1.00 66.58  ? 285  ASP A CG  1 
ATOM   2201 O OD1 . ASP A 1 285 ? 4.965   53.493 77.191 1.00 66.58  ? 285  ASP A OD1 1 
ATOM   2202 O OD2 . ASP A 1 285 ? 5.695   52.250 78.892 1.00 66.58  ? 285  ASP A OD2 1 
ATOM   2203 N N   . SER A 1 286 ? 5.301   53.204 73.981 1.00 43.12  ? 286  SER A N   1 
ATOM   2204 C CA  . SER A 1 286 ? 6.268   53.765 73.063 1.00 43.12  ? 286  SER A CA  1 
ATOM   2205 C C   . SER A 1 286 ? 6.245   55.260 72.858 1.00 43.12  ? 286  SER A C   1 
ATOM   2206 O O   . SER A 1 286 ? 5.393   55.974 73.374 1.00 43.12  ? 286  SER A O   1 
ATOM   2207 C CB  . SER A 1 286 ? 6.084   53.094 71.713 1.00 41.50  ? 286  SER A CB  1 
ATOM   2208 O OG  . SER A 1 286 ? 4.726   53.217 71.309 1.00 41.50  ? 286  SER A OG  1 
ATOM   2209 N N   . ILE A 1 287 ? 7.199   55.715 72.061 1.00 36.52  ? 287  ILE A N   1 
ATOM   2210 C CA  . ILE A 1 287 ? 7.343   57.118 71.748 1.00 36.52  ? 287  ILE A CA  1 
ATOM   2211 C C   . ILE A 1 287 ? 7.481   57.120 70.228 1.00 36.52  ? 287  ILE A C   1 
ATOM   2212 O O   . ILE A 1 287 ? 7.999   56.171 69.652 1.00 36.52  ? 287  ILE A O   1 
ATOM   2213 C CB  . ILE A 1 287 ? 8.599   57.681 72.475 1.00 42.86  ? 287  ILE A CB  1 
ATOM   2214 C CG1 . ILE A 1 287 ? 8.403   59.144 72.814 1.00 42.86  ? 287  ILE A CG1 1 
ATOM   2215 C CG2 . ILE A 1 287 ? 9.834   57.540 71.627 1.00 42.86  ? 287  ILE A CG2 1 
ATOM   2216 C CD1 . ILE A 1 287 ? 9.628   59.754 73.481 1.00 42.86  ? 287  ILE A CD1 1 
ATOM   2217 N N   . PHE A 1 288 ? 6.972   58.155 69.580 1.00 37.91  ? 288  PHE A N   1 
ATOM   2218 C CA  . PHE A 1 288 ? 7.043   58.265 68.127 1.00 37.91  ? 288  PHE A CA  1 
ATOM   2219 C C   . PHE A 1 288 ? 6.388   57.101 67.366 1.00 37.91  ? 288  PHE A C   1 
ATOM   2220 O O   . PHE A 1 288 ? 6.952   56.577 66.403 1.00 37.91  ? 288  PHE A O   1 
ATOM   2221 C CB  . PHE A 1 288 ? 8.495   58.408 67.679 1.00 31.57  ? 288  PHE A CB  1 
ATOM   2222 C CG  . PHE A 1 288 ? 8.674   59.300 66.487 1.00 31.57  ? 288  PHE A CG  1 
ATOM   2223 C CD1 . PHE A 1 288 ? 7.848   59.177 65.375 1.00 31.57  ? 288  PHE A CD1 1 
ATOM   2224 C CD2 . PHE A 1 288 ? 9.664   60.275 66.476 1.00 31.57  ? 288  PHE A CD2 1 
ATOM   2225 C CE1 . PHE A 1 288 ? 8.004   60.013 64.274 1.00 31.57  ? 288  PHE A CE1 1 
ATOM   2226 C CE2 . PHE A 1 288 ? 9.827   61.112 65.379 1.00 31.57  ? 288  PHE A CE2 1 
ATOM   2227 C CZ  . PHE A 1 288 ? 8.993   60.980 64.277 1.00 31.57  ? 288  PHE A CZ  1 
ATOM   2228 N N   . ARG A 1 289 ? 5.202   56.696 67.804 1.00 37.51  ? 289  ARG A N   1 
ATOM   2229 C CA  . ARG A 1 289 ? 4.462   55.627 67.149 1.00 37.51  ? 289  ARG A CA  1 
ATOM   2230 C C   . ARG A 1 289 ? 3.003   56.056 67.140 1.00 37.51  ? 289  ARG A C   1 
ATOM   2231 O O   . ARG A 1 289 ? 2.535   56.711 68.072 1.00 37.51  ? 289  ARG A O   1 
ATOM   2232 C CB  . ARG A 1 289 ? 4.639   54.302 67.888 1.00 28.07  ? 289  ARG A CB  1 
ATOM   2233 C CG  . ARG A 1 289 ? 6.035   53.710 67.790 1.00 28.07  ? 289  ARG A CG  1 
ATOM   2234 C CD  . ARG A 1 289 ? 6.382   53.271 66.371 1.00 28.07  ? 289  ARG A CD  1 
ATOM   2235 N NE  . ARG A 1 289 ? 7.654   52.539 66.295 1.00 28.07  ? 289  ARG A NE  1 
ATOM   2236 C CZ  . ARG A 1 289 ? 8.856   53.104 66.218 1.00 28.07  ? 289  ARG A CZ  1 
ATOM   2237 N NH1 . ARG A 1 289 ? 8.972   54.421 66.202 1.00 28.07  ? 289  ARG A NH1 1 
ATOM   2238 N NH2 . ARG A 1 289 ? 9.940   52.353 66.149 1.00 28.07  ? 289  ARG A NH2 1 
ATOM   2239 N N   . PHE A 1 290 ? 2.285   55.696 66.084 1.00 33.71  ? 290  PHE A N   1 
ATOM   2240 C CA  . PHE A 1 290 ? 0.902   56.109 65.952 1.00 33.71  ? 290  PHE A CA  1 
ATOM   2241 C C   . PHE A 1 290 ? -0.035  54.962 65.590 1.00 33.71  ? 290  PHE A C   1 
ATOM   2242 O O   . PHE A 1 290 ? 0.343   54.017 64.901 1.00 33.71  ? 290  PHE A O   1 
ATOM   2243 C CB  . PHE A 1 290 ? 0.863   57.233 64.930 1.00 31.48  ? 290  PHE A CB  1 
ATOM   2244 C CG  . PHE A 1 290 ? 1.987   58.224 65.106 1.00 31.48  ? 290  PHE A CG  1 
ATOM   2245 C CD1 . PHE A 1 290 ? 2.087   58.984 66.269 1.00 31.48  ? 290  PHE A CD1 1 
ATOM   2246 C CD2 . PHE A 1 290 ? 2.980   58.354 64.143 1.00 31.48  ? 290  PHE A CD2 1 
ATOM   2247 C CE1 . PHE A 1 290 ? 3.152   59.848 66.471 1.00 31.48  ? 290  PHE A CE1 1 
ATOM   2248 C CE2 . PHE A 1 290 ? 4.055   59.223 64.341 1.00 31.48  ? 290  PHE A CE2 1 
ATOM   2249 C CZ  . PHE A 1 290 ? 4.137   59.968 65.506 1.00 31.48  ? 290  PHE A CZ  1 
ATOM   2250 N N   . SER A 1 291 ? -1.265  55.057 66.074 1.00 38.20  ? 291  SER A N   1 
ATOM   2251 C CA  . SER A 1 291 ? -2.268  54.019 65.879 1.00 38.20  ? 291  SER A CA  1 
ATOM   2252 C C   . SER A 1 291 ? -2.635  53.617 64.459 1.00 38.20  ? 291  SER A C   1 
ATOM   2253 O O   . SER A 1 291 ? -2.455  52.462 64.070 1.00 38.20  ? 291  SER A O   1 
ATOM   2254 C CB  . SER A 1 291 ? -3.539  54.401 66.624 1.00 48.17  ? 291  SER A CB  1 
ATOM   2255 O OG  . SER A 1 291 ? -3.293  54.458 68.013 1.00 48.17  ? 291  SER A OG  1 
ATOM   2256 N N   . PHE A 1 292 ? -3.158  54.558 63.687 1.00 35.50  ? 292  PHE A N   1 
ATOM   2257 C CA  . PHE A 1 292 ? -3.581  54.246 62.334 1.00 35.50  ? 292  PHE A CA  1 
ATOM   2258 C C   . PHE A 1 292 ? -2.770  54.947 61.268 1.00 35.50  ? 292  PHE A C   1 
ATOM   2259 O O   . PHE A 1 292 ? -2.882  56.155 61.059 1.00 35.50  ? 292  PHE A O   1 
ATOM   2260 C CB  . PHE A 1 292 ? -5.065  54.558 62.214 1.00 37.75  ? 292  PHE A CB  1 
ATOM   2261 C CG  . PHE A 1 292 ? -5.875  53.902 63.281 1.00 37.75  ? 292  PHE A CG  1 
ATOM   2262 C CD1 . PHE A 1 292 ? -6.244  52.568 63.168 1.00 37.75  ? 292  PHE A CD1 1 
ATOM   2263 C CD2 . PHE A 1 292 ? -6.178  54.582 64.452 1.00 37.75  ? 292  PHE A CD2 1 
ATOM   2264 C CE1 . PHE A 1 292 ? -6.899  51.921 64.211 1.00 37.75  ? 292  PHE A CE1 1 
ATOM   2265 C CE2 . PHE A 1 292 ? -6.829  53.944 65.497 1.00 37.75  ? 292  PHE A CE2 1 
ATOM   2266 C CZ  . PHE A 1 292 ? -7.189  52.613 65.379 1.00 37.75  ? 292  PHE A CZ  1 
ATOM   2267 N N   . VAL A 1 293 ? -1.951  54.147 60.598 1.00 30.58  ? 293  VAL A N   1 
ATOM   2268 C CA  . VAL A 1 293 ? -1.059  54.615 59.559 1.00 30.58  ? 293  VAL A CA  1 
ATOM   2269 C C   . VAL A 1 293 ? -1.185  53.714 58.337 1.00 30.58  ? 293  VAL A C   1 
ATOM   2270 O O   . VAL A 1 293 ? -1.875  52.704 58.386 1.00 30.58  ? 293  VAL A O   1 
ATOM   2271 C CB  . VAL A 1 293 ? 0.408   54.591 60.073 1.00 26.41  ? 293  VAL A CB  1 
ATOM   2272 C CG1 . VAL A 1 293 ? 0.576   55.588 61.216 1.00 26.41  ? 293  VAL A CG1 1 
ATOM   2273 C CG2 . VAL A 1 293 ? 0.787   53.175 60.527 1.00 26.41  ? 293  VAL A CG2 1 
ATOM   2274 N N   . PRO A 1 294 ? -0.534  54.078 57.218 1.00 34.01  ? 294  PRO A N   1 
ATOM   2275 C CA  . PRO A 1 294 ? -0.600  53.263 56.005 1.00 34.01  ? 294  PRO A CA  1 
ATOM   2276 C C   . PRO A 1 294 ? -0.220  51.809 56.253 1.00 34.01  ? 294  PRO A C   1 
ATOM   2277 O O   . PRO A 1 294 ? 0.536   51.501 57.165 1.00 34.01  ? 294  PRO A O   1 
ATOM   2278 C CB  . PRO A 1 294 ? 0.376   53.973 55.073 1.00 29.03  ? 294  PRO A CB  1 
ATOM   2279 C CG  . PRO A 1 294 ? 0.171   55.386 55.427 1.00 29.03  ? 294  PRO A CG  1 
ATOM   2280 C CD  . PRO A 1 294 ? 0.159   55.348 56.938 1.00 29.03  ? 294  PRO A CD  1 
ATOM   2281 N N   . VAL A 1 295 ? -0.745  50.917 55.426 1.00 38.40  ? 295  VAL A N   1 
ATOM   2282 C CA  . VAL A 1 295 ? -0.469  49.496 55.558 1.00 38.40  ? 295  VAL A CA  1 
ATOM   2283 C C   . VAL A 1 295 ? -0.114  48.837 54.230 1.00 38.40  ? 295  VAL A C   1 
ATOM   2284 O O   . VAL A 1 295 ? -0.780  49.049 53.225 1.00 38.40  ? 295  VAL A O   1 
ATOM   2285 C CB  . VAL A 1 295 ? -1.678  48.774 56.162 1.00 39.03  ? 295  VAL A CB  1 
ATOM   2286 C CG1 . VAL A 1 295 ? -2.935  49.236 55.477 1.00 39.03  ? 295  VAL A CG1 1 
ATOM   2287 C CG2 . VAL A 1 295 ? -1.523  47.280 55.995 1.00 39.03  ? 295  VAL A CG2 1 
ATOM   2288 N N   . ILE A 1 296 ? 0.942   48.032 54.248 1.00 40.89  ? 296  ILE A N   1 
ATOM   2289 C CA  . ILE A 1 296 ? 1.419   47.316 53.069 1.00 40.89  ? 296  ILE A CA  1 
ATOM   2290 C C   . ILE A 1 296 ? 0.367   46.279 52.710 1.00 40.89  ? 296  ILE A C   1 
ATOM   2291 O O   . ILE A 1 296 ? 0.350   45.182 53.262 1.00 40.89  ? 296  ILE A O   1 
ATOM   2292 C CB  . ILE A 1 296 ? 2.743   46.628 53.381 1.00 32.58  ? 296  ILE A CB  1 
ATOM   2293 C CG1 . ILE A 1 296 ? 3.675   47.622 54.088 1.00 32.58  ? 296  ILE A CG1 1 
ATOM   2294 C CG2 . ILE A 1 296 ? 3.372   46.110 52.099 1.00 32.58  ? 296  ILE A CG2 1 
ATOM   2295 C CD1 . ILE A 1 296 ? 3.983   48.876 53.268 1.00 32.58  ? 296  ILE A CD1 1 
ATOM   2296 N N   . ASP A 1 297 ? -0.492  46.639 51.760 1.00 56.56  ? 297  ASP A N   1 
ATOM   2297 C CA  . ASP A 1 297 ? -1.631  45.822 51.348 1.00 56.56  ? 297  ASP A CA  1 
ATOM   2298 C C   . ASP A 1 297 ? -1.539  45.058 50.030 1.00 56.56  ? 297  ASP A C   1 
ATOM   2299 O O   . ASP A 1 297 ? -2.442  44.287 49.705 1.00 56.56  ? 297  ASP A O   1 
ATOM   2300 C CB  . ASP A 1 297 ? -2.858  46.729 51.275 1.00 57.07  ? 297  ASP A CB  1 
ATOM   2301 C CG  . ASP A 1 297 ? -2.710  47.807 50.198 1.00 57.07  ? 297  ASP A CG  1 
ATOM   2302 O OD1 . ASP A 1 297 ? -1.599  47.918 49.622 1.00 57.07  ? 297  ASP A OD1 1 
ATOM   2303 O OD2 . ASP A 1 297 ? -3.689  48.543 49.922 1.00 57.07  ? 297  ASP A OD2 1 
ATOM   2304 N N   . GLY A 1 298 ? -0.490  45.274 49.249 1.00 61.40  ? 298  GLY A N   1 
ATOM   2305 C CA  . GLY A 1 298 ? -0.404  44.570 47.979 1.00 61.40  ? 298  GLY A CA  1 
ATOM   2306 C C   . GLY A 1 298 ? -1.166  45.269 46.856 1.00 61.40  ? 298  GLY A C   1 
ATOM   2307 O O   . GLY A 1 298 ? -1.283  44.741 45.743 1.00 61.40  ? 298  GLY A O   1 
ATOM   2308 N N   . GLU A 1 299 ? -1.699  46.455 47.137 1.00 49.68  ? 299  GLU A N   1 
ATOM   2309 C CA  . GLU A 1 299 ? -2.427  47.217 46.124 1.00 49.68  ? 299  GLU A CA  1 
ATOM   2310 C C   . GLU A 1 299 ? -1.724  48.551 45.962 1.00 49.68  ? 299  GLU A C   1 
ATOM   2311 O O   . GLU A 1 299 ? -0.980  48.754 45.005 1.00 49.68  ? 299  GLU A O   1 
ATOM   2312 C CB  . GLU A 1 299 ? -3.867  47.448 46.559 1.00 101.64 ? 299  GLU A CB  1 
ATOM   2313 C CG  . GLU A 1 299 ? -4.657  46.171 46.733 1.00 101.64 ? 299  GLU A CG  1 
ATOM   2314 C CD  . GLU A 1 299 ? -5.964  46.404 47.479 1.00 101.64 ? 299  GLU A CD  1 
ATOM   2315 O OE1 . GLU A 1 299 ? -6.798  47.214 46.992 1.00 101.64 ? 299  GLU A OE1 1 
ATOM   2316 O OE2 . GLU A 1 299 ? -6.146  45.779 48.556 1.00 101.64 ? 299  GLU A OE2 1 
ATOM   2317 N N   . PHE A 1 300 ? -1.958  49.457 46.906 1.00 43.73  ? 300  PHE A N   1 
ATOM   2318 C CA  . PHE A 1 300 ? -1.308  50.751 46.864 1.00 43.73  ? 300  PHE A CA  1 
ATOM   2319 C C   . PHE A 1 300 ? 0.191   50.447 46.781 1.00 43.73  ? 300  PHE A C   1 
ATOM   2320 O O   . PHE A 1 300 ? 0.915   51.046 45.990 1.00 43.73  ? 300  PHE A O   1 
ATOM   2321 C CB  . PHE A 1 300 ? -1.652  51.547 48.125 1.00 41.89  ? 300  PHE A CB  1 
ATOM   2322 C CG  . PHE A 1 300 ? -1.381  53.021 48.002 1.00 41.89  ? 300  PHE A CG  1 
ATOM   2323 C CD1 . PHE A 1 300 ? -0.090  53.524 48.159 1.00 41.89  ? 300  PHE A CD1 1 
ATOM   2324 C CD2 . PHE A 1 300 ? -2.408  53.902 47.689 1.00 41.89  ? 300  PHE A CD2 1 
ATOM   2325 C CE1 . PHE A 1 300 ? 0.169   54.884 48.002 1.00 41.89  ? 300  PHE A CE1 1 
ATOM   2326 C CE2 . PHE A 1 300 ? -2.163  55.258 47.529 1.00 41.89  ? 300  PHE A CE2 1 
ATOM   2327 C CZ  . PHE A 1 300 ? -0.875  55.754 47.684 1.00 41.89  ? 300  PHE A CZ  1 
ATOM   2328 N N   . PHE A 1 301 ? 0.638   49.488 47.587 1.00 47.82  ? 301  PHE A N   1 
ATOM   2329 C CA  . PHE A 1 301 ? 2.034   49.065 47.585 1.00 47.82  ? 301  PHE A CA  1 
ATOM   2330 C C   . PHE A 1 301 ? 2.066   47.627 47.060 1.00 47.82  ? 301  PHE A C   1 
ATOM   2331 O O   . PHE A 1 301 ? 1.591   46.707 47.725 1.00 47.82  ? 301  PHE A O   1 
ATOM   2332 C CB  . PHE A 1 301 ? 2.607   49.105 49.002 1.00 43.15  ? 301  PHE A CB  1 
ATOM   2333 C CG  . PHE A 1 301 ? 2.488   50.444 49.666 1.00 43.15  ? 301  PHE A CG  1 
ATOM   2334 C CD1 . PHE A 1 301 ? 3.279   51.513 49.252 1.00 43.15  ? 301  PHE A CD1 1 
ATOM   2335 C CD2 . PHE A 1 301 ? 1.575   50.641 50.700 1.00 43.15  ? 301  PHE A CD2 1 
ATOM   2336 C CE1 . PHE A 1 301 ? 3.164   52.760 49.855 1.00 43.15  ? 301  PHE A CE1 1 
ATOM   2337 C CE2 . PHE A 1 301 ? 1.447   51.880 51.314 1.00 43.15  ? 301  PHE A CE2 1 
ATOM   2338 C CZ  . PHE A 1 301 ? 2.244   52.948 50.893 1.00 43.15  ? 301  PHE A CZ  1 
ATOM   2339 N N   . PRO A 1 302 ? 2.622   47.415 45.856 1.00 46.64  ? 302  PRO A N   1 
ATOM   2340 C CA  . PRO A 1 302 ? 2.715   46.089 45.239 1.00 46.64  ? 302  PRO A CA  1 
ATOM   2341 C C   . PRO A 1 302 ? 3.286   45.007 46.147 1.00 46.64  ? 302  PRO A C   1 
ATOM   2342 O O   . PRO A 1 302 ? 2.648   43.982 46.372 1.00 46.64  ? 302  PRO A O   1 
ATOM   2343 C CB  . PRO A 1 302 ? 3.593   46.347 44.022 1.00 51.35  ? 302  PRO A CB  1 
ATOM   2344 C CG  . PRO A 1 302 ? 3.176   47.719 43.627 1.00 51.35  ? 302  PRO A CG  1 
ATOM   2345 C CD  . PRO A 1 302 ? 3.165   48.441 44.949 1.00 51.35  ? 302  PRO A CD  1 
ATOM   2346 N N   . THR A 1 303 ? 4.490   45.238 46.659 1.00 47.43  ? 303  THR A N   1 
ATOM   2347 C CA  . THR A 1 303 ? 5.147   44.283 47.549 1.00 47.43  ? 303  THR A CA  1 
ATOM   2348 C C   . THR A 1 303 ? 5.620   45.007 48.800 1.00 47.43  ? 303  THR A C   1 
ATOM   2349 O O   . THR A 1 303 ? 5.022   45.994 49.198 1.00 47.43  ? 303  THR A O   1 
ATOM   2350 C CB  . THR A 1 303 ? 6.347   43.639 46.856 1.00 54.53  ? 303  THR A CB  1 
ATOM   2351 O OG1 . THR A 1 303 ? 7.293   44.655 46.491 1.00 54.53  ? 303  THR A OG1 1 
ATOM   2352 C CG2 . THR A 1 303 ? 5.883   42.905 45.601 1.00 54.53  ? 303  THR A CG2 1 
ATOM   2353 N N   . SER A 1 304 ? 6.682   44.529 49.432 1.00 41.15  ? 304  SER A N   1 
ATOM   2354 C CA  . SER A 1 304 ? 7.173   45.196 50.631 1.00 41.15  ? 304  SER A CA  1 
ATOM   2355 C C   . SER A 1 304 ? 8.028   46.381 50.201 1.00 41.15  ? 304  SER A C   1 
ATOM   2356 O O   . SER A 1 304 ? 8.660   46.340 49.150 1.00 41.15  ? 304  SER A O   1 
ATOM   2357 C CB  . SER A 1 304 ? 8.014   44.245 51.473 1.00 42.87  ? 304  SER A CB  1 
ATOM   2358 O OG  . SER A 1 304 ? 9.290   44.077 50.894 1.00 42.87  ? 304  SER A OG  1 
ATOM   2359 N N   . LEU A 1 305 ? 8.060   47.434 51.009 1.00 45.40  ? 305  LEU A N   1 
ATOM   2360 C CA  . LEU A 1 305 ? 8.837   48.611 50.657 1.00 45.40  ? 305  LEU A CA  1 
ATOM   2361 C C   . LEU A 1 305 ? 10.320  48.339 50.389 1.00 45.40  ? 305  LEU A C   1 
ATOM   2362 O O   . LEU A 1 305 ? 10.889  48.874 49.433 1.00 45.40  ? 305  LEU A O   1 
ATOM   2363 C CB  . LEU A 1 305 ? 8.691   49.677 51.742 1.00 44.69  ? 305  LEU A CB  1 
ATOM   2364 C CG  . LEU A 1 305 ? 7.253   50.161 51.968 1.00 44.69  ? 305  LEU A CG  1 
ATOM   2365 C CD1 . LEU A 1 305 ? 7.245   51.232 53.064 1.00 44.69  ? 305  LEU A CD1 1 
ATOM   2366 C CD2 . LEU A 1 305 ? 6.664   50.703 50.657 1.00 44.69  ? 305  LEU A CD2 1 
ATOM   2367 N N   . GLU A 1 306 ? 10.951  47.502 51.204 1.00 43.05  ? 306  GLU A N   1 
ATOM   2368 C CA  . GLU A 1 306 ? 12.369  47.237 51.007 1.00 43.05  ? 306  GLU A CA  1 
ATOM   2369 C C   . GLU A 1 306 ? 12.695  46.581 49.669 1.00 43.05  ? 306  GLU A C   1 
ATOM   2370 O O   . GLU A 1 306 ? 13.703  46.917 49.039 1.00 43.05  ? 306  GLU A O   1 
ATOM   2371 C CB  . GLU A 1 306 ? 12.922  46.382 52.143 1.00 94.42  ? 306  GLU A CB  1 
ATOM   2372 C CG  . GLU A 1 306 ? 14.454  46.355 52.181 1.00 94.42  ? 306  GLU A CG  1 
ATOM   2373 C CD  . GLU A 1 306 ? 15.085  47.769 52.083 1.00 94.42  ? 306  GLU A CD  1 
ATOM   2374 O OE1 . GLU A 1 306 ? 14.558  48.718 52.740 1.00 94.42  ? 306  GLU A OE1 1 
ATOM   2375 O OE2 . GLU A 1 306 ? 16.110  47.923 51.355 1.00 94.42  ? 306  GLU A OE2 1 
ATOM   2376 N N   . SER A 1 307 ? 11.856  45.645 49.230 1.00 50.24  ? 307  SER A N   1 
ATOM   2377 C CA  . SER A 1 307 ? 12.098  44.980 47.949 1.00 50.24  ? 307  SER A CA  1 
ATOM   2378 C C   . SER A 1 307 ? 11.799  45.940 46.798 1.00 50.24  ? 307  SER A C   1 
ATOM   2379 O O   . SER A 1 307 ? 12.373  45.827 45.715 1.00 50.24  ? 307  SER A O   1 
ATOM   2380 C CB  . SER A 1 307 ? 11.239  43.726 47.820 1.00 59.23  ? 307  SER A CB  1 
ATOM   2381 O OG  . SER A 1 307 ? 9.869   44.057 47.780 1.00 59.23  ? 307  SER A OG  1 
ATOM   2382 N N   . MET A 1 308 ? 10.899  46.888 47.034 1.00 40.74  ? 308  MET A N   1 
ATOM   2383 C CA  . MET A 1 308 ? 10.583  47.863 46.011 1.00 40.74  ? 308  MET A CA  1 
ATOM   2384 C C   . MET A 1 308 ? 11.790  48.773 45.826 1.00 40.74  ? 308  MET A C   1 
ATOM   2385 O O   . MET A 1 308 ? 12.181  49.060 44.697 1.00 40.74  ? 308  MET A O   1 
ATOM   2386 C CB  . MET A 1 308 ? 9.362   48.696 46.402 1.00 53.46  ? 308  MET A CB  1 
ATOM   2387 C CG  . MET A 1 308 ? 8.065   47.931 46.396 1.00 53.46  ? 308  MET A CG  1 
ATOM   2388 S SD  . MET A 1 308 ? 6.630   49.039 46.387 1.00 53.46  ? 308  MET A SD  1 
ATOM   2389 C CE  . MET A 1 308 ? 6.392   49.278 44.592 1.00 53.46  ? 308  MET A CE  1 
ATOM   2390 N N   . LEU A 1 309 ? 12.385  49.217 46.934 1.00 40.25  ? 309  LEU A N   1 
ATOM   2391 C CA  . LEU A 1 309 ? 13.549  50.095 46.861 1.00 40.25  ? 309  LEU A CA  1 
ATOM   2392 C C   . LEU A 1 309 ? 14.778  49.381 46.286 1.00 40.25  ? 309  LEU A C   1 
ATOM   2393 O O   . LEU A 1 309 ? 15.635  50.004 45.653 1.00 40.25  ? 309  LEU A O   1 
ATOM   2394 C CB  . LEU A 1 309 ? 13.885  50.663 48.244 1.00 38.77  ? 309  LEU A CB  1 
ATOM   2395 C CG  . LEU A 1 309 ? 12.896  51.658 48.858 1.00 38.77  ? 309  LEU A CG  1 
ATOM   2396 C CD1 . LEU A 1 309 ? 13.396  52.092 50.217 1.00 38.77  ? 309  LEU A CD1 1 
ATOM   2397 C CD2 . LEU A 1 309 ? 12.738  52.865 47.950 1.00 38.77  ? 309  LEU A CD2 1 
ATOM   2398 N N   . ASN A 1 310 ? 14.859  48.071 46.498 1.00 40.32  ? 310  ASN A N   1 
ATOM   2399 C CA  . ASN A 1 310 ? 15.981  47.287 45.997 1.00 40.32  ? 310  ASN A CA  1 
ATOM   2400 C C   . ASN A 1 310 ? 15.867  46.930 44.528 1.00 40.32  ? 310  ASN A C   1 
ATOM   2401 O O   . ASN A 1 310 ? 16.875  46.793 43.841 1.00 40.32  ? 310  ASN A O   1 
ATOM   2402 C CB  . ASN A 1 310 ? 16.138  46.010 46.823 1.00 82.62  ? 310  ASN A CB  1 
ATOM   2403 C CG  . ASN A 1 310 ? 17.054  46.208 48.014 1.00 82.62  ? 310  ASN A CG  1 
ATOM   2404 O OD1 . ASN A 1 310 ? 18.209  46.607 47.845 1.00 82.62  ? 310  ASN A OD1 1 
ATOM   2405 N ND2 . ASN A 1 310 ? 16.552  45.940 49.223 1.00 82.62  ? 310  ASN A ND2 1 
ATOM   2406 N N   . SER A 1 311 ? 14.638  46.783 44.047 1.00 46.75  ? 311  SER A N   1 
ATOM   2407 C CA  . SER A 1 311 ? 14.402  46.426 42.652 1.00 46.75  ? 311  SER A CA  1 
ATOM   2408 C C   . SER A 1 311 ? 14.265  47.628 41.719 1.00 46.75  ? 311  SER A C   1 
ATOM   2409 O O   . SER A 1 311 ? 14.108  47.456 40.513 1.00 46.75  ? 311  SER A O   1 
ATOM   2410 C CB  . SER A 1 311 ? 13.148  45.548 42.535 1.00 54.08  ? 311  SER A CB  1 
ATOM   2411 O OG  . SER A 1 311 ? 11.999  46.192 43.067 1.00 54.08  ? 311  SER A OG  1 
ATOM   2412 N N   . GLY A 1 312 ? 14.328  48.838 42.269 1.00 37.83  ? 312  GLY A N   1 
ATOM   2413 C CA  . GLY A 1 312 ? 14.205  50.027 41.441 1.00 37.83  ? 312  GLY A CA  1 
ATOM   2414 C C   . GLY A 1 312 ? 12.774  50.233 40.984 1.00 37.83  ? 312  GLY A C   1 
ATOM   2415 O O   . GLY A 1 312 ? 12.497  50.969 40.045 1.00 37.83  ? 312  GLY A O   1 
ATOM   2416 N N   . ASN A 1 313 ? 11.855  49.565 41.663 1.00 42.61  ? 313  ASN A N   1 
ATOM   2417 C CA  . ASN A 1 313 ? 10.444  49.660 41.337 1.00 42.61  ? 313  ASN A CA  1 
ATOM   2418 C C   . ASN A 1 313 ? 9.834   50.922 41.946 1.00 42.61  ? 313  ASN A C   1 
ATOM   2419 O O   . ASN A 1 313 ? 9.220   50.891 43.014 1.00 42.61  ? 313  ASN A O   1 
ATOM   2420 C CB  . ASN A 1 313 ? 9.726   48.408 41.843 1.00 47.69  ? 313  ASN A CB  1 
ATOM   2421 C CG  . ASN A 1 313 ? 8.287   48.365 41.427 1.00 47.69  ? 313  ASN A CG  1 
ATOM   2422 O OD1 . ASN A 1 313 ? 7.836   49.208 40.646 1.00 47.69  ? 313  ASN A OD1 1 
ATOM   2423 N ND2 . ASN A 1 313 ? 7.543   47.389 41.945 1.00 47.69  ? 313  ASN A ND2 1 
ATOM   2424 N N   . PHE A 1 314 ? 10.026  52.041 41.261 1.00 41.91  ? 314  PHE A N   1 
ATOM   2425 C CA  . PHE A 1 314 ? 9.511   53.327 41.718 1.00 41.91  ? 314  PHE A CA  1 
ATOM   2426 C C   . PHE A 1 314 ? 9.792   54.427 40.702 1.00 41.91  ? 314  PHE A C   1 
ATOM   2427 O O   . PHE A 1 314 ? 10.669  54.292 39.856 1.00 41.91  ? 314  PHE A O   1 
ATOM   2428 C CB  . PHE A 1 314 ? 10.101  53.694 43.094 1.00 33.71  ? 314  PHE A CB  1 
ATOM   2429 C CG  . PHE A 1 314 ? 11.609  53.689 43.151 1.00 33.71  ? 314  PHE A CG  1 
ATOM   2430 C CD1 . PHE A 1 314 ? 12.347  54.742 42.628 1.00 33.71  ? 314  PHE A CD1 1 
ATOM   2431 C CD2 . PHE A 1 314 ? 12.291  52.620 43.730 1.00 33.71  ? 314  PHE A CD2 1 
ATOM   2432 C CE1 . PHE A 1 314 ? 13.740  54.726 42.679 1.00 33.71  ? 314  PHE A CE1 1 
ATOM   2433 C CE2 . PHE A 1 314 ? 13.683  52.600 43.782 1.00 33.71  ? 314  PHE A CE2 1 
ATOM   2434 C CZ  . PHE A 1 314 ? 14.405  53.653 43.256 1.00 33.71  ? 314  PHE A CZ  1 
ATOM   2435 N N   . LYS A 1 315 ? 9.036   55.514 40.784 1.00 37.14  ? 315  LYS A N   1 
ATOM   2436 C CA  . LYS A 1 315 ? 9.201   56.620 39.858 1.00 37.14  ? 315  LYS A CA  1 
ATOM   2437 C C   . LYS A 1 315 ? 10.604  57.216 39.873 1.00 37.14  ? 315  LYS A C   1 
ATOM   2438 O O   . LYS A 1 315 ? 11.065  57.713 40.903 1.00 37.14  ? 315  LYS A O   1 
ATOM   2439 C CB  . LYS A 1 315 ? 8.187   57.713 40.177 1.00 33.24  ? 315  LYS A CB  1 
ATOM   2440 C CG  . LYS A 1 315 ? 8.252   58.902 39.247 1.00 33.24  ? 315  LYS A CG  1 
ATOM   2441 C CD  . LYS A 1 315 ? 7.422   60.056 39.785 1.00 33.24  ? 315  LYS A CD  1 
ATOM   2442 C CE  . LYS A 1 315 ? 7.397   61.200 38.810 1.00 33.24  ? 315  LYS A CE  1 
ATOM   2443 N NZ  . LYS A 1 315 ? 6.911   60.724 37.488 1.00 33.24  ? 315  LYS A NZ  1 
ATOM   2444 N N   . LYS A 1 316 ? 11.283  57.156 38.730 1.00 42.45  ? 316  LYS A N   1 
ATOM   2445 C CA  . LYS A 1 316 ? 12.623  57.723 38.602 1.00 42.45  ? 316  LYS A CA  1 
ATOM   2446 C C   . LYS A 1 316 ? 12.508  59.178 38.164 1.00 42.45  ? 316  LYS A C   1 
ATOM   2447 O O   . LYS A 1 316 ? 11.993  59.462 37.088 1.00 42.45  ? 316  LYS A O   1 
ATOM   2448 C CB  . LYS A 1 316 ? 13.442  56.968 37.560 1.00 47.00  ? 316  LYS A CB  1 
ATOM   2449 C CG  . LYS A 1 316 ? 13.984  55.649 38.024 1.00 47.00  ? 316  LYS A CG  1 
ATOM   2450 C CD  . LYS A 1 316 ? 13.012  54.524 37.798 1.00 47.00  ? 316  LYS A CD  1 
ATOM   2451 C CE  . LYS A 1 316 ? 13.650  53.213 38.224 1.00 47.00  ? 316  LYS A CE  1 
ATOM   2452 N NZ  . LYS A 1 316 ? 12.850  52.042 37.803 1.00 47.00  ? 316  LYS A NZ  1 
ATOM   2453 N N   . THR A 1 317 ? 12.994  60.097 38.990 1.00 37.33  ? 317  THR A N   1 
ATOM   2454 C CA  . THR A 1 317 ? 12.927  61.523 38.681 1.00 37.33  ? 317  THR A CA  1 
ATOM   2455 C C   . THR A 1 317 ? 13.967  62.230 39.551 1.00 37.33  ? 317  THR A C   1 
ATOM   2456 O O   . THR A 1 317 ? 14.954  61.614 39.932 1.00 37.33  ? 317  THR A O   1 
ATOM   2457 C CB  . THR A 1 317 ? 11.484  62.064 38.953 1.00 43.23  ? 317  THR A CB  1 
ATOM   2458 O OG1 . THR A 1 317 ? 11.459  63.488 38.787 1.00 43.23  ? 317  THR A OG1 1 
ATOM   2459 C CG2 . THR A 1 317 ? 11.016  61.693 40.351 1.00 43.23  ? 317  THR A CG2 1 
ATOM   2460 N N   . GLN A 1 318 ? 13.793  63.512 39.845 1.00 36.41  ? 318  GLN A N   1 
ATOM   2461 C CA  . GLN A 1 318 ? 14.751  64.177 40.717 1.00 36.41  ? 318  GLN A CA  1 
ATOM   2462 C C   . GLN A 1 318 ? 14.060  64.404 42.051 1.00 36.41  ? 318  GLN A C   1 
ATOM   2463 O O   . GLN A 1 318 ? 12.858  64.611 42.090 1.00 36.41  ? 318  GLN A O   1 
ATOM   2464 C CB  . GLN A 1 318 ? 15.192  65.530 40.161 1.00 38.83  ? 318  GLN A CB  1 
ATOM   2465 C CG  . GLN A 1 318 ? 15.780  65.512 38.775 1.00 38.83  ? 318  GLN A CG  1 
ATOM   2466 C CD  . GLN A 1 318 ? 14.710  65.609 37.710 1.00 38.83  ? 318  GLN A CD  1 
ATOM   2467 O OE1 . GLN A 1 318 ? 13.769  66.399 37.836 1.00 38.83  ? 318  GLN A OE1 1 
ATOM   2468 N NE2 . GLN A 1 318 ? 14.848  64.814 36.649 1.00 38.83  ? 318  GLN A NE2 1 
ATOM   2469 N N   . ILE A 1 319 ? 14.804  64.343 43.145 1.00 33.87  ? 319  ILE A N   1 
ATOM   2470 C CA  . ILE A 1 319 ? 14.208  64.588 44.445 1.00 33.87  ? 319  ILE A CA  1 
ATOM   2471 C C   . ILE A 1 319 ? 15.153  65.416 45.289 1.00 33.87  ? 319  ILE A C   1 
ATOM   2472 O O   . ILE A 1 319 ? 16.372  65.356 45.124 1.00 33.87  ? 319  ILE A O   1 
ATOM   2473 C CB  . ILE A 1 319 ? 13.893  63.293 45.217 1.00 38.66  ? 319  ILE A CB  1 
ATOM   2474 C CG1 . ILE A 1 319 ? 15.172  62.495 45.442 1.00 38.66  ? 319  ILE A CG1 1 
ATOM   2475 C CG2 . ILE A 1 319 ? 12.854  62.476 44.476 1.00 38.66  ? 319  ILE A CG2 1 
ATOM   2476 C CD1 . ILE A 1 319 ? 14.953  61.265 46.267 1.00 38.66  ? 319  ILE A CD1 1 
ATOM   2477 N N   . LEU A 1 320 ? 14.575  66.200 46.188 1.00 36.49  ? 320  LEU A N   1 
ATOM   2478 C CA  . LEU A 1 320 ? 15.340  67.049 47.080 1.00 36.49  ? 320  LEU A CA  1 
ATOM   2479 C C   . LEU A 1 320 ? 14.821  66.733 48.477 1.00 36.49  ? 320  LEU A C   1 
ATOM   2480 O O   . LEU A 1 320 ? 13.621  66.790 48.716 1.00 36.49  ? 320  LEU A O   1 
ATOM   2481 C CB  . LEU A 1 320 ? 15.101  68.513 46.714 1.00 28.41  ? 320  LEU A CB  1 
ATOM   2482 C CG  . LEU A 1 320 ? 15.925  69.584 47.421 1.00 28.41  ? 320  LEU A CG  1 
ATOM   2483 C CD1 . LEU A 1 320 ? 15.972  70.814 46.548 1.00 28.41  ? 320  LEU A CD1 1 
ATOM   2484 C CD2 . LEU A 1 320 ? 15.333  69.898 48.773 1.00 28.41  ? 320  LEU A CD2 1 
ATOM   2485 N N   . LEU A 1 321 ? 15.713  66.376 49.393 1.00 36.93  ? 321  LEU A N   1 
ATOM   2486 C CA  . LEU A 1 321 ? 15.285  66.036 50.743 1.00 36.93  ? 321  LEU A CA  1 
ATOM   2487 C C   . LEU A 1 321 ? 16.335  66.309 51.811 1.00 36.93  ? 321  LEU A C   1 
ATOM   2488 O O   . LEU A 1 321 ? 17.496  66.584 51.512 1.00 36.93  ? 321  LEU A O   1 
ATOM   2489 C CB  . LEU A 1 321 ? 14.850  64.566 50.801 1.00 37.58  ? 321  LEU A CB  1 
ATOM   2490 C CG  . LEU A 1 321 ? 15.894  63.475 50.576 1.00 37.58  ? 321  LEU A CG  1 
ATOM   2491 C CD1 . LEU A 1 321 ? 15.210  62.126 50.517 1.00 37.58  ? 321  LEU A CD1 1 
ATOM   2492 C CD2 . LEU A 1 321 ? 16.632  63.742 49.280 1.00 37.58  ? 321  LEU A CD2 1 
ATOM   2493 N N   . GLY A 1 322 ? 15.905  66.240 53.065 1.00 34.07  ? 322  GLY A N   1 
ATOM   2494 C CA  . GLY A 1 322 ? 16.804  66.494 54.170 1.00 34.07  ? 322  GLY A CA  1 
ATOM   2495 C C   . GLY A 1 322 ? 16.113  66.316 55.502 1.00 34.07  ? 322  GLY A C   1 
ATOM   2496 O O   . GLY A 1 322 ? 14.958  65.900 55.557 1.00 34.07  ? 322  GLY A O   1 
ATOM   2497 N N   . VAL A 1 323 ? 16.821  66.644 56.577 1.00 31.51  ? 323  VAL A N   1 
ATOM   2498 C CA  . VAL A 1 323 ? 16.290  66.492 57.919 1.00 31.51  ? 323  VAL A CA  1 
ATOM   2499 C C   . VAL A 1 323 ? 16.722  67.661 58.800 1.00 31.51  ? 323  VAL A C   1 
ATOM   2500 O O   . VAL A 1 323 ? 17.589  68.433 58.415 1.00 31.51  ? 323  VAL A O   1 
ATOM   2501 C CB  . VAL A 1 323 ? 16.825  65.175 58.565 1.00 34.39  ? 323  VAL A CB  1 
ATOM   2502 C CG1 . VAL A 1 323 ? 16.521  63.987 57.670 1.00 34.39  ? 323  VAL A CG1 1 
ATOM   2503 C CG2 . VAL A 1 323 ? 18.316  65.272 58.800 1.00 34.39  ? 323  VAL A CG2 1 
ATOM   2504 N N   . ASN A 1 324 ? 16.113  67.790 59.977 1.00 34.12  ? 324  ASN A N   1 
ATOM   2505 C CA  . ASN A 1 324 ? 16.496  68.837 60.924 1.00 34.12  ? 324  ASN A CA  1 
ATOM   2506 C C   . ASN A 1 324 ? 17.495  68.238 61.915 1.00 34.12  ? 324  ASN A C   1 
ATOM   2507 O O   . ASN A 1 324 ? 17.517  67.031 62.126 1.00 34.12  ? 324  ASN A O   1 
ATOM   2508 C CB  . ASN A 1 324 ? 15.294  69.363 61.706 1.00 49.02  ? 324  ASN A CB  1 
ATOM   2509 C CG  . ASN A 1 324 ? 14.239  69.946 60.821 1.00 49.02  ? 324  ASN A CG  1 
ATOM   2510 O OD1 . ASN A 1 324 ? 14.528  70.466 59.741 1.00 49.02  ? 324  ASN A OD1 1 
ATOM   2511 N ND2 . ASN A 1 324 ? 12.997  69.878 61.271 1.00 49.02  ? 324  ASN A ND2 1 
ATOM   2512 N N   . LYS A 1 325 ? 18.306  69.083 62.537 1.00 38.91  ? 325  LYS A N   1 
ATOM   2513 C CA  . LYS A 1 325 ? 19.299  68.609 63.489 1.00 38.91  ? 325  LYS A CA  1 
ATOM   2514 C C   . LYS A 1 325 ? 18.717  67.846 64.678 1.00 38.91  ? 325  LYS A C   1 
ATOM   2515 O O   . LYS A 1 325 ? 19.208  66.775 65.033 1.00 38.91  ? 325  LYS A O   1 
ATOM   2516 C CB  . LYS A 1 325 ? 20.128  69.787 64.009 1.00 43.16  ? 325  LYS A CB  1 
ATOM   2517 C CG  . LYS A 1 325 ? 21.286  69.402 64.908 1.00 43.16  ? 325  LYS A CG  1 
ATOM   2518 C CD  . LYS A 1 325 ? 22.004  70.645 65.407 1.00 43.16  ? 325  LYS A CD  1 
ATOM   2519 C CE  . LYS A 1 325 ? 23.263  70.311 66.206 1.00 43.16  ? 325  LYS A CE  1 
ATOM   2520 N NZ  . LYS A 1 325 ? 22.968  69.565 67.466 1.00 43.16  ? 325  LYS A NZ  1 
ATOM   2521 N N   . ASP A 1 326 ? 17.664  68.377 65.286 1.00 43.57  ? 326  ASP A N   1 
ATOM   2522 C CA  . ASP A 1 326 ? 17.109  67.728 66.464 1.00 43.57  ? 326  ASP A CA  1 
ATOM   2523 C C   . ASP A 1 326 ? 15.679  67.205 66.341 1.00 43.57  ? 326  ASP A C   1 
ATOM   2524 O O   . ASP A 1 326 ? 14.784  67.598 67.078 1.00 43.57  ? 326  ASP A O   1 
ATOM   2525 C CB  . ASP A 1 326 ? 17.256  68.686 67.651 1.00 52.56  ? 326  ASP A CB  1 
ATOM   2526 C CG  . ASP A 1 326 ? 18.723  69.110 67.879 1.00 52.56  ? 326  ASP A CG  1 
ATOM   2527 O OD1 . ASP A 1 326 ? 19.563  68.232 68.194 1.00 52.56  ? 326  ASP A OD1 1 
ATOM   2528 O OD2 . ASP A 1 326 ? 19.046  70.314 67.728 1.00 52.56  ? 326  ASP A OD2 1 
ATOM   2529 N N   . GLU A 1 327 ? 15.500  66.273 65.418 1.00 53.00  ? 327  GLU A N   1 
ATOM   2530 C CA  . GLU A 1 327 ? 14.215  65.657 65.132 1.00 53.00  ? 327  GLU A CA  1 
ATOM   2531 C C   . GLU A 1 327 ? 13.471  64.967 66.283 1.00 53.00  ? 327  GLU A C   1 
ATOM   2532 O O   . GLU A 1 327 ? 12.248  64.872 66.236 1.00 53.00  ? 327  GLU A O   1 
ATOM   2533 C CB  . GLU A 1 327 ? 14.395  64.634 64.006 1.00 75.84  ? 327  GLU A CB  1 
ATOM   2534 C CG  . GLU A 1 327 ? 14.952  65.206 62.709 1.00 75.84  ? 327  GLU A CG  1 
ATOM   2535 C CD  . GLU A 1 327 ? 13.885  65.872 61.846 1.00 75.84  ? 327  GLU A CD  1 
ATOM   2536 O OE1 . GLU A 1 327 ? 12.789  66.177 62.380 1.00 75.84  ? 327  GLU A OE1 1 
ATOM   2537 O OE2 . GLU A 1 327 ? 14.145  66.096 60.636 1.00 75.84  ? 327  GLU A OE2 1 
ATOM   2538 N N   . GLY A 1 328 ? 14.170  64.481 67.305 1.00 43.88  ? 328  GLY A N   1 
ATOM   2539 C CA  . GLY A 1 328 ? 13.469  63.767 68.363 1.00 43.88  ? 328  GLY A CA  1 
ATOM   2540 C C   . GLY A 1 328 ? 12.965  64.488 69.607 1.00 43.88  ? 328  GLY A C   1 
ATOM   2541 O O   . GLY A 1 328 ? 11.997  64.044 70.238 1.00 43.88  ? 328  GLY A O   1 
ATOM   2542 N N   . SER A 1 329 ? 13.602  65.597 69.970 1.00 50.44  ? 329  SER A N   1 
ATOM   2543 C CA  . SER A 1 329 ? 13.224  66.326 71.173 1.00 50.44  ? 329  SER A CA  1 
ATOM   2544 C C   . SER A 1 329 ? 11.723  66.527 71.400 1.00 50.44  ? 329  SER A C   1 
ATOM   2545 O O   . SER A 1 329 ? 11.259  66.488 72.535 1.00 50.44  ? 329  SER A O   1 
ATOM   2546 C CB  . SER A 1 329 ? 13.935  67.672 71.202 1.00 39.87  ? 329  SER A CB  1 
ATOM   2547 O OG  . SER A 1 329 ? 13.609  68.408 70.055 1.00 39.87  ? 329  SER A OG  1 
ATOM   2548 N N   . PHE A 1 330 ? 10.955  66.722 70.339 1.00 44.18  ? 330  PHE A N   1 
ATOM   2549 C CA  . PHE A 1 330 ? 9.527   66.952 70.504 1.00 44.18  ? 330  PHE A CA  1 
ATOM   2550 C C   . PHE A 1 330 ? 8.741   65.789 71.099 1.00 44.18  ? 330  PHE A C   1 
ATOM   2551 O O   . PHE A 1 330 ? 7.781   66.003 71.837 1.00 44.18  ? 330  PHE A O   1 
ATOM   2552 C CB  . PHE A 1 330 ? 8.912   67.332 69.175 1.00 59.65  ? 330  PHE A CB  1 
ATOM   2553 C CG  . PHE A 1 330 ? 7.785   68.288 69.305 1.00 59.65  ? 330  PHE A CG  1 
ATOM   2554 C CD1 . PHE A 1 330 ? 6.583   67.889 69.860 1.00 59.65  ? 330  PHE A CD1 1 
ATOM   2555 C CD2 . PHE A 1 330 ? 7.936   69.613 68.907 1.00 59.65  ? 330  PHE A CD2 1 
ATOM   2556 C CE1 . PHE A 1 330 ? 5.538   68.800 70.023 1.00 59.65  ? 330  PHE A CE1 1 
ATOM   2557 C CE2 . PHE A 1 330 ? 6.898   70.535 69.067 1.00 59.65  ? 330  PHE A CE2 1 
ATOM   2558 C CZ  . PHE A 1 330 ? 5.699   70.128 69.626 1.00 59.65  ? 330  PHE A CZ  1 
ATOM   2559 N N   . PHE A 1 331 ? 9.147   64.562 70.789 1.00 37.70  ? 331  PHE A N   1 
ATOM   2560 C CA  . PHE A 1 331 ? 8.461   63.376 71.283 1.00 37.70  ? 331  PHE A CA  1 
ATOM   2561 C C   . PHE A 1 331 ? 8.912   62.973 72.666 1.00 37.70  ? 331  PHE A C   1 
ATOM   2562 O O   . PHE A 1 331 ? 8.178   62.309 73.385 1.00 37.70  ? 331  PHE A O   1 
ATOM   2563 C CB  . PHE A 1 331 ? 8.664   62.222 70.310 1.00 38.96  ? 331  PHE A CB  1 
ATOM   2564 C CG  . PHE A 1 331 ? 8.268   62.562 68.914 1.00 38.96  ? 331  PHE A CG  1 
ATOM   2565 C CD1 . PHE A 1 331 ? 9.042   63.441 68.155 1.00 38.96  ? 331  PHE A CD1 1 
ATOM   2566 C CD2 . PHE A 1 331 ? 7.077   62.089 68.384 1.00 38.96  ? 331  PHE A CD2 1 
ATOM   2567 C CE1 . PHE A 1 331 ? 8.628   63.848 66.891 1.00 38.96  ? 331  PHE A CE1 1 
ATOM   2568 C CE2 . PHE A 1 331 ? 6.657   62.489 67.122 1.00 38.96  ? 331  PHE A CE2 1 
ATOM   2569 C CZ  . PHE A 1 331 ? 7.432   63.371 66.375 1.00 38.96  ? 331  PHE A CZ  1 
ATOM   2570 N N   . LEU A 1 332 ? 10.124  63.362 73.039 1.00 41.58  ? 332  LEU A N   1 
ATOM   2571 C CA  . LEU A 1 332 ? 10.636  63.042 74.363 1.00 41.58  ? 332  LEU A CA  1 
ATOM   2572 C C   . LEU A 1 332 ? 9.925   63.946 75.371 1.00 41.58  ? 332  LEU A C   1 
ATOM   2573 O O   . LEU A 1 332 ? 9.554   63.520 76.463 1.00 41.58  ? 332  LEU A O   1 
ATOM   2574 C CB  . LEU A 1 332 ? 12.150  63.272 74.413 1.00 32.79  ? 332  LEU A CB  1 
ATOM   2575 C CG  . LEU A 1 332 ? 13.013  62.244 73.685 1.00 32.79  ? 332  LEU A CG  1 
ATOM   2576 C CD1 . LEU A 1 332 ? 14.382  62.809 73.420 1.00 32.79  ? 332  LEU A CD1 1 
ATOM   2577 C CD2 . LEU A 1 332 ? 13.110  60.996 74.521 1.00 32.79  ? 332  LEU A CD2 1 
ATOM   2578 N N   . LEU A 1 333 ? 9.726   65.197 74.977 1.00 44.76  ? 333  LEU A N   1 
ATOM   2579 C CA  . LEU A 1 333 ? 9.065   66.177 75.817 1.00 44.76  ? 333  LEU A CA  1 
ATOM   2580 C C   . LEU A 1 333 ? 7.671   65.705 76.200 1.00 44.76  ? 333  LEU A C   1 
ATOM   2581 O O   . LEU A 1 333 ? 7.279   65.779 77.366 1.00 44.76  ? 333  LEU A O   1 
ATOM   2582 C CB  . LEU A 1 333 ? 8.974   67.508 75.074 1.00 42.41  ? 333  LEU A CB  1 
ATOM   2583 C CG  . LEU A 1 333 ? 8.101   68.601 75.685 1.00 42.41  ? 333  LEU A CG  1 
ATOM   2584 C CD1 . LEU A 1 333 ? 8.613   68.964 77.076 1.00 42.41  ? 333  LEU A CD1 1 
ATOM   2585 C CD2 . LEU A 1 333 ? 8.115   69.816 74.759 1.00 42.41  ? 333  LEU A CD2 1 
ATOM   2586 N N   . TYR A 1 334 ? 6.926   65.219 75.213 1.00 49.75  ? 334  TYR A N   1 
ATOM   2587 C CA  . TYR A 1 334 ? 5.573   64.745 75.451 1.00 49.75  ? 334  TYR A CA  1 
ATOM   2588 C C   . TYR A 1 334 ? 5.492   63.348 76.037 1.00 49.75  ? 334  TYR A C   1 
ATOM   2589 O O   . TYR A 1 334 ? 4.519   63.034 76.720 1.00 49.75  ? 334  TYR A O   1 
ATOM   2590 C CB  . TYR A 1 334 ? 4.749   64.750 74.154 1.00 39.96  ? 334  TYR A CB  1 
ATOM   2591 C CG  . TYR A 1 334 ? 4.187   66.089 73.752 1.00 39.96  ? 334  TYR A CG  1 
ATOM   2592 C CD1 . TYR A 1 334 ? 5.031   67.150 73.448 1.00 39.96  ? 334  TYR A CD1 1 
ATOM   2593 C CD2 . TYR A 1 334 ? 2.811   66.298 73.677 1.00 39.96  ? 334  TYR A CD2 1 
ATOM   2594 C CE1 . TYR A 1 334 ? 4.525   68.395 73.080 1.00 39.96  ? 334  TYR A CE1 1 
ATOM   2595 C CE2 . TYR A 1 334 ? 2.289   67.540 73.307 1.00 39.96  ? 334  TYR A CE2 1 
ATOM   2596 C CZ  . TYR A 1 334 ? 3.157   68.587 73.010 1.00 39.96  ? 334  TYR A CZ  1 
ATOM   2597 O OH  . TYR A 1 334 ? 2.688   69.829 72.644 1.00 39.96  ? 334  TYR A OH  1 
ATOM   2598 N N   . GLY A 1 335 ? 6.490   62.503 75.803 1.00 43.79  ? 335  GLY A N   1 
ATOM   2599 C CA  . GLY A 1 335 ? 6.358   61.152 76.309 1.00 43.79  ? 335  GLY A CA  1 
ATOM   2600 C C   . GLY A 1 335 ? 7.392   60.481 77.182 1.00 43.79  ? 335  GLY A C   1 
ATOM   2601 O O   . GLY A 1 335 ? 7.062   59.509 77.860 1.00 43.79  ? 335  GLY A O   1 
ATOM   2602 N N   . ALA A 1 336 ? 8.631   60.954 77.185 1.00 42.82  ? 336  ALA A N   1 
ATOM   2603 C CA  . ALA A 1 336 ? 9.646   60.302 78.007 1.00 42.82  ? 336  ALA A CA  1 
ATOM   2604 C C   . ALA A 1 336 ? 9.795   60.934 79.378 1.00 42.82  ? 336  ALA A C   1 
ATOM   2605 O O   . ALA A 1 336 ? 9.856   62.153 79.513 1.00 42.82  ? 336  ALA A O   1 
ATOM   2606 C CB  . ALA A 1 336 ? 10.986  60.303 77.287 1.00 39.60  ? 336  ALA A CB  1 
ATOM   2607 N N   . PRO A 1 337 ? 9.858   60.106 80.424 1.00 48.85  ? 337  PRO A N   1 
ATOM   2608 C CA  . PRO A 1 337 ? 10.007  60.623 81.786 1.00 48.85  ? 337  PRO A CA  1 
ATOM   2609 C C   . PRO A 1 337 ? 11.332  61.377 81.962 1.00 48.85  ? 337  PRO A C   1 
ATOM   2610 O O   . PRO A 1 337 ? 12.392  60.915 81.513 1.00 48.85  ? 337  PRO A O   1 
ATOM   2611 C CB  . PRO A 1 337 ? 9.948   59.361 82.634 1.00 49.54  ? 337  PRO A CB  1 
ATOM   2612 C CG  . PRO A 1 337 ? 10.605  58.334 81.720 1.00 49.54  ? 337  PRO A CG  1 
ATOM   2613 C CD  . PRO A 1 337 ? 9.938   58.635 80.403 1.00 49.54  ? 337  PRO A CD  1 
ATOM   2614 N N   . GLY A 1 338 ? 11.267  62.542 82.601 1.00 40.80  ? 338  GLY A N   1 
ATOM   2615 C CA  . GLY A 1 338 ? 12.470  63.317 82.824 1.00 40.80  ? 338  GLY A CA  1 
ATOM   2616 C C   . GLY A 1 338 ? 12.508  64.647 82.106 1.00 40.80  ? 338  GLY A C   1 
ATOM   2617 O O   . GLY A 1 338 ? 13.155  65.577 82.583 1.00 40.80  ? 338  GLY A O   1 
ATOM   2618 N N   . PHE A 1 339 ? 11.813  64.749 80.974 1.00 42.82  ? 339  PHE A N   1 
ATOM   2619 C CA  . PHE A 1 339 ? 11.802  65.982 80.186 1.00 42.82  ? 339  PHE A CA  1 
ATOM   2620 C C   . PHE A 1 339 ? 10.680  66.932 80.573 1.00 42.82  ? 339  PHE A C   1 
ATOM   2621 O O   . PHE A 1 339 ? 9.573   66.505 80.877 1.00 42.82  ? 339  PHE A O   1 
ATOM   2622 C CB  . PHE A 1 339 ? 11.712  65.658 78.689 1.00 32.44  ? 339  PHE A CB  1 
ATOM   2623 C CG  . PHE A 1 339 ? 12.844  64.808 78.182 1.00 32.44  ? 339  PHE A CG  1 
ATOM   2624 C CD1 . PHE A 1 339 ? 12.938  63.464 78.531 1.00 32.44  ? 339  PHE A CD1 1 
ATOM   2625 C CD2 . PHE A 1 339 ? 13.819  65.349 77.354 1.00 32.44  ? 339  PHE A CD2 1 
ATOM   2626 C CE1 . PHE A 1 339 ? 13.987  62.671 78.057 1.00 32.44  ? 339  PHE A CE1 1 
ATOM   2627 C CE2 . PHE A 1 339 ? 14.875  64.564 76.875 1.00 32.44  ? 339  PHE A CE2 1 
ATOM   2628 C CZ  . PHE A 1 339 ? 14.955  63.222 77.229 1.00 32.44  ? 339  PHE A CZ  1 
ATOM   2629 N N   . SER A 1 340 ? 10.977  68.226 80.566 1.00 47.10  ? 340  SER A N   1 
ATOM   2630 C CA  . SER A 1 340 ? 9.991   69.247 80.920 1.00 47.10  ? 340  SER A CA  1 
ATOM   2631 C C   . SER A 1 340 ? 10.142  70.467 80.033 1.00 47.10  ? 340  SER A C   1 
ATOM   2632 O O   . SER A 1 340 ? 11.250  70.825 79.637 1.00 47.10  ? 340  SER A O   1 
ATOM   2633 C CB  . SER A 1 340 ? 10.156  69.690 82.381 1.00 62.62  ? 340  SER A CB  1 
ATOM   2634 O OG  . SER A 1 340 ? 9.799   68.662 83.289 1.00 62.62  ? 340  SER A OG  1 
ATOM   2635 N N   . LYS A 1 341 ? 9.028   71.118 79.738 1.00 40.91  ? 341  LYS A N   1 
ATOM   2636 C CA  . LYS A 1 341 ? 9.071   72.295 78.899 1.00 40.91  ? 341  LYS A CA  1 
ATOM   2637 C C   . LYS A 1 341 ? 9.754   73.442 79.614 1.00 40.91  ? 341  LYS A C   1 
ATOM   2638 O O   . LYS A 1 341 ? 10.318  74.325 78.980 1.00 40.91  ? 341  LYS A O   1 
ATOM   2639 C CB  . LYS A 1 341 ? 7.661   72.736 78.509 1.00 47.83  ? 341  LYS A CB  1 
ATOM   2640 C CG  . LYS A 1 341 ? 7.669   73.867 77.494 1.00 47.83  ? 341  LYS A CG  1 
ATOM   2641 C CD  . LYS A 1 341 ? 6.267   74.329 77.108 1.00 47.83  ? 341  LYS A CD  1 
ATOM   2642 C CE  . LYS A 1 341 ? 5.643   75.175 78.206 1.00 47.83  ? 341  LYS A CE  1 
ATOM   2643 N NZ  . LYS A 1 341 ? 6.438   76.402 78.506 1.00 47.83  ? 341  LYS A NZ  1 
ATOM   2644 N N   . ASP A 1 342 ? 9.719   73.423 80.940 1.00 41.89  ? 342  ASP A N   1 
ATOM   2645 C CA  . ASP A 1 342 ? 10.291  74.520 81.702 1.00 41.89  ? 342  ASP A CA  1 
ATOM   2646 C C   . ASP A 1 342 ? 11.602  74.259 82.437 1.00 41.89  ? 342  ASP A C   1 
ATOM   2647 O O   . ASP A 1 342 ? 11.965  75.023 83.323 1.00 41.89  ? 342  ASP A O   1 
ATOM   2648 C CB  . ASP A 1 342 ? 9.246   75.047 82.698 1.00 63.21  ? 342  ASP A CB  1 
ATOM   2649 C CG  . ASP A 1 342 ? 8.045   75.722 82.016 1.00 63.21  ? 342  ASP A CG  1 
ATOM   2650 O OD1 . ASP A 1 342 ? 7.962   75.744 80.762 1.00 63.21  ? 342  ASP A OD1 1 
ATOM   2651 O OD2 . ASP A 1 342 ? 7.167   76.236 82.754 1.00 63.21  ? 342  ASP A OD2 1 
ATOM   2652 N N   . SER A 1 343 ? 12.311  73.191 82.094 1.00 44.11  ? 343  SER A N   1 
ATOM   2653 C CA  . SER A 1 343 ? 13.589  72.911 82.748 1.00 44.11  ? 343  SER A CA  1 
ATOM   2654 C C   . SER A 1 343 ? 14.620  72.449 81.730 1.00 44.11  ? 343  SER A C   1 
ATOM   2655 O O   . SER A 1 343 ? 14.287  72.143 80.581 1.00 44.11  ? 343  SER A O   1 
ATOM   2656 C CB  . SER A 1 343 ? 13.430  71.835 83.814 1.00 53.28  ? 343  SER A CB  1 
ATOM   2657 O OG  . SER A 1 343 ? 13.179  70.573 83.227 1.00 53.28  ? 343  SER A OG  1 
ATOM   2658 N N   . GLU A 1 344 ? 15.875  72.399 82.158 1.00 41.76  ? 344  GLU A N   1 
ATOM   2659 C CA  . GLU A 1 344 ? 16.952  71.971 81.281 1.00 41.76  ? 344  GLU A CA  1 
ATOM   2660 C C   . GLU A 1 344 ? 16.838  70.489 80.964 1.00 41.76  ? 344  GLU A C   1 
ATOM   2661 O O   . GLU A 1 344 ? 17.562  69.967 80.112 1.00 41.76  ? 344  GLU A O   1 
ATOM   2662 C CB  . GLU A 1 344 ? 18.299  72.215 81.939 1.00 88.90  ? 344  GLU A CB  1 
ATOM   2663 C CG  . GLU A 1 344 ? 18.767  73.644 81.954 1.00 88.90  ? 344  GLU A CG  1 
ATOM   2664 C CD  . GLU A 1 344 ? 20.191  73.727 82.477 1.00 88.90  ? 344  GLU A CD  1 
ATOM   2665 O OE1 . GLU A 1 344 ? 20.417  73.342 83.659 1.00 88.90  ? 344  GLU A OE1 1 
ATOM   2666 O OE2 . GLU A 1 344 ? 21.082  74.157 81.698 1.00 88.90  ? 344  GLU A OE2 1 
ATOM   2667 N N   . SER A 1 345 ? 15.944  69.813 81.680 1.00 46.01  ? 345  SER A N   1 
ATOM   2668 C CA  . SER A 1 345 ? 15.713  68.390 81.488 1.00 46.01  ? 345  SER A CA  1 
ATOM   2669 C C   . SER A 1 345 ? 16.995  67.555 81.439 1.00 46.01  ? 345  SER A C   1 
ATOM   2670 O O   . SER A 1 345 ? 17.281  66.887 80.440 1.00 46.01  ? 345  SER A O   1 
ATOM   2671 C CB  . SER A 1 345 ? 14.907  68.165 80.204 1.00 47.33  ? 345  SER A CB  1 
ATOM   2672 O OG  . SER A 1 345 ? 13.636  68.788 80.278 1.00 47.33  ? 345  SER A OG  1 
ATOM   2673 N N   . LYS A 1 346 ? 17.786  67.601 82.501 1.00 41.95  ? 346  LYS A N   1 
ATOM   2674 C CA  . LYS A 1 346 ? 18.991  66.792 82.532 1.00 41.95  ? 346  LYS A CA  1 
ATOM   2675 C C   . LYS A 1 346 ? 18.479  65.413 82.940 1.00 41.95  ? 346  LYS A C   1 
ATOM   2676 O O   . LYS A 1 346 ? 17.735  65.282 83.904 1.00 41.95  ? 346  LYS A O   1 
ATOM   2677 C CB  . LYS A 1 346 ? 19.978  67.364 83.544 1.00 71.32  ? 346  LYS A CB  1 
ATOM   2678 C CG  . LYS A 1 346 ? 20.510  68.730 83.124 1.00 71.32  ? 346  LYS A CG  1 
ATOM   2679 C CD  . LYS A 1 346 ? 21.233  69.443 84.265 1.00 71.32  ? 346  LYS A CD  1 
ATOM   2680 C CE  . LYS A 1 346 ? 21.731  70.816 83.807 1.00 71.32  ? 346  LYS A CE  1 
ATOM   2681 N NZ  . LYS A 1 346 ? 22.314  71.616 84.927 1.00 71.32  ? 346  LYS A NZ  1 
ATOM   2682 N N   . ILE A 1 347 ? 18.853  64.391 82.184 1.00 51.71  ? 347  ILE A N   1 
ATOM   2683 C CA  . ILE A 1 347 ? 18.366  63.046 82.440 1.00 51.71  ? 347  ILE A CA  1 
ATOM   2684 C C   . ILE A 1 347 ? 19.372  62.164 83.175 1.00 51.71  ? 347  ILE A C   1 
ATOM   2685 O O   . ILE A 1 347 ? 20.576  62.176 82.885 1.00 51.71  ? 347  ILE A O   1 
ATOM   2686 C CB  . ILE A 1 347 ? 17.945  62.375 81.094 1.00 40.28  ? 347  ILE A CB  1 
ATOM   2687 C CG1 . ILE A 1 347 ? 16.967  63.284 80.356 1.00 40.28  ? 347  ILE A CG1 1 
ATOM   2688 C CG2 . ILE A 1 347 ? 17.274  61.041 81.340 1.00 40.28  ? 347  ILE A CG2 1 
ATOM   2689 C CD1 . ILE A 1 347 ? 15.724  63.581 81.146 1.00 40.28  ? 347  ILE A CD1 1 
ATOM   2690 N N   . SER A 1 348 ? 18.861  61.397 84.131 1.00 47.35  ? 348  SER A N   1 
ATOM   2691 C CA  . SER A 1 348 ? 19.686  60.495 84.921 1.00 47.35  ? 348  SER A CA  1 
ATOM   2692 C C   . SER A 1 348 ? 19.882  59.205 84.146 1.00 47.35  ? 348  SER A C   1 
ATOM   2693 O O   . SER A 1 348 ? 19.298  59.024 83.083 1.00 47.35  ? 348  SER A O   1 
ATOM   2694 C CB  . SER A 1 348 ? 18.981  60.164 86.220 1.00 43.65  ? 348  SER A CB  1 
ATOM   2695 O OG  . SER A 1 348 ? 17.810  59.412 85.942 1.00 43.65  ? 348  SER A OG  1 
ATOM   2696 N N   . ARG A 1 349 ? 20.697  58.304 84.682 1.00 58.14  ? 349  ARG A N   1 
ATOM   2697 C CA  . ARG A 1 349 ? 20.923  57.025 84.027 1.00 58.14  ? 349  ARG A CA  1 
ATOM   2698 C C   . ARG A 1 349 ? 19.603  56.268 84.021 1.00 58.14  ? 349  ARG A C   1 
ATOM   2699 O O   . ARG A 1 349 ? 19.275  55.602 83.037 1.00 58.14  ? 349  ARG A O   1 
ATOM   2700 C CB  . ARG A 1 349 ? 21.963  56.203 84.786 1.00 55.91  ? 349  ARG A CB  1 
ATOM   2701 C CG  . ARG A 1 349 ? 23.381  56.340 84.283 1.00 55.91  ? 349  ARG A CG  1 
ATOM   2702 C CD  . ARG A 1 349 ? 23.605  55.485 83.052 1.00 55.91  ? 349  ARG A CD  1 
ATOM   2703 N NE  . ARG A 1 349 ? 23.566  56.283 81.834 1.00 55.91  ? 349  ARG A NE  1 
ATOM   2704 C CZ  . ARG A 1 349 ? 23.802  55.800 80.617 1.00 55.91  ? 349  ARG A CZ  1 
ATOM   2705 N NH1 . ARG A 1 349 ? 24.097  54.515 80.462 1.00 55.91  ? 349  ARG A NH1 1 
ATOM   2706 N NH2 . ARG A 1 349 ? 23.744  56.599 79.555 1.00 55.91  ? 349  ARG A NH2 1 
ATOM   2707 N N   . GLU A 1 350 ? 18.849  56.385 85.116 1.00 53.21  ? 350  GLU A N   1 
ATOM   2708 C CA  . GLU A 1 350 ? 17.563  55.695 85.254 1.00 53.21  ? 350  GLU A CA  1 
ATOM   2709 C C   . GLU A 1 350 ? 16.645  56.042 84.104 1.00 53.21  ? 350  GLU A C   1 
ATOM   2710 O O   . GLU A 1 350 ? 16.157  55.160 83.396 1.00 53.21  ? 350  GLU A O   1 
ATOM   2711 C CB  . GLU A 1 350 ? 16.826  56.105 86.536 1.00 101.72 ? 350  GLU A CB  1 
ATOM   2712 C CG  . GLU A 1 350 ? 17.701  56.578 87.678 1.00 101.72 ? 350  GLU A CG  1 
ATOM   2713 C CD  . GLU A 1 350 ? 18.510  55.458 88.274 1.00 101.72 ? 350  GLU A CD  1 
ATOM   2714 O OE1 . GLU A 1 350 ? 19.362  54.884 87.549 1.00 101.72 ? 350  GLU A OE1 1 
ATOM   2715 O OE2 . GLU A 1 350 ? 18.285  55.152 89.468 1.00 101.72 ? 350  GLU A OE2 1 
ATOM   2716 N N   . ASP A 1 351 ? 16.400  57.337 83.929 1.00 55.58  ? 351  ASP A N   1 
ATOM   2717 C CA  . ASP A 1 351 ? 15.503  57.790 82.872 1.00 55.58  ? 351  ASP A CA  1 
ATOM   2718 C C   . ASP A 1 351 ? 16.051  57.629 81.454 1.00 55.58  ? 351  ASP A C   1 
ATOM   2719 O O   . ASP A 1 351 ? 15.282  57.512 80.498 1.00 55.58  ? 351  ASP A O   1 
ATOM   2720 C CB  . ASP A 1 351 ? 15.062  59.231 83.148 1.00 91.32  ? 351  ASP A CB  1 
ATOM   2721 C CG  . ASP A 1 351 ? 14.238  59.350 84.456 1.00 91.32  ? 351  ASP A CG  1 
ATOM   2722 O OD1 . ASP A 1 351 ? 13.570  58.347 84.848 1.00 91.32  ? 351  ASP A OD1 1 
ATOM   2723 O OD2 . ASP A 1 351 ? 14.248  60.444 85.087 1.00 91.32  ? 351  ASP A OD2 1 
ATOM   2724 N N   . PHE A 1 352 ? 17.371  57.593 81.314 1.00 45.84  ? 352  PHE A N   1 
ATOM   2725 C CA  . PHE A 1 352 ? 17.960  57.404 80.000 1.00 45.84  ? 352  PHE A CA  1 
ATOM   2726 C C   . PHE A 1 352 ? 17.511  56.048 79.471 1.00 45.84  ? 352  PHE A C   1 
ATOM   2727 O O   . PHE A 1 352 ? 16.975  55.928 78.367 1.00 45.84  ? 352  PHE A O   1 
ATOM   2728 C CB  . PHE A 1 352 ? 19.477  57.398 80.082 1.00 33.44  ? 352  PHE A CB  1 
ATOM   2729 C CG  . PHE A 1 352 ? 20.145  57.169 78.765 1.00 33.44  ? 352  PHE A CG  1 
ATOM   2730 C CD1 . PHE A 1 352 ? 20.216  58.185 77.823 1.00 33.44  ? 352  PHE A CD1 1 
ATOM   2731 C CD2 . PHE A 1 352 ? 20.688  55.927 78.457 1.00 33.44  ? 352  PHE A CD2 1 
ATOM   2732 C CE1 . PHE A 1 352 ? 20.816  57.971 76.591 1.00 33.44  ? 352  PHE A CE1 1 
ATOM   2733 C CE2 . PHE A 1 352 ? 21.294  55.695 77.224 1.00 33.44  ? 352  PHE A CE2 1 
ATOM   2734 C CZ  . PHE A 1 352 ? 21.358  56.724 76.287 1.00 33.44  ? 352  PHE A CZ  1 
ATOM   2735 N N   . MET A 1 353 ? 17.737  55.023 80.279 1.00 53.61  ? 353  MET A N   1 
ATOM   2736 C CA  . MET A 1 353 ? 17.377  53.673 79.898 1.00 53.61  ? 353  MET A CA  1 
ATOM   2737 C C   . MET A 1 353 ? 15.876  53.473 79.761 1.00 53.61  ? 353  MET A C   1 
ATOM   2738 O O   . MET A 1 353 ? 15.440  52.652 78.953 1.00 53.61  ? 353  MET A O   1 
ATOM   2739 C CB  . MET A 1 353 ? 17.977  52.687 80.891 1.00 79.82  ? 353  MET A CB  1 
ATOM   2740 C CG  . MET A 1 353 ? 19.504  52.678 80.858 1.00 79.82  ? 353  MET A CG  1 
ATOM   2741 S SD  . MET A 1 353 ? 20.150  51.450 82.014 1.00 79.82  ? 353  MET A SD  1 
ATOM   2742 C CE  . MET A 1 353 ? 19.785  52.276 83.661 1.00 79.82  ? 353  MET A CE  1 
ATOM   2743 N N   . SER A 1 354 ? 15.079  54.205 80.538 1.00 49.13  ? 354  SER A N   1 
ATOM   2744 C CA  . SER A 1 354 ? 13.628  54.086 80.397 1.00 49.13  ? 354  SER A CA  1 
ATOM   2745 C C   . SER A 1 354 ? 13.296  54.651 79.010 1.00 49.13  ? 354  SER A C   1 
ATOM   2746 O O   . SER A 1 354 ? 12.425  54.133 78.302 1.00 49.13  ? 354  SER A O   1 
ATOM   2747 C CB  . SER A 1 354 ? 12.895  54.920 81.442 1.00 62.02  ? 354  SER A CB  1 
ATOM   2748 O OG  . SER A 1 354 ? 13.313  54.596 82.749 1.00 62.02  ? 354  SER A OG  1 
ATOM   2749 N N   . GLY A 1 355 ? 14.008  55.719 78.641 1.00 36.12  ? 355  GLY A N   1 
ATOM   2750 C CA  . GLY A 1 355 ? 13.804  56.360 77.357 1.00 36.12  ? 355  GLY A CA  1 
ATOM   2751 C C   . GLY A 1 355 ? 14.150  55.457 76.195 1.00 36.12  ? 355  GLY A C   1 
ATOM   2752 O O   . GLY A 1 355 ? 13.457  55.442 75.175 1.00 36.12  ? 355  GLY A O   1 
ATOM   2753 N N   . VAL A 1 356 ? 15.224  54.692 76.344 1.00 41.76  ? 356  VAL A N   1 
ATOM   2754 C CA  . VAL A 1 356 ? 15.642  53.787 75.285 1.00 41.76  ? 356  VAL A CA  1 
ATOM   2755 C C   . VAL A 1 356 ? 14.589  52.698 75.078 1.00 41.76  ? 356  VAL A C   1 
ATOM   2756 O O   . VAL A 1 356 ? 14.308  52.294 73.950 1.00 41.76  ? 356  VAL A O   1 
ATOM   2757 C CB  . VAL A 1 356 ? 16.997  53.152 75.616 1.00 30.78  ? 356  VAL A CB  1 
ATOM   2758 C CG1 . VAL A 1 356 ? 17.393  52.185 74.532 1.00 30.78  ? 356  VAL A CG1 1 
ATOM   2759 C CG2 . VAL A 1 356 ? 18.044  54.241 75.760 1.00 30.78  ? 356  VAL A CG2 1 
ATOM   2760 N N   . LYS A 1 357 ? 14.001  52.238 76.175 1.00 46.73  ? 357  LYS A N   1 
ATOM   2761 C CA  . LYS A 1 357 ? 12.973  51.209 76.125 1.00 46.73  ? 357  LYS A CA  1 
ATOM   2762 C C   . LYS A 1 357 ? 11.771  51.761 75.363 1.00 46.73  ? 357  LYS A C   1 
ATOM   2763 O O   . LYS A 1 357 ? 11.147  51.052 74.582 1.00 46.73  ? 357  LYS A O   1 
ATOM   2764 C CB  . LYS A 1 357 ? 12.572  50.805 77.556 1.00 62.76  ? 357  LYS A CB  1 
ATOM   2765 C CG  . LYS A 1 357 ? 11.574  49.645 77.667 1.00 62.76  ? 357  LYS A CG  1 
ATOM   2766 C CD  . LYS A 1 357 ? 12.140  48.339 77.130 1.00 62.76  ? 357  LYS A CD  1 
ATOM   2767 C CE  . LYS A 1 357 ? 11.055  47.285 76.960 1.00 62.76  ? 357  LYS A CE  1 
ATOM   2768 N NZ  . LYS A 1 357 ? 11.553  46.103 76.166 1.00 62.76  ? 357  LYS A NZ  1 
ATOM   2769 N N   . LEU A 1 358 ? 11.464  53.035 75.586 1.00 35.74  ? 358  LEU A N   1 
ATOM   2770 C CA  . LEU A 1 358 ? 10.349  53.712 74.931 1.00 35.74  ? 358  LEU A CA  1 
ATOM   2771 C C   . LEU A 1 358 ? 10.609  54.052 73.453 1.00 35.74  ? 358  LEU A C   1 
ATOM   2772 O O   . LEU A 1 358 ? 9.678   54.121 72.658 1.00 35.74  ? 358  LEU A O   1 
ATOM   2773 C CB  . LEU A 1 358 ? 10.036  55.001 75.689 1.00 26.99  ? 358  LEU A CB  1 
ATOM   2774 C CG  . LEU A 1 358 ? 8.817   55.158 76.604 1.00 26.99  ? 358  LEU A CG  1 
ATOM   2775 C CD1 . LEU A 1 358 ? 8.477   53.886 77.323 1.00 26.99  ? 358  LEU A CD1 1 
ATOM   2776 C CD2 . LEU A 1 358 ? 9.118   56.259 77.593 1.00 26.99  ? 358  LEU A CD2 1 
ATOM   2777 N N   . SER A 1 359 ? 11.872  54.262 73.085 1.00 45.10  ? 359  SER A N   1 
ATOM   2778 C CA  . SER A 1 359 ? 12.235  54.624 71.712 1.00 45.10  ? 359  SER A CA  1 
ATOM   2779 C C   . SER A 1 359 ? 12.388  53.460 70.757 1.00 45.10  ? 359  SER A C   1 
ATOM   2780 O O   . SER A 1 359 ? 12.116  53.587 69.566 1.00 45.10  ? 359  SER A O   1 
ATOM   2781 C CB  . SER A 1 359 ? 13.533  55.421 71.707 1.00 43.99  ? 359  SER A CB  1 
ATOM   2782 O OG  . SER A 1 359 ? 13.455  56.501 72.618 1.00 43.99  ? 359  SER A OG  1 
ATOM   2783 N N   . VAL A 1 360 ? 12.854  52.332 71.266 1.00 39.61  ? 360  VAL A N   1 
ATOM   2784 C CA  . VAL A 1 360 ? 13.020  51.160 70.428 1.00 39.61  ? 360  VAL A CA  1 
ATOM   2785 C C   . VAL A 1 360 ? 12.155  50.097 71.069 1.00 39.61  ? 360  VAL A C   1 
ATOM   2786 O O   . VAL A 1 360 ? 12.656  49.125 71.628 1.00 39.61  ? 360  VAL A O   1 
ATOM   2787 C CB  . VAL A 1 360 ? 14.472  50.691 70.414 1.00 38.12  ? 360  VAL A CB  1 
ATOM   2788 C CG1 . VAL A 1 360 ? 14.635  49.560 69.415 1.00 38.12  ? 360  VAL A CG1 1 
ATOM   2789 C CG2 . VAL A 1 360 ? 15.388  51.866 70.084 1.00 38.12  ? 360  VAL A CG2 1 
ATOM   2790 N N   . PRO A 1 361 ? 10.830  50.270 70.978 1.00 48.17  ? 361  PRO A N   1 
ATOM   2791 C CA  . PRO A 1 361 ? 9.802   49.387 71.530 1.00 48.17  ? 361  PRO A CA  1 
ATOM   2792 C C   . PRO A 1 361 ? 9.824   47.923 71.104 1.00 48.17  ? 361  PRO A C   1 
ATOM   2793 O O   . PRO A 1 361 ? 9.437   47.037 71.876 1.00 48.17  ? 361  PRO A O   1 
ATOM   2794 C CB  . PRO A 1 361 ? 8.519   50.087 71.120 1.00 42.78  ? 361  PRO A CB  1 
ATOM   2795 C CG  . PRO A 1 361 ? 8.884   50.679 69.793 1.00 42.78  ? 361  PRO A CG  1 
ATOM   2796 C CD  . PRO A 1 361 ? 10.227  51.272 70.078 1.00 42.78  ? 361  PRO A CD  1 
ATOM   2797 N N   . HIS A 1 362 ? 10.284  47.662 69.888 1.00 66.99  ? 362  HIS A N   1 
ATOM   2798 C CA  . HIS A 1 362 ? 10.309  46.299 69.365 1.00 66.99  ? 362  HIS A CA  1 
ATOM   2799 C C   . HIS A 1 362 ? 11.603  45.530 69.623 1.00 66.99  ? 362  HIS A C   1 
ATOM   2800 O O   . HIS A 1 362 ? 11.784  44.427 69.099 1.00 66.99  ? 362  HIS A O   1 
ATOM   2801 C CB  . HIS A 1 362 ? 10.056  46.335 67.856 1.00 70.08  ? 362  HIS A CB  1 
ATOM   2802 C CG  . HIS A 1 362 ? 11.040  47.176 67.102 1.00 70.08  ? 362  HIS A CG  1 
ATOM   2803 N ND1 . HIS A 1 362 ? 11.146  48.541 67.284 1.00 70.08  ? 362  HIS A ND1 1 
ATOM   2804 C CD2 . HIS A 1 362 ? 11.962  46.848 66.164 1.00 70.08  ? 362  HIS A CD2 1 
ATOM   2805 C CE1 . HIS A 1 362 ? 12.090  49.017 66.487 1.00 70.08  ? 362  HIS A CE1 1 
ATOM   2806 N NE2 . HIS A 1 362 ? 12.601  48.010 65.796 1.00 70.08  ? 362  HIS A NE2 1 
ATOM   2807 N N   . ALA A 1 363 ? 12.497  46.093 70.428 1.00 52.00  ? 363  ALA A N   1 
ATOM   2808 C CA  . ALA A 1 363 ? 13.776  45.445 70.679 1.00 52.00  ? 363  ALA A CA  1 
ATOM   2809 C C   . ALA A 1 363 ? 13.830  44.605 71.945 1.00 52.00  ? 363  ALA A C   1 
ATOM   2810 O O   . ALA A 1 363 ? 13.285  44.993 72.978 1.00 52.00  ? 363  ALA A O   1 
ATOM   2811 C CB  . ALA A 1 363 ? 14.881  46.499 70.714 1.00 44.60  ? 363  ALA A CB  1 
ATOM   2812 N N   . ASN A 1 364 ? 14.496  43.453 71.858 1.00 51.73  ? 364  ASN A N   1 
ATOM   2813 C CA  . ASN A 1 364 ? 14.653  42.582 73.018 1.00 51.73  ? 364  ASN A CA  1 
ATOM   2814 C C   . ASN A 1 364 ? 15.727  43.201 73.910 1.00 51.73  ? 364  ASN A C   1 
ATOM   2815 O O   . ASN A 1 364 ? 16.343  44.206 73.538 1.00 51.73  ? 364  ASN A O   1 
ATOM   2816 C CB  . ASN A 1 364 ? 15.072  41.164 72.605 1.00 52.17  ? 364  ASN A CB  1 
ATOM   2817 C CG  . ASN A 1 364 ? 16.293  41.145 71.704 1.00 52.17  ? 364  ASN A CG  1 
ATOM   2818 O OD1 . ASN A 1 364 ? 17.114  42.065 71.725 1.00 52.17  ? 364  ASN A OD1 1 
ATOM   2819 N ND2 . ASN A 1 364 ? 16.427  40.082 70.915 1.00 52.17  ? 364  ASN A ND2 1 
ATOM   2820 N N   . ASP A 1 365 ? 15.960  42.608 75.076 1.00 56.58  ? 365  ASP A N   1 
ATOM   2821 C CA  . ASP A 1 365 ? 16.945  43.146 76.001 1.00 56.58  ? 365  ASP A CA  1 
ATOM   2822 C C   . ASP A 1 365 ? 18.353  43.252 75.406 1.00 56.58  ? 365  ASP A C   1 
ATOM   2823 O O   . ASP A 1 365 ? 19.110  44.175 75.730 1.00 56.58  ? 365  ASP A O   1 
ATOM   2824 C CB  . ASP A 1 365 ? 16.936  42.327 77.297 1.00 94.95  ? 365  ASP A CB  1 
ATOM   2825 C CG  . ASP A 1 365 ? 15.755  42.711 78.228 1.00 94.95  ? 365  ASP A CG  1 
ATOM   2826 O OD1 . ASP A 1 365 ? 14.877  43.502 77.789 1.00 94.95  ? 365  ASP A OD1 1 
ATOM   2827 O OD2 . ASP A 1 365 ? 15.699  42.229 79.398 1.00 94.95  ? 365  ASP A OD2 1 
ATOM   2828 N N   . LEU A 1 366 ? 18.708  42.330 74.523 1.00 43.83  ? 366  LEU A N   1 
ATOM   2829 C CA  . LEU A 1 366 ? 20.019  42.395 73.909 1.00 43.83  ? 366  LEU A CA  1 
ATOM   2830 C C   . LEU A 1 366 ? 20.093  43.652 73.037 1.00 43.83  ? 366  LEU A C   1 
ATOM   2831 O O   . LEU A 1 366 ? 21.114  44.338 73.008 1.00 43.83  ? 366  LEU A O   1 
ATOM   2832 C CB  . LEU A 1 366 ? 20.266  41.148 73.064 1.00 48.76  ? 366  LEU A CB  1 
ATOM   2833 C CG  . LEU A 1 366 ? 21.557  41.169 72.246 1.00 48.76  ? 366  LEU A CG  1 
ATOM   2834 C CD1 . LEU A 1 366 ? 22.762  41.380 73.167 1.00 48.76  ? 366  LEU A CD1 1 
ATOM   2835 C CD2 . LEU A 1 366 ? 21.677  39.875 71.467 1.00 48.76  ? 366  LEU A CD2 1 
ATOM   2836 N N   . GLY A 1 367 ? 19.007  43.953 72.328 1.00 34.10  ? 367  GLY A N   1 
ATOM   2837 C CA  . GLY A 1 367 ? 18.978  45.127 71.467 1.00 34.10  ? 367  GLY A CA  1 
ATOM   2838 C C   . GLY A 1 367 ? 19.031  46.425 72.246 1.00 34.10  ? 367  GLY A C   1 
ATOM   2839 O O   . GLY A 1 367 ? 19.733  47.357 71.871 1.00 34.10  ? 367  GLY A O   1 
ATOM   2840 N N   . LEU A 1 368 ? 18.275  46.490 73.335 1.00 38.53  ? 368  LEU A N   1 
ATOM   2841 C CA  . LEU A 1 368 ? 18.268  47.676 74.169 1.00 38.53  ? 368  LEU A CA  1 
ATOM   2842 C C   . LEU A 1 368 ? 19.686  47.912 74.647 1.00 38.53  ? 368  LEU A C   1 
ATOM   2843 O O   . LEU A 1 368 ? 20.117  49.051 74.771 1.00 38.53  ? 368  LEU A O   1 
ATOM   2844 C CB  . LEU A 1 368 ? 17.337  47.484 75.361 1.00 36.61  ? 368  LEU A CB  1 
ATOM   2845 C CG  . LEU A 1 368 ? 15.862  47.381 74.979 1.00 36.61  ? 368  LEU A CG  1 
ATOM   2846 C CD1 . LEU A 1 368 ? 15.049  46.950 76.177 1.00 36.61  ? 368  LEU A CD1 1 
ATOM   2847 C CD2 . LEU A 1 368 ? 15.384  48.721 74.442 1.00 36.61  ? 368  LEU A CD2 1 
ATOM   2848 N N   . ASP A 1 369 ? 20.413  46.832 74.919 1.00 42.65  ? 369  ASP A N   1 
ATOM   2849 C CA  . ASP A 1 369 ? 21.797  46.958 75.358 1.00 42.65  ? 369  ASP A CA  1 
ATOM   2850 C C   . ASP A 1 369 ? 22.669  47.507 74.226 1.00 42.65  ? 369  ASP A C   1 
ATOM   2851 O O   . ASP A 1 369 ? 23.518  48.365 74.460 1.00 42.65  ? 369  ASP A O   1 
ATOM   2852 C CB  . ASP A 1 369 ? 22.348  45.608 75.843 1.00 89.96  ? 369  ASP A CB  1 
ATOM   2853 C CG  . ASP A 1 369 ? 21.837  45.225 77.243 1.00 89.96  ? 369  ASP A CG  1 
ATOM   2854 O OD1 . ASP A 1 369 ? 21.089  46.038 77.854 1.00 89.96  ? 369  ASP A OD1 1 
ATOM   2855 O OD2 . ASP A 1 369 ? 22.185  44.116 77.740 1.00 89.96  ? 369  ASP A OD2 1 
ATOM   2856 N N   . ALA A 1 370 ? 22.462  47.028 73.003 1.00 39.60  ? 370  ALA A N   1 
ATOM   2857 C CA  . ALA A 1 370 ? 23.252  47.519 71.883 1.00 39.60  ? 370  ALA A CA  1 
ATOM   2858 C C   . ALA A 1 370 ? 23.057  49.027 71.710 1.00 39.60  ? 370  ALA A C   1 
ATOM   2859 O O   . ALA A 1 370 ? 24.033  49.765 71.581 1.00 39.60  ? 370  ALA A O   1 
ATOM   2860 C CB  . ALA A 1 370 ? 22.876  46.794 70.608 1.00 25.01  ? 370  ALA A CB  1 
ATOM   2861 N N   . VAL A 1 371 ? 21.806  49.485 71.722 1.00 31.18  ? 371  VAL A N   1 
ATOM   2862 C CA  . VAL A 1 371 ? 21.504  50.909 71.565 1.00 31.18  ? 371  VAL A CA  1 
ATOM   2863 C C   . VAL A 1 371 ? 22.162  51.760 72.654 1.00 31.18  ? 371  VAL A C   1 
ATOM   2864 O O   . VAL A 1 371 ? 22.791  52.785 72.364 1.00 31.18  ? 371  VAL A O   1 
ATOM   2865 C CB  . VAL A 1 371 ? 19.976  51.162 71.592 1.00 36.50  ? 371  VAL A CB  1 
ATOM   2866 C CG1 . VAL A 1 371 ? 19.688  52.653 71.531 1.00 36.50  ? 371  VAL A CG1 1 
ATOM   2867 C CG2 . VAL A 1 371 ? 19.306  50.448 70.421 1.00 36.50  ? 371  VAL A CG2 1 
ATOM   2868 N N   . THR A 1 372 ? 22.009  51.324 73.902 1.00 34.75  ? 372  THR A N   1 
ATOM   2869 C CA  . THR A 1 372 ? 22.571  52.017 75.061 1.00 34.75  ? 372  THR A CA  1 
ATOM   2870 C C   . THR A 1 372 ? 24.084  52.162 74.963 1.00 34.75  ? 372  THR A C   1 
ATOM   2871 O O   . THR A 1 372 ? 24.644  53.216 75.258 1.00 34.75  ? 372  THR A O   1 
ATOM   2872 C CB  . THR A 1 372 ? 22.228  51.273 76.365 1.00 45.38  ? 372  THR A CB  1 
ATOM   2873 O OG1 . THR A 1 372 ? 20.810  51.315 76.583 1.00 45.38  ? 372  THR A OG1 1 
ATOM   2874 C CG2 . THR A 1 372 ? 22.939  51.912 77.543 1.00 45.38  ? 372  THR A CG2 1 
ATOM   2875 N N   . LEU A 1 373 ? 24.740  51.088 74.549 1.00 45.76  ? 373  LEU A N   1 
ATOM   2876 C CA  . LEU A 1 373 ? 26.183  51.088 74.386 1.00 45.76  ? 373  LEU A CA  1 
ATOM   2877 C C   . LEU A 1 373 ? 26.601  52.057 73.285 1.00 45.76  ? 373  LEU A C   1 
ATOM   2878 O O   . LEU A 1 373 ? 27.579  52.784 73.430 1.00 45.76  ? 373  LEU A O   1 
ATOM   2879 C CB  . LEU A 1 373 ? 26.672  49.682 74.034 1.00 48.34  ? 373  LEU A CB  1 
ATOM   2880 C CG  . LEU A 1 373 ? 28.150  49.562 73.651 1.00 48.34  ? 373  LEU A CG  1 
ATOM   2881 C CD1 . LEU A 1 373 ? 29.027  50.100 74.781 1.00 48.34  ? 373  LEU A CD1 1 
ATOM   2882 C CD2 . LEU A 1 373 ? 28.486  48.115 73.364 1.00 48.34  ? 373  LEU A CD2 1 
ATOM   2883 N N   . GLN A 1 374 ? 25.850  52.070 72.189 1.00 39.18  ? 374  GLN A N   1 
ATOM   2884 C CA  . GLN A 1 374 ? 26.146  52.928 71.046 1.00 39.18  ? 374  GLN A CA  1 
ATOM   2885 C C   . GLN A 1 374 ? 25.970  54.420 71.294 1.00 39.18  ? 374  GLN A C   1 
ATOM   2886 O O   . GLN A 1 374 ? 26.529  55.229 70.570 1.00 39.18  ? 374  GLN A O   1 
ATOM   2887 C CB  . GLN A 1 374 ? 25.260  52.529 69.866 1.00 45.09  ? 374  GLN A CB  1 
ATOM   2888 C CG  . GLN A 1 374 ? 25.767  52.989 68.528 1.00 45.09  ? 374  GLN A CG  1 
ATOM   2889 C CD  . GLN A 1 374 ? 27.011  52.220 68.092 1.00 45.09  ? 374  GLN A CD  1 
ATOM   2890 O OE1 . GLN A 1 374 ? 27.480  52.373 66.959 1.00 45.09  ? 374  GLN A OE1 1 
ATOM   2891 N NE2 . GLN A 1 374 ? 27.550  51.388 68.990 1.00 45.09  ? 374  GLN A NE2 1 
ATOM   2892 N N   . TYR A 1 375 ? 25.192  54.778 72.314 1.00 42.46  ? 375  TYR A N   1 
ATOM   2893 C CA  . TYR A 1 375 ? 24.906  56.181 72.629 1.00 42.46  ? 375  TYR A CA  1 
ATOM   2894 C C   . TYR A 1 375 ? 25.315  56.658 74.026 1.00 42.46  ? 375  TYR A C   1 
ATOM   2895 O O   . TYR A 1 375 ? 24.802  57.661 74.524 1.00 42.46  ? 375  TYR A O   1 
ATOM   2896 C CB  . TYR A 1 375 ? 23.408  56.438 72.430 1.00 29.03  ? 375  TYR A CB  1 
ATOM   2897 C CG  . TYR A 1 375 ? 22.997  56.557 70.984 1.00 29.03  ? 375  TYR A CG  1 
ATOM   2898 C CD1 . TYR A 1 375 ? 23.070  57.783 70.316 1.00 29.03  ? 375  TYR A CD1 1 
ATOM   2899 C CD2 . TYR A 1 375 ? 22.540  55.447 70.275 1.00 29.03  ? 375  TYR A CD2 1 
ATOM   2900 C CE1 . TYR A 1 375 ? 22.693  57.900 68.980 1.00 29.03  ? 375  TYR A CE1 1 
ATOM   2901 C CE2 . TYR A 1 375 ? 22.166  55.555 68.945 1.00 29.03  ? 375  TYR A CE2 1 
ATOM   2902 C CZ  . TYR A 1 375 ? 22.244  56.783 68.310 1.00 29.03  ? 375  TYR A CZ  1 
ATOM   2903 O OH  . TYR A 1 375 ? 21.865  56.890 67.005 1.00 29.03  ? 375  TYR A OH  1 
ATOM   2904 N N   . THR A 1 376 ? 26.238  55.950 74.657 1.00 43.95  ? 376  THR A N   1 
ATOM   2905 C CA  . THR A 1 376 ? 26.689  56.324 75.988 1.00 43.95  ? 376  THR A CA  1 
ATOM   2906 C C   . THR A 1 376 ? 28.178  56.620 75.996 1.00 43.95  ? 376  THR A C   1 
ATOM   2907 O O   . THR A 1 376 ? 28.957  55.909 75.377 1.00 43.95  ? 376  THR A O   1 
ATOM   2908 C CB  . THR A 1 376 ? 26.437  55.191 76.992 1.00 35.82  ? 376  THR A CB  1 
ATOM   2909 O OG1 . THR A 1 376 ? 25.034  54.941 77.097 1.00 35.82  ? 376  THR A OG1 1 
ATOM   2910 C CG2 . THR A 1 376 ? 26.970  55.557 78.339 1.00 35.82  ? 376  THR A CG2 1 
ATOM   2911 N N   . ASP A 1 377 ? 28.573  57.680 76.686 1.00 46.62  ? 377  ASP A N   1 
ATOM   2912 C CA  . ASP A 1 377 ? 29.985  58.028 76.810 1.00 46.62  ? 377  ASP A CA  1 
ATOM   2913 C C   . ASP A 1 377 ? 30.367  57.533 78.201 1.00 46.62  ? 377  ASP A C   1 
ATOM   2914 O O   . ASP A 1 377 ? 30.133  58.234 79.191 1.00 46.62  ? 377  ASP A O   1 
ATOM   2915 C CB  . ASP A 1 377 ? 30.177  59.541 76.742 1.00 69.53  ? 377  ASP A CB  1 
ATOM   2916 C CG  . ASP A 1 377 ? 31.612  59.959 77.029 1.00 69.53  ? 377  ASP A CG  1 
ATOM   2917 O OD1 . ASP A 1 377 ? 32.454  59.074 77.339 1.00 69.53  ? 377  ASP A OD1 1 
ATOM   2918 O OD2 . ASP A 1 377 ? 31.897  61.177 76.949 1.00 69.53  ? 377  ASP A OD2 1 
ATOM   2919 N N   . TRP A 1 378 ? 30.947  56.335 78.279 1.00 47.79  ? 378  TRP A N   1 
ATOM   2920 C CA  . TRP A 1 378 ? 31.303  55.769 79.573 1.00 47.79  ? 378  TRP A CA  1 
ATOM   2921 C C   . TRP A 1 378 ? 32.379  56.507 80.361 1.00 47.79  ? 378  TRP A C   1 
ATOM   2922 O O   . TRP A 1 378 ? 32.694  56.127 81.491 1.00 47.79  ? 378  TRP A O   1 
ATOM   2923 C CB  . TRP A 1 378 ? 31.660  54.290 79.432 1.00 52.41  ? 378  TRP A CB  1 
ATOM   2924 C CG  . TRP A 1 378 ? 30.492  53.465 78.925 1.00 52.41  ? 378  TRP A CG  1 
ATOM   2925 C CD1 . TRP A 1 378 ? 30.300  53.011 77.648 1.00 52.41  ? 378  TRP A CD1 1 
ATOM   2926 C CD2 . TRP A 1 378 ? 29.327  53.068 79.668 1.00 52.41  ? 378  TRP A CD2 1 
ATOM   2927 N NE1 . TRP A 1 378 ? 29.089  52.363 77.550 1.00 52.41  ? 378  TRP A NE1 1 
ATOM   2928 C CE2 . TRP A 1 378 ? 28.474  52.384 78.774 1.00 52.41  ? 378  TRP A CE2 1 
ATOM   2929 C CE3 . TRP A 1 378 ? 28.923  53.229 81.001 1.00 52.41  ? 378  TRP A CE3 1 
ATOM   2930 C CZ2 . TRP A 1 378 ? 27.243  51.861 79.165 1.00 52.41  ? 378  TRP A CZ2 1 
ATOM   2931 C CZ3 . TRP A 1 378 ? 27.697  52.709 81.394 1.00 52.41  ? 378  TRP A CZ3 1 
ATOM   2932 C CH2 . TRP A 1 378 ? 26.871  52.033 80.475 1.00 52.41  ? 378  TRP A CH2 1 
ATOM   2933 N N   . MET A 1 379 ? 32.945  57.562 79.789 1.00 54.36  ? 379  MET A N   1 
ATOM   2934 C CA  . MET A 1 379 ? 33.929  58.336 80.534 1.00 54.36  ? 379  MET A CA  1 
ATOM   2935 C C   . MET A 1 379 ? 33.169  59.419 81.289 1.00 54.36  ? 379  MET A C   1 
ATOM   2936 O O   . MET A 1 379 ? 33.763  60.157 82.079 1.00 54.36  ? 379  MET A O   1 
ATOM   2937 C CB  . MET A 1 379 ? 34.922  59.037 79.614 1.00 66.94  ? 379  MET A CB  1 
ATOM   2938 C CG  . MET A 1 379 ? 35.924  58.150 78.909 1.00 66.94  ? 379  MET A CG  1 
ATOM   2939 S SD  . MET A 1 379 ? 37.187  59.203 78.092 1.00 66.94  ? 379  MET A SD  1 
ATOM   2940 C CE  . MET A 1 379 ? 36.298  59.734 76.540 1.00 66.94  ? 379  MET A CE  1 
ATOM   2941 N N   . ASP A 1 380 ? 31.859  59.512 81.047 1.00 60.72  ? 380  ASP A N   1 
ATOM   2942 C CA  . ASP A 1 380 ? 31.022  60.544 81.671 1.00 60.72  ? 380  ASP A CA  1 
ATOM   2943 C C   . ASP A 1 380 ? 29.532  60.119 81.663 1.00 60.72  ? 380  ASP A C   1 
ATOM   2944 O O   . ASP A 1 380 ? 28.629  60.909 81.336 1.00 60.72  ? 380  ASP A O   1 
ATOM   2945 C CB  . ASP A 1 380 ? 31.241  61.848 80.884 1.00 63.92  ? 380  ASP A CB  1 
ATOM   2946 C CG  . ASP A 1 380 ? 30.722  63.078 81.604 1.00 63.92  ? 380  ASP A CG  1 
ATOM   2947 O OD1 . ASP A 1 380 ? 30.721  63.097 82.864 1.00 63.92  ? 380  ASP A OD1 1 
ATOM   2948 O OD2 . ASP A 1 380 ? 30.339  64.040 80.893 1.00 63.92  ? 380  ASP A OD2 1 
ATOM   2949 N N   . ASP A 1 381 ? 29.296  58.866 82.053 1.00 58.51  ? 381  ASP A N   1 
ATOM   2950 C CA  . ASP A 1 381 ? 27.959  58.266 82.062 1.00 58.51  ? 381  ASP A CA  1 
ATOM   2951 C C   . ASP A 1 381 ? 26.849  58.921 82.905 1.00 58.51  ? 381  ASP A C   1 
ATOM   2952 O O   . ASP A 1 381 ? 25.655  58.688 82.657 1.00 58.51  ? 381  ASP A O   1 
ATOM   2953 C CB  . ASP A 1 381 ? 28.080  56.783 82.434 1.00 71.17  ? 381  ASP A CB  1 
ATOM   2954 C CG  . ASP A 1 381 ? 28.584  56.568 83.855 1.00 71.17  ? 381  ASP A CG  1 
ATOM   2955 O OD1 . ASP A 1 381 ? 29.699  57.052 84.204 1.00 71.17  ? 381  ASP A OD1 1 
ATOM   2956 O OD2 . ASP A 1 381 ? 27.852  55.899 84.627 1.00 71.17  ? 381  ASP A OD2 1 
ATOM   2957 N N   . ASN A 1 382 ? 27.211  59.727 83.897 1.00 70.99  ? 382  ASN A N   1 
ATOM   2958 C CA  . ASN A 1 382 ? 26.179  60.372 84.714 1.00 70.99  ? 382  ASN A CA  1 
ATOM   2959 C C   . ASN A 1 382 ? 26.010  61.858 84.434 1.00 70.99  ? 382  ASN A C   1 
ATOM   2960 O O   . ASN A 1 382 ? 25.431  62.600 85.231 1.00 70.99  ? 382  ASN A O   1 
ATOM   2961 C CB  . ASN A 1 382 ? 26.450  60.134 86.194 1.00 69.10  ? 382  ASN A CB  1 
ATOM   2962 C CG  . ASN A 1 382 ? 26.147  58.715 86.589 1.00 69.10  ? 382  ASN A CG  1 
ATOM   2963 O OD1 . ASN A 1 382 ? 25.019  58.241 86.405 1.00 69.10  ? 382  ASN A OD1 1 
ATOM   2964 N ND2 . ASN A 1 382 ? 27.154  58.009 87.113 1.00 69.10  ? 382  ASN A ND2 1 
ATOM   2965 N N   . ASN A 1 383 ? 26.522  62.273 83.283 1.00 49.09  ? 383  ASN A N   1 
ATOM   2966 C CA  . ASN A 1 383 ? 26.418  63.643 82.842 1.00 49.09  ? 383  ASN A CA  1 
ATOM   2967 C C   . ASN A 1 383 ? 24.997  63.782 82.291 1.00 49.09  ? 383  ASN A C   1 
ATOM   2968 O O   . ASN A 1 383 ? 24.678  63.267 81.217 1.00 49.09  ? 383  ASN A O   1 
ATOM   2969 C CB  . ASN A 1 383 ? 27.461  63.890 81.757 1.00 46.50  ? 383  ASN A CB  1 
ATOM   2970 C CG  . ASN A 1 383 ? 27.389  65.276 81.183 1.00 46.50  ? 383  ASN A CG  1 
ATOM   2971 O OD1 . ASN A 1 383 ? 28.337  65.742 80.557 1.00 46.50  ? 383  ASN A OD1 1 
ATOM   2972 N ND2 . ASN A 1 383 ? 26.256  65.942 81.373 1.00 46.50  ? 383  ASN A ND2 1 
ATOM   2973 N N   . GLY A 1 384 ? 24.149  64.467 83.051 1.00 46.15  ? 384  GLY A N   1 
ATOM   2974 C CA  . GLY A 1 384 ? 22.768  64.661 82.657 1.00 46.15  ? 384  GLY A CA  1 
ATOM   2975 C C   . GLY A 1 384 ? 22.551  65.326 81.314 1.00 46.15  ? 384  GLY A C   1 
ATOM   2976 O O   . GLY A 1 384 ? 21.542  65.056 80.669 1.00 46.15  ? 384  GLY A O   1 
ATOM   2977 N N   . ILE A 1 385 ? 23.461  66.196 80.883 1.00 33.78  ? 385  ILE A N   1 
ATOM   2978 C CA  . ILE A 1 385 ? 23.281  66.843 79.591 1.00 33.78  ? 385  ILE A CA  1 
ATOM   2979 C C   . ILE A 1 385 ? 23.663  65.905 78.459 1.00 33.78  ? 385  ILE A C   1 
ATOM   2980 O O   . ILE A 1 385 ? 23.131  66.007 77.360 1.00 33.78  ? 385  ILE A O   1 
ATOM   2981 C CB  . ILE A 1 385 ? 24.095  68.156 79.478 1.00 36.35  ? 385  ILE A CB  1 
ATOM   2982 C CG1 . ILE A 1 385 ? 23.432  69.237 80.327 1.00 36.35  ? 385  ILE A CG1 1 
ATOM   2983 C CG2 . ILE A 1 385 ? 24.149  68.637 78.040 1.00 36.35  ? 385  ILE A CG2 1 
ATOM   2984 C CD1 . ILE A 1 385 ? 24.041  70.594 80.136 1.00 36.35  ? 385  ILE A CD1 1 
ATOM   2985 N N   . LYS A 1 386 ? 24.585  64.985 78.713 1.00 47.20  ? 386  LYS A N   1 
ATOM   2986 C CA  . LYS A 1 386 ? 24.972  64.044 77.667 1.00 47.20  ? 386  LYS A CA  1 
ATOM   2987 C C   . LYS A 1 386 ? 23.918  62.952 77.486 1.00 47.20  ? 386  LYS A C   1 
ATOM   2988 O O   . LYS A 1 386 ? 23.681  62.493 76.364 1.00 47.20  ? 386  LYS A O   1 
ATOM   2989 C CB  . LYS A 1 386 ? 26.340  63.442 77.967 1.00 50.19  ? 386  LYS A CB  1 
ATOM   2990 C CG  . LYS A 1 386 ? 27.462  64.350 77.537 1.00 50.19  ? 386  LYS A CG  1 
ATOM   2991 C CD  . LYS A 1 386 ? 28.818  63.763 77.867 1.00 50.19  ? 386  LYS A CD  1 
ATOM   2992 C CE  . LYS A 1 386 ? 29.938  64.618 77.291 1.00 50.19  ? 386  LYS A CE  1 
ATOM   2993 N NZ  . LYS A 1 386 ? 31.270  64.115 77.728 1.00 50.19  ? 386  LYS A NZ  1 
ATOM   2994 N N   . ASN A 1 387 ? 23.281  62.543 78.581 1.00 38.15  ? 387  ASN A N   1 
ATOM   2995 C CA  . ASN A 1 387 ? 22.236  61.539 78.489 1.00 38.15  ? 387  ASN A CA  1 
ATOM   2996 C C   . ASN A 1 387 ? 20.997  62.145 77.811 1.00 38.15  ? 387  ASN A C   1 
ATOM   2997 O O   . ASN A 1 387 ? 20.268  61.457 77.096 1.00 38.15  ? 387  ASN A O   1 
ATOM   2998 C CB  . ASN A 1 387 ? 21.874  61.003 79.875 1.00 47.94  ? 387  ASN A CB  1 
ATOM   2999 C CG  . ASN A 1 387 ? 23.029  60.263 80.536 1.00 47.94  ? 387  ASN A CG  1 
ATOM   3000 O OD1 . ASN A 1 387 ? 23.778  59.545 79.874 1.00 47.94  ? 387  ASN A OD1 1 
ATOM   3001 N ND2 . ASN A 1 387 ? 23.166  60.422 81.852 1.00 47.94  ? 387  ASN A ND2 1 
ATOM   3002 N N   . ARG A 1 388 ? 20.760  63.435 78.026 1.00 40.63  ? 388  ARG A N   1 
ATOM   3003 C CA  . ARG A 1 388 ? 19.616  64.094 77.404 1.00 40.63  ? 388  ARG A CA  1 
ATOM   3004 C C   . ARG A 1 388 ? 19.794  64.139 75.885 1.00 40.63  ? 388  ARG A C   1 
ATOM   3005 O O   . ARG A 1 388 ? 18.933  63.684 75.129 1.00 40.63  ? 388  ARG A O   1 
ATOM   3006 C CB  . ARG A 1 388 ? 19.460  65.517 77.932 1.00 38.30  ? 388  ARG A CB  1 
ATOM   3007 C CG  . ARG A 1 388 ? 18.293  66.259 77.330 1.00 38.30  ? 388  ARG A CG  1 
ATOM   3008 C CD  . ARG A 1 388 ? 18.744  67.571 76.735 1.00 38.30  ? 388  ARG A CD  1 
ATOM   3009 N NE  . ARG A 1 388 ? 18.934  68.588 77.758 1.00 38.30  ? 388  ARG A NE  1 
ATOM   3010 C CZ  . ARG A 1 388 ? 19.828  69.567 77.677 1.00 38.30  ? 388  ARG A CZ  1 
ATOM   3011 N NH1 . ARG A 1 388 ? 20.624  69.660 76.620 1.00 38.30  ? 388  ARG A NH1 1 
ATOM   3012 N NH2 . ARG A 1 388 ? 19.912  70.459 78.653 1.00 38.30  ? 388  ARG A NH2 1 
ATOM   3013 N N   . ASP A 1 389 ? 20.918  64.687 75.438 1.00 40.50  ? 389  ASP A N   1 
ATOM   3014 C CA  . ASP A 1 389 ? 21.183  64.774 74.016 1.00 40.50  ? 389  ASP A CA  1 
ATOM   3015 C C   . ASP A 1 389 ? 21.377  63.398 73.384 1.00 40.50  ? 389  ASP A C   1 
ATOM   3016 O O   . ASP A 1 389 ? 21.162  63.229 72.182 1.00 40.50  ? 389  ASP A O   1 
ATOM   3017 C CB  . ASP A 1 389 ? 22.405  65.650 73.762 1.00 49.16  ? 389  ASP A CB  1 
ATOM   3018 C CG  . ASP A 1 389 ? 22.223  67.073 74.279 1.00 49.16  ? 389  ASP A CG  1 
ATOM   3019 O OD1 . ASP A 1 389 ? 21.073  67.582 74.285 1.00 49.16  ? 389  ASP A OD1 1 
ATOM   3020 O OD2 . ASP A 1 389 ? 23.242  67.688 74.664 1.00 49.16  ? 389  ASP A OD2 1 
ATOM   3021 N N   . GLY A 1 390 ? 21.776  62.417 74.191 1.00 36.68  ? 390  GLY A N   1 
ATOM   3022 C CA  . GLY A 1 390 ? 21.964  61.073 73.674 1.00 36.68  ? 390  GLY A CA  1 
ATOM   3023 C C   . GLY A 1 390 ? 20.616  60.461 73.336 1.00 36.68  ? 390  GLY A C   1 
ATOM   3024 O O   . GLY A 1 390 ? 20.443  59.797 72.313 1.00 36.68  ? 390  GLY A O   1 
ATOM   3025 N N   . LEU A 1 391 ? 19.653  60.703 74.215 1.00 39.25  ? 391  LEU A N   1 
ATOM   3026 C CA  . LEU A 1 391 ? 18.299  60.203 74.057 1.00 39.25  ? 391  LEU A CA  1 
ATOM   3027 C C   . LEU A 1 391 ? 17.671  60.928 72.865 1.00 39.25  ? 391  LEU A C   1 
ATOM   3028 O O   . LEU A 1 391 ? 16.962  60.341 72.047 1.00 39.25  ? 391  LEU A O   1 
ATOM   3029 C CB  . LEU A 1 391 ? 17.521  60.491 75.341 1.00 39.22  ? 391  LEU A CB  1 
ATOM   3030 C CG  . LEU A 1 391 ? 16.445  59.509 75.798 1.00 39.22  ? 391  LEU A CG  1 
ATOM   3031 C CD1 . LEU A 1 391 ? 16.905  58.085 75.542 1.00 39.22  ? 391  LEU A CD1 1 
ATOM   3032 C CD2 . LEU A 1 391 ? 16.159  59.717 77.283 1.00 39.22  ? 391  LEU A CD2 1 
ATOM   3033 N N   . ASP A 1 392 ? 17.962  62.216 72.769 1.00 36.76  ? 392  ASP A N   1 
ATOM   3034 C CA  . ASP A 1 392 ? 17.447  63.037 71.691 1.00 36.76  ? 392  ASP A CA  1 
ATOM   3035 C C   . ASP A 1 392 ? 17.960  62.502 70.354 1.00 36.76  ? 392  ASP A C   1 
ATOM   3036 O O   . ASP A 1 392 ? 17.200  62.386 69.397 1.00 36.76  ? 392  ASP A O   1 
ATOM   3037 C CB  . ASP A 1 392 ? 17.895  64.482 71.896 1.00 67.33  ? 392  ASP A CB  1 
ATOM   3038 C CG  . ASP A 1 392 ? 17.105  65.465 71.060 1.00 67.33  ? 392  ASP A CG  1 
ATOM   3039 O OD1 . ASP A 1 392 ? 16.955  65.244 69.831 1.00 67.33  ? 392  ASP A OD1 1 
ATOM   3040 O OD2 . ASP A 1 392 ? 16.641  66.472 71.638 1.00 67.33  ? 392  ASP A OD2 1 
ATOM   3041 N N   . ASP A 1 393 ? 19.250  62.179 70.284 1.00 29.44  ? 393  ASP A N   1 
ATOM   3042 C CA  . ASP A 1 393 ? 19.828  61.640 69.052 1.00 29.44  ? 393  ASP A CA  1 
ATOM   3043 C C   . ASP A 1 393 ? 19.210  60.301 68.663 1.00 29.44  ? 393  ASP A C   1 
ATOM   3044 O O   . ASP A 1 393 ? 18.979  60.038 67.493 1.00 29.44  ? 393  ASP A O   1 
ATOM   3045 C CB  . ASP A 1 393 ? 21.336  61.445 69.195 1.00 77.17  ? 393  ASP A CB  1 
ATOM   3046 C CG  . ASP A 1 393 ? 22.121  62.714 68.927 1.00 77.17  ? 393  ASP A CG  1 
ATOM   3047 O OD1 . ASP A 1 393 ? 21.645  63.534 68.109 1.00 77.17  ? 393  ASP A OD1 1 
ATOM   3048 O OD2 . ASP A 1 393 ? 23.222  62.884 69.514 1.00 77.17  ? 393  ASP A OD2 1 
ATOM   3049 N N   . ILE A 1 394 ? 18.967  59.451 69.654 1.00 32.53  ? 394  ILE A N   1 
ATOM   3050 C CA  . ILE A 1 394 ? 18.382  58.142 69.411 1.00 32.53  ? 394  ILE A CA  1 
ATOM   3051 C C   . ILE A 1 394 ? 17.030  58.246 68.716 1.00 32.53  ? 394  ILE A C   1 
ATOM   3052 O O   . ILE A 1 394 ? 16.813  57.631 67.684 1.00 32.53  ? 394  ILE A O   1 
ATOM   3053 C CB  . ILE A 1 394 ? 18.199  57.366 70.729 1.00 27.89  ? 394  ILE A CB  1 
ATOM   3054 C CG1 . ILE A 1 394 ? 19.555  56.934 71.269 1.00 27.89  ? 394  ILE A CG1 1 
ATOM   3055 C CG2 . ILE A 1 394 ? 17.314  56.161 70.511 1.00 27.89  ? 394  ILE A CG2 1 
ATOM   3056 C CD1 . ILE A 1 394 ? 19.482  56.252 72.613 1.00 27.89  ? 394  ILE A CD1 1 
ATOM   3057 N N   . VAL A 1 395 ? 16.124  59.031 69.284 1.00 31.61  ? 395  VAL A N   1 
ATOM   3058 C CA  . VAL A 1 395 ? 14.798  59.187 68.718 1.00 31.61  ? 395  VAL A CA  1 
ATOM   3059 C C   . VAL A 1 395 ? 14.838  59.754 67.297 1.00 31.61  ? 395  VAL A C   1 
ATOM   3060 O O   . VAL A 1 395 ? 14.097  59.299 66.427 1.00 31.61  ? 395  VAL A O   1 
ATOM   3061 C CB  . VAL A 1 395 ? 13.920  60.078 69.626 1.00 25.78  ? 395  VAL A CB  1 
ATOM   3062 C CG1 . VAL A 1 395 ? 12.495  60.089 69.131 1.00 25.78  ? 395  VAL A CG1 1 
ATOM   3063 C CG2 . VAL A 1 395 ? 13.960  59.560 71.041 1.00 25.78  ? 395  VAL A CG2 1 
ATOM   3064 N N   . GLY A 1 396 ? 15.705  60.734 67.058 1.00 31.94  ? 396  GLY A N   1 
ATOM   3065 C CA  . GLY A 1 396 ? 15.815  61.318 65.732 1.00 31.94  ? 396  GLY A CA  1 
ATOM   3066 C C   . GLY A 1 396 ? 16.451  60.381 64.715 1.00 31.94  ? 396  GLY A C   1 
ATOM   3067 O O   . GLY A 1 396 ? 15.949  60.233 63.599 1.00 31.94  ? 396  GLY A O   1 
ATOM   3068 N N   . ASP A 1 397 ? 17.555  59.744 65.101 1.00 29.62  ? 397  ASP A N   1 
ATOM   3069 C CA  . ASP A 1 397 ? 18.267  58.814 64.229 1.00 29.62  ? 397  ASP A CA  1 
ATOM   3070 C C   . ASP A 1 397 ? 17.414  57.625 63.820 1.00 29.62  ? 397  ASP A C   1 
ATOM   3071 O O   . ASP A 1 397 ? 17.288  57.322 62.642 1.00 29.62  ? 397  ASP A O   1 
ATOM   3072 C CB  . ASP A 1 397 ? 19.537  58.297 64.906 1.00 36.92  ? 397  ASP A CB  1 
ATOM   3073 C CG  . ASP A 1 397 ? 20.628  59.346 64.993 1.00 36.92  ? 397  ASP A CG  1 
ATOM   3074 O OD1 . ASP A 1 397 ? 20.548  60.371 64.278 1.00 36.92  ? 397  ASP A OD1 1 
ATOM   3075 O OD2 . ASP A 1 397 ? 21.581  59.137 65.772 1.00 36.92  ? 397  ASP A OD2 1 
ATOM   3076 N N   . HIS A 1 398 ? 16.834  56.952 64.802 1.00 33.77  ? 398  HIS A N   1 
ATOM   3077 C CA  . HIS A 1 398 ? 15.990  55.788 64.552 1.00 33.77  ? 398  HIS A CA  1 
ATOM   3078 C C   . HIS A 1 398 ? 14.673  56.068 63.819 1.00 33.77  ? 398  HIS A C   1 
ATOM   3079 O O   . HIS A 1 398 ? 14.190  55.238 63.059 1.00 33.77  ? 398  HIS A O   1 
ATOM   3080 C CB  . HIS A 1 398 ? 15.663  55.101 65.875 1.00 31.58  ? 398  HIS A CB  1 
ATOM   3081 C CG  . HIS A 1 398 ? 14.592  54.064 65.763 1.00 31.58  ? 398  HIS A CG  1 
ATOM   3082 N ND1 . HIS A 1 398 ? 14.750  52.905 65.035 1.00 31.58  ? 398  HIS A ND1 1 
ATOM   3083 C CD2 . HIS A 1 398 ? 13.348  54.010 66.292 1.00 31.58  ? 398  HIS A CD2 1 
ATOM   3084 C CE1 . HIS A 1 398 ? 13.651  52.181 65.122 1.00 31.58  ? 398  HIS A CE1 1 
ATOM   3085 N NE2 . HIS A 1 398 ? 12.785  52.828 65.880 1.00 31.58  ? 398  HIS A NE2 1 
ATOM   3086 N N   . ASN A 1 399 ? 14.098  57.239 64.041 1.00 30.57  ? 399  ASN A N   1 
ATOM   3087 C CA  . ASN A 1 399 ? 12.829  57.566 63.434 1.00 30.57  ? 399  ASN A CA  1 
ATOM   3088 C C   . ASN A 1 399 ? 12.827  58.431 62.189 1.00 30.57  ? 399  ASN A C   1 
ATOM   3089 O O   . ASN A 1 399 ? 11.922  58.328 61.370 1.00 30.57  ? 399  ASN A O   1 
ATOM   3090 C CB  . ASN A 1 399 ? 11.943  58.196 64.492 1.00 29.72  ? 399  ASN A CB  1 
ATOM   3091 C CG  . ASN A 1 399 ? 11.525  57.205 65.536 1.00 29.72  ? 399  ASN A CG  1 
ATOM   3092 O OD1 . ASN A 1 399 ? 10.726  56.321 65.266 1.00 29.72  ? 399  ASN A OD1 1 
ATOM   3093 N ND2 . ASN A 1 399 ? 12.074  57.329 66.728 1.00 29.72  ? 399  ASN A ND2 1 
ATOM   3094 N N   . VAL A 1 400 ? 13.836  59.271 62.024 1.00 31.74  ? 400  VAL A N   1 
ATOM   3095 C CA  . VAL A 1 400 ? 13.850  60.150 60.874 1.00 31.74  ? 400  VAL A CA  1 
ATOM   3096 C C   . VAL A 1 400 ? 15.115  60.103 60.032 1.00 31.74  ? 400  VAL A C   1 
ATOM   3097 O O   . VAL A 1 400 ? 15.058  59.793 58.844 1.00 31.74  ? 400  VAL A O   1 
ATOM   3098 C CB  . VAL A 1 400 ? 13.588  61.600 61.330 1.00 27.68  ? 400  VAL A CB  1 
ATOM   3099 C CG1 . VAL A 1 400 ? 13.569  62.536 60.150 1.00 27.68  ? 400  VAL A CG1 1 
ATOM   3100 C CG2 . VAL A 1 400 ? 12.268  61.667 62.075 1.00 27.68  ? 400  VAL A CG2 1 
ATOM   3101 N N   . ILE A 1 401 ? 16.258  60.384 60.647 1.00 36.92  ? 401  ILE A N   1 
ATOM   3102 C CA  . ILE A 1 401 ? 17.515  60.424 59.913 1.00 36.92  ? 401  ILE A CA  1 
ATOM   3103 C C   . ILE A 1 401 ? 18.044  59.122 59.323 1.00 36.92  ? 401  ILE A C   1 
ATOM   3104 O O   . ILE A 1 401 ? 18.261  59.049 58.120 1.00 36.92  ? 401  ILE A O   1 
ATOM   3105 C CB  . ILE A 1 401 ? 18.618  61.083 60.756 1.00 29.80  ? 401  ILE A CB  1 
ATOM   3106 C CG1 . ILE A 1 401 ? 18.161  62.480 61.174 1.00 29.80  ? 401  ILE A CG1 1 
ATOM   3107 C CG2 . ILE A 1 401 ? 19.902  61.194 59.952 1.00 29.80  ? 401  ILE A CG2 1 
ATOM   3108 C CD1 . ILE A 1 401 ? 19.044  63.132 62.205 1.00 29.80  ? 401  ILE A CD1 1 
ATOM   3109 N N   . CYS A 1 402 ? 18.264  58.092 60.127 1.00 30.84  ? 402  CYS A N   1 
ATOM   3110 C CA  . CYS A 1 402 ? 18.780  56.865 59.545 1.00 30.84  ? 402  CYS A CA  1 
ATOM   3111 C C   . CYS A 1 402 ? 17.815  56.256 58.502 1.00 30.84  ? 402  CYS A C   1 
ATOM   3112 O O   . CYS A 1 402 ? 18.258  55.651 57.531 1.00 30.84  ? 402  CYS A O   1 
ATOM   3113 C CB  . CYS A 1 402 ? 19.146  55.857 60.649 1.00 25.08  ? 402  CYS A CB  1 
ATOM   3114 N N   . PRO A 1 403 ? 16.487  56.404 58.682 1.00 35.70  ? 403  PRO A N   1 
ATOM   3115 C CA  . PRO A 1 403 ? 15.575  55.837 57.682 1.00 35.70  ? 403  PRO A CA  1 
ATOM   3116 C C   . PRO A 1 403 ? 15.609  56.636 56.372 1.00 35.70  ? 403  PRO A C   1 
ATOM   3117 O O   . PRO A 1 403 ? 15.479  56.070 55.290 1.00 35.70  ? 403  PRO A O   1 
ATOM   3118 C CB  . PRO A 1 403 ? 14.206  55.934 58.358 1.00 34.37  ? 403  PRO A CB  1 
ATOM   3119 C CG  . PRO A 1 403 ? 14.525  55.858 59.779 1.00 34.37  ? 403  PRO A CG  1 
ATOM   3120 C CD  . PRO A 1 403 ? 15.740  56.732 59.906 1.00 34.37  ? 403  PRO A CD  1 
ATOM   3121 N N   . LEU A 1 404 ? 15.770  57.952 56.469 1.00 29.42  ? 404  LEU A N   1 
ATOM   3122 C CA  . LEU A 1 404 ? 15.811  58.772 55.272 1.00 29.42  ? 404  LEU A CA  1 
ATOM   3123 C C   . LEU A 1 404 ? 17.118  58.554 54.500 1.00 29.42  ? 404  LEU A C   1 
ATOM   3124 O O   . LEU A 1 404 ? 17.132  58.588 53.270 1.00 29.42  ? 404  LEU A O   1 
ATOM   3125 C CB  . LEU A 1 404 ? 15.611  60.253 55.627 1.00 41.35  ? 404  LEU A CB  1 
ATOM   3126 C CG  . LEU A 1 404 ? 15.537  61.268 54.476 1.00 41.35  ? 404  LEU A CG  1 
ATOM   3127 C CD1 . LEU A 1 404 ? 14.536  62.374 54.784 1.00 41.35  ? 404  LEU A CD1 1 
ATOM   3128 C CD2 . LEU A 1 404 ? 16.914  61.853 54.236 1.00 41.35  ? 404  LEU A CD2 1 
ATOM   3129 N N   . MET A 1 405 ? 18.214  58.321 55.210 1.00 35.57  ? 405  MET A N   1 
ATOM   3130 C CA  . MET A 1 405 ? 19.477  58.068 54.535 1.00 35.57  ? 405  MET A CA  1 
ATOM   3131 C C   . MET A 1 405 ? 19.460  56.711 53.819 1.00 35.57  ? 405  MET A C   1 
ATOM   3132 O O   . MET A 1 405 ? 20.194  56.497 52.858 1.00 35.57  ? 405  MET A O   1 
ATOM   3133 C CB  . MET A 1 405 ? 20.652  58.123 55.515 1.00 39.34  ? 405  MET A CB  1 
ATOM   3134 C CG  . MET A 1 405 ? 21.013  59.528 55.978 1.00 39.34  ? 405  MET A CG  1 
ATOM   3135 S SD  . MET A 1 405 ? 21.250  60.728 54.641 1.00 39.34  ? 405  MET A SD  1 
ATOM   3136 C CE  . MET A 1 405 ? 22.751  60.107 53.880 1.00 39.34  ? 405  MET A CE  1 
ATOM   3137 N N   . HIS A 1 406 ? 18.626  55.790 54.281 1.00 44.96  ? 406  HIS A N   1 
ATOM   3138 C CA  . HIS A 1 406 ? 18.539  54.485 53.632 1.00 44.96  ? 406  HIS A CA  1 
ATOM   3139 C C   . HIS A 1 406 ? 17.762  54.671 52.325 1.00 44.96  ? 406  HIS A C   1 
ATOM   3140 O O   . HIS A 1 406 ? 18.103  54.106 51.287 1.00 44.96  ? 406  HIS A O   1 
ATOM   3141 C CB  . HIS A 1 406 ? 17.815  53.490 54.543 1.00 49.46  ? 406  HIS A CB  1 
ATOM   3142 C CG  . HIS A 1 406 ? 17.717  52.106 53.980 1.00 49.46  ? 406  HIS A CG  1 
ATOM   3143 N ND1 . HIS A 1 406 ? 18.816  51.290 53.811 1.00 49.46  ? 406  HIS A ND1 1 
ATOM   3144 C CD2 . HIS A 1 406 ? 16.645  51.383 53.569 1.00 49.46  ? 406  HIS A CD2 1 
ATOM   3145 C CE1 . HIS A 1 406 ? 18.426  50.124 53.324 1.00 49.46  ? 406  HIS A CE1 1 
ATOM   3146 N NE2 . HIS A 1 406 ? 17.114  50.155 53.169 1.00 49.46  ? 406  HIS A NE2 1 
ATOM   3147 N N   . PHE A 1 407 ? 16.718  55.488 52.386 1.00 40.91  ? 407  PHE A N   1 
ATOM   3148 C CA  . PHE A 1 407 ? 15.900  55.756 51.217 1.00 40.91  ? 407  PHE A CA  1 
ATOM   3149 C C   . PHE A 1 407 ? 16.699  56.499 50.146 1.00 40.91  ? 407  PHE A C   1 
ATOM   3150 O O   . PHE A 1 407 ? 16.684  56.109 48.986 1.00 40.91  ? 407  PHE A O   1 
ATOM   3151 C CB  . PHE A 1 407 ? 14.675  56.588 51.615 1.00 32.24  ? 407  PHE A CB  1 
ATOM   3152 C CG  . PHE A 1 407 ? 13.832  57.009 50.456 1.00 32.24  ? 407  PHE A CG  1 
ATOM   3153 C CD1 . PHE A 1 407 ? 13.059  56.080 49.769 1.00 32.24  ? 407  PHE A CD1 1 
ATOM   3154 C CD2 . PHE A 1 407 ? 13.828  58.327 50.032 1.00 32.24  ? 407  PHE A CD2 1 
ATOM   3155 C CE1 . PHE A 1 407 ? 12.293  56.459 48.674 1.00 32.24  ? 407  PHE A CE1 1 
ATOM   3156 C CE2 . PHE A 1 407 ? 13.069  58.714 48.940 1.00 32.24  ? 407  PHE A CE2 1 
ATOM   3157 C CZ  . PHE A 1 407 ? 12.296  57.773 48.259 1.00 32.24  ? 407  PHE A CZ  1 
ATOM   3158 N N   . VAL A 1 408 ? 17.392  57.565 50.545 1.00 37.30  ? 408  VAL A N   1 
ATOM   3159 C CA  . VAL A 1 408 ? 18.171  58.366 49.616 1.00 37.30  ? 408  VAL A CA  1 
ATOM   3160 C C   . VAL A 1 408 ? 19.285  57.572 48.980 1.00 37.30  ? 408  VAL A C   1 
ATOM   3161 O O   . VAL A 1 408 ? 19.608  57.785 47.817 1.00 37.30  ? 408  VAL A O   1 
ATOM   3162 C CB  . VAL A 1 408 ? 18.786  59.599 50.302 1.00 41.64  ? 408  VAL A CB  1 
ATOM   3163 C CG1 . VAL A 1 408 ? 19.609  59.169 51.481 1.00 41.64  ? 408  VAL A CG1 1 
ATOM   3164 C CG2 . VAL A 1 408 ? 19.658  60.371 49.316 1.00 41.64  ? 408  VAL A CG2 1 
ATOM   3165 N N   . ASN A 1 409 ? 19.887  56.660 49.732 1.00 41.53  ? 409  ASN A N   1 
ATOM   3166 C CA  . ASN A 1 409 ? 20.963  55.864 49.166 1.00 41.53  ? 409  ASN A CA  1 
ATOM   3167 C C   . ASN A 1 409 ? 20.429  54.808 48.219 1.00 41.53  ? 409  ASN A C   1 
ATOM   3168 O O   . ASN A 1 409 ? 21.095  54.453 47.258 1.00 41.53  ? 409  ASN A O   1 
ATOM   3169 C CB  . ASN A 1 409 ? 21.810  55.228 50.262 1.00 41.58  ? 409  ASN A CB  1 
ATOM   3170 C CG  . ASN A 1 409 ? 22.929  56.145 50.722 1.00 41.58  ? 409  ASN A CG  1 
ATOM   3171 O OD1 . ASN A 1 409 ? 23.763  56.561 49.922 1.00 41.58  ? 409  ASN A OD1 1 
ATOM   3172 N ND2 . ASN A 1 409 ? 22.948  56.471 52.007 1.00 41.58  ? 409  ASN A ND2 1 
ATOM   3173 N N   . LYS A 1 410 ? 19.224  54.308 48.471 1.00 48.41  ? 410  LYS A N   1 
ATOM   3174 C CA  . LYS A 1 410 ? 18.631  53.313 47.583 1.00 48.41  ? 410  LYS A CA  1 
ATOM   3175 C C   . LYS A 1 410 ? 18.066  53.985 46.323 1.00 48.41  ? 410  LYS A C   1 
ATOM   3176 O O   . LYS A 1 410 ? 18.137  53.433 45.219 1.00 48.41  ? 410  LYS A O   1 
ATOM   3177 C CB  . LYS A 1 410 ? 17.501  52.584 48.297 1.00 50.79  ? 410  LYS A CB  1 
ATOM   3178 C CG  . LYS A 1 410 ? 17.942  51.664 49.390 1.00 50.79  ? 410  LYS A CG  1 
ATOM   3179 C CD  . LYS A 1 410 ? 18.549  50.432 48.802 1.00 50.79  ? 410  LYS A CD  1 
ATOM   3180 C CE  . LYS A 1 410 ? 18.888  49.442 49.886 1.00 50.79  ? 410  LYS A CE  1 
ATOM   3181 N NZ  . LYS A 1 410 ? 19.422  48.201 49.269 1.00 50.79  ? 410  LYS A NZ  1 
ATOM   3182 N N   . TYR A 1 411 ? 17.505  55.178 46.501 1.00 37.38  ? 411  TYR A N   1 
ATOM   3183 C CA  . TYR A 1 411 ? 16.904  55.921 45.407 1.00 37.38  ? 411  TYR A CA  1 
ATOM   3184 C C   . TYR A 1 411 ? 17.937  56.418 44.410 1.00 37.38  ? 411  TYR A C   1 
ATOM   3185 O O   . TYR A 1 411 ? 17.809  56.215 43.205 1.00 37.38  ? 411  TYR A O   1 
ATOM   3186 C CB  . TYR A 1 411 ? 16.120  57.125 45.941 1.00 35.16  ? 411  TYR A CB  1 
ATOM   3187 C CG  . TYR A 1 411 ? 15.303  57.802 44.872 1.00 35.16  ? 411  TYR A CG  1 
ATOM   3188 C CD1 . TYR A 1 411 ? 14.006  57.371 44.588 1.00 35.16  ? 411  TYR A CD1 1 
ATOM   3189 C CD2 . TYR A 1 411 ? 15.850  58.820 44.090 1.00 35.16  ? 411  TYR A CD2 1 
ATOM   3190 C CE1 . TYR A 1 411 ? 13.270  57.926 43.552 1.00 35.16  ? 411  TYR A CE1 1 
ATOM   3191 C CE2 . TYR A 1 411 ? 15.125  59.386 43.045 1.00 35.16  ? 411  TYR A CE2 1 
ATOM   3192 C CZ  . TYR A 1 411 ? 13.832  58.932 42.781 1.00 35.16  ? 411  TYR A CZ  1 
ATOM   3193 O OH  . TYR A 1 411 ? 13.104  59.474 41.746 1.00 35.16  ? 411  TYR A OH  1 
ATOM   3194 N N   . THR A 1 412 ? 18.953  57.091 44.926 1.00 40.33  ? 412  THR A N   1 
ATOM   3195 C CA  . THR A 1 412 ? 20.006  57.639 44.100 1.00 40.33  ? 412  THR A CA  1 
ATOM   3196 C C   . THR A 1 412 ? 20.607  56.624 43.126 1.00 40.33  ? 412  THR A C   1 
ATOM   3197 O O   . THR A 1 412 ? 21.145  56.997 42.084 1.00 40.33  ? 412  THR A O   1 
ATOM   3198 C CB  . THR A 1 412 ? 21.089  58.261 44.994 1.00 37.30  ? 412  THR A CB  1 
ATOM   3199 O OG1 . THR A 1 412 ? 20.564  59.461 45.577 1.00 37.30  ? 412  THR A OG1 1 
ATOM   3200 C CG2 . THR A 1 412 ? 22.343  58.582 44.201 1.00 37.30  ? 412  THR A CG2 1 
ATOM   3201 N N   . LYS A 1 413 ? 20.494  55.342 43.448 1.00 44.90  ? 413  LYS A N   1 
ATOM   3202 C CA  . LYS A 1 413 ? 21.016  54.309 42.562 1.00 44.90  ? 413  LYS A CA  1 
ATOM   3203 C C   . LYS A 1 413 ? 20.217  54.190 41.250 1.00 44.90  ? 413  LYS A C   1 
ATOM   3204 O O   . LYS A 1 413 ? 20.754  53.739 40.248 1.00 44.90  ? 413  LYS A O   1 
ATOM   3205 C CB  . LYS A 1 413 ? 21.038  52.954 43.269 1.00 69.67  ? 413  LYS A CB  1 
ATOM   3206 C CG  . LYS A 1 413 ? 21.600  51.853 42.385 1.00 69.67  ? 413  LYS A CG  1 
ATOM   3207 C CD  . LYS A 1 413 ? 21.440  50.463 43.003 1.00 69.67  ? 413  LYS A CD  1 
ATOM   3208 C CE  . LYS A 1 413 ? 21.954  49.392 42.042 1.00 69.67  ? 413  LYS A CE  1 
ATOM   3209 N NZ  . LYS A 1 413 ? 21.402  49.602 40.657 1.00 69.67  ? 413  LYS A NZ  1 
ATOM   3210 N N   . PHE A 1 414 ? 18.939  54.577 41.258 1.00 42.79  ? 414  PHE A N   1 
ATOM   3211 C CA  . PHE A 1 414 ? 18.110  54.526 40.045 1.00 42.79  ? 414  PHE A CA  1 
ATOM   3212 C C   . PHE A 1 414 ? 17.504  55.884 39.663 1.00 42.79  ? 414  PHE A C   1 
ATOM   3213 O O   . PHE A 1 414 ? 16.855  56.002 38.626 1.00 42.79  ? 414  PHE A O   1 
ATOM   3214 C CB  . PHE A 1 414 ? 16.945  53.561 40.201 1.00 41.59  ? 414  PHE A CB  1 
ATOM   3215 C CG  . PHE A 1 414 ? 17.342  52.165 40.521 1.00 41.59  ? 414  PHE A CG  1 
ATOM   3216 C CD1 . PHE A 1 414 ? 17.653  51.801 41.819 1.00 41.59  ? 414  PHE A CD1 1 
ATOM   3217 C CD2 . PHE A 1 414 ? 17.343  51.191 39.529 1.00 41.59  ? 414  PHE A CD2 1 
ATOM   3218 C CE1 . PHE A 1 414 ? 17.951  50.486 42.135 1.00 41.59  ? 414  PHE A CE1 1 
ATOM   3219 C CE2 . PHE A 1 414 ? 17.642  49.868 39.833 1.00 41.59  ? 414  PHE A CE2 1 
ATOM   3220 C CZ  . PHE A 1 414 ? 17.946  49.516 41.142 1.00 41.59  ? 414  PHE A CZ  1 
ATOM   3221 N N   . GLY A 1 415 ? 17.708  56.901 40.497 1.00 37.81  ? 415  GLY A N   1 
ATOM   3222 C CA  . GLY A 1 415 ? 17.131  58.207 40.223 1.00 37.81  ? 415  GLY A CA  1 
ATOM   3223 C C   . GLY A 1 415 ? 17.859  59.019 39.180 1.00 37.81  ? 415  GLY A C   1 
ATOM   3224 O O   . GLY A 1 415 ? 18.889  58.592 38.661 1.00 37.81  ? 415  GLY A O   1 
ATOM   3225 N N   . ASN A 1 416 ? 17.329  60.200 38.882 1.00 34.91  ? 416  ASN A N   1 
ATOM   3226 C CA  . ASN A 1 416 ? 17.934  61.076 37.892 1.00 34.91  ? 416  ASN A CA  1 
ATOM   3227 C C   . ASN A 1 416 ? 18.431  62.374 38.541 1.00 34.91  ? 416  ASN A C   1 
ATOM   3228 O O   . ASN A 1 416 ? 18.504  63.411 37.892 1.00 34.91  ? 416  ASN A O   1 
ATOM   3229 C CB  . ASN A 1 416 ? 16.915  61.354 36.772 1.00 42.81  ? 416  ASN A CB  1 
ATOM   3230 C CG  . ASN A 1 416 ? 17.464  62.240 35.654 1.00 42.81  ? 416  ASN A CG  1 
ATOM   3231 O OD1 . ASN A 1 416 ? 16.927  63.330 35.404 1.00 42.81  ? 416  ASN A OD1 1 
ATOM   3232 N ND2 . ASN A 1 416 ? 18.519  61.777 34.969 1.00 42.81  ? 416  ASN A ND2 1 
ATOM   3233 N N   . GLY A 1 417 ? 18.790  62.303 39.823 1.00 37.84  ? 417  GLY A N   1 
ATOM   3234 C CA  . GLY A 1 417 ? 19.294  63.478 40.526 1.00 37.84  ? 417  GLY A CA  1 
ATOM   3235 C C   . GLY A 1 417 ? 18.806  63.621 41.957 1.00 37.84  ? 417  GLY A C   1 
ATOM   3236 O O   . GLY A 1 417 ? 17.605  63.651 42.209 1.00 37.84  ? 417  GLY A O   1 
ATOM   3237 N N   . THR A 1 418 ? 19.738  63.736 42.894 1.00 28.46  ? 418  THR A N   1 
ATOM   3238 C CA  . THR A 1 418 ? 19.384  63.860 44.299 1.00 28.46  ? 418  THR A CA  1 
ATOM   3239 C C   . THR A 1 418 ? 20.096  65.042 44.953 1.00 28.46  ? 418  THR A C   1 
ATOM   3240 O O   . THR A 1 418 ? 21.282  65.267 44.705 1.00 28.46  ? 418  THR A O   1 
ATOM   3241 C CB  . THR A 1 418 ? 19.758  62.558 45.068 1.00 32.86  ? 418  THR A CB  1 
ATOM   3242 O OG1 . THR A 1 418 ? 19.107  61.431 44.464 1.00 32.86  ? 418  THR A OG1 1 
ATOM   3243 C CG2 . THR A 1 418 ? 19.347  62.654 46.529 1.00 32.86  ? 418  THR A CG2 1 
ATOM   3244 N N   . TYR A 1 419 ? 19.365  65.794 45.778 1.00 30.91  ? 419  TYR A N   1 
ATOM   3245 C CA  . TYR A 1 419 ? 19.913  66.952 46.500 1.00 30.91  ? 419  TYR A CA  1 
ATOM   3246 C C   . TYR A 1 419 ? 19.547  66.835 47.983 1.00 30.91  ? 419  TYR A C   1 
ATOM   3247 O O   . TYR A 1 419 ? 18.374  66.859 48.350 1.00 30.91  ? 419  TYR A O   1 
ATOM   3248 C CB  . TYR A 1 419 ? 19.364  68.262 45.929 1.00 38.39  ? 419  TYR A CB  1 
ATOM   3249 C CG  . TYR A 1 419 ? 19.782  68.528 44.500 1.00 38.39  ? 419  TYR A CG  1 
ATOM   3250 C CD1 . TYR A 1 419 ? 20.983  69.176 44.207 1.00 38.39  ? 419  TYR A CD1 1 
ATOM   3251 C CD2 . TYR A 1 419 ? 18.990  68.098 43.432 1.00 38.39  ? 419  TYR A CD2 1 
ATOM   3252 C CE1 . TYR A 1 419 ? 21.375  69.384 42.893 1.00 38.39  ? 419  TYR A CE1 1 
ATOM   3253 C CE2 . TYR A 1 419 ? 19.376  68.298 42.131 1.00 38.39  ? 419  TYR A CE2 1 
ATOM   3254 C CZ  . TYR A 1 419 ? 20.566  68.941 41.859 1.00 38.39  ? 419  TYR A CZ  1 
ATOM   3255 O OH  . TYR A 1 419 ? 20.937  69.143 40.543 1.00 38.39  ? 419  TYR A OH  1 
ATOM   3256 N N   . LEU A 1 420 ? 20.566  66.729 48.830 1.00 32.49  ? 420  LEU A N   1 
ATOM   3257 C CA  . LEU A 1 420 ? 20.360  66.544 50.256 1.00 32.49  ? 420  LEU A CA  1 
ATOM   3258 C C   . LEU A 1 420 ? 20.778  67.715 51.140 1.00 32.49  ? 420  LEU A C   1 
ATOM   3259 O O   . LEU A 1 420 ? 21.841  68.301 50.959 1.00 32.49  ? 420  LEU A O   1 
ATOM   3260 C CB  . LEU A 1 420 ? 21.099  65.277 50.686 1.00 27.97  ? 420  LEU A CB  1 
ATOM   3261 C CG  . LEU A 1 420 ? 20.924  64.754 52.105 1.00 27.97  ? 420  LEU A CG  1 
ATOM   3262 C CD1 . LEU A 1 420 ? 19.456  64.507 52.355 1.00 27.97  ? 420  LEU A CD1 1 
ATOM   3263 C CD2 . LEU A 1 420 ? 21.713  63.474 52.285 1.00 27.97  ? 420  LEU A CD2 1 
ATOM   3264 N N   . TYR A 1 421 ? 19.934  68.048 52.111 1.00 36.58  ? 421  TYR A N   1 
ATOM   3265 C CA  . TYR A 1 421 ? 20.235  69.144 53.030 1.00 36.58  ? 421  TYR A CA  1 
ATOM   3266 C C   . TYR A 1 421 ? 20.139  68.705 54.488 1.00 36.58  ? 421  TYR A C   1 
ATOM   3267 O O   . TYR A 1 421 ? 19.542  67.674 54.810 1.00 36.58  ? 421  TYR A O   1 
ATOM   3268 C CB  . TYR A 1 421 ? 19.279  70.329 52.797 1.00 39.84  ? 421  TYR A CB  1 
ATOM   3269 C CG  . TYR A 1 421 ? 17.862  70.138 53.326 1.00 39.84  ? 421  TYR A CG  1 
ATOM   3270 C CD1 . TYR A 1 421 ? 17.558  70.362 54.674 1.00 39.84  ? 421  TYR A CD1 1 
ATOM   3271 C CD2 . TYR A 1 421 ? 16.830  69.708 52.484 1.00 39.84  ? 421  TYR A CD2 1 
ATOM   3272 C CE1 . TYR A 1 421 ? 16.268  70.160 55.167 1.00 39.84  ? 421  TYR A CE1 1 
ATOM   3273 C CE2 . TYR A 1 421 ? 15.537  69.502 52.969 1.00 39.84  ? 421  TYR A CE2 1 
ATOM   3274 C CZ  . TYR A 1 421 ? 15.262  69.730 54.311 1.00 39.84  ? 421  TYR A CZ  1 
ATOM   3275 O OH  . TYR A 1 421 ? 13.985  69.530 54.794 1.00 39.84  ? 421  TYR A OH  1 
ATOM   3276 N N   . PHE A 1 422 ? 20.743  69.499 55.361 1.00 36.31  ? 422  PHE A N   1 
ATOM   3277 C CA  . PHE A 1 422 ? 20.710  69.252 56.791 1.00 36.31  ? 422  PHE A CA  1 
ATOM   3278 C C   . PHE A 1 422 ? 20.411  70.627 57.372 1.00 36.31  ? 422  PHE A C   1 
ATOM   3279 O O   . PHE A 1 422 ? 21.259  71.511 57.335 1.00 36.31  ? 422  PHE A O   1 
ATOM   3280 C CB  . PHE A 1 422 ? 22.066  68.749 57.282 1.00 34.81  ? 422  PHE A CB  1 
ATOM   3281 C CG  . PHE A 1 422 ? 22.098  68.394 58.749 1.00 34.81  ? 422  PHE A CG  1 
ATOM   3282 C CD1 . PHE A 1 422 ? 21.416  67.278 59.226 1.00 34.81  ? 422  PHE A CD1 1 
ATOM   3283 C CD2 . PHE A 1 422 ? 22.839  69.160 59.647 1.00 34.81  ? 422  PHE A CD2 1 
ATOM   3284 C CE1 . PHE A 1 422 ? 21.474  66.923 60.578 1.00 34.81  ? 422  PHE A CE1 1 
ATOM   3285 C CE2 . PHE A 1 422 ? 22.905  68.818 60.995 1.00 34.81  ? 422  PHE A CE2 1 
ATOM   3286 C CZ  . PHE A 1 422 ? 22.219  67.694 61.465 1.00 34.81  ? 422  PHE A CZ  1 
ATOM   3287 N N   . PHE A 1 423 ? 19.198  70.809 57.879 1.00 37.53  ? 423  PHE A N   1 
ATOM   3288 C CA  . PHE A 1 423 ? 18.777  72.083 58.451 1.00 37.53  ? 423  PHE A CA  1 
ATOM   3289 C C   . PHE A 1 423 ? 19.157  72.173 59.928 1.00 37.53  ? 423  PHE A C   1 
ATOM   3290 O O   . PHE A 1 423 ? 18.586  71.479 60.769 1.00 37.53  ? 423  PHE A O   1 
ATOM   3291 C CB  . PHE A 1 423 ? 17.270  72.230 58.304 1.00 31.55  ? 423  PHE A CB  1 
ATOM   3292 C CG  . PHE A 1 423 ? 16.760  73.565 58.700 1.00 31.55  ? 423  PHE A CG  1 
ATOM   3293 C CD1 . PHE A 1 423 ? 16.836  74.631 57.823 1.00 31.55  ? 423  PHE A CD1 1 
ATOM   3294 C CD2 . PHE A 1 423 ? 16.225  73.767 59.966 1.00 31.55  ? 423  PHE A CD2 1 
ATOM   3295 C CE1 . PHE A 1 423 ? 16.387  75.885 58.196 1.00 31.55  ? 423  PHE A CE1 1 
ATOM   3296 C CE2 . PHE A 1 423 ? 15.773  75.017 60.355 1.00 31.55  ? 423  PHE A CE2 1 
ATOM   3297 C CZ  . PHE A 1 423 ? 15.854  76.081 59.467 1.00 31.55  ? 423  PHE A CZ  1 
ATOM   3298 N N   . ASN A 1 424 ? 20.106  73.039 60.253 1.00 48.03  ? 424  ASN A N   1 
ATOM   3299 C CA  . ASN A 1 424 ? 20.531  73.156 61.636 1.00 48.03  ? 424  ASN A CA  1 
ATOM   3300 C C   . ASN A 1 424 ? 20.548  74.580 62.171 1.00 48.03  ? 424  ASN A C   1 
ATOM   3301 O O   . ASN A 1 424 ? 21.517  75.002 62.795 1.00 48.03  ? 424  ASN A O   1 
ATOM   3302 C CB  . ASN A 1 424 ? 21.911  72.512 61.812 1.00 36.23  ? 424  ASN A CB  1 
ATOM   3303 C CG  . ASN A 1 424 ? 22.986  73.208 61.005 1.00 36.23  ? 424  ASN A CG  1 
ATOM   3304 O OD1 . ASN A 1 424 ? 22.692  73.948 60.074 1.00 36.23  ? 424  ASN A OD1 1 
ATOM   3305 N ND2 . ASN A 1 424 ? 24.240  72.960 61.350 1.00 36.23  ? 424  ASN A ND2 1 
ATOM   3306 N N   . HIS A 1 425 ? 19.482  75.329 61.923 1.00 45.94  ? 425  HIS A N   1 
ATOM   3307 C CA  . HIS A 1 425 ? 19.402  76.687 62.440 1.00 45.94  ? 425  HIS A CA  1 
ATOM   3308 C C   . HIS A 1 425 ? 18.198  76.813 63.359 1.00 45.94  ? 425  HIS A C   1 
ATOM   3309 O O   . HIS A 1 425 ? 17.069  76.528 62.959 1.00 45.94  ? 425  HIS A O   1 
ATOM   3310 C CB  . HIS A 1 425 ? 19.262  77.717 61.317 1.00 48.94  ? 425  HIS A CB  1 
ATOM   3311 C CG  . HIS A 1 425 ? 19.028  79.111 61.818 1.00 48.94  ? 425  HIS A CG  1 
ATOM   3312 N ND1 . HIS A 1 425 ? 19.967  79.805 62.552 1.00 48.94  ? 425  HIS A ND1 1 
ATOM   3313 C CD2 . HIS A 1 425 ? 17.924  79.896 61.787 1.00 48.94  ? 425  HIS A CD2 1 
ATOM   3314 C CE1 . HIS A 1 425 ? 19.450  80.951 62.960 1.00 48.94  ? 425  HIS A CE1 1 
ATOM   3315 N NE2 . HIS A 1 425 ? 18.211  81.030 62.511 1.00 48.94  ? 425  HIS A NE2 1 
ATOM   3316 N N   . ARG A 1 426 ? 18.432  77.230 64.594 1.00 41.53  ? 426  ARG A N   1 
ATOM   3317 C CA  . ARG A 1 426 ? 17.323  77.407 65.517 1.00 41.53  ? 426  ARG A CA  1 
ATOM   3318 C C   . ARG A 1 426 ? 16.822  78.855 65.416 1.00 41.53  ? 426  ARG A C   1 
ATOM   3319 O O   . ARG A 1 426 ? 17.563  79.794 65.717 1.00 41.53  ? 426  ARG A O   1 
ATOM   3320 C CB  . ARG A 1 426 ? 17.758  77.099 66.957 1.00 47.31  ? 426  ARG A CB  1 
ATOM   3321 C CG  . ARG A 1 426 ? 16.608  77.189 67.966 1.00 47.31  ? 426  ARG A CG  1 
ATOM   3322 C CD  . ARG A 1 426 ? 17.122  77.083 69.381 1.00 47.31  ? 426  ARG A CD  1 
ATOM   3323 N NE  . ARG A 1 426 ? 16.161  77.579 70.362 1.00 47.31  ? 426  ARG A NE  1 
ATOM   3324 C CZ  . ARG A 1 426 ? 15.182  76.855 70.899 1.00 47.31  ? 426  ARG A CZ  1 
ATOM   3325 N NH1 . ARG A 1 426 ? 15.016  75.581 70.559 1.00 47.31  ? 426  ARG A NH1 1 
ATOM   3326 N NH2 . ARG A 1 426 ? 14.369  77.408 71.790 1.00 47.31  ? 426  ARG A NH2 1 
ATOM   3327 N N   . ALA A 1 427 ? 15.571  79.024 64.987 1.00 55.31  ? 427  ALA A N   1 
ATOM   3328 C CA  . ALA A 1 427 ? 14.967  80.354 64.847 1.00 55.31  ? 427  ALA A CA  1 
ATOM   3329 C C   . ALA A 1 427 ? 15.121  81.153 66.145 1.00 55.31  ? 427  ALA A C   1 
ATOM   3330 O O   . ALA A 1 427 ? 15.087  80.581 67.238 1.00 55.31  ? 427  ALA A O   1 
ATOM   3331 C CB  . ALA A 1 427 ? 13.490  80.220 64.479 1.00 33.15  ? 427  ALA A CB  1 
ATOM   3332 N N   . SER A 1 428 ? 15.290  82.469 66.033 1.00 50.92  ? 428  SER A N   1 
ATOM   3333 C CA  . SER A 1 428 ? 15.474  83.311 67.217 1.00 50.92  ? 428  SER A CA  1 
ATOM   3334 C C   . SER A 1 428 ? 14.198  83.540 68.030 1.00 50.92  ? 428  SER A C   1 
ATOM   3335 O O   . SER A 1 428 ? 14.265  83.849 69.221 1.00 50.92  ? 428  SER A O   1 
ATOM   3336 C CB  . SER A 1 428 ? 16.061  84.674 66.818 1.00 57.12  ? 428  SER A CB  1 
ATOM   3337 O OG  . SER A 1 428 ? 15.181  85.390 65.950 1.00 57.12  ? 428  SER A OG  1 
ATOM   3338 N N   . ASN A 1 429 ? 13.038  83.390 67.395 1.00 55.36  ? 429  ASN A N   1 
ATOM   3339 C CA  . ASN A 1 429 ? 11.771  83.614 68.089 1.00 55.36  ? 429  ASN A CA  1 
ATOM   3340 C C   . ASN A 1 429 ? 11.085  82.343 68.595 1.00 55.36  ? 429  ASN A C   1 
ATOM   3341 O O   . ASN A 1 429 ? 9.901   82.380 68.954 1.00 55.36  ? 429  ASN A O   1 
ATOM   3342 C CB  . ASN A 1 429 ? 10.799  84.378 67.181 1.00 52.83  ? 429  ASN A CB  1 
ATOM   3343 C CG  . ASN A 1 429 ? 10.764  83.824 65.762 1.00 52.83  ? 429  ASN A CG  1 
ATOM   3344 O OD1 . ASN A 1 429 ? 11.059  82.643 65.536 1.00 52.83  ? 429  ASN A OD1 1 
ATOM   3345 N ND2 . ASN A 1 429 ? 10.390  84.673 64.795 1.00 52.83  ? 429  ASN A ND2 1 
ATOM   3346 N N   . LEU A 1 430 ? 11.809  81.224 68.635 1.00 43.33  ? 430  LEU A N   1 
ATOM   3347 C CA  . LEU A 1 430 ? 11.199  79.982 69.097 1.00 43.33  ? 430  LEU A CA  1 
ATOM   3348 C C   . LEU A 1 430 ? 10.775  80.085 70.556 1.00 43.33  ? 430  LEU A C   1 
ATOM   3349 O O   . LEU A 1 430 ? 11.530  80.566 71.402 1.00 43.33  ? 430  LEU A O   1 
ATOM   3350 C CB  . LEU A 1 430 ? 12.158  78.804 68.920 1.00 63.53  ? 430  LEU A CB  1 
ATOM   3351 C CG  . LEU A 1 430 ? 11.854  77.840 67.767 1.00 63.53  ? 430  LEU A CG  1 
ATOM   3352 C CD1 . LEU A 1 430 ? 12.899  76.737 67.748 1.00 63.53  ? 430  LEU A CD1 1 
ATOM   3353 C CD2 . LEU A 1 430 ? 10.480  77.225 67.942 1.00 63.53  ? 430  LEU A CD2 1 
ATOM   3354 N N   . VAL A 1 431 ? 9.563   79.626 70.847 1.00 45.01  ? 431  VAL A N   1 
ATOM   3355 C CA  . VAL A 1 431 ? 9.048   79.674 72.212 1.00 45.01  ? 431  VAL A CA  1 
ATOM   3356 C C   . VAL A 1 431 ? 9.361   78.416 73.041 1.00 45.01  ? 431  VAL A C   1 
ATOM   3357 O O   . VAL A 1 431 ? 9.173   78.408 74.262 1.00 45.01  ? 431  VAL A O   1 
ATOM   3358 C CB  . VAL A 1 431 ? 7.519   79.933 72.202 1.00 49.78  ? 431  VAL A CB  1 
ATOM   3359 C CG1 . VAL A 1 431 ? 7.239   81.316 71.641 1.00 49.78  ? 431  VAL A CG1 1 
ATOM   3360 C CG2 . VAL A 1 431 ? 6.814   78.885 71.356 1.00 49.78  ? 431  VAL A CG2 1 
ATOM   3361 N N   . TRP A 1 432 ? 9.838   77.361 72.380 1.00 46.25  ? 432  TRP A N   1 
ATOM   3362 C CA  . TRP A 1 432 ? 10.195  76.115 73.064 1.00 46.25  ? 432  TRP A CA  1 
ATOM   3363 C C   . TRP A 1 432 ? 11.551  76.256 73.763 1.00 46.25  ? 432  TRP A C   1 
ATOM   3364 O O   . TRP A 1 432 ? 12.378  77.072 73.372 1.00 46.25  ? 432  TRP A O   1 
ATOM   3365 C CB  . TRP A 1 432 ? 10.257  74.948 72.073 1.00 40.95  ? 432  TRP A CB  1 
ATOM   3366 C CG  . TRP A 1 432 ? 8.946   74.635 71.413 1.00 40.95  ? 432  TRP A CG  1 
ATOM   3367 C CD1 . TRP A 1 432 ? 8.541   75.011 70.162 1.00 40.95  ? 432  TRP A CD1 1 
ATOM   3368 C CD2 . TRP A 1 432 ? 7.867   73.883 71.973 1.00 40.95  ? 432  TRP A CD2 1 
ATOM   3369 N NE1 . TRP A 1 432 ? 7.279   74.537 69.908 1.00 40.95  ? 432  TRP A NE1 1 
ATOM   3370 C CE2 . TRP A 1 432 ? 6.840   73.840 71.003 1.00 40.95  ? 432  TRP A CE2 1 
ATOM   3371 C CE3 . TRP A 1 432 ? 7.666   73.240 73.201 1.00 40.95  ? 432  TRP A CE3 1 
ATOM   3372 C CZ2 . TRP A 1 432 ? 5.629   73.178 71.222 1.00 40.95  ? 432  TRP A CZ2 1 
ATOM   3373 C CZ3 . TRP A 1 432 ? 6.461   72.582 73.420 1.00 40.95  ? 432  TRP A CZ3 1 
ATOM   3374 C CH2 . TRP A 1 432 ? 5.458   72.557 72.431 1.00 40.95  ? 432  TRP A CH2 1 
ATOM   3375 N N   . PRO A 1 433 ? 11.797  75.459 74.810 1.00 33.50  ? 433  PRO A N   1 
ATOM   3376 C CA  . PRO A 1 433 ? 13.084  75.572 75.499 1.00 33.50  ? 433  PRO A CA  1 
ATOM   3377 C C   . PRO A 1 433 ? 14.279  75.332 74.586 1.00 33.50  ? 433  PRO A C   1 
ATOM   3378 O O   . PRO A 1 433 ? 14.140  74.769 73.508 1.00 33.50  ? 433  PRO A O   1 
ATOM   3379 C CB  . PRO A 1 433 ? 12.970  74.544 76.624 1.00 35.25  ? 433  PRO A CB  1 
ATOM   3380 C CG  . PRO A 1 433 ? 11.960  73.556 76.098 1.00 35.25  ? 433  PRO A CG  1 
ATOM   3381 C CD  . PRO A 1 433 ? 10.948  74.425 75.424 1.00 35.25  ? 433  PRO A CD  1 
ATOM   3382 N N   . GLU A 1 434 ? 15.451  75.774 75.029 1.00 39.86  ? 434  GLU A N   1 
ATOM   3383 C CA  . GLU A 1 434 ? 16.680  75.632 74.260 1.00 39.86  ? 434  GLU A CA  1 
ATOM   3384 C C   . GLU A 1 434 ? 17.135  74.190 74.109 1.00 39.86  ? 434  GLU A C   1 
ATOM   3385 O O   . GLU A 1 434 ? 17.629  73.809 73.045 1.00 39.86  ? 434  GLU A O   1 
ATOM   3386 C CB  . GLU A 1 434 ? 17.823  76.431 74.903 1.00 83.20  ? 434  GLU A CB  1 
ATOM   3387 C CG  . GLU A 1 434 ? 17.654  77.951 74.901 1.00 83.20  ? 434  GLU A CG  1 
ATOM   3388 C CD  . GLU A 1 434 ? 17.700  78.564 73.499 1.00 83.20  ? 434  GLU A CD  1 
ATOM   3389 O OE1 . GLU A 1 434 ? 18.733  78.420 72.797 1.00 83.20  ? 434  GLU A OE1 1 
ATOM   3390 O OE2 . GLU A 1 434 ? 16.696  79.205 73.100 1.00 83.20  ? 434  GLU A OE2 1 
ATOM   3391 N N   . TRP A 1 435 ? 16.975  73.383 75.158 1.00 40.18  ? 435  TRP A N   1 
ATOM   3392 C CA  . TRP A 1 435 ? 17.432  72.001 75.080 1.00 40.18  ? 435  TRP A CA  1 
ATOM   3393 C C   . TRP A 1 435 ? 16.804  71.215 73.931 1.00 40.18  ? 435  TRP A C   1 
ATOM   3394 O O   . TRP A 1 435 ? 17.306  70.156 73.548 1.00 40.18  ? 435  TRP A O   1 
ATOM   3395 C CB  . TRP A 1 435 ? 17.221  71.261 76.414 1.00 39.17  ? 435  TRP A CB  1 
ATOM   3396 C CG  . TRP A 1 435 ? 15.806  71.015 76.793 1.00 39.17  ? 435  TRP A CG  1 
ATOM   3397 C CD1 . TRP A 1 435 ? 15.047  71.766 77.628 1.00 39.17  ? 435  TRP A CD1 1 
ATOM   3398 C CD2 . TRP A 1 435 ? 14.967  69.943 76.342 1.00 39.17  ? 435  TRP A CD2 1 
ATOM   3399 N NE1 . TRP A 1 435 ? 13.782  71.236 77.733 1.00 39.17  ? 435  TRP A NE1 1 
ATOM   3400 C CE2 . TRP A 1 435 ? 13.705  70.116 76.952 1.00 39.17  ? 435  TRP A CE2 1 
ATOM   3401 C CE3 . TRP A 1 435 ? 15.158  68.855 75.480 1.00 39.17  ? 435  TRP A CE3 1 
ATOM   3402 C CZ2 . TRP A 1 435 ? 12.639  69.246 76.730 1.00 39.17  ? 435  TRP A CZ2 1 
ATOM   3403 C CZ3 . TRP A 1 435 ? 14.098  67.990 75.256 1.00 39.17  ? 435  TRP A CZ3 1 
ATOM   3404 C CH2 . TRP A 1 435 ? 12.852  68.192 75.881 1.00 39.17  ? 435  TRP A CH2 1 
ATOM   3405 N N   . MET A 1 436 ? 15.722  71.739 73.367 1.00 41.08  ? 436  MET A N   1 
ATOM   3406 C CA  . MET A 1 436 ? 15.057  71.057 72.268 1.00 41.08  ? 436  MET A CA  1 
ATOM   3407 C C   . MET A 1 436 ? 15.730  71.314 70.922 1.00 41.08  ? 436  MET A C   1 
ATOM   3408 O O   . MET A 1 436 ? 15.470  70.601 69.966 1.00 41.08  ? 436  MET A O   1 
ATOM   3409 C CB  . MET A 1 436 ? 13.574  71.453 72.216 1.00 43.38  ? 436  MET A CB  1 
ATOM   3410 C CG  . MET A 1 436 ? 12.756  70.938 73.401 1.00 43.38  ? 436  MET A CG  1 
ATOM   3411 S SD  . MET A 1 436 ? 10.997  71.380 73.340 1.00 43.38  ? 436  MET A SD  1 
ATOM   3412 C CE  . MET A 1 436 ? 10.399  70.227 72.085 1.00 43.38  ? 436  MET A CE  1 
ATOM   3413 N N   . GLY A 1 437 ? 16.585  72.331 70.851 1.00 36.16  ? 437  GLY A N   1 
ATOM   3414 C CA  . GLY A 1 437 ? 17.308  72.646 69.618 1.00 36.16  ? 437  GLY A CA  1 
ATOM   3415 C C   . GLY A 1 437 ? 16.540  72.977 68.343 1.00 36.16  ? 437  GLY A C   1 
ATOM   3416 O O   . GLY A 1 437 ? 15.547  73.695 68.372 1.00 36.16  ? 437  GLY A O   1 
ATOM   3417 N N   . VAL A 1 438 ? 17.034  72.476 67.213 1.00 36.44  ? 438  VAL A N   1 
ATOM   3418 C CA  . VAL A 1 438 ? 16.394  72.683 65.912 1.00 36.44  ? 438  VAL A CA  1 
ATOM   3419 C C   . VAL A 1 438 ? 15.267  71.653 65.816 1.00 36.44  ? 438  VAL A C   1 
ATOM   3420 O O   . VAL A 1 438 ? 15.451  70.540 65.315 1.00 36.44  ? 438  VAL A O   1 
ATOM   3421 C CB  . VAL A 1 438 ? 17.386  72.450 64.771 1.00 29.06  ? 438  VAL A CB  1 
ATOM   3422 C CG1 . VAL A 1 438 ? 16.761  72.845 63.452 1.00 29.06  ? 438  VAL A CG1 1 
ATOM   3423 C CG2 . VAL A 1 438 ? 18.645  73.235 65.026 1.00 29.06  ? 438  VAL A CG2 1 
ATOM   3424 N N   . ILE A 1 439 ? 14.098  72.056 66.302 1.00 45.25  ? 439  ILE A N   1 
ATOM   3425 C CA  . ILE A 1 439 ? 12.916  71.207 66.381 1.00 45.25  ? 439  ILE A CA  1 
ATOM   3426 C C   . ILE A 1 439 ? 12.245  70.703 65.106 1.00 45.25  ? 439  ILE A C   1 
ATOM   3427 O O   . ILE A 1 439 ? 12.229  71.364 64.068 1.00 45.25  ? 439  ILE A O   1 
ATOM   3428 C CB  . ILE A 1 439 ? 11.842  71.905 67.237 1.00 42.69  ? 439  ILE A CB  1 
ATOM   3429 C CG1 . ILE A 1 439 ? 12.448  72.291 68.579 1.00 42.69  ? 439  ILE A CG1 1 
ATOM   3430 C CG2 . ILE A 1 439 ? 10.631  70.997 67.433 1.00 42.69  ? 439  ILE A CG2 1 
ATOM   3431 C CD1 . ILE A 1 439 ? 11.448  72.873 69.533 1.00 42.69  ? 439  ILE A CD1 1 
ATOM   3432 N N   . HIS A 1 440 ? 11.680  69.508 65.233 1.00 46.27  ? 440  HIS A N   1 
ATOM   3433 C CA  . HIS A 1 440 ? 10.944  68.821 64.183 1.00 46.27  ? 440  HIS A CA  1 
ATOM   3434 C C   . HIS A 1 440 ? 9.867   69.759 63.644 1.00 46.27  ? 440  HIS A C   1 
ATOM   3435 O O   . HIS A 1 440 ? 9.087   70.306 64.411 1.00 46.27  ? 440  HIS A O   1 
ATOM   3436 C CB  . HIS A 1 440 ? 10.296  67.580 64.799 1.00 57.71  ? 440  HIS A CB  1 
ATOM   3437 C CG  . HIS A 1 440 ? 9.549   66.722 63.830 1.00 57.71  ? 440  HIS A CG  1 
ATOM   3438 N ND1 . HIS A 1 440 ? 10.165  66.078 62.773 1.00 57.71  ? 440  HIS A ND1 1 
ATOM   3439 C CD2 . HIS A 1 440 ? 8.248   66.343 63.796 1.00 57.71  ? 440  HIS A CD2 1 
ATOM   3440 C CE1 . HIS A 1 440 ? 9.274   65.336 62.135 1.00 57.71  ? 440  HIS A CE1 1 
ATOM   3441 N NE2 . HIS A 1 440 ? 8.104   65.478 62.737 1.00 57.71  ? 440  HIS A NE2 1 
ATOM   3442 N N   . GLY A 1 441 ? 9.839   69.964 62.332 1.00 50.36  ? 441  GLY A N   1 
ATOM   3443 C CA  . GLY A 1 441 ? 8.820   70.821 61.744 1.00 50.36  ? 441  GLY A CA  1 
ATOM   3444 C C   . GLY A 1 441 ? 9.036   72.330 61.727 1.00 50.36  ? 441  GLY A C   1 
ATOM   3445 O O   . GLY A 1 441 ? 8.185   73.080 61.245 1.00 50.36  ? 441  GLY A O   1 
ATOM   3446 N N   . TYR A 1 442 ? 10.170  72.801 62.223 1.00 51.21  ? 442  TYR A N   1 
ATOM   3447 C CA  . TYR A 1 442 ? 10.394  74.232 62.223 1.00 51.21  ? 442  TYR A CA  1 
ATOM   3448 C C   . TYR A 1 442 ? 11.198  74.780 61.055 1.00 51.21  ? 442  TYR A C   1 
ATOM   3449 O O   . TYR A 1 442 ? 11.613  75.940 61.066 1.00 51.21  ? 442  TYR A O   1 
ATOM   3450 C CB  . TYR A 1 442 ? 10.982  74.665 63.565 1.00 41.84  ? 442  TYR A CB  1 
ATOM   3451 C CG  . TYR A 1 442 ? 9.899   74.760 64.605 1.00 41.84  ? 442  TYR A CG  1 
ATOM   3452 C CD1 . TYR A 1 442 ? 9.397   73.622 65.228 1.00 41.84  ? 442  TYR A CD1 1 
ATOM   3453 C CD2 . TYR A 1 442 ? 9.303   75.982 64.896 1.00 41.84  ? 442  TYR A CD2 1 
ATOM   3454 C CE1 . TYR A 1 442 ? 8.322   73.704 66.111 1.00 41.84  ? 442  TYR A CE1 1 
ATOM   3455 C CE2 . TYR A 1 442 ? 8.232   76.071 65.773 1.00 41.84  ? 442  TYR A CE2 1 
ATOM   3456 C CZ  . TYR A 1 442 ? 7.747   74.935 66.374 1.00 41.84  ? 442  TYR A CZ  1 
ATOM   3457 O OH  . TYR A 1 442 ? 6.680   75.040 67.236 1.00 41.84  ? 442  TYR A OH  1 
ATOM   3458 N N   . GLU A 1 443 ? 11.417  73.951 60.043 1.00 42.49  ? 443  GLU A N   1 
ATOM   3459 C CA  . GLU A 1 443 ? 12.118  74.421 58.855 1.00 42.49  ? 443  GLU A CA  1 
ATOM   3460 C C   . GLU A 1 443 ? 11.005  74.889 57.940 1.00 42.49  ? 443  GLU A C   1 
ATOM   3461 O O   . GLU A 1 443 ? 11.224  75.670 57.030 1.00 42.49  ? 443  GLU A O   1 
ATOM   3462 C CB  . GLU A 1 443 ? 12.912  73.299 58.168 1.00 59.65  ? 443  GLU A CB  1 
ATOM   3463 C CG  . GLU A 1 443 ? 12.086  72.254 57.392 1.00 59.65  ? 443  GLU A CG  1 
ATOM   3464 C CD  . GLU A 1 443 ? 11.132  71.437 58.280 1.00 59.65  ? 443  GLU A CD  1 
ATOM   3465 O OE1 . GLU A 1 443 ? 11.429  71.242 59.486 1.00 59.65  ? 443  GLU A OE1 1 
ATOM   3466 O OE2 . GLU A 1 443 ? 10.090  70.979 57.766 1.00 59.65  ? 443  GLU A OE2 1 
ATOM   3467 N N   . ILE A 1 444 ? 9.802   74.393 58.211 1.00 35.46  ? 444  ILE A N   1 
ATOM   3468 C CA  . ILE A 1 444 ? 8.614   74.721 57.442 1.00 35.46  ? 444  ILE A CA  1 
ATOM   3469 C C   . ILE A 1 444 ? 8.407   76.229 57.317 1.00 35.46  ? 444  ILE A C   1 
ATOM   3470 O O   . ILE A 1 444 ? 8.183   76.731 56.220 1.00 35.46  ? 444  ILE A O   1 
ATOM   3471 C CB  . ILE A 1 444 ? 7.355   74.075 58.089 1.00 46.40  ? 444  ILE A CB  1 
ATOM   3472 C CG1 . ILE A 1 444 ? 7.349   72.564 57.831 1.00 46.40  ? 444  ILE A CG1 1 
ATOM   3473 C CG2 . ILE A 1 444 ? 6.092   74.705 57.539 1.00 46.40  ? 444  ILE A CG2 1 
ATOM   3474 C CD1 . ILE A 1 444 ? 6.224   71.809 58.545 1.00 46.40  ? 444  ILE A CD1 1 
ATOM   3475 N N   . GLU A 1 445 ? 8.494   76.953 58.430 1.00 45.37  ? 445  GLU A N   1 
ATOM   3476 C CA  . GLU A 1 445 ? 8.289   78.401 58.405 1.00 45.37  ? 445  GLU A CA  1 
ATOM   3477 C C   . GLU A 1 445 ? 9.217   79.139 57.444 1.00 45.37  ? 445  GLU A C   1 
ATOM   3478 O O   . GLU A 1 445 ? 8.850   80.191 56.915 1.00 45.37  ? 445  GLU A O   1 
ATOM   3479 C CB  . GLU A 1 445 ? 8.402   78.990 59.819 1.00 70.61  ? 445  GLU A CB  1 
ATOM   3480 C CG  . GLU A 1 445 ? 9.638   78.589 60.618 1.00 70.61  ? 445  GLU A CG  1 
ATOM   3481 C CD  . GLU A 1 445 ? 9.431   78.794 62.132 1.00 70.61  ? 445  GLU A CD  1 
ATOM   3482 O OE1 . GLU A 1 445 ? 8.628   78.035 62.726 1.00 70.61  ? 445  GLU A OE1 1 
ATOM   3483 O OE2 . GLU A 1 445 ? 10.054  79.718 62.727 1.00 70.61  ? 445  GLU A OE2 1 
ATOM   3484 N N   . PHE A 1 446 ? 10.410  78.594 57.213 1.00 41.00  ? 446  PHE A N   1 
ATOM   3485 C CA  . PHE A 1 446 ? 11.336  79.218 56.283 1.00 41.00  ? 446  PHE A CA  1 
ATOM   3486 C C   . PHE A 1 446 ? 10.928  78.870 54.860 1.00 41.00  ? 446  PHE A C   1 
ATOM   3487 O O   . PHE A 1 446 ? 11.057  79.689 53.953 1.00 41.00  ? 446  PHE A O   1 
ATOM   3488 C CB  . PHE A 1 446 ? 12.767  78.764 56.543 1.00 35.57  ? 446  PHE A CB  1 
ATOM   3489 C CG  . PHE A 1 446 ? 13.345  79.299 57.826 1.00 35.57  ? 446  PHE A CG  1 
ATOM   3490 C CD1 . PHE A 1 446 ? 12.982  78.751 59.054 1.00 35.57  ? 446  PHE A CD1 1 
ATOM   3491 C CD2 . PHE A 1 446 ? 14.238  80.369 57.807 1.00 35.57  ? 446  PHE A CD2 1 
ATOM   3492 C CE1 . PHE A 1 446 ? 13.497  79.260 60.238 1.00 35.57  ? 446  PHE A CE1 1 
ATOM   3493 C CE2 . PHE A 1 446 ? 14.758  80.882 58.985 1.00 35.57  ? 446  PHE A CE2 1 
ATOM   3494 C CZ  . PHE A 1 446 ? 14.387  80.327 60.206 1.00 35.57  ? 446  PHE A CZ  1 
ATOM   3495 N N   . VAL A 1 447 ? 10.414  77.661 54.664 1.00 35.87  ? 447  VAL A N   1 
ATOM   3496 C CA  . VAL A 1 447 ? 9.980   77.241 53.341 1.00 35.87  ? 447  VAL A CA  1 
ATOM   3497 C C   . VAL A 1 447 ? 8.798   78.079 52.867 1.00 35.87  ? 447  VAL A C   1 
ATOM   3498 O O   . VAL A 1 447 ? 8.720   78.420 51.691 1.00 35.87  ? 447  VAL A O   1 
ATOM   3499 C CB  . VAL A 1 447 ? 9.593   75.749 53.334 1.00 35.94  ? 447  VAL A CB  1 
ATOM   3500 C CG1 . VAL A 1 447 ? 8.840   75.403 52.056 1.00 35.94  ? 447  VAL A CG1 1 
ATOM   3501 C CG2 . VAL A 1 447 ? 10.844  74.897 53.456 1.00 35.94  ? 447  VAL A CG2 1 
ATOM   3502 N N   . PHE A 1 448 ? 7.881   78.413 53.776 1.00 40.00  ? 448  PHE A N   1 
ATOM   3503 C CA  . PHE A 1 448 ? 6.719   79.227 53.408 1.00 40.00  ? 448  PHE A CA  1 
ATOM   3504 C C   . PHE A 1 448 ? 6.977   80.724 53.534 1.00 40.00  ? 448  PHE A C   1 
ATOM   3505 O O   . PHE A 1 448 ? 6.085   81.544 53.314 1.00 40.00  ? 448  PHE A O   1 
ATOM   3506 C CB  . PHE A 1 448 ? 5.488   78.834 54.220 1.00 39.44  ? 448  PHE A CB  1 
ATOM   3507 C CG  . PHE A 1 448 ? 4.857   77.557 53.762 1.00 39.44  ? 448  PHE A CG  1 
ATOM   3508 C CD1 . PHE A 1 448 ? 5.424   76.333 54.079 1.00 39.44  ? 448  PHE A CD1 1 
ATOM   3509 C CD2 . PHE A 1 448 ? 3.705   77.579 52.984 1.00 39.44  ? 448  PHE A CD2 1 
ATOM   3510 C CE1 . PHE A 1 448 ? 4.850   75.143 53.624 1.00 39.44  ? 448  PHE A CE1 1 
ATOM   3511 C CE2 . PHE A 1 448 ? 3.119   76.396 52.522 1.00 39.44  ? 448  PHE A CE2 1 
ATOM   3512 C CZ  . PHE A 1 448 ? 3.691   75.178 52.842 1.00 39.44  ? 448  PHE A CZ  1 
ATOM   3513 N N   . GLY A 1 449 ? 8.212   81.063 53.888 1.00 43.36  ? 449  GLY A N   1 
ATOM   3514 C CA  . GLY A 1 449 ? 8.614   82.451 53.992 1.00 43.36  ? 449  GLY A CA  1 
ATOM   3515 C C   . GLY A 1 449 ? 8.019   83.337 55.066 1.00 43.36  ? 449  GLY A C   1 
ATOM   3516 O O   . GLY A 1 449 ? 7.861   84.526 54.834 1.00 43.36  ? 449  GLY A O   1 
ATOM   3517 N N   . LEU A 1 450 ? 7.692   82.794 56.233 1.00 50.34  ? 450  LEU A N   1 
ATOM   3518 C CA  . LEU A 1 450 ? 7.143   83.628 57.302 1.00 50.34  ? 450  LEU A CA  1 
ATOM   3519 C C   . LEU A 1 450 ? 8.153   84.696 57.754 1.00 50.34  ? 450  LEU A C   1 
ATOM   3520 O O   . LEU A 1 450 ? 7.758   85.739 58.260 1.00 50.34  ? 450  LEU A O   1 
ATOM   3521 C CB  . LEU A 1 450 ? 6.715   82.774 58.512 1.00 45.18  ? 450  LEU A CB  1 
ATOM   3522 C CG  . LEU A 1 450 ? 5.437   81.923 58.422 1.00 45.18  ? 450  LEU A CG  1 
ATOM   3523 C CD1 . LEU A 1 450 ? 4.223   82.815 58.260 1.00 45.18  ? 450  LEU A CD1 1 
ATOM   3524 C CD2 . LEU A 1 450 ? 5.529   80.964 57.248 1.00 45.18  ? 450  LEU A CD2 1 
ATOM   3525 N N   . PRO A 1 451 ? 9.468   84.448 57.587 1.00 46.11  ? 451  PRO A N   1 
ATOM   3526 C CA  . PRO A 1 451 ? 10.455  85.454 58.006 1.00 46.11  ? 451  PRO A CA  1 
ATOM   3527 C C   . PRO A 1 451 ? 10.383  86.787 57.240 1.00 46.11  ? 451  PRO A C   1 
ATOM   3528 O O   . PRO A 1 451 ? 10.957  87.785 57.676 1.00 46.11  ? 451  PRO A O   1 
ATOM   3529 C CB  . PRO A 1 451 ? 11.787  84.744 57.780 1.00 45.82  ? 451  PRO A CB  1 
ATOM   3530 C CG  . PRO A 1 451 ? 11.448  83.331 58.061 1.00 45.82  ? 451  PRO A CG  1 
ATOM   3531 C CD  . PRO A 1 451 ? 10.137  83.162 57.324 1.00 45.82  ? 451  PRO A CD  1 
ATOM   3532 N N   . LEU A 1 452 ? 9.695   86.799 56.100 1.00 50.49  ? 452  LEU A N   1 
ATOM   3533 C CA  . LEU A 1 452 ? 9.569   88.015 55.311 1.00 50.49  ? 452  LEU A CA  1 
ATOM   3534 C C   . LEU A 1 452 ? 8.608   89.000 55.957 1.00 50.49  ? 452  LEU A C   1 
ATOM   3535 O O   . LEU A 1 452 ? 8.681   90.201 55.698 1.00 50.49  ? 452  LEU A O   1 
ATOM   3536 C CB  . LEU A 1 452 ? 9.085   87.704 53.898 1.00 45.28  ? 452  LEU A CB  1 
ATOM   3537 C CG  . LEU A 1 452 ? 9.900   86.707 53.074 1.00 45.28  ? 452  LEU A CG  1 
ATOM   3538 C CD1 . LEU A 1 452 ? 9.479   86.817 51.611 1.00 45.28  ? 452  LEU A CD1 1 
ATOM   3539 C CD2 . LEU A 1 452 ? 11.379  87.003 53.201 1.00 45.28  ? 452  LEU A CD2 1 
ATOM   3540 N N   . VAL A 1 453 ? 7.699   88.515 56.792 1.00 49.78  ? 453  VAL A N   1 
ATOM   3541 C CA  . VAL A 1 453 ? 6.779   89.436 57.432 1.00 49.78  ? 453  VAL A CA  1 
ATOM   3542 C C   . VAL A 1 453 ? 7.328   89.934 58.782 1.00 49.78  ? 453  VAL A C   1 
ATOM   3543 O O   . VAL A 1 453 ? 7.327   89.223 59.800 1.00 49.78  ? 453  VAL A O   1 
ATOM   3544 C CB  . VAL A 1 453 ? 5.378   88.808 57.589 1.00 60.96  ? 453  VAL A CB  1 
ATOM   3545 C CG1 . VAL A 1 453 ? 5.486   87.433 58.181 1.00 60.96  ? 453  VAL A CG1 1 
ATOM   3546 C CG2 . VAL A 1 453 ? 4.502   89.699 58.459 1.00 60.96  ? 453  VAL A CG2 1 
ATOM   3547 N N   . LYS A 1 454 ? 7.800   91.179 58.758 1.00 61.00  ? 454  LYS A N   1 
ATOM   3548 C CA  . LYS A 1 454 ? 8.400   91.854 59.914 1.00 61.00  ? 454  LYS A CA  1 
ATOM   3549 C C   . LYS A 1 454 ? 7.759   91.562 61.275 1.00 61.00  ? 454  LYS A C   1 
ATOM   3550 O O   . LYS A 1 454 ? 8.427   91.139 62.229 1.00 61.00  ? 454  LYS A O   1 
ATOM   3551 C CB  . LYS A 1 454 ? 8.378   93.371 59.680 1.00 87.14  ? 454  LYS A CB  1 
ATOM   3552 C CG  . LYS A 1 454 ? 8.616   93.803 58.225 1.00 87.14  ? 454  LYS A CG  1 
ATOM   3553 C CD  . LYS A 1 454 ? 10.060  93.575 57.755 1.00 87.14  ? 454  LYS A CD  1 
ATOM   3554 C CE  . LYS A 1 454 ? 10.263  94.105 56.322 1.00 87.14  ? 454  LYS A CE  1 
ATOM   3555 N NZ  . LYS A 1 454 ? 11.680  93.988 55.852 1.00 87.14  ? 454  LYS A NZ  1 
ATOM   3556 N N   . GLU A 1 455 ? 6.460   91.810 61.354 1.00 53.02  ? 455  GLU A N   1 
ATOM   3557 C CA  . GLU A 1 455 ? 5.699   91.631 62.581 1.00 53.02  ? 455  GLU A CA  1 
ATOM   3558 C C   . GLU A 1 455 ? 5.900   90.296 63.288 1.00 53.02  ? 455  GLU A C   1 
ATOM   3559 O O   . GLU A 1 455 ? 5.602   90.179 64.478 1.00 53.02  ? 455  GLU A O   1 
ATOM   3560 C CB  . GLU A 1 455 ? 4.203   91.866 62.312 1.00 90.88  ? 455  GLU A CB  1 
ATOM   3561 C CG  . GLU A 1 455 ? 3.824   92.053 60.821 1.00 90.88  ? 455  GLU A CG  1 
ATOM   3562 C CD  . GLU A 1 455 ? 4.720   93.062 60.068 1.00 90.88  ? 455  GLU A CD  1 
ATOM   3563 O OE1 . GLU A 1 455 ? 4.850   94.221 60.529 1.00 90.88  ? 455  GLU A OE1 1 
ATOM   3564 O OE2 . GLU A 1 455 ? 5.299   92.690 59.016 1.00 90.88  ? 455  GLU A OE2 1 
ATOM   3565 N N   . LEU A 1 456 ? 6.401   89.284 62.582 1.00 64.96  ? 456  LEU A N   1 
ATOM   3566 C CA  . LEU A 1 456 ? 6.617   87.998 63.231 1.00 64.96  ? 456  LEU A CA  1 
ATOM   3567 C C   . LEU A 1 456 ? 7.919   88.015 64.031 1.00 64.96  ? 456  LEU A C   1 
ATOM   3568 O O   . LEU A 1 456 ? 8.148   87.164 64.899 1.00 64.96  ? 456  LEU A O   1 
ATOM   3569 C CB  . LEU A 1 456 ? 6.598   86.872 62.205 1.00 56.90  ? 456  LEU A CB  1 
ATOM   3570 C CG  . LEU A 1 456 ? 5.212   86.717 61.561 1.00 56.90  ? 456  LEU A CG  1 
ATOM   3571 C CD1 . LEU A 1 456 ? 5.211   85.486 60.649 1.00 56.90  ? 456  LEU A CD1 1 
ATOM   3572 C CD2 . LEU A 1 456 ? 4.144   86.587 62.645 1.00 56.90  ? 456  LEU A CD2 1 
ATOM   3573 N N   . ASN A 1 457 ? 8.771   88.994 63.734 1.00 68.44  ? 457  ASN A N   1 
ATOM   3574 C CA  . ASN A 1 457 ? 10.017  89.175 64.477 1.00 68.44  ? 457  ASN A CA  1 
ATOM   3575 C C   . ASN A 1 457 ? 11.171  88.215 64.215 1.00 68.44  ? 457  ASN A C   1 
ATOM   3576 O O   . ASN A 1 457 ? 11.614  87.523 65.133 1.00 68.44  ? 457  ASN A O   1 
ATOM   3577 C CB  . ASN A 1 457 ? 9.737   89.181 66.003 1.00 62.65  ? 457  ASN A CB  1 
ATOM   3578 C CG  . ASN A 1 457 ? 8.740   90.272 66.428 1.00 62.65  ? 457  ASN A CG  1 
ATOM   3579 O OD1 . ASN A 1 457 ? 8.696   91.361 65.838 1.00 62.65  ? 457  ASN A OD1 1 
ATOM   3580 N ND2 . ASN A 1 457 ? 7.951   89.986 67.469 1.00 62.65  ? 457  ASN A ND2 1 
ATOM   3581 N N   . TYR A 1 458 ? 11.671  88.170 62.987 1.00 52.50  ? 458  TYR A N   1 
ATOM   3582 C CA  . TYR A 1 458 ? 12.817  87.314 62.695 1.00 52.50  ? 458  TYR A CA  1 
ATOM   3583 C C   . TYR A 1 458 ? 14.005  88.236 62.426 1.00 52.50  ? 458  TYR A C   1 
ATOM   3584 O O   . TYR A 1 458 ? 13.825  89.405 62.086 1.00 52.50  ? 458  TYR A O   1 
ATOM   3585 C CB  . TYR A 1 458 ? 12.578  86.434 61.463 1.00 38.33  ? 458  TYR A CB  1 
ATOM   3586 C CG  . TYR A 1 458 ? 11.586  85.308 61.649 1.00 38.33  ? 458  TYR A CG  1 
ATOM   3587 C CD1 . TYR A 1 458 ? 10.221  85.500 61.397 1.00 38.33  ? 458  TYR A CD1 1 
ATOM   3588 C CD2 . TYR A 1 458 ? 12.010  84.043 62.051 1.00 38.33  ? 458  TYR A CD2 1 
ATOM   3589 C CE1 . TYR A 1 458 ? 9.305   84.457 61.535 1.00 38.33  ? 458  TYR A CE1 1 
ATOM   3590 C CE2 . TYR A 1 458 ? 11.106  82.996 62.197 1.00 38.33  ? 458  TYR A CE2 1 
ATOM   3591 C CZ  . TYR A 1 458 ? 9.755   83.207 61.936 1.00 38.33  ? 458  TYR A CZ  1 
ATOM   3592 O OH  . TYR A 1 458 ? 8.864   82.165 62.066 1.00 38.33  ? 458  TYR A OH  1 
ATOM   3593 N N   . THR A 1 459 ? 15.219  87.717 62.569 1.00 45.70  ? 459  THR A N   1 
ATOM   3594 C CA  . THR A 1 459 ? 16.396  88.532 62.327 1.00 45.70  ? 459  THR A CA  1 
ATOM   3595 C C   . THR A 1 459 ? 16.548  88.771 60.828 1.00 45.70  ? 459  THR A C   1 
ATOM   3596 O O   . THR A 1 459 ? 15.884  88.127 60.015 1.00 45.70  ? 459  THR A O   1 
ATOM   3597 C CB  . THR A 1 459 ? 17.661  87.845 62.866 1.00 41.43  ? 459  THR A CB  1 
ATOM   3598 O OG1 . THR A 1 459 ? 17.974  86.699 62.063 1.00 41.43  ? 459  THR A OG1 1 
ATOM   3599 C CG2 . THR A 1 459 ? 17.437  87.400 64.306 1.00 41.43  ? 459  THR A CG2 1 
ATOM   3600 N N   . ALA A 1 460 ? 17.428  89.697 60.463 1.00 59.32  ? 460  ALA A N   1 
ATOM   3601 C CA  . ALA A 1 460 ? 17.649  90.011 59.058 1.00 59.32  ? 460  ALA A CA  1 
ATOM   3602 C C   . ALA A 1 460 ? 18.266  88.830 58.331 1.00 59.32  ? 460  ALA A C   1 
ATOM   3603 O O   . ALA A 1 460 ? 17.962  88.596 57.161 1.00 59.32  ? 460  ALA A O   1 
ATOM   3604 C CB  . ALA A 1 460 ? 18.547  91.229 58.927 1.00 53.02  ? 460  ALA A CB  1 
ATOM   3605 N N   . GLU A 1 461 ? 19.146  88.093 59.006 1.00 49.56  ? 461  GLU A N   1 
ATOM   3606 C CA  . GLU A 1 461 ? 19.774  86.941 58.368 1.00 49.56  ? 461  GLU A CA  1 
ATOM   3607 C C   . GLU A 1 461 ? 18.784  85.795 58.237 1.00 49.56  ? 461  GLU A C   1 
ATOM   3608 O O   . GLU A 1 461 ? 18.918  84.963 57.344 1.00 49.56  ? 461  GLU A O   1 
ATOM   3609 C CB  . GLU A 1 461 ? 21.018  86.479 59.135 1.00 81.70  ? 461  GLU A CB  1 
ATOM   3610 C CG  . GLU A 1 461 ? 20.980  86.756 60.615 1.00 81.70  ? 461  GLU A CG  1 
ATOM   3611 C CD  . GLU A 1 461 ? 21.274  88.216 60.937 1.00 81.70  ? 461  GLU A CD  1 
ATOM   3612 O OE1 . GLU A 1 461 ? 22.405  88.671 60.629 1.00 81.70  ? 461  GLU A OE1 1 
ATOM   3613 O OE2 . GLU A 1 461 ? 20.379  88.906 61.491 1.00 81.70  ? 461  GLU A OE2 1 
ATOM   3614 N N   . GLU A 1 462 ? 17.787  85.754 59.118 1.00 52.84  ? 462  GLU A N   1 
ATOM   3615 C CA  . GLU A 1 462 ? 16.778  84.709 59.037 1.00 52.84  ? 462  GLU A CA  1 
ATOM   3616 C C   . GLU A 1 462 ? 15.892  84.943 57.812 1.00 52.84  ? 462  GLU A C   1 
ATOM   3617 O O   . GLU A 1 462 ? 15.468  83.986 57.164 1.00 52.84  ? 462  GLU A O   1 
ATOM   3618 C CB  . GLU A 1 462 ? 15.932  84.661 60.313 1.00 52.23  ? 462  GLU A CB  1 
ATOM   3619 C CG  . GLU A 1 462 ? 16.701  84.111 61.492 1.00 52.23  ? 462  GLU A CG  1 
ATOM   3620 C CD  . GLU A 1 462 ? 15.871  83.983 62.753 1.00 52.23  ? 462  GLU A CD  1 
ATOM   3621 O OE1 . GLU A 1 462 ? 15.136  84.936 63.103 1.00 52.23  ? 462  GLU A OE1 1 
ATOM   3622 O OE2 . GLU A 1 462 ? 15.971  82.927 63.415 1.00 52.23  ? 462  GLU A OE2 1 
ATOM   3623 N N   . GLU A 1 463 ? 15.615  86.203 57.484 1.00 47.46  ? 463  GLU A N   1 
ATOM   3624 C CA  . GLU A 1 463 ? 14.799  86.489 56.306 1.00 47.46  ? 463  GLU A CA  1 
ATOM   3625 C C   . GLU A 1 463 ? 15.589  86.152 55.052 1.00 47.46  ? 463  GLU A C   1 
ATOM   3626 O O   . GLU A 1 463 ? 15.023  85.724 54.045 1.00 47.46  ? 463  GLU A O   1 
ATOM   3627 C CB  . GLU A 1 463 ? 14.388  87.963 56.252 1.00 72.06  ? 463  GLU A CB  1 
ATOM   3628 C CG  . GLU A 1 463 ? 14.369  88.522 54.831 1.00 72.06  ? 463  GLU A CG  1 
ATOM   3629 C CD  . GLU A 1 463 ? 13.626  89.844 54.705 1.00 72.06  ? 463  GLU A CD  1 
ATOM   3630 O OE1 . GLU A 1 463 ? 13.816  90.731 55.580 1.00 72.06  ? 463  GLU A OE1 1 
ATOM   3631 O OE2 . GLU A 1 463 ? 12.860  90.000 53.714 1.00 72.06  ? 463  GLU A OE2 1 
ATOM   3632 N N   . ALA A 1 464 ? 16.900  86.366 55.118 1.00 43.69  ? 464  ALA A N   1 
ATOM   3633 C CA  . ALA A 1 464 ? 17.772  86.079 53.986 1.00 43.69  ? 464  ALA A CA  1 
ATOM   3634 C C   . ALA A 1 464 ? 17.770  84.578 53.749 1.00 43.69  ? 464  ALA A C   1 
ATOM   3635 O O   . ALA A 1 464 ? 17.743  84.124 52.605 1.00 43.69  ? 464  ALA A O   1 
ATOM   3636 C CB  . ALA A 1 464 ? 19.192  86.567 54.269 1.00 31.87  ? 464  ALA A CB  1 
ATOM   3637 N N   . LEU A 1 465 ? 17.790  83.818 54.841 1.00 40.61  ? 465  LEU A N   1 
ATOM   3638 C CA  . LEU A 1 465 ? 17.777  82.362 54.760 1.00 40.61  ? 465  LEU A CA  1 
ATOM   3639 C C   . LEU A 1 465 ? 16.469  81.875 54.141 1.00 40.61  ? 465  LEU A C   1 
ATOM   3640 O O   . LEU A 1 465 ? 16.462  80.980 53.296 1.00 40.61  ? 465  LEU A O   1 
ATOM   3641 C CB  . LEU A 1 465 ? 17.940  81.747 56.152 1.00 35.19  ? 465  LEU A CB  1 
ATOM   3642 C CG  . LEU A 1 465 ? 17.936  80.222 56.198 1.00 35.19  ? 465  LEU A CG  1 
ATOM   3643 C CD1 . LEU A 1 465 ? 19.006  79.684 55.292 1.00 35.19  ? 465  LEU A CD1 1 
ATOM   3644 C CD2 . LEU A 1 465 ? 18.170  79.751 57.614 1.00 35.19  ? 465  LEU A CD2 1 
ATOM   3645 N N   . SER A 1 466 ? 15.365  82.480 54.558 1.00 35.73  ? 466  SER A N   1 
ATOM   3646 C CA  . SER A 1 466 ? 14.066  82.104 54.049 1.00 35.73  ? 466  SER A CA  1 
ATOM   3647 C C   . SER A 1 466 ? 13.978  82.292 52.536 1.00 35.73  ? 466  SER A C   1 
ATOM   3648 O O   . SER A 1 466 ? 13.384  81.469 51.840 1.00 35.73  ? 466  SER A O   1 
ATOM   3649 C CB  . SER A 1 466 ? 12.991  82.921 54.748 1.00 43.67  ? 466  SER A CB  1 
ATOM   3650 O OG  . SER A 1 466 ? 11.704  82.430 54.438 1.00 43.67  ? 466  SER A OG  1 
ATOM   3651 N N   . ARG A 1 467 ? 14.565  83.366 52.017 1.00 41.33  ? 467  ARG A N   1 
ATOM   3652 C CA  . ARG A 1 467 ? 14.527  83.602 50.577 1.00 41.33  ? 467  ARG A CA  1 
ATOM   3653 C C   . ARG A 1 467 ? 15.405  82.602 49.832 1.00 41.33  ? 467  ARG A C   1 
ATOM   3654 O O   . ARG A 1 467 ? 15.038  82.124 48.763 1.00 41.33  ? 467  ARG A O   1 
ATOM   3655 C CB  . ARG A 1 467 ? 14.965  85.028 50.253 1.00 42.37  ? 467  ARG A CB  1 
ATOM   3656 C CG  . ARG A 1 467 ? 13.926  86.075 50.584 1.00 42.37  ? 467  ARG A CG  1 
ATOM   3657 C CD  . ARG A 1 467 ? 14.448  87.494 50.363 1.00 42.37  ? 467  ARG A CD  1 
ATOM   3658 N NE  . ARG A 1 467 ? 13.461  88.476 50.804 1.00 42.37  ? 467  ARG A NE  1 
ATOM   3659 C CZ  . ARG A 1 467 ? 12.302  88.701 50.191 1.00 42.37  ? 467  ARG A CZ  1 
ATOM   3660 N NH1 . ARG A 1 467 ? 11.991  88.021 49.093 1.00 42.37  ? 467  ARG A NH1 1 
ATOM   3661 N NH2 . ARG A 1 467 ? 11.438  89.575 50.699 1.00 42.37  ? 467  ARG A NH2 1 
ATOM   3662 N N   . ARG A 1 468 ? 16.565  82.285 50.396 1.00 42.55  ? 468  ARG A N   1 
ATOM   3663 C CA  . ARG A 1 468 ? 17.468  81.322 49.779 1.00 42.55  ? 468  ARG A CA  1 
ATOM   3664 C C   . ARG A 1 468 ? 16.765  79.982 49.634 1.00 42.55  ? 468  ARG A C   1 
ATOM   3665 O O   . ARG A 1 468 ? 16.796  79.362 48.574 1.00 42.55  ? 468  ARG A O   1 
ATOM   3666 C CB  . ARG A 1 468 ? 18.694  81.112 50.647 1.00 45.73  ? 468  ARG A CB  1 
ATOM   3667 C CG  . ARG A 1 468 ? 19.935  81.757 50.165 1.00 45.73  ? 468  ARG A CG  1 
ATOM   3668 C CD  . ARG A 1 468 ? 21.005  81.554 51.199 1.00 45.73  ? 468  ARG A CD  1 
ATOM   3669 N NE  . ARG A 1 468 ? 21.435  80.161 51.302 1.00 45.73  ? 468  ARG A NE  1 
ATOM   3670 C CZ  . ARG A 1 468 ? 21.920  79.630 52.420 1.00 45.73  ? 468  ARG A CZ  1 
ATOM   3671 N NH1 . ARG A 1 468 ? 22.014  80.380 53.511 1.00 45.73  ? 468  ARG A NH1 1 
ATOM   3672 N NH2 . ARG A 1 468 ? 22.344  78.372 52.443 1.00 45.73  ? 468  ARG A NH2 1 
ATOM   3673 N N   . ILE A 1 469 ? 16.145  79.536 50.720 1.00 35.21  ? 469  ILE A N   1 
ATOM   3674 C CA  . ILE A 1 469 ? 15.438  78.267 50.732 1.00 35.21  ? 469  ILE A CA  1 
ATOM   3675 C C   . ILE A 1 469 ? 14.248  78.286 49.775 1.00 35.21  ? 469  ILE A C   1 
ATOM   3676 O O   . ILE A 1 469 ? 14.041  77.336 49.025 1.00 35.21  ? 469  ILE A O   1 
ATOM   3677 C CB  . ILE A 1 469 ? 15.006  77.914 52.181 1.00 27.22  ? 469  ILE A CB  1 
ATOM   3678 C CG1 . ILE A 1 469 ? 16.256  77.507 52.978 1.00 27.22  ? 469  ILE A CG1 1 
ATOM   3679 C CG2 . ILE A 1 469 ? 13.969  76.816 52.182 1.00 27.22  ? 469  ILE A CG2 1 
ATOM   3680 C CD1 . ILE A 1 469 ? 16.039  77.258 54.448 1.00 27.22  ? 469  ILE A CD1 1 
ATOM   3681 N N   . MET A 1 470 ? 13.485  79.377 49.781 1.00 42.85  ? 470  MET A N   1 
ATOM   3682 C CA  . MET A 1 470 ? 12.329  79.502 48.889 1.00 42.85  ? 470  MET A CA  1 
ATOM   3683 C C   . MET A 1 470 ? 12.748  79.461 47.426 1.00 42.85  ? 470  MET A C   1 
ATOM   3684 O O   . MET A 1 470 ? 12.001  78.987 46.567 1.00 42.85  ? 470  MET A O   1 
ATOM   3685 C CB  . MET A 1 470 ? 11.583  80.812 49.140 1.00 45.22  ? 470  MET A CB  1 
ATOM   3686 C CG  . MET A 1 470 ? 10.482  80.723 50.162 1.00 45.22  ? 470  MET A CG  1 
ATOM   3687 S SD  . MET A 1 470 ? 9.675   82.316 50.372 1.00 45.22  ? 470  MET A SD  1 
ATOM   3688 C CE  . MET A 1 470 ? 10.836  83.082 51.462 1.00 45.22  ? 470  MET A CE  1 
ATOM   3689 N N   . HIS A 1 471 ? 13.945  79.967 47.149 1.00 39.40  ? 471  HIS A N   1 
ATOM   3690 C CA  . HIS A 1 471 ? 14.441  79.998 45.788 1.00 39.40  ? 471  HIS A CA  1 
ATOM   3691 C C   . HIS A 1 471 ? 14.973  78.626 45.415 1.00 39.40  ? 471  HIS A C   1 
ATOM   3692 O O   . HIS A 1 471 ? 14.910  78.231 44.256 1.00 39.40  ? 471  HIS A O   1 
ATOM   3693 C CB  . HIS A 1 471 ? 15.538  81.056 45.634 1.00 58.02  ? 471  HIS A CB  1 
ATOM   3694 C CG  . HIS A 1 471 ? 15.861  81.382 44.209 1.00 58.02  ? 471  HIS A CG  1 
ATOM   3695 N ND1 . HIS A 1 471 ? 14.979  82.047 43.379 1.00 58.02  ? 471  HIS A ND1 1 
ATOM   3696 C CD2 . HIS A 1 471 ? 16.961  81.123 43.460 1.00 58.02  ? 471  HIS A CD2 1 
ATOM   3697 C CE1 . HIS A 1 471 ? 15.523  82.185 42.182 1.00 58.02  ? 471  HIS A CE1 1 
ATOM   3698 N NE2 . HIS A 1 471 ? 16.725  81.634 42.204 1.00 58.02  ? 471  HIS A NE2 1 
ATOM   3699 N N   . TYR A 1 472 ? 15.500  77.901 46.397 1.00 40.92  ? 472  TYR A N   1 
ATOM   3700 C CA  . TYR A 1 472 ? 16.014  76.555 46.153 1.00 40.92  ? 472  TYR A CA  1 
ATOM   3701 C C   . TYR A 1 472 ? 14.833  75.644 45.818 1.00 40.92  ? 472  TYR A C   1 
ATOM   3702 O O   . TYR A 1 472 ? 14.805  74.999 44.772 1.00 40.92  ? 472  TYR A O   1 
ATOM   3703 C CB  . TYR A 1 472 ? 16.711  75.983 47.392 1.00 43.89  ? 472  TYR A CB  1 
ATOM   3704 C CG  . TYR A 1 472 ? 18.095  76.501 47.694 1.00 43.89  ? 472  TYR A CG  1 
ATOM   3705 C CD1 . TYR A 1 472 ? 19.012  76.754 46.675 1.00 43.89  ? 472  TYR A CD1 1 
ATOM   3706 C CD2 . TYR A 1 472 ? 18.525  76.640 49.012 1.00 43.89  ? 472  TYR A CD2 1 
ATOM   3707 C CE1 . TYR A 1 472 ? 20.326  77.126 46.962 1.00 43.89  ? 472  TYR A CE1 1 
ATOM   3708 C CE2 . TYR A 1 472 ? 19.834  77.009 49.311 1.00 43.89  ? 472  TYR A CE2 1 
ATOM   3709 C CZ  . TYR A 1 472 ? 20.730  77.250 48.281 1.00 43.89  ? 472  TYR A CZ  1 
ATOM   3710 O OH  . TYR A 1 472 ? 22.026  77.611 48.577 1.00 43.89  ? 472  TYR A OH  1 
ATOM   3711 N N   . TRP A 1 473 ? 13.860  75.595 46.721 1.00 37.39  ? 473  TRP A N   1 
ATOM   3712 C CA  . TRP A 1 473 ? 12.694  74.756 46.516 1.00 37.39  ? 473  TRP A CA  1 
ATOM   3713 C C   . TRP A 1 473 ? 12.008  75.081 45.194 1.00 37.39  ? 473  TRP A C   1 
ATOM   3714 O O   . TRP A 1 473 ? 11.696  74.188 44.415 1.00 37.39  ? 473  TRP A O   1 
ATOM   3715 C CB  . TRP A 1 473 ? 11.689  74.934 47.663 1.00 34.54  ? 473  TRP A CB  1 
ATOM   3716 C CG  . TRP A 1 473 ? 11.839  74.004 48.854 1.00 34.54  ? 473  TRP A CG  1 
ATOM   3717 C CD1 . TRP A 1 473 ? 10.824  73.377 49.519 1.00 34.54  ? 473  TRP A CD1 1 
ATOM   3718 C CD2 . TRP A 1 473 ? 13.041  73.666 49.564 1.00 34.54  ? 473  TRP A CD2 1 
ATOM   3719 N NE1 . TRP A 1 473 ? 11.310  72.676 50.595 1.00 34.54  ? 473  TRP A NE1 1 
ATOM   3720 C CE2 . TRP A 1 473 ? 12.668  72.835 50.648 1.00 34.54  ? 473  TRP A CE2 1 
ATOM   3721 C CE3 . TRP A 1 473 ? 14.394  73.983 49.394 1.00 34.54  ? 473  TRP A CE3 1 
ATOM   3722 C CZ2 . TRP A 1 473 ? 13.599  72.319 51.556 1.00 34.54  ? 473  TRP A CZ2 1 
ATOM   3723 C CZ3 . TRP A 1 473 ? 15.318  73.468 50.298 1.00 34.54  ? 473  TRP A CZ3 1 
ATOM   3724 C CH2 . TRP A 1 473 ? 14.916  72.647 51.364 1.00 34.54  ? 473  TRP A CH2 1 
ATOM   3725 N N   . ALA A 1 474 ? 11.783  76.365 44.942 1.00 35.87  ? 474  ALA A N   1 
ATOM   3726 C CA  . ALA A 1 474 ? 11.104  76.803 43.727 1.00 35.87  ? 474  ALA A CA  1 
ATOM   3727 C C   . ALA A 1 474 ? 11.910  76.598 42.462 1.00 35.87  ? 474  ALA A C   1 
ATOM   3728 O O   . ALA A 1 474 ? 11.365  76.220 41.435 1.00 35.87  ? 474  ALA A O   1 
ATOM   3729 C CB  . ALA A 1 474 ? 10.714  78.258 43.856 1.00 21.49  ? 474  ALA A CB  1 
ATOM   3730 N N   . THR A 1 475 ? 13.207  76.858 42.526 1.00 39.53  ? 475  THR A N   1 
ATOM   3731 C CA  . THR A 1 475 ? 14.049  76.689 41.354 1.00 39.53  ? 475  THR A CA  1 
ATOM   3732 C C   . THR A 1 475 ? 14.173  75.217 41.028 1.00 39.53  ? 475  THR A C   1 
ATOM   3733 O O   . THR A 1 475 ? 14.345  74.839 39.867 1.00 39.53  ? 475  THR A O   1 
ATOM   3734 C CB  . THR A 1 475 ? 15.441  77.246 41.577 1.00 41.61  ? 475  THR A CB  1 
ATOM   3735 O OG1 . THR A 1 475 ? 15.346  78.647 41.861 1.00 41.61  ? 475  THR A OG1 1 
ATOM   3736 C CG2 . THR A 1 475 ? 16.300  77.025 40.338 1.00 41.61  ? 475  THR A CG2 1 
ATOM   3737 N N   . PHE A 1 476 ? 14.094  74.389 42.063 1.00 34.19  ? 476  PHE A N   1 
ATOM   3738 C CA  . PHE A 1 476 ? 14.169  72.955 41.889 1.00 34.19  ? 476  PHE A CA  1 
ATOM   3739 C C   . PHE A 1 476 ? 12.854  72.455 41.306 1.00 34.19  ? 476  PHE A C   1 
ATOM   3740 O O   . PHE A 1 476 ? 12.846  71.591 40.432 1.00 34.19  ? 476  PHE A O   1 
ATOM   3741 C CB  . PHE A 1 476 ? 14.428  72.268 43.228 1.00 36.34  ? 476  PHE A CB  1 
ATOM   3742 C CG  . PHE A 1 476 ? 14.255  70.777 43.183 1.00 36.34  ? 476  PHE A CG  1 
ATOM   3743 C CD1 . PHE A 1 476 ? 15.208  69.972 42.577 1.00 36.34  ? 476  PHE A CD1 1 
ATOM   3744 C CD2 . PHE A 1 476 ? 13.112  70.185 43.716 1.00 36.34  ? 476  PHE A CD2 1 
ATOM   3745 C CE1 . PHE A 1 476 ? 15.027  68.602 42.499 1.00 36.34  ? 476  PHE A CE1 1 
ATOM   3746 C CE2 . PHE A 1 476 ? 12.920  68.817 43.644 1.00 36.34  ? 476  PHE A CE2 1 
ATOM   3747 C CZ  . PHE A 1 476 ? 13.879  68.022 43.034 1.00 36.34  ? 476  PHE A CZ  1 
ATOM   3748 N N   . ALA A 1 477 ? 11.743  72.998 41.791 1.00 33.50  ? 477  ALA A N   1 
ATOM   3749 C CA  . ALA A 1 477 ? 10.440  72.589 41.301 1.00 33.50  ? 477  ALA A CA  1 
ATOM   3750 C C   . ALA A 1 477 ? 10.312  72.846 39.799 1.00 33.50  ? 477  ALA A C   1 
ATOM   3751 O O   . ALA A 1 477 ? 9.678   72.063 39.081 1.00 33.50  ? 477  ALA A O   1 
ATOM   3752 C CB  . ALA A 1 477 ? 9.362   73.326 42.041 1.00 21.33  ? 477  ALA A CB  1 
ATOM   3753 N N   . LYS A 1 478 ? 10.929  73.934 39.330 1.00 42.29  ? 478  LYS A N   1 
ATOM   3754 C CA  . LYS A 1 478 ? 10.873  74.317 37.921 1.00 42.29  ? 478  LYS A CA  1 
ATOM   3755 C C   . LYS A 1 478 ? 11.843  73.586 37.014 1.00 42.29  ? 478  LYS A C   1 
ATOM   3756 O O   . LYS A 1 478 ? 11.509  73.271 35.876 1.00 42.29  ? 478  LYS A O   1 
ATOM   3757 C CB  . LYS A 1 478 ? 11.165  75.815 37.747 1.00 71.38  ? 478  LYS A CB  1 
ATOM   3758 C CG  . LYS A 1 478 ? 10.159  76.753 38.378 1.00 71.38  ? 478  LYS A CG  1 
ATOM   3759 C CD  . LYS A 1 478 ? 10.778  78.145 38.638 1.00 71.38  ? 478  LYS A CD  1 
ATOM   3760 C CE  . LYS A 1 478 ? 9.856   79.019 39.515 1.00 71.38  ? 478  LYS A CE  1 
ATOM   3761 N NZ  . LYS A 1 478 ? 10.588  80.177 40.129 1.00 71.38  ? 478  LYS A NZ  1 
ATOM   3762 N N   . THR A 1 479 ? 13.043  73.323 37.519 1.00 35.35  ? 479  THR A N   1 
ATOM   3763 C CA  . THR A 1 479 ? 14.087  72.720 36.701 1.00 35.35  ? 479  THR A CA  1 
ATOM   3764 C C   . THR A 1 479 ? 14.678  71.364 37.082 1.00 35.35  ? 479  THR A C   1 
ATOM   3765 O O   . THR A 1 479 ? 15.333  70.736 36.258 1.00 35.35  ? 479  THR A O   1 
ATOM   3766 C CB  . THR A 1 479 ? 15.271  73.708 36.575 1.00 43.51  ? 479  THR A CB  1 
ATOM   3767 O OG1 . THR A 1 479 ? 16.052  73.684 37.783 1.00 43.51  ? 479  THR A OG1 1 
ATOM   3768 C CG2 . THR A 1 479 ? 14.754  75.133 36.360 1.00 43.51  ? 479  THR A CG2 1 
ATOM   3769 N N   . GLY A 1 480 ? 14.473  70.916 38.317 1.00 37.57  ? 480  GLY A N   1 
ATOM   3770 C CA  . GLY A 1 480 ? 15.049  69.645 38.737 1.00 37.57  ? 480  GLY A CA  1 
ATOM   3771 C C   . GLY A 1 480 ? 16.429  69.866 39.339 1.00 37.57  ? 480  GLY A C   1 
ATOM   3772 O O   . GLY A 1 480 ? 17.172  68.922 39.599 1.00 37.57  ? 480  GLY A O   1 
ATOM   3773 N N   . ASN A 1 481 ? 16.760  71.139 39.554 1.00 44.49  ? 481  ASN A N   1 
ATOM   3774 C CA  . ASN A 1 481 ? 18.039  71.556 40.116 1.00 44.49  ? 481  ASN A CA  1 
ATOM   3775 C C   . ASN A 1 481 ? 17.803  72.823 40.954 1.00 44.49  ? 481  ASN A C   1 
ATOM   3776 O O   . ASN A 1 481 ? 17.318  73.829 40.443 1.00 44.49  ? 481  ASN A O   1 
ATOM   3777 C CB  . ASN A 1 481 ? 19.007  71.867 38.984 1.00 43.61  ? 481  ASN A CB  1 
ATOM   3778 C CG  . ASN A 1 481 ? 20.402  72.160 39.476 1.00 43.61  ? 481  ASN A CG  1 
ATOM   3779 O OD1 . ASN A 1 481 ? 20.598  72.572 40.622 1.00 43.61  ? 481  ASN A OD1 1 
ATOM   3780 N ND2 . ASN A 1 481 ? 21.386  71.963 38.605 1.00 43.61  ? 481  ASN A ND2 1 
ATOM   3781 N N   . PRO A 1 482 ? 18.146  72.788 42.250 1.00 41.49  ? 482  PRO A N   1 
ATOM   3782 C CA  . PRO A 1 482 ? 17.961  73.938 43.140 1.00 41.49  ? 482  PRO A CA  1 
ATOM   3783 C C   . PRO A 1 482 ? 18.811  75.171 42.815 1.00 41.49  ? 482  PRO A C   1 
ATOM   3784 O O   . PRO A 1 482 ? 18.542  76.274 43.302 1.00 41.49  ? 482  PRO A O   1 
ATOM   3785 C CB  . PRO A 1 482 ? 18.291  73.358 44.510 1.00 40.60  ? 482  PRO A CB  1 
ATOM   3786 C CG  . PRO A 1 482 ? 19.322  72.334 44.195 1.00 40.60  ? 482  PRO A CG  1 
ATOM   3787 C CD  . PRO A 1 482 ? 18.732  71.655 42.986 1.00 40.60  ? 482  PRO A CD  1 
ATOM   3788 N N   . ASN A 1 483 ? 19.826  74.976 41.982 1.00 45.55  ? 483  ASN A N   1 
ATOM   3789 C CA  . ASN A 1 483 ? 20.738  76.048 41.605 1.00 45.55  ? 483  ASN A CA  1 
ATOM   3790 C C   . ASN A 1 483 ? 20.376  76.807 40.346 1.00 45.55  ? 483  ASN A C   1 
ATOM   3791 O O   . ASN A 1 483 ? 19.826  76.252 39.391 1.00 45.55  ? 483  ASN A O   1 
ATOM   3792 C CB  . ASN A 1 483 ? 22.142  75.485 41.431 1.00 47.87  ? 483  ASN A CB  1 
ATOM   3793 C CG  . ASN A 1 483 ? 22.643  74.803 42.675 1.00 47.87  ? 483  ASN A CG  1 
ATOM   3794 O OD1 . ASN A 1 483 ? 22.945  75.457 43.687 1.00 47.87  ? 483  ASN A OD1 1 
ATOM   3795 N ND2 . ASN A 1 483 ? 22.724  73.475 42.621 1.00 47.87  ? 483  ASN A ND2 1 
ATOM   3796 N N   . GLU A 1 484 ? 20.710  78.092 40.361 1.00 62.69  ? 484  GLU A N   1 
ATOM   3797 C CA  . GLU A 1 484 ? 20.491  78.972 39.221 1.00 62.69  ? 484  GLU A CA  1 
ATOM   3798 C C   . GLU A 1 484 ? 21.553  78.628 38.171 1.00 62.69  ? 484  GLU A C   1 
ATOM   3799 O O   . GLU A 1 484 ? 22.747  78.547 38.484 1.00 62.69  ? 484  GLU A O   1 
ATOM   3800 C CB  . GLU A 1 484 ? 20.631  80.426 39.668 1.00 95.87  ? 484  GLU A CB  1 
ATOM   3801 C CG  . GLU A 1 484 ? 19.422  80.924 40.430 1.00 95.87  ? 484  GLU A CG  1 
ATOM   3802 C CD  . GLU A 1 484 ? 18.297  81.285 39.477 1.00 95.87  ? 484  GLU A CD  1 
ATOM   3803 O OE1 . GLU A 1 484 ? 18.199  80.620 38.408 1.00 95.87  ? 484  GLU A OE1 1 
ATOM   3804 O OE2 . GLU A 1 484 ? 17.516  82.224 39.791 1.00 95.87  ? 484  GLU A OE2 1 
ATOM   3805 N N   . PRO A 1 485 ? 21.127  78.432 36.910 0.75 76.21  ? 485  PRO A N   1 
ATOM   3806 C CA  . PRO A 1 485 ? 21.993  78.088 35.774 0.75 76.21  ? 485  PRO A CA  1 
ATOM   3807 C C   . PRO A 1 485 ? 23.378  78.728 35.782 0.75 76.21  ? 485  PRO A C   1 
ATOM   3808 O O   . PRO A 1 485 ? 24.384  78.044 35.983 0.75 76.21  ? 485  PRO A O   1 
ATOM   3809 C CB  . PRO A 1 485 ? 21.169  78.527 34.568 0.75 71.95  ? 485  PRO A CB  1 
ATOM   3810 C CG  . PRO A 1 485 ? 19.765  78.237 35.012 0.75 71.95  ? 485  PRO A CG  1 
ATOM   3811 C CD  . PRO A 1 485 ? 19.761  78.759 36.447 0.75 71.95  ? 485  PRO A CD  1 
ATOM   3812 N N   . HIS A 1 486 ? 23.432  80.038 35.575 0.75 70.77  ? 486  HIS A N   1 
ATOM   3813 C CA  . HIS A 1 486 ? 24.714  80.733 35.535 0.75 70.77  ? 486  HIS A CA  1 
ATOM   3814 C C   . HIS A 1 486 ? 24.963  81.637 36.741 0.75 70.77  ? 486  HIS A C   1 
ATOM   3815 O O   . HIS A 1 486 ? 25.643  82.658 36.627 0.75 70.77  ? 486  HIS A O   1 
ATOM   3816 C CB  . HIS A 1 486 ? 24.808  81.568 34.254 0.75 82.37  ? 486  HIS A CB  1 
ATOM   3817 C CG  . HIS A 1 486 ? 24.516  80.794 33.005 0.75 82.37  ? 486  HIS A CG  1 
ATOM   3818 N ND1 . HIS A 1 486 ? 25.215  79.660 32.649 0.75 82.37  ? 486  HIS A ND1 1 
ATOM   3819 C CD2 . HIS A 1 486 ? 23.606  81.000 32.022 0.75 82.37  ? 486  HIS A CD2 1 
ATOM   3820 C CE1 . HIS A 1 486 ? 24.748  79.200 31.501 0.75 82.37  ? 486  HIS A CE1 1 
ATOM   3821 N NE2 . HIS A 1 486 ? 23.772  79.995 31.099 0.75 82.37  ? 486  HIS A NE2 1 
ATOM   3822 N N   . SER A 1 487 ? 24.423  81.262 37.894 0.75 50.80  ? 487  SER A N   1 
ATOM   3823 C CA  . SER A 1 487 ? 24.593  82.055 39.107 0.75 50.80  ? 487  SER A CA  1 
ATOM   3824 C C   . SER A 1 487 ? 26.057  82.164 39.554 0.75 50.80  ? 487  SER A C   1 
ATOM   3825 O O   . SER A 1 487 ? 26.917  81.413 39.090 0.75 50.80  ? 487  SER A O   1 
ATOM   3826 C CB  . SER A 1 487 ? 23.758  81.440 40.230 0.75 58.74  ? 487  SER A CB  1 
ATOM   3827 O OG  . SER A 1 487 ? 24.080  82.008 41.485 0.75 58.74  ? 487  SER A OG  1 
ATOM   3828 N N   . GLN A 1 488 ? 26.329  83.110 40.450 0.75 49.45  ? 488  GLN A N   1 
ATOM   3829 C CA  . GLN A 1 488 ? 27.674  83.309 40.988 0.75 49.45  ? 488  GLN A CA  1 
ATOM   3830 C C   . GLN A 1 488 ? 27.696  82.818 42.431 0.75 49.45  ? 488  GLN A C   1 
ATOM   3831 O O   . GLN A 1 488 ? 28.754  82.731 43.059 0.75 49.45  ? 488  GLN A O   1 
ATOM   3832 C CB  . GLN A 1 488 ? 28.059  84.791 40.969 0.75 63.60  ? 488  GLN A CB  1 
ATOM   3833 C CG  . GLN A 1 488 ? 28.158  85.414 39.589 0.75 63.60  ? 488  GLN A CG  1 
ATOM   3834 C CD  . GLN A 1 488 ? 29.118  84.668 38.683 0.75 63.60  ? 488  GLN A CD  1 
ATOM   3835 O OE1 . GLN A 1 488 ? 30.285  84.456 39.025 0.75 63.60  ? 488  GLN A OE1 1 
ATOM   3836 N NE2 . GLN A 1 488 ? 28.630  84.268 37.515 0.75 63.60  ? 488  GLN A NE2 1 
ATOM   3837 N N   . GLU A 1 489 ? 26.511  82.512 42.951 0.75 49.02  ? 489  GLU A N   1 
ATOM   3838 C CA  . GLU A 1 489 ? 26.357  82.030 44.325 0.75 49.02  ? 489  GLU A CA  1 
ATOM   3839 C C   . GLU A 1 489 ? 26.951  80.639 44.491 0.75 49.02  ? 489  GLU A C   1 
ATOM   3840 O O   . GLU A 1 489 ? 27.356  80.014 43.515 0.75 49.02  ? 489  GLU A O   1 
ATOM   3841 C CB  . GLU A 1 489 ? 24.875  81.977 44.702 0.75 78.77  ? 489  GLU A CB  1 
ATOM   3842 C CG  . GLU A 1 489 ? 24.154  83.307 44.649 0.75 78.77  ? 489  GLU A CG  1 
ATOM   3843 C CD  . GLU A 1 489 ? 24.738  84.321 45.615 0.75 78.77  ? 489  GLU A CD  1 
ATOM   3844 O OE1 . GLU A 1 489 ? 24.974  83.961 46.794 0.75 78.77  ? 489  GLU A OE1 1 
ATOM   3845 O OE2 . GLU A 1 489 ? 24.953  85.483 45.198 0.75 78.77  ? 489  GLU A OE2 1 
ATOM   3846 N N   . SER A 1 490 ? 26.994  80.161 45.733 1.00 67.02  ? 490  SER A N   1 
ATOM   3847 C CA  . SER A 1 490 ? 27.522  78.821 46.031 1.00 67.02  ? 490  SER A CA  1 
ATOM   3848 C C   . SER A 1 490 ? 26.628  77.737 45.443 1.00 67.02  ? 490  SER A C   1 
ATOM   3849 O O   . SER A 1 490 ? 25.400  77.879 45.414 1.00 67.02  ? 490  SER A O   1 
ATOM   3850 C CB  . SER A 1 490 ? 27.632  78.601 47.542 1.00 59.83  ? 490  SER A CB  1 
ATOM   3851 O OG  . SER A 1 490 ? 28.874  79.071 48.035 1.00 59.83  ? 490  SER A OG  1 
ATOM   3852 N N   . LYS A 1 491 ? 27.243  76.653 44.983 1.00 46.91  ? 491  LYS A N   1 
ATOM   3853 C CA  . LYS A 1 491 ? 26.482  75.566 44.394 1.00 46.91  ? 491  LYS A CA  1 
ATOM   3854 C C   . LYS A 1 491 ? 26.169  74.420 45.351 1.00 46.91  ? 491  LYS A C   1 
ATOM   3855 O O   . LYS A 1 491 ? 27.054  73.913 46.050 1.00 46.91  ? 491  LYS A O   1 
ATOM   3856 C CB  . LYS A 1 491 ? 27.215  75.016 43.175 1.00 64.53  ? 491  LYS A CB  1 
ATOM   3857 C CG  . LYS A 1 491 ? 27.377  76.030 42.055 1.00 64.53  ? 491  LYS A CG  1 
ATOM   3858 C CD  . LYS A 1 491 ? 26.033  76.612 41.623 1.00 64.53  ? 491  LYS A CD  1 
ATOM   3859 C CE  . LYS A 1 491 ? 26.206  77.662 40.533 1.00 64.53  ? 491  LYS A CE  1 
ATOM   3860 N NZ  . LYS A 1 491 ? 24.885  78.166 40.051 1.00 64.53  ? 491  LYS A NZ  1 
ATOM   3861 N N   . TRP A 1 492 ? 24.891  74.040 45.380 1.00 36.67  ? 492  TRP A N   1 
ATOM   3862 C CA  . TRP A 1 492 ? 24.395  72.934 46.186 1.00 36.67  ? 492  TRP A CA  1 
ATOM   3863 C C   . TRP A 1 492 ? 24.809  71.726 45.360 1.00 36.67  ? 492  TRP A C   1 
ATOM   3864 O O   . TRP A 1 492 ? 24.180  71.417 44.358 1.00 36.67  ? 492  TRP A O   1 
ATOM   3865 C CB  . TRP A 1 492 ? 22.869  73.002 46.265 1.00 31.04  ? 492  TRP A CB  1 
ATOM   3866 C CG  . TRP A 1 492 ? 22.212  71.990 47.166 1.00 31.04  ? 492  TRP A CG  1 
ATOM   3867 C CD1 . TRP A 1 492 ? 22.689  70.758 47.510 1.00 31.04  ? 492  TRP A CD1 1 
ATOM   3868 C CD2 . TRP A 1 492 ? 20.925  72.103 47.777 1.00 31.04  ? 492  TRP A CD2 1 
ATOM   3869 N NE1 . TRP A 1 492 ? 21.780  70.097 48.295 1.00 31.04  ? 492  TRP A NE1 1 
ATOM   3870 C CE2 . TRP A 1 492 ? 20.685  70.899 48.473 1.00 31.04  ? 492  TRP A CE2 1 
ATOM   3871 C CE3 . TRP A 1 492 ? 19.947  73.103 47.804 1.00 31.04  ? 492  TRP A CE3 1 
ATOM   3872 C CZ2 . TRP A 1 492 ? 19.506  70.669 49.188 1.00 31.04  ? 492  TRP A CZ2 1 
ATOM   3873 C CZ3 . TRP A 1 492 ? 18.778  72.874 48.514 1.00 31.04  ? 492  TRP A CZ3 1 
ATOM   3874 C CH2 . TRP A 1 492 ? 18.568  71.664 49.195 1.00 31.04  ? 492  TRP A CH2 1 
ATOM   3875 N N   . PRO A 1 493 ? 25.881  71.033 45.755 1.00 36.87  ? 493  PRO A N   1 
ATOM   3876 C CA  . PRO A 1 493 ? 26.293  69.875 44.967 1.00 36.87  ? 493  PRO A CA  1 
ATOM   3877 C C   . PRO A 1 493 ? 25.235  68.783 44.910 1.00 36.87  ? 493  PRO A C   1 
ATOM   3878 O O   . PRO A 1 493 ? 24.351  68.712 45.755 1.00 36.87  ? 493  PRO A O   1 
ATOM   3879 C CB  . PRO A 1 493 ? 27.561  69.425 45.671 1.00 34.29  ? 493  PRO A CB  1 
ATOM   3880 C CG  . PRO A 1 493 ? 27.253  69.725 47.082 1.00 34.29  ? 493  PRO A CG  1 
ATOM   3881 C CD  . PRO A 1 493 ? 26.658  71.111 46.999 1.00 34.29  ? 493  PRO A CD  1 
ATOM   3882 N N   . LEU A 1 494 ? 25.340  67.944 43.888 1.00 43.61  ? 494  LEU A N   1 
ATOM   3883 C CA  . LEU A 1 494 ? 24.431  66.829 43.661 1.00 43.61  ? 494  LEU A CA  1 
ATOM   3884 C C   . LEU A 1 494 ? 24.877  65.669 44.563 1.00 43.61  ? 494  LEU A C   1 
ATOM   3885 O O   . LEU A 1 494 ? 26.065  65.505 44.831 1.00 43.61  ? 494  LEU A O   1 
ATOM   3886 C CB  . LEU A 1 494 ? 24.527  66.427 42.191 1.00 33.79  ? 494  LEU A CB  1 
ATOM   3887 C CG  . LEU A 1 494 ? 23.548  65.510 41.470 1.00 33.79  ? 494  LEU A CG  1 
ATOM   3888 C CD1 . LEU A 1 494 ? 22.197  66.178 41.304 1.00 33.79  ? 494  LEU A CD1 1 
ATOM   3889 C CD2 . LEU A 1 494 ? 24.119  65.205 40.105 1.00 33.79  ? 494  LEU A CD2 1 
ATOM   3890 N N   . PHE A 1 495 ? 23.927  64.880 45.049 1.00 40.89  ? 495  PHE A N   1 
ATOM   3891 C CA  . PHE A 1 495 ? 24.254  63.744 45.895 1.00 40.89  ? 495  PHE A CA  1 
ATOM   3892 C C   . PHE A 1 495 ? 24.455  62.522 44.994 1.00 40.89  ? 495  PHE A C   1 
ATOM   3893 O O   . PHE A 1 495 ? 23.594  62.178 44.184 1.00 40.89  ? 495  PHE A O   1 
ATOM   3894 C CB  . PHE A 1 495 ? 23.128  63.512 46.912 1.00 27.54  ? 495  PHE A CB  1 
ATOM   3895 C CG  . PHE A 1 495 ? 23.303  62.282 47.767 1.00 27.54  ? 495  PHE A CG  1 
ATOM   3896 C CD1 . PHE A 1 495 ? 22.938  61.024 47.291 1.00 27.54  ? 495  PHE A CD1 1 
ATOM   3897 C CD2 . PHE A 1 495 ? 23.819  62.383 49.052 1.00 27.54  ? 495  PHE A CD2 1 
ATOM   3898 C CE1 . PHE A 1 495 ? 23.079  59.894 48.077 1.00 27.54  ? 495  PHE A CE1 1 
ATOM   3899 C CE2 . PHE A 1 495 ? 23.966  61.250 49.852 1.00 27.54  ? 495  PHE A CE2 1 
ATOM   3900 C CZ  . PHE A 1 495 ? 23.594  60.002 49.358 1.00 27.54  ? 495  PHE A CZ  1 
ATOM   3901 N N   . THR A 1 496 ? 25.607  61.878 45.136 1.00 43.47  ? 496  THR A N   1 
ATOM   3902 C CA  . THR A 1 496 ? 25.943  60.711 44.331 1.00 43.47  ? 496  THR A CA  1 
ATOM   3903 C C   . THR A 1 496 ? 26.271  59.513 45.209 1.00 43.47  ? 496  THR A C   1 
ATOM   3904 O O   . THR A 1 496 ? 26.765  59.669 46.318 1.00 43.47  ? 496  THR A O   1 
ATOM   3905 C CB  . THR A 1 496 ? 27.156  61.005 43.450 1.00 47.98  ? 496  THR A CB  1 
ATOM   3906 O OG1 . THR A 1 496 ? 28.304  61.247 44.282 1.00 47.98  ? 496  THR A OG1 1 
ATOM   3907 C CG2 . THR A 1 496 ? 26.886  62.222 42.587 1.00 47.98  ? 496  THR A CG2 1 
ATOM   3908 N N   . THR A 1 497 ? 26.005  58.316 44.699 1.00 48.63  ? 497  THR A N   1 
ATOM   3909 C CA  . THR A 1 497 ? 26.263  57.091 45.442 1.00 48.63  ? 497  THR A CA  1 
ATOM   3910 C C   . THR A 1 497 ? 27.698  57.088 45.923 1.00 48.63  ? 497  THR A C   1 
ATOM   3911 O O   . THR A 1 497 ? 27.999  56.594 47.012 1.00 48.63  ? 497  THR A O   1 
ATOM   3912 C CB  . THR A 1 497 ? 26.069  55.826 44.568 1.00 51.87  ? 497  THR A CB  1 
ATOM   3913 O OG1 . THR A 1 497 ? 24.743  55.802 44.026 1.00 51.87  ? 497  THR A OG1 1 
ATOM   3914 C CG2 . THR A 1 497 ? 26.280  54.569 45.404 1.00 51.87  ? 497  THR A CG2 1 
ATOM   3915 N N   . LYS A 1 498 ? 28.581  57.659 45.112 1.00 43.01  ? 498  LYS A N   1 
ATOM   3916 C CA  . LYS A 1 498 ? 29.991  57.689 45.443 1.00 43.01  ? 498  LYS A CA  1 
ATOM   3917 C C   . LYS A 1 498 ? 30.405  58.713 46.500 1.00 43.01  ? 498  LYS A C   1 
ATOM   3918 O O   . LYS A 1 498 ? 30.843  58.334 47.586 1.00 43.01  ? 498  LYS A O   1 
ATOM   3919 C CB  . LYS A 1 498 ? 30.802  57.907 44.168 1.00 71.41  ? 498  LYS A CB  1 
ATOM   3920 C CG  . LYS A 1 498 ? 32.312  57.765 44.361 1.00 71.41  ? 498  LYS A CG  1 
ATOM   3921 C CD  . LYS A 1 498 ? 33.048  57.975 43.044 1.00 71.41  ? 498  LYS A CD  1 
ATOM   3922 C CE  . LYS A 1 498 ? 34.560  57.915 43.220 1.00 71.41  ? 498  LYS A CE  1 
ATOM   3923 N NZ  . LYS A 1 498 ? 35.230  58.032 41.881 1.00 71.41  ? 498  LYS A NZ  1 
ATOM   3924 N N   . GLU A 1 499 ? 30.258  60.002 46.185 1.00 40.73  ? 499  GLU A N   1 
ATOM   3925 C CA  . GLU A 1 499 ? 30.663  61.087 47.092 1.00 40.73  ? 499  GLU A CA  1 
ATOM   3926 C C   . GLU A 1 499 ? 29.745  61.350 48.285 1.00 40.73  ? 499  GLU A C   1 
ATOM   3927 O O   . GLU A 1 499 ? 30.211  61.737 49.353 1.00 40.73  ? 499  GLU A O   1 
ATOM   3928 C CB  . GLU A 1 499 ? 30.815  62.390 46.309 1.00 93.48  ? 499  GLU A CB  1 
ATOM   3929 C CG  . GLU A 1 499 ? 31.507  62.249 44.968 1.00 93.48  ? 499  GLU A CG  1 
ATOM   3930 C CD  . GLU A 1 499 ? 32.879  61.627 45.097 1.00 93.48  ? 499  GLU A CD  1 
ATOM   3931 O OE1 . GLU A 1 499 ? 33.635  62.056 46.004 1.00 93.48  ? 499  GLU A OE1 1 
ATOM   3932 O OE2 . GLU A 1 499 ? 33.207  60.719 44.289 1.00 93.48  ? 499  GLU A OE2 1 
ATOM   3933 N N   . GLN A 1 500 ? 28.441  61.178 48.088 1.00 36.92  ? 500  GLN A N   1 
ATOM   3934 C CA  . GLN A 1 500 ? 27.462  61.380 49.156 1.00 36.92  ? 500  GLN A CA  1 
ATOM   3935 C C   . GLN A 1 500 ? 27.460  62.770 49.780 1.00 36.92  ? 500  GLN A C   1 
ATOM   3936 O O   . GLN A 1 500 ? 27.270  62.929 50.977 1.00 36.92  ? 500  GLN A O   1 
ATOM   3937 C CB  . GLN A 1 500 ? 27.674  60.315 50.232 1.00 46.08  ? 500  GLN A CB  1 
ATOM   3938 C CG  . GLN A 1 500 ? 27.220  58.947 49.758 1.00 46.08  ? 500  GLN A CG  1 
ATOM   3939 C CD  . GLN A 1 500 ? 27.452  57.861 50.774 1.00 46.08  ? 500  GLN A CD  1 
ATOM   3940 O OE1 . GLN A 1 500 ? 28.448  57.138 50.707 1.00 46.08  ? 500  GLN A OE1 1 
ATOM   3941 N NE2 . GLN A 1 500 ? 26.538  57.742 51.734 1.00 46.08  ? 500  GLN A NE2 1 
ATOM   3942 N N   . LYS A 1 501 ? 27.642  63.781 48.946 1.00 38.17  ? 501  LYS A N   1 
ATOM   3943 C CA  . LYS A 1 501 ? 27.682  65.153 49.414 1.00 38.17  ? 501  LYS A CA  1 
ATOM   3944 C C   . LYS A 1 501 ? 26.335  65.722 49.822 1.00 38.17  ? 501  LYS A C   1 
ATOM   3945 O O   . LYS A 1 501 ? 25.293  65.354 49.289 1.00 38.17  ? 501  LYS A O   1 
ATOM   3946 C CB  . LYS A 1 501 ? 28.289  66.043 48.333 1.00 50.03  ? 501  LYS A CB  1 
ATOM   3947 C CG  . LYS A 1 501 ? 29.723  65.666 47.965 1.00 50.03  ? 501  LYS A CG  1 
ATOM   3948 C CD  . LYS A 1 501 ? 30.286  66.594 46.903 1.00 50.03  ? 501  LYS A CD  1 
ATOM   3949 C CE  . LYS A 1 501 ? 31.726  66.246 46.606 1.00 50.03  ? 501  LYS A CE  1 
ATOM   3950 N NZ  . LYS A 1 501 ? 32.278  67.083 45.505 1.00 50.03  ? 501  LYS A NZ  1 
ATOM   3951 N N   . PHE A 1 502 ? 26.361  66.619 50.790 1.00 34.28  ? 502  PHE A N   1 
ATOM   3952 C CA  . PHE A 1 502 ? 25.149  67.271 51.219 1.00 34.28  ? 502  PHE A CA  1 
ATOM   3953 C C   . PHE A 1 502 ? 25.548  68.625 51.784 1.00 34.28  ? 502  PHE A C   1 
ATOM   3954 O O   . PHE A 1 502 ? 26.724  68.870 52.033 1.00 34.28  ? 502  PHE A O   1 
ATOM   3955 C CB  . PHE A 1 502 ? 24.410  66.420 52.254 1.00 28.22  ? 502  PHE A CB  1 
ATOM   3956 C CG  . PHE A 1 502 ? 24.960  66.520 53.648 1.00 28.22  ? 502  PHE A CG  1 
ATOM   3957 C CD1 . PHE A 1 502 ? 24.460  67.470 54.534 1.00 28.22  ? 502  PHE A CD1 1 
ATOM   3958 C CD2 . PHE A 1 502 ? 25.935  65.639 54.091 1.00 28.22  ? 502  PHE A CD2 1 
ATOM   3959 C CE1 . PHE A 1 502 ? 24.917  67.536 55.834 1.00 28.22  ? 502  PHE A CE1 1 
ATOM   3960 C CE2 . PHE A 1 502 ? 26.399  65.698 55.398 1.00 28.22  ? 502  PHE A CE2 1 
ATOM   3961 C CZ  . PHE A 1 502 ? 25.887  66.647 56.271 1.00 28.22  ? 502  PHE A CZ  1 
ATOM   3962 N N   . ILE A 1 503 ? 24.584  69.512 51.982 1.00 36.54  ? 503  ILE A N   1 
ATOM   3963 C CA  . ILE A 1 503 ? 24.906  70.827 52.508 1.00 36.54  ? 503  ILE A CA  1 
ATOM   3964 C C   . ILE A 1 503 ? 24.168  71.146 53.797 1.00 36.54  ? 503  ILE A C   1 
ATOM   3965 O O   . ILE A 1 503 ? 23.113  70.587 54.072 1.00 36.54  ? 503  ILE A O   1 
ATOM   3966 C CB  . ILE A 1 503 ? 24.537  71.928 51.509 1.00 44.47  ? 503  ILE A CB  1 
ATOM   3967 C CG1 . ILE A 1 503 ? 23.020  71.966 51.339 1.00 44.47  ? 503  ILE A CG1 1 
ATOM   3968 C CG2 . ILE A 1 503 ? 25.198  71.669 50.164 1.00 44.47  ? 503  ILE A CG2 1 
ATOM   3969 C CD1 . ILE A 1 503 ? 22.513  73.229 50.697 1.00 44.47  ? 503  ILE A CD1 1 
ATOM   3970 N N   . ASP A 1 504 ? 24.740  72.043 54.594 1.00 53.82  ? 504  ASP A N   1 
ATOM   3971 C CA  . ASP A 1 504 ? 24.090  72.487 55.820 1.00 53.82  ? 504  ASP A CA  1 
ATOM   3972 C C   . ASP A 1 504 ? 23.219  73.654 55.361 1.00 53.82  ? 504  ASP A C   1 
ATOM   3973 O O   . ASP A 1 504 ? 23.563  74.352 54.406 1.00 53.82  ? 504  ASP A O   1 
ATOM   3974 C CB  . ASP A 1 504 ? 25.105  72.993 56.852 1.00 95.56  ? 504  ASP A CB  1 
ATOM   3975 C CG  . ASP A 1 504 ? 25.758  71.865 57.650 1.00 95.56  ? 504  ASP A CG  1 
ATOM   3976 O OD1 . ASP A 1 504 ? 25.116  70.799 57.815 1.00 95.56  ? 504  ASP A OD1 1 
ATOM   3977 O OD2 . ASP A 1 504 ? 26.905  72.051 58.138 1.00 95.56  ? 504  ASP A OD2 1 
ATOM   3978 N N   . LEU A 1 505 ? 22.098  73.870 56.031 1.00 47.21  ? 505  LEU A N   1 
ATOM   3979 C CA  . LEU A 1 505 ? 21.212  74.952 55.652 1.00 47.21  ? 505  LEU A CA  1 
ATOM   3980 C C   . LEU A 1 505 ? 20.969  75.847 56.870 1.00 47.21  ? 505  LEU A C   1 
ATOM   3981 O O   . LEU A 1 505 ? 20.158  75.526 57.733 1.00 47.21  ? 505  LEU A O   1 
ATOM   3982 C CB  . LEU A 1 505 ? 19.906  74.361 55.124 1.00 33.68  ? 505  LEU A CB  1 
ATOM   3983 C CG  . LEU A 1 505 ? 19.205  75.034 53.950 1.00 33.68  ? 505  LEU A CG  1 
ATOM   3984 C CD1 . LEU A 1 505 ? 20.156  75.215 52.781 1.00 33.68  ? 505  LEU A CD1 1 
ATOM   3985 C CD2 . LEU A 1 505 ? 18.032  74.177 53.545 1.00 33.68  ? 505  LEU A CD2 1 
ATOM   3986 N N   . ASN A 1 506 ? 21.699  76.959 56.939 1.00 54.45  ? 506  ASN A N   1 
ATOM   3987 C CA  . ASN A 1 506 ? 21.573  77.916 58.039 1.00 54.45  ? 506  ASN A CA  1 
ATOM   3988 C C   . ASN A 1 506 ? 21.963  79.310 57.567 1.00 54.45  ? 506  ASN A C   1 
ATOM   3989 O O   . ASN A 1 506 ? 22.013  79.562 56.366 1.00 54.45  ? 506  ASN A O   1 
ATOM   3990 C CB  . ASN A 1 506 ? 22.466  77.510 59.204 1.00 40.35  ? 506  ASN A CB  1 
ATOM   3991 C CG  . ASN A 1 506 ? 23.885  77.307 58.784 1.00 40.35  ? 506  ASN A CG  1 
ATOM   3992 O OD1 . ASN A 1 506 ? 24.458  78.140 58.091 1.00 40.35  ? 506  ASN A OD1 1 
ATOM   3993 N ND2 . ASN A 1 506 ? 24.471  76.196 59.199 1.00 40.35  ? 506  ASN A ND2 1 
ATOM   3994 N N   . THR A 1 507 ? 22.251  80.211 58.503 1.00 49.94  ? 507  THR A N   1 
ATOM   3995 C CA  . THR A 1 507 ? 22.618  81.579 58.143 1.00 49.94  ? 507  THR A CA  1 
ATOM   3996 C C   . THR A 1 507 ? 24.120  81.804 57.987 1.00 49.94  ? 507  THR A C   1 
ATOM   3997 O O   . THR A 1 507 ? 24.586  82.937 58.024 1.00 49.94  ? 507  THR A O   1 
ATOM   3998 C CB  . THR A 1 507 ? 22.059  82.596 59.165 1.00 40.95  ? 507  THR A CB  1 
ATOM   3999 O OG1 . THR A 1 507 ? 22.517  82.266 60.482 1.00 40.95  ? 507  THR A OG1 1 
ATOM   4000 C CG2 . THR A 1 507 ? 20.551  82.580 59.153 1.00 40.95  ? 507  THR A CG2 1 
ATOM   4001 N N   . GLU A 1 508 ? 24.880  80.734 57.795 1.00 59.84  ? 508  GLU A N   1 
ATOM   4002 C CA  . GLU A 1 508 ? 26.330  80.850 57.619 1.00 59.84  ? 508  GLU A CA  1 
ATOM   4003 C C   . GLU A 1 508 ? 26.716  80.484 56.189 1.00 59.84  ? 508  GLU A C   1 
ATOM   4004 O O   . GLU A 1 508 ? 25.943  79.831 55.482 1.00 59.84  ? 508  GLU A O   1 
ATOM   4005 C CB  . GLU A 1 508 ? 27.057  79.917 58.588 1.00 88.57  ? 508  GLU A CB  1 
ATOM   4006 C CG  . GLU A 1 508 ? 26.854  80.271 60.045 1.00 88.57  ? 508  GLU A CG  1 
ATOM   4007 C CD  . GLU A 1 508 ? 27.371  79.188 60.981 1.00 88.57  ? 508  GLU A CD  1 
ATOM   4008 O OE1 . GLU A 1 508 ? 28.600  78.921 60.985 1.00 88.57  ? 508  GLU A OE1 1 
ATOM   4009 O OE2 . GLU A 1 508 ? 26.540  78.596 61.712 1.00 88.57  ? 508  GLU A OE2 1 
ATOM   4010 N N   . PRO A 1 509 ? 27.921  80.890 55.743 1.00 56.06  ? 509  PRO A N   1 
ATOM   4011 C CA  . PRO A 1 509 ? 28.359  80.573 54.378 1.00 56.06  ? 509  PRO A CA  1 
ATOM   4012 C C   . PRO A 1 509 ? 28.221  79.074 54.122 1.00 56.06  ? 509  PRO A C   1 
ATOM   4013 O O   . PRO A 1 509 ? 28.772  78.255 54.861 1.00 56.06  ? 509  PRO A O   1 
ATOM   4014 C CB  . PRO A 1 509 ? 29.820  81.023 54.367 1.00 54.13  ? 509  PRO A CB  1 
ATOM   4015 C CG  . PRO A 1 509 ? 29.844  82.134 55.384 1.00 54.13  ? 509  PRO A CG  1 
ATOM   4016 C CD  . PRO A 1 509 ? 28.993  81.569 56.494 1.00 54.13  ? 509  PRO A CD  1 
ATOM   4017 N N   . MET A 1 510 ? 27.487  78.719 53.076 1.00 60.03  ? 510  MET A N   1 
ATOM   4018 C CA  . MET A 1 510 ? 27.271  77.321 52.739 1.00 60.03  ? 510  MET A CA  1 
ATOM   4019 C C   . MET A 1 510 ? 28.523  76.467 52.868 1.00 60.03  ? 510  MET A C   1 
ATOM   4020 O O   . MET A 1 510 ? 29.614  76.891 52.490 1.00 60.03  ? 510  MET A O   1 
ATOM   4021 C CB  . MET A 1 510 ? 26.731  77.196 51.312 1.00 84.41  ? 510  MET A CB  1 
ATOM   4022 C CG  . MET A 1 510 ? 26.594  75.750 50.824 1.00 84.41  ? 510  MET A CG  1 
ATOM   4023 S SD  . MET A 1 510 ? 26.025  75.638 49.094 1.00 84.41  ? 510  MET A SD  1 
ATOM   4024 C CE  . MET A 1 510 ? 24.202  75.861 49.343 1.00 84.41  ? 510  MET A CE  1 
ATOM   4025 N N   . LYS A 1 511 ? 28.346  75.267 53.415 1.00 50.04  ? 511  LYS A N   1 
ATOM   4026 C CA  . LYS A 1 511 ? 29.427  74.303 53.580 1.00 50.04  ? 511  LYS A CA  1 
ATOM   4027 C C   . LYS A 1 511 ? 28.916  72.954 53.097 1.00 50.04  ? 511  LYS A C   1 
ATOM   4028 O O   . LYS A 1 511 ? 27.798  72.551 53.413 1.00 50.04  ? 511  LYS A O   1 
ATOM   4029 C CB  . LYS A 1 511 ? 29.831  74.156 55.041 1.00 73.43  ? 511  LYS A CB  1 
ATOM   4030 C CG  . LYS A 1 511 ? 30.333  75.417 55.718 1.00 73.43  ? 511  LYS A CG  1 
ATOM   4031 C CD  . LYS A 1 511 ? 30.869  75.054 57.111 1.00 73.43  ? 511  LYS A CD  1 
ATOM   4032 C CE  . LYS A 1 511 ? 31.368  76.254 57.912 1.00 73.43  ? 511  LYS A CE  1 
ATOM   4033 N NZ  . LYS A 1 511 ? 31.852  75.815 59.275 1.00 73.43  ? 511  LYS A NZ  1 
ATOM   4034 N N   . VAL A 1 512 ? 29.734  72.259 52.323 1.00 43.56  ? 512  VAL A N   1 
ATOM   4035 C CA  . VAL A 1 512 ? 29.360  70.952 51.826 1.00 43.56  ? 512  VAL A CA  1 
ATOM   4036 C C   . VAL A 1 512 ? 29.996  69.909 52.728 1.00 43.56  ? 512  VAL A C   1 
ATOM   4037 O O   . VAL A 1 512 ? 31.103  70.100 53.216 1.00 43.56  ? 512  VAL A O   1 
ATOM   4038 C CB  . VAL A 1 512 ? 29.850  70.749 50.381 1.00 41.65  ? 512  VAL A CB  1 
ATOM   4039 C CG1 . VAL A 1 512 ? 29.620  69.311 49.947 1.00 41.65  ? 512  VAL A CG1 1 
ATOM   4040 C CG2 . VAL A 1 512 ? 29.112  71.697 49.454 1.00 41.65  ? 512  VAL A CG2 1 
ATOM   4041 N N   . HIS A 1 513 ? 29.289  68.812 52.960 1.00 47.55  ? 513  HIS A N   1 
ATOM   4042 C CA  . HIS A 1 513 ? 29.803  67.739 53.804 1.00 47.55  ? 513  HIS A CA  1 
ATOM   4043 C C   . HIS A 1 513 ? 29.599  66.400 53.114 1.00 47.55  ? 513  HIS A C   1 
ATOM   4044 O O   . HIS A 1 513 ? 29.206  66.345 51.951 1.00 47.55  ? 513  HIS A O   1 
ATOM   4045 C CB  . HIS A 1 513 ? 29.063  67.701 55.131 1.00 59.92  ? 513  HIS A CB  1 
ATOM   4046 C CG  . HIS A 1 513 ? 29.171  68.959 55.925 1.00 59.92  ? 513  HIS A CG  1 
ATOM   4047 N ND1 . HIS A 1 513 ? 30.360  69.391 56.471 1.00 59.92  ? 513  HIS A ND1 1 
ATOM   4048 C CD2 . HIS A 1 513 ? 28.225  69.845 56.322 1.00 59.92  ? 513  HIS A CD2 1 
ATOM   4049 C CE1 . HIS A 1 513 ? 30.141  70.488 57.176 1.00 59.92  ? 513  HIS A CE1 1 
ATOM   4050 N NE2 . HIS A 1 513 ? 28.854  70.784 57.103 1.00 59.92  ? 513  HIS A NE2 1 
ATOM   4051 N N   . GLN A 1 514 ? 29.843  65.319 53.847 1.00 40.04  ? 514  GLN A N   1 
ATOM   4052 C CA  . GLN A 1 514 ? 29.669  63.991 53.299 1.00 40.04  ? 514  GLN A CA  1 
ATOM   4053 C C   . GLN A 1 514 ? 29.211  62.995 54.339 1.00 40.04  ? 514  GLN A C   1 
ATOM   4054 O O   . GLN A 1 514 ? 29.466  63.151 55.523 1.00 40.04  ? 514  GLN A O   1 
ATOM   4055 C CB  . GLN A 1 514 ? 30.968  63.502 52.678 1.00 55.70  ? 514  GLN A CB  1 
ATOM   4056 C CG  . GLN A 1 514 ? 31.296  64.146 51.356 1.00 55.70  ? 514  GLN A CG  1 
ATOM   4057 C CD  . GLN A 1 514 ? 32.643  63.702 50.836 1.00 55.70  ? 514  GLN A CD  1 
ATOM   4058 O OE1 . GLN A 1 514 ? 33.684  64.160 51.308 1.00 55.70  ? 514  GLN A OE1 1 
ATOM   4059 N NE2 . GLN A 1 514 ? 32.633  62.786 49.869 1.00 55.70  ? 514  GLN A NE2 1 
ATOM   4060 N N   . ARG A 1 515 ? 28.517  61.971 53.865 1.00 42.28  ? 515  ARG A N   1 
ATOM   4061 C CA  . ARG A 1 515 ? 28.013  60.898 54.697 1.00 42.28  ? 515  ARG A CA  1 
ATOM   4062 C C   . ARG A 1 515 ? 27.294  61.337 55.960 1.00 42.28  ? 515  ARG A C   1 
ATOM   4063 O O   . ARG A 1 515 ? 27.754  61.083 57.065 1.00 42.28  ? 515  ARG A O   1 
ATOM   4064 C CB  . ARG A 1 515 ? 29.164  59.960 55.028 1.00 62.51  ? 515  ARG A CB  1 
ATOM   4065 C CG  . ARG A 1 515 ? 29.853  59.460 53.778 1.00 62.51  ? 515  ARG A CG  1 
ATOM   4066 C CD  . ARG A 1 515 ? 30.827  58.339 54.065 1.00 62.51  ? 515  ARG A CD  1 
ATOM   4067 N NE  . ARG A 1 515 ? 31.243  57.663 52.839 1.00 62.51  ? 515  ARG A NE  1 
ATOM   4068 C CZ  . ARG A 1 515 ? 31.807  56.456 52.809 1.00 62.51  ? 515  ARG A CZ  1 
ATOM   4069 N NH1 . ARG A 1 515 ? 32.026  55.789 53.943 1.00 62.51  ? 515  ARG A NH1 1 
ATOM   4070 N NH2 . ARG A 1 515 ? 32.152  55.909 51.644 1.00 62.51  ? 515  ARG A NH2 1 
ATOM   4071 N N   . LEU A 1 516 ? 26.148  61.978 55.774 1.00 39.09  ? 516  LEU A N   1 
ATOM   4072 C CA  . LEU A 1 516 ? 25.330  62.455 56.876 1.00 39.09  ? 516  LEU A CA  1 
ATOM   4073 C C   . LEU A 1 516 ? 25.068  61.347 57.892 1.00 39.09  ? 516  LEU A C   1 
ATOM   4074 O O   . LEU A 1 516 ? 24.364  60.374 57.609 1.00 39.09  ? 516  LEU A O   1 
ATOM   4075 C CB  . LEU A 1 516 ? 24.009  63.007 56.331 1.00 33.88  ? 516  LEU A CB  1 
ATOM   4076 C CG  . LEU A 1 516 ? 22.929  63.526 57.284 1.00 33.88  ? 516  LEU A CG  1 
ATOM   4077 C CD1 . LEU A 1 516 ? 23.545  64.145 58.521 1.00 33.88  ? 516  LEU A CD1 1 
ATOM   4078 C CD2 . LEU A 1 516 ? 22.087  64.541 56.546 1.00 33.88  ? 516  LEU A CD2 1 
ATOM   4079 N N   . ARG A 1 517 ? 25.656  61.515 59.073 1.00 38.08  ? 517  ARG A N   1 
ATOM   4080 C CA  . ARG A 1 517 ? 25.545  60.577 60.187 1.00 38.08  ? 517  ARG A CA  1 
ATOM   4081 C C   . ARG A 1 517 ? 25.707  59.097 59.837 1.00 38.08  ? 517  ARG A C   1 
ATOM   4082 O O   . ARG A 1 517 ? 24.884  58.275 60.224 1.00 38.08  ? 517  ARG A O   1 
ATOM   4083 C CB  . ARG A 1 517 ? 24.225  60.823 60.947 1.00 50.84  ? 517  ARG A CB  1 
ATOM   4084 C CG  . ARG A 1 517 ? 24.189  62.203 61.614 1.00 50.84  ? 517  ARG A CG  1 
ATOM   4085 C CD  . ARG A 1 517 ? 22.934  62.489 62.417 1.00 50.84  ? 517  ARG A CD  1 
ATOM   4086 N NE  . ARG A 1 517 ? 22.917  61.798 63.705 1.00 50.84  ? 517  ARG A NE  1 
ATOM   4087 C CZ  . ARG A 1 517 ? 23.791  62.024 64.682 1.00 50.84  ? 517  ARG A CZ  1 
ATOM   4088 N NH1 . ARG A 1 517 ? 24.742  62.928 64.498 1.00 50.84  ? 517  ARG A NH1 1 
ATOM   4089 N NH2 . ARG A 1 517 ? 23.723  61.350 65.833 1.00 50.84  ? 517  ARG A NH2 1 
ATOM   4090 N N   . VAL A 1 518 ? 26.788  58.758 59.130 1.00 35.77  ? 518  VAL A N   1 
ATOM   4091 C CA  . VAL A 1 518 ? 27.062  57.369 58.732 1.00 35.77  ? 518  VAL A CA  1 
ATOM   4092 C C   . VAL A 1 518 ? 27.209  56.365 59.867 1.00 35.77  ? 518  VAL A C   1 
ATOM   4093 O O   . VAL A 1 518 ? 26.630  55.289 59.814 1.00 35.77  ? 518  VAL A O   1 
ATOM   4094 C CB  . VAL A 1 518 ? 28.345  57.244 57.889 1.00 29.35  ? 518  VAL A CB  1 
ATOM   4095 C CG1 . VAL A 1 518 ? 27.993  57.111 56.435 1.00 29.35  ? 518  VAL A CG1 1 
ATOM   4096 C CG2 . VAL A 1 518 ? 29.241  58.435 58.127 1.00 29.35  ? 518  VAL A CG2 1 
ATOM   4097 N N   . GLN A 1 519 ? 28.007  56.706 60.875 1.00 39.99  ? 519  GLN A N   1 
ATOM   4098 C CA  . GLN A 1 519 ? 28.232  55.819 62.009 1.00 39.99  ? 519  GLN A CA  1 
ATOM   4099 C C   . GLN A 1 519 ? 26.938  55.231 62.545 1.00 39.99  ? 519  GLN A C   1 
ATOM   4100 O O   . GLN A 1 519 ? 26.797  54.011 62.640 1.00 39.99  ? 519  GLN A O   1 
ATOM   4101 C CB  . GLN A 1 519 ? 28.923  56.563 63.141 1.00 48.23  ? 519  GLN A CB  1 
ATOM   4102 C CG  . GLN A 1 519 ? 29.925  55.711 63.857 1.00 48.23  ? 519  GLN A CG  1 
ATOM   4103 C CD  . GLN A 1 519 ? 30.976  55.191 62.891 1.00 48.23  ? 519  GLN A CD  1 
ATOM   4104 O OE1 . GLN A 1 519 ? 31.625  55.973 62.177 1.00 48.23  ? 519  GLN A OE1 1 
ATOM   4105 N NE2 . GLN A 1 519 ? 31.147  53.870 62.852 1.00 48.23  ? 519  GLN A NE2 1 
ATOM   4106 N N   . MET A 1 520 ? 26.002  56.111 62.896 1.00 41.49  ? 520  MET A N   1 
ATOM   4107 C CA  . MET A 1 520 ? 24.716  55.695 63.437 1.00 41.49  ? 520  MET A CA  1 
ATOM   4108 C C   . MET A 1 520 ? 23.815  55.090 62.373 1.00 41.49  ? 520  MET A C   1 
ATOM   4109 O O   . MET A 1 520 ? 23.083  54.147 62.643 1.00 41.49  ? 520  MET A O   1 
ATOM   4110 C CB  . MET A 1 520 ? 24.009  56.880 64.096 1.00 57.52  ? 520  MET A CB  1 
ATOM   4111 C CG  . MET A 1 520 ? 24.825  57.575 65.177 1.00 57.52  ? 520  MET A CG  1 
ATOM   4112 S SD  . MET A 1 520 ? 25.166  56.534 66.628 1.00 57.52  ? 520  MET A SD  1 
ATOM   4113 C CE  . MET A 1 520 ? 26.881  55.922 66.255 1.00 57.52  ? 520  MET A CE  1 
ATOM   4114 N N   . CYS A 1 521 ? 23.857  55.625 61.162 1.00 35.46  ? 521  CYS A N   1 
ATOM   4115 C CA  . CYS A 1 521 ? 23.023  55.083 60.101 1.00 35.46  ? 521  CYS A CA  1 
ATOM   4116 C C   . CYS A 1 521 ? 23.402  53.617 59.830 1.00 35.46  ? 521  CYS A C   1 
ATOM   4117 O O   . CYS A 1 521 ? 22.542  52.802 59.551 1.00 35.46  ? 521  CYS A O   1 
ATOM   4118 C CB  . CYS A 1 521 ? 23.148  55.946 58.825 1.00 31.71  ? 521  CYS A CB  1 
ATOM   4119 N N   . VAL A 1 522 ? 24.681  53.269 59.924 1.00 38.16  ? 522  VAL A N   1 
ATOM   4120 C CA  . VAL A 1 522 ? 25.080  51.879 59.707 1.00 38.16  ? 522  VAL A CA  1 
ATOM   4121 C C   . VAL A 1 522 ? 24.564  51.001 60.850 1.00 38.16  ? 522  VAL A C   1 
ATOM   4122 O O   . VAL A 1 522 ? 24.263  49.823 60.652 1.00 38.16  ? 522  VAL A O   1 
ATOM   4123 C CB  . VAL A 1 522 ? 26.621  51.725 59.605 1.00 33.52  ? 522  VAL A CB  1 
ATOM   4124 C CG1 . VAL A 1 522 ? 27.013  50.255 59.708 1.00 33.52  ? 522  VAL A CG1 1 
ATOM   4125 C CG2 . VAL A 1 522 ? 27.107  52.292 58.277 1.00 33.52  ? 522  VAL A CG2 1 
ATOM   4126 N N   . PHE A 1 523 ? 24.463  51.583 62.042 1.00 34.85  ? 523  PHE A N   1 
ATOM   4127 C CA  . PHE A 1 523 ? 23.956  50.870 63.206 1.00 34.85  ? 523  PHE A CA  1 
ATOM   4128 C C   . PHE A 1 523 ? 22.463  50.595 63.090 1.00 34.85  ? 523  PHE A C   1 
ATOM   4129 O O   . PHE A 1 523 ? 22.013  49.477 63.304 1.00 34.85  ? 523  PHE A O   1 
ATOM   4130 C CB  . PHE A 1 523 ? 24.185  51.684 64.477 1.00 33.16  ? 523  PHE A CB  1 
ATOM   4131 C CG  . PHE A 1 523 ? 23.478  51.132 65.686 1.00 33.16  ? 523  PHE A CG  1 
ATOM   4132 C CD1 . PHE A 1 523 ? 23.971  50.011 66.347 1.00 33.16  ? 523  PHE A CD1 1 
ATOM   4133 C CD2 . PHE A 1 523 ? 22.320  51.733 66.160 1.00 33.16  ? 523  PHE A CD2 1 
ATOM   4134 C CE1 . PHE A 1 523 ? 23.326  49.499 67.465 1.00 33.16  ? 523  PHE A CE1 1 
ATOM   4135 C CE2 . PHE A 1 523 ? 21.664  51.235 67.273 1.00 33.16  ? 523  PHE A CE2 1 
ATOM   4136 C CZ  . PHE A 1 523 ? 22.171  50.109 67.931 1.00 33.16  ? 523  PHE A CZ  1 
ATOM   4137 N N   . TRP A 1 524 ? 21.695  51.623 62.761 1.00 31.61  ? 524  TRP A N   1 
ATOM   4138 C CA  . TRP A 1 524 ? 20.256  51.469 62.654 1.00 31.61  ? 524  TRP A CA  1 
ATOM   4139 C C   . TRP A 1 524 ? 19.787  50.772 61.386 1.00 31.61  ? 524  TRP A C   1 
ATOM   4140 O O   . TRP A 1 524 ? 18.720  50.179 61.366 1.00 31.61  ? 524  TRP A O   1 
ATOM   4141 C CB  . TRP A 1 524 ? 19.572  52.830 62.776 1.00 28.56  ? 524  TRP A CB  1 
ATOM   4142 C CG  . TRP A 1 524 ? 19.726  53.474 64.128 1.00 28.56  ? 524  TRP A CG  1 
ATOM   4143 C CD1 . TRP A 1 524 ? 20.575  54.486 64.462 1.00 28.56  ? 524  TRP A CD1 1 
ATOM   4144 C CD2 . TRP A 1 524 ? 19.026  53.125 65.328 1.00 28.56  ? 524  TRP A CD2 1 
ATOM   4145 N NE1 . TRP A 1 524 ? 20.451  54.789 65.793 1.00 28.56  ? 524  TRP A NE1 1 
ATOM   4146 C CE2 . TRP A 1 524 ? 19.504  53.968 66.349 1.00 28.56  ? 524  TRP A CE2 1 
ATOM   4147 C CE3 . TRP A 1 524 ? 18.040  52.182 65.637 1.00 28.56  ? 524  TRP A CE3 1 
ATOM   4148 C CZ2 . TRP A 1 524 ? 19.025  53.897 67.662 1.00 28.56  ? 524  TRP A CZ2 1 
ATOM   4149 C CZ3 . TRP A 1 524 ? 17.566  52.115 66.939 1.00 28.56  ? 524  TRP A CZ3 1 
ATOM   4150 C CH2 . TRP A 1 524 ? 18.058  52.966 67.933 1.00 28.56  ? 524  TRP A CH2 1 
ATOM   4151 N N   . ASN A 1 525 ? 20.576  50.814 60.328 1.00 40.37  ? 525  ASN A N   1 
ATOM   4152 C CA  . ASN A 1 525 ? 20.134  50.169 59.111 1.00 40.37  ? 525  ASN A CA  1 
ATOM   4153 C C   . ASN A 1 525 ? 20.756  48.810 58.843 1.00 40.37  ? 525  ASN A C   1 
ATOM   4154 O O   . ASN A 1 525 ? 20.121  47.971 58.223 1.00 40.37  ? 525  ASN A O   1 
ATOM   4155 C CB  . ASN A 1 525 ? 20.347  51.094 57.908 1.00 41.82  ? 525  ASN A CB  1 
ATOM   4156 C CG  . ASN A 1 525 ? 19.566  52.394 58.032 1.00 41.82  ? 525  ASN A CG  1 
ATOM   4157 O OD1 . ASN A 1 525 ? 18.385  52.383 58.397 1.00 41.82  ? 525  ASN A OD1 1 
ATOM   4158 N ND2 . ASN A 1 525 ? 20.217  53.521 57.728 1.00 41.82  ? 525  ASN A ND2 1 
ATOM   4159 N N   . GLN A 1 526 ? 21.978  48.570 59.308 1.00 45.20  ? 526  GLN A N   1 
ATOM   4160 C CA  . GLN A 1 526 ? 22.597  47.272 59.053 1.00 45.20  ? 526  GLN A CA  1 
ATOM   4161 C C   . GLN A 1 526 ? 22.720  46.338 60.254 1.00 45.20  ? 526  GLN A C   1 
ATOM   4162 O O   . GLN A 1 526 ? 22.263  45.198 60.192 1.00 45.20  ? 526  GLN A O   1 
ATOM   4163 C CB  . GLN A 1 526 ? 23.983  47.446 58.440 1.00 73.56  ? 526  GLN A CB  1 
ATOM   4164 C CG  . GLN A 1 526 ? 24.006  48.169 57.107 1.00 73.56  ? 526  GLN A CG  1 
ATOM   4165 C CD  . GLN A 1 526 ? 25.400  48.144 56.456 1.00 73.56  ? 526  GLN A CD  1 
ATOM   4166 O OE1 . GLN A 1 526 ? 25.741  49.026 55.650 1.00 73.56  ? 526  GLN A OE1 1 
ATOM   4167 N NE2 . GLN A 1 526 ? 26.205  47.123 56.796 1.00 73.56  ? 526  GLN A NE2 1 
ATOM   4168 N N   . PHE A 1 527 ? 23.330  46.813 61.338 1.00 37.38  ? 527  PHE A N   1 
ATOM   4169 C CA  . PHE A 1 527 ? 23.539  45.985 62.520 1.00 37.38  ? 527  PHE A CA  1 
ATOM   4170 C C   . PHE A 1 527 ? 22.312  45.633 63.368 1.00 37.38  ? 527  PHE A C   1 
ATOM   4171 O O   . PHE A 1 527 ? 22.029  44.452 63.580 1.00 37.38  ? 527  PHE A O   1 
ATOM   4172 C CB  . PHE A 1 527 ? 24.604  46.617 63.429 1.00 29.93  ? 527  PHE A CB  1 
ATOM   4173 C CG  . PHE A 1 527 ? 24.941  45.780 64.635 1.00 29.93  ? 527  PHE A CG  1 
ATOM   4174 C CD1 . PHE A 1 527 ? 25.564  44.550 64.488 1.00 29.93  ? 527  PHE A CD1 1 
ATOM   4175 C CD2 . PHE A 1 527 ? 24.590  46.201 65.907 1.00 29.93  ? 527  PHE A CD2 1 
ATOM   4176 C CE1 . PHE A 1 527 ? 25.825  43.753 65.583 1.00 29.93  ? 527  PHE A CE1 1 
ATOM   4177 C CE2 . PHE A 1 527 ? 24.847  45.408 67.013 1.00 29.93  ? 527  PHE A CE2 1 
ATOM   4178 C CZ  . PHE A 1 527 ? 25.465  44.181 66.853 1.00 29.93  ? 527  PHE A CZ  1 
ATOM   4179 N N   . LEU A 1 528 ? 21.592  46.637 63.864 1.00 43.19  ? 528  LEU A N   1 
ATOM   4180 C CA  . LEU A 1 528 ? 20.436  46.365 64.714 1.00 43.19  ? 528  LEU A CA  1 
ATOM   4181 C C   . LEU A 1 528 ? 19.400  45.453 64.055 1.00 43.19  ? 528  LEU A C   1 
ATOM   4182 O O   . LEU A 1 528 ? 18.952  44.483 64.662 1.00 43.19  ? 528  LEU A O   1 
ATOM   4183 C CB  . LEU A 1 528 ? 19.777  47.672 65.177 1.00 39.51  ? 528  LEU A CB  1 
ATOM   4184 C CG  . LEU A 1 528 ? 18.828  47.533 66.378 1.00 39.51  ? 528  LEU A CG  1 
ATOM   4185 C CD1 . LEU A 1 528 ? 19.568  46.864 67.521 1.00 39.51  ? 528  LEU A CD1 1 
ATOM   4186 C CD2 . LEU A 1 528 ? 18.313  48.891 66.820 1.00 39.51  ? 528  LEU A CD2 1 
ATOM   4187 N N   . PRO A 1 529 ? 18.997  45.748 62.809 1.00 44.07  ? 529  PRO A N   1 
ATOM   4188 C CA  . PRO A 1 529 ? 18.009  44.878 62.167 1.00 44.07  ? 529  PRO A CA  1 
ATOM   4189 C C   . PRO A 1 529 ? 18.475  43.427 62.235 1.00 44.07  ? 529  PRO A C   1 
ATOM   4190 O O   . PRO A 1 529 ? 17.726  42.543 62.650 1.00 44.07  ? 529  PRO A O   1 
ATOM   4191 C CB  . PRO A 1 529 ? 17.969  45.413 60.747 1.00 44.99  ? 529  PRO A CB  1 
ATOM   4192 C CG  . PRO A 1 529 ? 18.191  46.875 60.956 1.00 44.99  ? 529  PRO A CG  1 
ATOM   4193 C CD  . PRO A 1 529 ? 19.324  46.896 61.945 1.00 44.99  ? 529  PRO A CD  1 
ATOM   4194 N N   . LYS A 1 530 ? 19.729  43.204 61.838 1.00 46.86  ? 530  LYS A N   1 
ATOM   4195 C CA  . LYS A 1 530 ? 20.368  41.885 61.849 1.00 46.86  ? 530  LYS A CA  1 
ATOM   4196 C C   . LYS A 1 530 ? 20.376  41.249 63.239 1.00 46.86  ? 530  LYS A C   1 
ATOM   4197 O O   . LYS A 1 530 ? 20.042  40.081 63.397 1.00 46.86  ? 530  LYS A O   1 
ATOM   4198 C CB  . LYS A 1 530 ? 21.807  42.009 61.338 1.00 67.90  ? 530  LYS A CB  1 
ATOM   4199 C CG  . LYS A 1 530 ? 22.616  40.725 61.403 1.00 67.90  ? 530  LYS A CG  1 
ATOM   4200 C CD  . LYS A 1 530 ? 23.883  40.812 60.541 1.00 67.90  ? 530  LYS A CD  1 
ATOM   4201 C CE  . LYS A 1 530 ? 24.613  39.461 60.526 1.00 67.90  ? 530  LYS A CE  1 
ATOM   4202 N NZ  . LYS A 1 530 ? 25.399  39.221 59.266 1.00 67.90  ? 530  LYS A NZ  1 
ATOM   4203 N N   . LEU A 1 531 ? 20.767  42.021 64.244 1.00 44.62  ? 531  LEU A N   1 
ATOM   4204 C CA  . LEU A 1 531 ? 20.799  41.521 65.608 1.00 44.62  ? 531  LEU A CA  1 
ATOM   4205 C C   . LEU A 1 531 ? 19.398  41.091 66.053 1.00 44.62  ? 531  LEU A C   1 
ATOM   4206 O O   . LEU A 1 531 ? 19.206  39.981 66.544 1.00 44.62  ? 531  LEU A O   1 
ATOM   4207 C CB  . LEU A 1 531 ? 21.358  42.600 66.536 1.00 40.01  ? 531  LEU A CB  1 
ATOM   4208 C CG  . LEU A 1 531 ? 21.476  42.279 68.023 1.00 40.01  ? 531  LEU A CG  1 
ATOM   4209 C CD1 . LEU A 1 531 ? 22.280  43.376 68.698 1.00 40.01  ? 531  LEU A CD1 1 
ATOM   4210 C CD2 . LEU A 1 531 ? 20.093  42.165 68.657 1.00 40.01  ? 531  LEU A CD2 1 
ATOM   4211 N N   . LEU A 1 532 ? 18.420  41.971 65.888 1.00 54.71  ? 532  LEU A N   1 
ATOM   4212 C CA  . LEU A 1 532 ? 17.045  41.643 66.270 1.00 54.71  ? 532  LEU A CA  1 
ATOM   4213 C C   . LEU A 1 532 ? 16.514  40.422 65.505 1.00 54.71  ? 532  LEU A C   1 
ATOM   4214 O O   . LEU A 1 532 ? 15.632  39.721 65.998 1.00 54.71  ? 532  LEU A O   1 
ATOM   4215 C CB  . LEU A 1 532 ? 16.111  42.835 66.026 1.00 43.54  ? 532  LEU A CB  1 
ATOM   4216 C CG  . LEU A 1 532 ? 16.331  44.038 66.944 1.00 43.54  ? 532  LEU A CG  1 
ATOM   4217 C CD1 . LEU A 1 532 ? 15.560  45.247 66.430 1.00 43.54  ? 532  LEU A CD1 1 
ATOM   4218 C CD2 . LEU A 1 532 ? 15.913  43.664 68.355 1.00 43.54  ? 532  LEU A CD2 1 
ATOM   4219 N N   . ASN A 1 533 ? 17.045  40.158 64.313 1.00 59.47  ? 533  ASN A N   1 
ATOM   4220 C CA  . ASN A 1 533 ? 16.573  39.010 63.548 1.00 59.47  ? 533  ASN A CA  1 
ATOM   4221 C C   . ASN A 1 533 ? 17.214  37.692 63.967 1.00 59.47  ? 533  ASN A C   1 
ATOM   4222 O O   . ASN A 1 533 ? 16.554  36.652 63.991 1.00 59.47  ? 533  ASN A O   1 
ATOM   4223 C CB  . ASN A 1 533 ? 16.798  39.203 62.047 1.00 57.59  ? 533  ASN A CB  1 
ATOM   4224 C CG  . ASN A 1 533 ? 16.194  38.073 61.230 1.00 57.59  ? 533  ASN A CG  1 
ATOM   4225 O OD1 . ASN A 1 533 ? 16.891  37.154 60.800 1.00 57.59  ? 533  ASN A OD1 1 
ATOM   4226 N ND2 . ASN A 1 533 ? 14.879  38.126 61.033 1.00 57.59  ? 533  ASN A ND2 1 
ATOM   4227 N N   . ALA A 1 534 ? 18.502  37.722 64.284 1.00 70.19  ? 534  ALA A N   1 
ATOM   4228 C CA  . ALA A 1 534 ? 19.182  36.499 64.684 1.00 70.19  ? 534  ALA A CA  1 
ATOM   4229 C C   . ALA A 1 534 ? 18.757  36.098 66.092 1.00 70.19  ? 534  ALA A C   1 
ATOM   4230 O O   . ALA A 1 534 ? 18.706  34.910 66.410 1.00 70.19  ? 534  ALA A O   1 
ATOM   4231 C CB  . ALA A 1 534 ? 20.693  36.688 64.614 1.00 59.83  ? 534  ALA A CB  1 
ATOM   4232 N N   . THR A 1 535 ? 18.440  37.084 66.929 1.00 94.72  ? 535  THR A N   1 
ATOM   4233 C CA  . THR A 1 535 ? 18.014  36.814 68.307 1.00 94.72  ? 535  THR A CA  1 
ATOM   4234 C C   . THR A 1 535 ? 16.516  37.068 68.467 1.00 94.72  ? 535  THR A C   1 
ATOM   4235 O O   . THR A 1 535 ? 15.826  37.148 67.426 1.00 94.72  ? 535  THR A O   1 
ATOM   4236 C CB  . THR A 1 535 ? 18.780  37.699 69.334 1.00 88.12  ? 535  THR A CB  1 
ATOM   4237 O OG1 . THR A 1 535 ? 18.288  39.046 69.281 1.00 88.12  ? 535  THR A OG1 1 
ATOM   4238 C CG2 . THR A 1 535 ? 20.289  37.695 69.027 1.00 88.12  ? 535  THR A CG2 1 
HETATM 4239 O O   . HOH B 2 .   ? 21.451  57.572 61.129 1.00 39.52  ? 1001 HOH A O   1 
HETATM 4240 O O   . HOH B 2 .   ? 1.427   90.016 54.944 1.00 27.80  ? 1002 HOH A O   1 
HETATM 4241 O O   . HOH B 2 .   ? -0.703  63.521 59.171 1.00 34.90  ? 1003 HOH A O   1 
HETATM 4242 O O   . HOH B 2 .   ? 19.464  62.386 32.558 1.00 43.92  ? 1004 HOH A O   1 
HETATM 4243 O O   . HOH B 2 .   ? -18.815 84.884 50.822 1.00 46.48  ? 1005 HOH A O   1 
HETATM 4244 O O   . HOH B 2 .   ? 4.143   80.774 51.502 1.00 37.94  ? 1006 HOH A O   1 
HETATM 4245 O O   . HOH B 2 .   ? 7.500   52.340 56.698 1.00 36.40  ? 1007 HOH A O   1 
HETATM 4246 O O   . HOH B 2 .   ? 18.702  60.293 41.998 1.00 45.11  ? 1008 HOH A O   1 
HETATM 4247 O O   . HOH B 2 .   ? -13.541 58.000 56.675 1.00 38.54  ? 1009 HOH A O   1 
HETATM 4248 O O   . HOH B 2 .   ? 5.405   63.761 63.417 1.00 46.21  ? 1010 HOH A O   1 
HETATM 4249 O O   . HOH B 2 .   ? -1.512  70.111 52.878 1.00 42.97  ? 1011 HOH A O   1 
HETATM 4250 O O   . HOH B 2 .   ? 3.962   69.287 58.233 1.00 47.25  ? 1012 HOH A O   1 
HETATM 4251 O O   . HOH B 2 .   ? 3.838   66.767 36.285 1.00 46.00  ? 1013 HOH A O   1 
HETATM 4252 O O   . HOH B 2 .   ? -4.872  83.305 52.611 1.00 46.98  ? 1014 HOH A O   1 
HETATM 4253 O O   . HOH B 2 .   ? 23.958  77.523 54.436 1.00 51.20  ? 1015 HOH A O   1 
HETATM 4254 O O   . HOH B 2 .   ? -9.047  58.262 64.998 1.00 47.60  ? 1016 HOH A O   1 
HETATM 4255 O O   . HOH B 2 .   ? -0.424  61.293 72.453 1.00 46.06  ? 1017 HOH A O   1 
HETATM 4256 O O   . HOH B 2 .   ? 27.960  63.778 45.864 1.00 47.76  ? 1018 HOH A O   1 
HETATM 4257 O O   . HOH B 2 .   ? 21.304  72.018 68.022 1.00 52.33  ? 1019 HOH A O   1 
HETATM 4258 O O   . HOH B 2 .   ? 21.365  62.000 36.529 1.00 38.05  ? 1020 HOH A O   1 
HETATM 4259 O O   . HOH B 2 .   ? 2.176   63.134 70.514 1.00 40.72  ? 1021 HOH A O   1 
HETATM 4260 O O   . HOH B 2 .   ? 10.669  55.946 68.796 1.00 40.51  ? 1022 HOH A O   1 
HETATM 4261 O O   . HOH B 2 .   ? -4.436  85.761 39.575 1.00 41.56  ? 1023 HOH A O   1 
HETATM 4262 O O   . HOH B 2 .   ? -0.519  77.913 62.464 1.00 57.46  ? 1024 HOH A O   1 
HETATM 4263 O O   . HOH B 2 .   ? -4.108  52.169 56.431 1.00 35.53  ? 1025 HOH A O   1 
HETATM 4264 O O   . HOH B 2 .   ? -1.906  57.887 63.026 1.00 57.21  ? 1026 HOH A O   1 
HETATM 4265 O O   . HOH B 2 .   ? 0.109   69.675 59.956 1.00 35.97  ? 1027 HOH A O   1 
HETATM 4266 O O   . HOH B 2 .   ? 24.717  66.947 85.152 1.00 47.94  ? 1028 HOH A O   1 
HETATM 4267 O O   . HOH B 2 .   ? -3.596  45.767 73.440 1.00 53.05  ? 1029 HOH A O   1 
HETATM 4268 O O   . HOH B 2 .   ? -10.646 66.066 69.012 1.00 48.45  ? 1030 HOH A O   1 
HETATM 4269 O O   . HOH B 2 .   ? 3.419   65.543 65.325 1.00 48.92  ? 1031 HOH A O   1 
HETATM 4270 O O   . HOH B 2 .   ? -7.333  68.245 58.189 1.00 48.82  ? 1032 HOH A O   1 
HETATM 4271 O O   . HOH B 2 .   ? -6.736  61.562 65.147 1.00 39.54  ? 1033 HOH A O   1 
HETATM 4272 O O   . HOH B 2 .   ? -0.521  69.753 62.615 1.00 39.87  ? 1034 HOH A O   1 
HETATM 4273 O O   . HOH B 2 .   ? -11.828 64.404 56.172 1.00 56.29  ? 1035 HOH A O   1 
HETATM 4274 O O   . HOH B 2 .   ? -4.667  70.848 34.126 1.00 40.66  ? 1036 HOH A O   1 
HETATM 4275 O O   . HOH B 2 .   ? 2.904   54.158 63.747 1.00 32.83  ? 1037 HOH A O   1 
HETATM 4276 O O   . HOH B 2 .   ? 9.164   81.066 37.084 1.00 49.93  ? 1038 HOH A O   1 
HETATM 4277 O O   . HOH B 2 .   ? 24.737  73.579 39.085 1.00 40.62  ? 1039 HOH A O   1 
HETATM 4278 O O   . HOH B 2 .   ? 4.265   68.459 61.774 1.00 50.35  ? 1040 HOH A O   1 
HETATM 4279 O O   . HOH B 2 .   ? 31.260  58.703 50.296 1.00 51.75  ? 1041 HOH A O   1 
HETATM 4280 O O   . HOH B 2 .   ? 22.668  79.543 61.773 1.00 50.07  ? 1042 HOH A O   1 
HETATM 4281 O O   . HOH B 2 .   ? 7.233   79.081 68.154 1.00 50.25  ? 1043 HOH A O   1 
HETATM 4282 O O   . HOH B 2 .   ? -3.636  50.969 60.006 1.00 46.90  ? 1044 HOH A O   1 
HETATM 4283 O O   . HOH B 2 .   ? -9.024  50.196 77.854 1.00 49.99  ? 1045 HOH A O   1 
HETATM 4284 O O   . HOH B 2 .   ? -2.087  75.814 52.815 1.00 73.31  ? 1046 HOH A O   1 
HETATM 4285 O O   . HOH B 2 .   ? 21.081  82.963 53.907 1.00 53.30  ? 1047 HOH A O   1 
HETATM 4286 O O   . HOH B 2 .   ? -10.051 51.960 55.043 1.00 48.82  ? 1048 HOH A O   1 
HETATM 4287 O O   . HOH B 2 .   ? -15.330 60.579 48.886 1.00 44.68  ? 1049 HOH A O   1 
HETATM 4288 O O   . HOH B 2 .   ? 23.578  52.023 81.335 1.00 49.72  ? 1050 HOH A O   1 
HETATM 4289 O O   . HOH B 2 .   ? 18.480  50.652 45.220 1.00 40.24  ? 1051 HOH A O   1 
HETATM 4290 O O   . HOH B 2 .   ? 25.109  58.480 41.125 1.00 45.57  ? 1052 HOH A O   1 
HETATM 4291 O O   . HOH B 2 .   ? 25.556  59.198 53.552 1.00 76.31  ? 1053 HOH A O   1 
HETATM 4292 O O   . HOH B 2 .   ? 23.225  67.317 48.102 1.00 37.88  ? 1054 HOH A O   1 
HETATM 4293 O O   . HOH B 2 .   ? 19.191  54.794 35.813 1.00 45.83  ? 1055 HOH A O   1 
HETATM 4294 O O   . HOH B 2 .   ? 21.198  84.684 62.918 1.00 59.11  ? 1056 HOH A O   1 
HETATM 4295 O O   . HOH B 2 .   ? 25.345  61.901 52.795 1.00 48.88  ? 1057 HOH A O   1 
HETATM 4296 O O   . HOH B 2 .   ? -19.879 57.516 59.473 1.00 58.27  ? 1058 HOH A O   1 
HETATM 4297 O O   . HOH B 2 .   ? -17.976 63.897 67.467 1.00 41.41  ? 1059 HOH A O   1 
HETATM 4298 O O   . HOH B 2 .   ? 15.434  52.628 61.819 1.00 54.40  ? 1060 HOH A O   1 
HETATM 4299 O O   . HOH B 2 .   ? -12.959 39.730 63.043 1.00 53.17  ? 1061 HOH A O   1 
HETATM 4300 O O   . HOH B 2 .   ? 16.615  89.188 52.465 1.00 57.24  ? 1062 HOH A O   1 
HETATM 4301 O O   . HOH B 2 .   ? 9.410   89.095 48.725 1.00 55.88  ? 1063 HOH A O   1 
HETATM 4302 O O   . HOH B 2 .   ? -9.639  70.348 54.787 1.00 61.67  ? 1064 HOH A O   1 
HETATM 4303 O O   . HOH B 2 .   ? -6.815  50.467 49.733 1.00 53.38  ? 1065 HOH A O   1 
HETATM 4304 O O   . HOH B 2 .   ? -5.512  40.097 57.378 1.00 43.93  ? 1066 HOH A O   1 
HETATM 4305 O O   . HOH B 2 .   ? 1.336   43.536 55.294 1.00 47.77  ? 1067 HOH A O   1 
HETATM 4306 O O   . HOH B 2 .   ? -1.019  71.454 29.206 1.00 45.28  ? 1068 HOH A O   1 
HETATM 4307 O O   . HOH B 2 .   ? 22.818  72.589 77.141 1.00 40.91  ? 1069 HOH A O   1 
HETATM 4308 O O   . HOH B 2 .   ? 20.704  47.051 51.998 1.00 44.72  ? 1070 HOH A O   1 
HETATM 4309 O O   . HOH B 2 .   ? 18.844  85.500 50.473 1.00 51.01  ? 1071 HOH A O   1 
HETATM 4310 O O   . HOH B 2 .   ? 7.241   46.794 53.957 1.00 43.35  ? 1072 HOH A O   1 
HETATM 4311 O O   . HOH B 2 .   ? -2.542  68.709 67.365 1.00 46.31  ? 1073 HOH A O   1 
HETATM 4312 O O   . HOH B 2 .   ? 22.011  52.734 54.454 1.00 45.49  ? 1074 HOH A O   1 
HETATM 4313 O O   . HOH B 2 .   ? -0.012  66.609 37.333 1.00 61.13  ? 1075 HOH A O   1 
HETATM 4314 O O   . HOH B 2 .   ? 12.455  80.011 75.720 1.00 51.01  ? 1076 HOH A O   1 
HETATM 4315 O O   . HOH B 2 .   ? -6.408  84.133 38.714 1.00 46.24  ? 1077 HOH A O   1 
HETATM 4316 O O   . HOH B 2 .   ? 19.550  67.751 38.720 1.00 39.05  ? 1078 HOH A O   1 
HETATM 4317 O O   . HOH B 2 .   ? -3.785  69.162 79.955 1.00 47.36  ? 1079 HOH A O   1 
HETATM 4318 O O   . HOH B 2 .   ? -4.051  70.328 62.646 1.00 41.48  ? 1080 HOH A O   1 
HETATM 4319 O O   . HOH B 2 .   ? -1.942  51.155 73.770 1.00 66.40  ? 1081 HOH A O   1 
HETATM 4320 O O   . HOH B 2 .   ? 2.665   40.161 59.368 1.00 41.95  ? 1082 HOH A O   1 
HETATM 4321 O O   . HOH B 2 .   ? -13.698 51.484 49.489 1.00 45.56  ? 1083 HOH A O   1 
HETATM 4322 O O   . HOH B 2 .   ? 3.454   51.519 64.847 1.00 36.08  ? 1084 HOH A O   1 
HETATM 4323 O O   . HOH B 2 .   ? -10.008 62.766 59.719 1.00 59.10  ? 1085 HOH A O   1 
HETATM 4324 O O   . HOH B 2 .   ? 11.709  67.411 67.756 1.00 56.28  ? 1086 HOH A O   1 
HETATM 4325 O O   . HOH B 2 .   ? -13.013 78.640 57.334 1.00 78.90  ? 1087 HOH A O   1 
HETATM 4326 O O   . HOH B 2 .   ? -15.539 87.335 33.256 1.00 53.97  ? 1088 HOH A O   1 
HETATM 4327 O O   . HOH B 2 .   ? -24.845 44.935 61.025 1.00 53.94  ? 1089 HOH A O   1 
HETATM 4328 O O   . HOH B 2 .   ? 6.042   81.676 64.728 1.00 50.55  ? 1090 HOH A O   1 
HETATM 4329 O O   . HOH B 2 .   ? 3.874   47.844 64.898 1.00 55.51  ? 1091 HOH A O   1 
HETATM 4330 O O   . HOH B 2 .   ? 33.379  68.598 48.311 1.00 54.68  ? 1092 HOH A O   1 
HETATM 4331 O O   . HOH B 2 .   ? -15.263 66.515 52.007 1.00 49.85  ? 1093 HOH A O   1 
HETATM 4332 O O   . HOH B 2 .   ? -10.618 47.425 76.167 1.00 48.78  ? 1094 HOH A O   1 
HETATM 4333 O O   . HOH B 2 .   ? 7.331   49.154 59.687 1.00 42.02  ? 1095 HOH A O   1 
HETATM 4334 O O   . HOH B 2 .   ? 30.287  58.209 65.739 1.00 51.90  ? 1096 HOH A O   1 
HETATM 4335 O O   . HOH B 2 .   ? 6.896   49.320 66.702 1.00 45.48  ? 1097 HOH A O   1 
HETATM 4336 O O   . HOH B 2 .   ? 7.675   78.586 36.384 1.00 57.55  ? 1098 HOH A O   1 
HETATM 4337 O O   . HOH B 2 .   ? 0.326   40.506 57.725 1.00 47.18  ? 1099 HOH A O   1 
HETATM 4338 O O   . HOH B 2 .   ? 13.469  86.794 47.013 1.00 42.45  ? 1100 HOH A O   1 
HETATM 4339 O O   . HOH B 2 .   ? 11.988  47.986 74.036 1.00 60.27  ? 1101 HOH A O   1 
HETATM 4340 O O   . HOH B 2 .   ? -6.824  58.807 40.635 1.00 52.83  ? 1102 HOH A O   1 
HETATM 4341 O O   . HOH B 2 .   ? 13.501  69.173 57.431 1.00 44.62  ? 1103 HOH A O   1 
HETATM 4342 O O   . HOH B 2 .   ? 3.742   46.161 61.691 1.00 49.12  ? 1104 HOH A O   1 
HETATM 4343 O O   . HOH B 2 .   ? 3.882   81.931 73.369 1.00 45.88  ? 1105 HOH A O   1 
HETATM 4344 O O   . HOH B 2 .   ? 11.516  56.487 84.886 1.00 65.10  ? 1106 HOH A O   1 
HETATM 4345 O O   . HOH B 2 .   ? 16.387  74.738 77.846 1.00 50.69  ? 1107 HOH A O   1 
HETATM 4346 O O   . HOH B 2 .   ? 14.777  36.310 58.520 1.00 57.49  ? 1108 HOH A O   1 
HETATM 4347 O O   . HOH B 2 .   ? 8.954   49.980 37.410 1.00 44.75  ? 1109 HOH A O   1 
HETATM 4348 O O   . HOH B 2 .   ? -6.240  49.725 61.237 1.00 48.93  ? 1110 HOH A O   1 
HETATM 4349 O O   . HOH B 2 .   ? -3.239  76.414 64.658 1.00 55.02  ? 1111 HOH A O   1 
HETATM 4350 O O   . HOH B 2 .   ? -2.127  98.049 48.595 1.00 58.15  ? 1112 HOH A O   1 
HETATM 4351 O O   . HOH B 2 .   ? -20.507 77.030 47.612 1.00 44.82  ? 1113 HOH A O   1 
HETATM 4352 O O   . HOH B 2 .   ? 4.683   50.448 62.490 1.00 46.35  ? 1114 HOH A O   1 
HETATM 4353 O O   . HOH B 2 .   ? -8.178  71.795 52.795 1.00 50.36  ? 1115 HOH A O   1 
HETATM 4354 O O   . HOH B 2 .   ? 14.248  51.247 57.064 1.00 46.94  ? 1116 HOH A O   1 
HETATM 4355 O O   . HOH B 2 .   ? 6.113   90.573 70.350 1.00 54.71  ? 1117 HOH A O   1 
HETATM 4356 O O   . HOH B 2 .   ? 4.136   65.767 69.517 1.00 58.34  ? 1118 HOH A O   1 
HETATM 4357 O O   . HOH B 2 .   ? -21.684 70.188 48.057 1.00 42.81  ? 1119 HOH A O   1 
HETATM 4358 O O   . HOH B 2 .   ? -19.283 55.396 48.898 1.00 67.18  ? 1120 HOH A O   1 
HETATM 4359 O O   . HOH B 2 .   ? 16.684  57.653 36.342 1.00 41.83  ? 1121 HOH A O   1 
HETATM 4360 O O   . HOH B 2 .   ? -7.293  69.483 29.259 1.00 51.72  ? 1122 HOH A O   1 
HETATM 4361 O O   . HOH B 2 .   ? -5.723  44.965 57.706 1.00 42.16  ? 1123 HOH A O   1 
HETATM 4362 O O   . HOH B 2 .   ? 13.114  83.840 47.674 1.00 39.29  ? 1124 HOH A O   1 
HETATM 4363 O O   . HOH B 2 .   ? -15.498 67.773 49.556 1.00 49.02  ? 1125 HOH A O   1 
HETATM 4364 O O   . HOH B 2 .   ? -12.654 72.333 65.899 1.00 47.85  ? 1126 HOH A O   1 
HETATM 4365 O O   . HOH B 2 .   ? 12.195  74.155 32.431 1.00 52.26  ? 1127 HOH A O   1 
HETATM 4366 O O   . HOH B 2 .   ? 22.335  78.512 43.753 1.00 54.34  ? 1128 HOH A O   1 
HETATM 4367 O O   . HOH B 2 .   ? -10.593 81.686 55.656 1.00 42.85  ? 1129 HOH A O   1 
HETATM 4368 O O   . HOH B 2 .   ? -12.064 67.219 37.154 1.00 39.37  ? 1130 HOH A O   1 
HETATM 4369 O O   . HOH B 2 .   ? 18.547  67.440 73.440 1.00 60.92  ? 1131 HOH A O   1 
HETATM 4370 O O   . HOH B 2 .   ? 15.751  64.366 32.871 1.00 59.32  ? 1132 HOH A O   1 
HETATM 4371 O O   . HOH B 2 .   ? 15.890  59.319 88.029 1.00 60.30  ? 1133 HOH A O   1 
HETATM 4372 O O   . HOH B 2 .   ? -12.401 77.542 30.527 1.00 50.57  ? 1134 HOH A O   1 
HETATM 4373 O O   . HOH B 2 .   ? 22.431  73.696 65.946 1.00 48.61  ? 1135 HOH A O   1 
HETATM 4374 O O   . HOH B 2 .   ? 5.092   88.374 68.450 1.00 51.30  ? 1136 HOH A O   1 
HETATM 4375 O O   . HOH B 2 .   ? -22.417 80.757 36.094 1.00 55.26  ? 1137 HOH A O   1 
HETATM 4376 O O   . HOH B 2 .   ? -10.224 76.401 67.159 1.00 52.76  ? 1138 HOH A O   1 
HETATM 4377 O O   . HOH B 2 .   ? -21.822 46.558 67.384 1.00 56.73  ? 1139 HOH A O   1 
HETATM 4378 O O   . HOH B 2 .   ? -14.478 65.905 67.451 1.00 64.40  ? 1140 HOH A O   1 
HETATM 4379 O O   . HOH B 2 .   ? -6.198  46.613 51.299 1.00 70.79  ? 1141 HOH A O   1 
HETATM 4380 O O   . HOH B 2 .   ? 34.738  65.639 45.642 1.00 49.70  ? 1142 HOH A O   1 
HETATM 4381 O O   . HOH B 2 .   ? 9.616   56.271 36.449 1.00 42.18  ? 1143 HOH A O   1 
HETATM 4382 O O   . HOH B 2 .   ? -18.658 72.479 51.509 1.00 51.51  ? 1144 HOH A O   1 
HETATM 4383 O O   . HOH B 2 .   ? 28.956  75.945 39.316 1.00 52.35  ? 1145 HOH A O   1 
HETATM 4384 O O   . HOH B 2 .   ? -3.495  67.586 31.989 1.00 42.52  ? 1146 HOH A O   1 
HETATM 4385 O O   . HOH B 2 .   ? 6.932   62.593 35.227 1.00 62.19  ? 1147 HOH A O   1 
HETATM 4386 O O   . HOH B 2 .   ? -12.487 90.814 39.492 1.00 54.55  ? 1148 HOH A O   1 
HETATM 4387 O O   . HOH B 2 .   ? 15.531  80.472 70.028 1.00 50.37  ? 1149 HOH A O   1 
HETATM 4388 O O   . HOH B 2 .   ? 15.811  52.885 59.144 1.00 72.70  ? 1150 HOH A O   1 
HETATM 4389 O O   . HOH B 2 .   ? 12.354  51.157 59.770 1.00 52.37  ? 1151 HOH A O   1 
HETATM 4390 O O   . HOH B 2 .   ? 19.286  64.476 86.646 1.00 41.48  ? 1152 HOH A O   1 
HETATM 4391 O O   . HOH B 2 .   ? -15.078 69.962 66.442 1.00 49.68  ? 1153 HOH A O   1 
HETATM 4392 O O   . HOH B 2 .   ? 25.086  48.640 77.216 1.00 51.99  ? 1154 HOH A O   1 
HETATM 4393 O O   . HOH B 2 .   ? 22.254  51.327 45.854 1.00 59.84  ? 1155 HOH A O   1 
HETATM 4394 O O   . HOH B 2 .   ? 21.415  84.272 56.503 1.00 44.24  ? 1156 HOH A O   1 
HETATM 4395 O O   . HOH B 2 .   ? 23.948  70.396 40.148 1.00 43.90  ? 1157 HOH A O   1 
HETATM 4396 O O   . HOH B 2 .   ? -7.874  85.811 32.754 1.00 51.45  ? 1158 HOH A O   1 
HETATM 4397 O O   . HOH B 2 .   ? 33.865  63.899 83.975 1.00 51.91  ? 1159 HOH A O   1 
HETATM 4398 O O   . HOH B 2 .   ? 23.441  79.349 46.849 1.00 48.47  ? 1160 HOH A O   1 
HETATM 4399 O O   . HOH B 2 .   ? 28.433  65.547 43.192 1.00 44.42  ? 1161 HOH A O   1 
HETATM 4400 O O   . HOH B 2 .   ? 19.270  58.734 35.226 1.00 48.92  ? 1162 HOH A O   1 
HETATM 4401 O O   . HOH B 2 .   ? -0.881  66.793 39.996 1.00 51.59  ? 1163 HOH A O   1 
HETATM 4402 O O   . HOH B 2 .   ? 28.171  79.887 40.877 1.00 85.02  ? 1164 HOH A O   1 
HETATM 4403 O O   . HOH B 2 .   ? 15.517  77.480 77.741 1.00 53.11  ? 1165 HOH A O   1 
HETATM 4404 O O   . HOH B 2 .   ? -10.401 55.928 45.321 1.00 47.86  ? 1166 HOH A O   1 
HETATM 4405 O O   . HOH B 2 .   ? 4.229   55.971 78.725 1.00 49.99  ? 1167 HOH A O   1 
HETATM 4406 O O   . HOH B 2 .   ? 20.986  73.005 79.264 1.00 55.06  ? 1168 HOH A O   1 
HETATM 4407 O O   . HOH B 2 .   ? 30.253  77.129 45.003 1.00 51.96  ? 1169 HOH A O   1 
HETATM 4408 O O   . HOH B 2 .   ? 25.014  58.194 56.122 1.00 62.91  ? 1170 HOH A O   1 
HETATM 4409 O O   . HOH B 2 .   ? -6.423  74.679 70.078 1.00 56.68  ? 1171 HOH A O   1 
HETATM 4410 O O   . HOH B 2 .   ? 12.326  67.882 83.703 1.00 62.05  ? 1172 HOH A O   1 
HETATM 4411 O O   . HOH B 2 .   ? 3.447   50.756 69.873 1.00 40.34  ? 1173 HOH A O   1 
HETATM 4412 O O   . HOH B 2 .   ? -11.986 38.683 65.787 1.00 56.29  ? 1174 HOH A O   1 
HETATM 4413 O O   . HOH B 2 .   ? 11.810  77.986 35.735 1.00 65.54  ? 1175 HOH A O   1 
HETATM 4414 O O   . HOH B 2 .   ? -17.875 65.715 61.658 1.00 59.17  ? 1176 HOH A O   1 
HETATM 4415 O O   . HOH B 2 .   ? -9.086  45.086 75.800 1.00 70.87  ? 1177 HOH A O   1 
HETATM 4416 O O   . HOH B 2 .   ? 14.402  91.550 65.226 1.00 53.38  ? 1178 HOH A O   1 
HETATM 4417 O O   . HOH B 2 .   ? 11.873  64.871 35.471 1.00 53.86  ? 1179 HOH A O   1 
HETATM 4418 O O   . HOH B 2 .   ? 31.867  58.691 62.456 1.00 50.83  ? 1180 HOH A O   1 
HETATM 4419 O O   . HOH B 2 .   ? 11.683  83.950 72.356 1.00 57.32  ? 1181 HOH A O   1 
HETATM 4420 O O   . HOH B 2 .   ? -15.245 47.380 45.778 1.00 58.34  ? 1182 HOH A O   1 
HETATM 4421 O O   . HOH B 2 .   ? 17.817  39.079 74.723 1.00 54.21  ? 1183 HOH A O   1 
HETATM 4422 O O   . HOH B 2 .   ? -14.853 60.252 57.352 1.00 43.12  ? 1184 HOH A O   1 
HETATM 4423 O O   . HOH B 2 .   ? -20.332 75.663 37.466 1.00 45.68  ? 1185 HOH A O   1 
HETATM 4424 O O   . HOH B 2 .   ? -23.490 37.743 69.567 1.00 56.47  ? 1186 HOH A O   1 
HETATM 4425 O O   . HOH B 2 .   ? 4.651   46.673 40.437 1.00 50.65  ? 1187 HOH A O   1 
HETATM 4426 O O   . HOH B 2 .   ? 27.211  63.920 59.979 1.00 47.72  ? 1188 HOH A O   1 
HETATM 4427 O O   . HOH B 2 .   ? -15.588 75.472 50.517 1.00 47.98  ? 1189 HOH A O   1 
HETATM 4428 O O   . HOH B 2 .   ? 3.907   56.216 70.619 1.00 38.62  ? 1190 HOH A O   1 
HETATM 4429 O O   . HOH B 2 .   ? -0.741  75.000 31.213 1.00 64.20  ? 1191 HOH A O   1 
HETATM 4430 O O   . HOH B 2 .   ? -4.649  80.653 32.080 1.00 52.75  ? 1192 HOH A O   1 
HETATM 4431 O O   . HOH B 2 .   ? 6.415   74.577 29.477 1.00 52.61  ? 1193 HOH A O   1 
HETATM 4432 O O   . HOH B 2 .   ? -24.284 80.634 41.962 1.00 48.43  ? 1194 HOH A O   1 
HETATM 4433 O O   . HOH B 2 .   ? 17.377  50.773 84.790 1.00 61.99  ? 1195 HOH A O   1 
HETATM 4434 O O   . HOH B 2 .   ? 9.731   52.908 80.446 1.00 52.87  ? 1196 HOH A O   1 
HETATM 4435 O O   . HOH B 2 .   ? 3.337   82.131 32.562 1.00 51.64  ? 1197 HOH A O   1 
HETATM 4436 O O   . HOH B 2 .   ? -12.784 42.623 76.339 1.00 63.93  ? 1198 HOH A O   1 
HETATM 4437 O O   . HOH B 2 .   ? -15.552 57.228 51.034 1.00 88.41  ? 1199 HOH A O   1 
HETATM 4438 O O   . HOH B 2 .   ? 17.628  46.368 79.422 1.00 51.72  ? 1200 HOH A O   1 
HETATM 4439 O O   . HOH B 2 .   ? -17.954 50.370 49.202 1.00 63.65  ? 1201 HOH A O   1 
HETATM 4440 O O   . HOH B 2 .   ? 7.331   54.499 80.982 1.00 61.93  ? 1202 HOH A O   1 
HETATM 4441 O O   . HOH B 2 .   ? 28.485  54.393 52.428 1.00 60.21  ? 1203 HOH A O   1 
HETATM 4442 O O   . HOH B 2 .   ? 9.855   47.138 38.973 1.00 60.41  ? 1204 HOH A O   1 
HETATM 4443 O O   . HOH B 2 .   ? 24.253  76.478 63.228 1.00 55.76  ? 1205 HOH A O   1 
HETATM 4444 O O   . HOH B 2 .   ? 8.907   45.132 43.702 1.00 51.77  ? 1206 HOH A O   1 
HETATM 4445 O O   . HOH B 2 .   ? 0.186   70.244 68.526 1.00 56.47  ? 1207 HOH A O   1 
HETATM 4446 O O   . HOH B 2 .   ? -19.006 77.606 50.004 1.00 48.28  ? 1208 HOH A O   1 
HETATM 4447 O O   . HOH B 2 .   ? 16.818  43.181 44.494 1.00 65.32  ? 1209 HOH A O   1 
HETATM 4448 O O   . HOH B 2 .   ? 30.448  52.917 66.490 1.00 53.29  ? 1210 HOH A O   1 
HETATM 4449 O O   . HOH B 2 .   ? -5.691  77.284 66.995 1.00 53.86  ? 1211 HOH A O   1 
HETATM 4450 O O   . HOH B 2 .   ? 20.044  74.465 68.771 1.00 41.03  ? 1212 HOH A O   1 
HETATM 4451 O O   . HOH B 2 .   ? 25.828  51.154 52.941 1.00 58.29  ? 1213 HOH A O   1 
HETATM 4452 O O   . HOH B 2 .   ? -22.064 58.921 62.730 1.00 55.31  ? 1214 HOH A O   1 
HETATM 4453 O O   . HOH B 2 .   ? 16.363  72.948 84.976 1.00 73.49  ? 1215 HOH A O   1 
HETATM 4454 O O   . HOH B 2 .   ? -6.916  55.351 42.620 1.00 48.49  ? 1216 HOH A O   1 
HETATM 4455 O O   . HOH B 2 .   ? -8.917  60.852 63.798 1.00 47.19  ? 1217 HOH A O   1 
HETATM 4456 O O   . HOH B 2 .   ? 33.579  64.481 43.440 1.00 51.01  ? 1218 HOH A O   1 
HETATM 4457 O O   . HOH B 2 .   ? 4.769   57.435 76.420 1.00 46.72  ? 1219 HOH A O   1 
HETATM 4458 O O   . HOH B 2 .   ? 1.288   81.271 74.027 1.00 50.61  ? 1220 HOH A O   1 
HETATM 4459 O O   . HOH B 2 .   ? 14.931  52.234 84.557 1.00 59.22  ? 1221 HOH A O   1 
HETATM 4460 O O   . HOH B 2 .   ? 11.213  77.384 84.607 1.00 67.28  ? 1222 HOH A O   1 
HETATM 4461 O O   . HOH B 2 .   ? 5.075   41.470 57.638 1.00 49.17  ? 1223 HOH A O   1 
HETATM 4462 O O   . HOH B 2 .   ? 7.113   65.609 80.422 1.00 65.73  ? 1224 HOH A O   1 
HETATM 4463 O O   . HOH B 2 .   ? 22.132  87.355 52.048 1.00 57.73  ? 1225 HOH A O   1 
HETATM 4464 O O   . HOH B 2 .   ? -18.931 83.065 33.823 1.00 72.00  ? 1226 HOH A O   1 
HETATM 4465 O O   . HOH B 2 .   ? 11.988  87.307 44.759 1.00 48.67  ? 1227 HOH A O   1 
HETATM 4466 O O   . HOH B 2 .   ? 5.747   57.892 36.135 1.00 59.59  ? 1228 HOH A O   1 
HETATM 4467 O O   . HOH B 2 .   ? 25.142  43.537 78.680 1.00 54.81  ? 1229 HOH A O   1 
HETATM 4468 O O   . HOH B 2 .   ? -10.360 60.376 40.072 1.00 58.14  ? 1230 HOH A O   1 
HETATM 4469 O O   . HOH B 2 .   ? -16.666 44.519 54.766 1.00 59.34  ? 1231 HOH A O   1 
HETATM 4470 O O   . HOH B 2 .   ? -15.676 65.446 36.543 1.00 65.46  ? 1232 HOH A O   1 
HETATM 4471 O O   . HOH B 2 .   ? 17.565  64.595 64.493 1.00 82.08  ? 1233 HOH A O   1 
HETATM 4472 O O   . HOH B 2 .   ? 25.192  70.699 63.235 1.00 47.48  ? 1234 HOH A O   1 
HETATM 4473 O O   . HOH B 2 .   ? 25.243  62.690 88.860 1.00 58.17  ? 1235 HOH A O   1 
HETATM 4474 O O   . HOH B 2 .   ? -21.682 81.199 45.596 1.00 57.68  ? 1236 HOH A O   1 
HETATM 4475 O O   . HOH B 2 .   ? -18.434 75.395 31.223 1.00 62.34  ? 1237 HOH A O   1 
HETATM 4476 O O   . HOH B 2 .   ? 3.604   92.072 56.207 1.00 60.05  ? 1238 HOH A O   1 
HETATM 4477 O O   . HOH B 2 .   ? 13.424  38.596 63.229 1.00 75.47  ? 1239 HOH A O   1 
HETATM 4478 O O   . HOH B 2 .   ? 17.157  69.522 85.043 1.00 45.90  ? 1240 HOH A O   1 
HETATM 4479 O O   . HOH B 2 .   ? -18.122 40.137 70.402 1.00 52.44  ? 1241 HOH A O   1 
HETATM 4480 O O   . HOH B 2 .   ? -24.801 56.105 59.747 1.00 61.13  ? 1242 HOH A O   1 
HETATM 4481 O O   . HOH B 2 .   ? 8.065   75.792 60.894 1.00 67.62  ? 1243 HOH A O   1 
HETATM 4482 O O   . HOH B 2 .   ? 9.055   59.732 35.899 1.00 54.44  ? 1244 HOH A O   1 
HETATM 4483 O O   . HOH B 2 .   ? -20.747 47.270 57.799 1.00 56.09  ? 1245 HOH A O   1 
HETATM 4484 O O   . HOH B 2 .   ? 20.418  63.086 65.155 1.00 59.29  ? 1246 HOH A O   1 
HETATM 4485 O O   . HOH B 2 .   ? -21.785 61.573 63.235 1.00 59.43  ? 1247 HOH A O   1 
HETATM 4486 O O   . HOH B 2 .   ? -13.380 62.731 57.694 1.00 52.49  ? 1248 HOH A O   1 
HETATM 4487 O O   . HOH B 2 .   ? -18.063 63.833 72.439 1.00 50.89  ? 1249 HOH A O   1 
HETATM 4488 O O   . HOH B 2 .   ? -9.489  55.570 76.970 1.00 56.64  ? 1250 HOH A O   1 
HETATM 4489 O O   . HOH B 2 .   ? -6.429  66.522 32.048 1.00 61.53  ? 1251 HOH A O   1 
HETATM 4490 O O   . HOH B 2 .   ? 23.140  84.693 48.793 1.00 61.05  ? 1252 HOH A O   1 
HETATM 4491 O O   . HOH B 2 .   ? 18.345  91.439 62.971 1.00 51.92  ? 1253 HOH A O   1 
HETATM 4492 O O   . HOH B 2 .   ? -4.995  80.634 58.723 1.00 53.55  ? 1254 HOH A O   1 
HETATM 4493 O O   . HOH B 2 .   ? 22.332  60.277 86.713 1.00 55.57  ? 1255 HOH A O   1 
HETATM 4494 O O   . HOH B 2 .   ? 11.846  70.431 33.894 1.00 44.04  ? 1256 HOH A O   1 
HETATM 4495 O O   . HOH B 2 .   ? 0.070   75.230 79.087 1.00 57.19  ? 1257 HOH A O   1 
HETATM 4496 O O   . HOH B 2 .   ? -4.288  40.034 63.491 1.00 50.03  ? 1258 HOH A O   1 
HETATM 4497 O O   . HOH B 2 .   ? 11.170  43.443 53.135 1.00 68.25  ? 1259 HOH A O   1 
HETATM 4498 O O   . HOH B 2 .   ? 14.158  39.989 76.057 1.00 52.60  ? 1260 HOH A O   1 
HETATM 4499 O O   . HOH B 2 .   ? 24.872  44.015 55.965 1.00 53.28  ? 1261 HOH A O   1 
HETATM 4500 O O   . HOH B 2 .   ? 10.810  51.925 83.544 1.00 71.30  ? 1262 HOH A O   1 
HETATM 4501 O O   . HOH B 2 .   ? -1.168  51.399 42.610 1.00 56.19  ? 1263 HOH A O   1 
HETATM 4502 O O   . HOH B 2 .   ? -24.738 78.294 35.915 1.00 63.55  ? 1264 HOH A O   1 
HETATM 4503 O O   . HOH B 2 .   ? -21.774 59.683 52.176 1.00 48.17  ? 1265 HOH A O   1 
HETATM 4504 O O   . HOH B 2 .   ? 20.035  69.855 35.860 1.00 50.20  ? 1266 HOH A O   1 
HETATM 4505 O O   . HOH B 2 .   ? -1.178  72.119 73.518 1.00 59.31  ? 1267 HOH A O   1 
HETATM 4506 O O   . HOH B 2 .   ? -15.536 57.017 72.962 1.00 71.47  ? 1268 HOH A O   1 
HETATM 4507 O O   . HOH B 2 .   ? -9.069  53.646 44.396 1.00 58.02  ? 1269 HOH A O   1 
HETATM 4508 O O   . HOH B 2 .   ? -23.527 49.275 53.470 1.00 64.37  ? 1270 HOH A O   1 
HETATM 4509 O O   . HOH B 2 .   ? 2.693   54.334 36.660 1.00 49.30  ? 1271 HOH A O   1 
HETATM 4510 O O   . HOH B 2 .   ? 21.512  58.657 38.111 1.00 65.46  ? 1272 HOH A O   1 
HETATM 4511 O O   . HOH B 2 .   ? 17.555  64.186 67.079 1.00 51.74  ? 1273 HOH A O   1 
HETATM 4512 O O   . HOH B 2 .   ? 28.880  50.244 70.853 1.00 78.04  ? 1274 HOH A O   1 
HETATM 4513 O O   . HOH B 2 .   ? 8.673   49.694 75.515 1.00 52.15  ? 1275 HOH A O   1 
HETATM 4514 O O   . HOH B 2 .   ? -10.072 65.278 38.272 1.00 45.20  ? 1276 HOH A O   1 
HETATM 4515 O O   . HOH B 2 .   ? 19.220  34.483 60.446 1.00 60.65  ? 1277 HOH A O   1 
HETATM 4516 O O   . HOH B 2 .   ? 34.408  62.148 77.829 1.00 60.45  ? 1278 HOH A O   1 
HETATM 4517 O O   . HOH B 2 .   ? 28.973  59.426 61.632 1.00 51.14  ? 1279 HOH A O   1 
HETATM 4518 O O   . HOH B 2 .   ? -18.891 60.199 41.866 1.00 55.53  ? 1280 HOH A O   1 
HETATM 4519 O O   . HOH B 2 .   ? 23.219  56.679 39.392 1.00 52.30  ? 1281 HOH A O   1 
HETATM 4520 O O   . HOH B 2 .   ? -17.020 67.209 33.706 1.00 52.25  ? 1282 HOH A O   1 
HETATM 4521 O O   . HOH B 2 .   ? 7.807   84.100 66.020 1.00 64.19  ? 1283 HOH A O   1 
HETATM 4522 O O   . HOH B 2 .   ? 21.392  78.578 64.987 1.00 52.51  ? 1284 HOH A O   1 
HETATM 4523 O O   . HOH B 2 .   ? -20.674 69.049 51.424 1.00 59.29  ? 1285 HOH A O   1 
HETATM 4524 O O   . HOH B 2 .   ? 2.172   83.316 61.010 1.00 60.68  ? 1286 HOH A O   1 
HETATM 4525 O O   . HOH B 2 .   ? 20.640  81.722 35.707 1.00 68.99  ? 1287 HOH A O   1 
HETATM 4526 O O   . HOH B 2 .   ? 18.076  75.597 37.403 1.00 55.38  ? 1288 HOH A O   1 
HETATM 4527 O O   . HOH B 2 .   ? -4.500  42.595 70.283 1.00 53.51  ? 1289 HOH A O   1 
HETATM 4528 O O   . HOH B 2 .   ? 31.393  62.143 57.102 1.00 80.97  ? 1290 HOH A O   1 
HETATM 4529 O O   . HOH B 2 .   ? 11.624  90.925 57.498 1.00 56.79  ? 1291 HOH A O   1 
HETATM 4530 O O   . HOH B 2 .   ? 19.068  75.239 71.245 1.00 55.21  ? 1292 HOH A O   1 
HETATM 4531 O O   . HOH B 2 .   ? 0.232   66.139 68.807 1.00 61.85  ? 1293 HOH A O   1 
HETATM 4532 O O   . HOH B 2 .   ? 11.909  60.769 86.491 1.00 70.77  ? 1294 HOH A O   1 
HETATM 4533 O O   . HOH B 2 .   ? -4.761  87.738 35.034 1.00 57.87  ? 1295 HOH A O   1 
HETATM 4534 O O   . HOH B 2 .   ? 25.157  70.228 69.063 1.00 60.07  ? 1296 HOH A O   1 
HETATM 4535 O O   . HOH B 2 .   ? 28.196  68.393 78.570 1.00 58.98  ? 1297 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS ALA A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS ALA A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS ALA A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS ALA A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS ALA A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 488 GLN GLN A . n 
A 1 489 GLU 489 489 489 GLU GLU A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS ALA A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   1001 1001 HOH HOH A . 
B 2 HOH 2   1002 1002 HOH HOH A . 
B 2 HOH 3   1003 1003 HOH HOH A . 
B 2 HOH 4   1004 1004 HOH HOH A . 
B 2 HOH 5   1005 1005 HOH HOH A . 
B 2 HOH 6   1006 1006 HOH HOH A . 
B 2 HOH 7   1007 1007 HOH HOH A . 
B 2 HOH 8   1008 1008 HOH HOH A . 
B 2 HOH 9   1009 1009 HOH HOH A . 
B 2 HOH 10  1010 1010 HOH HOH A . 
B 2 HOH 11  1011 1011 HOH HOH A . 
B 2 HOH 12  1012 1012 HOH HOH A . 
B 2 HOH 13  1013 1013 HOH HOH A . 
B 2 HOH 14  1014 1014 HOH HOH A . 
B 2 HOH 15  1015 1015 HOH HOH A . 
B 2 HOH 16  1016 1016 HOH HOH A . 
B 2 HOH 17  1017 1017 HOH HOH A . 
B 2 HOH 18  1018 1018 HOH HOH A . 
B 2 HOH 19  1019 1019 HOH HOH A . 
B 2 HOH 20  1020 1020 HOH HOH A . 
B 2 HOH 21  1021 1021 HOH HOH A . 
B 2 HOH 22  1022 1022 HOH HOH A . 
B 2 HOH 23  1023 1023 HOH HOH A . 
B 2 HOH 24  1024 1024 HOH HOH A . 
B 2 HOH 25  1025 1025 HOH HOH A . 
B 2 HOH 26  1026 1026 HOH HOH A . 
B 2 HOH 27  1027 1027 HOH HOH A . 
B 2 HOH 28  1028 1028 HOH HOH A . 
B 2 HOH 29  1029 1029 HOH HOH A . 
B 2 HOH 30  1030 1030 HOH HOH A . 
B 2 HOH 31  1031 1031 HOH HOH A . 
B 2 HOH 32  1032 1032 HOH HOH A . 
B 2 HOH 33  1033 1033 HOH HOH A . 
B 2 HOH 34  1034 1034 HOH HOH A . 
B 2 HOH 35  1035 1035 HOH HOH A . 
B 2 HOH 36  1036 1036 HOH HOH A . 
B 2 HOH 37  1037 1037 HOH HOH A . 
B 2 HOH 38  1038 1038 HOH HOH A . 
B 2 HOH 39  1039 1039 HOH HOH A . 
B 2 HOH 40  1040 1040 HOH HOH A . 
B 2 HOH 41  1041 1041 HOH HOH A . 
B 2 HOH 42  1042 1042 HOH HOH A . 
B 2 HOH 43  1043 1043 HOH HOH A . 
B 2 HOH 44  1044 1044 HOH HOH A . 
B 2 HOH 45  1045 1045 HOH HOH A . 
B 2 HOH 46  1046 1046 HOH HOH A . 
B 2 HOH 47  1047 1047 HOH HOH A . 
B 2 HOH 48  1048 1048 HOH HOH A . 
B 2 HOH 49  1049 1049 HOH HOH A . 
B 2 HOH 50  1050 1050 HOH HOH A . 
B 2 HOH 51  1051 1051 HOH HOH A . 
B 2 HOH 52  1052 1052 HOH HOH A . 
B 2 HOH 53  1053 1053 HOH HOH A . 
B 2 HOH 54  1054 1054 HOH HOH A . 
B 2 HOH 55  1055 1055 HOH HOH A . 
B 2 HOH 56  1056 1056 HOH HOH A . 
B 2 HOH 57  1057 1057 HOH HOH A . 
B 2 HOH 58  1058 1058 HOH HOH A . 
B 2 HOH 59  1059 1059 HOH HOH A . 
B 2 HOH 60  1060 1060 HOH HOH A . 
B 2 HOH 61  1061 1061 HOH HOH A . 
B 2 HOH 62  1062 1062 HOH HOH A . 
B 2 HOH 63  1063 1063 HOH HOH A . 
B 2 HOH 64  1064 1064 HOH HOH A . 
B 2 HOH 65  1065 1065 HOH HOH A . 
B 2 HOH 66  1066 1066 HOH HOH A . 
B 2 HOH 67  1067 1067 HOH HOH A . 
B 2 HOH 68  1068 1068 HOH HOH A . 
B 2 HOH 69  1069 1069 HOH HOH A . 
B 2 HOH 70  1070 1070 HOH HOH A . 
B 2 HOH 71  1071 1071 HOH HOH A . 
B 2 HOH 72  1072 1072 HOH HOH A . 
B 2 HOH 73  1073 1073 HOH HOH A . 
B 2 HOH 74  1074 1074 HOH HOH A . 
B 2 HOH 75  1075 1075 HOH HOH A . 
B 2 HOH 76  1076 1076 HOH HOH A . 
B 2 HOH 77  1077 1077 HOH HOH A . 
B 2 HOH 78  1078 1078 HOH HOH A . 
B 2 HOH 79  1079 1079 HOH HOH A . 
B 2 HOH 80  1080 1080 HOH HOH A . 
B 2 HOH 81  1081 1081 HOH HOH A . 
B 2 HOH 82  1082 1082 HOH HOH A . 
B 2 HOH 83  1083 1083 HOH HOH A . 
B 2 HOH 84  1084 1084 HOH HOH A . 
B 2 HOH 85  1085 1085 HOH HOH A . 
B 2 HOH 86  1086 1086 HOH HOH A . 
B 2 HOH 87  1087 1087 HOH HOH A . 
B 2 HOH 88  1088 1088 HOH HOH A . 
B 2 HOH 89  1089 1089 HOH HOH A . 
B 2 HOH 90  1090 1090 HOH HOH A . 
B 2 HOH 91  1091 1091 HOH HOH A . 
B 2 HOH 92  1092 1092 HOH HOH A . 
B 2 HOH 93  1093 1093 HOH HOH A . 
B 2 HOH 94  1094 1094 HOH HOH A . 
B 2 HOH 95  1095 1095 HOH HOH A . 
B 2 HOH 96  1096 1096 HOH HOH A . 
B 2 HOH 97  1097 1097 HOH HOH A . 
B 2 HOH 98  1098 1098 HOH HOH A . 
B 2 HOH 99  1099 1099 HOH HOH A . 
B 2 HOH 100 1100 1100 HOH HOH A . 
B 2 HOH 101 1101 1101 HOH HOH A . 
B 2 HOH 102 1102 1102 HOH HOH A . 
B 2 HOH 103 1103 1103 HOH HOH A . 
B 2 HOH 104 1104 1104 HOH HOH A . 
B 2 HOH 105 1105 1105 HOH HOH A . 
B 2 HOH 106 1106 1106 HOH HOH A . 
B 2 HOH 107 1107 1107 HOH HOH A . 
B 2 HOH 108 1108 1108 HOH HOH A . 
B 2 HOH 109 1109 1109 HOH HOH A . 
B 2 HOH 110 1110 1110 HOH HOH A . 
B 2 HOH 111 1111 1111 HOH HOH A . 
B 2 HOH 112 1112 1112 HOH HOH A . 
B 2 HOH 113 1113 1113 HOH HOH A . 
B 2 HOH 114 1114 1114 HOH HOH A . 
B 2 HOH 115 1115 1115 HOH HOH A . 
B 2 HOH 116 1116 1116 HOH HOH A . 
B 2 HOH 117 1117 1117 HOH HOH A . 
B 2 HOH 118 1118 1118 HOH HOH A . 
B 2 HOH 119 1119 1119 HOH HOH A . 
B 2 HOH 120 1120 1120 HOH HOH A . 
B 2 HOH 121 1121 1121 HOH HOH A . 
B 2 HOH 122 1122 1122 HOH HOH A . 
B 2 HOH 123 1123 1123 HOH HOH A . 
B 2 HOH 124 1124 1124 HOH HOH A . 
B 2 HOH 125 1125 1125 HOH HOH A . 
B 2 HOH 126 1126 1126 HOH HOH A . 
B 2 HOH 127 1127 1127 HOH HOH A . 
B 2 HOH 128 1128 1128 HOH HOH A . 
B 2 HOH 129 1129 1129 HOH HOH A . 
B 2 HOH 130 1130 1130 HOH HOH A . 
B 2 HOH 131 1131 1131 HOH HOH A . 
B 2 HOH 132 1132 1132 HOH HOH A . 
B 2 HOH 133 1133 1133 HOH HOH A . 
B 2 HOH 134 1134 1134 HOH HOH A . 
B 2 HOH 135 1135 1135 HOH HOH A . 
B 2 HOH 136 1136 1136 HOH HOH A . 
B 2 HOH 137 1137 1137 HOH HOH A . 
B 2 HOH 138 1138 1138 HOH HOH A . 
B 2 HOH 139 1139 1139 HOH HOH A . 
B 2 HOH 140 1140 1140 HOH HOH A . 
B 2 HOH 141 1141 1141 HOH HOH A . 
B 2 HOH 142 1142 1142 HOH HOH A . 
B 2 HOH 143 1143 1143 HOH HOH A . 
B 2 HOH 144 1144 1144 HOH HOH A . 
B 2 HOH 145 1145 1145 HOH HOH A . 
B 2 HOH 146 1146 1146 HOH HOH A . 
B 2 HOH 147 1147 1147 HOH HOH A . 
B 2 HOH 148 1148 1148 HOH HOH A . 
B 2 HOH 149 1149 1149 HOH HOH A . 
B 2 HOH 150 1150 1150 HOH HOH A . 
B 2 HOH 151 1151 1151 HOH HOH A . 
B 2 HOH 152 1152 1152 HOH HOH A . 
B 2 HOH 153 1153 1153 HOH HOH A . 
B 2 HOH 154 1154 1154 HOH HOH A . 
B 2 HOH 155 1155 1155 HOH HOH A . 
B 2 HOH 156 1156 1156 HOH HOH A . 
B 2 HOH 157 1157 1157 HOH HOH A . 
B 2 HOH 158 1158 1158 HOH HOH A . 
B 2 HOH 159 1159 1159 HOH HOH A . 
B 2 HOH 160 1160 1160 HOH HOH A . 
B 2 HOH 161 1161 1161 HOH HOH A . 
B 2 HOH 162 1162 1162 HOH HOH A . 
B 2 HOH 163 1163 1163 HOH HOH A . 
B 2 HOH 164 1164 1164 HOH HOH A . 
B 2 HOH 165 1165 1165 HOH HOH A . 
B 2 HOH 166 1166 1166 HOH HOH A . 
B 2 HOH 167 1167 1167 HOH HOH A . 
B 2 HOH 168 1168 1168 HOH HOH A . 
B 2 HOH 169 1169 1169 HOH HOH A . 
B 2 HOH 170 1170 1170 HOH HOH A . 
B 2 HOH 171 1171 1171 HOH HOH A . 
B 2 HOH 172 1172 1172 HOH HOH A . 
B 2 HOH 173 1173 1173 HOH HOH A . 
B 2 HOH 174 1174 1174 HOH HOH A . 
B 2 HOH 175 1175 1175 HOH HOH A . 
B 2 HOH 176 1176 1176 HOH HOH A . 
B 2 HOH 177 1177 1177 HOH HOH A . 
B 2 HOH 178 1178 1178 HOH HOH A . 
B 2 HOH 179 1179 1179 HOH HOH A . 
B 2 HOH 180 1180 1180 HOH HOH A . 
B 2 HOH 181 1181 1181 HOH HOH A . 
B 2 HOH 182 1182 1182 HOH HOH A . 
B 2 HOH 183 1183 1183 HOH HOH A . 
B 2 HOH 184 1184 1184 HOH HOH A . 
B 2 HOH 185 1185 1185 HOH HOH A . 
B 2 HOH 186 1186 1186 HOH HOH A . 
B 2 HOH 187 1187 1187 HOH HOH A . 
B 2 HOH 188 1188 1188 HOH HOH A . 
B 2 HOH 189 1189 1189 HOH HOH A . 
B 2 HOH 190 1190 1190 HOH HOH A . 
B 2 HOH 191 1191 1191 HOH HOH A . 
B 2 HOH 192 1192 1192 HOH HOH A . 
B 2 HOH 193 1193 1193 HOH HOH A . 
B 2 HOH 194 1194 1194 HOH HOH A . 
B 2 HOH 195 1195 1195 HOH HOH A . 
B 2 HOH 196 1196 1196 HOH HOH A . 
B 2 HOH 197 1197 1197 HOH HOH A . 
B 2 HOH 198 1198 1198 HOH HOH A . 
B 2 HOH 199 1199 1199 HOH HOH A . 
B 2 HOH 200 1200 1200 HOH HOH A . 
B 2 HOH 201 1201 1201 HOH HOH A . 
B 2 HOH 202 1202 1202 HOH HOH A . 
B 2 HOH 203 1203 1203 HOH HOH A . 
B 2 HOH 204 1204 1204 HOH HOH A . 
B 2 HOH 205 1205 1205 HOH HOH A . 
B 2 HOH 206 1206 1206 HOH HOH A . 
B 2 HOH 207 1207 1207 HOH HOH A . 
B 2 HOH 208 1208 1208 HOH HOH A . 
B 2 HOH 209 1209 1209 HOH HOH A . 
B 2 HOH 210 1210 1210 HOH HOH A . 
B 2 HOH 211 1211 1211 HOH HOH A . 
B 2 HOH 212 1212 1212 HOH HOH A . 
B 2 HOH 213 1213 1213 HOH HOH A . 
B 2 HOH 214 1214 1214 HOH HOH A . 
B 2 HOH 215 1215 1215 HOH HOH A . 
B 2 HOH 216 1216 1216 HOH HOH A . 
B 2 HOH 217 1217 1217 HOH HOH A . 
B 2 HOH 218 1218 1218 HOH HOH A . 
B 2 HOH 219 1219 1219 HOH HOH A . 
B 2 HOH 220 1220 1220 HOH HOH A . 
B 2 HOH 221 1221 1221 HOH HOH A . 
B 2 HOH 222 1222 1222 HOH HOH A . 
B 2 HOH 223 1223 1223 HOH HOH A . 
B 2 HOH 224 1224 1224 HOH HOH A . 
B 2 HOH 225 1225 1225 HOH HOH A . 
B 2 HOH 226 1226 1226 HOH HOH A . 
B 2 HOH 227 1227 1227 HOH HOH A . 
B 2 HOH 228 1228 1228 HOH HOH A . 
B 2 HOH 229 1229 1229 HOH HOH A . 
B 2 HOH 230 1230 1230 HOH HOH A . 
B 2 HOH 231 1231 1231 HOH HOH A . 
B 2 HOH 232 1232 1232 HOH HOH A . 
B 2 HOH 233 1233 1233 HOH HOH A . 
B 2 HOH 234 1234 1234 HOH HOH A . 
B 2 HOH 235 1235 1235 HOH HOH A . 
B 2 HOH 236 1236 1236 HOH HOH A . 
B 2 HOH 237 1237 1237 HOH HOH A . 
B 2 HOH 238 1238 1238 HOH HOH A . 
B 2 HOH 239 1239 1239 HOH HOH A . 
B 2 HOH 240 1240 1240 HOH HOH A . 
B 2 HOH 241 1241 1241 HOH HOH A . 
B 2 HOH 242 1242 1242 HOH HOH A . 
B 2 HOH 243 1243 1243 HOH HOH A . 
B 2 HOH 244 1244 1244 HOH HOH A . 
B 2 HOH 245 1245 1245 HOH HOH A . 
B 2 HOH 246 1246 1246 HOH HOH A . 
B 2 HOH 247 1247 1247 HOH HOH A . 
B 2 HOH 248 1248 1248 HOH HOH A . 
B 2 HOH 249 1249 1249 HOH HOH A . 
B 2 HOH 250 1250 1250 HOH HOH A . 
B 2 HOH 251 1251 1251 HOH HOH A . 
B 2 HOH 252 1252 1252 HOH HOH A . 
B 2 HOH 253 1253 1253 HOH HOH A . 
B 2 HOH 254 1254 1254 HOH HOH A . 
B 2 HOH 255 1255 1255 HOH HOH A . 
B 2 HOH 256 1256 1256 HOH HOH A . 
B 2 HOH 257 1257 1257 HOH HOH A . 
B 2 HOH 258 1258 1258 HOH HOH A . 
B 2 HOH 259 1259 1259 HOH HOH A . 
B 2 HOH 260 1260 1260 HOH HOH A . 
B 2 HOH 261 1261 1261 HOH HOH A . 
B 2 HOH 262 1262 1262 HOH HOH A . 
B 2 HOH 263 1263 1263 HOH HOH A . 
B 2 HOH 264 1264 1264 HOH HOH A . 
B 2 HOH 265 1265 1265 HOH HOH A . 
B 2 HOH 266 1266 1266 HOH HOH A . 
B 2 HOH 267 1267 1267 HOH HOH A . 
B 2 HOH 268 1268 1268 HOH HOH A . 
B 2 HOH 269 1269 1269 HOH HOH A . 
B 2 HOH 270 1270 1270 HOH HOH A . 
B 2 HOH 271 1271 1271 HOH HOH A . 
B 2 HOH 272 1272 1272 HOH HOH A . 
B 2 HOH 273 1273 1273 HOH HOH A . 
B 2 HOH 274 1274 1274 HOH HOH A . 
B 2 HOH 275 1275 1275 HOH HOH A . 
B 2 HOH 276 1276 1276 HOH HOH A . 
B 2 HOH 277 1277 1277 HOH HOH A . 
B 2 HOH 278 1278 1278 HOH HOH A . 
B 2 HOH 279 1279 1279 HOH HOH A . 
B 2 HOH 280 1280 1280 HOH HOH A . 
B 2 HOH 281 1281 1281 HOH HOH A . 
B 2 HOH 282 1282 1282 HOH HOH A . 
B 2 HOH 283 1283 1283 HOH HOH A . 
B 2 HOH 284 1284 1284 HOH HOH A . 
B 2 HOH 285 1285 1285 HOH HOH A . 
B 2 HOH 286 1286 1286 HOH HOH A . 
B 2 HOH 287 1287 1287 HOH HOH A . 
B 2 HOH 288 1288 1288 HOH HOH A . 
B 2 HOH 289 1289 1289 HOH HOH A . 
B 2 HOH 290 1290 1290 HOH HOH A . 
B 2 HOH 291 1291 1291 HOH HOH A . 
B 2 HOH 292 1292 1292 HOH HOH A . 
B 2 HOH 293 1293 1293 HOH HOH A . 
B 2 HOH 294 1294 1294 HOH HOH A . 
B 2 HOH 295 1295 1295 HOH HOH A . 
B 2 HOH 296 1296 1296 HOH HOH A . 
B 2 HOH 297 1297 1297 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 137.9940000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-01-28 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       0.5 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
SOLVE     phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 23  ? ? 39.04   50.68   
2  1 SER A 25  ? ? -168.58 -163.77 
3  1 PHE A 45  ? ? 75.38   -14.66  
4  1 ALA A 60  ? ? -109.81 52.79   
5  1 SER A 108 ? ? -160.55 66.45   
6  1 LEU A 158 ? ? -119.45 73.69   
7  1 ALA A 164 ? ? -166.99 67.67   
8  1 ASN A 167 ? ? 49.23   16.62   
9  1 THR A 193 ? ? -144.60 57.61   
10 1 SER A 200 ? ? 54.25   -119.45 
11 1 ILE A 296 ? ? -67.68  96.95   
12 1 GLU A 299 ? ? -120.97 -77.67  
13 1 THR A 303 ? ? -129.28 -151.39 
14 1 THR A 317 ? ? -160.64 -155.12 
15 1 ASP A 326 ? ? -116.63 61.49   
16 1 ASP A 380 ? ? -158.51 46.17   
17 1 VAL A 400 ? ? -126.96 -58.09  
18 1 GLU A 455 ? ? -49.05  -19.34  
19 1 ASN A 457 ? ? 75.17   60.93   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A CYS 67  ? SG ? A CYS 67  SG 
2 1 Y 1 A CYS 94  ? SG ? A CYS 94  SG 
3 1 Y 1 A CYS 254 ? SG ? A CYS 254 SG 
4 1 Y 1 A CYS 265 ? SG ? A CYS 265 SG 
5 1 Y 1 A CYS 402 ? SG ? A CYS 402 SG 
6 1 Y 1 A CYS 521 ? SG ? A CYS 521 SG 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 1   ? A ASP 1   
2 1 Y 1 A ASP 2   ? A ASP 2   
3 1 Y 1 A HIS 3   ? A HIS 3   
4 1 Y 1 A ALA 536 ? A ALA 536 
5 1 Y 1 A CYS 537 ? A CYS 537 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#