data_1QIJ
# 
_entry.id   1QIJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QIJ         
RCSB  RCSB001190   
WWPDB D_1000001190 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1QID 'EXPERIMENTAL TIME POINT A' unspecified 
PDB 1QIE 'EXPERIMENTAL TIME POINT B' unspecified 
PDB 1QIF 'EXPERIMENTAL TIME POINT C' unspecified 
PDB 1QIG 'EXPERIMENTAL TIME POINT D' unspecified 
PDB 1QIH 'EXPERIMENTAL TIME POINT E' unspecified 
PDB 1QII 'EXPERIMENTAL TIME POINT F' unspecified 
PDB 1QIJ 'EXPERIMENTAL TIME POINT G' unspecified 
PDB 1QIK 'EXPERIMENTAL TIME POINT H' unspecified 
PDB 1QIM 'EXPERIMENTAL TIME POINT I' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QIJ 
_pdbx_database_status.recvd_initial_deposition_date   1999-06-14 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kryger, G.'      1 
'Weik, M.'        2 
'Ravelli, R.B.G.' 3 
# 
_citation.id                        primary 
_citation.title                     'Specific chemical and structural damage to proteins produced by synchrotron radiation.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            97 
_citation.page_first                623 
_citation.page_last                 628 
_citation.year                      2000 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10639129 
_citation.pdbx_database_id_DOI      10.1073/pnas.97.2.623 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Weik, M.'      1  
primary 'Ravelli, R.B.' 2  
primary 'Kryger, G.'    3  
primary 'McSweeney, S.' 4  
primary 'Raves, M.L.'   5  
primary 'Harel, M.'     6  
primary 'Gros, P.'      7  
primary 'Silman, I.'    8  
primary 'Kroon, J.'     9  
primary 'Sussman, J.L.' 10 
# 
_cell.entry_id           1QIJ 
_cell.length_a           112.156 
_cell.length_b           112.156 
_cell.length_c           138.045 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QIJ 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat ACETYLCHOLINESTERASE 60736.516 1   3.1.1.7 ? ? ? 
2 water   nat water                18.015    293 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'Pacific electric ray' 
_entity_src_nat.pdbx_organism_scientific   'Torpedo californica' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      Torpedo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1QIJ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 537 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  558 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QIJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.8 
_exptl_crystal.density_percent_sol   68. 
_exptl_crystal.description           'ONLY PARTIAL REFINEMENT DONE' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_details    '30% PEG 200, 0.3 M MES, pH 5.8, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   1999-03-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9320 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             0.9320 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QIJ 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             36.71 
_reflns.d_resolution_high            2.80 
_reflns.number_obs                   25004 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.055 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        72.4 
_reflns.pdbx_redundancy              2.07 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1QIJ 
_refine.ls_number_reflns_obs                     24961 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           1832594.88 
_refine.ls_d_res_low                             36.71 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    98.9 
_refine.ls_R_factor_obs                          0.1940000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1940000 
_refine.ls_R_factor_R_free                       0.2230000 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  1201 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               46.4 
_refine.aniso_B[1][1]                            4.79 
_refine.aniso_B[2][2]                            4.79 
_refine.aniso_B[3][3]                            -9.57 
_refine.aniso_B[1][2]                            5.43 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.334 
_refine.solvent_model_param_bsol                 38.35 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;BULK SOLVENT MODEL USED. ONLY PARTIAL REFINEMENT DONE. ALL SIX CYSTEINE 
RESIDUES TAKING PART IN INTRACHAIN DISULFIDE LINKAGES,CYS 67-CYS 94, CYS 402- 
CYS 521 AND CYS 254-CYS 265, WERE MODELED AND REFINED AS ALANINE RESIDUES.

TCACHE IS A GLYCOPROTEIN OF MR = 65,000, WHICH CONTAINS
THREE INTRACHAIN DISULFIDE BONDS. IN THE COURSE OF
CRYOGENIC DATA COLLECTION ON TRIGONAL CRYSTALS OF TCACHE ON
THE UNDULATOR BEAMLINE, ID14-EH4, AT THE ESRF IN GRENOBLE,
IN PREPARATION FOR TIME-RESOLVED STUDIES, WE COLLECTED A
SERIES OF NINE HIGH-QUALITY COMPLETE DATA SETS ON THE SAME
CRYSTAL. DATA COLLECTION UTILIZED THE UNATTENUATED BEAM,
AND THE DURATION PER DATA SET WAS CA. 19 MIN, FOR 3 H IN
TOTAL, AT 100K. ELECTRON DENSITY MAPS WERE OBTAINED FOR
EACH DATA SET BY ROUTINE REFINEMENT, STARTING FROM THE SAME
MODEL OF NATIVE TCACHE. FOR RESULTS, SEE:
HTTP://SGJS3.WEIZMANN.AC.IL/~KRYGER/RADIATION_DAMAGE
(LOWER CASE!)

THIS ENTRY IS THE 7TH TIME POINT (7 OF 9). SEE HTTP://
SGJS3.WEIZMANN.AC.IL/~KRYGER/RADIATION_DAMAGE (LOWER CASE!)
;
_refine.pdbx_starting_model                      'PDB ENTRY 1VXR' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1QIJ 
_refine_analyze.Luzzati_coordinate_error_obs    0.30 
_refine_analyze.Luzzati_sigma_a_obs             0.42 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.36 
_refine_analyze.Luzzati_sigma_a_free            0.49 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4238 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             293 
_refine_hist.number_atoms_total               4531 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        36.71 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.009 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.9  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.87  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             3.75  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            5.82  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             7.18  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            10.28 2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.90 
_refine_ls_shell.number_reflns_R_work             2325 
_refine_ls_shell.R_factor_R_work                  0.3110000 
_refine_ls_shell.percent_reflns_obs               99.2 
_refine_ls_shell.R_factor_R_free                  0.3430000 
_refine_ls_shell.R_factor_R_free_error            0.032 
_refine_ls_shell.percent_reflns_R_free            4.8 
_refine_ls_shell.number_reflns_R_free             118 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP     'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER_REP.PARAM 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1QIJ 
_struct.title                     
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT G) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QIJ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;RADIATION DAMAGE, TIME SERIES, DISULFIDE BOND, SERINE HYDROLASE, ALPHA/BETA HYDROLASE, NEUROTRANSMITTER CLEAVAGE, CATALYTIC TRIAD, GLYCOSYLATED PROTEIN, HYDROLASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 41  ? MET A 43  ? GLY A 41  MET A 43  5 ? 3  
HELX_P HELX_P2  2  SER A 79  ? TRP A 84  ? SER A 79  TRP A 84  1 ? 6  
HELX_P HELX_P3  3  ASP A 128 ? TYR A 130 ? ASP A 128 TYR A 130 5 ? 3  
HELX_P HELX_P4  4  LYS A 133 ? GLU A 139 ? LYS A 133 GLU A 139 1 ? 7  
HELX_P HELX_P5  5  GLY A 151 ? PHE A 155 ? GLY A 151 PHE A 155 1 ? 5  
HELX_P HELX_P6  6  VAL A 168 ? PHE A 187 ? VAL A 168 PHE A 187 1 ? 20 
HELX_P HELX_P7  7  ALA A 201 ? LEU A 211 ? ALA A 201 LEU A 211 1 ? 11 
HELX_P HELX_P8  8  PRO A 213 ? LEU A 218 ? PRO A 213 LEU A 218 1 ? 6  
HELX_P HELX_P9  9  VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P10 10 ASP A 259 ? GLU A 268 ? ASP A 259 GLU A 268 1 ? 10 
HELX_P HELX_P11 11 PRO A 271 ? VAL A 281 ? PRO A 271 VAL A 281 1 ? 11 
HELX_P HELX_P12 12 LEU A 305 ? SER A 311 ? LEU A 305 SER A 311 1 ? 7  
HELX_P HELX_P13 13 SER A 329 ? GLY A 335 ? SER A 329 GLY A 335 1 ? 7  
HELX_P HELX_P14 14 ARG A 349 ? SER A 359 ? ARG A 349 SER A 359 1 ? 11 
HELX_P HELX_P15 15 ASP A 365 ? GLN A 374 ? ASP A 365 GLN A 374 1 ? 10 
HELX_P HELX_P16 16 GLY A 384 ? ASN A 399 ? GLY A 384 ASN A 399 1 ? 16 
HELX_P HELX_P17 17 ILE A 401 ? PHE A 414 ? ILE A 401 PHE A 414 1 ? 14 
HELX_P HELX_P18 18 GLU A 434 ? MET A 436 ? GLU A 434 MET A 436 5 ? 3  
HELX_P HELX_P19 19 ILE A 444 ? VAL A 447 ? ILE A 444 VAL A 447 1 ? 4  
HELX_P HELX_P20 20 LEU A 450 ? LEU A 452 ? LEU A 450 LEU A 452 5 ? 3  
HELX_P HELX_P21 21 LYS A 454 ? LEU A 456 ? LYS A 454 LEU A 456 5 ? 3  
HELX_P HELX_P22 22 ALA A 460 ? THR A 479 ? ALA A 460 THR A 479 1 ? 20 
HELX_P HELX_P23 23 VAL A 518 ? ASN A 525 ? VAL A 518 ASN A 525 1 ? 8  
HELX_P HELX_P24 24 PHE A 527 ? ASN A 533 ? PHE A 527 ASN A 533 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.13 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 6   ? THR A 10  ? LEU A 6   THR A 10  
A 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
A 3  VAL A 57  ? ALA A 60  ? VAL A 57  ALA A 60  
B 1  MET A 16  ? PRO A 21  ? MET A 16  PRO A 21  
B 2  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
B 3  TYR A 96  ? PRO A 102 ? TYR A 96  PRO A 102 
B 4  VAL A 142 ? SER A 147 ? VAL A 142 SER A 147 
B 5  THR A 109 ? TYR A 116 ? THR A 109 TYR A 116 
B 6  THR A 193 ? GLU A 199 ? THR A 193 GLU A 199 
B 7  ARG A 220 ? SER A 226 ? ARG A 220 SER A 226 
B 8  GLN A 318 ? ASN A 324 ? GLN A 318 ASN A 324 
B 9  GLY A 417 ? PHE A 423 ? GLY A 417 PHE A 423 
B 10 PHE A 502 ? LEU A 505 ? PHE A 502 LEU A 505 
B 11 MET A 510 ? GLN A 514 ? MET A 510 GLN A 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O VAL A 8   ? O VAL A 8   N VAL A 15  ? N VAL A 15  
A 2  3  O LYS A 14  ? O LYS A 14  N TRP A 58  ? N TRP A 58  
B 1  2  N THR A 18  ? N THR A 18  O ALA A 29  ? O ALA A 29  
B 2  3  O PHE A 30  ? O PHE A 30  N ILE A 99  ? N ILE A 99  
B 3  4  O TRP A 100 ? O TRP A 100 N LEU A 143 ? N LEU A 143 
B 4  5  O VAL A 142 ? O VAL A 142 N MET A 112 ? N MET A 112 
B 5  6  N VAL A 113 ? N VAL A 113 O THR A 195 ? O THR A 195 
B 6  7  O ILE A 196 ? O ILE A 196 N ILE A 223 ? N ILE A 223 
B 7  8  O LEU A 224 ? O LEU A 224 N GLY A 322 ? N GLY A 322 
B 8  9  O LEU A 321 ? O LEU A 321 N TYR A 421 ? N TYR A 421 
B 9  10 O LEU A 420 ? O LEU A 420 N ILE A 503 ? N ILE A 503 
B 10 11 O PHE A 502 ? O PHE A 502 N HIS A 513 ? N HIS A 513 
# 
_struct_site.id                   CAT 
_struct_site.pdbx_evidence_code   Author 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    3 
_struct_site.details              'CATALYTIC TRIAD' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 CAT 3 SER A 200 ? SER A 200 . ? 1_555 ? 
2 CAT 3 GLU A 327 ? GLU A 327 . ? 1_555 ? 
3 CAT 3 HIS A 440 ? HIS A 440 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QIJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QIJ 
_atom_sites.fract_transf_matrix[1][1]   0.008916 
_atom_sites.fract_transf_matrix[1][2]   0.005148 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010295 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007244 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -13.318 87.882 34.734 1.00 54.60  ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -12.729 88.297 36.044 1.00 54.60  ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -11.600 87.362 36.469 1.00 54.60  ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -11.704 86.142 36.341 1.00 54.60  ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -13.806 88.316 37.135 1.00 54.43  ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -13.254 88.721 38.381 1.00 54.43  ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -10.530 87.946 36.994 1.00 53.50  ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -9.364  87.193 37.435 1.00 53.50  ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.655  86.243 38.602 1.00 53.50  ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.945  85.251 38.797 1.00 53.50  ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -8.246  88.162 37.837 1.00 71.15  ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.949  87.474 38.214 1.00 71.15  ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.849  88.448 38.596 1.00 71.15  ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -6.050  89.247 39.542 1.00 71.15  ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -4.775  88.408 37.951 1.00 71.15  ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.689 86.537 39.380 1.00 46.66  ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -11.004 85.693 40.512 1.00 46.66  ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -12.001 84.608 40.158 1.00 46.66  ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.395 83.821 41.017 1.00 46.66  ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.546 86.538 41.655 1.00 41.79  ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.553 87.539 42.235 1.00 41.79  ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -11.208 88.310 43.368 1.00 41.79  ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -9.319  86.792 42.732 1.00 41.79  ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.403 84.552 38.896 1.00 44.07  ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -13.368 83.550 38.469 1.00 44.07  ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.684 82.536 37.570 1.00 44.07  ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -12.061 82.900 36.579 1.00 44.07  ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.518 84.225 37.727 1.00 52.22  ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.656 83.336 37.229 1.00 52.22  ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -16.277 82.577 38.384 1.00 52.22  ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.704 84.198 36.566 1.00 52.22  ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.781 81.264 37.930 1.00 39.18  ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -12.162 80.214 37.141 1.00 39.18  ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -13.149 79.100 36.848 1.00 39.18  ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.940 78.690 37.706 1.00 39.18  ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -10.936 79.618 37.844 1.00 36.12  ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -10.400 78.442 37.039 1.00 36.12  ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -9.861  80.673 37.986 1.00 36.12  ? 8    VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -13.093 78.607 35.618 1.00 46.03  ? 9    ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -13.995 77.562 35.199 1.00 46.03  ? 9    ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -13.236 76.264 35.036 1.00 46.03  ? 9    ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -12.474 76.089 34.092 1.00 46.03  ? 9    ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -14.676 77.978 33.899 1.00 69.95  ? 9    ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -15.720 76.985 33.449 1.00 69.95  ? 9    ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -16.376 76.321 34.272 1.00 69.95  ? 9    ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -15.898 76.878 32.131 1.00 69.95  ? 9    ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -13.448 75.358 35.979 1.00 45.90  ? 10   THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -12.781 74.070 35.966 1.00 45.90  ? 10   THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -13.681 73.018 35.357 1.00 45.90  ? 10   THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -14.818 73.298 34.991 1.00 45.90  ? 10   THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -12.445 73.603 37.383 1.00 41.79  ? 10   THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -13.646 73.160 38.024 1.00 41.79  ? 10   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -11.821 74.747 38.189 1.00 41.79  ? 10   THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -13.163 71.798 35.276 1.00 47.84  ? 11   LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -13.908 70.677 34.729 1.00 47.84  ? 11   LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -14.958 70.175 35.727 1.00 47.84  ? 11   LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -15.764 69.311 35.393 1.00 47.84  ? 11   LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -12.943 69.544 34.355 1.00 30.39  ? 11   LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -11.876 69.945 33.337 1.00 30.39  ? 11   LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -10.969 68.781 32.988 1.00 30.39  ? 11   LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -9.938  69.188 31.956 1.00 30.39  ? 11   LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -8.847  68.196 31.772 1.00 30.39  ? 11   LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -14.947 70.709 36.948 1.00 44.68  ? 12   SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -15.921 70.314 37.968 1.00 44.68  ? 12   SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -16.986 71.397 38.143 1.00 44.68  ? 12   SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -18.038 71.161 38.750 1.00 44.68  ? 12   SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -15.232 70.074 39.317 1.00 51.28  ? 12   SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -14.530 68.841 39.344 1.00 51.28  ? 12   SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -16.711 72.585 37.609 1.00 47.81  ? 13   GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -17.648 73.689 37.727 1.00 47.81  ? 13   GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -16.901 74.995 37.890 1.00 47.81  ? 13   GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -15.667 74.989 37.892 1.00 47.81  ? 13   GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -17.627 76.108 38.017 1.00 41.56  ? 14   LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -16.995 77.416 38.189 1.00 41.56  ? 14   LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -16.642 77.673 39.642 1.00 41.56  ? 14   LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -17.340 77.224 40.555 1.00 41.56  ? 14   LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -17.904 78.532 37.699 1.00 48.91  ? 14   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -18.016 78.612 36.205 1.00 48.91  ? 14   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -18.944 79.733 35.811 1.00 48.91  ? 14   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -19.289 79.667 34.341 1.00 48.91  ? 14   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -20.528 80.444 34.043 1.00 48.91  ? 14   LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -15.563 78.417 39.847 1.00 42.59  ? 15   VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -15.084 78.721 41.184 1.00 42.59  ? 15   VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -14.757 80.200 41.345 1.00 42.59  ? 15   VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -14.081 80.782 40.505 1.00 42.59  ? 15   VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -13.825 77.888 41.485 1.00 43.06  ? 15   VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -13.188 78.345 42.763 1.00 43.06  ? 15   VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -14.192 76.423 41.595 1.00 43.06  ? 15   VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -15.244 80.806 42.423 1.00 36.89  ? 16   MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -14.982 82.216 42.699 1.00 36.89  ? 16   MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -13.994 82.378 43.839 1.00 36.89  ? 16   MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -14.301 82.099 45.000 1.00 36.89  ? 16   MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -16.267 82.963 43.065 1.00 73.36  ? 16   MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -16.048 84.444 43.437 1.00 73.36  ? 16   MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -16.342 85.658 42.080 1.00 73.36  ? 16   MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -14.701 85.898 41.429 1.00 73.36  ? 16   MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -12.805 82.843 43.497 1.00 46.92  ? 17   GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -11.793 83.052 44.503 1.00 46.92  ? 17   GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -11.882 84.449 45.073 1.00 46.92  ? 17   GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -12.832 85.184 44.812 1.00 46.92  ? 17   GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -10.870 84.809 45.850 1.00 44.86  ? 18   THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -10.784 86.114 46.484 1.00 44.86  ? 18   THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -9.378  86.684 46.354 1.00 44.86  ? 18   THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -8.410  85.940 46.220 1.00 44.86  ? 18   THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -11.114 86.021 47.975 1.00 52.11  ? 18   THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -10.560 87.159 48.645 1.00 52.11  ? 18   THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -10.521 84.752 48.582 1.00 52.11  ? 18   THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -9.268  88.007 46.393 1.00 46.10  ? 19   ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -7.973  88.674 46.292 1.00 46.10  ? 19   ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -7.402  88.854 47.700 1.00 46.10  ? 19   ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -8.124  89.251 48.614 1.00 46.10  ? 19   ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -8.143  90.023 45.579 1.00 62.06  ? 19   ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -7.024  91.017 45.824 1.00 62.06  ? 19   ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -6.989  92.141 44.774 1.00 62.06  ? 19   ARG A CD  1 
ATOM   115  N NE  . ARG A 1 19  ? -6.171  91.770 43.618 1.00 62.06  ? 19   ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 19  ? -5.153  92.494 43.145 1.00 62.06  ? 19   ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 19  ? -4.822  93.644 43.721 1.00 62.06  ? 19   ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 19  ? -4.444  92.052 42.109 1.00 62.06  ? 19   ARG A NH2 1 
ATOM   119  N N   . VAL A 1 20  ? -6.122  88.531 47.891 1.00 44.50  ? 20   VAL A N   1 
ATOM   120  C CA  . VAL A 1 20  ? -5.510  88.679 49.215 1.00 44.50  ? 20   VAL A CA  1 
ATOM   121  C C   . VAL A 1 20  ? -4.215  89.479 49.193 1.00 44.50  ? 20   VAL A C   1 
ATOM   122  O O   . VAL A 1 20  ? -3.424  89.385 48.253 1.00 44.50  ? 20   VAL A O   1 
ATOM   123  C CB  . VAL A 1 20  ? -5.189  87.308 49.881 1.00 44.13  ? 20   VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 20  ? -6.446  86.485 50.024 1.00 44.13  ? 20   VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 20  ? -4.164  86.560 49.063 1.00 44.13  ? 20   VAL A CG2 1 
ATOM   126  N N   . PRO A 1 21  ? -3.980  90.276 50.244 1.00 41.84  ? 21   PRO A N   1 
ATOM   127  C CA  . PRO A 1 21  ? -2.760  91.081 50.314 1.00 41.84  ? 21   PRO A CA  1 
ATOM   128  C C   . PRO A 1 21  ? -1.582  90.232 50.808 1.00 41.84  ? 21   PRO A C   1 
ATOM   129  O O   . PRO A 1 21  ? -1.755  89.337 51.646 1.00 41.84  ? 21   PRO A O   1 
ATOM   130  C CB  . PRO A 1 21  ? -3.144  92.182 51.292 1.00 29.87  ? 21   PRO A CB  1 
ATOM   131  C CG  . PRO A 1 21  ? -4.003  91.449 52.266 1.00 29.87  ? 21   PRO A CG  1 
ATOM   132  C CD  . PRO A 1 21  ? -4.875  90.573 51.378 1.00 29.87  ? 21   PRO A CD  1 
ATOM   133  N N   . VAL A 1 22  ? -0.395  90.514 50.275 1.00 40.04  ? 22   VAL A N   1 
ATOM   134  C CA  . VAL A 1 22  ? 0.816   89.799 50.647 1.00 40.04  ? 22   VAL A CA  1 
ATOM   135  C C   . VAL A 1 22  ? 2.029   90.687 50.402 1.00 40.04  ? 22   VAL A C   1 
ATOM   136  O O   . VAL A 1 22  ? 2.202   91.200 49.296 1.00 40.04  ? 22   VAL A O   1 
ATOM   137  C CB  . VAL A 1 22  ? 0.964   88.485 49.831 1.00 40.34  ? 22   VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 22  ? 0.988   88.782 48.347 1.00 40.34  ? 22   VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 22  ? 2.227   87.759 50.243 1.00 40.34  ? 22   VAL A CG2 1 
ATOM   140  N N   . LEU A 1 23  ? 2.858   90.858 51.437 1.00 50.95  ? 23   LEU A N   1 
ATOM   141  C CA  . LEU A 1 23  ? 4.077   91.685 51.373 1.00 50.95  ? 23   LEU A CA  1 
ATOM   142  C C   . LEU A 1 23  ? 3.827   92.988 50.602 1.00 50.95  ? 23   LEU A C   1 
ATOM   143  O O   . LEU A 1 23  ? 4.605   93.365 49.706 1.00 50.95  ? 23   LEU A O   1 
ATOM   144  C CB  . LEU A 1 23  ? 5.225   90.903 50.708 1.00 43.81  ? 23   LEU A CB  1 
ATOM   145  C CG  . LEU A 1 23  ? 5.850   89.701 51.432 1.00 43.81  ? 23   LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 23  ? 7.079   89.213 50.661 1.00 43.81  ? 23   LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 23  ? 6.258   90.112 52.845 1.00 43.81  ? 23   LEU A CD2 1 
ATOM   148  N N   . SER A 1 24  ? 2.740   93.667 50.982 1.00 64.97  ? 24   SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? 2.275   94.913 50.354 1.00 64.97  ? 24   SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? 2.170   94.747 48.823 1.00 64.97  ? 24   SER A C   1 
ATOM   151  O O   . SER A 1 24  ? 2.952   95.303 48.046 1.00 64.97  ? 24   SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? 3.176   96.101 50.740 1.00 62.91  ? 24   SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? 4.520   95.899 50.346 1.00 62.91  ? 24   SER A OG  1 
ATOM   154  N N   . SER A 1 25  ? 1.189   93.939 48.425 1.00 48.51  ? 25   SER A N   1 
ATOM   155  C CA  . SER A 1 25  ? 0.883   93.627 47.035 1.00 48.51  ? 25   SER A CA  1 
ATOM   156  C C   . SER A 1 25  ? -0.300  92.670 47.093 1.00 48.51  ? 25   SER A C   1 
ATOM   157  O O   . SER A 1 25  ? -0.927  92.533 48.145 1.00 48.51  ? 25   SER A O   1 
ATOM   158  C CB  . SER A 1 25  ? 2.065   92.955 46.350 1.00 56.85  ? 25   SER A CB  1 
ATOM   159  O OG  . SER A 1 25  ? 1.791   92.780 44.969 1.00 56.85  ? 25   SER A OG  1 
ATOM   160  N N   . HIS A 1 26  ? -0.622  91.996 45.996 1.00 49.78  ? 26   HIS A N   1 
ATOM   161  C CA  . HIS A 1 26  ? -1.771  91.095 46.044 1.00 49.78  ? 26   HIS A CA  1 
ATOM   162  C C   . HIS A 1 26  ? -1.695  89.866 45.152 1.00 49.78  ? 26   HIS A C   1 
ATOM   163  O O   . HIS A 1 26  ? -0.954  89.842 44.174 1.00 49.78  ? 26   HIS A O   1 
ATOM   164  C CB  . HIS A 1 26  ? -3.069  91.858 45.711 1.00 66.73  ? 26   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 26  ? -3.454  92.885 46.732 1.00 66.73  ? 26   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 26  ? -3.073  94.209 46.639 1.00 66.73  ? 26   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 26  ? -4.166  92.779 47.881 1.00 66.73  ? 26   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 26  ? -3.535  94.873 47.687 1.00 66.73  ? 26   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 26  ? -4.201  94.029 48.456 1.00 66.73  ? 26   HIS A NE2 1 
ATOM   170  N N   . ILE A 1 27  ? -2.461  88.840 45.514 1.00 41.14  ? 27   ILE A N   1 
ATOM   171  C CA  . ILE A 1 27  ? -2.535  87.619 44.728 1.00 41.14  ? 27   ILE A CA  1 
ATOM   172  C C   . ILE A 1 27  ? -3.939  87.066 44.890 1.00 41.14  ? 27   ILE A C   1 
ATOM   173  O O   . ILE A 1 27  ? -4.704  87.531 45.742 1.00 41.14  ? 27   ILE A O   1 
ATOM   174  C CB  . ILE A 1 27  ? -1.529  86.532 45.179 1.00 41.98  ? 27   ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 27  ? -1.960  85.948 46.512 1.00 41.98  ? 27   ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 27  ? -0.131  87.105 45.272 1.00 41.98  ? 27   ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 27  ? -1.100  84.805 46.943 1.00 41.98  ? 27   ILE A CD1 1 
ATOM   178  N N   . SER A 1 28  ? -4.274  86.080 44.063 1.00 42.56  ? 28   SER A N   1 
ATOM   179  C CA  . SER A 1 28  ? -5.584  85.454 44.107 1.00 42.56  ? 28   SER A CA  1 
ATOM   180  C C   . SER A 1 28  ? -5.476  84.224 44.991 1.00 42.56  ? 28   SER A C   1 
ATOM   181  O O   . SER A 1 28  ? -4.405  83.638 45.130 1.00 42.56  ? 28   SER A O   1 
ATOM   182  C CB  . SER A 1 28  ? -6.020  85.037 42.705 1.00 46.90  ? 28   SER A CB  1 
ATOM   183  O OG  . SER A 1 28  ? -5.743  86.053 41.759 1.00 46.90  ? 28   SER A OG  1 
ATOM   184  N N   . ALA A 1 29  ? -6.593  83.843 45.590 1.00 39.68  ? 29   ALA A N   1 
ATOM   185  C CA  . ALA A 1 29  ? -6.633  82.687 46.455 1.00 39.68  ? 29   ALA A CA  1 
ATOM   186  C C   . ALA A 1 29  ? -7.988  82.031 46.321 1.00 39.68  ? 29   ALA A C   1 
ATOM   187  O O   . ALA A 1 29  ? -9.017  82.666 46.544 1.00 39.68  ? 29   ALA A O   1 
ATOM   188  C CB  . ALA A 1 29  ? -6.406  83.102 47.890 1.00 32.92  ? 29   ALA A CB  1 
ATOM   189  N N   . PHE A 1 30  ? -7.988  80.762 45.936 1.00 44.26  ? 30   PHE A N   1 
ATOM   190  C CA  . PHE A 1 30  ? -9.221  80.008 45.804 1.00 44.26  ? 30   PHE A CA  1 
ATOM   191  C C   . PHE A 1 30  ? -9.143  79.017 46.939 1.00 44.26  ? 30   PHE A C   1 
ATOM   192  O O   . PHE A 1 30  ? -8.446  78.025 46.846 1.00 44.26  ? 30   PHE A O   1 
ATOM   193  C CB  . PHE A 1 30  ? -9.269  79.287 44.455 1.00 36.46  ? 30   PHE A CB  1 
ATOM   194  C CG  . PHE A 1 30  ? -9.165  80.210 43.273 1.00 36.46  ? 30   PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 30  ? -7.947  80.779 42.925 1.00 36.46  ? 30   PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 30  ? -10.290 80.524 42.519 1.00 36.46  ? 30   PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 30  ? -7.849  81.643 41.849 1.00 36.46  ? 30   PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 30  ? -10.205 81.387 41.443 1.00 36.46  ? 30   PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 30  ? -8.979  81.948 41.107 1.00 36.46  ? 30   PHE A CZ  1 
ATOM   200  N N   . LEU A 1 31  ? -9.850  79.302 48.020 1.00 39.05  ? 31   LEU A N   1 
ATOM   201  C CA  . LEU A 1 31  ? -9.822  78.446 49.191 1.00 39.05  ? 31   LEU A CA  1 
ATOM   202  C C   . LEU A 1 31  ? -11.027 77.520 49.321 1.00 39.05  ? 31   LEU A C   1 
ATOM   203  O O   . LEU A 1 31  ? -12.155 77.893 49.012 1.00 39.05  ? 31   LEU A O   1 
ATOM   204  C CB  . LEU A 1 31  ? -9.698  79.324 50.432 1.00 32.06  ? 31   LEU A CB  1 
ATOM   205  C CG  . LEU A 1 31  ? -8.568  80.351 50.313 1.00 32.06  ? 31   LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 31  ? -8.535  81.225 51.540 1.00 32.06  ? 31   LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 31  ? -7.243  79.642 50.139 1.00 32.06  ? 31   LEU A CD2 1 
ATOM   208  N N   . GLY A 1 32  ? -10.769 76.299 49.770 1.00 43.89  ? 32   GLY A N   1 
ATOM   209  C CA  . GLY A 1 32  ? -11.829 75.327 49.965 1.00 43.89  ? 32   GLY A CA  1 
ATOM   210  C C   . GLY A 1 32  ? -12.500 74.747 48.733 1.00 43.89  ? 32   GLY A C   1 
ATOM   211  O O   . GLY A 1 32  ? -13.710 74.529 48.759 1.00 43.89  ? 32   GLY A O   1 
ATOM   212  N N   . ILE A 1 33  ? -11.750 74.502 47.659 1.00 47.01  ? 33   ILE A N   1 
ATOM   213  C CA  . ILE A 1 33  ? -12.338 73.911 46.455 1.00 47.01  ? 33   ILE A CA  1 
ATOM   214  C C   . ILE A 1 33  ? -12.463 72.416 46.760 1.00 47.01  ? 33   ILE A C   1 
ATOM   215  O O   . ILE A 1 33  ? -11.504 71.803 47.229 1.00 47.01  ? 33   ILE A O   1 
ATOM   216  C CB  . ILE A 1 33  ? -11.425 74.080 45.235 1.00 37.79  ? 33   ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 33  ? -11.035 75.549 45.064 1.00 37.79  ? 33   ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 33  ? -12.137 73.570 43.998 1.00 37.79  ? 33   ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 33  ? -10.097 75.808 43.903 1.00 37.79  ? 33   ILE A CD1 1 
ATOM   220  N N   . PRO A 1 34  ? -13.641 71.810 46.518 1.00 44.22  ? 34   PRO A N   1 
ATOM   221  C CA  . PRO A 1 34  ? -13.781 70.379 46.812 1.00 44.22  ? 34   PRO A CA  1 
ATOM   222  C C   . PRO A 1 34  ? -13.204 69.469 45.725 1.00 44.22  ? 34   PRO A C   1 
ATOM   223  O O   . PRO A 1 34  ? -13.203 69.845 44.553 1.00 44.22  ? 34   PRO A O   1 
ATOM   224  C CB  . PRO A 1 34  ? -15.292 70.223 46.984 1.00 36.49  ? 34   PRO A CB  1 
ATOM   225  C CG  . PRO A 1 34  ? -15.835 71.189 45.995 1.00 36.49  ? 34   PRO A CG  1 
ATOM   226  C CD  . PRO A 1 34  ? -14.943 72.406 46.163 1.00 36.49  ? 34   PRO A CD  1 
ATOM   227  N N   . PHE A 1 35  ? -12.702 68.287 46.106 1.00 40.72  ? 35   PHE A N   1 
ATOM   228  C CA  . PHE A 1 35  ? -12.139 67.347 45.124 1.00 40.72  ? 35   PHE A CA  1 
ATOM   229  C C   . PHE A 1 35  ? -12.665 65.924 45.272 1.00 40.72  ? 35   PHE A C   1 
ATOM   230  O O   . PHE A 1 35  ? -12.332 65.047 44.483 1.00 40.72  ? 35   PHE A O   1 
ATOM   231  C CB  . PHE A 1 35  ? -10.592 67.349 45.158 1.00 35.14  ? 35   PHE A CB  1 
ATOM   232  C CG  . PHE A 1 35  ? -9.987  66.855 46.454 1.00 35.14  ? 35   PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 35  ? -9.975  65.505 46.769 1.00 35.14  ? 35   PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 35  ? -9.427  67.746 47.359 1.00 35.14  ? 35   PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 35  ? -9.418  65.055 47.962 1.00 35.14  ? 35   PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 35  ? -8.868  67.298 48.557 1.00 35.14  ? 35   PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 35  ? -8.866  65.955 48.855 1.00 35.14  ? 35   PHE A CZ  1 
ATOM   238  N N   . ALA A 1 36  ? -13.496 65.700 46.279 1.00 39.33  ? 36   ALA A N   1 
ATOM   239  C CA  . ALA A 1 36  ? -14.076 64.382 46.511 1.00 39.33  ? 36   ALA A CA  1 
ATOM   240  C C   . ALA A 1 36  ? -15.420 64.570 47.193 1.00 39.33  ? 36   ALA A C   1 
ATOM   241  O O   . ALA A 1 36  ? -15.675 65.623 47.773 1.00 39.33  ? 36   ALA A O   1 
ATOM   242  C CB  . ALA A 1 36  ? -13.164 63.557 47.398 1.00 34.09  ? 36   ALA A CB  1 
ATOM   243  N N   . GLU A 1 37  ? -16.283 63.561 47.123 1.00 57.64  ? 37   GLU A N   1 
ATOM   244  C CA  . GLU A 1 37  ? -17.593 63.637 47.773 1.00 57.64  ? 37   GLU A CA  1 
ATOM   245  C C   . GLU A 1 37  ? -17.382 63.520 49.285 1.00 57.64  ? 37   GLU A C   1 
ATOM   246  O O   . GLU A 1 37  ? -16.484 62.804 49.737 1.00 57.64  ? 37   GLU A O   1 
ATOM   247  C CB  . GLU A 1 37  ? -18.493 62.499 47.284 1.00 68.79  ? 37   GLU A CB  1 
ATOM   248  C CG  . GLU A 1 37  ? -18.946 62.632 45.835 1.00 68.79  ? 37   GLU A CG  1 
ATOM   249  C CD  . GLU A 1 37  ? -20.049 63.681 45.644 1.00 68.79  ? 37   GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 37  ? -21.124 63.525 46.269 1.00 68.79  ? 37   GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 37  ? -19.848 64.657 44.871 1.00 68.79  ? 37   GLU A OE2 1 
ATOM   252  N N   . PRO A 1 38  ? -18.192 64.235 50.087 1.00 54.44  ? 38   PRO A N   1 
ATOM   253  C CA  . PRO A 1 38  ? -18.050 64.174 51.544 1.00 54.44  ? 38   PRO A CA  1 
ATOM   254  C C   . PRO A 1 38  ? -18.094 62.732 52.039 1.00 54.44  ? 38   PRO A C   1 
ATOM   255  O O   . PRO A 1 38  ? -19.101 62.048 51.879 1.00 54.44  ? 38   PRO A O   1 
ATOM   256  C CB  . PRO A 1 38  ? -19.232 64.999 52.031 1.00 40.29  ? 38   PRO A CB  1 
ATOM   257  C CG  . PRO A 1 38  ? -19.327 66.050 50.991 1.00 40.29  ? 38   PRO A CG  1 
ATOM   258  C CD  . PRO A 1 38  ? -19.191 65.248 49.709 1.00 40.29  ? 38   PRO A CD  1 
ATOM   259  N N   . PRO A 1 39  ? -16.992 62.249 52.641 1.00 52.34  ? 39   PRO A N   1 
ATOM   260  C CA  . PRO A 1 39  ? -16.876 60.883 53.163 1.00 52.34  ? 39   PRO A CA  1 
ATOM   261  C C   . PRO A 1 39  ? -17.629 60.641 54.460 1.00 52.34  ? 39   PRO A C   1 
ATOM   262  O O   . PRO A 1 39  ? -17.077 60.086 55.410 1.00 52.34  ? 39   PRO A O   1 
ATOM   263  C CB  . PRO A 1 39  ? -15.372 60.723 53.345 1.00 46.25  ? 39   PRO A CB  1 
ATOM   264  C CG  . PRO A 1 39  ? -14.969 62.087 53.784 1.00 46.25  ? 39   PRO A CG  1 
ATOM   265  C CD  . PRO A 1 39  ? -15.711 62.963 52.795 1.00 46.25  ? 39   PRO A CD  1 
ATOM   266  N N   . VAL A 1 40  ? -18.888 61.051 54.505 1.00 61.11  ? 40   VAL A N   1 
ATOM   267  C CA  . VAL A 1 40  ? -19.677 60.861 55.715 1.00 61.11  ? 40   VAL A CA  1 
ATOM   268  C C   . VAL A 1 40  ? -20.588 59.641 55.644 1.00 61.11  ? 40   VAL A C   1 
ATOM   269  O O   . VAL A 1 40  ? -20.625 58.931 54.638 1.00 61.11  ? 40   VAL A O   1 
ATOM   270  C CB  . VAL A 1 40  ? -20.528 62.095 56.005 1.00 50.17  ? 40   VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 40  ? -19.629 63.263 56.331 1.00 50.17  ? 40   VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 40  ? -21.379 62.420 54.794 1.00 50.17  ? 40   VAL A CG2 1 
ATOM   273  N N   . GLY A 1 41  ? -21.314 59.401 56.730 1.00 59.58  ? 41   GLY A N   1 
ATOM   274  C CA  . GLY A 1 41  ? -22.222 58.271 56.789 1.00 59.58  ? 41   GLY A CA  1 
ATOM   275  C C   . GLY A 1 41  ? -21.613 56.938 56.391 1.00 59.58  ? 41   GLY A C   1 
ATOM   276  O O   . GLY A 1 41  ? -20.562 56.529 56.909 1.00 59.58  ? 41   GLY A O   1 
ATOM   277  N N   . ASN A 1 42  ? -22.284 56.254 55.467 1.00 52.06  ? 42   ASN A N   1 
ATOM   278  C CA  . ASN A 1 42  ? -21.832 54.958 54.985 1.00 52.06  ? 42   ASN A CA  1 
ATOM   279  C C   . ASN A 1 42  ? -20.527 55.036 54.221 1.00 52.06  ? 42   ASN A C   1 
ATOM   280  O O   . ASN A 1 42  ? -19.949 54.010 53.866 1.00 52.06  ? 42   ASN A O   1 
ATOM   281  C CB  . ASN A 1 42  ? -22.913 54.319 54.114 1.00 89.75  ? 42   ASN A CB  1 
ATOM   282  C CG  . ASN A 1 42  ? -23.762 53.323 54.890 1.00 89.75  ? 42   ASN A CG  1 
ATOM   283  O OD1 . ASN A 1 42  ? -24.071 53.536 56.080 1.00 89.75  ? 42   ASN A OD1 1 
ATOM   284  N ND2 . ASN A 1 42  ? -24.151 52.227 54.223 1.00 89.75  ? 42   ASN A ND2 1 
ATOM   285  N N   . MET A 1 43  ? -20.055 56.246 53.958 1.00 52.71  ? 43   MET A N   1 
ATOM   286  C CA  . MET A 1 43  ? -18.795 56.376 53.254 1.00 52.71  ? 43   MET A CA  1 
ATOM   287  C C   . MET A 1 43  ? -17.574 56.370 54.190 1.00 52.71  ? 43   MET A C   1 
ATOM   288  O O   . MET A 1 43  ? -16.437 56.289 53.732 1.00 52.71  ? 43   MET A O   1 
ATOM   289  C CB  . MET A 1 43  ? -18.804 57.632 52.384 1.00 70.78  ? 43   MET A CB  1 
ATOM   290  C CG  . MET A 1 43  ? -19.534 57.442 51.067 1.00 70.78  ? 43   MET A CG  1 
ATOM   291  S SD  . MET A 1 43  ? -19.319 58.874 49.960 1.00 70.78  ? 43   MET A SD  1 
ATOM   292  C CE  . MET A 1 43  ? -17.517 58.658 49.429 1.00 70.78  ? 43   MET A CE  1 
ATOM   293  N N   . ARG A 1 44  ? -17.805 56.430 55.495 1.00 40.56  ? 44   ARG A N   1 
ATOM   294  C CA  . ARG A 1 44  ? -16.702 56.420 56.449 1.00 40.56  ? 44   ARG A CA  1 
ATOM   295  C C   . ARG A 1 44  ? -15.839 55.162 56.277 1.00 40.56  ? 44   ARG A C   1 
ATOM   296  O O   . ARG A 1 44  ? -16.353 54.061 56.104 1.00 40.56  ? 44   ARG A O   1 
ATOM   297  C CB  . ARG A 1 44  ? -17.241 56.509 57.885 1.00 29.09  ? 44   ARG A CB  1 
ATOM   298  C CG  . ARG A 1 44  ? -16.155 56.544 58.932 1.00 29.09  ? 44   ARG A CG  1 
ATOM   299  C CD  . ARG A 1 44  ? -16.697 56.501 60.338 1.00 29.09  ? 44   ARG A CD  1 
ATOM   300  N NE  . ARG A 1 44  ? -17.252 57.774 60.767 1.00 29.09  ? 44   ARG A NE  1 
ATOM   301  C CZ  . ARG A 1 44  ? -17.901 57.939 61.913 1.00 29.09  ? 44   ARG A CZ  1 
ATOM   302  N NH1 . ARG A 1 44  ? -18.073 56.911 62.732 1.00 29.09  ? 44   ARG A NH1 1 
ATOM   303  N NH2 . ARG A 1 44  ? -18.375 59.126 62.245 1.00 29.09  ? 44   ARG A NH2 1 
ATOM   304  N N   . PHE A 1 45  ? -14.522 55.348 56.319 1.00 37.07  ? 45   PHE A N   1 
ATOM   305  C CA  . PHE A 1 45  ? -13.532 54.275 56.165 1.00 37.07  ? 45   PHE A CA  1 
ATOM   306  C C   . PHE A 1 45  ? -13.412 53.793 54.734 1.00 37.07  ? 45   PHE A C   1 
ATOM   307  O O   . PHE A 1 45  ? -12.481 53.073 54.393 1.00 37.07  ? 45   PHE A O   1 
ATOM   308  C CB  . PHE A 1 45  ? -13.856 53.077 57.061 1.00 46.68  ? 45   PHE A CB  1 
ATOM   309  C CG  . PHE A 1 45  ? -14.001 53.424 58.516 1.00 46.68  ? 45   PHE A CG  1 
ATOM   310  C CD1 . PHE A 1 45  ? -13.035 54.192 59.166 1.00 46.68  ? 45   PHE A CD1 1 
ATOM   311  C CD2 . PHE A 1 45  ? -15.111 52.986 59.240 1.00 46.68  ? 45   PHE A CD2 1 
ATOM   312  C CE1 . PHE A 1 45  ? -13.170 54.524 60.517 1.00 46.68  ? 45   PHE A CE1 1 
ATOM   313  C CE2 . PHE A 1 45  ? -15.256 53.310 60.589 1.00 46.68  ? 45   PHE A CE2 1 
ATOM   314  C CZ  . PHE A 1 45  ? -14.280 54.084 61.230 1.00 46.68  ? 45   PHE A CZ  1 
ATOM   315  N N   . ARG A 1 46  ? -14.350 54.209 53.895 1.00 49.76  ? 46   ARG A N   1 
ATOM   316  C CA  . ARG A 1 46  ? -14.373 53.799 52.494 1.00 49.76  ? 46   ARG A CA  1 
ATOM   317  C C   . ARG A 1 46  ? -13.518 54.696 51.573 1.00 49.76  ? 46   ARG A C   1 
ATOM   318  O O   . ARG A 1 46  ? -13.163 55.817 51.940 1.00 49.76  ? 46   ARG A O   1 
ATOM   319  C CB  . ARG A 1 46  ? -15.833 53.770 52.020 1.00 82.47  ? 46   ARG A CB  1 
ATOM   320  C CG  . ARG A 1 46  ? -16.055 53.088 50.687 1.00 82.47  ? 46   ARG A CG  1 
ATOM   321  C CD  . ARG A 1 46  ? -17.526 53.098 50.308 1.00 82.47  ? 46   ARG A CD  1 
ATOM   322  N NE  . ARG A 1 46  ? -18.331 52.255 51.190 1.00 82.47  ? 46   ARG A NE  1 
ATOM   323  C CZ  . ARG A 1 46  ? -19.665 52.253 51.210 1.00 82.47  ? 46   ARG A CZ  1 
ATOM   324  N NH1 . ARG A 1 46  ? -20.352 53.057 50.394 1.00 82.47  ? 46   ARG A NH1 1 
ATOM   325  N NH2 . ARG A 1 46  ? -20.321 51.436 52.036 1.00 82.47  ? 46   ARG A NH2 1 
ATOM   326  N N   . ARG A 1 47  ? -13.175 54.196 50.386 1.00 43.53  ? 47   ARG A N   1 
ATOM   327  C CA  . ARG A 1 47  ? -12.377 54.964 49.425 1.00 43.53  ? 47   ARG A CA  1 
ATOM   328  C C   . ARG A 1 47  ? -13.120 56.224 48.949 1.00 43.53  ? 47   ARG A C   1 
ATOM   329  O O   . ARG A 1 47  ? -14.340 56.220 48.793 1.00 43.53  ? 47   ARG A O   1 
ATOM   330  C CB  . ARG A 1 47  ? -12.036 54.102 48.210 1.00 54.71  ? 47   ARG A CB  1 
ATOM   331  C CG  . ARG A 1 47  ? -11.131 52.915 48.481 1.00 54.71  ? 47   ARG A CG  1 
ATOM   332  C CD  . ARG A 1 47  ? -10.840 52.183 47.169 1.00 54.71  ? 47   ARG A CD  1 
ATOM   333  N NE  . ARG A 1 47  ? -9.766  51.192 47.269 1.00 54.71  ? 47   ARG A NE  1 
ATOM   334  C CZ  . ARG A 1 47  ? -9.916  49.949 47.722 1.00 54.71  ? 47   ARG A CZ  1 
ATOM   335  N NH1 . ARG A 1 47  ? -11.112 49.518 48.129 1.00 54.71  ? 47   ARG A NH1 1 
ATOM   336  N NH2 . ARG A 1 47  ? -8.863  49.136 47.759 1.00 54.71  ? 47   ARG A NH2 1 
ATOM   337  N N   . PRO A 1 48  ? -12.388 57.314 48.683 1.00 43.16  ? 48   PRO A N   1 
ATOM   338  C CA  . PRO A 1 48  ? -13.050 58.540 48.233 1.00 43.16  ? 48   PRO A CA  1 
ATOM   339  C C   . PRO A 1 48  ? -13.604 58.466 46.812 1.00 43.16  ? 48   PRO A C   1 
ATOM   340  O O   . PRO A 1 48  ? -13.006 57.837 45.932 1.00 43.16  ? 48   PRO A O   1 
ATOM   341  C CB  . PRO A 1 48  ? -11.945 59.573 48.346 1.00 35.75  ? 48   PRO A CB  1 
ATOM   342  C CG  . PRO A 1 48  ? -10.743 58.780 47.928 1.00 35.75  ? 48   PRO A CG  1 
ATOM   343  C CD  . PRO A 1 48  ? -10.922 57.478 48.680 1.00 35.75  ? 48   PRO A CD  1 
ATOM   344  N N   . GLU A 1 49  ? -14.747 59.112 46.589 1.00 42.17  ? 49   GLU A N   1 
ATOM   345  C CA  . GLU A 1 49  ? -15.342 59.147 45.261 1.00 42.17  ? 49   GLU A CA  1 
ATOM   346  C C   . GLU A 1 49  ? -15.216 60.570 44.708 1.00 42.17  ? 49   GLU A C   1 
ATOM   347  O O   . GLU A 1 49  ? -15.301 61.547 45.449 1.00 42.17  ? 49   GLU A O   1 
ATOM   348  C CB  . GLU A 1 49  ? -16.816 58.720 45.306 1.00 101.74 ? 49   GLU A CB  1 
ATOM   349  C CG  . GLU A 1 49  ? -17.076 57.225 45.624 1.00 101.74 ? 49   GLU A CG  1 
ATOM   350  C CD  . GLU A 1 49  ? -16.269 56.233 44.753 1.00 101.74 ? 49   GLU A CD  1 
ATOM   351  O OE1 . GLU A 1 49  ? -16.066 56.486 43.535 1.00 101.74 ? 49   GLU A OE1 1 
ATOM   352  O OE2 . GLU A 1 49  ? -15.851 55.179 45.296 1.00 101.74 ? 49   GLU A OE2 1 
ATOM   353  N N   . PRO A 1 50  ? -15.013 60.703 43.392 1.00 49.42  ? 50   PRO A N   1 
ATOM   354  C CA  . PRO A 1 50  ? -14.871 62.022 42.761 1.00 49.42  ? 50   PRO A CA  1 
ATOM   355  C C   . PRO A 1 50  ? -16.042 62.964 43.050 1.00 49.42  ? 50   PRO A C   1 
ATOM   356  O O   . PRO A 1 50  ? -17.194 62.535 43.087 1.00 49.42  ? 50   PRO A O   1 
ATOM   357  C CB  . PRO A 1 50  ? -14.772 61.685 41.273 1.00 39.55  ? 50   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 50  ? -14.267 60.258 41.256 1.00 39.55  ? 50   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 50  ? -15.043 59.636 42.377 1.00 39.55  ? 50   PRO A CD  1 
ATOM   360  N N   . LYS A 1 51  ? -15.756 64.245 43.252 1.00 45.07  ? 51   LYS A N   1 
ATOM   361  C CA  . LYS A 1 51  ? -16.823 65.203 43.517 1.00 45.07  ? 51   LYS A CA  1 
ATOM   362  C C   . LYS A 1 51  ? -17.664 65.379 42.265 1.00 45.07  ? 51   LYS A C   1 
ATOM   363  O O   . LYS A 1 51  ? -17.127 65.580 41.170 1.00 45.07  ? 51   LYS A O   1 
ATOM   364  C CB  . LYS A 1 51  ? -16.246 66.556 43.917 1.00 46.41  ? 51   LYS A CB  1 
ATOM   365  C CG  . LYS A 1 51  ? -17.283 67.662 44.090 1.00 46.41  ? 51   LYS A CG  1 
ATOM   366  C CD  . LYS A 1 51  ? -18.128 67.484 45.337 1.00 46.41  ? 51   LYS A CD  1 
ATOM   367  C CE  . LYS A 1 51  ? -18.985 68.716 45.575 1.00 46.41  ? 51   LYS A CE  1 
ATOM   368  N NZ  . LYS A 1 51  ? -19.754 68.629 46.855 1.00 46.41  ? 51   LYS A NZ  1 
ATOM   369  N N   . LYS A 1 52  ? -18.982 65.296 42.423 1.00 48.97  ? 52   LYS A N   1 
ATOM   370  C CA  . LYS A 1 52  ? -19.889 65.465 41.294 1.00 48.97  ? 52   LYS A CA  1 
ATOM   371  C C   . LYS A 1 52  ? -19.915 66.931 40.893 1.00 48.97  ? 52   LYS A C   1 
ATOM   372  O O   . LYS A 1 52  ? -20.013 67.819 41.744 1.00 48.97  ? 52   LYS A O   1 
ATOM   373  C CB  . LYS A 1 52  ? -21.286 64.995 41.671 1.00 68.19  ? 52   LYS A CB  1 
ATOM   374  C CG  . LYS A 1 52  ? -21.364 63.500 41.821 1.00 68.19  ? 52   LYS A CG  1 
ATOM   375  C CD  . LYS A 1 52  ? -22.536 63.076 42.684 1.00 68.19  ? 52   LYS A CD  1 
ATOM   376  C CE  . LYS A 1 52  ? -22.463 61.566 42.965 1.00 68.19  ? 52   LYS A CE  1 
ATOM   377  N NZ  . LYS A 1 52  ? -23.462 61.097 43.993 1.00 68.19  ? 52   LYS A NZ  1 
ATOM   378  N N   . PRO A 1 53  ? -19.818 67.208 39.585 1.00 48.46  ? 53   PRO A N   1 
ATOM   379  C CA  . PRO A 1 53  ? -19.830 68.586 39.088 1.00 48.46  ? 53   PRO A CA  1 
ATOM   380  C C   . PRO A 1 53  ? -20.974 69.398 39.689 1.00 48.46  ? 53   PRO A C   1 
ATOM   381  O O   . PRO A 1 53  ? -21.979 68.846 40.142 1.00 48.46  ? 53   PRO A O   1 
ATOM   382  C CB  . PRO A 1 53  ? -19.958 68.400 37.585 1.00 36.96  ? 53   PRO A CB  1 
ATOM   383  C CG  . PRO A 1 53  ? -19.192 67.128 37.358 1.00 36.96  ? 53   PRO A CG  1 
ATOM   384  C CD  . PRO A 1 53  ? -19.721 66.254 38.468 1.00 36.96  ? 53   PRO A CD  1 
ATOM   385  N N   . TRP A 1 54  ? -20.816 70.712 39.707 1.00 51.66  ? 54   TRP A N   1 
ATOM   386  C CA  . TRP A 1 54  ? -21.846 71.561 40.274 1.00 51.66  ? 54   TRP A CA  1 
ATOM   387  C C   . TRP A 1 54  ? -22.169 72.713 39.331 1.00 51.66  ? 54   TRP A C   1 
ATOM   388  O O   . TRP A 1 54  ? -21.362 73.082 38.472 1.00 51.66  ? 54   TRP A O   1 
ATOM   389  C CB  . TRP A 1 54  ? -21.378 72.099 41.626 1.00 35.61  ? 54   TRP A CB  1 
ATOM   390  C CG  . TRP A 1 54  ? -20.166 72.952 41.523 1.00 35.61  ? 54   TRP A CG  1 
ATOM   391  C CD1 . TRP A 1 54  ? -20.115 74.260 41.143 1.00 35.61  ? 54   TRP A CD1 1 
ATOM   392  C CD2 . TRP A 1 54  ? -18.814 72.542 41.732 1.00 35.61  ? 54   TRP A CD2 1 
ATOM   393  N NE1 . TRP A 1 54  ? -18.813 74.692 41.099 1.00 35.61  ? 54   TRP A NE1 1 
ATOM   394  C CE2 . TRP A 1 54  ? -17.993 73.655 41.456 1.00 35.61  ? 54   TRP A CE2 1 
ATOM   395  C CE3 . TRP A 1 54  ? -18.214 71.339 42.122 1.00 35.61  ? 54   TRP A CE3 1 
ATOM   396  C CZ2 . TRP A 1 54  ? -16.601 73.601 41.558 1.00 35.61  ? 54   TRP A CZ2 1 
ATOM   397  C CZ3 . TRP A 1 54  ? -16.832 71.286 42.222 1.00 35.61  ? 54   TRP A CZ3 1 
ATOM   398  C CH2 . TRP A 1 54  ? -16.041 72.410 41.942 1.00 35.61  ? 54   TRP A CH2 1 
ATOM   399  N N   . SER A 1 55  ? -23.363 73.272 39.486 1.00 75.61  ? 55   SER A N   1 
ATOM   400  C CA  . SER A 1 55  ? -23.768 74.397 38.657 1.00 75.61  ? 55   SER A CA  1 
ATOM   401  C C   . SER A 1 55  ? -23.637 75.675 39.467 1.00 75.61  ? 55   SER A C   1 
ATOM   402  O O   . SER A 1 55  ? -23.684 75.649 40.702 1.00 75.61  ? 55   SER A O   1 
ATOM   403  C CB  . SER A 1 55  ? -25.205 74.220 38.188 1.00 74.75  ? 55   SER A CB  1 
ATOM   404  O OG  . SER A 1 55  ? -25.279 73.144 37.266 1.00 74.75  ? 55   SER A OG  1 
ATOM   405  N N   . GLY A 1 56  ? -23.482 76.799 38.783 1.00 56.53  ? 56   GLY A N   1 
ATOM   406  C CA  . GLY A 1 56  ? -23.332 78.037 39.517 1.00 56.53  ? 56   GLY A CA  1 
ATOM   407  C C   . GLY A 1 56  ? -21.864 78.234 39.833 1.00 56.53  ? 56   GLY A C   1 
ATOM   408  O O   . GLY A 1 56  ? -21.000 77.570 39.252 1.00 56.53  ? 56   GLY A O   1 
ATOM   409  N N   . VAL A 1 57  ? -21.577 79.135 40.760 1.00 41.61  ? 57   VAL A N   1 
ATOM   410  C CA  . VAL A 1 57  ? -20.206 79.431 41.121 1.00 41.61  ? 57   VAL A CA  1 
ATOM   411  C C   . VAL A 1 57  ? -19.909 79.004 42.543 1.00 41.61  ? 57   VAL A C   1 
ATOM   412  O O   . VAL A 1 57  ? -20.601 79.404 43.477 1.00 41.61  ? 57   VAL A O   1 
ATOM   413  C CB  . VAL A 1 57  ? -19.929 80.935 41.006 1.00 42.21  ? 57   VAL A CB  1 
ATOM   414  C CG1 . VAL A 1 57  ? -18.433 81.201 41.156 1.00 42.21  ? 57   VAL A CG1 1 
ATOM   415  C CG2 . VAL A 1 57  ? -20.458 81.455 39.675 1.00 42.21  ? 57   VAL A CG2 1 
ATOM   416  N N   . TRP A 1 58  ? -18.881 78.185 42.713 1.00 40.10  ? 58   TRP A N   1 
ATOM   417  C CA  . TRP A 1 58  ? -18.523 77.757 44.047 1.00 40.10  ? 58   TRP A CA  1 
ATOM   418  C C   . TRP A 1 58  ? -17.782 78.917 44.696 1.00 40.10  ? 58   TRP A C   1 
ATOM   419  O O   . TRP A 1 58  ? -16.917 79.522 44.076 1.00 40.10  ? 58   TRP A O   1 
ATOM   420  C CB  . TRP A 1 58  ? -17.638 76.521 43.984 1.00 40.93  ? 58   TRP A CB  1 
ATOM   421  C CG  . TRP A 1 58  ? -17.297 76.006 45.329 1.00 40.93  ? 58   TRP A CG  1 
ATOM   422  C CD1 . TRP A 1 58  ? -16.348 76.496 46.187 1.00 40.93  ? 58   TRP A CD1 1 
ATOM   423  C CD2 . TRP A 1 58  ? -17.941 74.936 46.010 1.00 40.93  ? 58   TRP A CD2 1 
ATOM   424  N NE1 . TRP A 1 58  ? -16.369 75.794 47.361 1.00 40.93  ? 58   TRP A NE1 1 
ATOM   425  C CE2 . TRP A 1 58  ? -17.338 74.827 47.280 1.00 40.93  ? 58   TRP A CE2 1 
ATOM   426  C CE3 . TRP A 1 58  ? -18.973 74.054 45.674 1.00 40.93  ? 58   TRP A CE3 1 
ATOM   427  C CZ2 . TRP A 1 58  ? -17.738 73.866 48.218 1.00 40.93  ? 58   TRP A CZ2 1 
ATOM   428  C CZ3 . TRP A 1 58  ? -19.369 73.099 46.608 1.00 40.93  ? 58   TRP A CZ3 1 
ATOM   429  C CH2 . TRP A 1 58  ? -18.751 73.015 47.863 1.00 40.93  ? 58   TRP A CH2 1 
ATOM   430  N N   . ASN A 1 59  ? -18.139 79.230 45.936 1.00 47.89  ? 59   ASN A N   1 
ATOM   431  C CA  . ASN A 1 59  ? -17.523 80.329 46.682 1.00 47.89  ? 59   ASN A CA  1 
ATOM   432  C C   . ASN A 1 59  ? -16.254 79.842 47.385 1.00 47.89  ? 59   ASN A C   1 
ATOM   433  O O   . ASN A 1 59  ? -16.334 79.246 48.461 1.00 47.89  ? 59   ASN A O   1 
ATOM   434  C CB  . ASN A 1 59  ? -18.517 80.859 47.724 1.00 50.32  ? 59   ASN A CB  1 
ATOM   435  C CG  . ASN A 1 59  ? -17.989 82.062 48.484 1.00 50.32  ? 59   ASN A CG  1 
ATOM   436  O OD1 . ASN A 1 59  ? -16.779 82.223 48.622 1.00 50.32  ? 59   ASN A OD1 1 
ATOM   437  N ND2 . ASN A 1 59  ? -18.898 82.908 48.998 1.00 50.32  ? 59   ASN A ND2 1 
ATOM   438  N N   . ALA A 1 60  ? -15.091 80.100 46.789 1.00 40.81  ? 60   ALA A N   1 
ATOM   439  C CA  . ALA A 1 60  ? -13.821 79.665 47.375 1.00 40.81  ? 60   ALA A CA  1 
ATOM   440  C C   . ALA A 1 60  ? -13.037 80.820 47.980 1.00 40.81  ? 60   ALA A C   1 
ATOM   441  O O   . ALA A 1 60  ? -11.853 80.997 47.684 1.00 40.81  ? 60   ALA A O   1 
ATOM   442  C CB  . ALA A 1 60  ? -12.968 78.966 46.318 1.00 42.04  ? 60   ALA A CB  1 
ATOM   443  N N   . SER A 1 61  ? -13.683 81.592 48.845 1.00 49.26  ? 61   SER A N   1 
ATOM   444  C CA  . SER A 1 61  ? -13.021 82.741 49.452 1.00 49.26  ? 61   SER A CA  1 
ATOM   445  C C   . SER A 1 61  ? -12.665 82.574 50.924 1.00 49.26  ? 61   SER A C   1 
ATOM   446  O O   . SER A 1 61  ? -12.040 83.458 51.510 1.00 49.26  ? 61   SER A O   1 
ATOM   447  C CB  . SER A 1 61  ? -13.881 83.986 49.280 1.00 55.79  ? 61   SER A CB  1 
ATOM   448  O OG  . SER A 1 61  ? -15.073 83.852 50.030 1.00 55.79  ? 61   SER A OG  1 
ATOM   449  N N   . THR A 1 62  ? -13.068 81.454 51.519 1.00 39.66  ? 62   THR A N   1 
ATOM   450  C CA  . THR A 1 62  ? -12.742 81.174 52.916 1.00 39.66  ? 62   THR A CA  1 
ATOM   451  C C   . THR A 1 62  ? -12.266 79.738 53.100 1.00 39.66  ? 62   THR A C   1 
ATOM   452  O O   . THR A 1 62  ? -12.671 78.838 52.369 1.00 39.66  ? 62   THR A O   1 
ATOM   453  C CB  . THR A 1 62  ? -13.935 81.371 53.817 1.00 51.70  ? 62   THR A CB  1 
ATOM   454  O OG1 . THR A 1 62  ? -14.959 80.441 53.446 1.00 51.70  ? 62   THR A OG1 1 
ATOM   455  C CG2 . THR A 1 62  ? -14.451 82.792 53.696 1.00 51.70  ? 62   THR A CG2 1 
ATOM   456  N N   . TYR A 1 63  ? -11.405 79.529 54.086 1.00 43.61  ? 63   TYR A N   1 
ATOM   457  C CA  . TYR A 1 63  ? -10.879 78.199 54.359 1.00 43.61  ? 63   TYR A CA  1 
ATOM   458  C C   . TYR A 1 63  ? -11.963 77.152 54.627 1.00 43.61  ? 63   TYR A C   1 
ATOM   459  O O   . TYR A 1 63  ? -13.042 77.459 55.131 1.00 43.61  ? 63   TYR A O   1 
ATOM   460  C CB  . TYR A 1 63  ? -9.932  78.240 55.553 1.00 46.37  ? 63   TYR A CB  1 
ATOM   461  C CG  . TYR A 1 63  ? -8.509  78.648 55.236 1.00 46.37  ? 63   TYR A CG  1 
ATOM   462  C CD1 . TYR A 1 63  ? -7.851  78.174 54.095 1.00 46.37  ? 63   TYR A CD1 1 
ATOM   463  C CD2 . TYR A 1 63  ? -7.769  79.402 56.153 1.00 46.37  ? 63   TYR A CD2 1 
ATOM   464  C CE1 . TYR A 1 63  ? -6.484  78.427 53.886 1.00 46.37  ? 63   TYR A CE1 1 
ATOM   465  C CE2 . TYR A 1 63  ? -6.409  79.661 55.957 1.00 46.37  ? 63   TYR A CE2 1 
ATOM   466  C CZ  . TYR A 1 63  ? -5.770  79.168 54.831 1.00 46.37  ? 63   TYR A CZ  1 
ATOM   467  O OH  . TYR A 1 63  ? -4.411  79.375 54.699 1.00 46.37  ? 63   TYR A OH  1 
ATOM   468  N N   . PRO A 1 64  ? -11.680 75.888 54.289 1.00 38.40  ? 64   PRO A N   1 
ATOM   469  C CA  . PRO A 1 64  ? -12.630 74.798 54.500 1.00 38.40  ? 64   PRO A CA  1 
ATOM   470  C C   . PRO A 1 64  ? -12.516 74.307 55.930 1.00 38.40  ? 64   PRO A C   1 
ATOM   471  O O   . PRO A 1 64  ? -11.748 74.855 56.715 1.00 38.40  ? 64   PRO A O   1 
ATOM   472  C CB  . PRO A 1 64  ? -12.149 73.747 53.515 1.00 38.67  ? 64   PRO A CB  1 
ATOM   473  C CG  . PRO A 1 64  ? -10.663 73.898 53.625 1.00 38.67  ? 64   PRO A CG  1 
ATOM   474  C CD  . PRO A 1 64  ? -10.478 75.402 53.584 1.00 38.67  ? 64   PRO A CD  1 
ATOM   475  N N   . ASN A 1 65  ? -13.276 73.273 56.270 1.00 34.49  ? 65   ASN A N   1 
ATOM   476  C CA  . ASN A 1 65  ? -13.192 72.715 57.606 1.00 34.49  ? 65   ASN A CA  1 
ATOM   477  C C   . ASN A 1 65  ? -11.948 71.831 57.723 1.00 34.49  ? 65   ASN A C   1 
ATOM   478  O O   . ASN A 1 65  ? -11.259 71.557 56.740 1.00 34.49  ? 65   ASN A O   1 
ATOM   479  C CB  . ASN A 1 65  ? -14.438 71.899 57.917 1.00 56.37  ? 65   ASN A CB  1 
ATOM   480  C CG  . ASN A 1 65  ? -15.659 72.766 58.120 1.00 56.37  ? 65   ASN A CG  1 
ATOM   481  O OD1 . ASN A 1 65  ? -15.764 73.502 59.106 1.00 56.37  ? 65   ASN A OD1 1 
ATOM   482  N ND2 . ASN A 1 65  ? -16.594 72.690 57.178 1.00 56.37  ? 65   ASN A ND2 1 
ATOM   483  N N   . ASN A 1 66  ? -11.655 71.400 58.939 1.00 43.74  ? 66   ASN A N   1 
ATOM   484  C CA  . ASN A 1 66  ? -10.502 70.551 59.174 1.00 43.74  ? 66   ASN A CA  1 
ATOM   485  C C   . ASN A 1 66  ? -10.980 69.134 59.424 1.00 43.74  ? 66   ASN A C   1 
ATOM   486  O O   . ASN A 1 66  ? -12.050 68.928 59.992 1.00 43.74  ? 66   ASN A O   1 
ATOM   487  C CB  . ASN A 1 66  ? -9.704  71.066 60.377 1.00 45.07  ? 66   ASN A CB  1 
ATOM   488  C CG  . ASN A 1 66  ? -9.036  72.396 60.100 1.00 45.07  ? 66   ASN A CG  1 
ATOM   489  O OD1 . ASN A 1 66  ? -8.548  73.068 61.009 1.00 45.07  ? 66   ASN A OD1 1 
ATOM   490  N ND2 . ASN A 1 66  ? -9.003  72.782 58.828 1.00 45.07  ? 66   ASN A ND2 1 
ATOM   491  N N   . CYS A 1 67  ? -10.191 68.161 58.988 1.00 33.65  ? 67   CYS A N   1 
ATOM   492  C CA  . CYS A 1 67  ? -10.549 66.768 59.178 1.00 33.65  ? 67   CYS A CA  1 
ATOM   493  C C   . CYS A 1 67  ? -10.729 66.497 60.666 1.00 33.65  ? 67   CYS A C   1 
ATOM   494  O O   . CYS A 1 67  ? -10.106 67.156 61.497 1.00 33.65  ? 67   CYS A O   1 
ATOM   495  C CB  . CYS A 1 67  ? -9.456  65.867 58.592 1.00 34.18  ? 67   CYS A CB  1 
ATOM   496  N N   . GLN A 1 68  ? -11.603 65.551 61.005 1.00 40.50  ? 68   GLN A N   1 
ATOM   497  C CA  . GLN A 1 68  ? -11.826 65.178 62.407 1.00 40.50  ? 68   GLN A CA  1 
ATOM   498  C C   . GLN A 1 68  ? -10.521 64.601 62.930 1.00 40.50  ? 68   GLN A C   1 
ATOM   499  O O   . GLN A 1 68  ? -10.008 63.621 62.379 1.00 40.50  ? 68   GLN A O   1 
ATOM   500  C CB  . GLN A 1 68  ? -12.913 64.115 62.517 1.00 49.11  ? 68   GLN A CB  1 
ATOM   501  C CG  . GLN A 1 68  ? -14.320 64.649 62.455 1.00 49.11  ? 68   GLN A CG  1 
ATOM   502  C CD  . GLN A 1 68  ? -14.706 65.396 63.713 1.00 49.11  ? 68   GLN A CD  1 
ATOM   503  O OE1 . GLN A 1 68  ? -15.860 65.787 63.892 1.00 49.11  ? 68   GLN A OE1 1 
ATOM   504  N NE2 . GLN A 1 68  ? -13.739 65.600 64.597 1.00 49.11  ? 68   GLN A NE2 1 
ATOM   505  N N   . GLN A 1 69  ? -9.981  65.196 63.989 1.00 42.49  ? 69   GLN A N   1 
ATOM   506  C CA  . GLN A 1 69  ? -8.713  64.716 64.529 1.00 42.49  ? 69   GLN A CA  1 
ATOM   507  C C   . GLN A 1 69  ? -8.513  64.879 66.023 1.00 42.49  ? 69   GLN A C   1 
ATOM   508  O O   . GLN A 1 69  ? -9.307  65.515 66.729 1.00 42.49  ? 69   GLN A O   1 
ATOM   509  C CB  . GLN A 1 69  ? -7.553  65.404 63.813 1.00 35.64  ? 69   GLN A CB  1 
ATOM   510  C CG  . GLN A 1 69  ? -7.643  66.925 63.836 1.00 35.64  ? 69   GLN A CG  1 
ATOM   511  C CD  . GLN A 1 69  ? -6.570  67.595 62.990 1.00 35.64  ? 69   GLN A CD  1 
ATOM   512  O OE1 . GLN A 1 69  ? -5.436  67.796 63.437 1.00 35.64  ? 69   GLN A OE1 1 
ATOM   513  N NE2 . GLN A 1 69  ? -6.923  67.935 61.757 1.00 35.64  ? 69   GLN A NE2 1 
ATOM   514  N N   . TYR A 1 70  ? -7.425  64.279 66.488 1.00 39.96  ? 70   TYR A N   1 
ATOM   515  C CA  . TYR A 1 70  ? -7.034  64.345 67.881 1.00 39.96  ? 70   TYR A CA  1 
ATOM   516  C C   . TYR A 1 70  ? -6.415  65.724 68.073 1.00 39.96  ? 70   TYR A C   1 
ATOM   517  O O   . TYR A 1 70  ? -5.659  66.190 67.228 1.00 39.96  ? 70   TYR A O   1 
ATOM   518  C CB  . TYR A 1 70  ? -6.010  63.261 68.180 1.00 52.38  ? 70   TYR A CB  1 
ATOM   519  C CG  . TYR A 1 70  ? -5.417  63.380 69.548 1.00 52.38  ? 70   TYR A CG  1 
ATOM   520  C CD1 . TYR A 1 70  ? -6.102  62.906 70.677 1.00 52.38  ? 70   TYR A CD1 1 
ATOM   521  C CD2 . TYR A 1 70  ? -4.196  64.037 69.734 1.00 52.38  ? 70   TYR A CD2 1 
ATOM   522  C CE1 . TYR A 1 70  ? -5.583  63.095 71.957 1.00 52.38  ? 70   TYR A CE1 1 
ATOM   523  C CE2 . TYR A 1 70  ? -3.674  64.233 70.999 1.00 52.38  ? 70   TYR A CE2 1 
ATOM   524  C CZ  . TYR A 1 70  ? -4.367  63.767 72.108 1.00 52.38  ? 70   TYR A CZ  1 
ATOM   525  O OH  . TYR A 1 70  ? -3.852  64.010 73.364 1.00 52.38  ? 70   TYR A OH  1 
ATOM   526  N N   . VAL A 1 71  ? -6.742  66.379 69.178 1.00 37.52  ? 71   VAL A N   1 
ATOM   527  C CA  . VAL A 1 71  ? -6.230  67.714 69.448 1.00 37.52  ? 71   VAL A CA  1 
ATOM   528  C C   . VAL A 1 71  ? -5.343  67.743 70.667 1.00 37.52  ? 71   VAL A C   1 
ATOM   529  O O   . VAL A 1 71  ? -5.701  67.243 71.729 1.00 37.52  ? 71   VAL A O   1 
ATOM   530  C CB  . VAL A 1 71  ? -7.364  68.711 69.678 1.00 28.98  ? 71   VAL A CB  1 
ATOM   531  C CG1 . VAL A 1 71  ? -6.793  70.067 69.986 1.00 28.98  ? 71   VAL A CG1 1 
ATOM   532  C CG2 . VAL A 1 71  ? -8.256  68.765 68.465 1.00 28.98  ? 71   VAL A CG2 1 
ATOM   533  N N   . ASP A 1 72  ? -4.184  68.363 70.512 1.00 45.58  ? 72   ASP A N   1 
ATOM   534  C CA  . ASP A 1 72  ? -3.234  68.454 71.600 1.00 45.58  ? 72   ASP A CA  1 
ATOM   535  C C   . ASP A 1 72  ? -3.615  69.492 72.637 1.00 45.58  ? 72   ASP A C   1 
ATOM   536  O O   . ASP A 1 72  ? -3.864  70.650 72.311 1.00 45.58  ? 72   ASP A O   1 
ATOM   537  C CB  . ASP A 1 72  ? -1.856  68.762 71.050 1.00 61.11  ? 72   ASP A CB  1 
ATOM   538  C CG  . ASP A 1 72  ? -0.845  68.960 72.138 1.00 61.11  ? 72   ASP A CG  1 
ATOM   539  O OD1 . ASP A 1 72  ? -1.051  68.397 73.235 1.00 61.11  ? 72   ASP A OD1 1 
ATOM   540  O OD2 . ASP A 1 72  ? 0.160   69.667 71.898 1.00 61.11  ? 72   ASP A OD2 1 
ATOM   541  N N   . GLU A 1 73  ? -3.658  69.059 73.894 1.00 49.30  ? 73   GLU A N   1 
ATOM   542  C CA  . GLU A 1 73  ? -4.001  69.934 75.002 1.00 49.30  ? 73   GLU A CA  1 
ATOM   543  C C   . GLU A 1 73  ? -2.959  69.819 76.103 1.00 49.30  ? 73   GLU A C   1 
ATOM   544  O O   . GLU A 1 73  ? -3.233  70.073 77.277 1.00 49.30  ? 73   GLU A O   1 
ATOM   545  C CB  . GLU A 1 73  ? -5.376  69.572 75.554 1.00 70.73  ? 73   GLU A CB  1 
ATOM   546  C CG  . GLU A 1 73  ? -6.532  70.149 74.760 1.00 70.73  ? 73   GLU A CG  1 
ATOM   547  C CD  . GLU A 1 73  ? -7.891  69.594 75.207 1.00 70.73  ? 73   GLU A CD  1 
ATOM   548  O OE1 . GLU A 1 73  ? -8.269  69.795 76.393 1.00 70.73  ? 73   GLU A OE1 1 
ATOM   549  O OE2 . GLU A 1 73  ? -8.579  68.955 74.366 1.00 70.73  ? 73   GLU A OE2 1 
ATOM   550  N N   . GLN A 1 74  ? -1.753  69.429 75.718 1.00 49.97  ? 74   GLN A N   1 
ATOM   551  C CA  . GLN A 1 74  ? -0.664  69.297 76.671 1.00 49.97  ? 74   GLN A CA  1 
ATOM   552  C C   . GLN A 1 74  ? -0.236  70.669 77.222 1.00 49.97  ? 74   GLN A C   1 
ATOM   553  O O   . GLN A 1 74  ? 0.226   70.762 78.350 1.00 49.97  ? 74   GLN A O   1 
ATOM   554  C CB  . GLN A 1 74  ? 0.525   68.608 75.993 1.00 64.16  ? 74   GLN A CB  1 
ATOM   555  C CG  . GLN A 1 74  ? 1.724   68.378 76.898 1.00 64.16  ? 74   GLN A CG  1 
ATOM   556  C CD  . GLN A 1 74  ? 1.420   67.400 78.010 1.00 64.16  ? 74   GLN A CD  1 
ATOM   557  O OE1 . GLN A 1 74  ? 2.226   67.202 78.929 1.00 64.16  ? 74   GLN A OE1 1 
ATOM   558  N NE2 . GLN A 1 74  ? 0.251   66.772 77.932 1.00 64.16  ? 74   GLN A NE2 1 
ATOM   559  N N   . PHE A 1 75  ? -0.391  71.730 76.432 1.00 42.20  ? 75   PHE A N   1 
ATOM   560  C CA  . PHE A 1 75  ? 0.003   73.072 76.875 1.00 42.20  ? 75   PHE A CA  1 
ATOM   561  C C   . PHE A 1 75  ? -1.008  74.130 76.432 1.00 42.20  ? 75   PHE A C   1 
ATOM   562  O O   . PHE A 1 75  ? -0.762  74.879 75.485 1.00 42.20  ? 75   PHE A O   1 
ATOM   563  C CB  . PHE A 1 75  ? 1.375   73.423 76.305 1.00 42.86  ? 75   PHE A CB  1 
ATOM   564  C CG  . PHE A 1 75  ? 2.452   72.449 76.671 1.00 42.86  ? 75   PHE A CG  1 
ATOM   565  C CD1 . PHE A 1 75  ? 2.985   72.433 77.952 1.00 42.86  ? 75   PHE A CD1 1 
ATOM   566  C CD2 . PHE A 1 75  ? 2.931   71.546 75.732 1.00 42.86  ? 75   PHE A CD2 1 
ATOM   567  C CE1 . PHE A 1 75  ? 3.980   71.532 78.295 1.00 42.86  ? 75   PHE A CE1 1 
ATOM   568  C CE2 . PHE A 1 75  ? 3.927   70.636 76.059 1.00 42.86  ? 75   PHE A CE2 1 
ATOM   569  C CZ  . PHE A 1 75  ? 4.456   70.625 77.342 1.00 42.86  ? 75   PHE A CZ  1 
ATOM   570  N N   . PRO A 1 76  ? -2.163  74.204 77.118 1.00 54.28  ? 76   PRO A N   1 
ATOM   571  C CA  . PRO A 1 76  ? -3.217  75.169 76.793 1.00 54.28  ? 76   PRO A CA  1 
ATOM   572  C C   . PRO A 1 76  ? -2.688  76.599 76.713 1.00 54.28  ? 76   PRO A C   1 
ATOM   573  O O   . PRO A 1 76  ? -2.004  77.067 77.634 1.00 54.28  ? 76   PRO A O   1 
ATOM   574  C CB  . PRO A 1 76  ? -4.209  74.984 77.932 1.00 43.65  ? 76   PRO A CB  1 
ATOM   575  C CG  . PRO A 1 76  ? -4.046  73.543 78.287 1.00 43.65  ? 76   PRO A CG  1 
ATOM   576  C CD  . PRO A 1 76  ? -2.552  73.379 78.276 1.00 43.65  ? 76   PRO A CD  1 
ATOM   577  N N   . GLY A 1 77  ? -3.005  77.282 75.609 1.00 64.00  ? 77   GLY A N   1 
ATOM   578  C CA  . GLY A 1 77  ? -2.557  78.654 75.414 1.00 64.00  ? 77   GLY A CA  1 
ATOM   579  C C   . GLY A 1 77  ? -1.205  78.781 74.720 1.00 64.00  ? 77   GLY A C   1 
ATOM   580  O O   . GLY A 1 77  ? -0.998  79.668 73.884 1.00 64.00  ? 77   GLY A O   1 
ATOM   581  N N   . PHE A 1 78  ? -0.275  77.901 75.073 1.00 43.06  ? 78   PHE A N   1 
ATOM   582  C CA  . PHE A 1 78  ? 1.065   77.897 74.492 1.00 43.06  ? 78   PHE A CA  1 
ATOM   583  C C   . PHE A 1 78  ? 0.996   77.945 72.962 1.00 43.06  ? 78   PHE A C   1 
ATOM   584  O O   . PHE A 1 78  ? 0.486   77.028 72.322 1.00 43.06  ? 78   PHE A O   1 
ATOM   585  C CB  . PHE A 1 78  ? 1.791   76.636 74.952 1.00 42.10  ? 78   PHE A CB  1 
ATOM   586  C CG  . PHE A 1 78  ? 3.259   76.670 74.730 1.00 42.10  ? 78   PHE A CG  1 
ATOM   587  C CD1 . PHE A 1 78  ? 4.019   77.726 75.217 1.00 42.10  ? 78   PHE A CD1 1 
ATOM   588  C CD2 . PHE A 1 78  ? 3.895   75.635 74.047 1.00 42.10  ? 78   PHE A CD2 1 
ATOM   589  C CE1 . PHE A 1 78  ? 5.394   77.757 75.029 1.00 42.10  ? 78   PHE A CE1 1 
ATOM   590  C CE2 . PHE A 1 78  ? 5.271   75.649 73.850 1.00 42.10  ? 78   PHE A CE2 1 
ATOM   591  C CZ  . PHE A 1 78  ? 6.023   76.712 74.342 1.00 42.10  ? 78   PHE A CZ  1 
ATOM   592  N N   . SER A 1 79  ? 1.496   79.019 72.373 1.00 47.62  ? 79   SER A N   1 
ATOM   593  C CA  . SER A 1 79  ? 1.455   79.142 70.921 1.00 47.62  ? 79   SER A CA  1 
ATOM   594  C C   . SER A 1 79  ? 2.273   78.039 70.277 1.00 47.62  ? 79   SER A C   1 
ATOM   595  O O   . SER A 1 79  ? 1.917   77.522 69.220 1.00 47.62  ? 79   SER A O   1 
ATOM   596  C CB  . SER A 1 79  ? 2.018   80.487 70.481 1.00 46.39  ? 79   SER A CB  1 
ATOM   597  O OG  . SER A 1 79  ? 3.356   80.627 70.921 1.00 46.39  ? 79   SER A OG  1 
ATOM   598  N N   . GLY A 1 80  ? 3.372   77.681 70.932 1.00 51.96  ? 80   GLY A N   1 
ATOM   599  C CA  . GLY A 1 80  ? 4.258   76.662 70.406 1.00 51.96  ? 80   GLY A CA  1 
ATOM   600  C C   . GLY A 1 80  ? 3.602   75.356 70.016 1.00 51.96  ? 80   GLY A C   1 
ATOM   601  O O   . GLY A 1 80  ? 4.079   74.673 69.112 1.00 51.96  ? 80   GLY A O   1 
ATOM   602  N N   . SER A 1 81  ? 2.509   75.001 70.683 1.00 45.88  ? 81   SER A N   1 
ATOM   603  C CA  . SER A 1 81  ? 1.837   73.744 70.385 1.00 45.88  ? 81   SER A CA  1 
ATOM   604  C C   . SER A 1 81  ? 0.483   73.931 69.721 1.00 45.88  ? 81   SER A C   1 
ATOM   605  O O   . SER A 1 81  ? -0.020  73.026 69.048 1.00 45.88  ? 81   SER A O   1 
ATOM   606  C CB  . SER A 1 81  ? 1.663   72.927 71.667 1.00 42.52  ? 81   SER A CB  1 
ATOM   607  O OG  . SER A 1 81  ? 0.804   73.597 72.567 1.00 42.52  ? 81   SER A OG  1 
ATOM   608  N N   . GLU A 1 82  ? -0.111  75.101 69.904 1.00 51.78  ? 82   GLU A N   1 
ATOM   609  C CA  . GLU A 1 82  ? -1.411  75.343 69.315 1.00 51.78  ? 82   GLU A CA  1 
ATOM   610  C C   . GLU A 1 82  ? -1.343  75.736 67.857 1.00 51.78  ? 82   GLU A C   1 
ATOM   611  O O   . GLU A 1 82  ? -2.285  75.502 67.105 1.00 51.78  ? 82   GLU A O   1 
ATOM   612  C CB  . GLU A 1 82  ? -2.175  76.368 70.148 1.00 76.12  ? 82   GLU A CB  1 
ATOM   613  C CG  . GLU A 1 82  ? -2.819  75.699 71.363 1.00 76.12  ? 82   GLU A CG  1 
ATOM   614  C CD  . GLU A 1 82  ? -3.301  76.680 72.422 1.00 76.12  ? 82   GLU A CD  1 
ATOM   615  O OE1 . GLU A 1 82  ? -2.932  77.878 72.326 1.00 76.12  ? 82   GLU A OE1 1 
ATOM   616  O OE2 . GLU A 1 82  ? -4.038  76.248 73.354 1.00 76.12  ? 82   GLU A OE2 1 
ATOM   617  N N   . MET A 1 83  ? -0.218  76.299 67.438 1.00 42.40  ? 83   MET A N   1 
ATOM   618  C CA  . MET A 1 83  ? -0.067  76.684 66.041 1.00 42.40  ? 83   MET A CA  1 
ATOM   619  C C   . MET A 1 83  ? -0.141  75.451 65.148 1.00 42.40  ? 83   MET A C   1 
ATOM   620  O O   . MET A 1 83  ? -0.073  75.564 63.925 1.00 42.40  ? 83   MET A O   1 
ATOM   621  C CB  . MET A 1 83  ? 1.273   77.358 65.815 1.00 59.46  ? 83   MET A CB  1 
ATOM   622  C CG  . MET A 1 83  ? 2.415   76.414 66.024 1.00 59.46  ? 83   MET A CG  1 
ATOM   623  S SD  . MET A 1 83  ? 3.939   77.077 65.394 1.00 59.46  ? 83   MET A SD  1 
ATOM   624  C CE  . MET A 1 83  ? 4.896   77.391 67.024 1.00 59.46  ? 83   MET A CE  1 
ATOM   625  N N   . TRP A 1 84  ? -0.247  74.273 65.759 1.00 41.67  ? 84   TRP A N   1 
ATOM   626  C CA  . TRP A 1 84  ? -0.340  73.036 64.997 1.00 41.67  ? 84   TRP A CA  1 
ATOM   627  C C   . TRP A 1 84  ? -1.737  72.440 65.086 1.00 41.67  ? 84   TRP A C   1 
ATOM   628  O O   . TRP A 1 84  ? -2.109  71.624 64.253 1.00 41.67  ? 84   TRP A O   1 
ATOM   629  C CB  . TRP A 1 84  ? 0.699   72.017 65.474 1.00 37.04  ? 84   TRP A CB  1 
ATOM   630  C CG  . TRP A 1 84  ? 2.113   72.519 65.385 1.00 37.04  ? 84   TRP A CG  1 
ATOM   631  C CD1 . TRP A 1 84  ? 2.911   72.902 66.424 1.00 37.04  ? 84   TRP A CD1 1 
ATOM   632  C CD2 . TRP A 1 84  ? 2.891   72.715 64.193 1.00 37.04  ? 84   TRP A CD2 1 
ATOM   633  N NE1 . TRP A 1 84  ? 4.135   73.323 65.957 1.00 37.04  ? 84   TRP A NE1 1 
ATOM   634  C CE2 . TRP A 1 84  ? 4.149   73.219 64.592 1.00 37.04  ? 84   TRP A CE2 1 
ATOM   635  C CE3 . TRP A 1 84  ? 2.647   72.515 62.828 1.00 37.04  ? 84   TRP A CE3 1 
ATOM   636  C CZ2 . TRP A 1 84  ? 5.161   73.523 63.676 1.00 37.04  ? 84   TRP A CZ2 1 
ATOM   637  C CZ3 . TRP A 1 84  ? 3.655   72.817 61.918 1.00 37.04  ? 84   TRP A CZ3 1 
ATOM   638  C CH2 . TRP A 1 84  ? 4.895   73.316 62.348 1.00 37.04  ? 84   TRP A CH2 1 
ATOM   639  N N   . ASN A 1 85  ? -2.507  72.852 66.091 1.00 37.95  ? 85   ASN A N   1 
ATOM   640  C CA  . ASN A 1 85  ? -3.874  72.367 66.265 1.00 37.95  ? 85   ASN A CA  1 
ATOM   641  C C   . ASN A 1 85  ? -4.749  72.922 65.156 1.00 37.95  ? 85   ASN A C   1 
ATOM   642  O O   . ASN A 1 85  ? -4.396  73.915 64.526 1.00 37.95  ? 85   ASN A O   1 
ATOM   643  C CB  . ASN A 1 85  ? -4.482  72.848 67.587 1.00 51.17  ? 85   ASN A CB  1 
ATOM   644  C CG  . ASN A 1 85  ? -3.800  72.272 68.805 1.00 51.17  ? 85   ASN A CG  1 
ATOM   645  O OD1 . ASN A 1 85  ? -3.603  71.058 68.921 1.00 51.17  ? 85   ASN A OD1 1 
ATOM   646  N ND2 . ASN A 1 85  ? -3.454  73.144 69.739 1.00 51.17  ? 85   ASN A ND2 1 
ATOM   647  N N   . PRO A 1 86  ? -5.915  72.296 64.914 1.00 40.27  ? 86   PRO A N   1 
ATOM   648  C CA  . PRO A 1 86  ? -6.843  72.748 63.875 1.00 40.27  ? 86   PRO A CA  1 
ATOM   649  C C   . PRO A 1 86  ? -7.394  74.126 64.248 1.00 40.27  ? 86   PRO A C   1 
ATOM   650  O O   . PRO A 1 86  ? -7.830  74.336 65.377 1.00 40.27  ? 86   PRO A O   1 
ATOM   651  C CB  . PRO A 1 86  ? -7.937  71.684 63.900 1.00 29.50  ? 86   PRO A CB  1 
ATOM   652  C CG  . PRO A 1 86  ? -7.246  70.492 64.399 1.00 29.50  ? 86   PRO A CG  1 
ATOM   653  C CD  . PRO A 1 86  ? -6.383  71.031 65.498 1.00 29.50  ? 86   PRO A CD  1 
ATOM   654  N N   . ASN A 1 87  ? -7.376  75.057 63.304 1.00 42.25  ? 87   ASN A N   1 
ATOM   655  C CA  . ASN A 1 87  ? -7.878  76.392 63.560 1.00 42.25  ? 87   ASN A CA  1 
ATOM   656  C C   . ASN A 1 87  ? -9.238  76.597 62.901 1.00 42.25  ? 87   ASN A C   1 
ATOM   657  O O   . ASN A 1 87  ? -9.641  77.721 62.618 1.00 42.25  ? 87   ASN A O   1 
ATOM   658  C CB  . ASN A 1 87  ? -6.871  77.417 63.047 1.00 42.80  ? 87   ASN A CB  1 
ATOM   659  C CG  . ASN A 1 87  ? -6.607  77.284 61.565 1.00 42.80  ? 87   ASN A CG  1 
ATOM   660  O OD1 . ASN A 1 87  ? -6.908  76.261 60.952 1.00 42.80  ? 87   ASN A OD1 1 
ATOM   661  N ND2 . ASN A 1 87  ? -6.030  78.317 60.980 1.00 42.80  ? 87   ASN A ND2 1 
ATOM   662  N N   . ARG A 1 88  ? -9.953  75.502 62.670 1.00 43.85  ? 88   ARG A N   1 
ATOM   663  C CA  . ARG A 1 88  ? -11.266 75.556 62.036 1.00 43.85  ? 88   ARG A CA  1 
ATOM   664  C C   . ARG A 1 88  ? -12.155 74.475 62.601 1.00 43.85  ? 88   ARG A C   1 
ATOM   665  O O   . ARG A 1 88  ? -11.677 73.524 63.218 1.00 43.85  ? 88   ARG A O   1 
ATOM   666  C CB  . ARG A 1 88  ? -11.145 75.307 60.540 1.00 55.37  ? 88   ARG A CB  1 
ATOM   667  C CG  . ARG A 1 88  ? -10.330 76.313 59.813 1.00 55.37  ? 88   ARG A CG  1 
ATOM   668  C CD  . ARG A 1 88  ? -11.148 77.537 59.607 1.00 55.37  ? 88   ARG A CD  1 
ATOM   669  N NE  . ARG A 1 88  ? -10.283 78.696 59.492 1.00 55.37  ? 88   ARG A NE  1 
ATOM   670  C CZ  . ARG A 1 88  ? -10.720 79.916 59.221 1.00 55.37  ? 88   ARG A CZ  1 
ATOM   671  N NH1 . ARG A 1 88  ? -12.020 80.121 59.039 1.00 55.37  ? 88   ARG A NH1 1 
ATOM   672  N NH2 . ARG A 1 88  ? -9.854  80.919 59.125 1.00 55.37  ? 88   ARG A NH2 1 
ATOM   673  N N   . GLU A 1 89  ? -13.453 74.617 62.366 1.00 43.50  ? 89   GLU A N   1 
ATOM   674  C CA  . GLU A 1 89  ? -14.433 73.641 62.818 1.00 43.50  ? 89   GLU A CA  1 
ATOM   675  C C   . GLU A 1 89  ? -14.010 72.265 62.291 1.00 43.50  ? 89   GLU A C   1 
ATOM   676  O O   . GLU A 1 89  ? -13.700 72.132 61.113 1.00 43.50  ? 89   GLU A O   1 
ATOM   677  C CB  . GLU A 1 89  ? -15.789 73.991 62.219 1.00 91.74  ? 89   GLU A CB  1 
ATOM   678  C CG  . GLU A 1 89  ? -16.961 73.669 63.103 1.00 91.74  ? 89   GLU A CG  1 
ATOM   679  C CD  . GLU A 1 89  ? -17.086 74.659 64.245 1.00 91.74  ? 89   GLU A CD  1 
ATOM   680  O OE1 . GLU A 1 89  ? -17.231 75.880 63.975 1.00 91.74  ? 89   GLU A OE1 1 
ATOM   681  O OE2 . GLU A 1 89  ? -17.040 74.217 65.413 1.00 91.74  ? 89   GLU A OE2 1 
ATOM   682  N N   . MET A 1 90  ? -13.974 71.242 63.134 1.00 38.90  ? 90   MET A N   1 
ATOM   683  C CA  . MET A 1 90  ? -13.614 69.922 62.621 1.00 38.90  ? 90   MET A CA  1 
ATOM   684  C C   . MET A 1 90  ? -14.874 69.269 62.089 1.00 38.90  ? 90   MET A C   1 
ATOM   685  O O   . MET A 1 90  ? -15.952 69.485 62.621 1.00 38.90  ? 90   MET A O   1 
ATOM   686  C CB  . MET A 1 90  ? -12.997 69.042 63.707 1.00 47.61  ? 90   MET A CB  1 
ATOM   687  C CG  . MET A 1 90  ? -11.531 69.328 63.967 1.00 47.61  ? 90   MET A CG  1 
ATOM   688  S SD  . MET A 1 90  ? -10.887 68.217 65.215 1.00 47.61  ? 90   MET A SD  1 
ATOM   689  C CE  . MET A 1 90  ? -11.580 68.921 66.730 1.00 47.61  ? 90   MET A CE  1 
ATOM   690  N N   . SER A 1 91  ? -14.736 68.469 61.040 1.00 37.91  ? 91   SER A N   1 
ATOM   691  C CA  . SER A 1 91  ? -15.884 67.809 60.420 1.00 37.91  ? 91   SER A CA  1 
ATOM   692  C C   . SER A 1 91  ? -15.418 66.663 59.532 1.00 37.91  ? 91   SER A C   1 
ATOM   693  O O   . SER A 1 91  ? -14.332 66.726 58.961 1.00 37.91  ? 91   SER A O   1 
ATOM   694  C CB  . SER A 1 91  ? -16.660 68.830 59.571 1.00 39.55  ? 91   SER A CB  1 
ATOM   695  O OG  . SER A 1 91  ? -17.530 68.204 58.648 1.00 39.55  ? 91   SER A OG  1 
ATOM   696  N N   . GLU A 1 92  ? -16.230 65.616 59.415 1.00 50.25  ? 92   GLU A N   1 
ATOM   697  C CA  . GLU A 1 92  ? -15.860 64.503 58.553 1.00 50.25  ? 92   GLU A CA  1 
ATOM   698  C C   . GLU A 1 92  ? -15.880 64.930 57.085 1.00 50.25  ? 92   GLU A C   1 
ATOM   699  O O   . GLU A 1 92  ? -15.320 64.244 56.226 1.00 50.25  ? 92   GLU A O   1 
ATOM   700  C CB  . GLU A 1 92  ? -16.785 63.317 58.770 1.00 49.69  ? 92   GLU A CB  1 
ATOM   701  C CG  . GLU A 1 92  ? -16.266 62.360 59.815 1.00 49.69  ? 92   GLU A CG  1 
ATOM   702  C CD  . GLU A 1 92  ? -17.083 61.081 59.889 1.00 49.69  ? 92   GLU A CD  1 
ATOM   703  O OE1 . GLU A 1 92  ? -18.192 61.114 60.470 1.00 49.69  ? 92   GLU A OE1 1 
ATOM   704  O OE2 . GLU A 1 92  ? -16.616 60.044 59.351 1.00 49.69  ? 92   GLU A OE2 1 
ATOM   705  N N   . ASP A 1 93  ? -16.532 66.057 56.804 1.00 47.98  ? 93   ASP A N   1 
ATOM   706  C CA  . ASP A 1 93  ? -16.593 66.613 55.449 1.00 47.98  ? 93   ASP A CA  1 
ATOM   707  C C   . ASP A 1 93  ? -15.380 67.549 55.351 1.00 47.98  ? 93   ASP A C   1 
ATOM   708  O O   . ASP A 1 93  ? -15.502 68.777 55.450 1.00 47.98  ? 93   ASP A O   1 
ATOM   709  C CB  . ASP A 1 93  ? -17.909 67.380 55.265 1.00 59.37  ? 93   ASP A CB  1 
ATOM   710  C CG  . ASP A 1 93  ? -17.982 68.134 53.940 1.00 59.37  ? 93   ASP A CG  1 
ATOM   711  O OD1 . ASP A 1 93  ? -17.301 67.742 52.956 1.00 59.37  ? 93   ASP A OD1 1 
ATOM   712  O OD2 . ASP A 1 93  ? -18.746 69.122 53.883 1.00 59.37  ? 93   ASP A OD2 1 
ATOM   713  N N   . CYS A 1 94  ? -14.215 66.935 55.145 1.00 50.30  ? 94   CYS A N   1 
ATOM   714  C CA  . CYS A 1 94  ? -12.928 67.625 55.114 1.00 50.30  ? 94   CYS A CA  1 
ATOM   715  C C   . CYS A 1 94  ? -12.154 67.705 53.806 1.00 50.30  ? 94   CYS A C   1 
ATOM   716  O O   . CYS A 1 94  ? -11.255 68.531 53.698 1.00 50.30  ? 94   CYS A O   1 
ATOM   717  C CB  . CYS A 1 94  ? -12.014 66.987 56.174 1.00 18.49  ? 94   CYS A CB  1 
ATOM   718  N N   . LEU A 1 95  ? -12.473 66.870 52.823 1.00 41.87  ? 95   LEU A N   1 
ATOM   719  C CA  . LEU A 1 95  ? -11.701 66.846 51.576 1.00 41.87  ? 95   LEU A CA  1 
ATOM   720  C C   . LEU A 1 95  ? -11.758 68.027 50.602 1.00 41.87  ? 95   LEU A C   1 
ATOM   721  O O   . LEU A 1 95  ? -12.452 67.969 49.592 1.00 41.87  ? 95   LEU A O   1 
ATOM   722  C CB  . LEU A 1 95  ? -12.025 65.564 50.823 1.00 33.06  ? 95   LEU A CB  1 
ATOM   723  C CG  . LEU A 1 95  ? -11.907 64.348 51.733 1.00 33.06  ? 95   LEU A CG  1 
ATOM   724  C CD1 . LEU A 1 95  ? -12.220 63.087 50.949 1.00 33.06  ? 95   LEU A CD1 1 
ATOM   725  C CD2 . LEU A 1 95  ? -10.512 64.292 52.320 1.00 33.06  ? 95   LEU A CD2 1 
ATOM   726  N N   . TYR A 1 96  ? -11.004 69.081 50.891 1.00 35.81  ? 96   TYR A N   1 
ATOM   727  C CA  . TYR A 1 96  ? -10.956 70.256 50.023 1.00 35.81  ? 96   TYR A CA  1 
ATOM   728  C C   . TYR A 1 96  ? -9.511  70.684 49.799 1.00 35.81  ? 96   TYR A C   1 
ATOM   729  O O   . TYR A 1 96  ? -8.624  70.271 50.534 1.00 35.81  ? 96   TYR A O   1 
ATOM   730  C CB  . TYR A 1 96  ? -11.709 71.431 50.648 1.00 40.57  ? 96   TYR A CB  1 
ATOM   731  C CG  . TYR A 1 96  ? -13.130 71.131 51.012 1.00 40.57  ? 96   TYR A CG  1 
ATOM   732  C CD1 . TYR A 1 96  ? -13.437 70.504 52.213 1.00 40.57  ? 96   TYR A CD1 1 
ATOM   733  C CD2 . TYR A 1 96  ? -14.169 71.456 50.147 1.00 40.57  ? 96   TYR A CD2 1 
ATOM   734  C CE1 . TYR A 1 96  ? -14.746 70.206 52.549 1.00 40.57  ? 96   TYR A CE1 1 
ATOM   735  C CE2 . TYR A 1 96  ? -15.477 71.164 50.467 1.00 40.57  ? 96   TYR A CE2 1 
ATOM   736  C CZ  . TYR A 1 96  ? -15.762 70.537 51.670 1.00 40.57  ? 96   TYR A CZ  1 
ATOM   737  O OH  . TYR A 1 96  ? -17.058 70.224 51.988 1.00 40.57  ? 96   TYR A OH  1 
ATOM   738  N N   . LEU A 1 97  ? -9.271  71.513 48.790 1.00 30.87  ? 97   LEU A N   1 
ATOM   739  C CA  . LEU A 1 97  ? -7.919  71.982 48.533 1.00 30.87  ? 97   LEU A CA  1 
ATOM   740  C C   . LEU A 1 97  ? -7.877  73.503 48.358 1.00 30.87  ? 97   LEU A C   1 
ATOM   741  O O   . LEU A 1 97  ? -8.886  74.133 48.066 1.00 30.87  ? 97   LEU A O   1 
ATOM   742  C CB  . LEU A 1 97  ? -7.324  71.253 47.321 1.00 30.37  ? 97   LEU A CB  1 
ATOM   743  C CG  . LEU A 1 97  ? -7.977  71.358 45.946 1.00 30.37  ? 97   LEU A CG  1 
ATOM   744  C CD1 . LEU A 1 97  ? -7.681  72.708 45.355 1.00 30.37  ? 97   LEU A CD1 1 
ATOM   745  C CD2 . LEU A 1 97  ? -7.434  70.280 45.036 1.00 30.37  ? 97   LEU A CD2 1 
ATOM   746  N N   . ASN A 1 98  ? -6.705  74.085 48.561 1.00 37.96  ? 98   ASN A N   1 
ATOM   747  C CA  . ASN A 1 98  ? -6.529  75.523 48.457 1.00 37.96  ? 98   ASN A CA  1 
ATOM   748  C C   . ASN A 1 98  ? -5.484  75.861 47.399 1.00 37.96  ? 98   ASN A C   1 
ATOM   749  O O   . ASN A 1 98  ? -4.448  75.203 47.318 1.00 37.96  ? 98   ASN A O   1 
ATOM   750  C CB  . ASN A 1 98  ? -6.080  76.079 49.807 1.00 43.53  ? 98   ASN A CB  1 
ATOM   751  C CG  . ASN A 1 98  ? -6.925  75.568 50.965 1.00 43.53  ? 98   ASN A CG  1 
ATOM   752  O OD1 . ASN A 1 98  ? -8.112  75.872 51.066 1.00 43.53  ? 98   ASN A OD1 1 
ATOM   753  N ND2 . ASN A 1 98  ? -6.309  74.782 51.848 1.00 43.53  ? 98   ASN A ND2 1 
ATOM   754  N N   . ILE A 1 99  ? -5.750  76.894 46.603 1.00 41.55  ? 99   ILE A N   1 
ATOM   755  C CA  . ILE A 1 99  ? -4.830  77.315 45.545 1.00 41.55  ? 99   ILE A CA  1 
ATOM   756  C C   . ILE A 1 99  ? -4.450  78.801 45.620 1.00 41.55  ? 99   ILE A C   1 
ATOM   757  O O   . ILE A 1 99  ? -5.323  79.657 45.673 1.00 41.55  ? 99   ILE A O   1 
ATOM   758  C CB  . ILE A 1 99  ? -5.446  77.086 44.149 1.00 37.92  ? 99   ILE A CB  1 
ATOM   759  C CG1 . ILE A 1 99  ? -5.977  75.655 44.027 1.00 37.92  ? 99   ILE A CG1 1 
ATOM   760  C CG2 . ILE A 1 99  ? -4.407  77.369 43.090 1.00 37.92  ? 99   ILE A CG2 1 
ATOM   761  C CD1 . ILE A 1 99  ? -6.555  75.318 42.654 1.00 37.92  ? 99   ILE A CD1 1 
ATOM   762  N N   . TRP A 1 100 ? -3.157  79.108 45.615 1.00 31.20  ? 100  TRP A N   1 
ATOM   763  C CA  . TRP A 1 100 ? -2.711  80.499 45.642 1.00 31.20  ? 100  TRP A CA  1 
ATOM   764  C C   . TRP A 1 100 ? -2.127  80.798 44.286 1.00 31.20  ? 100  TRP A C   1 
ATOM   765  O O   . TRP A 1 100 ? -1.115  80.222 43.910 1.00 31.20  ? 100  TRP A O   1 
ATOM   766  C CB  . TRP A 1 100 ? -1.659  80.715 46.727 1.00 31.81  ? 100  TRP A CB  1 
ATOM   767  C CG  . TRP A 1 100 ? -2.265  80.880 48.068 1.00 31.81  ? 100  TRP A CG  1 
ATOM   768  C CD1 . TRP A 1 100 ? -2.798  82.018 48.587 1.00 31.81  ? 100  TRP A CD1 1 
ATOM   769  C CD2 . TRP A 1 100 ? -2.460  79.861 49.050 1.00 31.81  ? 100  TRP A CD2 1 
ATOM   770  N NE1 . TRP A 1 100 ? -3.313  81.774 49.833 1.00 31.81  ? 100  TRP A NE1 1 
ATOM   771  C CE2 . TRP A 1 100 ? -3.118  80.455 50.142 1.00 31.81  ? 100  TRP A CE2 1 
ATOM   772  C CE3 . TRP A 1 100 ? -2.143  78.498 49.111 1.00 31.81  ? 100  TRP A CE3 1 
ATOM   773  C CZ2 . TRP A 1 100 ? -3.466  79.737 51.286 1.00 31.81  ? 100  TRP A CZ2 1 
ATOM   774  C CZ3 . TRP A 1 100 ? -2.490  77.781 50.251 1.00 31.81  ? 100  TRP A CZ3 1 
ATOM   775  C CH2 . TRP A 1 100 ? -3.144  78.403 51.322 1.00 31.81  ? 100  TRP A CH2 1 
ATOM   776  N N   . VAL A 1 101 ? -2.765  81.692 43.541 1.00 38.94  ? 101  VAL A N   1 
ATOM   777  C CA  . VAL A 1 101 ? -2.300  82.017 42.197 1.00 38.94  ? 101  VAL A CA  1 
ATOM   778  C C   . VAL A 1 101 ? -1.785  83.438 42.078 1.00 38.94  ? 101  VAL A C   1 
ATOM   779  O O   . VAL A 1 101 ? -2.410  84.373 42.567 1.00 38.94  ? 101  VAL A O   1 
ATOM   780  C CB  . VAL A 1 101 ? -3.428  81.834 41.155 1.00 33.28  ? 101  VAL A CB  1 
ATOM   781  C CG1 . VAL A 1 101 ? -2.884  82.052 39.755 1.00 33.28  ? 101  VAL A CG1 1 
ATOM   782  C CG2 . VAL A 1 101 ? -4.034  80.459 41.274 1.00 33.28  ? 101  VAL A CG2 1 
ATOM   783  N N   . PRO A 1 102 ? -0.627  83.618 41.427 1.00 44.07  ? 102  PRO A N   1 
ATOM   784  C CA  . PRO A 1 102 ? -0.029  84.944 41.237 1.00 44.07  ? 102  PRO A CA  1 
ATOM   785  C C   . PRO A 1 102 ? -0.950  85.909 40.480 1.00 44.07  ? 102  PRO A C   1 
ATOM   786  O O   . PRO A 1 102 ? -1.950  85.505 39.878 1.00 44.07  ? 102  PRO A O   1 
ATOM   787  C CB  . PRO A 1 102 ? 1.238   84.634 40.445 1.00 34.47  ? 102  PRO A CB  1 
ATOM   788  C CG  . PRO A 1 102 ? 1.637   83.298 40.967 1.00 34.47  ? 102  PRO A CG  1 
ATOM   789  C CD  . PRO A 1 102 ? 0.316   82.556 41.027 1.00 34.47  ? 102  PRO A CD  1 
ATOM   790  N N   . SER A 1 103 ? -0.613  87.193 40.519 1.00 52.20  ? 103  SER A N   1 
ATOM   791  C CA  . SER A 1 103 ? -1.394  88.210 39.810 1.00 52.20  ? 103  SER A CA  1 
ATOM   792  C C   . SER A 1 103 ? -0.418  89.141 39.118 1.00 52.20  ? 103  SER A C   1 
ATOM   793  O O   . SER A 1 103 ? 0.466   89.701 39.757 1.00 52.20  ? 103  SER A O   1 
ATOM   794  C CB  . SER A 1 103 ? -2.258  89.026 40.776 1.00 52.67  ? 103  SER A CB  1 
ATOM   795  O OG  . SER A 1 103 ? -2.972  90.030 40.069 1.00 52.67  ? 103  SER A OG  1 
ATOM   796  N N   . PRO A 1 104 ? -0.563  89.316 37.799 1.00 53.94  ? 104  PRO A N   1 
ATOM   797  C CA  . PRO A 1 104 ? -1.589  88.686 36.960 1.00 53.94  ? 104  PRO A CA  1 
ATOM   798  C C   . PRO A 1 104 ? -1.453  87.155 36.818 1.00 53.94  ? 104  PRO A C   1 
ATOM   799  O O   . PRO A 1 104 ? -0.353  86.601 36.937 1.00 53.94  ? 104  PRO A O   1 
ATOM   800  C CB  . PRO A 1 104 ? -1.418  89.416 35.627 1.00 41.34  ? 104  PRO A CB  1 
ATOM   801  C CG  . PRO A 1 104 ? 0.062   89.634 35.573 1.00 41.34  ? 104  PRO A CG  1 
ATOM   802  C CD  . PRO A 1 104 ? 0.363   90.120 36.979 1.00 41.34  ? 104  PRO A CD  1 
ATOM   803  N N   . ARG A 1 105 ? -2.581  86.491 36.554 1.00 46.66  ? 105  ARG A N   1 
ATOM   804  C CA  . ARG A 1 105 ? -2.633  85.037 36.387 1.00 46.66  ? 105  ARG A CA  1 
ATOM   805  C C   . ARG A 1 105 ? -1.622  84.574 35.349 1.00 46.66  ? 105  ARG A C   1 
ATOM   806  O O   . ARG A 1 105 ? -1.567  85.107 34.235 1.00 46.66  ? 105  ARG A O   1 
ATOM   807  C CB  . ARG A 1 105 ? -4.038  84.602 35.952 1.00 43.39  ? 105  ARG A CB  1 
ATOM   808  C CG  . ARG A 1 105 ? -4.207  83.100 35.814 1.00 43.39  ? 105  ARG A CG  1 
ATOM   809  C CD  . ARG A 1 105 ? -5.582  82.717 35.274 1.00 43.39  ? 105  ARG A CD  1 
ATOM   810  N NE  . ARG A 1 105 ? -6.683  83.167 36.123 1.00 43.39  ? 105  ARG A NE  1 
ATOM   811  C CZ  . ARG A 1 105 ? -7.966  83.126 35.764 1.00 43.39  ? 105  ARG A CZ  1 
ATOM   812  N NH1 . ARG A 1 105 ? -8.313  82.653 34.574 1.00 43.39  ? 105  ARG A NH1 1 
ATOM   813  N NH2 . ARG A 1 105 ? -8.906  83.579 36.581 1.00 43.39  ? 105  ARG A NH2 1 
ATOM   814  N N   . PRO A 1 106 ? -0.804  83.572 35.702 1.00 48.67  ? 106  PRO A N   1 
ATOM   815  C CA  . PRO A 1 106 ? 0.217   83.028 34.795 1.00 48.67  ? 106  PRO A CA  1 
ATOM   816  C C   . PRO A 1 106 ? -0.466  82.283 33.654 1.00 48.67  ? 106  PRO A C   1 
ATOM   817  O O   . PRO A 1 106 ? -1.654  81.962 33.738 1.00 48.67  ? 106  PRO A O   1 
ATOM   818  C CB  . PRO A 1 106 ? 1.007   82.066 35.683 1.00 36.32  ? 106  PRO A CB  1 
ATOM   819  C CG  . PRO A 1 106 ? 0.678   82.501 37.091 1.00 36.32  ? 106  PRO A CG  1 
ATOM   820  C CD  . PRO A 1 106 ? -0.760  82.896 37.008 1.00 36.32  ? 106  PRO A CD  1 
ATOM   821  N N   . LYS A 1 107 ? 0.274   82.009 32.588 1.00 60.23  ? 107  LYS A N   1 
ATOM   822  C CA  . LYS A 1 107 ? -0.293  81.268 31.473 1.00 60.23  ? 107  LYS A CA  1 
ATOM   823  C C   . LYS A 1 107 ? 0.024   79.790 31.682 1.00 60.23  ? 107  LYS A C   1 
ATOM   824  O O   . LYS A 1 107 ? -0.839  78.932 31.501 1.00 60.23  ? 107  LYS A O   1 
ATOM   825  C CB  . LYS A 1 107 ? 0.288   81.750 30.146 1.00 53.76  ? 107  LYS A CB  1 
ATOM   826  C CG  . LYS A 1 107 ? 0.029   83.213 29.864 1.00 53.76  ? 107  LYS A CG  1 
ATOM   827  C CD  . LYS A 1 107 ? -1.439  83.545 30.054 1.00 53.76  ? 107  LYS A CD  1 
ATOM   828  C CE  . LYS A 1 107 ? -1.724  85.008 29.738 1.00 53.76  ? 107  LYS A CE  1 
ATOM   829  N NZ  . LYS A 1 107 ? -3.156  85.339 30.003 1.00 53.76  ? 107  LYS A NZ  1 
ATOM   830  N N   . SER A 1 108 ? 1.257   79.490 32.080 1.00 52.75  ? 108  SER A N   1 
ATOM   831  C CA  . SER A 1 108 ? 1.648   78.106 32.318 1.00 52.75  ? 108  SER A CA  1 
ATOM   832  C C   . SER A 1 108 ? 2.881   78.061 33.220 1.00 52.75  ? 108  SER A C   1 
ATOM   833  O O   . SER A 1 108 ? 3.980   77.731 32.784 1.00 52.75  ? 108  SER A O   1 
ATOM   834  C CB  . SER A 1 108 ? 1.940   77.417 30.986 1.00 56.23  ? 108  SER A CB  1 
ATOM   835  O OG  . SER A 1 108 ? 2.011   76.013 31.156 1.00 56.23  ? 108  SER A OG  1 
ATOM   836  N N   . THR A 1 109 ? 2.693   78.389 34.487 1.00 36.70  ? 109  THR A N   1 
ATOM   837  C CA  . THR A 1 109 ? 3.805   78.411 35.409 1.00 36.70  ? 109  THR A CA  1 
ATOM   838  C C   . THR A 1 109 ? 3.929   77.120 36.224 1.00 36.70  ? 109  THR A C   1 
ATOM   839  O O   . THR A 1 109 ? 3.061   76.257 36.170 1.00 36.70  ? 109  THR A O   1 
ATOM   840  C CB  . THR A 1 109 ? 3.676   79.630 36.351 1.00 47.06  ? 109  THR A CB  1 
ATOM   841  O OG1 . THR A 1 109 ? 4.898   79.804 37.073 1.00 47.06  ? 109  THR A OG1 1 
ATOM   842  C CG2 . THR A 1 109 ? 2.534   79.436 37.345 1.00 47.06  ? 109  THR A CG2 1 
ATOM   843  N N   . THR A 1 110 ? 5.019   76.997 36.977 1.00 42.92  ? 110  THR A N   1 
ATOM   844  C CA  . THR A 1 110 ? 5.280   75.825 37.816 1.00 42.92  ? 110  THR A CA  1 
ATOM   845  C C   . THR A 1 110 ? 4.305   75.654 38.980 1.00 42.92  ? 110  THR A C   1 
ATOM   846  O O   . THR A 1 110 ? 3.955   76.621 39.649 1.00 42.92  ? 110  THR A O   1 
ATOM   847  C CB  . THR A 1 110 ? 6.679   75.893 38.415 1.00 52.21  ? 110  THR A CB  1 
ATOM   848  O OG1 . THR A 1 110 ? 7.645   75.921 37.359 1.00 52.21  ? 110  THR A OG1 1 
ATOM   849  C CG2 . THR A 1 110 ? 6.928   74.697 39.311 1.00 52.21  ? 110  THR A CG2 1 
ATOM   850  N N   . VAL A 1 111 ? 3.901   74.412 39.235 1.00 38.18  ? 111  VAL A N   1 
ATOM   851  C CA  . VAL A 1 111 ? 2.968   74.098 40.315 1.00 38.18  ? 111  VAL A CA  1 
ATOM   852  C C   . VAL A 1 111 ? 3.636   73.367 41.486 1.00 38.18  ? 111  VAL A C   1 
ATOM   853  O O   . VAL A 1 111 ? 4.505   72.528 41.288 1.00 38.18  ? 111  VAL A O   1 
ATOM   854  C CB  . VAL A 1 111 ? 1.817   73.214 39.788 1.00 34.54  ? 111  VAL A CB  1 
ATOM   855  C CG1 . VAL A 1 111 ? 0.826   72.900 40.902 1.00 34.54  ? 111  VAL A CG1 1 
ATOM   856  C CG2 . VAL A 1 111 ? 1.133   73.907 38.640 1.00 34.54  ? 111  VAL A CG2 1 
ATOM   857  N N   . MET A 1 112 ? 3.226   73.693 42.706 1.00 35.49  ? 112  MET A N   1 
ATOM   858  C CA  . MET A 1 112 ? 3.757   73.037 43.891 1.00 35.49  ? 112  MET A CA  1 
ATOM   859  C C   . MET A 1 112 ? 2.604   72.591 44.768 1.00 35.49  ? 112  MET A C   1 
ATOM   860  O O   . MET A 1 112 ? 1.797   73.407 45.198 1.00 35.49  ? 112  MET A O   1 
ATOM   861  C CB  . MET A 1 112 ? 4.671   73.975 44.672 1.00 40.36  ? 112  MET A CB  1 
ATOM   862  C CG  . MET A 1 112 ? 5.960   74.265 43.945 1.00 40.36  ? 112  MET A CG  1 
ATOM   863  S SD  . MET A 1 112 ? 7.166   75.153 44.928 1.00 40.36  ? 112  MET A SD  1 
ATOM   864  C CE  . MET A 1 112 ? 7.897   73.841 45.855 1.00 40.36  ? 112  MET A CE  1 
ATOM   865  N N   . VAL A 1 113 ? 2.516   71.289 45.015 1.00 34.31  ? 113  VAL A N   1 
ATOM   866  C CA  . VAL A 1 113 ? 1.454   70.748 45.847 1.00 34.31  ? 113  VAL A CA  1 
ATOM   867  C C   . VAL A 1 113 ? 2.021   70.329 47.201 1.00 34.31  ? 113  VAL A C   1 
ATOM   868  O O   . VAL A 1 113 ? 2.900   69.481 47.272 1.00 34.31  ? 113  VAL A O   1 
ATOM   869  C CB  . VAL A 1 113 ? 0.782   69.539 45.160 1.00 24.39  ? 113  VAL A CB  1 
ATOM   870  C CG1 . VAL A 1 113 ? -0.334  68.992 46.032 1.00 24.39  ? 113  VAL A CG1 1 
ATOM   871  C CG2 . VAL A 1 113 ? 0.244   69.952 43.810 1.00 24.39  ? 113  VAL A CG2 1 
ATOM   872  N N   . TRP A 1 114 ? 1.503   70.931 48.269 1.00 36.75  ? 114  TRP A N   1 
ATOM   873  C CA  . TRP A 1 114 ? 1.952   70.657 49.636 1.00 36.75  ? 114  TRP A CA  1 
ATOM   874  C C   . TRP A 1 114 ? 1.067   69.681 50.404 1.00 36.75  ? 114  TRP A C   1 
ATOM   875  O O   . TRP A 1 114 ? -0.152  69.839 50.443 1.00 36.75  ? 114  TRP A O   1 
ATOM   876  C CB  . TRP A 1 114 ? 2.056   71.982 50.407 1.00 32.24  ? 114  TRP A CB  1 
ATOM   877  C CG  . TRP A 1 114 ? 2.155   71.874 51.905 1.00 32.24  ? 114  TRP A CG  1 
ATOM   878  C CD1 . TRP A 1 114 ? 1.139   72.026 52.813 1.00 32.24  ? 114  TRP A CD1 1 
ATOM   879  C CD2 . TRP A 1 114 ? 3.334   71.601 52.671 1.00 32.24  ? 114  TRP A CD2 1 
ATOM   880  N NE1 . TRP A 1 114 ? 1.614   71.864 54.094 1.00 32.24  ? 114  TRP A NE1 1 
ATOM   881  C CE2 . TRP A 1 114 ? 2.958   71.601 54.036 1.00 32.24  ? 114  TRP A CE2 1 
ATOM   882  C CE3 . TRP A 1 114 ? 4.673   71.355 52.341 1.00 32.24  ? 114  TRP A CE3 1 
ATOM   883  C CZ2 . TRP A 1 114 ? 3.877   71.364 55.063 1.00 32.24  ? 114  TRP A CZ2 1 
ATOM   884  C CZ3 . TRP A 1 114 ? 5.583   71.121 53.361 1.00 32.24  ? 114  TRP A CZ3 1 
ATOM   885  C CH2 . TRP A 1 114 ? 5.181   71.127 54.705 1.00 32.24  ? 114  TRP A CH2 1 
ATOM   886  N N   . ILE A 1 115 ? 1.690   68.670 51.007 1.00 34.47  ? 115  ILE A N   1 
ATOM   887  C CA  . ILE A 1 115 ? 0.981   67.673 51.808 1.00 34.47  ? 115  ILE A CA  1 
ATOM   888  C C   . ILE A 1 115 ? 1.434   67.808 53.268 1.00 34.47  ? 115  ILE A C   1 
ATOM   889  O O   . ILE A 1 115 ? 2.586   67.510 53.599 1.00 34.47  ? 115  ILE A O   1 
ATOM   890  C CB  . ILE A 1 115 ? 1.283   66.250 51.321 1.00 32.95  ? 115  ILE A CB  1 
ATOM   891  C CG1 . ILE A 1 115 ? 1.019   66.148 49.815 1.00 32.95  ? 115  ILE A CG1 1 
ATOM   892  C CG2 . ILE A 1 115 ? 0.411   65.263 52.068 1.00 32.95  ? 115  ILE A CG2 1 
ATOM   893  C CD1 . ILE A 1 115 ? 1.266   64.774 49.205 1.00 32.95  ? 115  ILE A CD1 1 
ATOM   894  N N   . TYR A 1 116 ? 0.531   68.260 54.140 1.00 35.72  ? 116  TYR A N   1 
ATOM   895  C CA  . TYR A 1 116 ? 0.876   68.458 55.544 1.00 35.72  ? 116  TYR A CA  1 
ATOM   896  C C   . TYR A 1 116 ? 1.200   67.175 56.274 1.00 35.72  ? 116  TYR A C   1 
ATOM   897  O O   . TYR A 1 116 ? 0.756   66.092 55.887 1.00 35.72  ? 116  TYR A O   1 
ATOM   898  C CB  . TYR A 1 116 ? -0.234  69.221 56.293 1.00 32.16  ? 116  TYR A CB  1 
ATOM   899  C CG  . TYR A 1 116 ? -1.590  68.542 56.350 1.00 32.16  ? 116  TYR A CG  1 
ATOM   900  C CD1 . TYR A 1 116 ? -1.801  67.398 57.129 1.00 32.16  ? 116  TYR A CD1 1 
ATOM   901  C CD2 . TYR A 1 116 ? -2.662  69.036 55.612 1.00 32.16  ? 116  TYR A CD2 1 
ATOM   902  C CE1 . TYR A 1 116 ? -3.049  66.764 57.162 1.00 32.16  ? 116  TYR A CE1 1 
ATOM   903  C CE2 . TYR A 1 116 ? -3.904  68.416 55.639 1.00 32.16  ? 116  TYR A CE2 1 
ATOM   904  C CZ  . TYR A 1 116 ? -4.093  67.283 56.411 1.00 32.16  ? 116  TYR A CZ  1 
ATOM   905  O OH  . TYR A 1 116 ? -5.327  66.675 56.419 1.00 32.16  ? 116  TYR A OH  1 
ATOM   906  N N   . GLY A 1 117 ? 1.997   67.313 57.330 1.00 45.94  ? 117  GLY A N   1 
ATOM   907  C CA  . GLY A 1 117 ? 2.385   66.174 58.138 1.00 45.94  ? 117  GLY A CA  1 
ATOM   908  C C   . GLY A 1 117 ? 1.564   66.159 59.410 1.00 45.94  ? 117  GLY A C   1 
ATOM   909  O O   . GLY A 1 117 ? 0.655   66.972 59.561 1.00 45.94  ? 117  GLY A O   1 
ATOM   910  N N   . GLY A 1 118 ? 1.877   65.247 60.327 1.00 37.54  ? 118  GLY A N   1 
ATOM   911  C CA  . GLY A 1 118 ? 1.123   65.167 61.565 1.00 37.54  ? 118  GLY A CA  1 
ATOM   912  C C   . GLY A 1 118 ? 0.970   63.751 62.078 1.00 37.54  ? 118  GLY A C   1 
ATOM   913  O O   . GLY A 1 118 ? 0.008   63.445 62.768 1.00 37.54  ? 118  GLY A O   1 
ATOM   914  N N   . GLY A 1 119 ? 1.920   62.885 61.741 1.00 36.53  ? 119  GLY A N   1 
ATOM   915  C CA  . GLY A 1 119 ? 1.860   61.508 62.194 1.00 36.53  ? 119  GLY A CA  1 
ATOM   916  C C   . GLY A 1 119 ? 0.675   60.740 61.654 1.00 36.53  ? 119  GLY A C   1 
ATOM   917  O O   . GLY A 1 119 ? 0.290   59.720 62.210 1.00 36.53  ? 119  GLY A O   1 
ATOM   918  N N   . PHE A 1 120 ? 0.090   61.224 60.567 1.00 39.86  ? 120  PHE A N   1 
ATOM   919  C CA  . PHE A 1 120 ? -1.058  60.558 59.971 1.00 39.86  ? 120  PHE A CA  1 
ATOM   920  C C   . PHE A 1 120 ? -2.260  60.563 60.915 1.00 39.86  ? 120  PHE A C   1 
ATOM   921  O O   . PHE A 1 120 ? -3.270  59.919 60.631 1.00 39.86  ? 120  PHE A O   1 
ATOM   922  C CB  . PHE A 1 120 ? -0.714  59.105 59.602 1.00 23.89  ? 120  PHE A CB  1 
ATOM   923  C CG  . PHE A 1 120 ? 0.229   58.971 58.443 1.00 23.89  ? 120  PHE A CG  1 
ATOM   924  C CD1 . PHE A 1 120 ? -0.121  59.440 57.186 1.00 23.89  ? 120  PHE A CD1 1 
ATOM   925  C CD2 . PHE A 1 120 ? 1.469   58.363 58.605 1.00 23.89  ? 120  PHE A CD2 1 
ATOM   926  C CE1 . PHE A 1 120 ? 0.747   59.305 56.115 1.00 23.89  ? 120  PHE A CE1 1 
ATOM   927  C CE2 . PHE A 1 120 ? 2.347   58.225 57.529 1.00 23.89  ? 120  PHE A CE2 1 
ATOM   928  C CZ  . PHE A 1 120 ? 1.982   58.697 56.287 1.00 23.89  ? 120  PHE A CZ  1 
ATOM   929  N N   . TYR A 1 121 ? -2.162  61.274 62.035 1.00 36.87  ? 121  TYR A N   1 
ATOM   930  C CA  . TYR A 1 121 ? -3.283  61.323 62.970 1.00 36.87  ? 121  TYR A CA  1 
ATOM   931  C C   . TYR A 1 121 ? -3.786  62.741 63.198 1.00 36.87  ? 121  TYR A C   1 
ATOM   932  O O   . TYR A 1 121 ? -4.716  62.962 63.973 1.00 36.87  ? 121  TYR A O   1 
ATOM   933  C CB  . TYR A 1 121 ? -2.896  60.700 64.317 1.00 36.09  ? 121  TYR A CB  1 
ATOM   934  C CG  . TYR A 1 121 ? -1.969  61.542 65.159 1.00 36.09  ? 121  TYR A CG  1 
ATOM   935  C CD1 . TYR A 1 121 ? -2.452  62.605 65.923 1.00 36.09  ? 121  TYR A CD1 1 
ATOM   936  C CD2 . TYR A 1 121 ? -0.603  61.280 65.182 1.00 36.09  ? 121  TYR A CD2 1 
ATOM   937  C CE1 . TYR A 1 121 ? -1.595  63.386 66.691 1.00 36.09  ? 121  TYR A CE1 1 
ATOM   938  C CE2 . TYR A 1 121 ? 0.266   62.050 65.942 1.00 36.09  ? 121  TYR A CE2 1 
ATOM   939  C CZ  . TYR A 1 121 ? -0.232  63.102 66.696 1.00 36.09  ? 121  TYR A CZ  1 
ATOM   940  O OH  . TYR A 1 121 ? 0.647   63.856 67.446 1.00 36.09  ? 121  TYR A OH  1 
ATOM   941  N N   . SER A 1 122 ? -3.176  63.700 62.519 1.00 26.26  ? 122  SER A N   1 
ATOM   942  C CA  . SER A 1 122 ? -3.563  65.083 62.685 1.00 26.26  ? 122  SER A CA  1 
ATOM   943  C C   . SER A 1 122 ? -3.020  65.897 61.550 1.00 26.26  ? 122  SER A C   1 
ATOM   944  O O   . SER A 1 122 ? -2.249  65.398 60.747 1.00 26.26  ? 122  SER A O   1 
ATOM   945  C CB  . SER A 1 122 ? -2.996  65.614 63.981 1.00 36.97  ? 122  SER A CB  1 
ATOM   946  O OG  . SER A 1 122 ? -1.600  65.406 64.001 1.00 36.97  ? 122  SER A OG  1 
ATOM   947  N N   . GLY A 1 123 ? -3.424  67.158 61.499 1.00 38.12  ? 123  GLY A N   1 
ATOM   948  C CA  . GLY A 1 123 ? -2.962  68.037 60.444 1.00 38.12  ? 123  GLY A CA  1 
ATOM   949  C C   . GLY A 1 123 ? -4.077  68.752 59.704 1.00 38.12  ? 123  GLY A C   1 
ATOM   950  O O   . GLY A 1 123 ? -5.148  68.198 59.472 1.00 38.12  ? 123  GLY A O   1 
ATOM   951  N N   . SER A 1 124 ? -3.823  69.993 59.325 1.00 35.03  ? 124  SER A N   1 
ATOM   952  C CA  . SER A 1 124 ? -4.810  70.776 58.614 1.00 35.03  ? 124  SER A CA  1 
ATOM   953  C C   . SER A 1 124 ? -4.054  71.535 57.551 1.00 35.03  ? 124  SER A C   1 
ATOM   954  O O   . SER A 1 124 ? -2.875  71.801 57.719 1.00 35.03  ? 124  SER A O   1 
ATOM   955  C CB  . SER A 1 124 ? -5.482  71.753 59.574 1.00 51.04  ? 124  SER A CB  1 
ATOM   956  O OG  . SER A 1 124 ? -5.994  71.078 60.716 1.00 51.04  ? 124  SER A OG  1 
ATOM   957  N N   . SER A 1 125 ? -4.712  71.878 56.450 1.00 51.99  ? 125  SER A N   1 
ATOM   958  C CA  . SER A 1 125 ? -4.047  72.622 55.382 1.00 51.99  ? 125  SER A CA  1 
ATOM   959  C C   . SER A 1 125 ? -4.199  74.114 55.645 1.00 51.99  ? 125  SER A C   1 
ATOM   960  O O   . SER A 1 125 ? -3.548  74.950 55.012 1.00 51.99  ? 125  SER A O   1 
ATOM   961  C CB  . SER A 1 125 ? -4.700  72.302 54.045 1.00 44.23  ? 125  SER A CB  1 
ATOM   962  O OG  . SER A 1 125 ? -6.029  72.793 54.013 1.00 44.23  ? 125  SER A OG  1 
ATOM   963  N N   . THR A 1 126 ? -5.057  74.429 56.605 1.00 45.04  ? 126  THR A N   1 
ATOM   964  C CA  . THR A 1 126 ? -5.385  75.795 56.945 1.00 45.04  ? 126  THR A CA  1 
ATOM   965  C C   . THR A 1 126 ? -4.596  76.466 58.067 1.00 45.04  ? 126  THR A C   1 
ATOM   966  O O   . THR A 1 126 ? -4.966  77.553 58.507 1.00 45.04  ? 126  THR A O   1 
ATOM   967  C CB  . THR A 1 126 ? -6.872  75.858 57.273 1.00 35.34  ? 126  THR A CB  1 
ATOM   968  O OG1 . THR A 1 126 ? -7.152  74.986 58.377 1.00 35.34  ? 126  THR A OG1 1 
ATOM   969  C CG2 . THR A 1 126 ? -7.680  75.392 56.081 1.00 35.34  ? 126  THR A CG2 1 
ATOM   970  N N   . LEU A 1 127 ? -3.518  75.846 58.539 1.00 40.59  ? 127  LEU A N   1 
ATOM   971  C CA  . LEU A 1 127 ? -2.732  76.461 59.612 1.00 40.59  ? 127  LEU A CA  1 
ATOM   972  C C   . LEU A 1 127 ? -2.066  77.714 59.075 1.00 40.59  ? 127  LEU A C   1 
ATOM   973  O O   . LEU A 1 127 ? -1.946  77.887 57.862 1.00 40.59  ? 127  LEU A O   1 
ATOM   974  C CB  . LEU A 1 127 ? -1.639  75.523 60.109 1.00 38.66  ? 127  LEU A CB  1 
ATOM   975  C CG  . LEU A 1 127 ? -2.037  74.122 60.555 1.00 38.66  ? 127  LEU A CG  1 
ATOM   976  C CD1 . LEU A 1 127 ? -0.813  73.393 61.084 1.00 38.66  ? 127  LEU A CD1 1 
ATOM   977  C CD2 . LEU A 1 127 ? -3.114  74.220 61.616 1.00 38.66  ? 127  LEU A CD2 1 
ATOM   978  N N   . ASP A 1 128 ? -1.617  78.582 59.975 1.00 46.99  ? 128  ASP A N   1 
ATOM   979  C CA  . ASP A 1 128 ? -0.954  79.814 59.565 1.00 46.99  ? 128  ASP A CA  1 
ATOM   980  C C   . ASP A 1 128 ? 0.390   79.538 58.891 1.00 46.99  ? 128  ASP A C   1 
ATOM   981  O O   . ASP A 1 128 ? 0.709   80.135 57.864 1.00 46.99  ? 128  ASP A O   1 
ATOM   982  C CB  . ASP A 1 128 ? -0.755  80.743 60.770 1.00 75.04  ? 128  ASP A CB  1 
ATOM   983  C CG  . ASP A 1 128 ? -2.086  81.222 61.376 1.00 75.04  ? 128  ASP A CG  1 
ATOM   984  O OD1 . ASP A 1 128 ? -3.073  81.353 60.604 1.00 75.04  ? 128  ASP A OD1 1 
ATOM   985  O OD2 . ASP A 1 128 ? -2.143  81.484 62.611 1.00 75.04  ? 128  ASP A OD2 1 
ATOM   986  N N   . VAL A 1 129 ? 1.177   78.632 59.462 1.00 46.14  ? 129  VAL A N   1 
ATOM   987  C CA  . VAL A 1 129 ? 2.479   78.296 58.895 1.00 46.14  ? 129  VAL A CA  1 
ATOM   988  C C   . VAL A 1 129 ? 2.415   77.707 57.497 1.00 46.14  ? 129  VAL A C   1 
ATOM   989  O O   . VAL A 1 129 ? 3.450   77.596 56.840 1.00 46.14  ? 129  VAL A O   1 
ATOM   990  C CB  . VAL A 1 129 ? 3.243   77.286 59.767 1.00 36.28  ? 129  VAL A CB  1 
ATOM   991  C CG1 . VAL A 1 129 ? 4.087   78.012 60.767 1.00 36.28  ? 129  VAL A CG1 1 
ATOM   992  C CG2 . VAL A 1 129 ? 2.265   76.362 60.473 1.00 36.28  ? 129  VAL A CG2 1 
ATOM   993  N N   . TYR A 1 130 ? 1.224   77.316 57.043 1.00 43.31  ? 130  TYR A N   1 
ATOM   994  C CA  . TYR A 1 130 ? 1.079   76.720 55.713 1.00 43.31  ? 130  TYR A CA  1 
ATOM   995  C C   . TYR A 1 130 ? 0.451   77.671 54.705 1.00 43.31  ? 130  TYR A C   1 
ATOM   996  O O   . TYR A 1 130 ? -0.072  77.232 53.685 1.00 43.31  ? 130  TYR A O   1 
ATOM   997  C CB  . TYR A 1 130 ? 0.228   75.439 55.766 1.00 37.41  ? 130  TYR A CB  1 
ATOM   998  C CG  . TYR A 1 130 ? 0.758   74.321 56.646 1.00 37.41  ? 130  TYR A CG  1 
ATOM   999  C CD1 . TYR A 1 130 ? 2.123   74.150 56.867 1.00 37.41  ? 130  TYR A CD1 1 
ATOM   1000 C CD2 . TYR A 1 130 ? -0.114  73.419 57.243 1.00 37.41  ? 130  TYR A CD2 1 
ATOM   1001 C CE1 . TYR A 1 130 ? 2.603   73.111 57.665 1.00 37.41  ? 130  TYR A CE1 1 
ATOM   1002 C CE2 . TYR A 1 130 ? 0.350   72.376 58.037 1.00 37.41  ? 130  TYR A CE2 1 
ATOM   1003 C CZ  . TYR A 1 130 ? 1.706   72.225 58.248 1.00 37.41  ? 130  TYR A CZ  1 
ATOM   1004 O OH  . TYR A 1 130 ? 2.153   71.192 59.050 1.00 37.41  ? 130  TYR A OH  1 
ATOM   1005 N N   . ASN A 1 131 ? 0.498   78.970 54.989 1.00 54.23  ? 131  ASN A N   1 
ATOM   1006 C CA  . ASN A 1 131 ? -0.091  79.972 54.102 1.00 54.23  ? 131  ASN A CA  1 
ATOM   1007 C C   . ASN A 1 131 ? 0.737   80.111 52.832 1.00 54.23  ? 131  ASN A C   1 
ATOM   1008 O O   . ASN A 1 131 ? 1.829   80.683 52.843 1.00 54.23  ? 131  ASN A O   1 
ATOM   1009 C CB  . ASN A 1 131 ? -0.171  81.319 54.808 1.00 57.08  ? 131  ASN A CB  1 
ATOM   1010 C CG  . ASN A 1 131 ? -1.151  82.262 54.142 1.00 57.08  ? 131  ASN A CG  1 
ATOM   1011 O OD1 . ASN A 1 131 ? -1.380  82.188 52.924 1.00 57.08  ? 131  ASN A OD1 1 
ATOM   1012 N ND2 . ASN A 1 131 ? -1.734  83.166 54.932 1.00 57.08  ? 131  ASN A ND2 1 
ATOM   1013 N N   . GLY A 1 132 ? 0.197   79.611 51.729 1.00 48.75  ? 132  GLY A N   1 
ATOM   1014 C CA  . GLY A 1 132 ? 0.924   79.645 50.475 1.00 48.75  ? 132  GLY A CA  1 
ATOM   1015 C C   . GLY A 1 132 ? 1.158   80.978 49.796 1.00 48.75  ? 132  GLY A C   1 
ATOM   1016 O O   . GLY A 1 132 ? 2.011   81.069 48.913 1.00 48.75  ? 132  GLY A O   1 
ATOM   1017 N N   . LYS A 1 133 ? 0.430   82.014 50.198 1.00 56.91  ? 133  LYS A N   1 
ATOM   1018 C CA  . LYS A 1 133 ? 0.584   83.316 49.556 1.00 56.91  ? 133  LYS A CA  1 
ATOM   1019 C C   . LYS A 1 133 ? 2.009   83.884 49.518 1.00 56.91  ? 133  LYS A C   1 
ATOM   1020 O O   . LYS A 1 133 ? 2.421   84.407 48.479 1.00 56.91  ? 133  LYS A O   1 
ATOM   1021 C CB  . LYS A 1 133 ? -0.367  84.336 50.184 1.00 49.27  ? 133  LYS A CB  1 
ATOM   1022 C CG  . LYS A 1 133 ? 0.034   84.811 51.554 1.00 49.27  ? 133  LYS A CG  1 
ATOM   1023 C CD  . LYS A 1 133 ? -1.006  85.775 52.070 1.00 49.27  ? 133  LYS A CD  1 
ATOM   1024 C CE  . LYS A 1 133 ? -0.552  86.475 53.332 1.00 49.27  ? 133  LYS A CE  1 
ATOM   1025 N NZ  . LYS A 1 133 ? -1.550  87.498 53.772 1.00 49.27  ? 133  LYS A NZ  1 
ATOM   1026 N N   . TYR A 1 134 ? 2.767   83.787 50.613 1.00 39.32  ? 134  TYR A N   1 
ATOM   1027 C CA  . TYR A 1 134 ? 4.128   84.327 50.615 1.00 39.32  ? 134  TYR A CA  1 
ATOM   1028 C C   . TYR A 1 134 ? 4.999   83.650 49.578 1.00 39.32  ? 134  TYR A C   1 
ATOM   1029 O O   . TYR A 1 134 ? 5.734   84.308 48.850 1.00 39.32  ? 134  TYR A O   1 
ATOM   1030 C CB  . TYR A 1 134 ? 4.802   84.155 51.974 1.00 43.05  ? 134  TYR A CB  1 
ATOM   1031 C CG  . TYR A 1 134 ? 4.076   84.803 53.110 1.00 43.05  ? 134  TYR A CG  1 
ATOM   1032 C CD1 . TYR A 1 134 ? 3.934   86.188 53.173 1.00 43.05  ? 134  TYR A CD1 1 
ATOM   1033 C CD2 . TYR A 1 134 ? 3.497   84.028 54.111 1.00 43.05  ? 134  TYR A CD2 1 
ATOM   1034 C CE1 . TYR A 1 134 ? 3.225   86.788 54.209 1.00 43.05  ? 134  TYR A CE1 1 
ATOM   1035 C CE2 . TYR A 1 134 ? 2.782   84.614 55.150 1.00 43.05  ? 134  TYR A CE2 1 
ATOM   1036 C CZ  . TYR A 1 134 ? 2.649   85.994 55.194 1.00 43.05  ? 134  TYR A CZ  1 
ATOM   1037 O OH  . TYR A 1 134 ? 1.930   86.567 56.213 1.00 43.05  ? 134  TYR A OH  1 
ATOM   1038 N N   . LEU A 1 135 ? 4.925   82.326 49.522 1.00 43.87  ? 135  LEU A N   1 
ATOM   1039 C CA  . LEU A 1 135 ? 5.738   81.564 48.582 1.00 43.87  ? 135  LEU A CA  1 
ATOM   1040 C C   . LEU A 1 135 ? 5.263   81.757 47.141 1.00 43.87  ? 135  LEU A C   1 
ATOM   1041 O O   . LEU A 1 135 ? 6.073   81.968 46.236 1.00 43.87  ? 135  LEU A O   1 
ATOM   1042 C CB  . LEU A 1 135 ? 5.720   80.078 48.973 1.00 43.24  ? 135  LEU A CB  1 
ATOM   1043 C CG  . LEU A 1 135 ? 6.552   79.071 48.175 1.00 43.24  ? 135  LEU A CG  1 
ATOM   1044 C CD1 . LEU A 1 135 ? 8.012   79.490 48.159 1.00 43.24  ? 135  LEU A CD1 1 
ATOM   1045 C CD2 . LEU A 1 135 ? 6.395   77.692 48.793 1.00 43.24  ? 135  LEU A CD2 1 
ATOM   1046 N N   . ALA A 1 136 ? 3.950   81.695 46.927 1.00 51.31  ? 136  ALA A N   1 
ATOM   1047 C CA  . ALA A 1 136 ? 3.389   81.869 45.588 1.00 51.31  ? 136  ALA A CA  1 
ATOM   1048 C C   . ALA A 1 136 ? 3.856   83.218 45.071 1.00 51.31  ? 136  ALA A C   1 
ATOM   1049 O O   . ALA A 1 136 ? 4.417   83.333 43.980 1.00 51.31  ? 136  ALA A O   1 
ATOM   1050 C CB  . ALA A 1 136 ? 1.865   81.824 45.641 1.00 23.18  ? 136  ALA A CB  1 
ATOM   1051 N N   . TYR A 1 137 ? 3.637   84.239 45.887 1.00 54.64  ? 137  TYR A N   1 
ATOM   1052 C CA  . TYR A 1 137 ? 4.021   85.591 45.539 1.00 54.64  ? 137  TYR A CA  1 
ATOM   1053 C C   . TYR A 1 137 ? 5.512   85.737 45.252 1.00 54.64  ? 137  TYR A C   1 
ATOM   1054 O O   . TYR A 1 137 ? 5.894   86.098 44.145 1.00 54.64  ? 137  TYR A O   1 
ATOM   1055 C CB  . TYR A 1 137 ? 3.633   86.533 46.664 1.00 53.98  ? 137  TYR A CB  1 
ATOM   1056 C CG  . TYR A 1 137 ? 4.038   87.947 46.397 1.00 53.98  ? 137  TYR A CG  1 
ATOM   1057 C CD1 . TYR A 1 137 ? 3.372   88.711 45.438 1.00 53.98  ? 137  TYR A CD1 1 
ATOM   1058 C CD2 . TYR A 1 137 ? 5.109   88.523 47.082 1.00 53.98  ? 137  TYR A CD2 1 
ATOM   1059 C CE1 . TYR A 1 137 ? 3.766   90.030 45.163 1.00 53.98  ? 137  TYR A CE1 1 
ATOM   1060 C CE2 . TYR A 1 137 ? 5.518   89.835 46.820 1.00 53.98  ? 137  TYR A CE2 1 
ATOM   1061 C CZ  . TYR A 1 137 ? 4.844   90.584 45.859 1.00 53.98  ? 137  TYR A CZ  1 
ATOM   1062 O OH  . TYR A 1 137 ? 5.257   91.870 45.581 1.00 53.98  ? 137  TYR A OH  1 
ATOM   1063 N N   . THR A 1 138 ? 6.350   85.439 46.243 1.00 44.21  ? 138  THR A N   1 
ATOM   1064 C CA  . THR A 1 138 ? 7.798   85.587 46.105 1.00 44.21  ? 138  THR A CA  1 
ATOM   1065 C C   . THR A 1 138 ? 8.484   84.796 45.002 1.00 44.21  ? 138  THR A C   1 
ATOM   1066 O O   . THR A 1 138 ? 9.448   85.279 44.411 1.00 44.21  ? 138  THR A O   1 
ATOM   1067 C CB  . THR A 1 138 ? 8.519   85.271 47.432 1.00 42.68  ? 138  THR A CB  1 
ATOM   1068 O OG1 . THR A 1 138 ? 8.046   86.159 48.452 1.00 42.68  ? 138  THR A OG1 1 
ATOM   1069 C CG2 . THR A 1 138 ? 10.021  85.458 47.283 1.00 42.68  ? 138  THR A CG2 1 
ATOM   1070 N N   . GLU A 1 139 ? 8.008   83.588 44.716 1.00 56.43  ? 139  GLU A N   1 
ATOM   1071 C CA  . GLU A 1 139 ? 8.638   82.775 43.678 1.00 56.43  ? 139  GLU A CA  1 
ATOM   1072 C C   . GLU A 1 139 ? 7.825   82.670 42.388 1.00 56.43  ? 139  GLU A C   1 
ATOM   1073 O O   . GLU A 1 139 ? 8.282   82.082 41.403 1.00 56.43  ? 139  GLU A O   1 
ATOM   1074 C CB  . GLU A 1 139 ? 8.937   81.378 44.216 1.00 59.75  ? 139  GLU A CB  1 
ATOM   1075 C CG  . GLU A 1 139 ? 10.057  81.338 45.249 1.00 59.75  ? 139  GLU A CG  1 
ATOM   1076 C CD  . GLU A 1 139 ? 11.386  81.894 44.717 1.00 59.75  ? 139  GLU A CD  1 
ATOM   1077 O OE1 . GLU A 1 139 ? 11.784  81.542 43.573 1.00 59.75  ? 139  GLU A OE1 1 
ATOM   1078 O OE2 . GLU A 1 139 ? 12.042  82.675 45.450 1.00 59.75  ? 139  GLU A OE2 1 
ATOM   1079 N N   . GLU A 1 140 ? 6.624   83.246 42.395 1.00 53.59  ? 140  GLU A N   1 
ATOM   1080 C CA  . GLU A 1 140 ? 5.753   83.229 41.222 1.00 53.59  ? 140  GLU A CA  1 
ATOM   1081 C C   . GLU A 1 140 ? 5.406   81.808 40.793 1.00 53.59  ? 140  GLU A C   1 
ATOM   1082 O O   . GLU A 1 140 ? 5.669   81.414 39.657 1.00 53.59  ? 140  GLU A O   1 
ATOM   1083 C CB  . GLU A 1 140 ? 6.427   83.946 40.051 1.00 99.91  ? 140  GLU A CB  1 
ATOM   1084 C CG  . GLU A 1 140 ? 6.958   85.326 40.389 1.00 99.91  ? 140  GLU A CG  1 
ATOM   1085 C CD  . GLU A 1 140 ? 7.820   85.908 39.270 1.00 99.91  ? 140  GLU A CD  1 
ATOM   1086 O OE1 . GLU A 1 140 ? 7.263   86.161 38.174 1.00 99.91  ? 140  GLU A OE1 1 
ATOM   1087 O OE2 . GLU A 1 140 ? 9.049   86.104 39.488 1.00 99.91  ? 140  GLU A OE2 1 
ATOM   1088 N N   . VAL A 1 141 ? 4.825   81.036 41.700 1.00 38.96  ? 141  VAL A N   1 
ATOM   1089 C CA  . VAL A 1 141 ? 4.436   79.677 41.377 1.00 38.96  ? 141  VAL A CA  1 
ATOM   1090 C C   . VAL A 1 141 ? 3.001   79.491 41.857 1.00 38.96  ? 141  VAL A C   1 
ATOM   1091 O O   . VAL A 1 141 ? 2.535   80.238 42.712 1.00 38.96  ? 141  VAL A O   1 
ATOM   1092 C CB  . VAL A 1 141 ? 5.360   78.641 42.086 1.00 40.94  ? 141  VAL A CB  1 
ATOM   1093 C CG1 . VAL A 1 141 ? 6.817   78.900 41.726 1.00 40.94  ? 141  VAL A CG1 1 
ATOM   1094 C CG2 . VAL A 1 141 ? 5.180   78.709 43.591 1.00 40.94  ? 141  VAL A CG2 1 
ATOM   1095 N N   . VAL A 1 142 ? 2.281   78.533 41.283 1.00 36.42  ? 142  VAL A N   1 
ATOM   1096 C CA  . VAL A 1 142 ? 0.926   78.261 41.741 1.00 36.42  ? 142  VAL A CA  1 
ATOM   1097 C C   . VAL A 1 142 ? 1.132   77.299 42.909 1.00 36.42  ? 142  VAL A C   1 
ATOM   1098 O O   . VAL A 1 142 ? 1.749   76.251 42.746 1.00 36.42  ? 142  VAL A O   1 
ATOM   1099 C CB  . VAL A 1 142 ? 0.074   77.586 40.658 1.00 26.19  ? 142  VAL A CB  1 
ATOM   1100 C CG1 . VAL A 1 142 ? -1.186  77.021 41.269 1.00 26.19  ? 142  VAL A CG1 1 
ATOM   1101 C CG2 . VAL A 1 142 ? -0.298  78.589 39.610 1.00 26.19  ? 142  VAL A CG2 1 
ATOM   1102 N N   . LEU A 1 143 ? 0.639   77.669 44.087 1.00 41.96  ? 143  LEU A N   1 
ATOM   1103 C CA  . LEU A 1 143 ? 0.798   76.851 45.286 1.00 41.96  ? 143  LEU A CA  1 
ATOM   1104 C C   . LEU A 1 143 ? -0.521  76.169 45.669 1.00 41.96  ? 143  LEU A C   1 
ATOM   1105 O O   . LEU A 1 143 ? -1.521  76.836 45.960 1.00 41.96  ? 143  LEU A O   1 
ATOM   1106 C CB  . LEU A 1 143 ? 1.293   77.744 46.435 1.00 46.47  ? 143  LEU A CB  1 
ATOM   1107 C CG  . LEU A 1 143 ? 2.144   77.184 47.580 1.00 46.47  ? 143  LEU A CG  1 
ATOM   1108 C CD1 . LEU A 1 143 ? 1.371   76.172 48.400 1.00 46.47  ? 143  LEU A CD1 1 
ATOM   1109 C CD2 . LEU A 1 143 ? 3.382   76.554 47.000 1.00 46.47  ? 143  LEU A CD2 1 
ATOM   1110 N N   . VAL A 1 144 ? -0.525  74.838 45.650 1.00 28.48  ? 144  VAL A N   1 
ATOM   1111 C CA  . VAL A 1 144 ? -1.720  74.085 46.009 1.00 28.48  ? 144  VAL A CA  1 
ATOM   1112 C C   . VAL A 1 144 ? -1.472  73.390 47.327 1.00 28.48  ? 144  VAL A C   1 
ATOM   1113 O O   . VAL A 1 144 ? -0.384  72.892 47.588 1.00 28.48  ? 144  VAL A O   1 
ATOM   1114 C CB  . VAL A 1 144 ? -2.079  72.993 44.971 1.00 28.12  ? 144  VAL A CB  1 
ATOM   1115 C CG1 . VAL A 1 144 ? -3.340  72.281 45.403 1.00 28.12  ? 144  VAL A CG1 1 
ATOM   1116 C CG2 . VAL A 1 144 ? -2.263  73.599 43.602 1.00 28.12  ? 144  VAL A CG2 1 
ATOM   1117 N N   . SER A 1 145 ? -2.498  73.351 48.153 1.00 34.21  ? 145  SER A N   1 
ATOM   1118 C CA  . SER A 1 145 ? -2.406  72.723 49.450 1.00 34.21  ? 145  SER A CA  1 
ATOM   1119 C C   . SER A 1 145 ? -3.632  71.825 49.603 1.00 34.21  ? 145  SER A C   1 
ATOM   1120 O O   . SER A 1 145 ? -4.759  72.302 49.648 1.00 34.21  ? 145  SER A O   1 
ATOM   1121 C CB  . SER A 1 145 ? -2.375  73.815 50.512 1.00 43.15  ? 145  SER A CB  1 
ATOM   1122 O OG  . SER A 1 145 ? -2.777  73.328 51.768 1.00 43.15  ? 145  SER A OG  1 
ATOM   1123 N N   . LEU A 1 146 ? -3.422  70.519 49.659 1.00 37.25  ? 146  LEU A N   1 
ATOM   1124 C CA  . LEU A 1 146 ? -4.547  69.606 49.783 1.00 37.25  ? 146  LEU A CA  1 
ATOM   1125 C C   . LEU A 1 146 ? -4.737  69.140 51.215 1.00 37.25  ? 146  LEU A C   1 
ATOM   1126 O O   . LEU A 1 146 ? -3.976  69.512 52.099 1.00 37.25  ? 146  LEU A O   1 
ATOM   1127 C CB  . LEU A 1 146 ? -4.338  68.399 48.867 1.00 30.33  ? 146  LEU A CB  1 
ATOM   1128 C CG  . LEU A 1 146 ? -2.985  67.700 48.982 1.00 30.33  ? 146  LEU A CG  1 
ATOM   1129 C CD1 . LEU A 1 146 ? -2.881  66.972 50.304 1.00 30.33  ? 146  LEU A CD1 1 
ATOM   1130 C CD2 . LEU A 1 146 ? -2.830  66.718 47.845 1.00 30.33  ? 146  LEU A CD2 1 
ATOM   1131 N N   . SER A 1 147 ? -5.763  68.331 51.437 1.00 43.42  ? 147  SER A N   1 
ATOM   1132 C CA  . SER A 1 147 ? -6.028  67.793 52.756 1.00 43.42  ? 147  SER A CA  1 
ATOM   1133 C C   . SER A 1 147 ? -6.453  66.341 52.582 1.00 43.42  ? 147  SER A C   1 
ATOM   1134 O O   . SER A 1 147 ? -6.900  65.943 51.504 1.00 43.42  ? 147  SER A O   1 
ATOM   1135 C CB  . SER A 1 147 ? -7.123  68.584 53.447 1.00 45.64  ? 147  SER A CB  1 
ATOM   1136 O OG  . SER A 1 147 ? -8.366  68.325 52.844 1.00 45.64  ? 147  SER A OG  1 
ATOM   1137 N N   . TYR A 1 148 ? -6.301  65.543 53.631 1.00 41.39  ? 148  TYR A N   1 
ATOM   1138 C CA  . TYR A 1 148 ? -6.646  64.133 53.551 1.00 41.39  ? 148  TYR A CA  1 
ATOM   1139 C C   . TYR A 1 148 ? -7.124  63.658 54.907 1.00 41.39  ? 148  TYR A C   1 
ATOM   1140 O O   . TYR A 1 148 ? -6.864  64.310 55.911 1.00 41.39  ? 148  TYR A O   1 
ATOM   1141 C CB  . TYR A 1 148 ? -5.425  63.319 53.109 1.00 29.51  ? 148  TYR A CB  1 
ATOM   1142 C CG  . TYR A 1 148 ? -4.200  63.478 53.986 1.00 29.51  ? 148  TYR A CG  1 
ATOM   1143 C CD1 . TYR A 1 148 ? -3.341  64.562 53.844 1.00 29.51  ? 148  TYR A CD1 1 
ATOM   1144 C CD2 . TYR A 1 148 ? -3.899  62.532 54.960 1.00 29.51  ? 148  TYR A CD2 1 
ATOM   1145 C CE1 . TYR A 1 148 ? -2.210  64.694 54.651 1.00 29.51  ? 148  TYR A CE1 1 
ATOM   1146 C CE2 . TYR A 1 148 ? -2.775  62.657 55.774 1.00 29.51  ? 148  TYR A CE2 1 
ATOM   1147 C CZ  . TYR A 1 148 ? -1.937  63.733 55.616 1.00 29.51  ? 148  TYR A CZ  1 
ATOM   1148 O OH  . TYR A 1 148 ? -0.828  63.829 56.426 1.00 29.51  ? 148  TYR A OH  1 
ATOM   1149 N N   . ARG A 1 149 ? -7.829  62.537 54.949 1.00 30.60  ? 149  ARG A N   1 
ATOM   1150 C CA  . ARG A 1 149 ? -8.312  62.040 56.220 1.00 30.60  ? 149  ARG A CA  1 
ATOM   1151 C C   . ARG A 1 149 ? -7.192  61.426 57.052 1.00 30.60  ? 149  ARG A C   1 
ATOM   1152 O O   . ARG A 1 149 ? -6.321  60.744 56.520 1.00 30.60  ? 149  ARG A O   1 
ATOM   1153 C CB  . ARG A 1 149 ? -9.413  61.019 55.991 1.00 30.63  ? 149  ARG A CB  1 
ATOM   1154 C CG  . ARG A 1 149 ? -10.681 61.619 55.476 1.00 30.63  ? 149  ARG A CG  1 
ATOM   1155 C CD  . ARG A 1 149 ? -11.645 60.547 55.071 1.00 30.63  ? 149  ARG A CD  1 
ATOM   1156 N NE  . ARG A 1 149 ? -11.293 59.951 53.790 1.00 30.63  ? 149  ARG A NE  1 
ATOM   1157 C CZ  . ARG A 1 149 ? -11.907 58.892 53.274 1.00 30.63  ? 149  ARG A CZ  1 
ATOM   1158 N NH1 . ARG A 1 149 ? -12.895 58.316 53.940 1.00 30.63  ? 149  ARG A NH1 1 
ATOM   1159 N NH2 . ARG A 1 149 ? -11.550 58.421 52.085 1.00 30.63  ? 149  ARG A NH2 1 
ATOM   1160 N N   . VAL A 1 150 ? -7.223  61.684 58.360 1.00 40.10  ? 150  VAL A N   1 
ATOM   1161 C CA  . VAL A 1 150 ? -6.222  61.165 59.293 1.00 40.10  ? 150  VAL A CA  1 
ATOM   1162 C C   . VAL A 1 150 ? -6.836  60.262 60.375 1.00 40.10  ? 150  VAL A C   1 
ATOM   1163 O O   . VAL A 1 150 ? -8.056  60.095 60.450 1.00 40.10  ? 150  VAL A O   1 
ATOM   1164 C CB  . VAL A 1 150 ? -5.451  62.317 60.005 1.00 30.67  ? 150  VAL A CB  1 
ATOM   1165 C CG1 . VAL A 1 150 ? -4.750  63.175 58.986 1.00 30.67  ? 150  VAL A CG1 1 
ATOM   1166 C CG2 . VAL A 1 150 ? -6.396  63.154 60.839 1.00 30.67  ? 150  VAL A CG2 1 
ATOM   1167 N N   . GLY A 1 151 ? -5.978  59.683 61.212 1.00 38.14  ? 151  GLY A N   1 
ATOM   1168 C CA  . GLY A 1 151 ? -6.446  58.814 62.277 1.00 38.14  ? 151  GLY A CA  1 
ATOM   1169 C C   . GLY A 1 151 ? -7.254  57.641 61.758 1.00 38.14  ? 151  GLY A C   1 
ATOM   1170 O O   . GLY A 1 151 ? -7.111  57.247 60.607 1.00 38.14  ? 151  GLY A O   1 
ATOM   1171 N N   . ALA A 1 152 ? -8.112  57.083 62.603 1.00 42.12  ? 152  ALA A N   1 
ATOM   1172 C CA  . ALA A 1 152 ? -8.932  55.953 62.193 1.00 42.12  ? 152  ALA A CA  1 
ATOM   1173 C C   . ALA A 1 152 ? -9.699  56.260 60.903 1.00 42.12  ? 152  ALA A C   1 
ATOM   1174 O O   . ALA A 1 152 ? -9.823  55.413 60.017 1.00 42.12  ? 152  ALA A O   1 
ATOM   1175 C CB  . ALA A 1 152 ? -9.903  55.598 63.304 1.00 40.78  ? 152  ALA A CB  1 
ATOM   1176 N N   . PHE A 1 153 ? -10.195 57.485 60.806 1.00 37.83  ? 153  PHE A N   1 
ATOM   1177 C CA  . PHE A 1 153 ? -10.975 57.929 59.664 1.00 37.83  ? 153  PHE A CA  1 
ATOM   1178 C C   . PHE A 1 153 ? -10.300 57.756 58.315 1.00 37.83  ? 153  PHE A C   1 
ATOM   1179 O O   . PHE A 1 153 ? -10.976 57.589 57.297 1.00 37.83  ? 153  PHE A O   1 
ATOM   1180 C CB  . PHE A 1 153 ? -11.357 59.390 59.865 1.00 38.16  ? 153  PHE A CB  1 
ATOM   1181 C CG  . PHE A 1 153 ? -12.162 59.632 61.105 1.00 38.16  ? 153  PHE A CG  1 
ATOM   1182 C CD1 . PHE A 1 153 ? -13.473 59.172 61.198 1.00 38.16  ? 153  PHE A CD1 1 
ATOM   1183 C CD2 . PHE A 1 153 ? -11.601 60.293 62.197 1.00 38.16  ? 153  PHE A CD2 1 
ATOM   1184 C CE1 . PHE A 1 153 ? -14.218 59.362 62.360 1.00 38.16  ? 153  PHE A CE1 1 
ATOM   1185 C CE2 . PHE A 1 153 ? -12.336 60.491 63.367 1.00 38.16  ? 153  PHE A CE2 1 
ATOM   1186 C CZ  . PHE A 1 153 ? -13.650 60.023 63.449 1.00 38.16  ? 153  PHE A CZ  1 
ATOM   1187 N N   . GLY A 1 154 ? -8.973  57.793 58.303 1.00 33.63  ? 154  GLY A N   1 
ATOM   1188 C CA  . GLY A 1 154 ? -8.259  57.659 57.050 1.00 33.63  ? 154  GLY A CA  1 
ATOM   1189 C C   . GLY A 1 154 ? -7.327  56.467 56.952 1.00 33.63  ? 154  GLY A C   1 
ATOM   1190 O O   . GLY A 1 154 ? -6.779  56.198 55.884 1.00 33.63  ? 154  GLY A O   1 
ATOM   1191 N N   . PHE A 1 155 ? -7.156  55.722 58.037 1.00 31.45  ? 155  PHE A N   1 
ATOM   1192 C CA  . PHE A 1 155 ? -6.241  54.600 57.982 1.00 31.45  ? 155  PHE A CA  1 
ATOM   1193 C C   . PHE A 1 155 ? -6.670  53.277 58.614 1.00 31.45  ? 155  PHE A C   1 
ATOM   1194 O O   . PHE A 1 155 ? -5.872  52.334 58.690 1.00 31.45  ? 155  PHE A O   1 
ATOM   1195 C CB  . PHE A 1 155 ? -4.890  55.070 58.514 1.00 22.78  ? 155  PHE A CB  1 
ATOM   1196 C CG  . PHE A 1 155 ? -4.268  56.137 57.666 1.00 22.78  ? 155  PHE A CG  1 
ATOM   1197 C CD1 . PHE A 1 155 ? -3.647  55.814 56.472 1.00 22.78  ? 155  PHE A CD1 1 
ATOM   1198 C CD2 . PHE A 1 155 ? -4.396  57.471 58.005 1.00 22.78  ? 155  PHE A CD2 1 
ATOM   1199 C CE1 . PHE A 1 155 ? -3.172  56.801 55.628 1.00 22.78  ? 155  PHE A CE1 1 
ATOM   1200 C CE2 . PHE A 1 155 ? -3.926  58.463 57.163 1.00 22.78  ? 155  PHE A CE2 1 
ATOM   1201 C CZ  . PHE A 1 155 ? -3.314  58.126 55.973 1.00 22.78  ? 155  PHE A CZ  1 
ATOM   1202 N N   . LEU A 1 156 ? -7.929  53.193 59.044 1.00 40.38  ? 156  LEU A N   1 
ATOM   1203 C CA  . LEU A 1 156 ? -8.456  51.951 59.619 1.00 40.38  ? 156  LEU A CA  1 
ATOM   1204 C C   . LEU A 1 156 ? -8.279  50.900 58.532 1.00 40.38  ? 156  LEU A C   1 
ATOM   1205 O O   . LEU A 1 156 ? -8.586  51.156 57.372 1.00 40.38  ? 156  LEU A O   1 
ATOM   1206 C CB  . LEU A 1 156 ? -9.942  52.084 59.937 1.00 40.10  ? 156  LEU A CB  1 
ATOM   1207 C CG  . LEU A 1 156 ? -10.559 50.887 60.660 1.00 40.10  ? 156  LEU A CG  1 
ATOM   1208 C CD1 . LEU A 1 156 ? -10.106 50.903 62.112 1.00 40.10  ? 156  LEU A CD1 1 
ATOM   1209 C CD2 . LEU A 1 156 ? -12.080 50.959 60.597 1.00 40.10  ? 156  LEU A CD2 1 
ATOM   1210 N N   . ALA A 1 157 ? -7.795  49.718 58.877 1.00 44.48  ? 157  ALA A N   1 
ATOM   1211 C CA  . ALA A 1 157 ? -7.590  48.737 57.827 1.00 44.48  ? 157  ALA A CA  1 
ATOM   1212 C C   . ALA A 1 157 ? -7.938  47.289 58.135 1.00 44.48  ? 157  ALA A C   1 
ATOM   1213 O O   . ALA A 1 157 ? -7.244  46.618 58.908 1.00 44.48  ? 157  ALA A O   1 
ATOM   1214 C CB  . ALA A 1 157 ? -6.157  48.824 57.338 1.00 30.29  ? 157  ALA A CB  1 
ATOM   1215 N N   . LEU A 1 158 ? -9.014  46.819 57.505 1.00 47.64  ? 158  LEU A N   1 
ATOM   1216 C CA  . LEU A 1 158 ? -9.481  45.440 57.618 1.00 47.64  ? 158  LEU A CA  1 
ATOM   1217 C C   . LEU A 1 158 ? -9.276  44.846 56.230 1.00 47.64  ? 158  LEU A C   1 
ATOM   1218 O O   . LEU A 1 158 ? -10.221 44.761 55.449 1.00 47.64  ? 158  LEU A O   1 
ATOM   1219 C CB  . LEU A 1 158 ? -10.961 45.415 57.980 1.00 35.16  ? 158  LEU A CB  1 
ATOM   1220 C CG  . LEU A 1 158 ? -11.217 45.938 59.386 1.00 35.16  ? 158  LEU A CG  1 
ATOM   1221 C CD1 . LEU A 1 158 ? -12.704 46.058 59.678 1.00 35.16  ? 158  LEU A CD1 1 
ATOM   1222 C CD2 . LEU A 1 158 ? -10.542 44.983 60.355 1.00 35.16  ? 158  LEU A CD2 1 
ATOM   1223 N N   . HIS A 1 159 ? -8.041  44.457 55.914 1.00 55.06  ? 159  HIS A N   1 
ATOM   1224 C CA  . HIS A 1 159 ? -7.715  43.902 54.595 1.00 55.06  ? 159  HIS A CA  1 
ATOM   1225 C C   . HIS A 1 159 ? -8.726  42.865 54.153 1.00 55.06  ? 159  HIS A C   1 
ATOM   1226 O O   . HIS A 1 159 ? -9.332  42.196 54.989 1.00 55.06  ? 159  HIS A O   1 
ATOM   1227 C CB  . HIS A 1 159 ? -6.335  43.256 54.602 1.00 54.06  ? 159  HIS A CB  1 
ATOM   1228 C CG  . HIS A 1 159 ? -5.823  42.920 53.236 1.00 54.06  ? 159  HIS A CG  1 
ATOM   1229 N ND1 . HIS A 1 159 ? -5.576  43.882 52.276 1.00 54.06  ? 159  HIS A ND1 1 
ATOM   1230 C CD2 . HIS A 1 159 ? -5.484  41.732 52.675 1.00 54.06  ? 159  HIS A CD2 1 
ATOM   1231 C CE1 . HIS A 1 159 ? -5.104  43.302 51.185 1.00 54.06  ? 159  HIS A CE1 1 
ATOM   1232 N NE2 . HIS A 1 159 ? -5.038  41.999 51.401 1.00 54.06  ? 159  HIS A NE2 1 
ATOM   1233 N N   . GLY A 1 160 ? -8.912  42.733 52.842 1.00 58.94  ? 160  GLY A N   1 
ATOM   1234 C CA  . GLY A 1 160 ? -9.859  41.754 52.333 1.00 58.94  ? 160  GLY A CA  1 
ATOM   1235 C C   . GLY A 1 160 ? -11.290 42.260 52.217 1.00 58.94  ? 160  GLY A C   1 
ATOM   1236 O O   . GLY A 1 160 ? -12.114 41.686 51.487 1.00 58.94  ? 160  GLY A O   1 
ATOM   1237 N N   . SER A 1 161 ? -11.590 43.332 52.943 1.00 68.69  ? 161  SER A N   1 
ATOM   1238 C CA  . SER A 1 161 ? -12.921 43.933 52.923 1.00 68.69  ? 161  SER A CA  1 
ATOM   1239 C C   . SER A 1 161 ? -12.894 45.206 52.075 1.00 68.69  ? 161  SER A C   1 
ATOM   1240 O O   . SER A 1 161 ? -11.896 45.923 52.064 1.00 68.69  ? 161  SER A O   1 
ATOM   1241 C CB  . SER A 1 161 ? -13.357 44.270 54.352 1.00 70.09  ? 161  SER A CB  1 
ATOM   1242 O OG  . SER A 1 161 ? -14.325 45.308 54.355 1.00 70.09  ? 161  SER A OG  1 
ATOM   1243 N N   . GLN A 1 162 ? -13.975 45.489 51.358 1.00 57.66  ? 162  GLN A N   1 
ATOM   1244 C CA  . GLN A 1 162 ? -14.011 46.696 50.540 1.00 57.66  ? 162  GLN A CA  1 
ATOM   1245 C C   . GLN A 1 162 ? -14.640 47.845 51.322 1.00 57.66  ? 162  GLN A C   1 
ATOM   1246 O O   . GLN A 1 162 ? -14.820 48.943 50.793 1.00 57.66  ? 162  GLN A O   1 
ATOM   1247 C CB  . GLN A 1 162 ? -14.799 46.461 49.243 1.00 80.73  ? 162  GLN A CB  1 
ATOM   1248 C CG  . GLN A 1 162 ? -14.218 45.382 48.310 1.00 80.73  ? 162  GLN A CG  1 
ATOM   1249 C CD  . GLN A 1 162 ? -12.721 45.564 48.019 1.00 80.73  ? 162  GLN A CD  1 
ATOM   1250 O OE1 . GLN A 1 162 ? -12.226 46.695 47.889 1.00 80.73  ? 162  GLN A OE1 1 
ATOM   1251 N NE2 . GLN A 1 162 ? -12.000 44.443 47.899 1.00 80.73  ? 162  GLN A NE2 1 
ATOM   1252 N N   . GLU A 1 163 ? -14.967 47.597 52.585 1.00 56.27  ? 163  GLU A N   1 
ATOM   1253 C CA  . GLU A 1 163 ? -15.568 48.638 53.408 1.00 56.27  ? 163  GLU A CA  1 
ATOM   1254 C C   . GLU A 1 163 ? -14.547 49.525 54.128 1.00 56.27  ? 163  GLU A C   1 
ATOM   1255 O O   . GLU A 1 163 ? -14.844 50.673 54.472 1.00 56.27  ? 163  GLU A O   1 
ATOM   1256 C CB  . GLU A 1 163 ? -16.546 48.016 54.412 1.00 84.63  ? 163  GLU A CB  1 
ATOM   1257 C CG  . GLU A 1 163 ? -17.864 47.602 53.759 1.00 84.63  ? 163  GLU A CG  1 
ATOM   1258 C CD  . GLU A 1 163 ? -18.359 48.658 52.755 1.00 84.63  ? 163  GLU A CD  1 
ATOM   1259 O OE1 . GLU A 1 163 ? -18.495 49.849 53.150 1.00 84.63  ? 163  GLU A OE1 1 
ATOM   1260 O OE2 . GLU A 1 163 ? -18.605 48.298 51.570 1.00 84.63  ? 163  GLU A OE2 1 
ATOM   1261 N N   . ALA A 1 164 ? -13.350 48.985 54.347 1.00 62.38  ? 164  ALA A N   1 
ATOM   1262 C CA  . ALA A 1 164 ? -12.246 49.700 55.006 1.00 62.38  ? 164  ALA A CA  1 
ATOM   1263 C C   . ALA A 1 164 ? -10.972 49.001 54.524 1.00 62.38  ? 164  ALA A C   1 
ATOM   1264 O O   . ALA A 1 164 ? -10.273 48.334 55.289 1.00 62.38  ? 164  ALA A O   1 
ATOM   1265 C CB  . ALA A 1 164 ? -12.373 49.600 56.535 1.00 22.09  ? 164  ALA A CB  1 
ATOM   1266 N N   . PRO A 1 165 ? -10.661 49.147 53.232 1.00 47.14  ? 165  PRO A N   1 
ATOM   1267 C CA  . PRO A 1 165 ? -9.478  48.517 52.650 1.00 47.14  ? 165  PRO A CA  1 
ATOM   1268 C C   . PRO A 1 165 ? -8.180  48.986 53.276 1.00 47.14  ? 165  PRO A C   1 
ATOM   1269 O O   . PRO A 1 165 ? -7.236  48.211 53.423 1.00 47.14  ? 165  PRO A O   1 
ATOM   1270 C CB  . PRO A 1 165 ? -9.588  48.890 51.176 1.00 36.12  ? 165  PRO A CB  1 
ATOM   1271 C CG  . PRO A 1 165 ? -10.199 50.242 51.225 1.00 36.12  ? 165  PRO A CG  1 
ATOM   1272 C CD  . PRO A 1 165 ? -11.276 50.092 52.283 1.00 36.12  ? 165  PRO A CD  1 
ATOM   1273 N N   . GLY A 1 166 ? -8.147  50.256 53.661 1.00 44.62  ? 166  GLY A N   1 
ATOM   1274 C CA  . GLY A 1 166 ? -6.946  50.817 54.246 1.00 44.62  ? 166  GLY A CA  1 
ATOM   1275 C C   . GLY A 1 166 ? -6.369  51.813 53.261 1.00 44.62  ? 166  GLY A C   1 
ATOM   1276 O O   . GLY A 1 166 ? -6.806  51.876 52.113 1.00 44.62  ? 166  GLY A O   1 
ATOM   1277 N N   . ASN A 1 167 ? -5.404  52.601 53.711 1.00 36.00  ? 167  ASN A N   1 
ATOM   1278 C CA  . ASN A 1 167 ? -4.769  53.592 52.862 1.00 36.00  ? 167  ASN A CA  1 
ATOM   1279 C C   . ASN A 1 167 ? -5.747  54.544 52.197 1.00 36.00  ? 167  ASN A C   1 
ATOM   1280 O O   . ASN A 1 167 ? -5.378  55.261 51.271 1.00 36.00  ? 167  ASN A O   1 
ATOM   1281 C CB  . ASN A 1 167 ? -3.934  52.899 51.785 1.00 38.40  ? 167  ASN A CB  1 
ATOM   1282 C CG  . ASN A 1 167 ? -2.878  51.989 52.369 1.00 38.40  ? 167  ASN A CG  1 
ATOM   1283 O OD1 . ASN A 1 167 ? -2.265  52.311 53.379 1.00 38.40  ? 167  ASN A OD1 1 
ATOM   1284 N ND2 . ASN A 1 167 ? -2.651  50.854 51.730 1.00 38.40  ? 167  ASN A ND2 1 
ATOM   1285 N N   . VAL A 1 168 ? -6.989  54.578 52.659 1.00 44.05  ? 168  VAL A N   1 
ATOM   1286 C CA  . VAL A 1 168 ? -7.945  55.474 52.019 1.00 44.05  ? 168  VAL A CA  1 
ATOM   1287 C C   . VAL A 1 168 ? -7.489  56.917 52.187 1.00 44.05  ? 168  VAL A C   1 
ATOM   1288 O O   . VAL A 1 168 ? -7.892  57.798 51.435 1.00 44.05  ? 168  VAL A O   1 
ATOM   1289 C CB  . VAL A 1 168 ? -9.403  55.291 52.565 1.00 39.48  ? 168  VAL A CB  1 
ATOM   1290 C CG1 . VAL A 1 168 ? -9.777  53.810 52.556 1.00 39.48  ? 168  VAL A CG1 1 
ATOM   1291 C CG2 . VAL A 1 168 ? -9.544  55.886 53.949 1.00 39.48  ? 168  VAL A CG2 1 
ATOM   1292 N N   . GLY A 1 169 ? -6.628  57.151 53.168 1.00 29.13  ? 169  GLY A N   1 
ATOM   1293 C CA  . GLY A 1 169 ? -6.120  58.493 53.390 1.00 29.13  ? 169  GLY A CA  1 
ATOM   1294 C C   . GLY A 1 169 ? -5.137  58.896 52.304 1.00 29.13  ? 169  GLY A C   1 
ATOM   1295 O O   . GLY A 1 169 ? -5.014  60.075 51.979 1.00 29.13  ? 169  GLY A O   1 
ATOM   1296 N N   . LEU A 1 170 ? -4.425  57.909 51.757 1.00 32.57  ? 170  LEU A N   1 
ATOM   1297 C CA  . LEU A 1 170 ? -3.460  58.147 50.694 1.00 32.57  ? 170  LEU A CA  1 
ATOM   1298 C C   . LEU A 1 170 ? -4.218  58.282 49.385 1.00 32.57  ? 170  LEU A C   1 
ATOM   1299 O O   . LEU A 1 170 ? -3.803  59.020 48.495 1.00 32.57  ? 170  LEU A O   1 
ATOM   1300 C CB  . LEU A 1 170 ? -2.458  57.000 50.611 1.00 27.54  ? 170  LEU A CB  1 
ATOM   1301 C CG  . LEU A 1 170 ? -1.459  56.919 51.761 1.00 27.54  ? 170  LEU A CG  1 
ATOM   1302 C CD1 . LEU A 1 170 ? -0.585  55.707 51.591 1.00 27.54  ? 170  LEU A CD1 1 
ATOM   1303 C CD2 . LEU A 1 170 ? -0.614  58.163 51.790 1.00 27.54  ? 170  LEU A CD2 1 
ATOM   1304 N N   . LEU A 1 171 ? -5.339  57.572 49.273 1.00 43.26  ? 171  LEU A N   1 
ATOM   1305 C CA  . LEU A 1 171 ? -6.157  57.672 48.074 1.00 43.26  ? 171  LEU A CA  1 
ATOM   1306 C C   . LEU A 1 171 ? -6.721  59.082 48.014 1.00 43.26  ? 171  LEU A C   1 
ATOM   1307 O O   . LEU A 1 171 ? -6.875  59.640 46.933 1.00 43.26  ? 171  LEU A O   1 
ATOM   1308 C CB  . LEU A 1 171 ? -7.286  56.648 48.099 1.00 31.12  ? 171  LEU A CB  1 
ATOM   1309 C CG  . LEU A 1 171 ? -6.807  55.199 48.016 1.00 31.12  ? 171  LEU A CG  1 
ATOM   1310 C CD1 . LEU A 1 171 ? -8.009  54.314 47.818 1.00 31.12  ? 171  LEU A CD1 1 
ATOM   1311 C CD2 . LEU A 1 171 ? -5.818  55.018 46.869 1.00 31.12  ? 171  LEU A CD2 1 
ATOM   1312 N N   . ASP A 1 172 ? -7.030  59.651 49.184 1.00 41.15  ? 172  ASP A N   1 
ATOM   1313 C CA  . ASP A 1 172 ? -7.531  61.023 49.289 1.00 41.15  ? 172  ASP A CA  1 
ATOM   1314 C C   . ASP A 1 172 ? -6.513  61.968 48.635 1.00 41.15  ? 172  ASP A C   1 
ATOM   1315 O O   . ASP A 1 172 ? -6.862  62.814 47.814 1.00 41.15  ? 172  ASP A O   1 
ATOM   1316 C CB  . ASP A 1 172 ? -7.686  61.445 50.762 1.00 51.53  ? 172  ASP A CB  1 
ATOM   1317 C CG  . ASP A 1 172 ? -9.014  61.025 51.376 1.00 51.53  ? 172  ASP A CG  1 
ATOM   1318 O OD1 . ASP A 1 172 ? -9.987  60.840 50.619 1.00 51.53  ? 172  ASP A OD1 1 
ATOM   1319 O OD2 . ASP A 1 172 ? -9.095  60.907 52.622 1.00 51.53  ? 172  ASP A OD2 1 
ATOM   1320 N N   . GLN A 1 173 ? -5.250  61.824 49.019 1.00 37.74  ? 173  GLN A N   1 
ATOM   1321 C CA  . GLN A 1 173 ? -4.189  62.663 48.481 1.00 37.74  ? 173  GLN A CA  1 
ATOM   1322 C C   . GLN A 1 173 ? -4.064  62.483 46.980 1.00 37.74  ? 173  GLN A C   1 
ATOM   1323 O O   . GLN A 1 173 ? -3.868  63.450 46.244 1.00 37.74  ? 173  GLN A O   1 
ATOM   1324 C CB  . GLN A 1 173 ? -2.853  62.310 49.122 1.00 30.19  ? 173  GLN A CB  1 
ATOM   1325 C CG  . GLN A 1 173 ? -2.703  62.673 50.567 1.00 30.19  ? 173  GLN A CG  1 
ATOM   1326 C CD  . GLN A 1 173 ? -1.502  61.993 51.163 1.00 30.19  ? 173  GLN A CD  1 
ATOM   1327 O OE1 . GLN A 1 173 ? -0.641  61.500 50.443 1.00 30.19  ? 173  GLN A OE1 1 
ATOM   1328 N NE2 . GLN A 1 173 ? -1.430  61.962 52.479 1.00 30.19  ? 173  GLN A NE2 1 
ATOM   1329 N N   . ARG A 1 174 ? -4.171  61.237 46.527 1.00 34.22  ? 174  ARG A N   1 
ATOM   1330 C CA  . ARG A 1 174 ? -4.044  60.941 45.109 1.00 34.22  ? 174  ARG A CA  1 
ATOM   1331 C C   . ARG A 1 174 ? -5.159  61.616 44.351 1.00 34.22  ? 174  ARG A C   1 
ATOM   1332 O O   . ARG A 1 174 ? -4.973  62.069 43.228 1.00 34.22  ? 174  ARG A O   1 
ATOM   1333 C CB  . ARG A 1 174 ? -4.091  59.435 44.861 1.00 36.29  ? 174  ARG A CB  1 
ATOM   1334 C CG  . ARG A 1 174 ? -3.969  59.090 43.398 1.00 36.29  ? 174  ARG A CG  1 
ATOM   1335 C CD  . ARG A 1 174 ? -4.181  57.624 43.147 1.00 36.29  ? 174  ARG A CD  1 
ATOM   1336 N NE  . ARG A 1 174 ? -3.083  56.816 43.655 1.00 36.29  ? 174  ARG A NE  1 
ATOM   1337 C CZ  . ARG A 1 174 ? -3.140  55.496 43.776 1.00 36.29  ? 174  ARG A CZ  1 
ATOM   1338 N NH1 . ARG A 1 174 ? -4.244  54.849 43.429 1.00 36.29  ? 174  ARG A NH1 1 
ATOM   1339 N NH2 . ARG A 1 174 ? -2.097  54.826 44.238 1.00 36.29  ? 174  ARG A NH2 1 
ATOM   1340 N N   . MET A 1 175 ? -6.318  61.685 44.988 1.00 33.88  ? 175  MET A N   1 
ATOM   1341 C CA  . MET A 1 175 ? -7.489  62.300 44.389 1.00 33.88  ? 175  MET A CA  1 
ATOM   1342 C C   . MET A 1 175 ? -7.198  63.768 44.165 1.00 33.88  ? 175  MET A C   1 
ATOM   1343 O O   . MET A 1 175 ? -7.423  64.298 43.083 1.00 33.88  ? 175  MET A O   1 
ATOM   1344 C CB  . MET A 1 175 ? -8.693  62.146 45.314 1.00 55.02  ? 175  MET A CB  1 
ATOM   1345 C CG  . MET A 1 175 ? -10.005 62.615 44.714 1.00 55.02  ? 175  MET A CG  1 
ATOM   1346 S SD  . MET A 1 175 ? -11.039 61.251 44.153 1.00 55.02  ? 175  MET A SD  1 
ATOM   1347 C CE  . MET A 1 175 ? -12.313 61.301 45.347 1.00 55.02  ? 175  MET A CE  1 
ATOM   1348 N N   . ALA A 1 176 ? -6.699  64.428 45.200 1.00 32.79  ? 176  ALA A N   1 
ATOM   1349 C CA  . ALA A 1 176 ? -6.374  65.829 45.086 1.00 32.79  ? 176  ALA A CA  1 
ATOM   1350 C C   . ALA A 1 176 ? -5.374  66.013 43.950 1.00 32.79  ? 176  ALA A C   1 
ATOM   1351 O O   . ALA A 1 176 ? -5.490  66.942 43.161 1.00 32.79  ? 176  ALA A O   1 
ATOM   1352 C CB  . ALA A 1 176 ? -5.800  66.325 46.382 1.00 29.31  ? 176  ALA A CB  1 
ATOM   1353 N N   . LEU A 1 177 ? -4.396  65.120 43.856 1.00 30.08  ? 177  LEU A N   1 
ATOM   1354 C CA  . LEU A 1 177 ? -3.399  65.216 42.798 1.00 30.08  ? 177  LEU A CA  1 
ATOM   1355 C C   . LEU A 1 177 ? -3.996  64.996 41.418 1.00 30.08  ? 177  LEU A C   1 
ATOM   1356 O O   . LEU A 1 177 ? -3.557  65.584 40.439 1.00 30.08  ? 177  LEU A O   1 
ATOM   1357 C CB  . LEU A 1 177 ? -2.281  64.210 43.031 1.00 35.37  ? 177  LEU A CB  1 
ATOM   1358 C CG  . LEU A 1 177 ? -1.326  64.551 44.174 1.00 35.37  ? 177  LEU A CG  1 
ATOM   1359 C CD1 . LEU A 1 177 ? -0.409  63.358 44.442 1.00 35.37  ? 177  LEU A CD1 1 
ATOM   1360 C CD2 . LEU A 1 177 ? -0.523  65.801 43.827 1.00 35.37  ? 177  LEU A CD2 1 
ATOM   1361 N N   . GLN A 1 178 ? -5.000  64.136 41.338 1.00 40.23  ? 178  GLN A N   1 
ATOM   1362 C CA  . GLN A 1 178 ? -5.643  63.865 40.061 1.00 40.23  ? 178  GLN A CA  1 
ATOM   1363 C C   . GLN A 1 178 ? -6.348  65.130 39.601 1.00 40.23  ? 178  GLN A C   1 
ATOM   1364 O O   . GLN A 1 178 ? -6.331  65.457 38.423 1.00 40.23  ? 178  GLN A O   1 
ATOM   1365 C CB  . GLN A 1 178 ? -6.652  62.717 40.200 1.00 42.54  ? 178  GLN A CB  1 
ATOM   1366 C CG  . GLN A 1 178 ? -7.338  62.275 38.903 1.00 42.54  ? 178  GLN A CG  1 
ATOM   1367 C CD  . GLN A 1 178 ? -6.384  61.640 37.907 1.00 42.54  ? 178  GLN A CD  1 
ATOM   1368 O OE1 . GLN A 1 178 ? -5.709  60.655 38.216 1.00 42.54  ? 178  GLN A OE1 1 
ATOM   1369 N NE2 . GLN A 1 178 ? -6.326  62.202 36.701 1.00 42.54  ? 178  GLN A NE2 1 
ATOM   1370 N N   . TRP A 1 179 ? -6.956  65.846 40.538 1.00 37.05  ? 179  TRP A N   1 
ATOM   1371 C CA  . TRP A 1 179 ? -7.662  67.078 40.211 1.00 37.05  ? 179  TRP A CA  1 
ATOM   1372 C C   . TRP A 1 179 ? -6.661  68.142 39.761 1.00 37.05  ? 179  TRP A C   1 
ATOM   1373 O O   . TRP A 1 179 ? -6.893  68.817 38.766 1.00 37.05  ? 179  TRP A O   1 
ATOM   1374 C CB  . TRP A 1 179 ? -8.445  67.567 41.422 1.00 28.34  ? 179  TRP A CB  1 
ATOM   1375 C CG  . TRP A 1 179 ? -9.547  68.505 41.109 1.00 28.34  ? 179  TRP A CG  1 
ATOM   1376 C CD1 . TRP A 1 179 ? -10.833 68.183 40.792 1.00 28.34  ? 179  TRP A CD1 1 
ATOM   1377 C CD2 . TRP A 1 179 ? -9.479  69.931 41.112 1.00 28.34  ? 179  TRP A CD2 1 
ATOM   1378 N NE1 . TRP A 1 179 ? -11.575 69.325 40.599 1.00 28.34  ? 179  TRP A NE1 1 
ATOM   1379 C CE2 . TRP A 1 179 ? -10.764 70.412 40.791 1.00 28.34  ? 179  TRP A CE2 1 
ATOM   1380 C CE3 . TRP A 1 179 ? -8.455  70.851 41.356 1.00 28.34  ? 179  TRP A CE3 1 
ATOM   1381 C CZ2 . TRP A 1 179 ? -11.050 71.773 40.707 1.00 28.34  ? 179  TRP A CZ2 1 
ATOM   1382 C CZ3 . TRP A 1 179 ? -8.743  72.203 41.273 1.00 28.34  ? 179  TRP A CZ3 1 
ATOM   1383 C CH2 . TRP A 1 179 ? -10.029 72.650 40.951 1.00 28.34  ? 179  TRP A CH2 1 
ATOM   1384 N N   . VAL A 1 180 ? -5.551  68.294 40.481 1.00 38.58  ? 180  VAL A N   1 
ATOM   1385 C CA  . VAL A 1 180 ? -4.545  69.274 40.090 1.00 38.58  ? 180  VAL A CA  1 
ATOM   1386 C C   . VAL A 1 180 ? -4.075  68.935 38.680 1.00 38.58  ? 180  VAL A C   1 
ATOM   1387 O O   . VAL A 1 180 ? -3.801  69.814 37.868 1.00 38.58  ? 180  VAL A O   1 
ATOM   1388 C CB  . VAL A 1 180 ? -3.316  69.251 41.028 1.00 29.50  ? 180  VAL A CB  1 
ATOM   1389 C CG1 . VAL A 1 180 ? -2.187  70.103 40.458 1.00 29.50  ? 180  VAL A CG1 1 
ATOM   1390 C CG2 . VAL A 1 180 ? -3.704  69.773 42.381 1.00 29.50  ? 180  VAL A CG2 1 
ATOM   1391 N N   . HIS A 1 181 ? -3.992  67.650 38.385 1.00 35.59  ? 181  HIS A N   1 
ATOM   1392 C CA  . HIS A 1 181 ? -3.548  67.231 37.078 1.00 35.59  ? 181  HIS A CA  1 
ATOM   1393 C C   . HIS A 1 181 ? -4.551  67.558 35.988 1.00 35.59  ? 181  HIS A C   1 
ATOM   1394 O O   . HIS A 1 181 ? -4.169  67.919 34.888 1.00 35.59  ? 181  HIS A O   1 
ATOM   1395 C CB  . HIS A 1 181 ? -3.266  65.735 37.091 1.00 49.89  ? 181  HIS A CB  1 
ATOM   1396 C CG  . HIS A 1 181 ? -2.705  65.219 35.806 1.00 49.89  ? 181  HIS A CG  1 
ATOM   1397 N ND1 . HIS A 1 181 ? -3.502  64.845 34.743 1.00 49.89  ? 181  HIS A ND1 1 
ATOM   1398 C CD2 . HIS A 1 181 ? -1.426  65.031 35.405 1.00 49.89  ? 181  HIS A CD2 1 
ATOM   1399 C CE1 . HIS A 1 181 ? -2.737  64.445 33.743 1.00 49.89  ? 181  HIS A CE1 1 
ATOM   1400 N NE2 . HIS A 1 181 ? -1.472  64.547 34.119 1.00 49.89  ? 181  HIS A NE2 1 
ATOM   1401 N N   . ASP A 1 182 ? -5.835  67.447 36.294 1.00 44.67  ? 182  ASP A N   1 
ATOM   1402 C CA  . ASP A 1 182 ? -6.868  67.709 35.305 1.00 44.67  ? 182  ASP A CA  1 
ATOM   1403 C C   . ASP A 1 182 ? -7.366  69.145 35.248 1.00 44.67  ? 182  ASP A C   1 
ATOM   1404 O O   . ASP A 1 182 ? -8.056  69.517 34.303 1.00 44.67  ? 182  ASP A O   1 
ATOM   1405 C CB  . ASP A 1 182 ? -8.078  66.808 35.555 1.00 73.42  ? 182  ASP A CB  1 
ATOM   1406 C CG  . ASP A 1 182 ? -7.725  65.318 35.560 1.00 73.42  ? 182  ASP A CG  1 
ATOM   1407 O OD1 . ASP A 1 182 ? -6.970  64.877 34.654 1.00 73.42  ? 182  ASP A OD1 1 
ATOM   1408 O OD2 . ASP A 1 182 ? -8.218  64.583 36.458 1.00 73.42  ? 182  ASP A OD2 1 
ATOM   1409 N N   . ASN A 1 183 ? -7.015  69.967 36.229 1.00 36.33  ? 183  ASN A N   1 
ATOM   1410 C CA  . ASN A 1 183 ? -7.539  71.325 36.239 1.00 36.33  ? 183  ASN A CA  1 
ATOM   1411 C C   . ASN A 1 183 ? -6.591  72.496 36.484 1.00 36.33  ? 183  ASN A C   1 
ATOM   1412 O O   . ASN A 1 183 ? -6.907  73.635 36.124 1.00 36.33  ? 183  ASN A O   1 
ATOM   1413 C CB  . ASN A 1 183 ? -8.669  71.392 37.261 1.00 44.99  ? 183  ASN A CB  1 
ATOM   1414 C CG  . ASN A 1 183 ? -9.808  70.446 36.931 1.00 44.99  ? 183  ASN A CG  1 
ATOM   1415 O OD1 . ASN A 1 183 ? -10.599 70.700 36.017 1.00 44.99  ? 183  ASN A OD1 1 
ATOM   1416 N ND2 . ASN A 1 183 ? -9.895  69.344 37.665 1.00 44.99  ? 183  ASN A ND2 1 
ATOM   1417 N N   . ILE A 1 184 ? -5.434  72.237 37.082 1.00 36.98  ? 184  ILE A N   1 
ATOM   1418 C CA  . ILE A 1 184 ? -4.512  73.317 37.394 1.00 36.98  ? 184  ILE A CA  1 
ATOM   1419 C C   . ILE A 1 184 ? -4.185  74.202 36.195 1.00 36.98  ? 184  ILE A C   1 
ATOM   1420 O O   . ILE A 1 184 ? -3.731  75.330 36.358 1.00 36.98  ? 184  ILE A O   1 
ATOM   1421 C CB  . ILE A 1 184 ? -3.203  72.766 38.041 1.00 28.30  ? 184  ILE A CB  1 
ATOM   1422 C CG1 . ILE A 1 184 ? -2.559  73.848 38.912 1.00 28.30  ? 184  ILE A CG1 1 
ATOM   1423 C CG2 . ILE A 1 184 ? -2.239  72.272 36.977 1.00 28.30  ? 184  ILE A CG2 1 
ATOM   1424 C CD1 . ILE A 1 184 ? -3.439  74.294 40.072 1.00 28.30  ? 184  ILE A CD1 1 
ATOM   1425 N N   . GLN A 1 185 ? -4.440  73.713 34.989 1.00 39.04  ? 185  GLN A N   1 
ATOM   1426 C CA  . GLN A 1 185 ? -4.134  74.496 33.806 1.00 39.04  ? 185  GLN A CA  1 
ATOM   1427 C C   . GLN A 1 185 ? -5.031  75.716 33.724 1.00 39.04  ? 185  GLN A C   1 
ATOM   1428 O O   . GLN A 1 185 ? -4.630  76.751 33.203 1.00 39.04  ? 185  GLN A O   1 
ATOM   1429 C CB  . GLN A 1 185 ? -4.297  73.646 32.549 1.00 50.46  ? 185  GLN A CB  1 
ATOM   1430 C CG  . GLN A 1 185 ? -5.731  73.324 32.212 1.00 50.46  ? 185  GLN A CG  1 
ATOM   1431 C CD  . GLN A 1 185 ? -5.864  72.242 31.149 1.00 50.46  ? 185  GLN A CD  1 
ATOM   1432 O OE1 . GLN A 1 185 ? -5.647  71.058 31.415 1.00 50.46  ? 185  GLN A OE1 1 
ATOM   1433 N NE2 . GLN A 1 185 ? -6.221  72.648 29.935 1.00 50.46  ? 185  GLN A NE2 1 
ATOM   1434 N N   . PHE A 1 186 ? -6.242  75.606 34.252 1.00 46.78  ? 186  PHE A N   1 
ATOM   1435 C CA  . PHE A 1 186 ? -7.177  76.726 34.208 1.00 46.78  ? 186  PHE A CA  1 
ATOM   1436 C C   . PHE A 1 186 ? -6.860  77.787 35.250 1.00 46.78  ? 186  PHE A C   1 
ATOM   1437 O O   . PHE A 1 186 ? -7.491  78.841 35.280 1.00 46.78  ? 186  PHE A O   1 
ATOM   1438 C CB  . PHE A 1 186 ? -8.603  76.215 34.387 1.00 34.70  ? 186  PHE A CB  1 
ATOM   1439 C CG  . PHE A 1 186 ? -8.965  75.140 33.419 1.00 34.70  ? 186  PHE A CG  1 
ATOM   1440 C CD1 . PHE A 1 186 ? -9.019  75.406 32.060 1.00 34.70  ? 186  PHE A CD1 1 
ATOM   1441 C CD2 . PHE A 1 186 ? -9.182  73.842 33.853 1.00 34.70  ? 186  PHE A CD2 1 
ATOM   1442 C CE1 . PHE A 1 186 ? -9.278  74.390 31.142 1.00 34.70  ? 186  PHE A CE1 1 
ATOM   1443 C CE2 . PHE A 1 186 ? -9.441  72.820 32.944 1.00 34.70  ? 186  PHE A CE2 1 
ATOM   1444 C CZ  . PHE A 1 186 ? -9.488  73.096 31.587 1.00 34.70  ? 186  PHE A CZ  1 
ATOM   1445 N N   . PHE A 1 187 ? -5.886  77.505 36.110 1.00 41.68  ? 187  PHE A N   1 
ATOM   1446 C CA  . PHE A 1 187 ? -5.482  78.454 37.140 1.00 41.68  ? 187  PHE A CA  1 
ATOM   1447 C C   . PHE A 1 187 ? -4.143  79.066 36.760 1.00 41.68  ? 187  PHE A C   1 
ATOM   1448 O O   . PHE A 1 187 ? -3.570  79.846 37.514 1.00 41.68  ? 187  PHE A O   1 
ATOM   1449 C CB  . PHE A 1 187 ? -5.363  77.769 38.506 1.00 24.83  ? 187  PHE A CB  1 
ATOM   1450 C CG  . PHE A 1 187 ? -6.675  77.321 39.082 1.00 24.83  ? 187  PHE A CG  1 
ATOM   1451 C CD1 . PHE A 1 187 ? -7.183  76.059 38.799 1.00 24.83  ? 187  PHE A CD1 1 
ATOM   1452 C CD2 . PHE A 1 187 ? -7.402  78.163 39.920 1.00 24.83  ? 187  PHE A CD2 1 
ATOM   1453 C CE1 . PHE A 1 187 ? -8.392  75.641 39.345 1.00 24.83  ? 187  PHE A CE1 1 
ATOM   1454 C CE2 . PHE A 1 187 ? -8.614  77.757 40.470 1.00 24.83  ? 187  PHE A CE2 1 
ATOM   1455 C CZ  . PHE A 1 187 ? -9.112  76.493 40.183 1.00 24.83  ? 187  PHE A CZ  1 
ATOM   1456 N N   . GLY A 1 188 ? -3.649  78.701 35.583 1.00 43.94  ? 188  GLY A N   1 
ATOM   1457 C CA  . GLY A 1 188 ? -2.373  79.218 35.123 1.00 43.94  ? 188  GLY A CA  1 
ATOM   1458 C C   . GLY A 1 188 ? -1.218  78.243 35.309 1.00 43.94  ? 188  GLY A C   1 
ATOM   1459 O O   . GLY A 1 188 ? -0.100  78.483 34.829 1.00 43.94  ? 188  GLY A O   1 
ATOM   1460 N N   . GLY A 1 189 ? -1.492  77.136 35.996 1.00 43.11  ? 189  GLY A N   1 
ATOM   1461 C CA  . GLY A 1 189 ? -0.464  76.150 36.253 1.00 43.11  ? 189  GLY A CA  1 
ATOM   1462 C C   . GLY A 1 189 ? -0.183  75.191 35.116 1.00 43.11  ? 189  GLY A C   1 
ATOM   1463 O O   . GLY A 1 189 ? -1.026  74.969 34.242 1.00 43.11  ? 189  GLY A O   1 
ATOM   1464 N N   . ASP A 1 190 ? 1.023   74.631 35.121 1.00 49.75  ? 190  ASP A N   1 
ATOM   1465 C CA  . ASP A 1 190 ? 1.429   73.671 34.109 1.00 49.75  ? 190  ASP A CA  1 
ATOM   1466 C C   . ASP A 1 190 ? 1.400   72.289 34.751 1.00 49.75  ? 190  ASP A C   1 
ATOM   1467 O O   . ASP A 1 190 ? 2.276   71.939 35.542 1.00 49.75  ? 190  ASP A O   1 
ATOM   1468 C CB  . ASP A 1 190 ? 2.832   73.983 33.584 1.00 58.90  ? 190  ASP A CB  1 
ATOM   1469 C CG  . ASP A 1 190 ? 3.378   72.867 32.687 1.00 58.90  ? 190  ASP A CG  1 
ATOM   1470 O OD1 . ASP A 1 190 ? 2.571   72.024 32.221 1.00 58.90  ? 190  ASP A OD1 1 
ATOM   1471 O OD2 . ASP A 1 190 ? 4.608   72.829 32.442 1.00 58.90  ? 190  ASP A OD2 1 
ATOM   1472 N N   . PRO A 1 191 ? 0.394   71.479 34.401 1.00 40.65  ? 191  PRO A N   1 
ATOM   1473 C CA  . PRO A 1 191 ? 0.222   70.132 34.934 1.00 40.65  ? 191  PRO A CA  1 
ATOM   1474 C C   . PRO A 1 191 ? 1.395   69.183 34.721 1.00 40.65  ? 191  PRO A C   1 
ATOM   1475 O O   . PRO A 1 191 ? 1.538   68.211 35.457 1.00 40.65  ? 191  PRO A O   1 
ATOM   1476 C CB  . PRO A 1 191 ? -1.045  69.661 34.238 1.00 32.89  ? 191  PRO A CB  1 
ATOM   1477 C CG  . PRO A 1 191 ? -0.951  70.333 32.919 1.00 32.89  ? 191  PRO A CG  1 
ATOM   1478 C CD  . PRO A 1 191 ? -0.541  71.718 33.290 1.00 32.89  ? 191  PRO A CD  1 
ATOM   1479 N N   . LYS A 1 192 ? 2.231   69.453 33.721 1.00 50.81  ? 192  LYS A N   1 
ATOM   1480 C CA  . LYS A 1 192 ? 3.377   68.586 33.447 1.00 50.81  ? 192  LYS A CA  1 
ATOM   1481 C C   . LYS A 1 192 ? 4.599   69.030 34.267 1.00 50.81  ? 192  LYS A C   1 
ATOM   1482 O O   . LYS A 1 192 ? 5.730   68.588 34.028 1.00 50.81  ? 192  LYS A O   1 
ATOM   1483 C CB  . LYS A 1 192 ? 3.716   68.584 31.943 1.00 65.54  ? 192  LYS A CB  1 
ATOM   1484 C CG  . LYS A 1 192 ? 4.297   69.914 31.419 1.00 65.54  ? 192  LYS A CG  1 
ATOM   1485 C CD  . LYS A 1 192 ? 4.811   69.858 29.950 1.00 65.54  ? 192  LYS A CD  1 
ATOM   1486 C CE  . LYS A 1 192 ? 3.712   69.514 28.899 1.00 65.54  ? 192  LYS A CE  1 
ATOM   1487 N NZ  . LYS A 1 192 ? 3.599   68.045 28.543 1.00 65.54  ? 192  LYS A NZ  1 
ATOM   1488 N N   . THR A 1 193 ? 4.372   69.898 35.246 1.00 42.10  ? 193  THR A N   1 
ATOM   1489 C CA  . THR A 1 193 ? 5.467   70.367 36.078 1.00 42.10  ? 193  THR A CA  1 
ATOM   1490 C C   . THR A 1 193 ? 4.986   70.674 37.482 1.00 42.10  ? 193  THR A C   1 
ATOM   1491 O O   . THR A 1 193 ? 5.071   71.801 37.968 1.00 42.10  ? 193  THR A O   1 
ATOM   1492 C CB  . THR A 1 193 ? 6.122   71.605 35.462 1.00 59.25  ? 193  THR A CB  1 
ATOM   1493 O OG1 . THR A 1 193 ? 6.406   71.333 34.086 1.00 59.25  ? 193  THR A OG1 1 
ATOM   1494 C CG2 . THR A 1 193 ? 7.429   71.934 36.170 1.00 59.25  ? 193  THR A CG2 1 
ATOM   1495 N N   . VAL A 1 194 ? 4.467   69.643 38.126 1.00 33.30  ? 194  VAL A N   1 
ATOM   1496 C CA  . VAL A 1 194 ? 3.975   69.762 39.480 1.00 33.30  ? 194  VAL A CA  1 
ATOM   1497 C C   . VAL A 1 194 ? 4.928   69.030 40.405 1.00 33.30  ? 194  VAL A C   1 
ATOM   1498 O O   . VAL A 1 194 ? 5.290   67.885 40.165 1.00 33.30  ? 194  VAL A O   1 
ATOM   1499 C CB  . VAL A 1 194 ? 2.550   69.173 39.611 1.00 40.28  ? 194  VAL A CB  1 
ATOM   1500 C CG1 . VAL A 1 194 ? 2.423   67.964 38.727 1.00 40.28  ? 194  VAL A CG1 1 
ATOM   1501 C CG2 . VAL A 1 194 ? 2.260   68.786 41.053 1.00 40.28  ? 194  VAL A CG2 1 
ATOM   1502 N N   . THR A 1 195 ? 5.346   69.728 41.451 1.00 45.73  ? 195  THR A N   1 
ATOM   1503 C CA  . THR A 1 195 ? 6.249   69.189 42.453 1.00 45.73  ? 195  THR A CA  1 
ATOM   1504 C C   . THR A 1 195 ? 5.425   68.950 43.707 1.00 45.73  ? 195  THR A C   1 
ATOM   1505 O O   . THR A 1 195 ? 4.707   69.844 44.146 1.00 45.73  ? 195  THR A O   1 
ATOM   1506 C CB  . THR A 1 195 ? 7.350   70.214 42.823 1.00 31.93  ? 195  THR A CB  1 
ATOM   1507 O OG1 . THR A 1 195 ? 8.070   70.596 41.649 1.00 31.93  ? 195  THR A OG1 1 
ATOM   1508 C CG2 . THR A 1 195 ? 8.310   69.629 43.832 1.00 31.93  ? 195  THR A CG2 1 
ATOM   1509 N N   . ILE A 1 196 ? 5.479   67.755 44.276 1.00 33.55  ? 196  ILE A N   1 
ATOM   1510 C CA  . ILE A 1 196 ? 4.756   67.556 45.515 1.00 33.55  ? 196  ILE A CA  1 
ATOM   1511 C C   . ILE A 1 196 ? 5.831   67.613 46.598 1.00 33.55  ? 196  ILE A C   1 
ATOM   1512 O O   . ILE A 1 196 ? 6.949   67.156 46.384 1.00 33.55  ? 196  ILE A O   1 
ATOM   1513 C CB  . ILE A 1 196 ? 4.005   66.209 45.543 1.00 32.72  ? 196  ILE A CB  1 
ATOM   1514 C CG1 . ILE A 1 196 ? 4.977   65.044 45.500 1.00 32.72  ? 196  ILE A CG1 1 
ATOM   1515 C CG2 . ILE A 1 196 ? 3.075   66.120 44.361 1.00 32.72  ? 196  ILE A CG2 1 
ATOM   1516 C CD1 . ILE A 1 196 ? 4.286   63.703 45.539 1.00 32.72  ? 196  ILE A CD1 1 
ATOM   1517 N N   . PHE A 1 197 ? 5.527   68.232 47.731 1.00 27.30  ? 197  PHE A N   1 
ATOM   1518 C CA  . PHE A 1 197 ? 6.495   68.310 48.821 1.00 27.30  ? 197  PHE A CA  1 
ATOM   1519 C C   . PHE A 1 197 ? 5.791   68.233 50.158 1.00 27.30  ? 197  PHE A C   1 
ATOM   1520 O O   . PHE A 1 197 ? 4.734   68.809 50.333 1.00 27.30  ? 197  PHE A O   1 
ATOM   1521 C CB  . PHE A 1 197 ? 7.370   69.579 48.721 1.00 38.37  ? 197  PHE A CB  1 
ATOM   1522 C CG  . PHE A 1 197 ? 6.645   70.886 48.964 1.00 38.37  ? 197  PHE A CG  1 
ATOM   1523 C CD1 . PHE A 1 197 ? 5.593   71.287 48.160 1.00 38.37  ? 197  PHE A CD1 1 
ATOM   1524 C CD2 . PHE A 1 197 ? 7.073   71.749 49.968 1.00 38.37  ? 197  PHE A CD2 1 
ATOM   1525 C CE1 . PHE A 1 197 ? 4.982   72.528 48.352 1.00 38.37  ? 197  PHE A CE1 1 
ATOM   1526 C CE2 . PHE A 1 197 ? 6.465   72.991 50.163 1.00 38.37  ? 197  PHE A CE2 1 
ATOM   1527 C CZ  . PHE A 1 197 ? 5.423   73.378 49.355 1.00 38.37  ? 197  PHE A CZ  1 
ATOM   1528 N N   . GLY A 1 198 ? 6.371   67.495 51.096 1.00 26.84  ? 198  GLY A N   1 
ATOM   1529 C CA  . GLY A 1 198 ? 5.745   67.339 52.390 1.00 26.84  ? 198  GLY A CA  1 
ATOM   1530 C C   . GLY A 1 198 ? 6.713   67.358 53.543 1.00 26.84  ? 198  GLY A C   1 
ATOM   1531 O O   . GLY A 1 198 ? 7.908   67.518 53.357 1.00 26.84  ? 198  GLY A O   1 
ATOM   1532 N N   . GLU A 1 199 ? 6.181   67.170 54.742 1.00 40.26  ? 199  GLU A N   1 
ATOM   1533 C CA  . GLU A 1 199 ? 6.976   67.196 55.959 1.00 40.26  ? 199  GLU A CA  1 
ATOM   1534 C C   . GLU A 1 199 ? 6.468   66.137 56.936 1.00 40.26  ? 199  GLU A C   1 
ATOM   1535 O O   . GLU A 1 199 ? 5.266   65.999 57.108 1.00 40.26  ? 199  GLU A O   1 
ATOM   1536 C CB  . GLU A 1 199 ? 6.845   68.587 56.571 1.00 82.12  ? 199  GLU A CB  1 
ATOM   1537 C CG  . GLU A 1 199 ? 8.055   69.104 57.321 1.00 82.12  ? 199  GLU A CG  1 
ATOM   1538 C CD  . GLU A 1 199 ? 7.953   68.883 58.820 1.00 82.12  ? 199  GLU A CD  1 
ATOM   1539 O OE1 . GLU A 1 199 ? 6.801   68.861 59.343 1.00 82.12  ? 199  GLU A OE1 1 
ATOM   1540 O OE2 . GLU A 1 199 ? 9.025   68.749 59.472 1.00 82.12  ? 199  GLU A OE2 1 
ATOM   1541 N N   . SER A 1 200 ? 7.375   65.393 57.569 1.00 41.05  ? 200  SER A N   1 
ATOM   1542 C CA  . SER A 1 200 ? 7.009   64.348 58.544 1.00 41.05  ? 200  SER A CA  1 
ATOM   1543 C C   . SER A 1 200 ? 6.099   63.324 57.857 1.00 41.05  ? 200  SER A C   1 
ATOM   1544 O O   . SER A 1 200 ? 6.523   62.685 56.903 1.00 41.05  ? 200  SER A O   1 
ATOM   1545 C CB  . SER A 1 200 ? 6.331   64.980 59.785 1.00 43.67  ? 200  SER A CB  1 
ATOM   1546 O OG  . SER A 1 200 ? 6.023   64.024 60.800 1.00 43.67  ? 200  SER A OG  1 
ATOM   1547 N N   . ALA A 1 201 ? 4.865   63.157 58.314 1.00 34.48  ? 201  ALA A N   1 
ATOM   1548 C CA  . ALA A 1 201 ? 3.975   62.194 57.670 1.00 34.48  ? 201  ALA A CA  1 
ATOM   1549 C C   . ALA A 1 201 ? 3.734   62.565 56.208 1.00 34.48  ? 201  ALA A C   1 
ATOM   1550 O O   . ALA A 1 201 ? 3.398   61.714 55.393 1.00 34.48  ? 201  ALA A O   1 
ATOM   1551 C CB  . ALA A 1 201 ? 2.647   62.121 58.412 1.00 41.50  ? 201  ALA A CB  1 
ATOM   1552 N N   . GLY A 1 202 ? 3.902   63.845 55.886 1.00 34.24  ? 202  GLY A N   1 
ATOM   1553 C CA  . GLY A 1 202 ? 3.702   64.315 54.529 1.00 34.24  ? 202  GLY A CA  1 
ATOM   1554 C C   . GLY A 1 202 ? 4.913   64.003 53.691 1.00 34.24  ? 202  GLY A C   1 
ATOM   1555 O O   . GLY A 1 202 ? 4.824   63.870 52.479 1.00 34.24  ? 202  GLY A O   1 
ATOM   1556 N N   . GLY A 1 203 ? 6.061   63.900 54.348 1.00 41.10  ? 203  GLY A N   1 
ATOM   1557 C CA  . GLY A 1 203 ? 7.288   63.577 53.651 1.00 41.10  ? 203  GLY A CA  1 
ATOM   1558 C C   . GLY A 1 203 ? 7.236   62.097 53.355 1.00 41.10  ? 203  GLY A C   1 
ATOM   1559 O O   . GLY A 1 203 ? 7.727   61.637 52.331 1.00 41.10  ? 203  GLY A O   1 
ATOM   1560 N N   . ALA A 1 204 ? 6.635   61.348 54.272 1.00 37.15  ? 204  ALA A N   1 
ATOM   1561 C CA  . ALA A 1 204 ? 6.481   59.913 54.108 1.00 37.15  ? 204  ALA A CA  1 
ATOM   1562 C C   . ALA A 1 204 ? 5.428   59.644 53.020 1.00 37.15  ? 204  ALA A C   1 
ATOM   1563 O O   . ALA A 1 204 ? 5.522   58.669 52.277 1.00 37.15  ? 204  ALA A O   1 
ATOM   1564 C CB  . ALA A 1 204 ? 6.060   59.284 55.428 1.00 26.58  ? 204  ALA A CB  1 
ATOM   1565 N N   . SER A 1 205 ? 4.428   60.513 52.931 1.00 36.42  ? 205  SER A N   1 
ATOM   1566 C CA  . SER A 1 205 ? 3.392   60.374 51.922 1.00 36.42  ? 205  SER A CA  1 
ATOM   1567 C C   . SER A 1 205 ? 3.971   60.627 50.527 1.00 36.42  ? 205  SER A C   1 
ATOM   1568 O O   . SER A 1 205 ? 3.658   59.906 49.579 1.00 36.42  ? 205  SER A O   1 
ATOM   1569 C CB  . SER A 1 205 ? 2.255   61.358 52.185 1.00 31.07  ? 205  SER A CB  1 
ATOM   1570 O OG  . SER A 1 205 ? 1.547   61.001 53.347 1.00 31.07  ? 205  SER A OG  1 
ATOM   1571 N N   . VAL A 1 206 ? 4.808   61.655 50.402 1.00 36.65  ? 206  VAL A N   1 
ATOM   1572 C CA  . VAL A 1 206 ? 5.416   61.970 49.117 1.00 36.65  ? 206  VAL A CA  1 
ATOM   1573 C C   . VAL A 1 206 ? 6.213   60.773 48.658 1.00 36.65  ? 206  VAL A C   1 
ATOM   1574 O O   . VAL A 1 206 ? 6.118   60.363 47.514 1.00 36.65  ? 206  VAL A O   1 
ATOM   1575 C CB  . VAL A 1 206 ? 6.351   63.195 49.202 1.00 30.84  ? 206  VAL A CB  1 
ATOM   1576 C CG1 . VAL A 1 206 ? 7.422   63.113 48.133 1.00 30.84  ? 206  VAL A CG1 1 
ATOM   1577 C CG2 . VAL A 1 206 ? 5.554   64.460 49.014 1.00 30.84  ? 206  VAL A CG2 1 
ATOM   1578 N N   . GLY A 1 207 ? 6.998   60.210 49.561 1.00 37.91  ? 207  GLY A N   1 
ATOM   1579 C CA  . GLY A 1 207 ? 7.792   59.052 49.214 1.00 37.91  ? 207  GLY A CA  1 
ATOM   1580 C C   . GLY A 1 207 ? 6.937   57.857 48.850 1.00 37.91  ? 207  GLY A C   1 
ATOM   1581 O O   . GLY A 1 207 ? 7.387   56.973 48.120 1.00 37.91  ? 207  GLY A O   1 
ATOM   1582 N N   . MET A 1 208 ? 5.706   57.825 49.352 1.00 46.76  ? 208  MET A N   1 
ATOM   1583 C CA  . MET A 1 208 ? 4.804   56.717 49.068 1.00 46.76  ? 208  MET A CA  1 
ATOM   1584 C C   . MET A 1 208 ? 4.151   56.817 47.699 1.00 46.76  ? 208  MET A C   1 
ATOM   1585 O O   . MET A 1 208 ? 3.758   55.801 47.138 1.00 46.76  ? 208  MET A O   1 
ATOM   1586 C CB  . MET A 1 208 ? 3.741   56.593 50.161 1.00 40.52  ? 208  MET A CB  1 
ATOM   1587 C CG  . MET A 1 208 ? 4.168   55.696 51.299 1.00 40.52  ? 208  MET A CG  1 
ATOM   1588 S SD  . MET A 1 208 ? 3.297   55.987 52.835 1.00 40.52  ? 208  MET A SD  1 
ATOM   1589 C CE  . MET A 1 208 ? 4.534   55.514 54.015 1.00 40.52  ? 208  MET A CE  1 
ATOM   1590 N N   . HIS A 1 209 ? 4.037   58.024 47.152 1.00 37.68  ? 209  HIS A N   1 
ATOM   1591 C CA  . HIS A 1 209 ? 3.444   58.176 45.829 1.00 37.68  ? 209  HIS A CA  1 
ATOM   1592 C C   . HIS A 1 209 ? 4.507   57.865 44.806 1.00 37.68  ? 209  HIS A C   1 
ATOM   1593 O O   . HIS A 1 209 ? 4.211   57.526 43.669 1.00 37.68  ? 209  HIS A O   1 
ATOM   1594 C CB  . HIS A 1 209 ? 2.916   59.585 45.629 1.00 37.92  ? 209  HIS A CB  1 
ATOM   1595 C CG  . HIS A 1 209 ? 1.729   59.895 46.480 1.00 37.92  ? 209  HIS A CG  1 
ATOM   1596 N ND1 . HIS A 1 209 ? 0.550   59.189 46.389 1.00 37.92  ? 209  HIS A ND1 1 
ATOM   1597 C CD2 . HIS A 1 209 ? 1.550   60.806 47.464 1.00 37.92  ? 209  HIS A CD2 1 
ATOM   1598 C CE1 . HIS A 1 209 ? -0.305  59.653 47.283 1.00 37.92  ? 209  HIS A CE1 1 
ATOM   1599 N NE2 . HIS A 1 209 ? 0.277   60.634 47.949 1.00 37.92  ? 209  HIS A NE2 1 
ATOM   1600 N N   . ILE A 1 210 ? 5.756   57.982 45.231 1.00 37.35  ? 210  ILE A N   1 
ATOM   1601 C CA  . ILE A 1 210 ? 6.894   57.682 44.382 1.00 37.35  ? 210  ILE A CA  1 
ATOM   1602 C C   . ILE A 1 210 ? 6.981   56.163 44.229 1.00 37.35  ? 210  ILE A C   1 
ATOM   1603 O O   . ILE A 1 210 ? 7.351   55.668 43.170 1.00 37.35  ? 210  ILE A O   1 
ATOM   1604 C CB  . ILE A 1 210 ? 8.194   58.222 45.021 1.00 31.62  ? 210  ILE A CB  1 
ATOM   1605 C CG1 . ILE A 1 210 ? 8.239   59.732 44.848 1.00 31.62  ? 210  ILE A CG1 1 
ATOM   1606 C CG2 . ILE A 1 210 ? 9.416   57.571 44.413 1.00 31.62  ? 210  ILE A CG2 1 
ATOM   1607 C CD1 . ILE A 1 210 ? 9.330   60.383 45.615 1.00 31.62  ? 210  ILE A CD1 1 
ATOM   1608 N N   . LEU A 1 211 ? 6.622   55.435 45.289 1.00 44.25  ? 211  LEU A N   1 
ATOM   1609 C CA  . LEU A 1 211 ? 6.668   53.972 45.295 1.00 44.25  ? 211  LEU A CA  1 
ATOM   1610 C C   . LEU A 1 211 ? 5.424   53.304 44.701 1.00 44.25  ? 211  LEU A C   1 
ATOM   1611 O O   . LEU A 1 211 ? 5.522   52.279 44.024 1.00 44.25  ? 211  LEU A O   1 
ATOM   1612 C CB  . LEU A 1 211 ? 6.859   53.460 46.723 1.00 36.63  ? 211  LEU A CB  1 
ATOM   1613 C CG  . LEU A 1 211 ? 8.114   53.869 47.488 1.00 36.63  ? 211  LEU A CG  1 
ATOM   1614 C CD1 . LEU A 1 211 ? 8.012   53.376 48.907 1.00 36.63  ? 211  LEU A CD1 1 
ATOM   1615 C CD2 . LEU A 1 211 ? 9.330   53.288 46.829 1.00 36.63  ? 211  LEU A CD2 1 
ATOM   1616 N N   . SER A 1 212 ? 4.258   53.881 44.965 1.00 45.20  ? 212  SER A N   1 
ATOM   1617 C CA  . SER A 1 212 ? 2.991   53.343 44.478 1.00 45.20  ? 212  SER A CA  1 
ATOM   1618 C C   . SER A 1 212 ? 2.748   53.523 42.976 1.00 45.20  ? 212  SER A C   1 
ATOM   1619 O O   . SER A 1 212 ? 2.728   54.649 42.472 1.00 45.20  ? 212  SER A O   1 
ATOM   1620 C CB  . SER A 1 212 ? 1.850   53.992 45.247 1.00 50.57  ? 212  SER A CB  1 
ATOM   1621 O OG  . SER A 1 212 ? 0.625   53.833 44.562 1.00 50.57  ? 212  SER A OG  1 
ATOM   1622 N N   . PRO A 1 213 ? 2.529   52.417 42.244 1.00 47.77  ? 213  PRO A N   1 
ATOM   1623 C CA  . PRO A 1 213 ? 2.286   52.494 40.796 1.00 47.77  ? 213  PRO A CA  1 
ATOM   1624 C C   . PRO A 1 213 ? 1.149   53.437 40.416 1.00 47.77  ? 213  PRO A C   1 
ATOM   1625 O O   . PRO A 1 213 ? 1.253   54.182 39.445 1.00 47.77  ? 213  PRO A O   1 
ATOM   1626 C CB  . PRO A 1 213 ? 1.978   51.051 40.422 1.00 29.51  ? 213  PRO A CB  1 
ATOM   1627 C CG  . PRO A 1 213 ? 2.813   50.284 41.399 1.00 29.51  ? 213  PRO A CG  1 
ATOM   1628 C CD  . PRO A 1 213 ? 2.572   51.015 42.693 1.00 29.51  ? 213  PRO A CD  1 
ATOM   1629 N N   . GLY A 1 214 ? 0.067   53.408 41.187 1.00 43.87  ? 214  GLY A N   1 
ATOM   1630 C CA  . GLY A 1 214 ? -1.068  54.263 40.886 1.00 43.87  ? 214  GLY A CA  1 
ATOM   1631 C C   . GLY A 1 214 ? -0.895  55.779 40.944 1.00 43.87  ? 214  GLY A C   1 
ATOM   1632 O O   . GLY A 1 214 ? -1.710  56.499 40.382 1.00 43.87  ? 214  GLY A O   1 
ATOM   1633 N N   . SER A 1 215 ? 0.145   56.285 41.600 1.00 47.00  ? 215  SER A N   1 
ATOM   1634 C CA  . SER A 1 215 ? 0.323   57.733 41.710 1.00 47.00  ? 215  SER A CA  1 
ATOM   1635 C C   . SER A 1 215 ? 1.483   58.296 40.906 1.00 47.00  ? 215  SER A C   1 
ATOM   1636 O O   . SER A 1 215 ? 1.536   59.489 40.648 1.00 47.00  ? 215  SER A O   1 
ATOM   1637 C CB  . SER A 1 215 ? 0.540   58.126 43.178 1.00 41.23  ? 215  SER A CB  1 
ATOM   1638 O OG  . SER A 1 215 ? -0.469  57.618 44.030 1.00 41.23  ? 215  SER A OG  1 
ATOM   1639 N N   . ARG A 1 216 ? 2.412   57.437 40.513 1.00 39.66  ? 216  ARG A N   1 
ATOM   1640 C CA  . ARG A 1 216 ? 3.613   57.863 39.799 1.00 39.66  ? 216  ARG A CA  1 
ATOM   1641 C C   . ARG A 1 216 ? 3.429   58.851 38.652 1.00 39.66  ? 216  ARG A C   1 
ATOM   1642 O O   . ARG A 1 216 ? 4.200   59.796 38.525 1.00 39.66  ? 216  ARG A O   1 
ATOM   1643 C CB  . ARG A 1 216 ? 4.389   56.634 39.295 1.00 40.96  ? 216  ARG A CB  1 
ATOM   1644 C CG  . ARG A 1 216 ? 4.318   55.420 40.227 1.00 40.96  ? 216  ARG A CG  1 
ATOM   1645 C CD  . ARG A 1 216 ? 5.689   54.881 40.612 1.00 40.96  ? 216  ARG A CD  1 
ATOM   1646 N NE  . ARG A 1 216 ? 6.223   53.878 39.690 1.00 40.96  ? 216  ARG A NE  1 
ATOM   1647 C CZ  . ARG A 1 216 ? 6.404   52.592 39.995 1.00 40.96  ? 216  ARG A CZ  1 
ATOM   1648 N NH1 . ARG A 1 216 ? 6.094   52.131 41.202 1.00 40.96  ? 216  ARG A NH1 1 
ATOM   1649 N NH2 . ARG A 1 216 ? 6.909   51.765 39.090 1.00 40.96  ? 216  ARG A NH2 1 
ATOM   1650 N N   . ASP A 1 217 ? 2.406   58.659 37.830 1.00 42.95  ? 217  ASP A N   1 
ATOM   1651 C CA  . ASP A 1 217 ? 2.208   59.541 36.678 1.00 42.95  ? 217  ASP A CA  1 
ATOM   1652 C C   . ASP A 1 217 ? 1.564   60.899 36.986 1.00 42.95  ? 217  ASP A C   1 
ATOM   1653 O O   . ASP A 1 217 ? 1.361   61.704 36.079 1.00 42.95  ? 217  ASP A O   1 
ATOM   1654 C CB  . ASP A 1 217 ? 1.365   58.825 35.598 1.00 65.34  ? 217  ASP A CB  1 
ATOM   1655 C CG  . ASP A 1 217 ? 1.804   57.355 35.341 1.00 65.34  ? 217  ASP A CG  1 
ATOM   1656 O OD1 . ASP A 1 217 ? 2.985   57.008 35.597 1.00 65.34  ? 217  ASP A OD1 1 
ATOM   1657 O OD2 . ASP A 1 217 ? 0.962   56.544 34.860 1.00 65.34  ? 217  ASP A OD2 1 
ATOM   1658 N N   . LEU A 1 218 ? 1.265   61.170 38.253 1.00 40.16  ? 218  LEU A N   1 
ATOM   1659 C CA  . LEU A 1 218 ? 0.600   62.418 38.615 1.00 40.16  ? 218  LEU A CA  1 
ATOM   1660 C C   . LEU A 1 218 ? 1.438   63.609 39.072 1.00 40.16  ? 218  LEU A C   1 
ATOM   1661 O O   . LEU A 1 218 ? 0.880   64.635 39.460 1.00 40.16  ? 218  LEU A O   1 
ATOM   1662 C CB  . LEU A 1 218 ? -0.471  62.143 39.667 1.00 41.61  ? 218  LEU A CB  1 
ATOM   1663 C CG  . LEU A 1 218 ? -1.660  61.312 39.177 1.00 41.61  ? 218  LEU A CG  1 
ATOM   1664 C CD1 . LEU A 1 218 ? -2.718  61.180 40.279 1.00 41.61  ? 218  LEU A CD1 1 
ATOM   1665 C CD2 . LEU A 1 218 ? -2.248  61.971 37.949 1.00 41.61  ? 218  LEU A CD2 1 
ATOM   1666 N N   . PHE A 1 219 ? 2.759   63.484 39.045 1.00 26.73  ? 219  PHE A N   1 
ATOM   1667 C CA  . PHE A 1 219 ? 3.629   64.584 39.430 1.00 26.73  ? 219  PHE A CA  1 
ATOM   1668 C C   . PHE A 1 219 ? 4.965   64.427 38.732 1.00 26.73  ? 219  PHE A C   1 
ATOM   1669 O O   . PHE A 1 219 ? 5.292   63.355 38.241 1.00 26.73  ? 219  PHE A O   1 
ATOM   1670 C CB  . PHE A 1 219 ? 3.813   64.662 40.952 1.00 33.61  ? 219  PHE A CB  1 
ATOM   1671 C CG  . PHE A 1 219 ? 4.394   63.430 41.563 1.00 33.61  ? 219  PHE A CG  1 
ATOM   1672 C CD1 . PHE A 1 219 ? 3.598   62.314 41.803 1.00 33.61  ? 219  PHE A CD1 1 
ATOM   1673 C CD2 . PHE A 1 219 ? 5.743   63.372 41.879 1.00 33.61  ? 219  PHE A CD2 1 
ATOM   1674 C CE1 . PHE A 1 219 ? 4.138   61.157 42.347 1.00 33.61  ? 219  PHE A CE1 1 
ATOM   1675 C CE2 . PHE A 1 219 ? 6.298   62.218 42.424 1.00 33.61  ? 219  PHE A CE2 1 
ATOM   1676 C CZ  . PHE A 1 219 ? 5.494   61.108 42.658 1.00 33.61  ? 219  PHE A CZ  1 
ATOM   1677 N N   . ARG A 1 220 ? 5.730   65.508 38.688 1.00 38.37  ? 220  ARG A N   1 
ATOM   1678 C CA  . ARG A 1 220 ? 7.018   65.531 38.010 1.00 38.37  ? 220  ARG A CA  1 
ATOM   1679 C C   . ARG A 1 220 ? 8.198   65.288 38.949 1.00 38.37  ? 220  ARG A C   1 
ATOM   1680 O O   . ARG A 1 220 ? 9.029   64.411 38.706 1.00 38.37  ? 220  ARG A O   1 
ATOM   1681 C CB  . ARG A 1 220 ? 7.156   66.885 37.300 1.00 46.20  ? 220  ARG A CB  1 
ATOM   1682 C CG  . ARG A 1 220 ? 8.453   67.154 36.572 1.00 46.20  ? 220  ARG A CG  1 
ATOM   1683 C CD  . ARG A 1 220 ? 8.719   66.124 35.515 1.00 46.20  ? 220  ARG A CD  1 
ATOM   1684 N NE  . ARG A 1 220 ? 9.697   66.570 34.524 1.00 46.20  ? 220  ARG A NE  1 
ATOM   1685 C CZ  . ARG A 1 220 ? 9.440   67.442 33.552 1.00 46.20  ? 220  ARG A CZ  1 
ATOM   1686 N NH1 . ARG A 1 220 ? 8.229   67.983 33.432 1.00 46.20  ? 220  ARG A NH1 1 
ATOM   1687 N NH2 . ARG A 1 220 ? 10.389  67.749 32.676 1.00 46.20  ? 220  ARG A NH2 1 
ATOM   1688 N N   . ARG A 1 221 ? 8.256   66.060 40.027 1.00 34.22  ? 221  ARG A N   1 
ATOM   1689 C CA  . ARG A 1 221 ? 9.334   65.964 40.997 1.00 34.22  ? 221  ARG A CA  1 
ATOM   1690 C C   . ARG A 1 221 ? 8.790   65.893 42.406 1.00 34.22  ? 221  ARG A C   1 
ATOM   1691 O O   . ARG A 1 221 ? 7.588   66.041 42.622 1.00 34.22  ? 221  ARG A O   1 
ATOM   1692 C CB  . ARG A 1 221 ? 10.228  67.186 40.894 1.00 39.18  ? 221  ARG A CB  1 
ATOM   1693 C CG  . ARG A 1 221 ? 11.110  67.224 39.693 1.00 39.18  ? 221  ARG A CG  1 
ATOM   1694 C CD  . ARG A 1 221 ? 11.899  68.490 39.744 1.00 39.18  ? 221  ARG A CD  1 
ATOM   1695 N NE  . ARG A 1 221 ? 11.362  69.463 38.818 1.00 39.18  ? 221  ARG A NE  1 
ATOM   1696 C CZ  . ARG A 1 221 ? 11.569  69.414 37.512 1.00 39.18  ? 221  ARG A CZ  1 
ATOM   1697 N NH1 . ARG A 1 221 ? 12.305  68.444 36.990 1.00 39.18  ? 221  ARG A NH1 1 
ATOM   1698 N NH2 . ARG A 1 221 ? 11.025  70.325 36.727 1.00 39.18  ? 221  ARG A NH2 1 
ATOM   1699 N N   . ALA A 1 222 ? 9.689   65.699 43.370 1.00 33.74  ? 222  ALA A N   1 
ATOM   1700 C CA  . ALA A 1 222 ? 9.287   65.603 44.764 1.00 33.74  ? 222  ALA A CA  1 
ATOM   1701 C C   . ALA A 1 222 ? 10.313  66.132 45.748 1.00 33.74  ? 222  ALA A C   1 
ATOM   1702 O O   . ALA A 1 222 ? 11.514  66.060 45.511 1.00 33.74  ? 222  ALA A O   1 
ATOM   1703 C CB  . ALA A 1 222 ? 8.968   64.168 45.095 1.00 21.51  ? 222  ALA A CB  1 
ATOM   1704 N N   . ILE A 1 223 ? 9.812   66.670 46.855 1.00 37.96  ? 223  ILE A N   1 
ATOM   1705 C CA  . ILE A 1 223 ? 10.637  67.190 47.943 1.00 37.96  ? 223  ILE A CA  1 
ATOM   1706 C C   . ILE A 1 223 ? 10.144  66.516 49.228 1.00 37.96  ? 223  ILE A C   1 
ATOM   1707 O O   . ILE A 1 223 ? 8.956   66.554 49.529 1.00 37.96  ? 223  ILE A O   1 
ATOM   1708 C CB  . ILE A 1 223 ? 10.476  68.711 48.103 1.00 25.16  ? 223  ILE A CB  1 
ATOM   1709 C CG1 . ILE A 1 223 ? 10.886  69.415 46.821 1.00 25.16  ? 223  ILE A CG1 1 
ATOM   1710 C CG2 . ILE A 1 223 ? 11.329  69.210 49.242 1.00 25.16  ? 223  ILE A CG2 1 
ATOM   1711 C CD1 . ILE A 1 223 ? 10.655  70.890 46.860 1.00 25.16  ? 223  ILE A CD1 1 
ATOM   1712 N N   . LEU A 1 224 ? 11.043  65.884 49.973 1.00 34.83  ? 224  LEU A N   1 
ATOM   1713 C CA  . LEU A 1 224 ? 10.665  65.216 51.219 1.00 34.83  ? 224  LEU A CA  1 
ATOM   1714 C C   . LEU A 1 224 ? 11.401  65.845 52.390 1.00 34.83  ? 224  LEU A C   1 
ATOM   1715 O O   . LEU A 1 224 ? 12.623  65.884 52.404 1.00 34.83  ? 224  LEU A O   1 
ATOM   1716 C CB  . LEU A 1 224 ? 11.012  63.723 51.170 1.00 33.44  ? 224  LEU A CB  1 
ATOM   1717 C CG  . LEU A 1 224 ? 10.368  62.798 50.135 1.00 33.44  ? 224  LEU A CG  1 
ATOM   1718 C CD1 . LEU A 1 224 ? 10.909  63.094 48.748 1.00 33.44  ? 224  LEU A CD1 1 
ATOM   1719 C CD2 . LEU A 1 224 ? 10.663  61.358 50.524 1.00 33.44  ? 224  LEU A CD2 1 
ATOM   1720 N N   . GLN A 1 225 ? 10.664  66.324 53.383 1.00 33.54  ? 225  GLN A N   1 
ATOM   1721 C CA  . GLN A 1 225 ? 11.289  66.949 54.538 1.00 33.54  ? 225  GLN A CA  1 
ATOM   1722 C C   . GLN A 1 225 ? 11.078  66.152 55.815 1.00 33.54  ? 225  GLN A C   1 
ATOM   1723 O O   . GLN A 1 225 ? 9.959   65.857 56.205 1.00 33.54  ? 225  GLN A O   1 
ATOM   1724 C CB  . GLN A 1 225 ? 10.738  68.357 54.722 1.00 41.47  ? 225  GLN A CB  1 
ATOM   1725 C CG  . GLN A 1 225 ? 10.795  69.191 53.465 1.00 41.47  ? 225  GLN A CG  1 
ATOM   1726 C CD  . GLN A 1 225 ? 10.104  70.529 53.620 1.00 41.47  ? 225  GLN A CD  1 
ATOM   1727 O OE1 . GLN A 1 225 ? 9.715   71.157 52.636 1.00 41.47  ? 225  GLN A OE1 1 
ATOM   1728 N NE2 . GLN A 1 225 ? 9.952   70.979 54.859 1.00 41.47  ? 225  GLN A NE2 1 
ATOM   1729 N N   . SER A 1 226 ? 12.169  65.782 56.459 1.00 49.06  ? 226  SER A N   1 
ATOM   1730 C CA  . SER A 1 226 ? 12.089  65.061 57.718 1.00 49.06  ? 226  SER A CA  1 
ATOM   1731 C C   . SER A 1 226 ? 11.143  63.869 57.691 1.00 49.06  ? 226  SER A C   1 
ATOM   1732 O O   . SER A 1 226 ? 10.402  63.645 58.646 1.00 49.06  ? 226  SER A O   1 
ATOM   1733 C CB  . SER A 1 226 ? 11.646  66.025 58.828 1.00 53.00  ? 226  SER A CB  1 
ATOM   1734 O OG  . SER A 1 226 ? 12.454  67.195 58.862 1.00 53.00  ? 226  SER A OG  1 
ATOM   1735 N N   . GLY A 1 227 ? 11.159  63.097 56.613 1.00 43.39  ? 227  GLY A N   1 
ATOM   1736 C CA  . GLY A 1 227 ? 10.282  61.946 56.567 1.00 43.39  ? 227  GLY A CA  1 
ATOM   1737 C C   . GLY A 1 227 ? 10.421  61.158 55.294 1.00 43.39  ? 227  GLY A C   1 
ATOM   1738 O O   . GLY A 1 227 ? 10.565  61.740 54.230 1.00 43.39  ? 227  GLY A O   1 
ATOM   1739 N N   . SER A 1 228 ? 10.393  59.834 55.399 1.00 41.42  ? 228  SER A N   1 
ATOM   1740 C CA  . SER A 1 228 ? 10.497  58.970 54.230 1.00 41.42  ? 228  SER A CA  1 
ATOM   1741 C C   . SER A 1 228 ? 9.565   57.780 54.433 1.00 41.42  ? 228  SER A C   1 
ATOM   1742 O O   . SER A 1 228 ? 9.274   57.403 55.554 1.00 41.42  ? 228  SER A O   1 
ATOM   1743 C CB  . SER A 1 228 ? 11.936  58.505 54.029 1.00 46.08  ? 228  SER A CB  1 
ATOM   1744 O OG  . SER A 1 228 ? 12.336  57.638 55.062 1.00 46.08  ? 228  SER A OG  1 
ATOM   1745 N N   . PRO A 1 229 ? 9.100   57.163 53.342 1.00 40.63  ? 229  PRO A N   1 
ATOM   1746 C CA  . PRO A 1 229 ? 8.183   56.017 53.388 1.00 40.63  ? 229  PRO A CA  1 
ATOM   1747 C C   . PRO A 1 229 ? 8.572   54.829 54.256 1.00 40.63  ? 229  PRO A C   1 
ATOM   1748 O O   . PRO A 1 229 ? 7.716   54.180 54.852 1.00 40.63  ? 229  PRO A O   1 
ATOM   1749 C CB  . PRO A 1 229 ? 8.050   55.635 51.918 1.00 42.35  ? 229  PRO A CB  1 
ATOM   1750 C CG  . PRO A 1 229 ? 9.409   55.984 51.367 1.00 42.35  ? 229  PRO A CG  1 
ATOM   1751 C CD  . PRO A 1 229 ? 9.654   57.333 51.985 1.00 42.35  ? 229  PRO A CD  1 
ATOM   1752 N N   . ASN A 1 230 ? 9.861   54.547 54.334 1.00 36.28  ? 230  ASN A N   1 
ATOM   1753 C CA  . ASN A 1 230 ? 10.327  53.412 55.108 1.00 36.28  ? 230  ASN A CA  1 
ATOM   1754 C C   . ASN A 1 230 ? 10.645  53.719 56.568 1.00 36.28  ? 230  ASN A C   1 
ATOM   1755 O O   . ASN A 1 230 ? 11.486  53.061 57.175 1.00 36.28  ? 230  ASN A O   1 
ATOM   1756 C CB  . ASN A 1 230 ? 11.549  52.804 54.423 1.00 45.79  ? 230  ASN A CB  1 
ATOM   1757 C CG  . ASN A 1 230 ? 12.722  53.751 54.386 1.00 45.79  ? 230  ASN A CG  1 
ATOM   1758 O OD1 . ASN A 1 230 ? 12.551  54.955 54.211 1.00 45.79  ? 230  ASN A OD1 1 
ATOM   1759 N ND2 . ASN A 1 230 ? 13.927  53.213 54.541 1.00 45.79  ? 230  ASN A ND2 1 
ATOM   1760 N N   . CYS A 1 231 ? 9.977   54.715 57.139 1.00 36.18  ? 231  CYS A N   1 
ATOM   1761 C CA  . CYS A 1 231 ? 10.201  55.057 58.543 1.00 36.18  ? 231  CYS A CA  1 
ATOM   1762 C C   . CYS A 1 231 ? 9.448   54.025 59.390 1.00 36.18  ? 231  CYS A C   1 
ATOM   1763 O O   . CYS A 1 231 ? 8.356   53.612 59.027 1.00 36.18  ? 231  CYS A O   1 
ATOM   1764 C CB  . CYS A 1 231 ? 9.688   56.477 58.835 1.00 42.43  ? 231  CYS A CB  1 
ATOM   1765 S SG  . CYS A 1 231 ? 10.729  57.857 58.214 1.00 42.43  ? 231  CYS A SG  1 
ATOM   1766 N N   . PRO A 1 232 ? 10.014  53.607 60.535 1.00 30.72  ? 232  PRO A N   1 
ATOM   1767 C CA  . PRO A 1 232 ? 9.366   52.613 61.401 1.00 30.72  ? 232  PRO A CA  1 
ATOM   1768 C C   . PRO A 1 232 ? 7.955   52.943 61.909 1.00 30.72  ? 232  PRO A C   1 
ATOM   1769 O O   . PRO A 1 232 ? 7.255   52.067 62.406 1.00 30.72  ? 232  PRO A O   1 
ATOM   1770 C CB  . PRO A 1 232 ? 10.373  52.452 62.542 1.00 25.86  ? 232  PRO A CB  1 
ATOM   1771 C CG  . PRO A 1 232 ? 10.969  53.800 62.655 1.00 25.86  ? 232  PRO A CG  1 
ATOM   1772 C CD  . PRO A 1 232 ? 11.196  54.184 61.205 1.00 25.86  ? 232  PRO A CD  1 
ATOM   1773 N N   . TRP A 1 233 ? 7.535   54.195 61.767 1.00 32.11  ? 233  TRP A N   1 
ATOM   1774 C CA  . TRP A 1 233 ? 6.221   54.621 62.240 1.00 32.11  ? 233  TRP A CA  1 
ATOM   1775 C C   . TRP A 1 233 ? 5.204   54.885 61.139 1.00 32.11  ? 233  TRP A C   1 
ATOM   1776 O O   . TRP A 1 233 ? 4.023   55.023 61.419 1.00 32.11  ? 233  TRP A O   1 
ATOM   1777 C CB  . TRP A 1 233 ? 6.360   55.899 63.059 1.00 38.04  ? 233  TRP A CB  1 
ATOM   1778 C CG  . TRP A 1 233 ? 7.162   56.952 62.349 1.00 38.04  ? 233  TRP A CG  1 
ATOM   1779 C CD1 . TRP A 1 233 ? 8.494   57.198 62.492 1.00 38.04  ? 233  TRP A CD1 1 
ATOM   1780 C CD2 . TRP A 1 233 ? 6.693   57.867 61.356 1.00 38.04  ? 233  TRP A CD2 1 
ATOM   1781 N NE1 . TRP A 1 233 ? 8.887   58.208 61.653 1.00 38.04  ? 233  TRP A NE1 1 
ATOM   1782 C CE2 . TRP A 1 233 ? 7.800   58.638 60.943 1.00 38.04  ? 233  TRP A CE2 1 
ATOM   1783 C CE3 . TRP A 1 233 ? 5.446   58.112 60.774 1.00 38.04  ? 233  TRP A CE3 1 
ATOM   1784 C CZ2 . TRP A 1 233 ? 7.698   59.637 59.973 1.00 38.04  ? 233  TRP A CZ2 1 
ATOM   1785 C CZ3 . TRP A 1 233 ? 5.344   59.109 59.807 1.00 38.04  ? 233  TRP A CZ3 1 
ATOM   1786 C CH2 . TRP A 1 233 ? 6.465   59.858 59.419 1.00 38.04  ? 233  TRP A CH2 1 
ATOM   1787 N N   . ALA A 1 234 ? 5.667   54.951 59.897 1.00 31.36  ? 234  ALA A N   1 
ATOM   1788 C CA  . ALA A 1 234 ? 4.814   55.256 58.762 1.00 31.36  ? 234  ALA A CA  1 
ATOM   1789 C C   . ALA A 1 234 ? 3.960   54.148 58.174 1.00 31.36  ? 234  ALA A C   1 
ATOM   1790 O O   . ALA A 1 234 ? 3.126   54.424 57.324 1.00 31.36  ? 234  ALA A O   1 
ATOM   1791 C CB  . ALA A 1 234 ? 5.644   55.875 57.675 1.00 20.11  ? 234  ALA A CB  1 
ATOM   1792 N N   . SER A 1 235 ? 4.152   52.901 58.592 1.00 38.73  ? 235  SER A N   1 
ATOM   1793 C CA  . SER A 1 235 ? 3.326   51.820 58.055 1.00 38.73  ? 235  SER A CA  1 
ATOM   1794 C C   . SER A 1 235 ? 3.313   50.548 58.885 1.00 38.73  ? 235  SER A C   1 
ATOM   1795 O O   . SER A 1 235 ? 4.192   50.320 59.699 1.00 38.73  ? 235  SER A O   1 
ATOM   1796 C CB  . SER A 1 235 ? 3.741   51.482 56.625 1.00 36.99  ? 235  SER A CB  1 
ATOM   1797 O OG  . SER A 1 235 ? 5.015   50.884 56.587 1.00 36.99  ? 235  SER A OG  1 
ATOM   1798 N N   . VAL A 1 236 ? 2.295   49.726 58.672 1.00 31.24  ? 236  VAL A N   1 
ATOM   1799 C CA  . VAL A 1 236 ? 2.144   48.474 59.398 1.00 31.24  ? 236  VAL A CA  1 
ATOM   1800 C C   . VAL A 1 236 ? 1.756   47.354 58.445 1.00 31.24  ? 236  VAL A C   1 
ATOM   1801 O O   . VAL A 1 236 ? 1.434   47.591 57.288 1.00 31.24  ? 236  VAL A O   1 
ATOM   1802 C CB  . VAL A 1 236 ? 1.040   48.579 60.494 1.00 30.79  ? 236  VAL A CB  1 
ATOM   1803 C CG1 . VAL A 1 236 ? 1.396   49.655 61.496 1.00 30.79  ? 236  VAL A CG1 1 
ATOM   1804 C CG2 . VAL A 1 236 ? -0.310  48.872 59.857 1.00 30.79  ? 236  VAL A CG2 1 
ATOM   1805 N N   . SER A 1 237 ? 1.790   46.128 58.942 1.00 33.10  ? 237  SER A N   1 
ATOM   1806 C CA  . SER A 1 237 ? 1.422   44.974 58.139 1.00 33.10  ? 237  SER A CA  1 
ATOM   1807 C C   . SER A 1 237 ? -0.090  44.871 58.211 1.00 33.10  ? 237  SER A C   1 
ATOM   1808 O O   . SER A 1 237 ? -0.704  45.446 59.109 1.00 33.10  ? 237  SER A O   1 
ATOM   1809 C CB  . SER A 1 237 ? 2.039   43.713 58.724 1.00 35.96  ? 237  SER A CB  1 
ATOM   1810 O OG  . SER A 1 237 ? 1.510   43.462 60.017 1.00 35.96  ? 237  SER A OG  1 
ATOM   1811 N N   . VAL A 1 238 ? -0.695  44.137 57.286 1.00 35.80  ? 238  VAL A N   1 
ATOM   1812 C CA  . VAL A 1 238 ? -2.139  43.996 57.295 1.00 35.80  ? 238  VAL A CA  1 
ATOM   1813 C C   . VAL A 1 238 ? -2.575  43.324 58.580 1.00 35.80  ? 238  VAL A C   1 
ATOM   1814 O O   . VAL A 1 238 ? -3.661  43.593 59.089 1.00 35.80  ? 238  VAL A O   1 
ATOM   1815 C CB  . VAL A 1 238 ? -2.618  43.174 56.114 1.00 37.97  ? 238  VAL A CB  1 
ATOM   1816 C CG1 . VAL A 1 238 ? -2.142  43.811 54.828 1.00 37.97  ? 238  VAL A CG1 1 
ATOM   1817 C CG2 . VAL A 1 238 ? -2.091  41.787 56.218 1.00 37.97  ? 238  VAL A CG2 1 
ATOM   1818 N N   . ALA A 1 239 ? -1.714  42.464 59.114 1.00 39.30  ? 239  ALA A N   1 
ATOM   1819 C CA  . ALA A 1 239 ? -2.003  41.750 60.355 1.00 39.30  ? 239  ALA A CA  1 
ATOM   1820 C C   . ALA A 1 239 ? -2.094  42.685 61.550 1.00 39.30  ? 239  ALA A C   1 
ATOM   1821 O O   . ALA A 1 239 ? -3.006  42.560 62.363 1.00 39.30  ? 239  ALA A O   1 
ATOM   1822 C CB  . ALA A 1 239 ? -0.948  40.703 60.611 1.00 33.70  ? 239  ALA A CB  1 
ATOM   1823 N N   . GLU A 1 240 ? -1.139  43.609 61.672 1.00 42.63  ? 240  GLU A N   1 
ATOM   1824 C CA  . GLU A 1 240 ? -1.150  44.565 62.781 1.00 42.63  ? 240  GLU A CA  1 
ATOM   1825 C C   . GLU A 1 240 ? -2.246  45.594 62.539 1.00 42.63  ? 240  GLU A C   1 
ATOM   1826 O O   . GLU A 1 240 ? -2.818  46.139 63.479 1.00 42.63  ? 240  GLU A O   1 
ATOM   1827 C CB  . GLU A 1 240 ? 0.207   45.258 62.916 1.00 57.08  ? 240  GLU A CB  1 
ATOM   1828 C CG  . GLU A 1 240 ? 0.294   46.324 64.028 1.00 57.08  ? 240  GLU A CG  1 
ATOM   1829 C CD  . GLU A 1 240 ? -0.186  45.861 65.425 1.00 57.08  ? 240  GLU A CD  1 
ATOM   1830 O OE1 . GLU A 1 240 ? -0.050  44.670 65.773 1.00 57.08  ? 240  GLU A OE1 1 
ATOM   1831 O OE2 . GLU A 1 240 ? -0.687  46.712 66.193 1.00 57.08  ? 240  GLU A OE2 1 
ATOM   1832 N N   . GLY A 1 241 ? -2.540  45.851 61.269 1.00 38.94  ? 241  GLY A N   1 
ATOM   1833 C CA  . GLY A 1 241 ? -3.593  46.792 60.946 1.00 38.94  ? 241  GLY A CA  1 
ATOM   1834 C C   . GLY A 1 241 ? -4.909  46.184 61.381 1.00 38.94  ? 241  GLY A C   1 
ATOM   1835 O O   . GLY A 1 241 ? -5.767  46.852 61.948 1.00 38.94  ? 241  GLY A O   1 
ATOM   1836 N N   . ARG A 1 242 ? -5.064  44.894 61.117 1.00 40.29  ? 242  ARG A N   1 
ATOM   1837 C CA  . ARG A 1 242 ? -6.278  44.201 61.496 1.00 40.29  ? 242  ARG A CA  1 
ATOM   1838 C C   . ARG A 1 242 ? -6.370  44.097 63.019 1.00 40.29  ? 242  ARG A C   1 
ATOM   1839 O O   . ARG A 1 242 ? -7.433  44.287 63.604 1.00 40.29  ? 242  ARG A O   1 
ATOM   1840 C CB  . ARG A 1 242 ? -6.302  42.813 60.856 1.00 47.70  ? 242  ARG A CB  1 
ATOM   1841 C CG  . ARG A 1 242 ? -7.531  41.982 61.216 1.00 47.70  ? 242  ARG A CG  1 
ATOM   1842 C CD  . ARG A 1 242 ? -7.632  40.721 60.363 1.00 47.70  ? 242  ARG A CD  1 
ATOM   1843 N NE  . ARG A 1 242 ? -8.176  40.986 59.031 1.00 47.70  ? 242  ARG A NE  1 
ATOM   1844 C CZ  . ARG A 1 242 ? -9.461  41.251 58.784 1.00 47.70  ? 242  ARG A CZ  1 
ATOM   1845 N NH1 . ARG A 1 242 ? -10.350 41.289 59.778 1.00 47.70  ? 242  ARG A NH1 1 
ATOM   1846 N NH2 . ARG A 1 242 ? -9.863  41.470 57.535 1.00 47.70  ? 242  ARG A NH2 1 
ATOM   1847 N N   . ARG A 1 243 ? -5.247  43.811 63.661 1.00 33.66  ? 243  ARG A N   1 
ATOM   1848 C CA  . ARG A 1 243 ? -5.216  43.689 65.104 1.00 33.66  ? 243  ARG A CA  1 
ATOM   1849 C C   . ARG A 1 243 ? -5.672  44.981 65.780 1.00 33.66  ? 243  ARG A C   1 
ATOM   1850 O O   . ARG A 1 243 ? -6.421  44.943 66.751 1.00 33.66  ? 243  ARG A O   1 
ATOM   1851 C CB  . ARG A 1 243 ? -3.809  43.341 65.555 1.00 42.78  ? 243  ARG A CB  1 
ATOM   1852 C CG  . ARG A 1 243 ? -3.711  42.939 66.999 1.00 42.78  ? 243  ARG A CG  1 
ATOM   1853 C CD  . ARG A 1 243 ? -2.517  43.601 67.643 1.00 42.78  ? 243  ARG A CD  1 
ATOM   1854 N NE  . ARG A 1 243 ? -2.943  44.372 68.801 1.00 42.78  ? 243  ARG A NE  1 
ATOM   1855 C CZ  . ARG A 1 243 ? -2.476  45.573 69.121 1.00 42.78  ? 243  ARG A CZ  1 
ATOM   1856 N NH1 . ARG A 1 243 ? -1.555  46.153 68.364 1.00 42.78  ? 243  ARG A NH1 1 
ATOM   1857 N NH2 . ARG A 1 243 ? -2.940  46.196 70.200 1.00 42.78  ? 243  ARG A NH2 1 
ATOM   1858 N N   . ARG A 1 244 ? -5.226  46.124 65.264 1.00 34.09  ? 244  ARG A N   1 
ATOM   1859 C CA  . ARG A 1 244 ? -5.606  47.418 65.830 1.00 34.09  ? 244  ARG A CA  1 
ATOM   1860 C C   . ARG A 1 244 ? -7.042  47.806 65.503 1.00 34.09  ? 244  ARG A C   1 
ATOM   1861 O O   . ARG A 1 244 ? -7.690  48.496 66.283 1.00 34.09  ? 244  ARG A O   1 
ATOM   1862 C CB  . ARG A 1 244 ? -4.670  48.530 65.338 1.00 35.06  ? 244  ARG A CB  1 
ATOM   1863 C CG  . ARG A 1 244 ? -3.234  48.407 65.815 1.00 35.06  ? 244  ARG A CG  1 
ATOM   1864 C CD  . ARG A 1 244 ? -2.361  49.522 65.271 1.00 35.06  ? 244  ARG A CD  1 
ATOM   1865 N NE  . ARG A 1 244 ? -0.950  49.219 65.472 1.00 35.06  ? 244  ARG A NE  1 
ATOM   1866 C CZ  . ARG A 1 244 ? 0.055   50.023 65.151 1.00 35.06  ? 244  ARG A CZ  1 
ATOM   1867 N NH1 . ARG A 1 244 ? -0.169  51.209 64.601 1.00 35.06  ? 244  ARG A NH1 1 
ATOM   1868 N NH2 . ARG A 1 244 ? 1.294   49.637 65.393 1.00 35.06  ? 244  ARG A NH2 1 
ATOM   1869 N N   . ALA A 1 245 ? -7.532  47.376 64.345 1.00 35.55  ? 245  ALA A N   1 
ATOM   1870 C CA  . ALA A 1 245 ? -8.900  47.680 63.929 1.00 35.55  ? 245  ALA A CA  1 
ATOM   1871 C C   . ALA A 1 245 ? -9.867  47.064 64.927 1.00 35.55  ? 245  ALA A C   1 
ATOM   1872 O O   . ALA A 1 245 ? -10.812 47.703 65.390 1.00 35.55  ? 245  ALA A O   1 
ATOM   1873 C CB  . ALA A 1 245 ? -9.154  47.110 62.559 1.00 50.44  ? 245  ALA A CB  1 
ATOM   1874 N N   . VAL A 1 246 ? -9.607  45.803 65.247 1.00 47.76  ? 246  VAL A N   1 
ATOM   1875 C CA  . VAL A 1 246 ? -10.407 45.052 66.195 1.00 47.76  ? 246  VAL A CA  1 
ATOM   1876 C C   . VAL A 1 246 ? -10.354 45.641 67.604 1.00 47.76  ? 246  VAL A C   1 
ATOM   1877 O O   . VAL A 1 246 ? -11.395 45.894 68.214 1.00 47.76  ? 246  VAL A O   1 
ATOM   1878 C CB  . VAL A 1 246 ? -9.926  43.608 66.261 1.00 27.97  ? 246  VAL A CB  1 
ATOM   1879 C CG1 . VAL A 1 246 ? -10.703 42.858 67.328 1.00 27.97  ? 246  VAL A CG1 1 
ATOM   1880 C CG2 . VAL A 1 246 ? -10.076 42.960 64.897 1.00 27.97  ? 246  VAL A CG2 1 
ATOM   1881 N N   . GLU A 1 247 ? -9.142  45.842 68.118 1.00 37.70  ? 247  GLU A N   1 
ATOM   1882 C CA  . GLU A 1 247 ? -8.947  46.399 69.451 1.00 37.70  ? 247  GLU A CA  1 
ATOM   1883 C C   . GLU A 1 247 ? -9.676  47.734 69.559 1.00 37.70  ? 247  GLU A C   1 
ATOM   1884 O O   . GLU A 1 247 ? -10.254 48.042 70.597 1.00 37.70  ? 247  GLU A O   1 
ATOM   1885 C CB  . GLU A 1 247 ? -7.456  46.585 69.723 1.00 67.68  ? 247  GLU A CB  1 
ATOM   1886 C CG  . GLU A 1 247 ? -7.065  46.712 71.202 1.00 67.68  ? 247  GLU A CG  1 
ATOM   1887 C CD  . GLU A 1 247 ? -7.464  45.488 72.056 1.00 67.68  ? 247  GLU A CD  1 
ATOM   1888 O OE1 . GLU A 1 247 ? -7.450  44.347 71.521 1.00 67.68  ? 247  GLU A OE1 1 
ATOM   1889 O OE2 . GLU A 1 247 ? -7.777  45.673 73.264 1.00 67.68  ? 247  GLU A OE2 1 
ATOM   1890 N N   . LEU A 1 248 ? -9.654  48.530 68.491 1.00 39.07  ? 248  LEU A N   1 
ATOM   1891 C CA  . LEU A 1 248 ? -10.357 49.808 68.510 1.00 39.07  ? 248  LEU A CA  1 
ATOM   1892 C C   . LEU A 1 248 ? -11.820 49.496 68.781 1.00 39.07  ? 248  LEU A C   1 
ATOM   1893 O O   . LEU A 1 248 ? -12.450 50.112 69.640 1.00 39.07  ? 248  LEU A O   1 
ATOM   1894 C CB  . LEU A 1 248 ? -10.245 50.532 67.167 1.00 25.17  ? 248  LEU A CB  1 
ATOM   1895 C CG  . LEU A 1 248 ? -11.173 51.750 67.045 1.00 25.17  ? 248  LEU A CG  1 
ATOM   1896 C CD1 . LEU A 1 248 ? -10.716 52.814 68.013 1.00 25.17  ? 248  LEU A CD1 1 
ATOM   1897 C CD2 . LEU A 1 248 ? -11.180 52.293 65.629 1.00 25.17  ? 248  LEU A CD2 1 
ATOM   1898 N N   . GLY A 1 249 ? -12.347 48.523 68.040 1.00 40.16  ? 249  GLY A N   1 
ATOM   1899 C CA  . GLY A 1 249 ? -13.734 48.122 68.198 1.00 40.16  ? 249  GLY A CA  1 
ATOM   1900 C C   . GLY A 1 249 ? -14.013 47.528 69.562 1.00 40.16  ? 249  GLY A C   1 
ATOM   1901 O O   . GLY A 1 249 ? -15.128 47.603 70.063 1.00 40.16  ? 249  GLY A O   1 
ATOM   1902 N N   . ARG A 1 250 ? -12.997 46.936 70.170 1.00 44.57  ? 250  ARG A N   1 
ATOM   1903 C CA  . ARG A 1 250 ? -13.154 46.343 71.488 1.00 44.57  ? 250  ARG A CA  1 
ATOM   1904 C C   . ARG A 1 250 ? -13.288 47.424 72.583 1.00 44.57  ? 250  ARG A C   1 
ATOM   1905 O O   . ARG A 1 250 ? -13.945 47.206 73.601 1.00 44.57  ? 250  ARG A O   1 
ATOM   1906 C CB  . ARG A 1 250 ? -11.960 45.436 71.786 1.00 53.55  ? 250  ARG A CB  1 
ATOM   1907 C CG  . ARG A 1 250 ? -12.138 44.563 73.009 1.00 53.55  ? 250  ARG A CG  1 
ATOM   1908 C CD  . ARG A 1 250 ? -10.839 43.866 73.367 1.00 53.55  ? 250  ARG A CD  1 
ATOM   1909 N NE  . ARG A 1 250 ? -10.254 43.150 72.232 1.00 53.55  ? 250  ARG A NE  1 
ATOM   1910 C CZ  . ARG A 1 250 ? -10.795 42.083 71.646 1.00 53.55  ? 250  ARG A CZ  1 
ATOM   1911 N NH1 . ARG A 1 250 ? -11.951 41.590 72.078 1.00 53.55  ? 250  ARG A NH1 1 
ATOM   1912 N NH2 . ARG A 1 250 ? -10.164 41.492 70.636 1.00 53.55  ? 250  ARG A NH2 1 
ATOM   1913 N N   . ASN A 1 251 ? -12.665 48.583 72.371 1.00 47.06  ? 251  ASN A N   1 
ATOM   1914 C CA  . ASN A 1 251 ? -12.721 49.690 73.330 1.00 47.06  ? 251  ASN A CA  1 
ATOM   1915 C C   . ASN A 1 251 ? -14.082 50.405 73.312 1.00 47.06  ? 251  ASN A C   1 
ATOM   1916 O O   . ASN A 1 251 ? -14.470 51.068 74.284 1.00 47.06  ? 251  ASN A O   1 
ATOM   1917 C CB  . ASN A 1 251 ? -11.632 50.725 73.018 1.00 51.17  ? 251  ASN A CB  1 
ATOM   1918 C CG  . ASN A 1 251 ? -10.264 50.340 73.546 1.00 51.17  ? 251  ASN A CG  1 
ATOM   1919 O OD1 . ASN A 1 251 ? -9.656  51.101 74.297 1.00 51.17  ? 251  ASN A OD1 1 
ATOM   1920 N ND2 . ASN A 1 251 ? -9.762  49.172 73.145 1.00 51.17  ? 251  ASN A ND2 1 
ATOM   1921 N N   . LEU A 1 252 ? -14.789 50.301 72.192 1.00 66.00  ? 252  LEU A N   1 
ATOM   1922 C CA  . LEU A 1 252 ? -16.095 50.938 72.064 1.00 66.00  ? 252  LEU A CA  1 
ATOM   1923 C C   . LEU A 1 252 ? -17.204 49.899 72.212 1.00 66.00  ? 252  LEU A C   1 
ATOM   1924 O O   . LEU A 1 252 ? -18.365 50.156 71.893 1.00 66.00  ? 252  LEU A O   1 
ATOM   1925 C CB  . LEU A 1 252 ? -16.203 51.659 70.716 1.00 45.84  ? 252  LEU A CB  1 
ATOM   1926 C CG  . LEU A 1 252 ? -15.111 52.721 70.542 1.00 45.84  ? 252  LEU A CG  1 
ATOM   1927 C CD1 . LEU A 1 252 ? -15.164 53.298 69.134 1.00 45.84  ? 252  LEU A CD1 1 
ATOM   1928 C CD2 . LEU A 1 252 ? -15.290 53.821 71.584 1.00 45.84  ? 252  LEU A CD2 1 
ATOM   1929 N N   . ASN A 1 253 ? -16.832 48.723 72.705 1.00 54.50  ? 253  ASN A N   1 
ATOM   1930 C CA  . ASN A 1 253 ? -17.787 47.647 72.919 1.00 54.50  ? 253  ASN A CA  1 
ATOM   1931 C C   . ASN A 1 253 ? -18.565 47.376 71.647 1.00 54.50  ? 253  ASN A C   1 
ATOM   1932 O O   . ASN A 1 253 ? -19.771 47.611 71.598 1.00 54.50  ? 253  ASN A O   1 
ATOM   1933 C CB  . ASN A 1 253 ? -18.766 48.039 74.029 1.00 87.93  ? 253  ASN A CB  1 
ATOM   1934 C CG  . ASN A 1 253 ? -18.091 48.803 75.161 1.00 87.93  ? 253  ASN A CG  1 
ATOM   1935 O OD1 . ASN A 1 253 ? -17.185 48.283 75.834 1.00 87.93  ? 253  ASN A OD1 1 
ATOM   1936 N ND2 . ASN A 1 253 ? -18.525 50.051 75.375 1.00 87.93  ? 253  ASN A ND2 1 
ATOM   1937 N N   . CYS A 1 254 ? -17.885 46.891 70.619 1.00 46.49  ? 254  CYS A N   1 
ATOM   1938 C CA  . CYS A 1 254 ? -18.553 46.603 69.357 1.00 46.49  ? 254  CYS A CA  1 
ATOM   1939 C C   . CYS A 1 254 ? -18.559 45.104 69.091 1.00 46.49  ? 254  CYS A C   1 
ATOM   1940 O O   . CYS A 1 254 ? -17.654 44.383 69.517 1.00 46.49  ? 254  CYS A O   1 
ATOM   1941 C CB  . CYS A 1 254 ? -17.859 47.346 68.206 1.00 29.04  ? 254  CYS A CB  1 
ATOM   1942 N N   . ASN A 1 255 ? -19.592 44.637 68.396 1.00 55.22  ? 255  ASN A N   1 
ATOM   1943 C CA  . ASN A 1 255 ? -19.725 43.225 68.043 1.00 55.22  ? 255  ASN A CA  1 
ATOM   1944 C C   . ASN A 1 255 ? -18.530 42.854 67.159 1.00 55.22  ? 255  ASN A C   1 
ATOM   1945 O O   . ASN A 1 255 ? -18.347 43.431 66.079 1.00 55.22  ? 255  ASN A O   1 
ATOM   1946 C CB  . ASN A 1 255 ? -21.030 43.018 67.272 1.00 67.40  ? 255  ASN A CB  1 
ATOM   1947 C CG  . ASN A 1 255 ? -21.306 41.558 66.972 1.00 67.40  ? 255  ASN A CG  1 
ATOM   1948 O OD1 . ASN A 1 255 ? -20.381 40.766 66.723 1.00 67.40  ? 255  ASN A OD1 1 
ATOM   1949 N ND2 . ASN A 1 255 ? -22.585 41.194 66.968 1.00 67.40  ? 255  ASN A ND2 1 
ATOM   1950 N N   . LEU A 1 256 ? -17.728 41.888 67.602 1.00 57.01  ? 256  LEU A N   1 
ATOM   1951 C CA  . LEU A 1 256 ? -16.540 41.500 66.841 1.00 57.01  ? 256  LEU A CA  1 
ATOM   1952 C C   . LEU A 1 256 ? -16.609 40.162 66.094 1.00 57.01  ? 256  LEU A C   1 
ATOM   1953 O O   . LEU A 1 256 ? -15.564 39.559 65.818 1.00 57.01  ? 256  LEU A O   1 
ATOM   1954 C CB  . LEU A 1 256 ? -15.322 41.485 67.770 1.00 45.52  ? 256  LEU A CB  1 
ATOM   1955 C CG  . LEU A 1 256 ? -15.172 42.677 68.724 1.00 45.52  ? 256  LEU A CG  1 
ATOM   1956 C CD1 . LEU A 1 256 ? -13.939 42.478 69.602 1.00 45.52  ? 256  LEU A CD1 1 
ATOM   1957 C CD2 . LEU A 1 256 ? -15.058 43.979 67.935 1.00 45.52  ? 256  LEU A CD2 1 
ATOM   1958 N N   . ASN A 1 257 ? -17.813 39.699 65.749 1.00 59.57  ? 257  ASN A N   1 
ATOM   1959 C CA  . ASN A 1 257 ? -17.954 38.418 65.041 1.00 59.57  ? 257  ASN A CA  1 
ATOM   1960 C C   . ASN A 1 257 ? -17.542 38.446 63.572 1.00 59.57  ? 257  ASN A C   1 
ATOM   1961 O O   . ASN A 1 257 ? -17.217 37.408 63.001 1.00 59.57  ? 257  ASN A O   1 
ATOM   1962 C CB  . ASN A 1 257 ? -19.396 37.904 65.118 1.00 83.89  ? 257  ASN A CB  1 
ATOM   1963 C CG  . ASN A 1 257 ? -19.802 37.505 66.527 1.00 83.89  ? 257  ASN A CG  1 
ATOM   1964 O OD1 . ASN A 1 257 ? -19.029 36.854 67.247 1.00 83.89  ? 257  ASN A OD1 1 
ATOM   1965 N ND2 . ASN A 1 257 ? -21.024 37.881 66.929 1.00 83.89  ? 257  ASN A ND2 1 
ATOM   1966 N N   . SER A 1 258 ? -17.569 39.620 62.954 1.00 55.81  ? 258  SER A N   1 
ATOM   1967 C CA  . SER A 1 258 ? -17.204 39.730 61.544 1.00 55.81  ? 258  SER A CA  1 
ATOM   1968 C C   . SER A 1 258 ? -16.823 41.168 61.170 1.00 55.81  ? 258  SER A C   1 
ATOM   1969 O O   . SER A 1 258 ? -17.174 42.128 61.870 1.00 55.81  ? 258  SER A O   1 
ATOM   1970 C CB  . SER A 1 258 ? -18.374 39.274 60.670 1.00 58.90  ? 258  SER A CB  1 
ATOM   1971 O OG  . SER A 1 258 ? -19.508 40.109 60.868 1.00 58.90  ? 258  SER A OG  1 
ATOM   1972 N N   . ASP A 1 259 ? -16.107 41.323 60.063 1.00 56.09  ? 259  ASP A N   1 
ATOM   1973 C CA  . ASP A 1 259 ? -15.711 42.657 59.628 1.00 56.09  ? 259  ASP A CA  1 
ATOM   1974 C C   . ASP A 1 259 ? -16.930 43.571 59.454 1.00 56.09  ? 259  ASP A C   1 
ATOM   1975 O O   . ASP A 1 259 ? -16.904 44.734 59.872 1.00 56.09  ? 259  ASP A O   1 
ATOM   1976 C CB  . ASP A 1 259 ? -14.901 42.559 58.332 1.00 83.48  ? 259  ASP A CB  1 
ATOM   1977 C CG  . ASP A 1 259 ? -13.549 41.865 58.544 1.00 83.48  ? 259  ASP A CG  1 
ATOM   1978 O OD1 . ASP A 1 259 ? -13.362 41.243 59.625 1.00 83.48  ? 259  ASP A OD1 1 
ATOM   1979 O OD2 . ASP A 1 259 ? -12.679 41.934 57.634 1.00 83.48  ? 259  ASP A OD2 1 
ATOM   1980 N N   . GLU A 1 260 ? -17.998 43.041 58.858 1.00 54.39  ? 260  GLU A N   1 
ATOM   1981 C CA  . GLU A 1 260 ? -19.220 43.809 58.643 1.00 54.39  ? 260  GLU A CA  1 
ATOM   1982 C C   . GLU A 1 260 ? -19.752 44.216 60.007 1.00 54.39  ? 260  GLU A C   1 
ATOM   1983 O O   . GLU A 1 260 ? -20.195 45.349 60.220 1.00 54.39  ? 260  GLU A O   1 
ATOM   1984 C CB  . GLU A 1 260 ? -20.269 42.954 57.933 1.00 97.68  ? 260  GLU A CB  1 
ATOM   1985 C CG  . GLU A 1 260 ? -19.782 42.271 56.643 1.00 97.68  ? 260  GLU A CG  1 
ATOM   1986 C CD  . GLU A 1 260 ? -18.613 41.295 56.880 1.00 97.68  ? 260  GLU A CD  1 
ATOM   1987 O OE1 . GLU A 1 260 ? -18.639 40.540 57.891 1.00 97.68  ? 260  GLU A OE1 1 
ATOM   1988 O OE2 . GLU A 1 260 ? -17.676 41.281 56.043 1.00 97.68  ? 260  GLU A OE2 1 
ATOM   1989 N N   . GLU A 1 261 ? -19.708 43.259 60.925 1.00 60.72  ? 261  GLU A N   1 
ATOM   1990 C CA  . GLU A 1 261 ? -20.153 43.464 62.295 1.00 60.72  ? 261  GLU A CA  1 
ATOM   1991 C C   . GLU A 1 261 ? -19.427 44.682 62.877 1.00 60.72  ? 261  GLU A C   1 
ATOM   1992 O O   . GLU A 1 261 ? -20.053 45.648 63.314 1.00 60.72  ? 261  GLU A O   1 
ATOM   1993 C CB  . GLU A 1 261 ? -19.801 42.227 63.124 1.00 101.74 ? 261  GLU A CB  1 
ATOM   1994 C CG  . GLU A 1 261 ? -20.884 41.771 64.052 1.00 101.74 ? 261  GLU A CG  1 
ATOM   1995 C CD  . GLU A 1 261 ? -22.125 41.350 63.298 1.00 101.74 ? 261  GLU A CD  1 
ATOM   1996 O OE1 . GLU A 1 261 ? -21.975 40.583 62.309 1.00 101.74 ? 261  GLU A OE1 1 
ATOM   1997 O OE2 . GLU A 1 261 ? -23.239 41.780 63.698 1.00 101.74 ? 261  GLU A OE2 1 
ATOM   1998 N N   . LEU A 1 262 ? -18.099 44.611 62.874 1.00 45.30  ? 262  LEU A N   1 
ATOM   1999 C CA  . LEU A 1 262 ? -17.246 45.669 63.398 1.00 45.30  ? 262  LEU A CA  1 
ATOM   2000 C C   . LEU A 1 262 ? -17.424 47.002 62.679 1.00 45.30  ? 262  LEU A C   1 
ATOM   2001 O O   . LEU A 1 262 ? -17.787 48.001 63.292 1.00 45.30  ? 262  LEU A O   1 
ATOM   2002 C CB  . LEU A 1 262 ? -15.785 45.230 63.310 1.00 36.79  ? 262  LEU A CB  1 
ATOM   2003 C CG  . LEU A 1 262 ? -14.695 46.211 63.730 1.00 36.79  ? 262  LEU A CG  1 
ATOM   2004 C CD1 . LEU A 1 262 ? -14.838 46.567 65.187 1.00 36.79  ? 262  LEU A CD1 1 
ATOM   2005 C CD2 . LEU A 1 262 ? -13.346 45.567 63.480 1.00 36.79  ? 262  LEU A CD2 1 
ATOM   2006 N N   . ILE A 1 263 ? -17.165 47.013 61.377 1.00 46.31  ? 263  ILE A N   1 
ATOM   2007 C CA  . ILE A 1 263 ? -17.285 48.233 60.582 1.00 46.31  ? 263  ILE A CA  1 
ATOM   2008 C C   . ILE A 1 263 ? -18.611 48.960 60.794 1.00 46.31  ? 263  ILE A C   1 
ATOM   2009 O O   . ILE A 1 263 ? -18.634 50.169 61.004 1.00 46.31  ? 263  ILE A O   1 
ATOM   2010 C CB  . ILE A 1 263 ? -17.135 47.943 59.074 1.00 37.69  ? 263  ILE A CB  1 
ATOM   2011 C CG1 . ILE A 1 263 ? -15.803 47.244 58.801 1.00 37.69  ? 263  ILE A CG1 1 
ATOM   2012 C CG2 . ILE A 1 263 ? -17.216 49.244 58.294 1.00 37.69  ? 263  ILE A CG2 1 
ATOM   2013 C CD1 . ILE A 1 263 ? -15.643 46.790 57.366 1.00 37.69  ? 263  ILE A CD1 1 
ATOM   2014 N N   . HIS A 1 264 ? -19.719 48.232 60.731 1.00 53.37  ? 264  HIS A N   1 
ATOM   2015 C CA  . HIS A 1 264 ? -21.014 48.868 60.920 1.00 53.37  ? 264  HIS A CA  1 
ATOM   2016 C C   . HIS A 1 264 ? -21.095 49.554 62.284 1.00 53.37  ? 264  HIS A C   1 
ATOM   2017 O O   . HIS A 1 264 ? -21.596 50.676 62.391 1.00 53.37  ? 264  HIS A O   1 
ATOM   2018 C CB  . HIS A 1 264 ? -22.154 47.850 60.769 1.00 80.71  ? 264  HIS A CB  1 
ATOM   2019 C CG  . HIS A 1 264 ? -23.498 48.396 61.146 1.00 80.71  ? 264  HIS A CG  1 
ATOM   2020 N ND1 . HIS A 1 264 ? -23.872 48.615 62.460 1.00 80.71  ? 264  HIS A ND1 1 
ATOM   2021 C CD2 . HIS A 1 264 ? -24.530 48.836 60.384 1.00 80.71  ? 264  HIS A CD2 1 
ATOM   2022 C CE1 . HIS A 1 264 ? -25.072 49.172 62.489 1.00 80.71  ? 264  HIS A CE1 1 
ATOM   2023 N NE2 . HIS A 1 264 ? -25.493 49.317 61.243 1.00 80.71  ? 264  HIS A NE2 1 
ATOM   2024 N N   . CYS A 1 265 ? -20.599 48.895 63.328 1.00 48.17  ? 265  CYS A N   1 
ATOM   2025 C CA  . CYS A 1 265 ? -20.648 49.485 64.665 1.00 48.17  ? 265  CYS A CA  1 
ATOM   2026 C C   . CYS A 1 265 ? -19.800 50.753 64.713 1.00 48.17  ? 265  CYS A C   1 
ATOM   2027 O O   . CYS A 1 265 ? -20.197 51.747 65.316 1.00 48.17  ? 265  CYS A O   1 
ATOM   2028 C CB  . CYS A 1 265 ? -20.170 48.469 65.728 1.00 37.86  ? 265  CYS A CB  1 
ATOM   2029 N N   . LEU A 1 266 ? -18.638 50.718 64.065 1.00 50.69  ? 266  LEU A N   1 
ATOM   2030 C CA  . LEU A 1 266 ? -17.750 51.874 64.044 1.00 50.69  ? 266  LEU A CA  1 
ATOM   2031 C C   . LEU A 1 266 ? -18.354 53.027 63.236 1.00 50.69  ? 266  LEU A C   1 
ATOM   2032 O O   . LEU A 1 266 ? -18.061 54.195 63.494 1.00 50.69  ? 266  LEU A O   1 
ATOM   2033 C CB  . LEU A 1 266 ? -16.375 51.477 63.487 1.00 32.19  ? 266  LEU A CB  1 
ATOM   2034 C CG  . LEU A 1 266 ? -15.513 50.579 64.382 1.00 32.19  ? 266  LEU A CG  1 
ATOM   2035 C CD1 . LEU A 1 266 ? -14.373 49.984 63.592 1.00 32.19  ? 266  LEU A CD1 1 
ATOM   2036 C CD2 . LEU A 1 266 ? -14.983 51.382 65.537 1.00 32.19  ? 266  LEU A CD2 1 
ATOM   2037 N N   . ARG A 1 267 ? -19.210 52.713 62.271 1.00 52.04  ? 267  ARG A N   1 
ATOM   2038 C CA  . ARG A 1 267 ? -19.839 53.768 61.479 1.00 52.04  ? 267  ARG A CA  1 
ATOM   2039 C C   . ARG A 1 267 ? -20.980 54.464 62.215 1.00 52.04  ? 267  ARG A C   1 
ATOM   2040 O O   . ARG A 1 267 ? -21.419 55.533 61.796 1.00 52.04  ? 267  ARG A O   1 
ATOM   2041 C CB  . ARG A 1 267 ? -20.346 53.228 60.140 1.00 42.07  ? 267  ARG A CB  1 
ATOM   2042 C CG  . ARG A 1 267 ? -19.230 52.943 59.183 1.00 42.07  ? 267  ARG A CG  1 
ATOM   2043 C CD  . ARG A 1 267 ? -19.723 52.616 57.807 1.00 42.07  ? 267  ARG A CD  1 
ATOM   2044 N NE  . ARG A 1 267 ? -18.593 52.279 56.953 1.00 42.07  ? 267  ARG A NE  1 
ATOM   2045 C CZ  . ARG A 1 267 ? -18.702 51.767 55.734 1.00 42.07  ? 267  ARG A CZ  1 
ATOM   2046 N NH1 . ARG A 1 267 ? -19.903 51.533 55.218 1.00 42.07  ? 267  ARG A NH1 1 
ATOM   2047 N NH2 . ARG A 1 267 ? -17.608 51.473 55.041 1.00 42.07  ? 267  ARG A NH2 1 
ATOM   2048 N N   . GLU A 1 268 ? -21.455 53.873 63.308 1.00 51.63  ? 268  GLU A N   1 
ATOM   2049 C CA  . GLU A 1 268 ? -22.539 54.490 64.075 1.00 51.63  ? 268  GLU A CA  1 
ATOM   2050 C C   . GLU A 1 268 ? -22.016 55.356 65.217 1.00 51.63  ? 268  GLU A C   1 
ATOM   2051 O O   . GLU A 1 268 ? -22.790 56.030 65.896 1.00 51.63  ? 268  GLU A O   1 
ATOM   2052 C CB  . GLU A 1 268 ? -23.481 53.421 64.640 1.00 101.75 ? 268  GLU A CB  1 
ATOM   2053 C CG  . GLU A 1 268 ? -24.171 52.614 63.553 1.00 101.75 ? 268  GLU A CG  1 
ATOM   2054 C CD  . GLU A 1 268 ? -24.797 53.515 62.483 1.00 101.75 ? 268  GLU A CD  1 
ATOM   2055 O OE1 . GLU A 1 268 ? -25.775 54.239 62.818 1.00 101.75 ? 268  GLU A OE1 1 
ATOM   2056 O OE2 . GLU A 1 268 ? -24.300 53.507 61.320 1.00 101.75 ? 268  GLU A OE2 1 
ATOM   2057 N N   . LYS A 1 269 ? -20.705 55.339 65.423 1.00 43.49  ? 269  LYS A N   1 
ATOM   2058 C CA  . LYS A 1 269 ? -20.104 56.119 66.486 1.00 43.49  ? 269  LYS A CA  1 
ATOM   2059 C C   . LYS A 1 269 ? -19.824 57.557 66.070 1.00 43.49  ? 269  LYS A C   1 
ATOM   2060 O O   . LYS A 1 269 ? -19.470 57.829 64.918 1.00 43.49  ? 269  LYS A O   1 
ATOM   2061 C CB  . LYS A 1 269 ? -18.800 55.468 66.927 1.00 52.71  ? 269  LYS A CB  1 
ATOM   2062 C CG  . LYS A 1 269 ? -18.959 54.058 67.436 1.00 52.71  ? 269  LYS A CG  1 
ATOM   2063 C CD  . LYS A 1 269 ? -19.794 54.027 68.698 1.00 52.71  ? 269  LYS A CD  1 
ATOM   2064 C CE  . LYS A 1 269 ? -19.818 52.630 69.271 1.00 52.71  ? 269  LYS A CE  1 
ATOM   2065 N NZ  . LYS A 1 269 ? -20.473 52.618 70.603 1.00 52.71  ? 269  LYS A NZ  1 
ATOM   2066 N N   . LYS A 1 270 ? -19.992 58.478 67.013 1.00 47.66  ? 270  LYS A N   1 
ATOM   2067 C CA  . LYS A 1 270 ? -19.719 59.885 66.755 1.00 47.66  ? 270  LYS A CA  1 
ATOM   2068 C C   . LYS A 1 270 ? -18.206 59.988 66.552 1.00 47.66  ? 270  LYS A C   1 
ATOM   2069 O O   . LYS A 1 270 ? -17.445 59.233 67.157 1.00 47.66  ? 270  LYS A O   1 
ATOM   2070 C CB  . LYS A 1 270 ? -20.140 60.744 67.954 1.00 76.04  ? 270  LYS A CB  1 
ATOM   2071 C CG  . LYS A 1 270 ? -21.647 60.823 68.222 1.00 76.04  ? 270  LYS A CG  1 
ATOM   2072 C CD  . LYS A 1 270 ? -21.928 61.693 69.474 1.00 76.04  ? 270  LYS A CD  1 
ATOM   2073 C CE  . LYS A 1 270 ? -23.419 62.041 69.650 1.00 76.04  ? 270  LYS A CE  1 
ATOM   2074 N NZ  . LYS A 1 270 ? -24.292 60.853 69.901 1.00 76.04  ? 270  LYS A NZ  1 
ATOM   2075 N N   . PRO A 1 271 ? -17.752 60.923 65.708 1.00 37.83  ? 271  PRO A N   1 
ATOM   2076 C CA  . PRO A 1 271 ? -16.327 61.105 65.434 1.00 37.83  ? 271  PRO A CA  1 
ATOM   2077 C C   . PRO A 1 271 ? -15.438 61.163 66.672 1.00 37.83  ? 271  PRO A C   1 
ATOM   2078 O O   . PRO A 1 271 ? -14.384 60.535 66.714 1.00 37.83  ? 271  PRO A O   1 
ATOM   2079 C CB  . PRO A 1 271 ? -16.294 62.417 64.655 1.00 53.88  ? 271  PRO A CB  1 
ATOM   2080 C CG  . PRO A 1 271 ? -17.584 62.398 63.929 1.00 53.88  ? 271  PRO A CG  1 
ATOM   2081 C CD  . PRO A 1 271 ? -18.545 61.937 64.999 1.00 53.88  ? 271  PRO A CD  1 
ATOM   2082 N N   . GLN A 1 272 ? -15.869 61.912 67.681 1.00 41.26  ? 272  GLN A N   1 
ATOM   2083 C CA  . GLN A 1 272 ? -15.077 62.073 68.901 1.00 41.26  ? 272  GLN A CA  1 
ATOM   2084 C C   . GLN A 1 272 ? -14.961 60.837 69.797 1.00 41.26  ? 272  GLN A C   1 
ATOM   2085 O O   . GLN A 1 272 ? -14.185 60.826 70.752 1.00 41.26  ? 272  GLN A O   1 
ATOM   2086 C CB  . GLN A 1 272 ? -15.623 63.247 69.721 1.00 52.77  ? 272  GLN A CB  1 
ATOM   2087 C CG  . GLN A 1 272 ? -14.678 63.725 70.819 1.00 52.77  ? 272  GLN A CG  1 
ATOM   2088 C CD  . GLN A 1 272 ? -13.275 63.985 70.293 1.00 52.77  ? 272  GLN A CD  1 
ATOM   2089 O OE1 . GLN A 1 272 ? -13.090 64.720 69.312 1.00 52.77  ? 272  GLN A OE1 1 
ATOM   2090 N NE2 . GLN A 1 272 ? -12.276 63.378 70.938 1.00 52.77  ? 272  GLN A NE2 1 
ATOM   2091 N N   . GLU A 1 273 ? -15.716 59.793 69.486 1.00 52.10  ? 273  GLU A N   1 
ATOM   2092 C CA  . GLU A 1 273 ? -15.673 58.582 70.297 1.00 52.10  ? 273  GLU A CA  1 
ATOM   2093 C C   . GLU A 1 273 ? -14.560 57.654 69.843 1.00 52.10  ? 273  GLU A C   1 
ATOM   2094 O O   . GLU A 1 273 ? -13.996 56.912 70.655 1.00 52.10  ? 273  GLU A O   1 
ATOM   2095 C CB  . GLU A 1 273 ? -17.015 57.863 70.226 1.00 93.92  ? 273  GLU A CB  1 
ATOM   2096 C CG  . GLU A 1 273 ? -18.186 58.827 70.254 1.00 93.92  ? 273  GLU A CG  1 
ATOM   2097 C CD  . GLU A 1 273 ? -19.501 58.132 70.535 1.00 93.92  ? 273  GLU A CD  1 
ATOM   2098 O OE1 . GLU A 1 273 ? -19.598 57.497 71.618 1.00 93.92  ? 273  GLU A OE1 1 
ATOM   2099 O OE2 . GLU A 1 273 ? -20.425 58.224 69.682 1.00 93.92  ? 273  GLU A OE2 1 
ATOM   2100 N N   . LEU A 1 274 ? -14.261 57.683 68.545 1.00 51.09  ? 274  LEU A N   1 
ATOM   2101 C CA  . LEU A 1 274 ? -13.188 56.862 68.007 1.00 51.09  ? 274  LEU A CA  1 
ATOM   2102 C C   . LEU A 1 274 ? -11.898 57.527 68.432 1.00 51.09  ? 274  LEU A C   1 
ATOM   2103 O O   . LEU A 1 274 ? -10.944 56.860 68.809 1.00 51.09  ? 274  LEU A O   1 
ATOM   2104 C CB  . LEU A 1 274 ? -13.248 56.790 66.480 1.00 45.47  ? 274  LEU A CB  1 
ATOM   2105 C CG  . LEU A 1 274 ? -14.155 55.731 65.855 1.00 45.47  ? 274  LEU A CG  1 
ATOM   2106 C CD1 . LEU A 1 274 ? -15.517 55.778 66.500 1.00 45.47  ? 274  LEU A CD1 1 
ATOM   2107 C CD2 . LEU A 1 274 ? -14.286 55.979 64.369 1.00 45.47  ? 274  LEU A CD2 1 
ATOM   2108 N N   . ILE A 1 275 ? -11.877 58.850 68.385 1.00 45.65  ? 275  ILE A N   1 
ATOM   2109 C CA  . ILE A 1 275 ? -10.691 59.592 68.770 1.00 45.65  ? 275  ILE A CA  1 
ATOM   2110 C C   . ILE A 1 275 ? -10.404 59.487 70.271 1.00 45.65  ? 275  ILE A C   1 
ATOM   2111 O O   . ILE A 1 275 ? -9.251  59.507 70.685 1.00 45.65  ? 275  ILE A O   1 
ATOM   2112 C CB  . ILE A 1 275 ? -10.823 61.075 68.373 1.00 43.14  ? 275  ILE A CB  1 
ATOM   2113 C CG1 . ILE A 1 275 ? -11.035 61.180 66.863 1.00 43.14  ? 275  ILE A CG1 1 
ATOM   2114 C CG2 . ILE A 1 275 ? -9.587  61.847 68.804 1.00 43.14  ? 275  ILE A CG2 1 
ATOM   2115 C CD1 . ILE A 1 275 ? -11.152 62.596 66.362 1.00 43.14  ? 275  ILE A CD1 1 
ATOM   2116 N N   . ASP A 1 276 ? -11.439 59.367 71.092 1.00 41.14  ? 276  ASP A N   1 
ATOM   2117 C CA  . ASP A 1 276 ? -11.211 59.258 72.533 1.00 41.14  ? 276  ASP A CA  1 
ATOM   2118 C C   . ASP A 1 276 ? -10.446 58.001 72.943 1.00 41.14  ? 276  ASP A C   1 
ATOM   2119 O O   . ASP A 1 276 ? -9.762  58.009 73.958 1.00 41.14  ? 276  ASP A O   1 
ATOM   2120 C CB  . ASP A 1 276 ? -12.536 59.289 73.318 1.00 73.25  ? 276  ASP A CB  1 
ATOM   2121 C CG  . ASP A 1 276 ? -13.100 60.700 73.487 1.00 73.25  ? 276  ASP A CG  1 
ATOM   2122 O OD1 . ASP A 1 276 ? -12.303 61.664 73.519 1.00 73.25  ? 276  ASP A OD1 1 
ATOM   2123 O OD2 . ASP A 1 276 ? -14.339 60.846 73.610 1.00 73.25  ? 276  ASP A OD2 1 
ATOM   2124 N N   . VAL A 1 277 ? -10.561 56.922 72.169 1.00 37.79  ? 277  VAL A N   1 
ATOM   2125 C CA  . VAL A 1 277 ? -9.888  55.665 72.510 1.00 37.79  ? 277  VAL A CA  1 
ATOM   2126 C C   . VAL A 1 277 ? -8.814  55.218 71.521 1.00 37.79  ? 277  VAL A C   1 
ATOM   2127 O O   . VAL A 1 277 ? -8.195  54.172 71.692 1.00 37.79  ? 277  VAL A O   1 
ATOM   2128 C CB  . VAL A 1 277 ? -10.915 54.520 72.663 1.00 37.22  ? 277  VAL A CB  1 
ATOM   2129 C CG1 . VAL A 1 277 ? -11.744 54.728 73.920 1.00 37.22  ? 277  VAL A CG1 1 
ATOM   2130 C CG2 . VAL A 1 277 ? -11.815 54.471 71.443 1.00 37.22  ? 277  VAL A CG2 1 
ATOM   2131 N N   . GLU A 1 278 ? -8.599  56.028 70.495 1.00 41.84  ? 278  GLU A N   1 
ATOM   2132 C CA  . GLU A 1 278 ? -7.614  55.769 69.455 1.00 41.84  ? 278  GLU A CA  1 
ATOM   2133 C C   . GLU A 1 278 ? -6.211  55.369 69.945 1.00 41.84  ? 278  GLU A C   1 
ATOM   2134 O O   . GLU A 1 278 ? -5.618  54.436 69.416 1.00 41.84  ? 278  GLU A O   1 
ATOM   2135 C CB  . GLU A 1 278 ? -7.553  57.007 68.548 1.00 79.40  ? 278  GLU A CB  1 
ATOM   2136 C CG  . GLU A 1 278 ? -6.207  57.321 67.893 1.00 79.40  ? 278  GLU A CG  1 
ATOM   2137 C CD  . GLU A 1 278 ? -6.285  58.507 66.913 1.00 79.40  ? 278  GLU A CD  1 
ATOM   2138 O OE1 . GLU A 1 278 ? -6.737  59.607 67.324 1.00 79.40  ? 278  GLU A OE1 1 
ATOM   2139 O OE2 . GLU A 1 278 ? -5.891  58.336 65.729 1.00 79.40  ? 278  GLU A OE2 1 
ATOM   2140 N N   . TRP A 1 279 ? -5.680  56.051 70.954 1.00 47.11  ? 279  TRP A N   1 
ATOM   2141 C CA  . TRP A 1 279 ? -4.343  55.732 71.453 1.00 47.11  ? 279  TRP A CA  1 
ATOM   2142 C C   . TRP A 1 279 ? -4.228  54.471 72.288 1.00 47.11  ? 279  TRP A C   1 
ATOM   2143 O O   . TRP A 1 279 ? -3.126  54.099 72.683 1.00 47.11  ? 279  TRP A O   1 
ATOM   2144 C CB  . TRP A 1 279 ? -3.770  56.897 72.265 1.00 54.57  ? 279  TRP A CB  1 
ATOM   2145 C CG  . TRP A 1 279 ? -3.615  58.130 71.464 1.00 54.57  ? 279  TRP A CG  1 
ATOM   2146 C CD1 . TRP A 1 279 ? -4.546  59.107 71.281 1.00 54.57  ? 279  TRP A CD1 1 
ATOM   2147 C CD2 . TRP A 1 279 ? -2.487  58.494 70.670 1.00 54.57  ? 279  TRP A CD2 1 
ATOM   2148 N NE1 . TRP A 1 279 ? -4.069  60.062 70.421 1.00 54.57  ? 279  TRP A NE1 1 
ATOM   2149 C CE2 . TRP A 1 279 ? -2.805  59.712 70.029 1.00 54.57  ? 279  TRP A CE2 1 
ATOM   2150 C CE3 . TRP A 1 279 ? -1.236  57.909 70.432 1.00 54.57  ? 279  TRP A CE3 1 
ATOM   2151 C CZ2 . TRP A 1 279 ? -1.914  60.365 69.160 1.00 54.57  ? 279  TRP A CZ2 1 
ATOM   2152 C CZ3 . TRP A 1 279 ? -0.343  58.552 69.568 1.00 54.57  ? 279  TRP A CZ3 1 
ATOM   2153 C CH2 . TRP A 1 279 ? -0.690  59.772 68.942 1.00 54.57  ? 279  TRP A CH2 1 
ATOM   2154 N N   . ASN A 1 280 ? -5.347  53.813 72.569 1.00 38.41  ? 280  ASN A N   1 
ATOM   2155 C CA  . ASN A 1 280 ? -5.312  52.592 73.364 1.00 38.41  ? 280  ASN A CA  1 
ATOM   2156 C C   . ASN A 1 280 ? -4.921  51.354 72.566 1.00 38.41  ? 280  ASN A C   1 
ATOM   2157 O O   . ASN A 1 280 ? -4.709  50.299 73.141 1.00 38.41  ? 280  ASN A O   1 
ATOM   2158 C CB  . ASN A 1 280 ? -6.675  52.319 74.003 1.00 49.84  ? 280  ASN A CB  1 
ATOM   2159 C CG  . ASN A 1 280 ? -7.104  53.405 74.964 1.00 49.84  ? 280  ASN A CG  1 
ATOM   2160 O OD1 . ASN A 1 280 ? -6.277  54.153 75.489 1.00 49.84  ? 280  ASN A OD1 1 
ATOM   2161 N ND2 . ASN A 1 280 ? -8.404  53.486 75.218 1.00 49.84  ? 280  ASN A ND2 1 
ATOM   2162 N N   . VAL A 1 281 ? -4.816  51.461 71.251 1.00 32.63  ? 281  VAL A N   1 
ATOM   2163 C CA  . VAL A 1 281 ? -4.505  50.274 70.472 1.00 32.63  ? 281  VAL A CA  1 
ATOM   2164 C C   . VAL A 1 281 ? -3.044  50.007 70.163 1.00 32.63  ? 281  VAL A C   1 
ATOM   2165 O O   . VAL A 1 281 ? -2.725  48.971 69.596 1.00 32.63  ? 281  VAL A O   1 
ATOM   2166 C CB  . VAL A 1 281 ? -5.295  50.256 69.139 1.00 33.75  ? 281  VAL A CB  1 
ATOM   2167 C CG1 . VAL A 1 281 ? -6.782  50.439 69.418 1.00 33.75  ? 281  VAL A CG1 1 
ATOM   2168 C CG2 . VAL A 1 281 ? -4.768  51.334 68.193 1.00 33.75  ? 281  VAL A CG2 1 
ATOM   2169 N N   . LEU A 1 282 ? -2.151  50.921 70.522 1.00 41.93  ? 282  LEU A N   1 
ATOM   2170 C CA  . LEU A 1 282 ? -0.733  50.698 70.250 1.00 41.93  ? 282  LEU A CA  1 
ATOM   2171 C C   . LEU A 1 282 ? -0.241  49.435 70.948 1.00 41.93  ? 282  LEU A C   1 
ATOM   2172 O O   . LEU A 1 282 ? -0.551  49.194 72.111 1.00 41.93  ? 282  LEU A O   1 
ATOM   2173 C CB  . LEU A 1 282 ? 0.098   51.893 70.698 1.00 35.47  ? 282  LEU A CB  1 
ATOM   2174 C CG  . LEU A 1 282 ? -0.072  53.128 69.822 1.00 35.47  ? 282  LEU A CG  1 
ATOM   2175 C CD1 . LEU A 1 282 ? 0.730   54.262 70.403 1.00 35.47  ? 282  LEU A CD1 1 
ATOM   2176 C CD2 . LEU A 1 282 ? 0.391   52.826 68.410 1.00 35.47  ? 282  LEU A CD2 1 
ATOM   2177 N N   . PRO A 1 283 ? 0.542   48.610 70.239 1.00 42.67  ? 283  PRO A N   1 
ATOM   2178 C CA  . PRO A 1 283 ? 1.067   47.362 70.798 1.00 42.67  ? 283  PRO A CA  1 
ATOM   2179 C C   . PRO A 1 283 ? 2.097   47.495 71.912 1.00 42.67  ? 283  PRO A C   1 
ATOM   2180 O O   . PRO A 1 283 ? 2.225   46.597 72.738 1.00 42.67  ? 283  PRO A O   1 
ATOM   2181 C CB  . PRO A 1 283 ? 1.632   46.655 69.576 1.00 36.37  ? 283  PRO A CB  1 
ATOM   2182 C CG  . PRO A 1 283 ? 2.122   47.785 68.759 1.00 36.37  ? 283  PRO A CG  1 
ATOM   2183 C CD  . PRO A 1 283 ? 0.998   48.790 68.849 1.00 36.37  ? 283  PRO A CD  1 
ATOM   2184 N N   . PHE A 1 284 ? 2.829   48.602 71.945 1.00 46.94  ? 284  PHE A N   1 
ATOM   2185 C CA  . PHE A 1 284 ? 3.843   48.781 72.976 1.00 46.94  ? 284  PHE A CA  1 
ATOM   2186 C C   . PHE A 1 284 ? 3.780   50.139 73.627 1.00 46.94  ? 284  PHE A C   1 
ATOM   2187 O O   . PHE A 1 284 ? 3.169   51.069 73.110 1.00 46.94  ? 284  PHE A O   1 
ATOM   2188 C CB  . PHE A 1 284 ? 5.244   48.628 72.396 1.00 47.75  ? 284  PHE A CB  1 
ATOM   2189 C CG  . PHE A 1 284 ? 5.451   47.368 71.612 1.00 47.75  ? 284  PHE A CG  1 
ATOM   2190 C CD1 . PHE A 1 284 ? 5.497   46.135 72.250 1.00 47.75  ? 284  PHE A CD1 1 
ATOM   2191 C CD2 . PHE A 1 284 ? 5.630   47.420 70.226 1.00 47.75  ? 284  PHE A CD2 1 
ATOM   2192 C CE1 . PHE A 1 284 ? 5.724   44.965 71.519 1.00 47.75  ? 284  PHE A CE1 1 
ATOM   2193 C CE2 . PHE A 1 284 ? 5.856   46.264 69.486 1.00 47.75  ? 284  PHE A CE2 1 
ATOM   2194 C CZ  . PHE A 1 284 ? 5.905   45.031 70.132 1.00 47.75  ? 284  PHE A CZ  1 
ATOM   2195 N N   . ASP A 1 285 ? 4.420   50.234 74.784 1.00 44.69  ? 285  ASP A N   1 
ATOM   2196 C CA  . ASP A 1 285 ? 4.513   51.484 75.509 1.00 44.69  ? 285  ASP A CA  1 
ATOM   2197 C C   . ASP A 1 285 ? 5.580   52.121 74.638 1.00 44.69  ? 285  ASP A C   1 
ATOM   2198 O O   . ASP A 1 285 ? 6.706   51.639 74.579 1.00 44.69  ? 285  ASP A O   1 
ATOM   2199 C CB  . ASP A 1 285 ? 5.031   51.213 76.914 1.00 76.52  ? 285  ASP A CB  1 
ATOM   2200 C CG  . ASP A 1 285 ? 5.226   52.480 77.726 1.00 76.52  ? 285  ASP A CG  1 
ATOM   2201 O OD1 . ASP A 1 285 ? 5.082   53.588 77.139 1.00 76.52  ? 285  ASP A OD1 1 
ATOM   2202 O OD2 . ASP A 1 285 ? 5.534   52.356 78.947 1.00 76.52  ? 285  ASP A OD2 1 
ATOM   2203 N N   . SER A 1 286 ? 5.241   53.195 73.952 1.00 45.68  ? 286  SER A N   1 
ATOM   2204 C CA  . SER A 1 286 ? 6.212   53.757 73.039 1.00 45.68  ? 286  SER A CA  1 
ATOM   2205 C C   . SER A 1 286 ? 6.229   55.263 72.877 1.00 45.68  ? 286  SER A C   1 
ATOM   2206 O O   . SER A 1 286 ? 5.438   55.985 73.471 1.00 45.68  ? 286  SER A O   1 
ATOM   2207 C CB  . SER A 1 286 ? 5.994   53.118 71.682 1.00 49.35  ? 286  SER A CB  1 
ATOM   2208 O OG  . SER A 1 286 ? 4.619   53.223 71.330 1.00 49.35  ? 286  SER A OG  1 
ATOM   2209 N N   . ILE A 1 287 ? 7.146   55.717 72.034 1.00 40.35  ? 287  ILE A N   1 
ATOM   2210 C CA  . ILE A 1 287 ? 7.329   57.128 71.754 1.00 40.35  ? 287  ILE A CA  1 
ATOM   2211 C C   . ILE A 1 287 ? 7.544   57.179 70.237 1.00 40.35  ? 287  ILE A C   1 
ATOM   2212 O O   . ILE A 1 287 ? 8.224   56.325 69.672 1.00 40.35  ? 287  ILE A O   1 
ATOM   2213 C CB  . ILE A 1 287 ? 8.563   57.655 72.549 1.00 40.65  ? 287  ILE A CB  1 
ATOM   2214 C CG1 . ILE A 1 287 ? 8.517   59.160 72.693 1.00 40.65  ? 287  ILE A CG1 1 
ATOM   2215 C CG2 . ILE A 1 287 ? 9.848   57.304 71.847 1.00 40.65  ? 287  ILE A CG2 1 
ATOM   2216 C CD1 . ILE A 1 287 ? 9.762   59.707 73.367 1.00 40.65  ? 287  ILE A CD1 1 
ATOM   2217 N N   . PHE A 1 288 ? 6.929   58.149 69.577 1.00 37.12  ? 288  PHE A N   1 
ATOM   2218 C CA  . PHE A 1 288 ? 7.043   58.301 68.130 1.00 37.12  ? 288  PHE A CA  1 
ATOM   2219 C C   . PHE A 1 288 ? 6.401   57.156 67.334 1.00 37.12  ? 288  PHE A C   1 
ATOM   2220 O O   . PHE A 1 288 ? 6.958   56.685 66.342 1.00 37.12  ? 288  PHE A O   1 
ATOM   2221 C CB  . PHE A 1 288 ? 8.507   58.440 67.718 1.00 28.17  ? 288  PHE A CB  1 
ATOM   2222 C CG  . PHE A 1 288 ? 8.719   59.358 66.551 1.00 28.17  ? 288  PHE A CG  1 
ATOM   2223 C CD1 . PHE A 1 288 ? 7.907   59.277 65.428 1.00 28.17  ? 288  PHE A CD1 1 
ATOM   2224 C CD2 . PHE A 1 288 ? 9.727   60.310 66.578 1.00 28.17  ? 288  PHE A CD2 1 
ATOM   2225 C CE1 . PHE A 1 288 ? 8.092   60.127 64.355 1.00 28.17  ? 288  PHE A CE1 1 
ATOM   2226 C CE2 . PHE A 1 288 ? 9.921   61.165 65.506 1.00 28.17  ? 288  PHE A CE2 1 
ATOM   2227 C CZ  . PHE A 1 288 ? 9.100   61.073 64.393 1.00 28.17  ? 288  PHE A CZ  1 
ATOM   2228 N N   . ARG A 1 289 ? 5.229   56.716 67.778 1.00 39.22  ? 289  ARG A N   1 
ATOM   2229 C CA  . ARG A 1 289 ? 4.489   55.653 67.117 1.00 39.22  ? 289  ARG A CA  1 
ATOM   2230 C C   . ARG A 1 289 ? 3.024   56.062 67.142 1.00 39.22  ? 289  ARG A C   1 
ATOM   2231 O O   . ARG A 1 289 ? 2.554   56.650 68.118 1.00 39.22  ? 289  ARG A O   1 
ATOM   2232 C CB  . ARG A 1 289 ? 4.686   54.322 67.836 1.00 27.81  ? 289  ARG A CB  1 
ATOM   2233 C CG  . ARG A 1 289 ? 6.093   53.776 67.764 1.00 27.81  ? 289  ARG A CG  1 
ATOM   2234 C CD  . ARG A 1 289 ? 6.516   53.462 66.338 1.00 27.81  ? 289  ARG A CD  1 
ATOM   2235 N NE  . ARG A 1 289 ? 7.710   52.611 66.287 1.00 27.81  ? 289  ARG A NE  1 
ATOM   2236 C CZ  . ARG A 1 289 ? 8.965   53.049 66.237 1.00 27.81  ? 289  ARG A CZ  1 
ATOM   2237 N NH1 . ARG A 1 289 ? 9.225   54.346 66.225 1.00 27.81  ? 289  ARG A NH1 1 
ATOM   2238 N NH2 . ARG A 1 289 ? 9.963   52.184 66.204 1.00 27.81  ? 289  ARG A NH2 1 
ATOM   2239 N N   . PHE A 1 290 ? 2.303   55.743 66.073 1.00 35.66  ? 290  PHE A N   1 
ATOM   2240 C CA  . PHE A 1 290 ? 0.913   56.135 65.961 1.00 35.66  ? 290  PHE A CA  1 
ATOM   2241 C C   . PHE A 1 290 ? -0.027  54.990 65.605 1.00 35.66  ? 290  PHE A C   1 
ATOM   2242 O O   . PHE A 1 290 ? 0.331   54.066 64.883 1.00 35.66  ? 290  PHE A O   1 
ATOM   2243 C CB  . PHE A 1 290 ? 0.851   57.267 64.952 1.00 32.47  ? 290  PHE A CB  1 
ATOM   2244 C CG  . PHE A 1 290 ? 1.975   58.256 65.120 1.00 32.47  ? 290  PHE A CG  1 
ATOM   2245 C CD1 . PHE A 1 290 ? 2.115   58.976 66.304 1.00 32.47  ? 290  PHE A CD1 1 
ATOM   2246 C CD2 . PHE A 1 290 ? 2.925   58.430 64.126 1.00 32.47  ? 290  PHE A CD2 1 
ATOM   2247 C CE1 . PHE A 1 290 ? 3.174   59.842 66.496 1.00 32.47  ? 290  PHE A CE1 1 
ATOM   2248 C CE2 . PHE A 1 290 ? 3.993   59.302 64.314 1.00 32.47  ? 290  PHE A CE2 1 
ATOM   2249 C CZ  . PHE A 1 290 ? 4.114   60.006 65.503 1.00 32.47  ? 290  PHE A CZ  1 
ATOM   2250 N N   . SER A 1 291 ? -1.241  55.069 66.129 1.00 38.95  ? 291  SER A N   1 
ATOM   2251 C CA  . SER A 1 291 ? -2.243  54.032 65.944 1.00 38.95  ? 291  SER A CA  1 
ATOM   2252 C C   . SER A 1 291 ? -2.592  53.629 64.527 1.00 38.95  ? 291  SER A C   1 
ATOM   2253 O O   . SER A 1 291 ? -2.328  52.503 64.112 1.00 38.95  ? 291  SER A O   1 
ATOM   2254 C CB  . SER A 1 291 ? -3.516  54.429 66.674 1.00 45.06  ? 291  SER A CB  1 
ATOM   2255 O OG  . SER A 1 291 ? -3.284  54.437 68.065 1.00 45.06  ? 291  SER A OG  1 
ATOM   2256 N N   . PHE A 1 292 ? -3.200  54.541 63.785 1.00 42.75  ? 292  PHE A N   1 
ATOM   2257 C CA  . PHE A 1 292 ? -3.601  54.228 62.428 1.00 42.75  ? 292  PHE A CA  1 
ATOM   2258 C C   . PHE A 1 292 ? -2.754  54.930 61.389 1.00 42.75  ? 292  PHE A C   1 
ATOM   2259 O O   . PHE A 1 292 ? -2.761  56.156 61.270 1.00 42.75  ? 292  PHE A O   1 
ATOM   2260 C CB  . PHE A 1 292 ? -5.079  54.552 62.281 1.00 40.24  ? 292  PHE A CB  1 
ATOM   2261 C CG  . PHE A 1 292 ? -5.910  53.903 63.332 1.00 40.24  ? 292  PHE A CG  1 
ATOM   2262 C CD1 . PHE A 1 292 ? -6.270  52.567 63.220 1.00 40.24  ? 292  PHE A CD1 1 
ATOM   2263 C CD2 . PHE A 1 292 ? -6.241  54.589 64.490 1.00 40.24  ? 292  PHE A CD2 1 
ATOM   2264 C CE1 . PHE A 1 292 ? -6.942  51.921 64.254 1.00 40.24  ? 292  PHE A CE1 1 
ATOM   2265 C CE2 . PHE A 1 292 ? -6.910  53.954 65.525 1.00 40.24  ? 292  PHE A CE2 1 
ATOM   2266 C CZ  . PHE A 1 292 ? -7.260  52.618 65.409 1.00 40.24  ? 292  PHE A CZ  1 
ATOM   2267 N N   . VAL A 1 293 ? -2.013  54.117 60.649 1.00 29.02  ? 293  VAL A N   1 
ATOM   2268 C CA  . VAL A 1 293 ? -1.111  54.590 59.625 1.00 29.02  ? 293  VAL A CA  1 
ATOM   2269 C C   . VAL A 1 293 ? -1.223  53.687 58.411 1.00 29.02  ? 293  VAL A C   1 
ATOM   2270 O O   . VAL A 1 293 ? -1.883  52.656 58.470 1.00 29.02  ? 293  VAL A O   1 
ATOM   2271 C CB  . VAL A 1 293 ? 0.344   54.553 60.139 1.00 29.59  ? 293  VAL A CB  1 
ATOM   2272 C CG1 . VAL A 1 293 ? 0.531   55.571 61.253 1.00 29.59  ? 293  VAL A CG1 1 
ATOM   2273 C CG2 . VAL A 1 293 ? 0.690   53.145 60.628 1.00 29.59  ? 293  VAL A CG2 1 
ATOM   2274 N N   . PRO A 1 294 ? -0.592  54.070 57.288 1.00 34.51  ? 294  PRO A N   1 
ATOM   2275 C CA  . PRO A 1 294 ? -0.628  53.269 56.067 1.00 34.51  ? 294  PRO A CA  1 
ATOM   2276 C C   . PRO A 1 294 ? -0.256  51.815 56.321 1.00 34.51  ? 294  PRO A C   1 
ATOM   2277 O O   . PRO A 1 294 ? 0.473   51.501 57.251 1.00 34.51  ? 294  PRO A O   1 
ATOM   2278 C CB  . PRO A 1 294 ? 0.383   53.974 55.175 1.00 31.78  ? 294  PRO A CB  1 
ATOM   2279 C CG  . PRO A 1 294 ? 0.155   55.381 55.510 1.00 31.78  ? 294  PRO A CG  1 
ATOM   2280 C CD  . PRO A 1 294 ? 0.056   55.365 57.023 1.00 31.78  ? 294  PRO A CD  1 
ATOM   2281 N N   . VAL A 1 295 ? -0.761  50.928 55.480 1.00 36.37  ? 295  VAL A N   1 
ATOM   2282 C CA  . VAL A 1 295 ? -0.481  49.514 55.617 1.00 36.37  ? 295  VAL A CA  1 
ATOM   2283 C C   . VAL A 1 295 ? -0.125  48.880 54.284 1.00 36.37  ? 295  VAL A C   1 
ATOM   2284 O O   . VAL A 1 295 ? -0.782  49.119 53.280 1.00 36.37  ? 295  VAL A O   1 
ATOM   2285 C CB  . VAL A 1 295 ? -1.683  48.794 56.206 1.00 40.67  ? 295  VAL A CB  1 
ATOM   2286 C CG1 . VAL A 1 295 ? -2.939  49.337 55.592 1.00 40.67  ? 295  VAL A CG1 1 
ATOM   2287 C CG2 . VAL A 1 295 ? -1.574  47.307 55.944 1.00 40.67  ? 295  VAL A CG2 1 
ATOM   2288 N N   . ILE A 1 296 ? 0.928   48.072 54.296 1.00 41.52  ? 296  ILE A N   1 
ATOM   2289 C CA  . ILE A 1 296 ? 1.406   47.378 53.110 1.00 41.52  ? 296  ILE A CA  1 
ATOM   2290 C C   . ILE A 1 296 ? 0.369   46.325 52.762 1.00 41.52  ? 296  ILE A C   1 
ATOM   2291 O O   . ILE A 1 296 ? 0.402   45.210 53.273 1.00 41.52  ? 296  ILE A O   1 
ATOM   2292 C CB  . ILE A 1 296 ? 2.746   46.728 53.402 1.00 29.17  ? 296  ILE A CB  1 
ATOM   2293 C CG1 . ILE A 1 296 ? 3.685   47.772 54.020 1.00 29.17  ? 296  ILE A CG1 1 
ATOM   2294 C CG2 . ILE A 1 296 ? 3.323   46.145 52.130 1.00 29.17  ? 296  ILE A CG2 1 
ATOM   2295 C CD1 . ILE A 1 296 ? 3.905   49.009 53.151 1.00 29.17  ? 296  ILE A CD1 1 
ATOM   2296 N N   . ASP A 1 297 ? -0.540  46.702 51.869 1.00 56.08  ? 297  ASP A N   1 
ATOM   2297 C CA  . ASP A 1 297 ? -1.677  45.886 51.462 1.00 56.08  ? 297  ASP A CA  1 
ATOM   2298 C C   . ASP A 1 297 ? -1.552  45.062 50.186 1.00 56.08  ? 297  ASP A C   1 
ATOM   2299 O O   . ASP A 1 297 ? -2.350  44.151 49.961 1.00 56.08  ? 297  ASP A O   1 
ATOM   2300 C CB  . ASP A 1 297 ? -2.885  46.805 51.306 1.00 63.43  ? 297  ASP A CB  1 
ATOM   2301 C CG  . ASP A 1 297 ? -2.689  47.832 50.178 1.00 63.43  ? 297  ASP A CG  1 
ATOM   2302 O OD1 . ASP A 1 297 ? -1.567  47.903 49.614 1.00 63.43  ? 297  ASP A OD1 1 
ATOM   2303 O OD2 . ASP A 1 297 ? -3.648  48.571 49.851 1.00 63.43  ? 297  ASP A OD2 1 
ATOM   2304 N N   . GLY A 1 298 ? -0.595  45.389 49.327 1.00 59.81  ? 298  GLY A N   1 
ATOM   2305 C CA  . GLY A 1 298 ? -0.474  44.639 48.086 1.00 59.81  ? 298  GLY A CA  1 
ATOM   2306 C C   . GLY A 1 298 ? -1.199  45.321 46.932 1.00 59.81  ? 298  GLY A C   1 
ATOM   2307 O O   . GLY A 1 298 ? -1.270  44.797 45.813 1.00 59.81  ? 298  GLY A O   1 
ATOM   2308 N N   . GLU A 1 299 ? -1.756  46.495 47.202 1.00 53.71  ? 299  GLU A N   1 
ATOM   2309 C CA  . GLU A 1 299 ? -2.455  47.249 46.170 1.00 53.71  ? 299  GLU A CA  1 
ATOM   2310 C C   . GLU A 1 299 ? -1.727  48.566 46.018 1.00 53.71  ? 299  GLU A C   1 
ATOM   2311 O O   . GLU A 1 299 ? -0.956  48.743 45.079 1.00 53.71  ? 299  GLU A O   1 
ATOM   2312 C CB  . GLU A 1 299 ? -3.902  47.496 46.579 1.00 101.62 ? 299  GLU A CB  1 
ATOM   2313 C CG  . GLU A 1 299 ? -4.725  46.229 46.669 1.00 101.62 ? 299  GLU A CG  1 
ATOM   2314 C CD  . GLU A 1 299 ? -5.996  46.418 47.489 1.00 101.62 ? 299  GLU A CD  1 
ATOM   2315 O OE1 . GLU A 1 299 ? -6.874  47.221 47.072 1.00 101.62 ? 299  GLU A OE1 1 
ATOM   2316 O OE2 . GLU A 1 299 ? -6.103  45.762 48.556 1.00 101.62 ? 299  GLU A OE2 1 
ATOM   2317 N N   . PHE A 1 300 ? -1.963  49.484 46.952 1.00 44.00  ? 300  PHE A N   1 
ATOM   2318 C CA  . PHE A 1 300 ? -1.296  50.773 46.913 1.00 44.00  ? 300  PHE A CA  1 
ATOM   2319 C C   . PHE A 1 300 ? 0.195   50.452 46.823 1.00 44.00  ? 300  PHE A C   1 
ATOM   2320 O O   . PHE A 1 300 ? 0.924   51.052 46.040 1.00 44.00  ? 300  PHE A O   1 
ATOM   2321 C CB  . PHE A 1 300 ? -1.623  51.573 48.178 1.00 43.64  ? 300  PHE A CB  1 
ATOM   2322 C CG  . PHE A 1 300 ? -1.366  53.052 48.045 1.00 43.64  ? 300  PHE A CG  1 
ATOM   2323 C CD1 . PHE A 1 300 ? -0.077  53.569 48.179 1.00 43.64  ? 300  PHE A CD1 1 
ATOM   2324 C CD2 . PHE A 1 300 ? -2.409  53.926 47.756 1.00 43.64  ? 300  PHE A CD2 1 
ATOM   2325 C CE1 . PHE A 1 300 ? 0.166   54.936 48.026 1.00 43.64  ? 300  PHE A CE1 1 
ATOM   2326 C CE2 . PHE A 1 300 ? -2.180  55.289 47.599 1.00 43.64  ? 300  PHE A CE2 1 
ATOM   2327 C CZ  . PHE A 1 300 ? -0.891  55.798 47.734 1.00 43.64  ? 300  PHE A CZ  1 
ATOM   2328 N N   . PHE A 1 301 ? 0.632   49.480 47.617 1.00 45.13  ? 301  PHE A N   1 
ATOM   2329 C CA  . PHE A 1 301 ? 2.022   49.041 47.606 1.00 45.13  ? 301  PHE A CA  1 
ATOM   2330 C C   . PHE A 1 301 ? 2.060   47.605 47.076 1.00 45.13  ? 301  PHE A C   1 
ATOM   2331 O O   . PHE A 1 301 ? 1.586   46.678 47.730 1.00 45.13  ? 301  PHE A O   1 
ATOM   2332 C CB  . PHE A 1 301 ? 2.603   49.083 49.019 1.00 42.37  ? 301  PHE A CB  1 
ATOM   2333 C CG  . PHE A 1 301 ? 2.463   50.415 49.685 1.00 42.37  ? 301  PHE A CG  1 
ATOM   2334 C CD1 . PHE A 1 301 ? 3.208   51.510 49.244 1.00 42.37  ? 301  PHE A CD1 1 
ATOM   2335 C CD2 . PHE A 1 301 ? 1.563   50.589 50.734 1.00 42.37  ? 301  PHE A CD2 1 
ATOM   2336 C CE1 . PHE A 1 301 ? 3.059   52.757 49.834 1.00 42.37  ? 301  PHE A CE1 1 
ATOM   2337 C CE2 . PHE A 1 301 ? 1.405   51.831 51.334 1.00 42.37  ? 301  PHE A CE2 1 
ATOM   2338 C CZ  . PHE A 1 301 ? 2.155   52.921 50.883 1.00 42.37  ? 301  PHE A CZ  1 
ATOM   2339 N N   . PRO A 1 302 ? 2.610   47.406 45.869 1.00 48.61  ? 302  PRO A N   1 
ATOM   2340 C CA  . PRO A 1 302 ? 2.704   46.076 45.260 1.00 48.61  ? 302  PRO A CA  1 
ATOM   2341 C C   . PRO A 1 302 ? 3.282   45.012 46.188 1.00 48.61  ? 302  PRO A C   1 
ATOM   2342 O O   . PRO A 1 302 ? 2.646   43.990 46.430 1.00 48.61  ? 302  PRO A O   1 
ATOM   2343 C CB  . PRO A 1 302 ? 3.582   46.329 44.048 1.00 45.90  ? 302  PRO A CB  1 
ATOM   2344 C CG  . PRO A 1 302 ? 3.123   47.685 43.622 1.00 45.90  ? 302  PRO A CG  1 
ATOM   2345 C CD  . PRO A 1 302 ? 3.072   48.440 44.927 1.00 45.90  ? 302  PRO A CD  1 
ATOM   2346 N N   . THR A 1 303 ? 4.482   45.255 46.707 1.00 42.98  ? 303  THR A N   1 
ATOM   2347 C CA  . THR A 1 303 ? 5.133   44.310 47.614 1.00 42.98  ? 303  THR A CA  1 
ATOM   2348 C C   . THR A 1 303 ? 5.638   45.045 48.850 1.00 42.98  ? 303  THR A C   1 
ATOM   2349 O O   . THR A 1 303 ? 5.099   46.081 49.210 1.00 42.98  ? 303  THR A O   1 
ATOM   2350 C CB  . THR A 1 303 ? 6.305   43.622 46.915 1.00 46.24  ? 303  THR A CB  1 
ATOM   2351 O OG1 . THR A 1 303 ? 7.336   44.582 46.644 1.00 46.24  ? 303  THR A OG1 1 
ATOM   2352 C CG2 . THR A 1 303 ? 5.835   43.022 45.598 1.00 46.24  ? 303  THR A CG2 1 
ATOM   2353 N N   . SER A 1 304 ? 6.660   44.519 49.510 1.00 39.00  ? 304  SER A N   1 
ATOM   2354 C CA  . SER A 1 304 ? 7.188   45.191 50.695 1.00 39.00  ? 304  SER A CA  1 
ATOM   2355 C C   . SER A 1 304 ? 7.998   46.395 50.235 1.00 39.00  ? 304  SER A C   1 
ATOM   2356 O O   . SER A 1 304 ? 8.514   46.403 49.121 1.00 39.00  ? 304  SER A O   1 
ATOM   2357 C CB  . SER A 1 304 ? 8.102   44.263 51.487 1.00 46.24  ? 304  SER A CB  1 
ATOM   2358 O OG  . SER A 1 304 ? 9.399   44.255 50.921 1.00 46.24  ? 304  SER A OG  1 
ATOM   2359 N N   . LEU A 1 305 ? 8.128   47.405 51.089 1.00 45.32  ? 305  LEU A N   1 
ATOM   2360 C CA  . LEU A 1 305 ? 8.875   48.592 50.708 1.00 45.32  ? 305  LEU A CA  1 
ATOM   2361 C C   . LEU A 1 305 ? 10.350  48.326 50.414 1.00 45.32  ? 305  LEU A C   1 
ATOM   2362 O O   . LEU A 1 305 ? 10.889  48.817 49.420 1.00 45.32  ? 305  LEU A O   1 
ATOM   2363 C CB  . LEU A 1 305 ? 8.749   49.664 51.790 1.00 44.11  ? 305  LEU A CB  1 
ATOM   2364 C CG  . LEU A 1 305 ? 7.324   50.178 52.040 1.00 44.11  ? 305  LEU A CG  1 
ATOM   2365 C CD1 . LEU A 1 305 ? 7.362   51.276 53.111 1.00 44.11  ? 305  LEU A CD1 1 
ATOM   2366 C CD2 . LEU A 1 305 ? 6.710   50.701 50.729 1.00 44.11  ? 305  LEU A CD2 1 
ATOM   2367 N N   . GLU A 1 306 ? 11.001  47.535 51.259 1.00 44.12  ? 306  GLU A N   1 
ATOM   2368 C CA  . GLU A 1 306 ? 12.419  47.255 51.077 1.00 44.12  ? 306  GLU A CA  1 
ATOM   2369 C C   . GLU A 1 306 ? 12.751  46.594 49.748 1.00 44.12  ? 306  GLU A C   1 
ATOM   2370 O O   . GLU A 1 306 ? 13.776  46.911 49.134 1.00 44.12  ? 306  GLU A O   1 
ATOM   2371 C CB  . GLU A 1 306 ? 12.942  46.394 52.229 1.00 98.92  ? 306  GLU A CB  1 
ATOM   2372 C CG  . GLU A 1 306 ? 14.476  46.406 52.363 1.00 98.92  ? 306  GLU A CG  1 
ATOM   2373 C CD  . GLU A 1 306 ? 15.099  47.814 52.150 1.00 98.92  ? 306  GLU A CD  1 
ATOM   2374 O OE1 . GLU A 1 306 ? 14.464  48.831 52.562 1.00 98.92  ? 306  GLU A OE1 1 
ATOM   2375 O OE2 . GLU A 1 306 ? 16.228  47.893 51.580 1.00 98.92  ? 306  GLU A OE2 1 
ATOM   2376 N N   . SER A 1 307 ? 11.896  45.679 49.296 1.00 47.71  ? 307  SER A N   1 
ATOM   2377 C CA  . SER A 1 307 ? 12.139  45.002 48.025 1.00 47.71  ? 307  SER A CA  1 
ATOM   2378 C C   . SER A 1 307 ? 11.851  45.936 46.851 1.00 47.71  ? 307  SER A C   1 
ATOM   2379 O O   . SER A 1 307 ? 12.434  45.792 45.781 1.00 47.71  ? 307  SER A O   1 
ATOM   2380 C CB  . SER A 1 307 ? 11.284  43.743 47.910 1.00 53.73  ? 307  SER A CB  1 
ATOM   2381 O OG  . SER A 1 307 ? 9.911   44.062 47.838 1.00 53.73  ? 307  SER A OG  1 
ATOM   2382 N N   . MET A 1 308 ? 10.947  46.890 47.052 1.00 40.28  ? 308  MET A N   1 
ATOM   2383 C CA  . MET A 1 308 ? 10.626  47.846 46.004 1.00 40.28  ? 308  MET A CA  1 
ATOM   2384 C C   . MET A 1 308 ? 11.829  48.763 45.826 1.00 40.28  ? 308  MET A C   1 
ATOM   2385 O O   . MET A 1 308 ? 12.224  49.075 44.701 1.00 40.28  ? 308  MET A O   1 
ATOM   2386 C CB  . MET A 1 308 ? 9.407   48.692 46.387 1.00 56.32  ? 308  MET A CB  1 
ATOM   2387 C CG  . MET A 1 308 ? 8.099   47.941 46.446 1.00 56.32  ? 308  MET A CG  1 
ATOM   2388 S SD  . MET A 1 308 ? 6.700   49.101 46.472 1.00 56.32  ? 308  MET A SD  1 
ATOM   2389 C CE  . MET A 1 308 ? 6.282   49.200 44.700 1.00 56.32  ? 308  MET A CE  1 
ATOM   2390 N N   . LEU A 1 309 ? 12.403  49.196 46.948 1.00 40.15  ? 309  LEU A N   1 
ATOM   2391 C CA  . LEU A 1 309 ? 13.563  50.075 46.922 1.00 40.15  ? 309  LEU A CA  1 
ATOM   2392 C C   . LEU A 1 309 ? 14.794  49.378 46.336 1.00 40.15  ? 309  LEU A C   1 
ATOM   2393 O O   . LEU A 1 309 ? 15.657  50.027 45.739 1.00 40.15  ? 309  LEU A O   1 
ATOM   2394 C CB  . LEU A 1 309 ? 13.880  50.580 48.333 1.00 38.65  ? 309  LEU A CB  1 
ATOM   2395 C CG  . LEU A 1 309 ? 12.965  51.645 48.942 1.00 38.65  ? 309  LEU A CG  1 
ATOM   2396 C CD1 . LEU A 1 309 ? 13.379  51.921 50.370 1.00 38.65  ? 309  LEU A CD1 1 
ATOM   2397 C CD2 . LEU A 1 309 ? 13.044  52.916 48.118 1.00 38.65  ? 309  LEU A CD2 1 
ATOM   2398 N N   . ASN A 1 310 ? 14.877  48.060 46.505 1.00 42.22  ? 310  ASN A N   1 
ATOM   2399 C CA  . ASN A 1 310 ? 16.011  47.297 45.989 1.00 42.22  ? 310  ASN A CA  1 
ATOM   2400 C C   . ASN A 1 310 ? 15.887  46.949 44.524 1.00 42.22  ? 310  ASN A C   1 
ATOM   2401 O O   . ASN A 1 310 ? 16.887  46.814 43.830 1.00 42.22  ? 310  ASN A O   1 
ATOM   2402 C CB  . ASN A 1 310 ? 16.202  46.007 46.790 1.00 75.73  ? 310  ASN A CB  1 
ATOM   2403 C CG  . ASN A 1 310 ? 17.044  46.221 48.036 1.00 75.73  ? 310  ASN A CG  1 
ATOM   2404 O OD1 . ASN A 1 310 ? 18.131  46.807 47.961 1.00 75.73  ? 310  ASN A OD1 1 
ATOM   2405 N ND2 . ASN A 1 310 ? 16.555  45.749 49.188 1.00 75.73  ? 310  ASN A ND2 1 
ATOM   2406 N N   . SER A 1 311 ? 14.655  46.805 44.055 1.00 46.67  ? 311  SER A N   1 
ATOM   2407 C CA  . SER A 1 311 ? 14.407  46.447 42.667 1.00 46.67  ? 311  SER A CA  1 
ATOM   2408 C C   . SER A 1 311 ? 14.230  47.638 41.720 1.00 46.67  ? 311  SER A C   1 
ATOM   2409 O O   . SER A 1 311 ? 13.996  47.441 40.530 1.00 46.67  ? 311  SER A O   1 
ATOM   2410 C CB  . SER A 1 311 ? 13.173  45.540 42.580 1.00 50.15  ? 311  SER A CB  1 
ATOM   2411 O OG  . SER A 1 311 ? 12.007  46.183 43.074 1.00 50.15  ? 311  SER A OG  1 
ATOM   2412 N N   . GLY A 1 312 ? 14.341  48.861 42.236 1.00 42.21  ? 312  GLY A N   1 
ATOM   2413 C CA  . GLY A 1 312 ? 14.182  50.036 41.391 1.00 42.21  ? 312  GLY A CA  1 
ATOM   2414 C C   . GLY A 1 312 ? 12.741  50.236 40.950 1.00 42.21  ? 312  GLY A C   1 
ATOM   2415 O O   . GLY A 1 312 ? 12.447  50.973 40.011 1.00 42.21  ? 312  GLY A O   1 
ATOM   2416 N N   . ASN A 1 313 ? 11.836  49.569 41.648 1.00 41.76  ? 313  ASN A N   1 
ATOM   2417 C CA  . ASN A 1 313 ? 10.421  49.646 41.346 1.00 41.76  ? 313  ASN A CA  1 
ATOM   2418 C C   . ASN A 1 313 ? 9.827   50.911 41.953 1.00 41.76  ? 313  ASN A C   1 
ATOM   2419 O O   . ASN A 1 313 ? 9.203   50.876 43.012 1.00 41.76  ? 313  ASN A O   1 
ATOM   2420 C CB  . ASN A 1 313 ? 9.722   48.397 41.892 1.00 48.79  ? 313  ASN A CB  1 
ATOM   2421 C CG  . ASN A 1 313 ? 8.283   48.308 41.466 1.00 48.79  ? 313  ASN A CG  1 
ATOM   2422 O OD1 . ASN A 1 313 ? 7.809   49.136 40.690 1.00 48.79  ? 313  ASN A OD1 1 
ATOM   2423 N ND2 . ASN A 1 313 ? 7.569   47.305 41.973 1.00 48.79  ? 313  ASN A ND2 1 
ATOM   2424 N N   . PHE A 1 314 ? 10.042  52.034 41.280 1.00 40.16  ? 314  PHE A N   1 
ATOM   2425 C CA  . PHE A 1 314 ? 9.537   53.324 41.745 1.00 40.16  ? 314  PHE A CA  1 
ATOM   2426 C C   . PHE A 1 314 ? 9.804   54.444 40.739 1.00 40.16  ? 314  PHE A C   1 
ATOM   2427 O O   . PHE A 1 314 ? 10.657  54.318 39.867 1.00 40.16  ? 314  PHE A O   1 
ATOM   2428 C CB  . PHE A 1 314 ? 10.136  53.674 43.125 1.00 34.72  ? 314  PHE A CB  1 
ATOM   2429 C CG  . PHE A 1 314 ? 11.645  53.686 43.168 1.00 34.72  ? 314  PHE A CG  1 
ATOM   2430 C CD1 . PHE A 1 314 ? 12.368  54.726 42.602 1.00 34.72  ? 314  PHE A CD1 1 
ATOM   2431 C CD2 . PHE A 1 314 ? 12.341  52.645 43.775 1.00 34.72  ? 314  PHE A CD2 1 
ATOM   2432 C CE1 . PHE A 1 314 ? 13.758  54.726 42.639 1.00 34.72  ? 314  PHE A CE1 1 
ATOM   2433 C CE2 . PHE A 1 314 ? 13.729  52.641 43.814 1.00 34.72  ? 314  PHE A CE2 1 
ATOM   2434 C CZ  . PHE A 1 314 ? 14.437  53.682 43.245 1.00 34.72  ? 314  PHE A CZ  1 
ATOM   2435 N N   . LYS A 1 315 ? 9.072   55.542 40.865 1.00 36.19  ? 315  LYS A N   1 
ATOM   2436 C CA  . LYS A 1 315 ? 9.223   56.656 39.947 1.00 36.19  ? 315  LYS A CA  1 
ATOM   2437 C C   . LYS A 1 315 ? 10.614  57.279 39.940 1.00 36.19  ? 315  LYS A C   1 
ATOM   2438 O O   . LYS A 1 315 ? 11.056  57.857 40.933 1.00 36.19  ? 315  LYS A O   1 
ATOM   2439 C CB  . LYS A 1 315 ? 8.195   57.732 40.265 1.00 34.11  ? 315  LYS A CB  1 
ATOM   2440 C CG  . LYS A 1 315 ? 8.222   58.897 39.303 1.00 34.11  ? 315  LYS A CG  1 
ATOM   2441 C CD  . LYS A 1 315 ? 7.286   60.006 39.754 1.00 34.11  ? 315  LYS A CD  1 
ATOM   2442 C CE  . LYS A 1 315 ? 7.347   61.173 38.802 1.00 34.11  ? 315  LYS A CE  1 
ATOM   2443 N NZ  . LYS A 1 315 ? 7.016   60.741 37.415 1.00 34.11  ? 315  LYS A NZ  1 
ATOM   2444 N N   . LYS A 1 316 ? 11.302  57.164 38.811 1.00 38.16  ? 316  LYS A N   1 
ATOM   2445 C CA  . LYS A 1 316 ? 12.631  57.739 38.679 1.00 38.16  ? 316  LYS A CA  1 
ATOM   2446 C C   . LYS A 1 316 ? 12.552  59.188 38.211 1.00 38.16  ? 316  LYS A C   1 
ATOM   2447 O O   . LYS A 1 316 ? 12.121  59.461 37.097 1.00 38.16  ? 316  LYS A O   1 
ATOM   2448 C CB  . LYS A 1 316 ? 13.462  56.930 37.689 1.00 48.60  ? 316  LYS A CB  1 
ATOM   2449 C CG  . LYS A 1 316 ? 13.940  55.617 38.240 1.00 48.60  ? 316  LYS A CG  1 
ATOM   2450 C CD  . LYS A 1 316 ? 13.182  54.450 37.669 1.00 48.60  ? 316  LYS A CD  1 
ATOM   2451 C CE  . LYS A 1 316 ? 13.698  53.164 38.284 1.00 48.60  ? 316  LYS A CE  1 
ATOM   2452 N NZ  . LYS A 1 316 ? 13.027  51.976 37.711 1.00 48.60  ? 316  LYS A NZ  1 
ATOM   2453 N N   . THR A 1 317 ? 12.967  60.117 39.064 1.00 39.71  ? 317  THR A N   1 
ATOM   2454 C CA  . THR A 1 317 ? 12.939  61.538 38.729 1.00 39.71  ? 317  THR A CA  1 
ATOM   2455 C C   . THR A 1 317 ? 14.000  62.245 39.578 1.00 39.71  ? 317  THR A C   1 
ATOM   2456 O O   . THR A 1 317 ? 15.011  61.635 39.911 1.00 39.71  ? 317  THR A O   1 
ATOM   2457 C CB  . THR A 1 317 ? 11.513  62.117 38.980 1.00 50.33  ? 317  THR A CB  1 
ATOM   2458 O OG1 . THR A 1 317 ? 11.532  63.539 38.802 1.00 50.33  ? 317  THR A OG1 1 
ATOM   2459 C CG2 . THR A 1 317 ? 11.013  61.761 40.374 1.00 50.33  ? 317  THR A CG2 1 
ATOM   2460 N N   . GLN A 1 318 ? 13.819  63.522 39.894 1.00 34.49  ? 318  GLN A N   1 
ATOM   2461 C CA  . GLN A 1 318 ? 14.789  64.197 40.754 1.00 34.49  ? 318  GLN A CA  1 
ATOM   2462 C C   . GLN A 1 318 ? 14.098  64.379 42.088 1.00 34.49  ? 318  GLN A C   1 
ATOM   2463 O O   . GLN A 1 318 ? 12.883  64.467 42.140 1.00 34.49  ? 318  GLN A O   1 
ATOM   2464 C CB  . GLN A 1 318 ? 15.169  65.587 40.239 1.00 40.90  ? 318  GLN A CB  1 
ATOM   2465 C CG  . GLN A 1 318 ? 15.748  65.656 38.861 1.00 40.90  ? 318  GLN A CG  1 
ATOM   2466 C CD  . GLN A 1 318 ? 14.677  65.690 37.811 1.00 40.90  ? 318  GLN A CD  1 
ATOM   2467 O OE1 . GLN A 1 318 ? 13.697  66.426 37.938 1.00 40.90  ? 318  GLN A OE1 1 
ATOM   2468 N NE2 . GLN A 1 318 ? 14.853  64.900 36.756 1.00 40.90  ? 318  GLN A NE2 1 
ATOM   2469 N N   . ILE A 1 319 ? 14.856  64.421 43.170 1.00 36.77  ? 319  ILE A N   1 
ATOM   2470 C CA  . ILE A 1 319 ? 14.256  64.647 44.471 1.00 36.77  ? 319  ILE A CA  1 
ATOM   2471 C C   . ILE A 1 319 ? 15.202  65.485 45.299 1.00 36.77  ? 319  ILE A C   1 
ATOM   2472 O O   . ILE A 1 319 ? 16.420  65.461 45.103 1.00 36.77  ? 319  ILE A O   1 
ATOM   2473 C CB  . ILE A 1 319 ? 13.959  63.348 45.249 1.00 33.03  ? 319  ILE A CB  1 
ATOM   2474 C CG1 . ILE A 1 319 ? 15.244  62.561 45.468 1.00 33.03  ? 319  ILE A CG1 1 
ATOM   2475 C CG2 . ILE A 1 319 ? 12.931  62.524 44.522 1.00 33.03  ? 319  ILE A CG2 1 
ATOM   2476 C CD1 . ILE A 1 319 ? 15.035  61.296 46.246 1.00 33.03  ? 319  ILE A CD1 1 
ATOM   2477 N N   . LEU A 1 320 ? 14.622  66.242 46.216 1.00 37.33  ? 320  LEU A N   1 
ATOM   2478 C CA  . LEU A 1 320 ? 15.384  67.098 47.098 1.00 37.33  ? 320  LEU A CA  1 
ATOM   2479 C C   . LEU A 1 320 ? 14.847  66.779 48.485 1.00 37.33  ? 320  LEU A C   1 
ATOM   2480 O O   . LEU A 1 320 ? 13.652  66.900 48.727 1.00 37.33  ? 320  LEU A O   1 
ATOM   2481 C CB  . LEU A 1 320 ? 15.136  68.560 46.723 1.00 30.49  ? 320  LEU A CB  1 
ATOM   2482 C CG  . LEU A 1 320 ? 15.940  69.653 47.419 1.00 30.49  ? 320  LEU A CG  1 
ATOM   2483 C CD1 . LEU A 1 320 ? 15.886  70.906 46.588 1.00 30.49  ? 320  LEU A CD1 1 
ATOM   2484 C CD2 . LEU A 1 320 ? 15.392  69.908 48.796 1.00 30.49  ? 320  LEU A CD2 1 
ATOM   2485 N N   . LEU A 1 321 ? 15.714  66.337 49.386 1.00 36.75  ? 321  LEU A N   1 
ATOM   2486 C CA  . LEU A 1 321 ? 15.262  66.006 50.727 1.00 36.75  ? 321  LEU A CA  1 
ATOM   2487 C C   . LEU A 1 321 ? 16.305  66.300 51.804 1.00 36.75  ? 321  LEU A C   1 
ATOM   2488 O O   . LEU A 1 321 ? 17.466  66.570 51.507 1.00 36.75  ? 321  LEU A O   1 
ATOM   2489 C CB  . LEU A 1 321 ? 14.815  64.538 50.783 1.00 38.12  ? 321  LEU A CB  1 
ATOM   2490 C CG  . LEU A 1 321 ? 15.819  63.398 50.640 1.00 38.12  ? 321  LEU A CG  1 
ATOM   2491 C CD1 . LEU A 1 321 ? 15.067  62.088 50.474 1.00 38.12  ? 321  LEU A CD1 1 
ATOM   2492 C CD2 . LEU A 1 321 ? 16.694  63.638 49.440 1.00 38.12  ? 321  LEU A CD2 1 
ATOM   2493 N N   . GLY A 1 322 ? 15.876  66.265 53.058 1.00 36.59  ? 322  GLY A N   1 
ATOM   2494 C CA  . GLY A 1 322 ? 16.789  66.540 54.146 1.00 36.59  ? 322  GLY A CA  1 
ATOM   2495 C C   . GLY A 1 322 ? 16.130  66.342 55.488 1.00 36.59  ? 322  GLY A C   1 
ATOM   2496 O O   . GLY A 1 322 ? 14.988  65.906 55.555 1.00 36.59  ? 322  GLY A O   1 
ATOM   2497 N N   . VAL A 1 323 ? 16.844  66.674 56.556 1.00 30.54  ? 323  VAL A N   1 
ATOM   2498 C CA  . VAL A 1 323 ? 16.323  66.507 57.900 1.00 30.54  ? 323  VAL A CA  1 
ATOM   2499 C C   . VAL A 1 323 ? 16.723  67.687 58.775 1.00 30.54  ? 323  VAL A C   1 
ATOM   2500 O O   . VAL A 1 323 ? 17.535  68.507 58.369 1.00 30.54  ? 323  VAL A O   1 
ATOM   2501 C CB  . VAL A 1 323 ? 16.888  65.216 58.545 1.00 33.70  ? 323  VAL A CB  1 
ATOM   2502 C CG1 . VAL A 1 323 ? 16.535  64.010 57.704 1.00 33.70  ? 323  VAL A CG1 1 
ATOM   2503 C CG2 . VAL A 1 323 ? 18.386  65.317 58.684 1.00 33.70  ? 323  VAL A CG2 1 
ATOM   2504 N N   . ASN A 1 324 ? 16.137  67.774 59.969 1.00 40.06  ? 324  ASN A N   1 
ATOM   2505 C CA  . ASN A 1 324 ? 16.475  68.825 60.930 1.00 40.06  ? 324  ASN A CA  1 
ATOM   2506 C C   . ASN A 1 324 ? 17.503  68.259 61.899 1.00 40.06  ? 324  ASN A C   1 
ATOM   2507 O O   . ASN A 1 324 ? 17.565  67.053 62.104 1.00 40.06  ? 324  ASN A O   1 
ATOM   2508 C CB  . ASN A 1 324 ? 15.255  69.276 61.729 1.00 50.60  ? 324  ASN A CB  1 
ATOM   2509 C CG  . ASN A 1 324 ? 14.267  70.037 60.893 1.00 50.60  ? 324  ASN A CG  1 
ATOM   2510 O OD1 . ASN A 1 324 ? 14.588  70.495 59.793 1.00 50.60  ? 324  ASN A OD1 1 
ATOM   2511 N ND2 . ASN A 1 324 ? 13.052  70.191 61.410 1.00 50.60  ? 324  ASN A ND2 1 
ATOM   2512 N N   . LYS A 1 325 ? 18.302  69.126 62.505 1.00 41.94  ? 325  LYS A N   1 
ATOM   2513 C CA  . LYS A 1 325 ? 19.326  68.669 63.436 1.00 41.94  ? 325  LYS A CA  1 
ATOM   2514 C C   . LYS A 1 325 ? 18.768  67.891 64.623 1.00 41.94  ? 325  LYS A C   1 
ATOM   2515 O O   . LYS A 1 325 ? 19.280  66.828 64.962 1.00 41.94  ? 325  LYS A O   1 
ATOM   2516 C CB  . LYS A 1 325 ? 20.139  69.861 63.953 1.00 47.65  ? 325  LYS A CB  1 
ATOM   2517 C CG  . LYS A 1 325 ? 21.290  69.487 64.863 1.00 47.65  ? 325  LYS A CG  1 
ATOM   2518 C CD  . LYS A 1 325 ? 21.943  70.733 65.446 1.00 47.65  ? 325  LYS A CD  1 
ATOM   2519 C CE  . LYS A 1 325 ? 23.168  70.395 66.292 1.00 47.65  ? 325  LYS A CE  1 
ATOM   2520 N NZ  . LYS A 1 325 ? 22.819  69.543 67.471 1.00 47.65  ? 325  LYS A NZ  1 
ATOM   2521 N N   . ASP A 1 326 ? 17.708  68.404 65.238 1.00 46.10  ? 326  ASP A N   1 
ATOM   2522 C CA  . ASP A 1 326 ? 17.154  67.752 66.414 1.00 46.10  ? 326  ASP A CA  1 
ATOM   2523 C C   . ASP A 1 326 ? 15.707  67.268 66.280 1.00 46.10  ? 326  ASP A C   1 
ATOM   2524 O O   . ASP A 1 326 ? 14.807  67.710 66.989 1.00 46.10  ? 326  ASP A O   1 
ATOM   2525 C CB  . ASP A 1 326 ? 17.323  68.696 67.613 1.00 58.86  ? 326  ASP A CB  1 
ATOM   2526 C CG  . ASP A 1 326 ? 18.801  69.105 67.838 1.00 58.86  ? 326  ASP A CG  1 
ATOM   2527 O OD1 . ASP A 1 326 ? 19.625  68.210 68.140 1.00 58.86  ? 326  ASP A OD1 1 
ATOM   2528 O OD2 . ASP A 1 326 ? 19.147  70.310 67.703 1.00 58.86  ? 326  ASP A OD2 1 
ATOM   2529 N N   . GLU A 1 327 ? 15.514  66.320 65.372 1.00 54.86  ? 327  GLU A N   1 
ATOM   2530 C CA  . GLU A 1 327 ? 14.216  65.728 65.081 1.00 54.86  ? 327  GLU A CA  1 
ATOM   2531 C C   . GLU A 1 327 ? 13.524  65.031 66.258 1.00 54.86  ? 327  GLU A C   1 
ATOM   2532 O O   . GLU A 1 327 ? 12.294  64.926 66.278 1.00 54.86  ? 327  GLU A O   1 
ATOM   2533 C CB  . GLU A 1 327 ? 14.372  64.696 63.958 1.00 85.05  ? 327  GLU A CB  1 
ATOM   2534 C CG  . GLU A 1 327 ? 14.955  65.239 62.665 1.00 85.05  ? 327  GLU A CG  1 
ATOM   2535 C CD  . GLU A 1 327 ? 13.889  65.816 61.732 1.00 85.05  ? 327  GLU A CD  1 
ATOM   2536 O OE1 . GLU A 1 327 ? 12.866  66.350 62.244 1.00 85.05  ? 327  GLU A OE1 1 
ATOM   2537 O OE2 . GLU A 1 327 ? 14.080  65.745 60.490 1.00 85.05  ? 327  GLU A OE2 1 
ATOM   2538 N N   . GLY A 1 328 ? 14.290  64.544 67.228 1.00 44.09  ? 328  GLY A N   1 
ATOM   2539 C CA  . GLY A 1 328 ? 13.673  63.814 68.321 1.00 44.09  ? 328  GLY A CA  1 
ATOM   2540 C C   . GLY A 1 328 ? 13.067  64.538 69.511 1.00 44.09  ? 328  GLY A C   1 
ATOM   2541 O O   . GLY A 1 328 ? 11.997  64.155 69.992 1.00 44.09  ? 328  GLY A O   1 
ATOM   2542 N N   . SER A 1 329 ? 13.740  65.581 69.990 1.00 46.22  ? 329  SER A N   1 
ATOM   2543 C CA  . SER A 1 329 ? 13.293  66.320 71.166 1.00 46.22  ? 329  SER A CA  1 
ATOM   2544 C C   . SER A 1 329 ? 11.788  66.473 71.376 1.00 46.22  ? 329  SER A C   1 
ATOM   2545 O O   . SER A 1 329 ? 11.296  66.277 72.481 1.00 46.22  ? 329  SER A O   1 
ATOM   2546 C CB  . SER A 1 329 ? 13.951  67.693 71.192 1.00 42.43  ? 329  SER A CB  1 
ATOM   2547 O OG  . SER A 1 329 ? 13.556  68.421 70.064 1.00 42.43  ? 329  SER A OG  1 
ATOM   2548 N N   . PHE A 1 330 ? 11.048  66.802 70.331 1.00 46.04  ? 330  PHE A N   1 
ATOM   2549 C CA  . PHE A 1 330 ? 9.612   66.998 70.484 1.00 46.04  ? 330  PHE A CA  1 
ATOM   2550 C C   . PHE A 1 330 ? 8.825   65.844 71.095 1.00 46.04  ? 330  PHE A C   1 
ATOM   2551 O O   . PHE A 1 330 ? 7.886   66.073 71.855 1.00 46.04  ? 330  PHE A O   1 
ATOM   2552 C CB  . PHE A 1 330 ? 8.990   67.343 69.148 1.00 61.99  ? 330  PHE A CB  1 
ATOM   2553 C CG  . PHE A 1 330 ? 7.869   68.308 69.258 1.00 61.99  ? 330  PHE A CG  1 
ATOM   2554 C CD1 . PHE A 1 330 ? 6.761   68.011 70.033 1.00 61.99  ? 330  PHE A CD1 1 
ATOM   2555 C CD2 . PHE A 1 330 ? 7.933   69.542 68.616 1.00 61.99  ? 330  PHE A CD2 1 
ATOM   2556 C CE1 . PHE A 1 330 ? 5.723   68.935 70.176 1.00 61.99  ? 330  PHE A CE1 1 
ATOM   2557 C CE2 . PHE A 1 330 ? 6.901   70.475 68.753 1.00 61.99  ? 330  PHE A CE2 1 
ATOM   2558 C CZ  . PHE A 1 330 ? 5.795   70.169 69.536 1.00 61.99  ? 330  PHE A CZ  1 
ATOM   2559 N N   . PHE A 1 331 ? 9.204   64.609 70.773 1.00 41.89  ? 331  PHE A N   1 
ATOM   2560 C CA  . PHE A 1 331 ? 8.500   63.430 71.274 1.00 41.89  ? 331  PHE A CA  1 
ATOM   2561 C C   . PHE A 1 331 ? 8.927   63.010 72.657 1.00 41.89  ? 331  PHE A C   1 
ATOM   2562 O O   . PHE A 1 331 ? 8.168   62.364 73.372 1.00 41.89  ? 331  PHE A O   1 
ATOM   2563 C CB  . PHE A 1 331 ? 8.673   62.269 70.299 1.00 33.32  ? 331  PHE A CB  1 
ATOM   2564 C CG  . PHE A 1 331 ? 8.266   62.615 68.910 1.00 33.32  ? 331  PHE A CG  1 
ATOM   2565 C CD1 . PHE A 1 331 ? 9.064   63.441 68.128 1.00 33.32  ? 331  PHE A CD1 1 
ATOM   2566 C CD2 . PHE A 1 331 ? 7.044   62.198 68.409 1.00 33.32  ? 331  PHE A CD2 1 
ATOM   2567 C CE1 . PHE A 1 331 ? 8.645   63.853 66.867 1.00 33.32  ? 331  PHE A CE1 1 
ATOM   2568 C CE2 . PHE A 1 331 ? 6.616   62.601 67.152 1.00 33.32  ? 331  PHE A CE2 1 
ATOM   2569 C CZ  . PHE A 1 331 ? 7.418   63.432 66.379 1.00 33.32  ? 331  PHE A CZ  1 
ATOM   2570 N N   . LEU A 1 332 ? 10.148  63.359 73.031 1.00 43.31  ? 332  LEU A N   1 
ATOM   2571 C CA  . LEU A 1 332 ? 10.644  63.033 74.359 1.00 43.31  ? 332  LEU A CA  1 
ATOM   2572 C C   . LEU A 1 332 ? 9.922   63.945 75.351 1.00 43.31  ? 332  LEU A C   1 
ATOM   2573 O O   . LEU A 1 332 ? 9.538   63.528 76.443 1.00 43.31  ? 332  LEU A O   1 
ATOM   2574 C CB  . LEU A 1 332 ? 12.152  63.274 74.427 1.00 34.50  ? 332  LEU A CB  1 
ATOM   2575 C CG  . LEU A 1 332 ? 13.034  62.274 73.695 1.00 34.50  ? 332  LEU A CG  1 
ATOM   2576 C CD1 . LEU A 1 332 ? 14.403  62.865 73.467 1.00 34.50  ? 332  LEU A CD1 1 
ATOM   2577 C CD2 . LEU A 1 332 ? 13.128  61.014 74.509 1.00 34.50  ? 332  LEU A CD2 1 
ATOM   2578 N N   . LEU A 1 333 ? 9.735   65.195 74.950 1.00 42.49  ? 333  LEU A N   1 
ATOM   2579 C CA  . LEU A 1 333 ? 9.065   66.173 75.787 1.00 42.49  ? 333  LEU A CA  1 
ATOM   2580 C C   . LEU A 1 333 ? 7.698   65.671 76.210 1.00 42.49  ? 333  LEU A C   1 
ATOM   2581 O O   . LEU A 1 333 ? 7.350   65.709 77.390 1.00 42.49  ? 333  LEU A O   1 
ATOM   2582 C CB  . LEU A 1 333 ? 8.908   67.489 75.029 1.00 44.95  ? 333  LEU A CB  1 
ATOM   2583 C CG  . LEU A 1 333 ? 8.060   68.566 75.703 1.00 44.95  ? 333  LEU A CG  1 
ATOM   2584 C CD1 . LEU A 1 333 ? 8.610   68.860 77.097 1.00 44.95  ? 333  LEU A CD1 1 
ATOM   2585 C CD2 . LEU A 1 333 ? 8.063   69.827 74.835 1.00 44.95  ? 333  LEU A CD2 1 
ATOM   2586 N N   . TYR A 1 334 ? 6.932   65.191 75.237 1.00 51.15  ? 334  TYR A N   1 
ATOM   2587 C CA  . TYR A 1 334 ? 5.591   64.697 75.490 1.00 51.15  ? 334  TYR A CA  1 
ATOM   2588 C C   . TYR A 1 334 ? 5.494   63.306 76.101 1.00 51.15  ? 334  TYR A C   1 
ATOM   2589 O O   . TYR A 1 334 ? 4.515   63.015 76.784 1.00 51.15  ? 334  TYR A O   1 
ATOM   2590 C CB  . TYR A 1 334 ? 4.763   64.702 74.198 1.00 41.59  ? 334  TYR A CB  1 
ATOM   2591 C CG  . TYR A 1 334 ? 4.227   66.051 73.784 1.00 41.59  ? 334  TYR A CG  1 
ATOM   2592 C CD1 . TYR A 1 334 ? 5.090   67.111 73.531 1.00 41.59  ? 334  TYR A CD1 1 
ATOM   2593 C CD2 . TYR A 1 334 ? 2.858   66.268 73.643 1.00 41.59  ? 334  TYR A CD2 1 
ATOM   2594 C CE1 . TYR A 1 334 ? 4.607   68.362 73.147 1.00 41.59  ? 334  TYR A CE1 1 
ATOM   2595 C CE2 . TYR A 1 334 ? 2.361   67.516 73.256 1.00 41.59  ? 334  TYR A CE2 1 
ATOM   2596 C CZ  . TYR A 1 334 ? 3.245   68.561 73.009 1.00 41.59  ? 334  TYR A CZ  1 
ATOM   2597 O OH  . TYR A 1 334 ? 2.793   69.805 72.612 1.00 41.59  ? 334  TYR A OH  1 
ATOM   2598 N N   . GLY A 1 335 ? 6.477   62.438 75.887 1.00 40.45  ? 335  GLY A N   1 
ATOM   2599 C CA  . GLY A 1 335 ? 6.312   61.106 76.434 1.00 40.45  ? 335  GLY A CA  1 
ATOM   2600 C C   . GLY A 1 335 ? 7.367   60.426 77.277 1.00 40.45  ? 335  GLY A C   1 
ATOM   2601 O O   . GLY A 1 335 ? 7.077   59.409 77.917 1.00 40.45  ? 335  GLY A O   1 
ATOM   2602 N N   . ALA A 1 336 ? 8.585   60.946 77.293 1.00 41.89  ? 336  ALA A N   1 
ATOM   2603 C CA  . ALA A 1 336 ? 9.621   60.299 78.080 1.00 41.89  ? 336  ALA A CA  1 
ATOM   2604 C C   . ALA A 1 336 ? 9.791   60.934 79.451 1.00 41.89  ? 336  ALA A C   1 
ATOM   2605 O O   . ALA A 1 336 ? 9.815   62.150 79.590 1.00 41.89  ? 336  ALA A O   1 
ATOM   2606 C CB  . ALA A 1 336 ? 10.936  60.317 77.324 1.00 51.72  ? 336  ALA A CB  1 
ATOM   2607 N N   . PRO A 1 337 ? 9.912   60.107 80.489 1.00 56.00  ? 337  PRO A N   1 
ATOM   2608 C CA  . PRO A 1 337 ? 10.083  60.604 81.858 1.00 56.00  ? 337  PRO A CA  1 
ATOM   2609 C C   . PRO A 1 337 ? 11.397  61.386 82.037 1.00 56.00  ? 337  PRO A C   1 
ATOM   2610 O O   . PRO A 1 337 ? 12.475  60.917 81.646 1.00 56.00  ? 337  PRO A O   1 
ATOM   2611 C CB  . PRO A 1 337 ? 10.056  59.325 82.681 1.00 67.38  ? 337  PRO A CB  1 
ATOM   2612 C CG  . PRO A 1 337 ? 10.723  58.325 81.731 1.00 67.38  ? 337  PRO A CG  1 
ATOM   2613 C CD  . PRO A 1 337 ? 10.019  58.639 80.438 1.00 67.38  ? 337  PRO A CD  1 
ATOM   2614 N N   . GLY A 1 338 ? 11.303  62.578 82.619 1.00 43.03  ? 338  GLY A N   1 
ATOM   2615 C CA  . GLY A 1 338 ? 12.494  63.375 82.832 1.00 43.03  ? 338  GLY A CA  1 
ATOM   2616 C C   . GLY A 1 338 ? 12.483  64.716 82.124 1.00 43.03  ? 338  GLY A C   1 
ATOM   2617 O O   . GLY A 1 338 ? 13.051  65.683 82.638 1.00 43.03  ? 338  GLY A O   1 
ATOM   2618 N N   . PHE A 1 339 ? 11.834  64.788 80.962 1.00 43.64  ? 339  PHE A N   1 
ATOM   2619 C CA  . PHE A 1 339 ? 11.787  66.025 80.185 1.00 43.64  ? 339  PHE A CA  1 
ATOM   2620 C C   . PHE A 1 339 ? 10.650  66.963 80.569 1.00 43.64  ? 339  PHE A C   1 
ATOM   2621 O O   . PHE A 1 339 ? 9.534   66.526 80.826 1.00 43.64  ? 339  PHE A O   1 
ATOM   2622 C CB  . PHE A 1 339 ? 11.713  65.702 78.692 1.00 34.58  ? 339  PHE A CB  1 
ATOM   2623 C CG  . PHE A 1 339 ? 12.855  64.857 78.198 1.00 34.58  ? 339  PHE A CG  1 
ATOM   2624 C CD1 . PHE A 1 339 ? 12.936  63.509 78.528 1.00 34.58  ? 339  PHE A CD1 1 
ATOM   2625 C CD2 . PHE A 1 339 ? 13.850  65.407 77.401 1.00 34.58  ? 339  PHE A CD2 1 
ATOM   2626 C CE1 . PHE A 1 339 ? 13.989  62.723 78.070 1.00 34.58  ? 339  PHE A CE1 1 
ATOM   2627 C CE2 . PHE A 1 339 ? 14.911  64.631 76.937 1.00 34.58  ? 339  PHE A CE2 1 
ATOM   2628 C CZ  . PHE A 1 339 ? 14.979  63.284 77.272 1.00 34.58  ? 339  PHE A CZ  1 
ATOM   2629 N N   . SER A 1 340 ? 10.947  68.259 80.612 1.00 45.44  ? 340  SER A N   1 
ATOM   2630 C CA  . SER A 1 340 ? 9.957   69.279 80.965 1.00 45.44  ? 340  SER A CA  1 
ATOM   2631 C C   . SER A 1 340 ? 10.141  70.501 80.088 1.00 45.44  ? 340  SER A C   1 
ATOM   2632 O O   . SER A 1 340 ? 11.267  70.875 79.760 1.00 45.44  ? 340  SER A O   1 
ATOM   2633 C CB  . SER A 1 340 ? 10.102  69.711 82.432 1.00 72.98  ? 340  SER A CB  1 
ATOM   2634 O OG  . SER A 1 340 ? 9.601   68.733 83.332 1.00 72.98  ? 340  SER A OG  1 
ATOM   2635 N N   . LYS A 1 341 ? 9.034   71.134 79.722 1.00 40.03  ? 341  LYS A N   1 
ATOM   2636 C CA  . LYS A 1 341 ? 9.102   72.313 78.881 1.00 40.03  ? 341  LYS A CA  1 
ATOM   2637 C C   . LYS A 1 341 ? 9.765   73.458 79.618 1.00 40.03  ? 341  LYS A C   1 
ATOM   2638 O O   . LYS A 1 341 ? 10.311  74.368 79.003 1.00 40.03  ? 341  LYS A O   1 
ATOM   2639 C CB  . LYS A 1 341 ? 7.703   72.755 78.453 1.00 53.23  ? 341  LYS A CB  1 
ATOM   2640 C CG  . LYS A 1 341 ? 7.730   73.939 77.498 1.00 53.23  ? 341  LYS A CG  1 
ATOM   2641 C CD  . LYS A 1 341 ? 6.338   74.439 77.135 1.00 53.23  ? 341  LYS A CD  1 
ATOM   2642 C CE  . LYS A 1 341 ? 5.703   75.189 78.298 1.00 53.23  ? 341  LYS A CE  1 
ATOM   2643 N NZ  . LYS A 1 341 ? 6.494   76.384 78.714 1.00 53.23  ? 341  LYS A NZ  1 
ATOM   2644 N N   . ASP A 1 342 ? 9.735   73.409 80.943 1.00 41.01  ? 342  ASP A N   1 
ATOM   2645 C CA  . ASP A 1 342 ? 10.293  74.495 81.721 1.00 41.01  ? 342  ASP A CA  1 
ATOM   2646 C C   . ASP A 1 342 ? 11.617  74.249 82.435 1.00 41.01  ? 342  ASP A C   1 
ATOM   2647 O O   . ASP A 1 342 ? 12.054  75.095 83.204 1.00 41.01  ? 342  ASP A O   1 
ATOM   2648 C CB  . ASP A 1 342 ? 9.246   74.981 82.733 1.00 68.63  ? 342  ASP A CB  1 
ATOM   2649 C CG  . ASP A 1 342 ? 8.030   75.648 82.071 1.00 68.63  ? 342  ASP A CG  1 
ATOM   2650 O OD1 . ASP A 1 342 ? 7.995   75.778 80.824 1.00 68.63  ? 342  ASP A OD1 1 
ATOM   2651 O OD2 . ASP A 1 342 ? 7.099   76.054 82.808 1.00 68.63  ? 342  ASP A OD2 1 
ATOM   2652 N N   . SER A 1 343 ? 12.262  73.110 82.208 1.00 43.60  ? 343  SER A N   1 
ATOM   2653 C CA  . SER A 1 343 ? 13.550  72.860 82.858 1.00 43.60  ? 343  SER A CA  1 
ATOM   2654 C C   . SER A 1 343 ? 14.590  72.447 81.834 1.00 43.60  ? 343  SER A C   1 
ATOM   2655 O O   . SER A 1 343 ? 14.260  72.164 80.682 1.00 43.60  ? 343  SER A O   1 
ATOM   2656 C CB  . SER A 1 343 ? 13.430  71.769 83.919 1.00 54.18  ? 343  SER A CB  1 
ATOM   2657 O OG  . SER A 1 343 ? 13.092  70.518 83.347 1.00 54.18  ? 343  SER A OG  1 
ATOM   2658 N N   . GLU A 1 344 ? 15.850  72.423 82.247 1.00 41.64  ? 344  GLU A N   1 
ATOM   2659 C CA  . GLU A 1 344 ? 16.920  72.027 81.343 1.00 41.64  ? 344  GLU A CA  1 
ATOM   2660 C C   . GLU A 1 344 ? 16.796  70.547 81.033 1.00 41.64  ? 344  GLU A C   1 
ATOM   2661 O O   . GLU A 1 344 ? 17.529  70.012 80.197 1.00 41.64  ? 344  GLU A O   1 
ATOM   2662 C CB  . GLU A 1 344 ? 18.278  72.255 81.979 1.00 89.01  ? 344  GLU A CB  1 
ATOM   2663 C CG  . GLU A 1 344 ? 18.823  73.652 81.886 1.00 89.01  ? 344  GLU A CG  1 
ATOM   2664 C CD  . GLU A 1 344 ? 20.244  73.707 82.429 1.00 89.01  ? 344  GLU A CD  1 
ATOM   2665 O OE1 . GLU A 1 344 ? 20.440  73.387 83.636 1.00 89.01  ? 344  GLU A OE1 1 
ATOM   2666 O OE2 . GLU A 1 344 ? 21.159  74.054 81.640 1.00 89.01  ? 344  GLU A OE2 1 
ATOM   2667 N N   . SER A 1 345 ? 15.891  69.882 81.741 1.00 46.15  ? 345  SER A N   1 
ATOM   2668 C CA  . SER A 1 345 ? 15.654  68.464 81.544 1.00 46.15  ? 345  SER A CA  1 
ATOM   2669 C C   . SER A 1 345 ? 16.932  67.634 81.449 1.00 46.15  ? 345  SER A C   1 
ATOM   2670 O O   . SER A 1 345 ? 17.214  67.023 80.413 1.00 46.15  ? 345  SER A O   1 
ATOM   2671 C CB  . SER A 1 345 ? 14.815  68.248 80.280 1.00 49.37  ? 345  SER A CB  1 
ATOM   2672 O OG  . SER A 1 345 ? 13.546  68.873 80.388 1.00 49.37  ? 345  SER A OG  1 
ATOM   2673 N N   . LYS A 1 346 ? 17.717  67.618 82.516 1.00 39.92  ? 346  LYS A N   1 
ATOM   2674 C CA  . LYS A 1 346 ? 18.925  66.809 82.516 1.00 39.92  ? 346  LYS A CA  1 
ATOM   2675 C C   . LYS A 1 346 ? 18.437  65.411 82.906 1.00 39.92  ? 346  LYS A C   1 
ATOM   2676 O O   . LYS A 1 346 ? 17.659  65.255 83.846 1.00 39.92  ? 346  LYS A O   1 
ATOM   2677 C CB  . LYS A 1 346 ? 19.923  67.375 83.518 1.00 69.60  ? 346  LYS A CB  1 
ATOM   2678 C CG  . LYS A 1 346 ? 20.413  68.761 83.127 1.00 69.60  ? 346  LYS A CG  1 
ATOM   2679 C CD  . LYS A 1 346 ? 21.200  69.430 84.250 1.00 69.60  ? 346  LYS A CD  1 
ATOM   2680 C CE  . LYS A 1 346 ? 21.683  70.821 83.824 1.00 69.60  ? 346  LYS A CE  1 
ATOM   2681 N NZ  . LYS A 1 346 ? 22.357  71.553 84.938 1.00 69.60  ? 346  LYS A NZ  1 
ATOM   2682 N N   . ILE A 1 347 ? 18.868  64.396 82.169 1.00 53.08  ? 347  ILE A N   1 
ATOM   2683 C CA  . ILE A 1 347 ? 18.401  63.039 82.418 1.00 53.08  ? 347  ILE A CA  1 
ATOM   2684 C C   . ILE A 1 347 ? 19.408  62.146 83.143 1.00 53.08  ? 347  ILE A C   1 
ATOM   2685 O O   . ILE A 1 347 ? 20.606  62.125 82.828 1.00 53.08  ? 347  ILE A O   1 
ATOM   2686 C CB  . ILE A 1 347 ? 17.965  62.375 81.074 1.00 38.33  ? 347  ILE A CB  1 
ATOM   2687 C CG1 . ILE A 1 347 ? 16.986  63.289 80.348 1.00 38.33  ? 347  ILE A CG1 1 
ATOM   2688 C CG2 . ILE A 1 347 ? 17.268  61.061 81.327 1.00 38.33  ? 347  ILE A CG2 1 
ATOM   2689 C CD1 . ILE A 1 347 ? 15.755  63.597 81.157 1.00 38.33  ? 347  ILE A CD1 1 
ATOM   2690 N N   . SER A 1 348 ? 18.892  61.406 84.118 1.00 44.00  ? 348  SER A N   1 
ATOM   2691 C CA  . SER A 1 348 ? 19.679  60.491 84.925 1.00 44.00  ? 348  SER A CA  1 
ATOM   2692 C C   . SER A 1 348 ? 19.871  59.181 84.184 1.00 44.00  ? 348  SER A C   1 
ATOM   2693 O O   . SER A 1 348 ? 19.287  58.970 83.128 1.00 44.00  ? 348  SER A O   1 
ATOM   2694 C CB  . SER A 1 348 ? 18.932  60.200 86.211 1.00 44.45  ? 348  SER A CB  1 
ATOM   2695 O OG  . SER A 1 348 ? 17.693  59.572 85.912 1.00 44.45  ? 348  SER A OG  1 
ATOM   2696 N N   . ARG A 1 349 ? 20.673  58.288 84.750 1.00 62.12  ? 349  ARG A N   1 
ATOM   2697 C CA  . ARG A 1 349 ? 20.897  56.991 84.133 1.00 62.12  ? 349  ARG A CA  1 
ATOM   2698 C C   . ARG A 1 349 ? 19.588  56.210 84.067 1.00 62.12  ? 349  ARG A C   1 
ATOM   2699 O O   . ARG A 1 349 ? 19.297  55.585 83.042 1.00 62.12  ? 349  ARG A O   1 
ATOM   2700 C CB  . ARG A 1 349 ? 21.912  56.184 84.935 1.00 59.19  ? 349  ARG A CB  1 
ATOM   2701 C CG  . ARG A 1 349 ? 23.336  56.308 84.447 1.00 59.19  ? 349  ARG A CG  1 
ATOM   2702 C CD  . ARG A 1 349 ? 23.552  55.451 83.227 1.00 59.19  ? 349  ARG A CD  1 
ATOM   2703 N NE  . ARG A 1 349 ? 23.690  56.267 82.032 1.00 59.19  ? 349  ARG A NE  1 
ATOM   2704 C CZ  . ARG A 1 349 ? 23.869  55.774 80.811 1.00 59.19  ? 349  ARG A CZ  1 
ATOM   2705 N NH1 . ARG A 1 349 ? 23.932  54.457 80.629 1.00 59.19  ? 349  ARG A NH1 1 
ATOM   2706 N NH2 . ARG A 1 349 ? 23.973  56.594 79.769 1.00 59.19  ? 349  ARG A NH2 1 
ATOM   2707 N N   . GLU A 1 350 ? 18.797  56.242 85.143 1.00 55.91  ? 350  GLU A N   1 
ATOM   2708 C CA  . GLU A 1 350 ? 17.535  55.496 85.151 1.00 55.91  ? 350  GLU A CA  1 
ATOM   2709 C C   . GLU A 1 350 ? 16.610  55.973 84.052 1.00 55.91  ? 350  GLU A C   1 
ATOM   2710 O O   . GLU A 1 350 ? 16.119  55.167 83.259 1.00 55.91  ? 350  GLU A O   1 
ATOM   2711 C CB  . GLU A 1 350 ? 16.779  55.617 86.481 1.00 101.75 ? 350  GLU A CB  1 
ATOM   2712 C CG  . GLU A 1 350 ? 17.439  56.461 87.538 1.00 101.75 ? 350  GLU A CG  1 
ATOM   2713 C CD  . GLU A 1 350 ? 18.579  55.733 88.202 1.00 101.75 ? 350  GLU A CD  1 
ATOM   2714 O OE1 . GLU A 1 350 ? 19.570  55.396 87.500 1.00 101.75 ? 350  GLU A OE1 1 
ATOM   2715 O OE2 . GLU A 1 350 ? 18.474  55.494 89.426 1.00 101.75 ? 350  GLU A OE2 1 
ATOM   2716 N N   . ASP A 1 351 ? 16.365  57.280 84.003 1.00 55.95  ? 351  ASP A N   1 
ATOM   2717 C CA  . ASP A 1 351 ? 15.474  57.822 82.980 1.00 55.95  ? 351  ASP A CA  1 
ATOM   2718 C C   . ASP A 1 351 ? 16.028  57.684 81.556 1.00 55.95  ? 351  ASP A C   1 
ATOM   2719 O O   . ASP A 1 351 ? 15.264  57.598 80.594 1.00 55.95  ? 351  ASP A O   1 
ATOM   2720 C CB  . ASP A 1 351 ? 15.111  59.276 83.303 1.00 97.88  ? 351  ASP A CB  1 
ATOM   2721 C CG  . ASP A 1 351 ? 14.187  59.392 84.544 1.00 97.88  ? 351  ASP A CG  1 
ATOM   2722 O OD1 . ASP A 1 351 ? 13.436  58.411 84.836 1.00 97.88  ? 351  ASP A OD1 1 
ATOM   2723 O OD2 . ASP A 1 351 ? 14.197  60.462 85.218 1.00 97.88  ? 351  ASP A OD2 1 
ATOM   2724 N N   . PHE A 1 352 ? 17.348  57.637 81.422 1.00 43.57  ? 352  PHE A N   1 
ATOM   2725 C CA  . PHE A 1 352 ? 17.948  57.472 80.108 1.00 43.57  ? 352  PHE A CA  1 
ATOM   2726 C C   . PHE A 1 352 ? 17.503  56.128 79.558 1.00 43.57  ? 352  PHE A C   1 
ATOM   2727 O O   . PHE A 1 352 ? 16.988  56.024 78.440 1.00 43.57  ? 352  PHE A O   1 
ATOM   2728 C CB  . PHE A 1 352 ? 19.464  57.461 80.200 1.00 34.04  ? 352  PHE A CB  1 
ATOM   2729 C CG  . PHE A 1 352 ? 20.138  57.220 78.890 1.00 34.04  ? 352  PHE A CG  1 
ATOM   2730 C CD1 . PHE A 1 352 ? 20.206  58.220 77.940 1.00 34.04  ? 352  PHE A CD1 1 
ATOM   2731 C CD2 . PHE A 1 352 ? 20.685  55.979 78.598 1.00 34.04  ? 352  PHE A CD2 1 
ATOM   2732 C CE1 . PHE A 1 352 ? 20.809  57.992 76.714 1.00 34.04  ? 352  PHE A CE1 1 
ATOM   2733 C CE2 . PHE A 1 352 ? 21.295  55.736 77.370 1.00 34.04  ? 352  PHE A CE2 1 
ATOM   2734 C CZ  . PHE A 1 352 ? 21.356  56.747 76.426 1.00 34.04  ? 352  PHE A CZ  1 
ATOM   2735 N N   . MET A 1 353 ? 17.714  55.094 80.359 1.00 49.85  ? 353  MET A N   1 
ATOM   2736 C CA  . MET A 1 353 ? 17.353  53.749 79.963 1.00 49.85  ? 353  MET A CA  1 
ATOM   2737 C C   . MET A 1 353 ? 15.852  53.554 79.828 1.00 49.85  ? 353  MET A C   1 
ATOM   2738 O O   . MET A 1 353 ? 15.414  52.726 79.035 1.00 49.85  ? 353  MET A O   1 
ATOM   2739 C CB  . MET A 1 353 ? 17.952  52.749 80.938 1.00 77.53  ? 353  MET A CB  1 
ATOM   2740 C CG  . MET A 1 353 ? 19.469  52.743 80.905 1.00 77.53  ? 353  MET A CG  1 
ATOM   2741 S SD  . MET A 1 353 ? 20.103  51.474 82.018 1.00 77.53  ? 353  MET A SD  1 
ATOM   2742 C CE  . MET A 1 353 ? 19.789  52.255 83.710 1.00 77.53  ? 353  MET A CE  1 
ATOM   2743 N N   . SER A 1 354 ? 15.057  54.297 80.593 1.00 44.02  ? 354  SER A N   1 
ATOM   2744 C CA  . SER A 1 354 ? 13.607  54.184 80.439 1.00 44.02  ? 354  SER A CA  1 
ATOM   2745 C C   . SER A 1 354 ? 13.299  54.704 79.031 1.00 44.02  ? 354  SER A C   1 
ATOM   2746 O O   . SER A 1 354 ? 12.462  54.147 78.314 1.00 44.02  ? 354  SER A O   1 
ATOM   2747 C CB  . SER A 1 354 ? 12.869  55.057 81.450 1.00 59.51  ? 354  SER A CB  1 
ATOM   2748 O OG  . SER A 1 354 ? 13.105  54.620 82.768 1.00 59.51  ? 354  SER A OG  1 
ATOM   2749 N N   . GLY A 1 355 ? 13.998  55.778 78.655 1.00 34.62  ? 355  GLY A N   1 
ATOM   2750 C CA  . GLY A 1 355 ? 13.823  56.391 77.355 1.00 34.62  ? 355  GLY A CA  1 
ATOM   2751 C C   . GLY A 1 355 ? 14.201  55.472 76.218 1.00 34.62  ? 355  GLY A C   1 
ATOM   2752 O O   . GLY A 1 355 ? 13.500  55.390 75.207 1.00 34.62  ? 355  GLY A O   1 
ATOM   2753 N N   . VAL A 1 356 ? 15.314  54.769 76.371 1.00 48.49  ? 356  VAL A N   1 
ATOM   2754 C CA  . VAL A 1 356 ? 15.750  53.856 75.324 1.00 48.49  ? 356  VAL A CA  1 
ATOM   2755 C C   . VAL A 1 356 ? 14.725  52.737 75.129 1.00 48.49  ? 356  VAL A C   1 
ATOM   2756 O O   . VAL A 1 356 ? 14.531  52.242 74.020 1.00 48.49  ? 356  VAL A O   1 
ATOM   2757 C CB  . VAL A 1 356 ? 17.120  53.261 75.657 1.00 32.30  ? 356  VAL A CB  1 
ATOM   2758 C CG1 . VAL A 1 356 ? 17.488  52.212 74.637 1.00 32.30  ? 356  VAL A CG1 1 
ATOM   2759 C CG2 . VAL A 1 356 ? 18.161  54.367 75.682 1.00 32.30  ? 356  VAL A CG2 1 
ATOM   2760 N N   . LYS A 1 357 ? 14.060  52.355 76.211 1.00 49.20  ? 357  LYS A N   1 
ATOM   2761 C CA  . LYS A 1 357 ? 13.048  51.306 76.158 1.00 49.20  ? 357  LYS A CA  1 
ATOM   2762 C C   . LYS A 1 357 ? 11.833  51.827 75.403 1.00 49.20  ? 357  LYS A C   1 
ATOM   2763 O O   . LYS A 1 357 ? 11.219  51.098 74.635 1.00 49.20  ? 357  LYS A O   1 
ATOM   2764 C CB  . LYS A 1 357 ? 12.648  50.886 77.584 1.00 59.96  ? 357  LYS A CB  1 
ATOM   2765 C CG  . LYS A 1 357 ? 11.609  49.762 77.673 1.00 59.96  ? 357  LYS A CG  1 
ATOM   2766 C CD  . LYS A 1 357 ? 12.139  48.446 77.122 1.00 59.96  ? 357  LYS A CD  1 
ATOM   2767 C CE  . LYS A 1 357 ? 11.043  47.398 76.997 1.00 59.96  ? 357  LYS A CE  1 
ATOM   2768 N NZ  . LYS A 1 357 ? 11.538  46.187 76.259 1.00 59.96  ? 357  LYS A NZ  1 
ATOM   2769 N N   . LEU A 1 358 ? 11.495  53.092 75.625 1.00 33.08  ? 358  LEU A N   1 
ATOM   2770 C CA  . LEU A 1 358 ? 10.361  53.724 74.968 1.00 33.08  ? 358  LEU A CA  1 
ATOM   2771 C C   . LEU A 1 358 ? 10.613  54.046 73.487 1.00 33.08  ? 358  LEU A C   1 
ATOM   2772 O O   . LEU A 1 358 ? 9.675   54.082 72.695 1.00 33.08  ? 358  LEU A O   1 
ATOM   2773 C CB  . LEU A 1 358 ? 10.005  55.015 75.704 1.00 25.70  ? 358  LEU A CB  1 
ATOM   2774 C CG  . LEU A 1 358 ? 8.819   55.111 76.659 1.00 25.70  ? 358  LEU A CG  1 
ATOM   2775 C CD1 . LEU A 1 358 ? 8.718   53.924 77.569 1.00 25.70  ? 358  LEU A CD1 1 
ATOM   2776 C CD2 . LEU A 1 358 ? 8.995   56.362 77.468 1.00 25.70  ? 358  LEU A CD2 1 
ATOM   2777 N N   . SER A 1 359 ? 11.875  54.271 73.114 1.00 50.06  ? 359  SER A N   1 
ATOM   2778 C CA  . SER A 1 359 ? 12.239  54.627 71.734 1.00 50.06  ? 359  SER A CA  1 
ATOM   2779 C C   . SER A 1 359 ? 12.371  53.465 70.772 1.00 50.06  ? 359  SER A C   1 
ATOM   2780 O O   . SER A 1 359 ? 12.075  53.595 69.585 1.00 50.06  ? 359  SER A O   1 
ATOM   2781 C CB  . SER A 1 359 ? 13.549  55.406 71.715 1.00 41.88  ? 359  SER A CB  1 
ATOM   2782 O OG  . SER A 1 359 ? 13.495  56.506 72.606 1.00 41.88  ? 359  SER A OG  1 
ATOM   2783 N N   . VAL A 1 360 ? 12.850  52.338 71.266 1.00 47.91  ? 360  VAL A N   1 
ATOM   2784 C CA  . VAL A 1 360 ? 12.990  51.173 70.416 1.00 47.91  ? 360  VAL A CA  1 
ATOM   2785 C C   . VAL A 1 360 ? 12.140  50.109 71.069 1.00 47.91  ? 360  VAL A C   1 
ATOM   2786 O O   . VAL A 1 360 ? 12.652  49.137 71.615 1.00 47.91  ? 360  VAL A O   1 
ATOM   2787 C CB  . VAL A 1 360 ? 14.438  50.699 70.356 1.00 40.43  ? 360  VAL A CB  1 
ATOM   2788 C CG1 . VAL A 1 360 ? 14.559  49.549 69.370 1.00 40.43  ? 360  VAL A CG1 1 
ATOM   2789 C CG2 . VAL A 1 360 ? 15.342  51.860 69.970 1.00 40.43  ? 360  VAL A CG2 1 
ATOM   2790 N N   . PRO A 1 361 ? 10.816  50.280 71.005 1.00 49.99  ? 361  PRO A N   1 
ATOM   2791 C CA  . PRO A 1 361 ? 9.804   49.392 71.576 1.00 49.99  ? 361  PRO A CA  1 
ATOM   2792 C C   . PRO A 1 361 ? 9.806   47.936 71.115 1.00 49.99  ? 361  PRO A C   1 
ATOM   2793 O O   . PRO A 1 361 ? 9.336   47.045 71.835 1.00 49.99  ? 361  PRO A O   1 
ATOM   2794 C CB  . PRO A 1 361 ? 8.510   50.108 71.226 1.00 45.16  ? 361  PRO A CB  1 
ATOM   2795 C CG  . PRO A 1 361 ? 8.827   50.706 69.890 1.00 45.16  ? 361  PRO A CG  1 
ATOM   2796 C CD  . PRO A 1 361 ? 10.190  51.286 70.128 1.00 45.16  ? 361  PRO A CD  1 
ATOM   2797 N N   . HIS A 1 362 ? 10.335  47.685 69.926 1.00 68.88  ? 362  HIS A N   1 
ATOM   2798 C CA  . HIS A 1 362 ? 10.353  46.328 69.387 1.00 68.88  ? 362  HIS A CA  1 
ATOM   2799 C C   . HIS A 1 362 ? 11.654  45.570 69.636 1.00 68.88  ? 362  HIS A C   1 
ATOM   2800 O O   . HIS A 1 362 ? 11.884  44.518 69.032 1.00 68.88  ? 362  HIS A O   1 
ATOM   2801 C CB  . HIS A 1 362 ? 10.105  46.381 67.880 1.00 74.77  ? 362  HIS A CB  1 
ATOM   2802 C CG  . HIS A 1 362 ? 11.082  47.244 67.143 1.00 74.77  ? 362  HIS A CG  1 
ATOM   2803 N ND1 . HIS A 1 362 ? 11.143  48.613 67.316 1.00 74.77  ? 362  HIS A ND1 1 
ATOM   2804 C CD2 . HIS A 1 362 ? 12.040  46.935 66.233 1.00 74.77  ? 362  HIS A CD2 1 
ATOM   2805 C CE1 . HIS A 1 362 ? 12.093  49.111 66.541 1.00 74.77  ? 362  HIS A CE1 1 
ATOM   2806 N NE2 . HIS A 1 362 ? 12.653  48.114 65.873 1.00 74.77  ? 362  HIS A NE2 1 
ATOM   2807 N N   . ALA A 1 363 ? 12.501  46.082 70.523 1.00 48.35  ? 363  ALA A N   1 
ATOM   2808 C CA  . ALA A 1 363 ? 13.786  45.434 70.759 1.00 48.35  ? 363  ALA A CA  1 
ATOM   2809 C C   . ALA A 1 363 ? 13.869  44.605 72.029 1.00 48.35  ? 363  ALA A C   1 
ATOM   2810 O O   . ALA A 1 363 ? 13.345  45.001 73.076 1.00 48.35  ? 363  ALA A O   1 
ATOM   2811 C CB  . ALA A 1 363 ? 14.895  46.489 70.754 1.00 44.77  ? 363  ALA A CB  1 
ATOM   2812 N N   . ASN A 1 364 ? 14.535  43.452 71.926 1.00 44.72  ? 364  ASN A N   1 
ATOM   2813 C CA  . ASN A 1 364 ? 14.720  42.578 73.080 1.00 44.72  ? 364  ASN A CA  1 
ATOM   2814 C C   . ASN A 1 364 ? 15.771  43.193 73.995 1.00 44.72  ? 364  ASN A C   1 
ATOM   2815 O O   . ASN A 1 364 ? 16.376  44.215 73.658 1.00 44.72  ? 364  ASN A O   1 
ATOM   2816 C CB  . ASN A 1 364 ? 15.165  41.173 72.659 1.00 50.98  ? 364  ASN A CB  1 
ATOM   2817 C CG  . ASN A 1 364 ? 16.326  41.185 71.684 1.00 50.98  ? 364  ASN A CG  1 
ATOM   2818 O OD1 . ASN A 1 364 ? 17.125  42.119 71.656 1.00 50.98  ? 364  ASN A OD1 1 
ATOM   2819 N ND2 . ASN A 1 364 ? 16.434  40.126 70.886 1.00 50.98  ? 364  ASN A ND2 1 
ATOM   2820 N N   . ASP A 1 365 ? 15.996  42.576 75.149 1.00 53.25  ? 365  ASP A N   1 
ATOM   2821 C CA  . ASP A 1 365 ? 16.966  43.114 76.088 1.00 53.25  ? 365  ASP A CA  1 
ATOM   2822 C C   . ASP A 1 365 ? 18.370  43.245 75.498 1.00 53.25  ? 365  ASP A C   1 
ATOM   2823 O O   . ASP A 1 365 ? 19.137  44.143 75.869 1.00 53.25  ? 365  ASP A O   1 
ATOM   2824 C CB  . ASP A 1 365 ? 16.968  42.276 77.369 1.00 101.75 ? 365  ASP A CB  1 
ATOM   2825 C CG  . ASP A 1 365 ? 15.890  42.744 78.376 1.00 101.75 ? 365  ASP A CG  1 
ATOM   2826 O OD1 . ASP A 1 365 ? 15.110  43.664 78.013 1.00 101.75 ? 365  ASP A OD1 1 
ATOM   2827 O OD2 . ASP A 1 365 ? 15.821  42.207 79.524 1.00 101.75 ? 365  ASP A OD2 1 
ATOM   2828 N N   . LEU A 1 366 ? 18.700  42.372 74.558 1.00 45.75  ? 366  LEU A N   1 
ATOM   2829 C CA  . LEU A 1 366 ? 20.003  42.430 73.934 1.00 45.75  ? 366  LEU A CA  1 
ATOM   2830 C C   . LEU A 1 366 ? 20.091  43.697 73.084 1.00 45.75  ? 366  LEU A C   1 
ATOM   2831 O O   . LEU A 1 366 ? 21.102  44.403 73.109 1.00 45.75  ? 366  LEU A O   1 
ATOM   2832 C CB  . LEU A 1 366 ? 20.210  41.188 73.078 1.00 50.37  ? 366  LEU A CB  1 
ATOM   2833 C CG  . LEU A 1 366 ? 21.500  41.095 72.274 1.00 50.37  ? 366  LEU A CG  1 
ATOM   2834 C CD1 . LEU A 1 366 ? 22.707  41.306 73.179 1.00 50.37  ? 366  LEU A CD1 1 
ATOM   2835 C CD2 . LEU A 1 366 ? 21.545  39.737 71.592 1.00 50.37  ? 366  LEU A CD2 1 
ATOM   2836 N N   . GLY A 1 367 ? 19.024  43.987 72.338 1.00 37.34  ? 367  GLY A N   1 
ATOM   2837 C CA  . GLY A 1 367 ? 18.996  45.170 71.488 1.00 37.34  ? 367  GLY A CA  1 
ATOM   2838 C C   . GLY A 1 367 ? 19.045  46.457 72.287 1.00 37.34  ? 367  GLY A C   1 
ATOM   2839 O O   . GLY A 1 367 ? 19.776  47.382 71.952 1.00 37.34  ? 367  GLY A O   1 
ATOM   2840 N N   . LEU A 1 368 ? 18.256  46.513 73.351 1.00 38.04  ? 368  LEU A N   1 
ATOM   2841 C CA  . LEU A 1 368 ? 18.231  47.682 74.207 1.00 38.04  ? 368  LEU A CA  1 
ATOM   2842 C C   . LEU A 1 368 ? 19.631  47.960 74.704 1.00 38.04  ? 368  LEU A C   1 
ATOM   2843 O O   . LEU A 1 368 ? 19.994  49.106 74.935 1.00 38.04  ? 368  LEU A O   1 
ATOM   2844 C CB  . LEU A 1 368 ? 17.303  47.449 75.391 1.00 37.77  ? 368  LEU A CB  1 
ATOM   2845 C CG  . LEU A 1 368 ? 15.838  47.340 74.985 1.00 37.77  ? 368  LEU A CG  1 
ATOM   2846 C CD1 . LEU A 1 368 ? 15.025  46.827 76.148 1.00 37.77  ? 368  LEU A CD1 1 
ATOM   2847 C CD2 . LEU A 1 368 ? 15.346  48.696 74.518 1.00 37.77  ? 368  LEU A CD2 1 
ATOM   2848 N N   . ASP A 1 369 ? 20.422  46.908 74.878 1.00 46.78  ? 369  ASP A N   1 
ATOM   2849 C CA  . ASP A 1 369 ? 21.796  47.084 75.333 1.00 46.78  ? 369  ASP A CA  1 
ATOM   2850 C C   . ASP A 1 369 ? 22.675  47.595 74.198 1.00 46.78  ? 369  ASP A C   1 
ATOM   2851 O O   . ASP A 1 369 ? 23.536  48.444 74.419 1.00 46.78  ? 369  ASP A O   1 
ATOM   2852 C CB  . ASP A 1 369 ? 22.365  45.776 75.896 1.00 97.42  ? 369  ASP A CB  1 
ATOM   2853 C CG  . ASP A 1 369 ? 21.746  45.397 77.253 1.00 97.42  ? 369  ASP A CG  1 
ATOM   2854 O OD1 . ASP A 1 369 ? 21.116  46.283 77.901 1.00 97.42  ? 369  ASP A OD1 1 
ATOM   2855 O OD2 . ASP A 1 369 ? 21.901  44.219 77.683 1.00 97.42  ? 369  ASP A OD2 1 
ATOM   2856 N N   . ALA A 1 370 ? 22.467  47.090 72.986 1.00 40.75  ? 370  ALA A N   1 
ATOM   2857 C CA  . ALA A 1 370 ? 23.255  47.562 71.862 1.00 40.75  ? 370  ALA A CA  1 
ATOM   2858 C C   . ALA A 1 370 ? 23.031  49.068 71.699 1.00 40.75  ? 370  ALA A C   1 
ATOM   2859 O O   . ALA A 1 370 ? 23.989  49.826 71.571 1.00 40.75  ? 370  ALA A O   1 
ATOM   2860 C CB  . ALA A 1 370 ? 22.861  46.838 70.599 1.00 38.12  ? 370  ALA A CB  1 
ATOM   2861 N N   . VAL A 1 371 ? 21.776  49.508 71.725 1.00 34.43  ? 371  VAL A N   1 
ATOM   2862 C CA  . VAL A 1 371 ? 21.473  50.933 71.582 1.00 34.43  ? 371  VAL A CA  1 
ATOM   2863 C C   . VAL A 1 371 ? 22.142  51.787 72.666 1.00 34.43  ? 371  VAL A C   1 
ATOM   2864 O O   . VAL A 1 371 ? 22.730  52.833 72.372 1.00 34.43  ? 371  VAL A O   1 
ATOM   2865 C CB  . VAL A 1 371 ? 19.949  51.193 71.618 1.00 32.26  ? 371  VAL A CB  1 
ATOM   2866 C CG1 . VAL A 1 371 ? 19.677  52.682 71.631 1.00 32.26  ? 371  VAL A CG1 1 
ATOM   2867 C CG2 . VAL A 1 371 ? 19.279  50.556 70.412 1.00 32.26  ? 371  VAL A CG2 1 
ATOM   2868 N N   . THR A 1 372 ? 22.049  51.336 73.914 1.00 33.61  ? 372  THR A N   1 
ATOM   2869 C CA  . THR A 1 372 ? 22.637  52.047 75.049 1.00 33.61  ? 372  THR A CA  1 
ATOM   2870 C C   . THR A 1 372 ? 24.156  52.149 74.958 1.00 33.61  ? 372  THR A C   1 
ATOM   2871 O O   . THR A 1 372 ? 24.738  53.196 75.235 1.00 33.61  ? 372  THR A O   1 
ATOM   2872 C CB  . THR A 1 372 ? 22.271  51.361 76.376 1.00 46.39  ? 372  THR A CB  1 
ATOM   2873 O OG1 . THR A 1 372 ? 20.864  51.508 76.623 1.00 46.39  ? 372  THR A OG1 1 
ATOM   2874 C CG2 . THR A 1 372 ? 23.058  51.976 77.522 1.00 46.39  ? 372  THR A CG2 1 
ATOM   2875 N N   . LEU A 1 373 ? 24.795  51.050 74.580 1.00 51.05  ? 373  LEU A N   1 
ATOM   2876 C CA  . LEU A 1 373 ? 26.243  51.027 74.432 1.00 51.05  ? 373  LEU A CA  1 
ATOM   2877 C C   . LEU A 1 373 ? 26.664  51.987 73.324 1.00 51.05  ? 373  LEU A C   1 
ATOM   2878 O O   . LEU A 1 373 ? 27.667  52.686 73.447 1.00 51.05  ? 373  LEU A O   1 
ATOM   2879 C CB  . LEU A 1 373 ? 26.724  49.617 74.087 1.00 48.24  ? 373  LEU A CB  1 
ATOM   2880 C CG  . LEU A 1 373 ? 28.197  49.515 73.674 1.00 48.24  ? 373  LEU A CG  1 
ATOM   2881 C CD1 . LEU A 1 373 ? 29.089  49.982 74.817 1.00 48.24  ? 373  LEU A CD1 1 
ATOM   2882 C CD2 . LEU A 1 373 ? 28.529  48.091 73.302 1.00 48.24  ? 373  LEU A CD2 1 
ATOM   2883 N N   . GLN A 1 374 ? 25.887  52.017 72.247 1.00 42.63  ? 374  GLN A N   1 
ATOM   2884 C CA  . GLN A 1 374 ? 26.162  52.876 71.097 1.00 42.63  ? 374  GLN A CA  1 
ATOM   2885 C C   . GLN A 1 374 ? 25.991  54.363 71.370 1.00 42.63  ? 374  GLN A C   1 
ATOM   2886 O O   . GLN A 1 374 ? 26.592  55.193 70.694 1.00 42.63  ? 374  GLN A O   1 
ATOM   2887 C CB  . GLN A 1 374 ? 25.237  52.504 69.940 1.00 45.46  ? 374  GLN A CB  1 
ATOM   2888 C CG  . GLN A 1 374 ? 25.627  53.128 68.636 1.00 45.46  ? 374  GLN A CG  1 
ATOM   2889 C CD  . GLN A 1 374 ? 26.896  52.507 68.077 1.00 45.46  ? 374  GLN A CD  1 
ATOM   2890 O OE1 . GLN A 1 374 ? 27.344  52.861 66.982 1.00 45.46  ? 374  GLN A OE1 1 
ATOM   2891 N NE2 . GLN A 1 374 ? 27.481  51.567 68.825 1.00 45.46  ? 374  GLN A NE2 1 
ATOM   2892 N N   . TYR A 1 375 ? 25.160  54.694 72.353 1.00 44.01  ? 375  TYR A N   1 
ATOM   2893 C CA  . TYR A 1 375 ? 24.873  56.089 72.682 1.00 44.01  ? 375  TYR A CA  1 
ATOM   2894 C C   . TYR A 1 375 ? 25.308  56.564 74.068 1.00 44.01  ? 375  TYR A C   1 
ATOM   2895 O O   . TYR A 1 375 ? 24.788  57.551 74.578 1.00 44.01  ? 375  TYR A O   1 
ATOM   2896 C CB  . TYR A 1 375 ? 23.373  56.338 72.499 1.00 28.32  ? 375  TYR A CB  1 
ATOM   2897 C CG  . TYR A 1 375 ? 22.972  56.524 71.056 1.00 28.32  ? 375  TYR A CG  1 
ATOM   2898 C CD1 . TYR A 1 375 ? 23.088  57.770 70.438 1.00 28.32  ? 375  TYR A CD1 1 
ATOM   2899 C CD2 . TYR A 1 375 ? 22.510  55.450 70.292 1.00 28.32  ? 375  TYR A CD2 1 
ATOM   2900 C CE1 . TYR A 1 375 ? 22.756  57.945 69.105 1.00 28.32  ? 375  TYR A CE1 1 
ATOM   2901 C CE2 . TYR A 1 375 ? 22.177  55.618 68.957 1.00 28.32  ? 375  TYR A CE2 1 
ATOM   2902 C CZ  . TYR A 1 375 ? 22.304  56.868 68.376 1.00 28.32  ? 375  TYR A CZ  1 
ATOM   2903 O OH  . TYR A 1 375 ? 21.974  57.047 67.064 1.00 28.32  ? 375  TYR A OH  1 
ATOM   2904 N N   . THR A 1 376 ? 26.274  55.880 74.666 1.00 42.22  ? 376  THR A N   1 
ATOM   2905 C CA  . THR A 1 376 ? 26.746  56.250 75.991 1.00 42.22  ? 376  THR A CA  1 
ATOM   2906 C C   . THR A 1 376 ? 28.251  56.494 76.067 1.00 42.22  ? 376  THR A C   1 
ATOM   2907 O O   . THR A 1 376 ? 29.053  55.639 75.695 1.00 42.22  ? 376  THR A O   1 
ATOM   2908 C CB  . THR A 1 376 ? 26.405  55.165 76.998 1.00 36.87  ? 376  THR A CB  1 
ATOM   2909 O OG1 . THR A 1 376 ? 24.996  54.933 76.985 1.00 36.87  ? 376  THR A OG1 1 
ATOM   2910 C CG2 . THR A 1 376 ? 26.820  55.581 78.374 1.00 36.87  ? 376  THR A CG2 1 
ATOM   2911 N N   . ASP A 1 377 ? 28.630  57.667 76.557 1.00 47.30  ? 377  ASP A N   1 
ATOM   2912 C CA  . ASP A 1 377 ? 30.037  58.018 76.718 1.00 47.30  ? 377  ASP A CA  1 
ATOM   2913 C C   . ASP A 1 377 ? 30.438  57.574 78.120 1.00 47.30  ? 377  ASP A C   1 
ATOM   2914 O O   . ASP A 1 377 ? 30.308  58.335 79.077 1.00 47.30  ? 377  ASP A O   1 
ATOM   2915 C CB  . ASP A 1 377 ? 30.215  59.530 76.563 1.00 71.86  ? 377  ASP A CB  1 
ATOM   2916 C CG  . ASP A 1 377 ? 31.567  60.012 77.046 1.00 71.86  ? 377  ASP A CG  1 
ATOM   2917 O OD1 . ASP A 1 377 ? 32.538  59.214 77.051 1.00 71.86  ? 377  ASP A OD1 1 
ATOM   2918 O OD2 . ASP A 1 377 ? 31.656  61.206 77.412 1.00 71.86  ? 377  ASP A OD2 1 
ATOM   2919 N N   . TRP A 1 378 ? 30.923  56.339 78.228 1.00 48.09  ? 378  TRP A N   1 
ATOM   2920 C CA  . TRP A 1 378 ? 31.299  55.764 79.514 1.00 48.09  ? 378  TRP A CA  1 
ATOM   2921 C C   . TRP A 1 378 ? 32.370  56.485 80.313 1.00 48.09  ? 378  TRP A C   1 
ATOM   2922 O O   . TRP A 1 378 ? 32.675  56.089 81.437 1.00 48.09  ? 378  TRP A O   1 
ATOM   2923 C CB  . TRP A 1 378 ? 31.676  54.294 79.341 1.00 52.67  ? 378  TRP A CB  1 
ATOM   2924 C CG  . TRP A 1 378 ? 30.510  53.480 78.861 1.00 52.67  ? 378  TRP A CG  1 
ATOM   2925 C CD1 . TRP A 1 378 ? 30.285  53.032 77.585 1.00 52.67  ? 378  TRP A CD1 1 
ATOM   2926 C CD2 . TRP A 1 378 ? 29.353  53.106 79.625 1.00 52.67  ? 378  TRP A CD2 1 
ATOM   2927 N NE1 . TRP A 1 378 ? 29.059  52.411 77.510 1.00 52.67  ? 378  TRP A NE1 1 
ATOM   2928 C CE2 . TRP A 1 378 ? 28.466  52.443 78.745 1.00 52.67  ? 378  TRP A CE2 1 
ATOM   2929 C CE3 . TRP A 1 378 ? 28.979  53.273 80.967 1.00 52.67  ? 378  TRP A CE3 1 
ATOM   2930 C CZ2 . TRP A 1 378 ? 27.229  51.948 79.162 1.00 52.67  ? 378  TRP A CZ2 1 
ATOM   2931 C CZ3 . TRP A 1 378 ? 27.751  52.783 81.383 1.00 52.67  ? 378  TRP A CZ3 1 
ATOM   2932 C CH2 . TRP A 1 378 ? 26.889  52.128 80.482 1.00 52.67  ? 378  TRP A CH2 1 
ATOM   2933 N N   . MET A 1 379 ? 32.957  57.535 79.754 1.00 59.20  ? 379  MET A N   1 
ATOM   2934 C CA  . MET A 1 379 ? 33.944  58.275 80.522 1.00 59.20  ? 379  MET A CA  1 
ATOM   2935 C C   . MET A 1 379 ? 33.193  59.304 81.345 1.00 59.20  ? 379  MET A C   1 
ATOM   2936 O O   . MET A 1 379 ? 33.747  59.864 82.291 1.00 59.20  ? 379  MET A O   1 
ATOM   2937 C CB  . MET A 1 379 ? 34.921  59.016 79.619 1.00 72.87  ? 379  MET A CB  1 
ATOM   2938 C CG  . MET A 1 379 ? 35.985  58.154 78.974 1.00 72.87  ? 379  MET A CG  1 
ATOM   2939 S SD  . MET A 1 379 ? 37.236  59.206 78.156 1.00 72.87  ? 379  MET A SD  1 
ATOM   2940 C CE  . MET A 1 379 ? 36.363  59.705 76.596 1.00 72.87  ? 379  MET A CE  1 
ATOM   2941 N N   . ASP A 1 380 ? 31.926  59.536 80.988 1.00 57.52  ? 380  ASP A N   1 
ATOM   2942 C CA  . ASP A 1 380 ? 31.080  60.542 81.648 1.00 57.52  ? 380  ASP A CA  1 
ATOM   2943 C C   . ASP A 1 380 ? 29.588  60.096 81.669 1.00 57.52  ? 380  ASP A C   1 
ATOM   2944 O O   . ASP A 1 380 ? 28.667  60.882 81.380 1.00 57.52  ? 380  ASP A O   1 
ATOM   2945 C CB  . ASP A 1 380 ? 31.276  61.868 80.878 1.00 70.32  ? 380  ASP A CB  1 
ATOM   2946 C CG  . ASP A 1 380 ? 30.722  63.087 81.608 1.00 70.32  ? 380  ASP A CG  1 
ATOM   2947 O OD1 . ASP A 1 380 ? 30.747  63.119 82.868 1.00 70.32  ? 380  ASP A OD1 1 
ATOM   2948 O OD2 . ASP A 1 380 ? 30.286  64.030 80.899 1.00 70.32  ? 380  ASP A OD2 1 
ATOM   2949 N N   . ASP A 1 381 ? 29.370  58.832 82.039 1.00 58.51  ? 381  ASP A N   1 
ATOM   2950 C CA  . ASP A 1 381 ? 28.034  58.227 82.076 1.00 58.51  ? 381  ASP A CA  1 
ATOM   2951 C C   . ASP A 1 381 ? 26.925  58.935 82.878 1.00 58.51  ? 381  ASP A C   1 
ATOM   2952 O O   . ASP A 1 381 ? 25.736  58.801 82.552 1.00 58.51  ? 381  ASP A O   1 
ATOM   2953 C CB  . ASP A 1 381 ? 28.147  56.760 82.526 1.00 71.94  ? 381  ASP A CB  1 
ATOM   2954 C CG  . ASP A 1 381 ? 28.727  56.606 83.934 1.00 71.94  ? 381  ASP A CG  1 
ATOM   2955 O OD1 . ASP A 1 381 ? 29.832  57.148 84.224 1.00 71.94  ? 381  ASP A OD1 1 
ATOM   2956 O OD2 . ASP A 1 381 ? 28.069  55.921 84.754 1.00 71.94  ? 381  ASP A OD2 1 
ATOM   2957 N N   . ASN A 1 382 ? 27.284  59.686 83.914 1.00 78.38  ? 382  ASN A N   1 
ATOM   2958 C CA  . ASN A 1 382 ? 26.253  60.383 84.694 1.00 78.38  ? 382  ASN A CA  1 
ATOM   2959 C C   . ASN A 1 382 ? 26.080  61.867 84.398 1.00 78.38  ? 382  ASN A C   1 
ATOM   2960 O O   . ASN A 1 382 ? 25.525  62.612 85.206 1.00 78.38  ? 382  ASN A O   1 
ATOM   2961 C CB  . ASN A 1 382 ? 26.485  60.179 86.185 1.00 66.55  ? 382  ASN A CB  1 
ATOM   2962 C CG  . ASN A 1 382 ? 26.033  58.823 86.633 1.00 66.55  ? 382  ASN A CG  1 
ATOM   2963 O OD1 . ASN A 1 382 ? 24.888  58.433 86.379 1.00 66.55  ? 382  ASN A OD1 1 
ATOM   2964 N ND2 . ASN A 1 382 ? 26.923  58.080 87.286 1.00 66.55  ? 382  ASN A ND2 1 
ATOM   2965 N N   . ASN A 1 383 ? 26.555  62.286 83.232 1.00 47.46  ? 383  ASN A N   1 
ATOM   2966 C CA  . ASN A 1 383 ? 26.434  63.665 82.808 1.00 47.46  ? 383  ASN A CA  1 
ATOM   2967 C C   . ASN A 1 383 ? 24.999  63.831 82.304 1.00 47.46  ? 383  ASN A C   1 
ATOM   2968 O O   . ASN A 1 383 ? 24.626  63.301 81.255 1.00 47.46  ? 383  ASN A O   1 
ATOM   2969 C CB  . ASN A 1 383 ? 27.450  63.934 81.702 1.00 51.29  ? 383  ASN A CB  1 
ATOM   2970 C CG  . ASN A 1 383 ? 27.364  65.332 81.151 1.00 51.29  ? 383  ASN A CG  1 
ATOM   2971 O OD1 . ASN A 1 383 ? 28.305  65.815 80.526 1.00 51.29  ? 383  ASN A OD1 1 
ATOM   2972 N ND2 . ASN A 1 383 ? 26.229  65.987 81.358 1.00 51.29  ? 383  ASN A ND2 1 
ATOM   2973 N N   . GLY A 1 384 ? 24.198  64.558 83.076 1.00 46.14  ? 384  GLY A N   1 
ATOM   2974 C CA  . GLY A 1 384 ? 22.810  64.778 82.721 1.00 46.14  ? 384  GLY A CA  1 
ATOM   2975 C C   . GLY A 1 384 ? 22.579  65.402 81.361 1.00 46.14  ? 384  GLY A C   1 
ATOM   2976 O O   . GLY A 1 384 ? 21.589  65.084 80.709 1.00 46.14  ? 384  GLY A O   1 
ATOM   2977 N N   . ILE A 1 385 ? 23.469  66.289 80.924 1.00 35.30  ? 385  ILE A N   1 
ATOM   2978 C CA  . ILE A 1 385 ? 23.293  66.916 79.628 1.00 35.30  ? 385  ILE A CA  1 
ATOM   2979 C C   . ILE A 1 385 ? 23.650  65.959 78.510 1.00 35.30  ? 385  ILE A C   1 
ATOM   2980 O O   . ILE A 1 385 ? 23.115  66.058 77.410 1.00 35.30  ? 385  ILE A O   1 
ATOM   2981 C CB  . ILE A 1 385 ? 24.127  68.204 79.499 1.00 41.11  ? 385  ILE A CB  1 
ATOM   2982 C CG1 . ILE A 1 385 ? 23.454  69.319 80.291 1.00 41.11  ? 385  ILE A CG1 1 
ATOM   2983 C CG2 . ILE A 1 385 ? 24.235  68.636 78.053 1.00 41.11  ? 385  ILE A CG2 1 
ATOM   2984 C CD1 . ILE A 1 385 ? 24.089  70.662 80.070 1.00 41.11  ? 385  ILE A CD1 1 
ATOM   2985 N N   . LYS A 1 386 ? 24.549  65.021 78.776 1.00 44.93  ? 386  LYS A N   1 
ATOM   2986 C CA  . LYS A 1 386 ? 24.917  64.061 77.744 1.00 44.93  ? 386  LYS A CA  1 
ATOM   2987 C C   . LYS A 1 386 ? 23.857  62.974 77.576 1.00 44.93  ? 386  LYS A C   1 
ATOM   2988 O O   . LYS A 1 386 ? 23.586  62.533 76.460 1.00 44.93  ? 386  LYS A O   1 
ATOM   2989 C CB  . LYS A 1 386 ? 26.285  63.459 78.048 1.00 42.45  ? 386  LYS A CB  1 
ATOM   2990 C CG  . LYS A 1 386 ? 27.407  64.377 77.635 1.00 42.45  ? 386  LYS A CG  1 
ATOM   2991 C CD  . LYS A 1 386 ? 28.757  63.746 77.857 1.00 42.45  ? 386  LYS A CD  1 
ATOM   2992 C CE  . LYS A 1 386 ? 29.855  64.569 77.198 1.00 42.45  ? 386  LYS A CE  1 
ATOM   2993 N NZ  . LYS A 1 386 ? 31.206  64.037 77.536 1.00 42.45  ? 386  LYS A NZ  1 
ATOM   2994 N N   . ASN A 1 387 ? 23.251  62.546 78.677 1.00 36.54  ? 387  ASN A N   1 
ATOM   2995 C CA  . ASN A 1 387 ? 22.206  61.546 78.590 1.00 36.54  ? 387  ASN A CA  1 
ATOM   2996 C C   . ASN A 1 387 ? 20.967  62.153 77.910 1.00 36.54  ? 387  ASN A C   1 
ATOM   2997 O O   . ASN A 1 387 ? 20.229  61.461 77.209 1.00 36.54  ? 387  ASN A O   1 
ATOM   2998 C CB  . ASN A 1 387 ? 21.844  61.022 79.980 1.00 47.48  ? 387  ASN A CB  1 
ATOM   2999 C CG  . ASN A 1 387 ? 22.981  60.248 80.626 1.00 47.48  ? 387  ASN A CG  1 
ATOM   3000 O OD1 . ASN A 1 387 ? 23.655  59.454 79.971 1.00 47.48  ? 387  ASN A OD1 1 
ATOM   3001 N ND2 . ASN A 1 387 ? 23.187  60.463 81.923 1.00 47.48  ? 387  ASN A ND2 1 
ATOM   3002 N N   . ARG A 1 388 ? 20.740  63.448 78.108 1.00 42.81  ? 388  ARG A N   1 
ATOM   3003 C CA  . ARG A 1 388 ? 19.598  64.104 77.481 1.00 42.81  ? 388  ARG A CA  1 
ATOM   3004 C C   . ARG A 1 388 ? 19.799  64.192 75.971 1.00 42.81  ? 388  ARG A C   1 
ATOM   3005 O O   . ARG A 1 388 ? 18.954  63.750 75.197 1.00 42.81  ? 388  ARG A O   1 
ATOM   3006 C CB  . ARG A 1 388 ? 19.398  65.510 78.044 1.00 38.52  ? 388  ARG A CB  1 
ATOM   3007 C CG  . ARG A 1 388 ? 18.251  66.266 77.405 1.00 38.52  ? 388  ARG A CG  1 
ATOM   3008 C CD  . ARG A 1 388 ? 18.732  67.555 76.756 1.00 38.52  ? 388  ARG A CD  1 
ATOM   3009 N NE  . ARG A 1 388 ? 18.902  68.618 77.735 1.00 38.52  ? 388  ARG A NE  1 
ATOM   3010 C CZ  . ARG A 1 388 ? 19.847  69.547 77.673 1.00 38.52  ? 388  ARG A CZ  1 
ATOM   3011 N NH1 . ARG A 1 388 ? 20.720  69.550 76.676 1.00 38.52  ? 388  ARG A NH1 1 
ATOM   3012 N NH2 . ARG A 1 388 ? 19.916  70.473 78.617 1.00 38.52  ? 388  ARG A NH2 1 
ATOM   3013 N N   . ASP A 1 389 ? 20.923  64.760 75.548 1.00 41.27  ? 389  ASP A N   1 
ATOM   3014 C CA  . ASP A 1 389 ? 21.199  64.885 74.126 1.00 41.27  ? 389  ASP A CA  1 
ATOM   3015 C C   . ASP A 1 389 ? 21.420  63.532 73.459 1.00 41.27  ? 389  ASP A C   1 
ATOM   3016 O O   . ASP A 1 389 ? 21.255  63.404 72.245 1.00 41.27  ? 389  ASP A O   1 
ATOM   3017 C CB  . ASP A 1 389 ? 22.411  65.784 73.893 1.00 50.72  ? 389  ASP A CB  1 
ATOM   3018 C CG  . ASP A 1 389 ? 22.188  67.214 74.377 1.00 50.72  ? 389  ASP A CG  1 
ATOM   3019 O OD1 . ASP A 1 389 ? 21.016  67.669 74.447 1.00 50.72  ? 389  ASP A OD1 1 
ATOM   3020 O OD2 . ASP A 1 389 ? 23.198  67.889 74.673 1.00 50.72  ? 389  ASP A OD2 1 
ATOM   3021 N N   . GLY A 1 390 ? 21.795  62.526 74.243 1.00 38.76  ? 390  GLY A N   1 
ATOM   3022 C CA  . GLY A 1 390 ? 22.000  61.202 73.682 1.00 38.76  ? 390  GLY A CA  1 
ATOM   3023 C C   . GLY A 1 390 ? 20.657  60.569 73.365 1.00 38.76  ? 390  GLY A C   1 
ATOM   3024 O O   . GLY A 1 390 ? 20.476  59.906 72.347 1.00 38.76  ? 390  GLY A O   1 
ATOM   3025 N N   . LEU A 1 391 ? 19.704  60.786 74.261 1.00 42.44  ? 391  LEU A N   1 
ATOM   3026 C CA  . LEU A 1 391 ? 18.362  60.261 74.108 1.00 42.44  ? 391  LEU A CA  1 
ATOM   3027 C C   . LEU A 1 391 ? 17.727  60.980 72.920 1.00 42.44  ? 391  LEU A C   1 
ATOM   3028 O O   . LEU A 1 391 ? 17.058  60.380 72.083 1.00 42.44  ? 391  LEU A O   1 
ATOM   3029 C CB  . LEU A 1 391 ? 17.581  60.532 75.393 1.00 37.62  ? 391  LEU A CB  1 
ATOM   3030 C CG  . LEU A 1 391 ? 16.486  59.554 75.817 1.00 37.62  ? 391  LEU A CG  1 
ATOM   3031 C CD1 . LEU A 1 391 ? 16.917  58.126 75.511 1.00 37.62  ? 391  LEU A CD1 1 
ATOM   3032 C CD2 . LEU A 1 391 ? 16.202  59.720 77.311 1.00 37.62  ? 391  LEU A CD2 1 
ATOM   3033 N N   . ASP A 1 392 ? 17.969  62.278 72.847 1.00 39.32  ? 392  ASP A N   1 
ATOM   3034 C CA  . ASP A 1 392 ? 17.439  63.096 71.773 1.00 39.32  ? 392  ASP A CA  1 
ATOM   3035 C C   . ASP A 1 392 ? 17.930  62.546 70.434 1.00 39.32  ? 392  ASP A C   1 
ATOM   3036 O O   . ASP A 1 392 ? 17.171  62.476 69.472 1.00 39.32  ? 392  ASP A O   1 
ATOM   3037 C CB  . ASP A 1 392 ? 17.900  64.545 71.966 1.00 68.34  ? 392  ASP A CB  1 
ATOM   3038 C CG  . ASP A 1 392 ? 17.186  65.525 71.045 1.00 68.34  ? 392  ASP A CG  1 
ATOM   3039 O OD1 . ASP A 1 392 ? 17.062  65.242 69.827 1.00 68.34  ? 392  ASP A OD1 1 
ATOM   3040 O OD2 . ASP A 1 392 ? 16.763  66.595 71.546 1.00 68.34  ? 392  ASP A OD2 1 
ATOM   3041 N N   . ASP A 1 393 ? 19.201  62.154 70.375 1.00 33.44  ? 393  ASP A N   1 
ATOM   3042 C CA  . ASP A 1 393 ? 19.776  61.608 69.144 1.00 33.44  ? 393  ASP A CA  1 
ATOM   3043 C C   . ASP A 1 393 ? 19.175  60.268 68.763 1.00 33.44  ? 393  ASP A C   1 
ATOM   3044 O O   . ASP A 1 393 ? 18.933  60.005 67.597 1.00 33.44  ? 393  ASP A O   1 
ATOM   3045 C CB  . ASP A 1 393 ? 21.290  61.431 69.273 1.00 76.95  ? 393  ASP A CB  1 
ATOM   3046 C CG  . ASP A 1 393 ? 22.066  62.708 68.972 1.00 76.95  ? 393  ASP A CG  1 
ATOM   3047 O OD1 . ASP A 1 393 ? 21.532  63.565 68.232 1.00 76.95  ? 393  ASP A OD1 1 
ATOM   3048 O OD2 . ASP A 1 393 ? 23.219  62.847 69.454 1.00 76.95  ? 393  ASP A OD2 1 
ATOM   3049 N N   . ILE A 1 394 ? 18.961  59.410 69.752 1.00 32.49  ? 394  ILE A N   1 
ATOM   3050 C CA  . ILE A 1 394 ? 18.392  58.103 69.491 1.00 32.49  ? 394  ILE A CA  1 
ATOM   3051 C C   . ILE A 1 394 ? 17.049  58.236 68.790 1.00 32.49  ? 394  ILE A C   1 
ATOM   3052 O O   . ILE A 1 394 ? 16.828  57.635 67.749 1.00 32.49  ? 394  ILE A O   1 
ATOM   3053 C CB  . ILE A 1 394 ? 18.200  57.311 70.793 1.00 25.39  ? 394  ILE A CB  1 
ATOM   3054 C CG1 . ILE A 1 394 ? 19.557  56.968 71.394 1.00 25.39  ? 394  ILE A CG1 1 
ATOM   3055 C CG2 . ILE A 1 394 ? 17.411  56.049 70.527 1.00 25.39  ? 394  ILE A CG2 1 
ATOM   3056 C CD1 . ILE A 1 394 ? 19.470  56.148 72.661 1.00 25.39  ? 394  ILE A CD1 1 
ATOM   3057 N N   . VAL A 1 395 ? 16.155  59.035 69.354 1.00 28.87  ? 395  VAL A N   1 
ATOM   3058 C CA  . VAL A 1 395 ? 14.834  59.211 68.777 1.00 28.87  ? 395  VAL A CA  1 
ATOM   3059 C C   . VAL A 1 395 ? 14.874  59.741 67.343 1.00 28.87  ? 395  VAL A C   1 
ATOM   3060 O O   . VAL A 1 395 ? 14.146  59.254 66.481 1.00 28.87  ? 395  VAL A O   1 
ATOM   3061 C CB  . VAL A 1 395 ? 13.977  60.147 69.654 1.00 23.17  ? 395  VAL A CB  1 
ATOM   3062 C CG1 . VAL A 1 395 ? 12.576  60.224 69.115 1.00 23.17  ? 395  VAL A CG1 1 
ATOM   3063 C CG2 . VAL A 1 395 ? 13.954  59.643 71.072 1.00 23.17  ? 395  VAL A CG2 1 
ATOM   3064 N N   . GLY A 1 396 ? 15.723  60.731 67.085 1.00 32.58  ? 396  GLY A N   1 
ATOM   3065 C CA  . GLY A 1 396 ? 15.825  61.287 65.745 1.00 32.58  ? 396  GLY A CA  1 
ATOM   3066 C C   . GLY A 1 396 ? 16.456  60.348 64.727 1.00 32.58  ? 396  GLY A C   1 
ATOM   3067 O O   . GLY A 1 396 ? 15.944  60.187 63.615 1.00 32.58  ? 396  GLY A O   1 
ATOM   3068 N N   . ASP A 1 397 ? 17.570  59.726 65.107 1.00 31.34  ? 397  ASP A N   1 
ATOM   3069 C CA  . ASP A 1 397 ? 18.285  58.804 64.237 1.00 31.34  ? 397  ASP A CA  1 
ATOM   3070 C C   . ASP A 1 397 ? 17.434  57.615 63.830 1.00 31.34  ? 397  ASP A C   1 
ATOM   3071 O O   . ASP A 1 397 ? 17.298  57.318 62.651 1.00 31.34  ? 397  ASP A O   1 
ATOM   3072 C CB  . ASP A 1 397 ? 19.556  58.299 64.918 1.00 33.45  ? 397  ASP A CB  1 
ATOM   3073 C CG  . ASP A 1 397 ? 20.632  59.363 65.021 1.00 33.45  ? 397  ASP A CG  1 
ATOM   3074 O OD1 . ASP A 1 397 ? 20.441  60.474 64.490 1.00 33.45  ? 397  ASP A OD1 1 
ATOM   3075 O OD2 . ASP A 1 397 ? 21.682  59.087 65.637 1.00 33.45  ? 397  ASP A OD2 1 
ATOM   3076 N N   . HIS A 1 398 ? 16.862  56.935 64.808 1.00 33.96  ? 398  HIS A N   1 
ATOM   3077 C CA  . HIS A 1 398 ? 16.031  55.769 64.545 1.00 33.96  ? 398  HIS A CA  1 
ATOM   3078 C C   . HIS A 1 398 ? 14.706  56.046 63.828 1.00 33.96  ? 398  HIS A C   1 
ATOM   3079 O O   . HIS A 1 398 ? 14.215  55.213 63.078 1.00 33.96  ? 398  HIS A O   1 
ATOM   3080 C CB  . HIS A 1 398 ? 15.738  55.054 65.860 1.00 32.86  ? 398  HIS A CB  1 
ATOM   3081 C CG  . HIS A 1 398 ? 14.630  54.057 65.767 1.00 32.86  ? 398  HIS A CG  1 
ATOM   3082 N ND1 . HIS A 1 398 ? 14.695  52.948 64.954 1.00 32.86  ? 398  HIS A ND1 1 
ATOM   3083 C CD2 . HIS A 1 398 ? 13.425  54.008 66.376 1.00 32.86  ? 398  HIS A CD2 1 
ATOM   3084 C CE1 . HIS A 1 398 ? 13.579  52.256 65.069 1.00 32.86  ? 398  HIS A CE1 1 
ATOM   3085 N NE2 . HIS A 1 398 ? 12.791  52.877 65.925 1.00 32.86  ? 398  HIS A NE2 1 
ATOM   3086 N N   . ASN A 1 399 ? 14.135  57.218 64.053 1.00 28.72  ? 399  ASN A N   1 
ATOM   3087 C CA  . ASN A 1 399 ? 12.860  57.557 63.461 1.00 28.72  ? 399  ASN A CA  1 
ATOM   3088 C C   . ASN A 1 399 ? 12.849  58.426 62.221 1.00 28.72  ? 399  ASN A C   1 
ATOM   3089 O O   . ASN A 1 399 ? 11.919  58.353 61.426 1.00 28.72  ? 399  ASN A O   1 
ATOM   3090 C CB  . ASN A 1 399 ? 11.995  58.206 64.524 1.00 34.90  ? 399  ASN A CB  1 
ATOM   3091 C CG  . ASN A 1 399 ? 11.495  57.214 65.520 1.00 34.90  ? 399  ASN A CG  1 
ATOM   3092 O OD1 . ASN A 1 399 ? 10.591  56.438 65.229 1.00 34.90  ? 399  ASN A OD1 1 
ATOM   3093 N ND2 . ASN A 1 399 ? 12.087  57.208 66.700 1.00 34.90  ? 399  ASN A ND2 1 
ATOM   3094 N N   . VAL A 1 400 ? 13.870  59.249 62.041 1.00 31.41  ? 400  VAL A N   1 
ATOM   3095 C CA  . VAL A 1 400 ? 13.878  60.131 60.897 1.00 31.41  ? 400  VAL A CA  1 
ATOM   3096 C C   . VAL A 1 400 ? 15.145  60.096 60.062 1.00 31.41  ? 400  VAL A C   1 
ATOM   3097 O O   . VAL A 1 400 ? 15.107  59.756 58.880 1.00 31.41  ? 400  VAL A O   1 
ATOM   3098 C CB  . VAL A 1 400 ? 13.614  61.571 61.359 1.00 26.44  ? 400  VAL A CB  1 
ATOM   3099 C CG1 . VAL A 1 400 ? 13.612  62.511 60.186 1.00 26.44  ? 400  VAL A CG1 1 
ATOM   3100 C CG2 . VAL A 1 400 ? 12.286  61.636 62.081 1.00 26.44  ? 400  VAL A CG2 1 
ATOM   3101 N N   . ILE A 1 401 ? 16.271  60.426 60.679 1.00 37.59  ? 401  ILE A N   1 
ATOM   3102 C CA  . ILE A 1 401 ? 17.530  60.483 59.954 1.00 37.59  ? 401  ILE A CA  1 
ATOM   3103 C C   . ILE A 1 401 ? 18.069  59.180 59.375 1.00 37.59  ? 401  ILE A C   1 
ATOM   3104 O O   . ILE A 1 401 ? 18.289  59.105 58.175 1.00 37.59  ? 401  ILE A O   1 
ATOM   3105 C CB  . ILE A 1 401 ? 18.612  61.163 60.804 1.00 29.10  ? 401  ILE A CB  1 
ATOM   3106 C CG1 . ILE A 1 401 ? 18.127  62.557 61.216 1.00 29.10  ? 401  ILE A CG1 1 
ATOM   3107 C CG2 . ILE A 1 401 ? 19.898  61.289 60.009 1.00 29.10  ? 401  ILE A CG2 1 
ATOM   3108 C CD1 . ILE A 1 401 ? 18.950  63.201 62.303 1.00 29.10  ? 401  ILE A CD1 1 
ATOM   3109 N N   . CYS A 1 402 ? 18.285  58.150 60.181 1.00 32.55  ? 402  CYS A N   1 
ATOM   3110 C CA  . CYS A 1 402 ? 18.812  56.922 59.603 1.00 32.55  ? 402  CYS A CA  1 
ATOM   3111 C C   . CYS A 1 402 ? 17.856  56.286 58.566 1.00 32.55  ? 402  CYS A C   1 
ATOM   3112 O O   . CYS A 1 402 ? 18.310  55.646 57.626 1.00 32.55  ? 402  CYS A O   1 
ATOM   3113 C CB  . CYS A 1 402 ? 19.207  55.928 60.710 1.00 18.76  ? 402  CYS A CB  1 
ATOM   3114 N N   . PRO A 1 403 ? 16.528  56.441 58.723 1.00 35.73  ? 403  PRO A N   1 
ATOM   3115 C CA  . PRO A 1 403 ? 15.623  55.850 57.730 1.00 35.73  ? 403  PRO A CA  1 
ATOM   3116 C C   . PRO A 1 403 ? 15.656  56.638 56.418 1.00 35.73  ? 403  PRO A C   1 
ATOM   3117 O O   . PRO A 1 403 ? 15.588  56.059 55.339 1.00 35.73  ? 403  PRO A O   1 
ATOM   3118 C CB  . PRO A 1 403 ? 14.254  55.947 58.398 1.00 34.72  ? 403  PRO A CB  1 
ATOM   3119 C CG  . PRO A 1 403 ? 14.566  55.849 59.806 1.00 34.72  ? 403  PRO A CG  1 
ATOM   3120 C CD  . PRO A 1 403 ? 15.786  56.726 59.960 1.00 34.72  ? 403  PRO A CD  1 
ATOM   3121 N N   . LEU A 1 404 ? 15.748  57.961 56.511 1.00 30.22  ? 404  LEU A N   1 
ATOM   3122 C CA  . LEU A 1 404 ? 15.792  58.778 55.314 1.00 30.22  ? 404  LEU A CA  1 
ATOM   3123 C C   . LEU A 1 404 ? 17.098  58.564 54.543 1.00 30.22  ? 404  LEU A C   1 
ATOM   3124 O O   . LEU A 1 404 ? 17.116  58.607 53.318 1.00 30.22  ? 404  LEU A O   1 
ATOM   3125 C CB  . LEU A 1 404 ? 15.604  60.258 55.667 1.00 41.88  ? 404  LEU A CB  1 
ATOM   3126 C CG  . LEU A 1 404 ? 15.535  61.254 54.496 1.00 41.88  ? 404  LEU A CG  1 
ATOM   3127 C CD1 . LEU A 1 404 ? 14.455  62.305 54.736 1.00 41.88  ? 404  LEU A CD1 1 
ATOM   3128 C CD2 . LEU A 1 404 ? 16.893  61.909 54.314 1.00 41.88  ? 404  LEU A CD2 1 
ATOM   3129 N N   . MET A 1 405 ? 18.195  58.328 55.250 1.00 39.31  ? 405  MET A N   1 
ATOM   3130 C CA  . MET A 1 405 ? 19.460  58.085 54.569 1.00 39.31  ? 405  MET A CA  1 
ATOM   3131 C C   . MET A 1 405 ? 19.448  56.735 53.847 1.00 39.31  ? 405  MET A C   1 
ATOM   3132 O O   . MET A 1 405 ? 20.157  56.541 52.863 1.00 39.31  ? 405  MET A O   1 
ATOM   3133 C CB  . MET A 1 405 ? 20.634  58.138 55.548 1.00 41.25  ? 405  MET A CB  1 
ATOM   3134 C CG  . MET A 1 405 ? 21.012  59.545 55.990 1.00 41.25  ? 405  MET A CG  1 
ATOM   3135 S SD  . MET A 1 405 ? 21.304  60.677 54.618 1.00 41.25  ? 405  MET A SD  1 
ATOM   3136 C CE  . MET A 1 405 ? 22.825  60.024 53.948 1.00 41.25  ? 405  MET A CE  1 
ATOM   3137 N N   . HIS A 1 406 ? 18.643  55.797 54.335 1.00 45.66  ? 406  HIS A N   1 
ATOM   3138 C CA  . HIS A 1 406 ? 18.544  54.486 53.693 1.00 45.66  ? 406  HIS A CA  1 
ATOM   3139 C C   . HIS A 1 406 ? 17.770  54.681 52.384 1.00 45.66  ? 406  HIS A C   1 
ATOM   3140 O O   . HIS A 1 406 ? 18.087  54.079 51.361 1.00 45.66  ? 406  HIS A O   1 
ATOM   3141 C CB  . HIS A 1 406 ? 17.806  53.499 54.610 1.00 49.63  ? 406  HIS A CB  1 
ATOM   3142 C CG  . HIS A 1 406 ? 17.717  52.105 54.065 1.00 49.63  ? 406  HIS A CG  1 
ATOM   3143 N ND1 . HIS A 1 406 ? 18.822  51.292 53.912 1.00 49.63  ? 406  HIS A ND1 1 
ATOM   3144 C CD2 . HIS A 1 406 ? 16.653  51.377 53.644 1.00 49.63  ? 406  HIS A CD2 1 
ATOM   3145 C CE1 . HIS A 1 406 ? 18.441  50.125 53.421 1.00 49.63  ? 406  HIS A CE1 1 
ATOM   3146 N NE2 . HIS A 1 406 ? 17.131  50.150 53.250 1.00 49.63  ? 406  HIS A NE2 1 
ATOM   3147 N N   . PHE A 1 407 ? 16.760  55.543 52.424 1.00 44.42  ? 407  PHE A N   1 
ATOM   3148 C CA  . PHE A 1 407 ? 15.952  55.827 51.245 1.00 44.42  ? 407  PHE A CA  1 
ATOM   3149 C C   . PHE A 1 407 ? 16.776  56.568 50.192 1.00 44.42  ? 407  PHE A C   1 
ATOM   3150 O O   . PHE A 1 407 ? 16.836  56.150 49.041 1.00 44.42  ? 407  PHE A O   1 
ATOM   3151 C CB  . PHE A 1 407 ? 14.734  56.674 51.632 1.00 33.30  ? 407  PHE A CB  1 
ATOM   3152 C CG  . PHE A 1 407 ? 13.876  57.066 50.468 1.00 33.30  ? 407  PHE A CG  1 
ATOM   3153 C CD1 . PHE A 1 407 ? 13.082  56.123 49.825 1.00 33.30  ? 407  PHE A CD1 1 
ATOM   3154 C CD2 . PHE A 1 407 ? 13.873  58.370 50.004 1.00 33.30  ? 407  PHE A CD2 1 
ATOM   3155 C CE1 . PHE A 1 407 ? 12.296  56.475 48.735 1.00 33.30  ? 407  PHE A CE1 1 
ATOM   3156 C CE2 . PHE A 1 407 ? 13.093  58.729 48.917 1.00 33.30  ? 407  PHE A CE2 1 
ATOM   3157 C CZ  . PHE A 1 407 ? 12.301  57.775 48.281 1.00 33.30  ? 407  PHE A CZ  1 
ATOM   3158 N N   . VAL A 1 408 ? 17.411  57.666 50.593 1.00 34.61  ? 408  VAL A N   1 
ATOM   3159 C CA  . VAL A 1 408 ? 18.204  58.461 49.672 1.00 34.61  ? 408  VAL A CA  1 
ATOM   3160 C C   . VAL A 1 408 ? 19.295  57.636 49.032 1.00 34.61  ? 408  VAL A C   1 
ATOM   3161 O O   . VAL A 1 408 ? 19.647  57.865 47.885 1.00 34.61  ? 408  VAL A O   1 
ATOM   3162 C CB  . VAL A 1 408 ? 18.850  59.673 50.374 1.00 42.65  ? 408  VAL A CB  1 
ATOM   3163 C CG1 . VAL A 1 408 ? 19.704  59.201 51.510 1.00 42.65  ? 408  VAL A CG1 1 
ATOM   3164 C CG2 . VAL A 1 408 ? 19.694  60.471 49.387 1.00 42.65  ? 408  VAL A CG2 1 
ATOM   3165 N N   . ASN A 1 409 ? 19.844  56.674 49.760 1.00 41.98  ? 409  ASN A N   1 
ATOM   3166 C CA  . ASN A 1 409 ? 20.890  55.858 49.173 1.00 41.98  ? 409  ASN A CA  1 
ATOM   3167 C C   . ASN A 1 409 ? 20.328  54.833 48.207 1.00 41.98  ? 409  ASN A C   1 
ATOM   3168 O O   . ASN A 1 409 ? 20.876  54.653 47.131 1.00 41.98  ? 409  ASN A O   1 
ATOM   3169 C CB  . ASN A 1 409 ? 21.734  55.202 50.253 1.00 40.66  ? 409  ASN A CB  1 
ATOM   3170 C CG  . ASN A 1 409 ? 22.851  56.112 50.724 1.00 40.66  ? 409  ASN A CG  1 
ATOM   3171 O OD1 . ASN A 1 409 ? 23.660  56.572 49.920 1.00 40.66  ? 409  ASN A OD1 1 
ATOM   3172 N ND2 . ASN A 1 409 ? 22.895  56.391 52.019 1.00 40.66  ? 409  ASN A ND2 1 
ATOM   3173 N N   . LYS A 1 410 ? 19.231  54.171 48.558 1.00 45.42  ? 410  LYS A N   1 
ATOM   3174 C CA  . LYS A 1 410 ? 18.632  53.199 47.642 1.00 45.42  ? 410  LYS A CA  1 
ATOM   3175 C C   . LYS A 1 410 ? 18.070  53.893 46.383 1.00 45.42  ? 410  LYS A C   1 
ATOM   3176 O O   . LYS A 1 410 ? 18.126  53.351 45.276 1.00 45.42  ? 410  LYS A O   1 
ATOM   3177 C CB  . LYS A 1 410 ? 17.493  52.456 48.333 1.00 51.18  ? 410  LYS A CB  1 
ATOM   3178 C CG  . LYS A 1 410 ? 17.912  51.575 49.468 1.00 51.18  ? 410  LYS A CG  1 
ATOM   3179 C CD  . LYS A 1 410 ? 18.590  50.342 48.950 1.00 51.18  ? 410  LYS A CD  1 
ATOM   3180 C CE  . LYS A 1 410 ? 18.876  49.400 50.091 1.00 51.18  ? 410  LYS A CE  1 
ATOM   3181 N NZ  . LYS A 1 410 ? 19.592  48.193 49.605 1.00 51.18  ? 410  LYS A NZ  1 
ATOM   3182 N N   . TYR A 1 411 ? 17.527  55.092 46.569 1.00 37.63  ? 411  TYR A N   1 
ATOM   3183 C CA  . TYR A 1 411 ? 16.931  55.849 45.483 1.00 37.63  ? 411  TYR A CA  1 
ATOM   3184 C C   . TYR A 1 411 ? 17.957  56.345 44.487 1.00 37.63  ? 411  TYR A C   1 
ATOM   3185 O O   . TYR A 1 411 ? 17.843  56.104 43.287 1.00 37.63  ? 411  TYR A O   1 
ATOM   3186 C CB  . TYR A 1 411 ? 16.163  57.059 46.022 1.00 35.85  ? 411  TYR A CB  1 
ATOM   3187 C CG  . TYR A 1 411 ? 15.360  57.758 44.953 1.00 35.85  ? 411  TYR A CG  1 
ATOM   3188 C CD1 . TYR A 1 411 ? 14.072  57.330 44.639 1.00 35.85  ? 411  TYR A CD1 1 
ATOM   3189 C CD2 . TYR A 1 411 ? 15.919  58.787 44.195 1.00 35.85  ? 411  TYR A CD2 1 
ATOM   3190 C CE1 . TYR A 1 411 ? 13.356  57.900 43.592 1.00 35.85  ? 411  TYR A CE1 1 
ATOM   3191 C CE2 . TYR A 1 411 ? 15.215  59.368 43.140 1.00 35.85  ? 411  TYR A CE2 1 
ATOM   3192 C CZ  . TYR A 1 411 ? 13.931  58.917 42.843 1.00 35.85  ? 411  TYR A CZ  1 
ATOM   3193 O OH  . TYR A 1 411 ? 13.225  59.469 41.797 1.00 35.85  ? 411  TYR A OH  1 
ATOM   3194 N N   . THR A 1 412 ? 18.948  57.062 44.996 1.00 43.37  ? 412  THR A N   1 
ATOM   3195 C CA  . THR A 1 412 ? 19.997  57.618 44.162 1.00 43.37  ? 412  THR A CA  1 
ATOM   3196 C C   . THR A 1 412 ? 20.585  56.624 43.165 1.00 43.37  ? 412  THR A C   1 
ATOM   3197 O O   . THR A 1 412 ? 21.047  57.015 42.094 1.00 43.37  ? 412  THR A O   1 
ATOM   3198 C CB  . THR A 1 412 ? 21.097  58.218 45.043 1.00 35.47  ? 412  THR A CB  1 
ATOM   3199 O OG1 . THR A 1 412 ? 20.605  59.437 45.615 1.00 35.47  ? 412  THR A OG1 1 
ATOM   3200 C CG2 . THR A 1 412 ? 22.350  58.504 44.241 1.00 35.47  ? 412  THR A CG2 1 
ATOM   3201 N N   . LYS A 1 413 ? 20.547  55.341 43.499 1.00 49.55  ? 413  LYS A N   1 
ATOM   3202 C CA  . LYS A 1 413 ? 21.067  54.319 42.598 1.00 49.55  ? 413  LYS A CA  1 
ATOM   3203 C C   . LYS A 1 413 ? 20.252  54.166 41.293 1.00 49.55  ? 413  LYS A C   1 
ATOM   3204 O O   . LYS A 1 413 ? 20.748  53.596 40.327 1.00 49.55  ? 413  LYS A O   1 
ATOM   3205 C CB  . LYS A 1 413 ? 21.139  52.971 43.316 1.00 65.77  ? 413  LYS A CB  1 
ATOM   3206 C CG  . LYS A 1 413 ? 21.747  51.887 42.451 1.00 65.77  ? 413  LYS A CG  1 
ATOM   3207 C CD  . LYS A 1 413 ? 21.655  50.504 43.079 1.00 65.77  ? 413  LYS A CD  1 
ATOM   3208 C CE  . LYS A 1 413 ? 22.048  49.455 42.048 1.00 65.77  ? 413  LYS A CE  1 
ATOM   3209 N NZ  . LYS A 1 413 ? 21.370  49.743 40.735 1.00 65.77  ? 413  LYS A NZ  1 
ATOM   3210 N N   . PHE A 1 414 ? 19.010  54.659 41.271 1.00 43.09  ? 414  PHE A N   1 
ATOM   3211 C CA  . PHE A 1 414 ? 18.157  54.593 40.073 1.00 43.09  ? 414  PHE A CA  1 
ATOM   3212 C C   . PHE A 1 414 ? 17.543  55.952 39.705 1.00 43.09  ? 414  PHE A C   1 
ATOM   3213 O O   . PHE A 1 414 ? 16.887  56.077 38.676 1.00 43.09  ? 414  PHE A O   1 
ATOM   3214 C CB  . PHE A 1 414 ? 16.984  53.636 40.254 1.00 41.46  ? 414  PHE A CB  1 
ATOM   3215 C CG  . PHE A 1 414 ? 17.367  52.236 40.573 1.00 41.46  ? 414  PHE A CG  1 
ATOM   3216 C CD1 . PHE A 1 414 ? 17.750  51.884 41.856 1.00 41.46  ? 414  PHE A CD1 1 
ATOM   3217 C CD2 . PHE A 1 414 ? 17.264  51.244 39.605 1.00 41.46  ? 414  PHE A CD2 1 
ATOM   3218 C CE1 . PHE A 1 414 ? 18.016  50.559 42.182 1.00 41.46  ? 414  PHE A CE1 1 
ATOM   3219 C CE2 . PHE A 1 414 ? 17.529  49.915 39.916 1.00 41.46  ? 414  PHE A CE2 1 
ATOM   3220 C CZ  . PHE A 1 414 ? 17.904  49.572 41.212 1.00 41.46  ? 414  PHE A CZ  1 
ATOM   3221 N N   . GLY A 1 415 ? 17.741  56.960 40.549 1.00 41.31  ? 415  GLY A N   1 
ATOM   3222 C CA  . GLY A 1 415 ? 17.160  58.269 40.286 1.00 41.31  ? 415  GLY A CA  1 
ATOM   3223 C C   . GLY A 1 415 ? 17.903  59.074 39.250 1.00 41.31  ? 415  GLY A C   1 
ATOM   3224 O O   . GLY A 1 415 ? 18.951  58.652 38.768 1.00 41.31  ? 415  GLY A O   1 
ATOM   3225 N N   . ASN A 1 416 ? 17.367  60.239 38.912 1.00 35.85  ? 416  ASN A N   1 
ATOM   3226 C CA  . ASN A 1 416 ? 17.992  61.096 37.917 1.00 35.85  ? 416  ASN A CA  1 
ATOM   3227 C C   . ASN A 1 416 ? 18.433  62.422 38.551 1.00 35.85  ? 416  ASN A C   1 
ATOM   3228 O O   . ASN A 1 416 ? 18.429  63.462 37.903 1.00 35.85  ? 416  ASN A O   1 
ATOM   3229 C CB  . ASN A 1 416 ? 17.012  61.299 36.741 1.00 38.79  ? 416  ASN A CB  1 
ATOM   3230 C CG  . ASN A 1 416 ? 17.552  62.220 35.638 1.00 38.79  ? 416  ASN A CG  1 
ATOM   3231 O OD1 . ASN A 1 416 ? 17.007  63.309 35.425 1.00 38.79  ? 416  ASN A OD1 1 
ATOM   3232 N ND2 . ASN A 1 416 ? 18.605  61.784 34.924 1.00 38.79  ? 416  ASN A ND2 1 
ATOM   3233 N N   . GLY A 1 417 ? 18.832  62.367 39.823 1.00 37.85  ? 417  GLY A N   1 
ATOM   3234 C CA  . GLY A 1 417 ? 19.296  63.558 40.526 1.00 37.85  ? 417  GLY A CA  1 
ATOM   3235 C C   . GLY A 1 417 ? 18.828  63.646 41.964 1.00 37.85  ? 417  GLY A C   1 
ATOM   3236 O O   . GLY A 1 417 ? 17.639  63.584 42.230 1.00 37.85  ? 417  GLY A O   1 
ATOM   3237 N N   . THR A 1 418 ? 19.756  63.808 42.896 1.00 28.27  ? 418  THR A N   1 
ATOM   3238 C CA  . THR A 1 418 ? 19.389  63.890 44.304 1.00 28.27  ? 418  THR A CA  1 
ATOM   3239 C C   . THR A 1 418 ? 20.085  65.071 44.980 1.00 28.27  ? 418  THR A C   1 
ATOM   3240 O O   . THR A 1 418 ? 21.262  65.314 44.736 1.00 28.27  ? 418  THR A O   1 
ATOM   3241 C CB  . THR A 1 418 ? 19.770  62.572 45.048 1.00 32.76  ? 418  THR A CB  1 
ATOM   3242 O OG1 . THR A 1 418 ? 19.093  61.457 44.450 1.00 32.76  ? 418  THR A OG1 1 
ATOM   3243 C CG2 . THR A 1 418 ? 19.391  62.649 46.513 1.00 32.76  ? 418  THR A CG2 1 
ATOM   3244 N N   . TYR A 1 419 ? 19.350  65.805 45.816 1.00 34.92  ? 419  TYR A N   1 
ATOM   3245 C CA  . TYR A 1 419 ? 19.892  66.961 46.548 1.00 34.92  ? 419  TYR A CA  1 
ATOM   3246 C C   . TYR A 1 419 ? 19.536  66.845 48.034 1.00 34.92  ? 419  TYR A C   1 
ATOM   3247 O O   . TYR A 1 419 ? 18.363  66.884 48.408 1.00 34.92  ? 419  TYR A O   1 
ATOM   3248 C CB  . TYR A 1 419 ? 19.337  68.267 45.979 1.00 36.88  ? 419  TYR A CB  1 
ATOM   3249 C CG  . TYR A 1 419 ? 19.738  68.521 44.543 1.00 36.88  ? 419  TYR A CG  1 
ATOM   3250 C CD1 . TYR A 1 419 ? 20.933  69.168 44.233 1.00 36.88  ? 419  TYR A CD1 1 
ATOM   3251 C CD2 . TYR A 1 419 ? 18.933  68.084 43.492 1.00 36.88  ? 419  TYR A CD2 1 
ATOM   3252 C CE1 . TYR A 1 419 ? 21.311  69.372 42.913 1.00 36.88  ? 419  TYR A CE1 1 
ATOM   3253 C CE2 . TYR A 1 419 ? 19.303  68.278 42.182 1.00 36.88  ? 419  TYR A CE2 1 
ATOM   3254 C CZ  . TYR A 1 419 ? 20.489  68.923 41.892 1.00 36.88  ? 419  TYR A CZ  1 
ATOM   3255 O OH  . TYR A 1 419 ? 20.837  69.120 40.575 1.00 36.88  ? 419  TYR A OH  1 
ATOM   3256 N N   . LEU A 1 420 ? 20.555  66.727 48.878 1.00 31.79  ? 420  LEU A N   1 
ATOM   3257 C CA  . LEU A 1 420 ? 20.349  66.541 50.304 1.00 31.79  ? 420  LEU A CA  1 
ATOM   3258 C C   . LEU A 1 420 ? 20.776  67.729 51.157 1.00 31.79  ? 420  LEU A C   1 
ATOM   3259 O O   . LEU A 1 420 ? 21.798  68.350 50.900 1.00 31.79  ? 420  LEU A O   1 
ATOM   3260 C CB  . LEU A 1 420 ? 21.104  65.282 50.735 1.00 29.61  ? 420  LEU A CB  1 
ATOM   3261 C CG  . LEU A 1 420 ? 20.879  64.712 52.126 1.00 29.61  ? 420  LEU A CG  1 
ATOM   3262 C CD1 . LEU A 1 420 ? 19.412  64.457 52.295 1.00 29.61  ? 420  LEU A CD1 1 
ATOM   3263 C CD2 . LEU A 1 420 ? 21.655  63.431 52.304 1.00 29.61  ? 420  LEU A CD2 1 
ATOM   3264 N N   . TYR A 1 421 ? 19.988  68.041 52.181 1.00 35.76  ? 421  TYR A N   1 
ATOM   3265 C CA  . TYR A 1 421 ? 20.300  69.157 53.070 1.00 35.76  ? 421  TYR A CA  1 
ATOM   3266 C C   . TYR A 1 421 ? 20.227  68.744 54.537 1.00 35.76  ? 421  TYR A C   1 
ATOM   3267 O O   . TYR A 1 421 ? 19.740  67.665 54.870 1.00 35.76  ? 421  TYR A O   1 
ATOM   3268 C CB  . TYR A 1 421 ? 19.338  70.333 52.819 1.00 41.98  ? 421  TYR A CB  1 
ATOM   3269 C CG  . TYR A 1 421 ? 17.916  70.145 53.340 1.00 41.98  ? 421  TYR A CG  1 
ATOM   3270 C CD1 . TYR A 1 421 ? 17.613  70.337 54.691 1.00 41.98  ? 421  TYR A CD1 1 
ATOM   3271 C CD2 . TYR A 1 421 ? 16.881  69.754 52.486 1.00 41.98  ? 421  TYR A CD2 1 
ATOM   3272 C CE1 . TYR A 1 421 ? 16.320  70.144 55.178 1.00 41.98  ? 421  TYR A CE1 1 
ATOM   3273 C CE2 . TYR A 1 421 ? 15.579  69.557 52.966 1.00 41.98  ? 421  TYR A CE2 1 
ATOM   3274 C CZ  . TYR A 1 421 ? 15.306  69.754 54.315 1.00 41.98  ? 421  TYR A CZ  1 
ATOM   3275 O OH  . TYR A 1 421 ? 14.027  69.563 54.803 1.00 41.98  ? 421  TYR A OH  1 
ATOM   3276 N N   . PHE A 1 422 ? 20.717  69.613 55.409 1.00 36.47  ? 422  PHE A N   1 
ATOM   3277 C CA  . PHE A 1 422 ? 20.693  69.360 56.841 1.00 36.47  ? 422  PHE A CA  1 
ATOM   3278 C C   . PHE A 1 422 ? 20.387  70.709 57.469 1.00 36.47  ? 422  PHE A C   1 
ATOM   3279 O O   . PHE A 1 422 ? 21.262  71.562 57.561 1.00 36.47  ? 422  PHE A O   1 
ATOM   3280 C CB  . PHE A 1 422 ? 22.057  68.853 57.312 1.00 33.32  ? 422  PHE A CB  1 
ATOM   3281 C CG  . PHE A 1 422 ? 22.103  68.463 58.767 1.00 33.32  ? 422  PHE A CG  1 
ATOM   3282 C CD1 . PHE A 1 422 ? 21.477  67.302 59.215 1.00 33.32  ? 422  PHE A CD1 1 
ATOM   3283 C CD2 . PHE A 1 422 ? 22.805  69.242 59.687 1.00 33.32  ? 422  PHE A CD2 1 
ATOM   3284 C CE1 . PHE A 1 422 ? 21.552  66.920 60.558 1.00 33.32  ? 422  PHE A CE1 1 
ATOM   3285 C CE2 . PHE A 1 422 ? 22.884  68.869 61.026 1.00 33.32  ? 422  PHE A CE2 1 
ATOM   3286 C CZ  . PHE A 1 422 ? 22.256  67.703 61.463 1.00 33.32  ? 422  PHE A CZ  1 
ATOM   3287 N N   . PHE A 1 423 ? 19.140  70.912 57.874 1.00 35.83  ? 423  PHE A N   1 
ATOM   3288 C CA  . PHE A 1 423 ? 18.733  72.173 58.470 1.00 35.83  ? 423  PHE A CA  1 
ATOM   3289 C C   . PHE A 1 423 ? 19.137  72.220 59.939 1.00 35.83  ? 423  PHE A C   1 
ATOM   3290 O O   . PHE A 1 423 ? 18.625  71.467 60.764 1.00 35.83  ? 423  PHE A O   1 
ATOM   3291 C CB  . PHE A 1 423 ? 17.224  72.341 58.341 1.00 33.35  ? 423  PHE A CB  1 
ATOM   3292 C CG  . PHE A 1 423 ? 16.739  73.695 58.720 1.00 33.35  ? 423  PHE A CG  1 
ATOM   3293 C CD1 . PHE A 1 423 ? 16.855  74.754 57.837 1.00 33.35  ? 423  PHE A CD1 1 
ATOM   3294 C CD2 . PHE A 1 423 ? 16.201  73.923 59.980 1.00 33.35  ? 423  PHE A CD2 1 
ATOM   3295 C CE1 . PHE A 1 423 ? 16.443  76.029 58.198 1.00 33.35  ? 423  PHE A CE1 1 
ATOM   3296 C CE2 . PHE A 1 423 ? 15.784  75.192 60.359 1.00 33.35  ? 423  PHE A CE2 1 
ATOM   3297 C CZ  . PHE A 1 423 ? 15.906  76.251 59.465 1.00 33.35  ? 423  PHE A CZ  1 
ATOM   3298 N N   . ASN A 1 424 ? 20.057  73.108 60.276 1.00 45.54  ? 424  ASN A N   1 
ATOM   3299 C CA  . ASN A 1 424 ? 20.500  73.187 61.654 1.00 45.54  ? 424  ASN A CA  1 
ATOM   3300 C C   . ASN A 1 424 ? 20.543  74.611 62.189 1.00 45.54  ? 424  ASN A C   1 
ATOM   3301 O O   . ASN A 1 424 ? 21.517  75.013 62.808 1.00 45.54  ? 424  ASN A O   1 
ATOM   3302 C CB  . ASN A 1 424 ? 21.872  72.509 61.806 1.00 38.24  ? 424  ASN A CB  1 
ATOM   3303 C CG  . ASN A 1 424 ? 22.963  73.193 60.996 1.00 38.24  ? 424  ASN A CG  1 
ATOM   3304 O OD1 . ASN A 1 424 ? 22.687  73.894 60.030 1.00 38.24  ? 424  ASN A OD1 1 
ATOM   3305 N ND2 . ASN A 1 424 ? 24.207  72.974 61.380 1.00 38.24  ? 424  ASN A ND2 1 
ATOM   3306 N N   . HIS A 1 425 ? 19.487  75.377 61.939 1.00 45.16  ? 425  HIS A N   1 
ATOM   3307 C CA  . HIS A 1 425 ? 19.409  76.737 62.447 1.00 45.16  ? 425  HIS A CA  1 
ATOM   3308 C C   . HIS A 1 425 ? 18.197  76.863 63.360 1.00 45.16  ? 425  HIS A C   1 
ATOM   3309 O O   . HIS A 1 425 ? 17.079  76.540 62.964 1.00 45.16  ? 425  HIS A O   1 
ATOM   3310 C CB  . HIS A 1 425 ? 19.267  77.754 61.309 1.00 54.77  ? 425  HIS A CB  1 
ATOM   3311 C CG  . HIS A 1 425 ? 19.021  79.154 61.791 1.00 54.77  ? 425  HIS A CG  1 
ATOM   3312 N ND1 . HIS A 1 425 ? 19.977  79.890 62.460 1.00 54.77  ? 425  HIS A ND1 1 
ATOM   3313 C CD2 . HIS A 1 425 ? 17.896  79.909 61.800 1.00 54.77  ? 425  HIS A CD2 1 
ATOM   3314 C CE1 . HIS A 1 425 ? 19.450  81.031 62.867 1.00 54.77  ? 425  HIS A CE1 1 
ATOM   3315 N NE2 . HIS A 1 425 ? 18.189  81.068 62.481 1.00 54.77  ? 425  HIS A NE2 1 
ATOM   3316 N N   . ARG A 1 426 ? 18.406  77.325 64.585 1.00 43.22  ? 426  ARG A N   1 
ATOM   3317 C CA  . ARG A 1 426 ? 17.281  77.505 65.499 1.00 43.22  ? 426  ARG A CA  1 
ATOM   3318 C C   . ARG A 1 426 ? 16.753  78.947 65.379 1.00 43.22  ? 426  ARG A C   1 
ATOM   3319 O O   . ARG A 1 426 ? 17.493  79.904 65.626 1.00 43.22  ? 426  ARG A O   1 
ATOM   3320 C CB  . ARG A 1 426 ? 17.714  77.217 66.944 1.00 44.42  ? 426  ARG A CB  1 
ATOM   3321 C CG  . ARG A 1 426 ? 16.566  77.283 67.944 1.00 44.42  ? 426  ARG A CG  1 
ATOM   3322 C CD  . ARG A 1 426 ? 17.065  77.051 69.344 1.00 44.42  ? 426  ARG A CD  1 
ATOM   3323 N NE  . ARG A 1 426 ? 16.146  77.580 70.345 1.00 44.42  ? 426  ARG A NE  1 
ATOM   3324 C CZ  . ARG A 1 426 ? 15.149  76.895 70.900 1.00 44.42  ? 426  ARG A CZ  1 
ATOM   3325 N NH1 . ARG A 1 426 ? 14.924  75.632 70.557 1.00 44.42  ? 426  ARG A NH1 1 
ATOM   3326 N NH2 . ARG A 1 426 ? 14.379  77.477 71.811 1.00 44.42  ? 426  ARG A NH2 1 
ATOM   3327 N N   . ALA A 1 427 ? 15.487  79.102 64.988 1.00 57.11  ? 427  ALA A N   1 
ATOM   3328 C CA  . ALA A 1 427 ? 14.896  80.439 64.841 1.00 57.11  ? 427  ALA A CA  1 
ATOM   3329 C C   . ALA A 1 427 ? 15.072  81.236 66.136 1.00 57.11  ? 427  ALA A C   1 
ATOM   3330 O O   . ALA A 1 427 ? 14.989  80.672 67.230 1.00 57.11  ? 427  ALA A O   1 
ATOM   3331 C CB  . ALA A 1 427 ? 13.416  80.329 64.483 1.00 40.45  ? 427  ALA A CB  1 
ATOM   3332 N N   . SER A 1 428 ? 15.312  82.540 66.021 1.00 49.36  ? 428  SER A N   1 
ATOM   3333 C CA  . SER A 1 428 ? 15.527  83.372 67.206 1.00 49.36  ? 428  SER A CA  1 
ATOM   3334 C C   . SER A 1 428 ? 14.267  83.615 68.032 1.00 49.36  ? 428  SER A C   1 
ATOM   3335 O O   . SER A 1 428 ? 14.353  83.961 69.213 1.00 49.36  ? 428  SER A O   1 
ATOM   3336 C CB  . SER A 1 428 ? 16.134  84.726 66.811 1.00 58.72  ? 428  SER A CB  1 
ATOM   3337 O OG  . SER A 1 428 ? 15.233  85.484 66.007 1.00 58.72  ? 428  SER A OG  1 
ATOM   3338 N N   . ASN A 1 429 ? 13.098  83.437 67.416 1.00 50.27  ? 429  ASN A N   1 
ATOM   3339 C CA  . ASN A 1 429 ? 11.837  83.661 68.118 1.00 50.27  ? 429  ASN A CA  1 
ATOM   3340 C C   . ASN A 1 429 ? 11.143  82.395 68.613 1.00 50.27  ? 429  ASN A C   1 
ATOM   3341 O O   . ASN A 1 429 ? 9.969   82.447 69.004 1.00 50.27  ? 429  ASN A O   1 
ATOM   3342 C CB  . ASN A 1 429 ? 10.865  84.447 67.230 1.00 51.35  ? 429  ASN A CB  1 
ATOM   3343 C CG  . ASN A 1 429 ? 10.754  83.872 65.824 1.00 51.35  ? 429  ASN A CG  1 
ATOM   3344 O OD1 . ASN A 1 429 ? 10.960  82.673 65.605 1.00 51.35  ? 429  ASN A OD1 1 
ATOM   3345 N ND2 . ASN A 1 429 ? 10.407  84.729 64.861 1.00 51.35  ? 429  ASN A ND2 1 
ATOM   3346 N N   . LEU A 1 430 ? 11.847  81.264 68.607 1.00 40.93  ? 430  LEU A N   1 
ATOM   3347 C CA  . LEU A 1 430 ? 11.230  80.020 69.057 1.00 40.93  ? 430  LEU A CA  1 
ATOM   3348 C C   . LEU A 1 430 ? 10.805  80.114 70.519 1.00 40.93  ? 430  LEU A C   1 
ATOM   3349 O O   . LEU A 1 430 ? 11.548  80.618 71.361 1.00 40.93  ? 430  LEU A O   1 
ATOM   3350 C CB  . LEU A 1 430 ? 12.189  78.845 68.873 1.00 58.79  ? 430  LEU A CB  1 
ATOM   3351 C CG  . LEU A 1 430 ? 11.833  77.798 67.809 1.00 58.79  ? 430  LEU A CG  1 
ATOM   3352 C CD1 . LEU A 1 430 ? 12.811  76.637 67.914 1.00 58.79  ? 430  LEU A CD1 1 
ATOM   3353 C CD2 . LEU A 1 430 ? 10.423  77.280 68.014 1.00 58.79  ? 430  LEU A CD2 1 
ATOM   3354 N N   . VAL A 1 431 ? 9.609   79.624 70.821 1.00 42.36  ? 431  VAL A N   1 
ATOM   3355 C CA  . VAL A 1 431 ? 9.103   79.670 72.191 1.00 42.36  ? 431  VAL A CA  1 
ATOM   3356 C C   . VAL A 1 431 ? 9.436   78.436 73.056 1.00 42.36  ? 431  VAL A C   1 
ATOM   3357 O O   . VAL A 1 431 ? 9.280   78.468 74.279 1.00 42.36  ? 431  VAL A O   1 
ATOM   3358 C CB  . VAL A 1 431 ? 7.573   79.896 72.188 1.00 57.27  ? 431  VAL A CB  1 
ATOM   3359 C CG1 . VAL A 1 431 ? 7.265   81.282 71.663 1.00 57.27  ? 431  VAL A CG1 1 
ATOM   3360 C CG2 . VAL A 1 431 ? 6.890   78.857 71.310 1.00 57.27  ? 431  VAL A CG2 1 
ATOM   3361 N N   . TRP A 1 432 ? 9.894   77.357 72.423 1.00 46.82  ? 432  TRP A N   1 
ATOM   3362 C CA  . TRP A 1 432 ? 10.254  76.134 73.142 1.00 46.82  ? 432  TRP A CA  1 
ATOM   3363 C C   . TRP A 1 432 ? 11.610  76.278 73.830 1.00 46.82  ? 432  TRP A C   1 
ATOM   3364 O O   . TRP A 1 432 ? 12.428  77.105 73.449 1.00 46.82  ? 432  TRP A O   1 
ATOM   3365 C CB  . TRP A 1 432 ? 10.301  74.942 72.185 1.00 37.12  ? 432  TRP A CB  1 
ATOM   3366 C CG  . TRP A 1 432 ? 9.007   74.666 71.500 1.00 37.12  ? 432  TRP A CG  1 
ATOM   3367 C CD1 . TRP A 1 432 ? 8.640   75.057 70.247 1.00 37.12  ? 432  TRP A CD1 1 
ATOM   3368 C CD2 . TRP A 1 432 ? 7.909   73.925 72.028 1.00 37.12  ? 432  TRP A CD2 1 
ATOM   3369 N NE1 . TRP A 1 432 ? 7.381   74.600 69.957 1.00 37.12  ? 432  TRP A NE1 1 
ATOM   3370 C CE2 . TRP A 1 432 ? 6.907   73.900 71.034 1.00 37.12  ? 432  TRP A CE2 1 
ATOM   3371 C CE3 . TRP A 1 432 ? 7.671   73.278 73.247 1.00 37.12  ? 432  TRP A CE3 1 
ATOM   3372 C CZ2 . TRP A 1 432 ? 5.685   73.249 71.220 1.00 37.12  ? 432  TRP A CZ2 1 
ATOM   3373 C CZ3 . TRP A 1 432 ? 6.460   72.634 73.435 1.00 37.12  ? 432  TRP A CZ3 1 
ATOM   3374 C CH2 . TRP A 1 432 ? 5.479   72.623 72.424 1.00 37.12  ? 432  TRP A CH2 1 
ATOM   3375 N N   . PRO A 1 433 ? 11.868  75.463 74.855 1.00 32.14  ? 433  PRO A N   1 
ATOM   3376 C CA  . PRO A 1 433 ? 13.157  75.575 75.538 1.00 32.14  ? 433  PRO A CA  1 
ATOM   3377 C C   . PRO A 1 433 ? 14.343  75.329 74.619 1.00 32.14  ? 433  PRO A C   1 
ATOM   3378 O O   . PRO A 1 433 ? 14.192  74.786 73.531 1.00 32.14  ? 433  PRO A O   1 
ATOM   3379 C CB  . PRO A 1 433 ? 13.044  74.552 76.665 1.00 42.63  ? 433  PRO A CB  1 
ATOM   3380 C CG  . PRO A 1 433 ? 12.087  73.541 76.115 1.00 42.63  ? 433  PRO A CG  1 
ATOM   3381 C CD  . PRO A 1 433 ? 11.050  74.382 75.425 1.00 42.63  ? 433  PRO A CD  1 
ATOM   3382 N N   . GLU A 1 434 ? 15.524  75.743 75.067 1.00 47.99  ? 434  GLU A N   1 
ATOM   3383 C CA  . GLU A 1 434 ? 16.742  75.596 74.286 1.00 47.99  ? 434  GLU A CA  1 
ATOM   3384 C C   . GLU A 1 434 ? 17.150  74.146 74.104 1.00 47.99  ? 434  GLU A C   1 
ATOM   3385 O O   . GLU A 1 434 ? 17.559  73.759 73.006 1.00 47.99  ? 434  GLU A O   1 
ATOM   3386 C CB  . GLU A 1 434 ? 17.907  76.358 74.932 1.00 81.32  ? 434  GLU A CB  1 
ATOM   3387 C CG  . GLU A 1 434 ? 17.738  77.873 75.001 1.00 81.32  ? 434  GLU A CG  1 
ATOM   3388 C CD  . GLU A 1 434 ? 17.682  78.542 73.623 1.00 81.32  ? 434  GLU A CD  1 
ATOM   3389 O OE1 . GLU A 1 434 ? 18.715  78.559 72.901 1.00 81.32  ? 434  GLU A OE1 1 
ATOM   3390 O OE2 . GLU A 1 434 ? 16.592  79.058 73.265 1.00 81.32  ? 434  GLU A OE2 1 
ATOM   3391 N N   . TRP A 1 435 ? 17.036  73.337 75.158 1.00 42.73  ? 435  TRP A N   1 
ATOM   3392 C CA  . TRP A 1 435 ? 17.450  71.940 75.055 1.00 42.73  ? 435  TRP A CA  1 
ATOM   3393 C C   . TRP A 1 435 ? 16.795  71.184 73.898 1.00 42.73  ? 435  TRP A C   1 
ATOM   3394 O O   . TRP A 1 435 ? 17.266  70.116 73.492 1.00 42.73  ? 435  TRP A O   1 
ATOM   3395 C CB  . TRP A 1 435 ? 17.227  71.189 76.379 1.00 38.67  ? 435  TRP A CB  1 
ATOM   3396 C CG  . TRP A 1 435 ? 15.804  70.981 76.772 1.00 38.67  ? 435  TRP A CG  1 
ATOM   3397 C CD1 . TRP A 1 435 ? 15.072  71.748 77.626 1.00 38.67  ? 435  TRP A CD1 1 
ATOM   3398 C CD2 . TRP A 1 435 ? 14.940  69.922 76.343 1.00 38.67  ? 435  TRP A CD2 1 
ATOM   3399 N NE1 . TRP A 1 435 ? 13.802  71.233 77.761 1.00 38.67  ? 435  TRP A NE1 1 
ATOM   3400 C CE2 . TRP A 1 435 ? 13.694  70.112 76.983 1.00 38.67  ? 435  TRP A CE2 1 
ATOM   3401 C CE3 . TRP A 1 435 ? 15.096  68.831 75.477 1.00 38.67  ? 435  TRP A CE3 1 
ATOM   3402 C CZ2 . TRP A 1 435 ? 12.613  69.257 76.786 1.00 38.67  ? 435  TRP A CZ2 1 
ATOM   3403 C CZ3 . TRP A 1 435 ? 14.022  67.981 75.279 1.00 38.67  ? 435  TRP A CZ3 1 
ATOM   3404 C CH2 . TRP A 1 435 ? 12.794  68.200 75.932 1.00 38.67  ? 435  TRP A CH2 1 
ATOM   3405 N N   . MET A 1 436 ? 15.719  71.732 73.352 1.00 41.02  ? 436  MET A N   1 
ATOM   3406 C CA  . MET A 1 436 ? 15.069  71.058 72.247 1.00 41.02  ? 436  MET A CA  1 
ATOM   3407 C C   . MET A 1 436 ? 15.819  71.309 70.946 1.00 41.02  ? 436  MET A C   1 
ATOM   3408 O O   . MET A 1 436 ? 15.801  70.469 70.062 1.00 41.02  ? 436  MET A O   1 
ATOM   3409 C CB  . MET A 1 436 ? 13.605  71.489 72.153 1.00 44.95  ? 436  MET A CB  1 
ATOM   3410 C CG  . MET A 1 436 ? 12.798  71.042 73.364 1.00 44.95  ? 436  MET A CG  1 
ATOM   3411 S SD  . MET A 1 436 ? 11.043  71.436 73.296 1.00 44.95  ? 436  MET A SD  1 
ATOM   3412 C CE  . MET A 1 436 ? 10.427  70.077 72.336 1.00 44.95  ? 436  MET A CE  1 
ATOM   3413 N N   . GLY A 1 437 ? 16.486  72.456 70.835 1.00 39.80  ? 437  GLY A N   1 
ATOM   3414 C CA  . GLY A 1 437 ? 17.268  72.772 69.640 1.00 39.80  ? 437  GLY A CA  1 
ATOM   3415 C C   . GLY A 1 437 ? 16.537  73.073 68.342 1.00 39.80  ? 437  GLY A C   1 
ATOM   3416 O O   . GLY A 1 437 ? 15.560  73.816 68.336 1.00 39.80  ? 437  GLY A O   1 
ATOM   3417 N N   . VAL A 1 438 ? 17.030  72.524 67.234 1.00 32.87  ? 438  VAL A N   1 
ATOM   3418 C CA  . VAL A 1 438 ? 16.396  72.720 65.928 1.00 32.87  ? 438  VAL A CA  1 
ATOM   3419 C C   . VAL A 1 438 ? 15.273  71.689 65.841 1.00 32.87  ? 438  VAL A C   1 
ATOM   3420 O O   . VAL A 1 438 ? 15.457  70.580 65.336 1.00 32.87  ? 438  VAL A O   1 
ATOM   3421 C CB  . VAL A 1 438 ? 17.385  72.483 64.780 1.00 29.77  ? 438  VAL A CB  1 
ATOM   3422 C CG1 . VAL A 1 438 ? 16.783  72.954 63.469 1.00 29.77  ? 438  VAL A CG1 1 
ATOM   3423 C CG2 . VAL A 1 438 ? 18.676  73.202 65.060 1.00 29.77  ? 438  VAL A CG2 1 
ATOM   3424 N N   . ILE A 1 439 ? 14.110  72.085 66.350 1.00 45.08  ? 439  ILE A N   1 
ATOM   3425 C CA  . ILE A 1 439 ? 12.915  71.248 66.437 1.00 45.08  ? 439  ILE A CA  1 
ATOM   3426 C C   . ILE A 1 439 ? 12.239  70.751 65.163 1.00 45.08  ? 439  ILE A C   1 
ATOM   3427 O O   . ILE A 1 439 ? 12.217  71.423 64.135 1.00 45.08  ? 439  ILE A O   1 
ATOM   3428 C CB  . ILE A 1 439 ? 11.840  71.965 67.269 1.00 45.79  ? 439  ILE A CB  1 
ATOM   3429 C CG1 . ILE A 1 439 ? 12.436  72.391 68.604 1.00 45.79  ? 439  ILE A CG1 1 
ATOM   3430 C CG2 . ILE A 1 439 ? 10.630  71.059 67.473 1.00 45.79  ? 439  ILE A CG2 1 
ATOM   3431 C CD1 . ILE A 1 439 ? 11.431  73.027 69.527 1.00 45.79  ? 439  ILE A CD1 1 
ATOM   3432 N N   . HIS A 1 440 ? 11.659  69.561 65.283 1.00 46.22  ? 440  HIS A N   1 
ATOM   3433 C CA  . HIS A 1 440 ? 10.925  68.887 64.224 1.00 46.22  ? 440  HIS A CA  1 
ATOM   3434 C C   . HIS A 1 440 ? 9.878   69.831 63.640 1.00 46.22  ? 440  HIS A C   1 
ATOM   3435 O O   . HIS A 1 440 ? 9.111   70.435 64.377 1.00 46.22  ? 440  HIS A O   1 
ATOM   3436 C CB  . HIS A 1 440 ? 10.244  67.666 64.832 1.00 54.02  ? 440  HIS A CB  1 
ATOM   3437 C CG  . HIS A 1 440 ? 9.528   66.801 63.847 1.00 54.02  ? 440  HIS A CG  1 
ATOM   3438 N ND1 . HIS A 1 440 ? 10.169  66.187 62.789 1.00 54.02  ? 440  HIS A ND1 1 
ATOM   3439 C CD2 . HIS A 1 440 ? 8.240   66.378 63.805 1.00 54.02  ? 440  HIS A CD2 1 
ATOM   3440 C CE1 . HIS A 1 440 ? 9.307   65.419 62.142 1.00 54.02  ? 440  HIS A CE1 1 
ATOM   3441 N NE2 . HIS A 1 440 ? 8.131   65.516 62.740 1.00 54.02  ? 440  HIS A NE2 1 
ATOM   3442 N N   . GLY A 1 441 ? 9.861   69.976 62.319 1.00 48.46  ? 441  GLY A N   1 
ATOM   3443 C CA  . GLY A 1 441 ? 8.872   70.837 61.686 1.00 48.46  ? 441  GLY A CA  1 
ATOM   3444 C C   . GLY A 1 441 ? 9.062   72.353 61.688 1.00 48.46  ? 441  GLY A C   1 
ATOM   3445 O O   . GLY A 1 441 ? 8.262   73.082 61.097 1.00 48.46  ? 441  GLY A O   1 
ATOM   3446 N N   . TYR A 1 442 ? 10.109  72.854 62.327 1.00 53.04  ? 442  TYR A N   1 
ATOM   3447 C CA  . TYR A 1 442 ? 10.302  74.291 62.342 1.00 53.04  ? 442  TYR A CA  1 
ATOM   3448 C C   . TYR A 1 442 ? 11.114  74.864 61.188 1.00 53.04  ? 442  TYR A C   1 
ATOM   3449 O O   . TYR A 1 442 ? 11.486  76.042 61.205 1.00 53.04  ? 442  TYR A O   1 
ATOM   3450 C CB  . TYR A 1 442 ? 10.871  74.722 63.692 1.00 45.52  ? 442  TYR A CB  1 
ATOM   3451 C CG  . TYR A 1 442 ? 9.778   74.781 64.719 1.00 45.52  ? 442  TYR A CG  1 
ATOM   3452 C CD1 . TYR A 1 442 ? 9.234   73.621 65.248 1.00 45.52  ? 442  TYR A CD1 1 
ATOM   3453 C CD2 . TYR A 1 442 ? 9.220   75.996 65.091 1.00 45.52  ? 442  TYR A CD2 1 
ATOM   3454 C CE1 . TYR A 1 442 ? 8.152   73.669 66.123 1.00 45.52  ? 442  TYR A CE1 1 
ATOM   3455 C CE2 . TYR A 1 442 ? 8.143   76.057 65.958 1.00 45.52  ? 442  TYR A CE2 1 
ATOM   3456 C CZ  . TYR A 1 442 ? 7.614   74.894 66.471 1.00 45.52  ? 442  TYR A CZ  1 
ATOM   3457 O OH  . TYR A 1 442 ? 6.552   74.957 67.342 1.00 45.52  ? 442  TYR A OH  1 
ATOM   3458 N N   . GLU A 1 443 ? 11.389  74.034 60.187 1.00 45.92  ? 443  GLU A N   1 
ATOM   3459 C CA  . GLU A 1 443 ? 12.106  74.506 59.008 1.00 45.92  ? 443  GLU A CA  1 
ATOM   3460 C C   . GLU A 1 443 ? 11.024  74.959 58.047 1.00 45.92  ? 443  GLU A C   1 
ATOM   3461 O O   . GLU A 1 443 ? 11.285  75.706 57.114 1.00 45.92  ? 443  GLU A O   1 
ATOM   3462 C CB  . GLU A 1 443 ? 12.932  73.393 58.339 1.00 65.77  ? 443  GLU A CB  1 
ATOM   3463 C CG  . GLU A 1 443 ? 12.134  72.336 57.530 1.00 65.77  ? 443  GLU A CG  1 
ATOM   3464 C CD  . GLU A 1 443 ? 11.172  71.488 58.389 1.00 65.77  ? 443  GLU A CD  1 
ATOM   3465 O OE1 . GLU A 1 443 ? 11.509  71.179 59.558 1.00 65.77  ? 443  GLU A OE1 1 
ATOM   3466 O OE2 . GLU A 1 443 ? 10.084  71.116 57.892 1.00 65.77  ? 443  GLU A OE2 1 
ATOM   3467 N N   . ILE A 1 444 ? 9.804   74.490 58.297 1.00 38.72  ? 444  ILE A N   1 
ATOM   3468 C CA  . ILE A 1 444 ? 8.653   74.811 57.472 1.00 38.72  ? 444  ILE A CA  1 
ATOM   3469 C C   . ILE A 1 444 ? 8.449   76.310 57.331 1.00 38.72  ? 444  ILE A C   1 
ATOM   3470 O O   . ILE A 1 444 ? 8.232   76.801 56.228 1.00 38.72  ? 444  ILE A O   1 
ATOM   3471 C CB  . ILE A 1 444 ? 7.361   74.207 58.056 1.00 45.85  ? 444  ILE A CB  1 
ATOM   3472 C CG1 . ILE A 1 444 ? 7.450   72.682 58.086 1.00 45.85  ? 444  ILE A CG1 1 
ATOM   3473 C CG2 . ILE A 1 444 ? 6.176   74.625 57.219 1.00 45.85  ? 444  ILE A CG2 1 
ATOM   3474 C CD1 . ILE A 1 444 ? 6.234   72.006 58.710 1.00 45.85  ? 444  ILE A CD1 1 
ATOM   3475 N N   . GLU A 1 445 ? 8.518   77.041 58.441 1.00 49.58  ? 445  GLU A N   1 
ATOM   3476 C CA  . GLU A 1 445 ? 8.319   78.487 58.398 1.00 49.58  ? 445  GLU A CA  1 
ATOM   3477 C C   . GLU A 1 445 ? 9.243   79.205 57.417 1.00 49.58  ? 445  GLU A C   1 
ATOM   3478 O O   . GLU A 1 445 ? 8.884   80.251 56.877 1.00 49.58  ? 445  GLU A O   1 
ATOM   3479 C CB  . GLU A 1 445 ? 8.459   79.086 59.799 1.00 77.34  ? 445  GLU A CB  1 
ATOM   3480 C CG  . GLU A 1 445 ? 9.662   78.609 60.599 1.00 77.34  ? 445  GLU A CG  1 
ATOM   3481 C CD  . GLU A 1 445 ? 9.438   78.760 62.118 1.00 77.34  ? 445  GLU A CD  1 
ATOM   3482 O OE1 . GLU A 1 445 ? 8.620   77.991 62.681 1.00 77.34  ? 445  GLU A OE1 1 
ATOM   3483 O OE2 . GLU A 1 445 ? 10.062  79.650 62.750 1.00 77.34  ? 445  GLU A OE2 1 
ATOM   3484 N N   . PHE A 1 446 ? 10.427  78.648 57.178 1.00 44.29  ? 446  PHE A N   1 
ATOM   3485 C CA  . PHE A 1 446 ? 11.352  79.260 56.240 1.00 44.29  ? 446  PHE A CA  1 
ATOM   3486 C C   . PHE A 1 446 ? 10.934  78.919 54.815 1.00 44.29  ? 446  PHE A C   1 
ATOM   3487 O O   . PHE A 1 446 ? 11.095  79.727 53.899 1.00 44.29  ? 446  PHE A O   1 
ATOM   3488 C CB  . PHE A 1 446 ? 12.781  78.794 56.508 1.00 32.72  ? 446  PHE A CB  1 
ATOM   3489 C CG  . PHE A 1 446 ? 13.345  79.294 57.816 1.00 32.72  ? 446  PHE A CG  1 
ATOM   3490 C CD1 . PHE A 1 446 ? 13.005  78.682 59.021 1.00 32.72  ? 446  PHE A CD1 1 
ATOM   3491 C CD2 . PHE A 1 446 ? 14.200  80.392 57.846 1.00 32.72  ? 446  PHE A CD2 1 
ATOM   3492 C CE1 . PHE A 1 446 ? 13.508  79.156 60.224 1.00 32.72  ? 446  PHE A CE1 1 
ATOM   3493 C CE2 . PHE A 1 446 ? 14.705  80.869 59.046 1.00 32.72  ? 446  PHE A CE2 1 
ATOM   3494 C CZ  . PHE A 1 446 ? 14.359  80.251 60.236 1.00 32.72  ? 446  PHE A CZ  1 
ATOM   3495 N N   . VAL A 1 447 ? 10.370  77.730 54.635 1.00 34.64  ? 447  VAL A N   1 
ATOM   3496 C CA  . VAL A 1 447 ? 9.918   77.295 53.324 1.00 34.64  ? 447  VAL A CA  1 
ATOM   3497 C C   . VAL A 1 447 ? 8.739   78.133 52.847 1.00 34.64  ? 447  VAL A C   1 
ATOM   3498 O O   . VAL A 1 447 ? 8.644   78.447 51.664 1.00 34.64  ? 447  VAL A O   1 
ATOM   3499 C CB  . VAL A 1 447 ? 9.520   75.806 53.348 1.00 31.10  ? 447  VAL A CB  1 
ATOM   3500 C CG1 . VAL A 1 447 ? 8.723   75.449 52.096 1.00 31.10  ? 447  VAL A CG1 1 
ATOM   3501 C CG2 . VAL A 1 447 ? 10.773  74.944 53.450 1.00 31.10  ? 447  VAL A CG2 1 
ATOM   3502 N N   . PHE A 1 448 ? 7.843   78.494 53.765 1.00 44.59  ? 448  PHE A N   1 
ATOM   3503 C CA  . PHE A 1 448 ? 6.683   79.309 53.413 1.00 44.59  ? 448  PHE A CA  1 
ATOM   3504 C C   . PHE A 1 448 ? 6.937   80.806 53.559 1.00 44.59  ? 448  PHE A C   1 
ATOM   3505 O O   . PHE A 1 448 ? 6.045   81.629 53.339 1.00 44.59  ? 448  PHE A O   1 
ATOM   3506 C CB  . PHE A 1 448 ? 5.465   78.895 54.225 1.00 37.65  ? 448  PHE A CB  1 
ATOM   3507 C CG  . PHE A 1 448 ? 4.863   77.607 53.771 1.00 37.65  ? 448  PHE A CG  1 
ATOM   3508 C CD1 . PHE A 1 448 ? 5.475   76.399 54.064 1.00 37.65  ? 448  PHE A CD1 1 
ATOM   3509 C CD2 . PHE A 1 448 ? 3.692   77.600 53.016 1.00 37.65  ? 448  PHE A CD2 1 
ATOM   3510 C CE1 . PHE A 1 448 ? 4.927   75.200 53.609 1.00 37.65  ? 448  PHE A CE1 1 
ATOM   3511 C CE2 . PHE A 1 448 ? 3.135   76.404 52.556 1.00 37.65  ? 448  PHE A CE2 1 
ATOM   3512 C CZ  . PHE A 1 448 ? 3.751   75.205 52.851 1.00 37.65  ? 448  PHE A CZ  1 
ATOM   3513 N N   . GLY A 1 449 ? 8.166   81.144 53.934 1.00 45.90  ? 449  GLY A N   1 
ATOM   3514 C CA  . GLY A 1 449 ? 8.570   82.530 54.054 1.00 45.90  ? 449  GLY A CA  1 
ATOM   3515 C C   . GLY A 1 449 ? 8.005   83.411 55.143 1.00 45.90  ? 449  GLY A C   1 
ATOM   3516 O O   . GLY A 1 449 ? 7.892   84.610 54.934 1.00 45.90  ? 449  GLY A O   1 
ATOM   3517 N N   . LEU A 1 450 ? 7.655   82.853 56.298 1.00 48.84  ? 450  LEU A N   1 
ATOM   3518 C CA  . LEU A 1 450 ? 7.134   83.681 57.383 1.00 48.84  ? 450  LEU A CA  1 
ATOM   3519 C C   . LEU A 1 450 ? 8.173   84.722 57.840 1.00 48.84  ? 450  LEU A C   1 
ATOM   3520 O O   . LEU A 1 450 ? 7.809   85.752 58.398 1.00 48.84  ? 450  LEU A O   1 
ATOM   3521 C CB  . LEU A 1 450 ? 6.704   82.818 58.586 1.00 46.55  ? 450  LEU A CB  1 
ATOM   3522 C CG  . LEU A 1 450 ? 5.419   81.977 58.516 1.00 46.55  ? 450  LEU A CG  1 
ATOM   3523 C CD1 . LEU A 1 450 ? 4.210   82.877 58.417 1.00 46.55  ? 450  LEU A CD1 1 
ATOM   3524 C CD2 . LEU A 1 450 ? 5.465   81.047 57.321 1.00 46.55  ? 450  LEU A CD2 1 
ATOM   3525 N N   . PRO A 1 451 ? 9.478   84.464 57.622 1.00 48.16  ? 451  PRO A N   1 
ATOM   3526 C CA  . PRO A 1 451 ? 10.471  85.454 58.051 1.00 48.16  ? 451  PRO A CA  1 
ATOM   3527 C C   . PRO A 1 451 ? 10.372  86.804 57.330 1.00 48.16  ? 451  PRO A C   1 
ATOM   3528 O O   . PRO A 1 451 ? 10.840  87.817 57.849 1.00 48.16  ? 451  PRO A O   1 
ATOM   3529 C CB  . PRO A 1 451 ? 11.796  84.754 57.767 1.00 40.48  ? 451  PRO A CB  1 
ATOM   3530 C CG  . PRO A 1 451 ? 11.466  83.336 58.009 1.00 40.48  ? 451  PRO A CG  1 
ATOM   3531 C CD  . PRO A 1 451 ? 10.145  83.193 57.296 1.00 40.48  ? 451  PRO A CD  1 
ATOM   3532 N N   . LEU A 1 452 ? 9.772   86.817 56.143 1.00 50.01  ? 452  LEU A N   1 
ATOM   3533 C CA  . LEU A 1 452 ? 9.633   88.051 55.378 1.00 50.01  ? 452  LEU A CA  1 
ATOM   3534 C C   . LEU A 1 452 ? 8.643   89.022 55.999 1.00 50.01  ? 452  LEU A C   1 
ATOM   3535 O O   . LEU A 1 452 ? 8.688   90.218 55.717 1.00 50.01  ? 452  LEU A O   1 
ATOM   3536 C CB  . LEU A 1 452 ? 9.190   87.765 53.948 1.00 44.74  ? 452  LEU A CB  1 
ATOM   3537 C CG  . LEU A 1 452 ? 9.952   86.687 53.190 1.00 44.74  ? 452  LEU A CG  1 
ATOM   3538 C CD1 . LEU A 1 452 ? 9.629   86.817 51.712 1.00 44.74  ? 452  LEU A CD1 1 
ATOM   3539 C CD2 . LEU A 1 452 ? 11.445  86.841 53.417 1.00 44.74  ? 452  LEU A CD2 1 
ATOM   3540 N N   . VAL A 1 453 ? 7.732   88.530 56.826 1.00 46.26  ? 453  VAL A N   1 
ATOM   3541 C CA  . VAL A 1 453 ? 6.785   89.441 57.443 1.00 46.26  ? 453  VAL A CA  1 
ATOM   3542 C C   . VAL A 1 453 ? 7.319   89.959 58.794 1.00 46.26  ? 453  VAL A C   1 
ATOM   3543 O O   . VAL A 1 453 ? 7.285   89.268 59.825 1.00 46.26  ? 453  VAL A O   1 
ATOM   3544 C CB  . VAL A 1 453 ? 5.386   88.782 57.576 1.00 54.45  ? 453  VAL A CB  1 
ATOM   3545 C CG1 . VAL A 1 453 ? 5.520   87.361 58.044 1.00 54.45  ? 453  VAL A CG1 1 
ATOM   3546 C CG2 . VAL A 1 453 ? 4.517   89.577 58.534 1.00 54.45  ? 453  VAL A CG2 1 
ATOM   3547 N N   . LYS A 1 454 ? 7.825   91.193 58.750 1.00 54.14  ? 454  LYS A N   1 
ATOM   3548 C CA  . LYS A 1 454 ? 8.414   91.898 59.896 1.00 54.14  ? 454  LYS A CA  1 
ATOM   3549 C C   . LYS A 1 454 ? 7.790   91.597 61.269 1.00 54.14  ? 454  LYS A C   1 
ATOM   3550 O O   . LYS A 1 454 ? 8.451   91.116 62.200 1.00 54.14  ? 454  LYS A O   1 
ATOM   3551 C CB  . LYS A 1 454 ? 8.340   93.409 59.639 1.00 86.02  ? 454  LYS A CB  1 
ATOM   3552 C CG  . LYS A 1 454 ? 8.637   93.830 58.190 1.00 86.02  ? 454  LYS A CG  1 
ATOM   3553 C CD  . LYS A 1 454 ? 10.103  93.607 57.786 1.00 86.02  ? 454  LYS A CD  1 
ATOM   3554 C CE  . LYS A 1 454 ? 10.371  94.103 56.354 1.00 86.02  ? 454  LYS A CE  1 
ATOM   3555 N NZ  . LYS A 1 454 ? 11.805  93.974 55.942 1.00 86.02  ? 454  LYS A NZ  1 
ATOM   3556 N N   . GLU A 1 455 ? 6.510   91.910 61.377 1.00 51.48  ? 455  GLU A N   1 
ATOM   3557 C CA  . GLU A 1 455 ? 5.741   91.720 62.594 1.00 51.48  ? 455  GLU A CA  1 
ATOM   3558 C C   . GLU A 1 455 ? 5.947   90.377 63.288 1.00 51.48  ? 455  GLU A C   1 
ATOM   3559 O O   . GLU A 1 455 ? 5.649   90.250 64.474 1.00 51.48  ? 455  GLU A O   1 
ATOM   3560 C CB  . GLU A 1 455 ? 4.250   91.936 62.295 1.00 88.89  ? 455  GLU A CB  1 
ATOM   3561 C CG  . GLU A 1 455 ? 3.908   92.058 60.788 1.00 88.89  ? 455  GLU A CG  1 
ATOM   3562 C CD  . GLU A 1 455 ? 4.762   93.106 60.034 1.00 88.89  ? 455  GLU A CD  1 
ATOM   3563 O OE1 . GLU A 1 455 ? 4.777   94.291 60.446 1.00 88.89  ? 455  GLU A OE1 1 
ATOM   3564 O OE2 . GLU A 1 455 ? 5.419   92.741 59.028 1.00 88.89  ? 455  GLU A OE2 1 
ATOM   3565 N N   . LEU A 1 456 ? 6.452   89.374 62.573 1.00 64.66  ? 456  LEU A N   1 
ATOM   3566 C CA  . LEU A 1 456 ? 6.676   88.079 63.208 1.00 64.66  ? 456  LEU A CA  1 
ATOM   3567 C C   . LEU A 1 456 ? 7.984   88.034 64.003 1.00 64.66  ? 456  LEU A C   1 
ATOM   3568 O O   . LEU A 1 456 ? 8.270   87.061 64.715 1.00 64.66  ? 456  LEU A O   1 
ATOM   3569 C CB  . LEU A 1 456 ? 6.629   86.963 62.174 1.00 57.21  ? 456  LEU A CB  1 
ATOM   3570 C CG  . LEU A 1 456 ? 5.199   86.761 61.672 1.00 57.21  ? 456  LEU A CG  1 
ATOM   3571 C CD1 . LEU A 1 456 ? 5.162   85.596 60.684 1.00 57.21  ? 456  LEU A CD1 1 
ATOM   3572 C CD2 . LEU A 1 456 ? 4.276   86.501 62.859 1.00 57.21  ? 456  LEU A CD2 1 
ATOM   3573 N N   . ASN A 1 457 ? 8.777   89.092 63.874 1.00 65.51  ? 457  ASN A N   1 
ATOM   3574 C CA  . ASN A 1 457 ? 10.020  89.210 64.625 1.00 65.51  ? 457  ASN A CA  1 
ATOM   3575 C C   . ASN A 1 457 ? 11.155  88.248 64.288 1.00 65.51  ? 457  ASN A C   1 
ATOM   3576 O O   . ASN A 1 457 ? 11.639  87.531 65.165 1.00 65.51  ? 457  ASN A O   1 
ATOM   3577 C CB  . ASN A 1 457 ? 9.734   89.109 66.140 1.00 65.71  ? 457  ASN A CB  1 
ATOM   3578 C CG  . ASN A 1 457 ? 8.711   90.136 66.622 1.00 65.71  ? 457  ASN A CG  1 
ATOM   3579 O OD1 . ASN A 1 457 ? 8.593   91.229 66.058 1.00 65.71  ? 457  ASN A OD1 1 
ATOM   3580 N ND2 . ASN A 1 457 ? 7.981   89.794 67.686 1.00 65.71  ? 457  ASN A ND2 1 
ATOM   3581 N N   . TYR A 1 458 ? 11.585  88.221 63.035 1.00 50.66  ? 458  TYR A N   1 
ATOM   3582 C CA  . TYR A 1 458 ? 12.713  87.371 62.678 1.00 50.66  ? 458  TYR A CA  1 
ATOM   3583 C C   . TYR A 1 458 ? 13.906  88.287 62.415 1.00 50.66  ? 458  TYR A C   1 
ATOM   3584 O O   . TYR A 1 458 ? 13.735  89.471 62.124 1.00 50.66  ? 458  TYR A O   1 
ATOM   3585 C CB  . TYR A 1 458 ? 12.425  86.540 61.425 1.00 42.85  ? 458  TYR A CB  1 
ATOM   3586 C CG  . TYR A 1 458 ? 11.518  85.348 61.643 1.00 42.85  ? 458  TYR A CG  1 
ATOM   3587 C CD1 . TYR A 1 458 ? 12.047  84.105 61.993 1.00 42.85  ? 458  TYR A CD1 1 
ATOM   3588 C CD2 . TYR A 1 458 ? 10.131  85.456 61.478 1.00 42.85  ? 458  TYR A CD2 1 
ATOM   3589 C CE1 . TYR A 1 458 ? 11.220  83.000 62.172 1.00 42.85  ? 458  TYR A CE1 1 
ATOM   3590 C CE2 . TYR A 1 458 ? 9.293   84.357 61.650 1.00 42.85  ? 458  TYR A CE2 1 
ATOM   3591 C CZ  . TYR A 1 458 ? 9.843   83.131 61.997 1.00 42.85  ? 458  TYR A CZ  1 
ATOM   3592 O OH  . TYR A 1 458 ? 9.024   82.033 62.155 1.00 42.85  ? 458  TYR A OH  1 
ATOM   3593 N N   . THR A 1 459 ? 15.116  87.752 62.517 1.00 40.21  ? 459  THR A N   1 
ATOM   3594 C CA  . THR A 1 459 ? 16.296  88.564 62.277 1.00 40.21  ? 459  THR A CA  1 
ATOM   3595 C C   . THR A 1 459 ? 16.509  88.758 60.780 1.00 40.21  ? 459  THR A C   1 
ATOM   3596 O O   . THR A 1 459 ? 15.958  88.023 59.956 1.00 40.21  ? 459  THR A O   1 
ATOM   3597 C CB  . THR A 1 459 ? 17.544  87.920 62.895 1.00 33.45  ? 459  THR A CB  1 
ATOM   3598 O OG1 . THR A 1 459 ? 17.909  86.751 62.151 1.00 33.45  ? 459  THR A OG1 1 
ATOM   3599 C CG2 . THR A 1 459 ? 17.261  87.532 64.337 1.00 33.45  ? 459  THR A CG2 1 
ATOM   3600 N N   . ALA A 1 460 ? 17.313  89.758 60.435 1.00 58.92  ? 460  ALA A N   1 
ATOM   3601 C CA  . ALA A 1 460 ? 17.596  90.064 59.041 1.00 58.92  ? 460  ALA A CA  1 
ATOM   3602 C C   . ALA A 1 460 ? 18.236  88.879 58.337 1.00 58.92  ? 460  ALA A C   1 
ATOM   3603 O O   . ALA A 1 460 ? 17.966  88.639 57.160 1.00 58.92  ? 460  ALA A O   1 
ATOM   3604 C CB  . ALA A 1 460 ? 18.506  91.276 58.949 1.00 53.29  ? 460  ALA A CB  1 
ATOM   3605 N N   . GLU A 1 461 ? 19.093  88.140 59.038 1.00 52.89  ? 461  GLU A N   1 
ATOM   3606 C CA  . GLU A 1 461 ? 19.734  86.987 58.415 1.00 52.89  ? 461  GLU A CA  1 
ATOM   3607 C C   . GLU A 1 461 ? 18.752  85.836 58.269 1.00 52.89  ? 461  GLU A C   1 
ATOM   3608 O O   . GLU A 1 461 ? 18.892  85.012 57.363 1.00 52.89  ? 461  GLU A O   1 
ATOM   3609 C CB  . GLU A 1 461 ? 20.968  86.533 59.201 1.00 83.83  ? 461  GLU A CB  1 
ATOM   3610 C CG  . GLU A 1 461 ? 20.925  86.863 60.674 1.00 83.83  ? 461  GLU A CG  1 
ATOM   3611 C CD  . GLU A 1 461 ? 21.187  88.340 60.941 1.00 83.83  ? 461  GLU A CD  1 
ATOM   3612 O OE1 . GLU A 1 461 ? 22.298  88.809 60.585 1.00 83.83  ? 461  GLU A OE1 1 
ATOM   3613 O OE2 . GLU A 1 461 ? 20.286  89.027 61.499 1.00 83.83  ? 461  GLU A OE2 1 
ATOM   3614 N N   . GLU A 1 462 ? 17.755  85.779 59.150 1.00 55.37  ? 462  GLU A N   1 
ATOM   3615 C CA  . GLU A 1 462 ? 16.755  84.730 59.054 1.00 55.37  ? 462  GLU A CA  1 
ATOM   3616 C C   . GLU A 1 462 ? 15.882  84.981 57.825 1.00 55.37  ? 462  GLU A C   1 
ATOM   3617 O O   . GLU A 1 462 ? 15.464  84.035 57.163 1.00 55.37  ? 462  GLU A O   1 
ATOM   3618 C CB  . GLU A 1 462 ? 15.905  84.665 60.321 1.00 54.80  ? 462  GLU A CB  1 
ATOM   3619 C CG  . GLU A 1 462 ? 16.701  84.181 61.512 1.00 54.80  ? 462  GLU A CG  1 
ATOM   3620 C CD  . GLU A 1 462 ? 15.875  84.034 62.780 1.00 54.80  ? 462  GLU A CD  1 
ATOM   3621 O OE1 . GLU A 1 462 ? 15.183  85.004 63.178 1.00 54.80  ? 462  GLU A OE1 1 
ATOM   3622 O OE2 . GLU A 1 462 ? 15.934  82.941 63.389 1.00 54.80  ? 462  GLU A OE2 1 
ATOM   3623 N N   . GLU A 1 463 ? 15.612  86.245 57.504 1.00 45.93  ? 463  GLU A N   1 
ATOM   3624 C CA  . GLU A 1 463 ? 14.807  86.543 56.318 1.00 45.93  ? 463  GLU A CA  1 
ATOM   3625 C C   . GLU A 1 463 ? 15.622  86.210 55.078 1.00 45.93  ? 463  GLU A C   1 
ATOM   3626 O O   . GLU A 1 463 ? 15.080  85.816 54.046 1.00 45.93  ? 463  GLU A O   1 
ATOM   3627 C CB  . GLU A 1 463 ? 14.408  88.020 56.268 1.00 69.79  ? 463  GLU A CB  1 
ATOM   3628 C CG  . GLU A 1 463 ? 14.435  88.597 54.849 1.00 69.79  ? 463  GLU A CG  1 
ATOM   3629 C CD  . GLU A 1 463 ? 13.660  89.908 54.704 1.00 69.79  ? 463  GLU A CD  1 
ATOM   3630 O OE1 . GLU A 1 463 ? 13.825  90.809 55.571 1.00 69.79  ? 463  GLU A OE1 1 
ATOM   3631 O OE2 . GLU A 1 463 ? 12.896  90.038 53.705 1.00 69.79  ? 463  GLU A OE2 1 
ATOM   3632 N N   . ALA A 1 464 ? 16.933  86.384 55.192 1.00 47.91  ? 464  ALA A N   1 
ATOM   3633 C CA  . ALA A 1 464 ? 17.838  86.107 54.088 1.00 47.91  ? 464  ALA A CA  1 
ATOM   3634 C C   . ALA A 1 464 ? 17.867  84.611 53.827 1.00 47.91  ? 464  ALA A C   1 
ATOM   3635 O O   . ALA A 1 464 ? 17.932  84.173 52.682 1.00 47.91  ? 464  ALA A O   1 
ATOM   3636 C CB  . ALA A 1 464 ? 19.233  86.612 54.421 1.00 42.56  ? 464  ALA A CB  1 
ATOM   3637 N N   . LEU A 1 465 ? 17.821  83.835 54.904 1.00 43.64  ? 465  LEU A N   1 
ATOM   3638 C CA  . LEU A 1 465 ? 17.832  82.381 54.807 1.00 43.64  ? 465  LEU A CA  1 
ATOM   3639 C C   . LEU A 1 465 ? 16.519  81.890 54.207 1.00 43.64  ? 465  LEU A C   1 
ATOM   3640 O O   . LEU A 1 465 ? 16.495  80.938 53.427 1.00 43.64  ? 465  LEU A O   1 
ATOM   3641 C CB  . LEU A 1 465 ? 18.019  81.766 56.194 1.00 38.59  ? 465  LEU A CB  1 
ATOM   3642 C CG  . LEU A 1 465 ? 17.960  80.247 56.322 1.00 38.59  ? 465  LEU A CG  1 
ATOM   3643 C CD1 . LEU A 1 465 ? 19.047  79.605 55.504 1.00 38.59  ? 465  LEU A CD1 1 
ATOM   3644 C CD2 . LEU A 1 465 ? 18.124  79.879 57.777 1.00 38.59  ? 465  LEU A CD2 1 
ATOM   3645 N N   . SER A 1 466 ? 15.425  82.548 54.575 1.00 35.33  ? 466  SER A N   1 
ATOM   3646 C CA  . SER A 1 466 ? 14.125  82.168 54.072 1.00 35.33  ? 466  SER A CA  1 
ATOM   3647 C C   . SER A 1 466 ? 14.061  82.357 52.562 1.00 35.33  ? 466  SER A C   1 
ATOM   3648 O O   . SER A 1 466 ? 13.514  81.519 51.851 1.00 35.33  ? 466  SER A O   1 
ATOM   3649 C CB  . SER A 1 466 ? 13.045  82.995 54.755 1.00 47.67  ? 466  SER A CB  1 
ATOM   3650 O OG  . SER A 1 466 ? 11.756  82.496 54.451 1.00 47.67  ? 466  SER A OG  1 
ATOM   3651 N N   . ARG A 1 467 ? 14.619  83.449 52.054 1.00 39.46  ? 467  ARG A N   1 
ATOM   3652 C CA  . ARG A 1 467 ? 14.586  83.667 50.615 1.00 39.46  ? 467  ARG A CA  1 
ATOM   3653 C C   . ARG A 1 467 ? 15.465  82.663 49.878 1.00 39.46  ? 467  ARG A C   1 
ATOM   3654 O O   . ARG A 1 467 ? 15.108  82.206 48.799 1.00 39.46  ? 467  ARG A O   1 
ATOM   3655 C CB  . ARG A 1 467 ? 15.004  85.094 50.278 1.00 41.35  ? 467  ARG A CB  1 
ATOM   3656 C CG  . ARG A 1 467 ? 13.941  86.114 50.609 1.00 41.35  ? 467  ARG A CG  1 
ATOM   3657 C CD  . ARG A 1 467 ? 14.399  87.534 50.326 1.00 41.35  ? 467  ARG A CD  1 
ATOM   3658 N NE  . ARG A 1 467 ? 13.386  88.489 50.764 1.00 41.35  ? 467  ARG A NE  1 
ATOM   3659 C CZ  . ARG A 1 467 ? 12.210  88.667 50.168 1.00 41.35  ? 467  ARG A CZ  1 
ATOM   3660 N NH1 . ARG A 1 467 ? 11.895  87.959 49.086 1.00 41.35  ? 467  ARG A NH1 1 
ATOM   3661 N NH2 . ARG A 1 467 ? 11.333  89.527 50.677 1.00 41.35  ? 467  ARG A NH2 1 
ATOM   3662 N N   . ARG A 1 468 ? 16.609  82.312 50.459 1.00 45.88  ? 468  ARG A N   1 
ATOM   3663 C CA  . ARG A 1 468 ? 17.497  81.336 49.835 1.00 45.88  ? 468  ARG A CA  1 
ATOM   3664 C C   . ARG A 1 468 ? 16.779  80.010 49.657 1.00 45.88  ? 468  ARG A C   1 
ATOM   3665 O O   . ARG A 1 468 ? 16.779  79.434 48.572 1.00 45.88  ? 468  ARG A O   1 
ATOM   3666 C CB  . ARG A 1 468 ? 18.719  81.079 50.695 1.00 44.12  ? 468  ARG A CB  1 
ATOM   3667 C CG  . ARG A 1 468 ? 19.898  81.925 50.406 1.00 44.12  ? 468  ARG A CG  1 
ATOM   3668 C CD  . ARG A 1 468 ? 20.954  81.606 51.418 1.00 44.12  ? 468  ARG A CD  1 
ATOM   3669 N NE  . ARG A 1 468 ? 21.392  80.216 51.327 1.00 44.12  ? 468  ARG A NE  1 
ATOM   3670 C CZ  . ARG A 1 468 ? 21.959  79.561 52.336 1.00 44.12  ? 468  ARG A CZ  1 
ATOM   3671 N NH1 . ARG A 1 468 ? 22.135  80.177 53.498 1.00 44.12  ? 468  ARG A NH1 1 
ATOM   3672 N NH2 . ARG A 1 468 ? 22.379  78.312 52.179 1.00 44.12  ? 468  ARG A NH2 1 
ATOM   3673 N N   . ILE A 1 469 ? 16.185  79.522 50.742 1.00 39.68  ? 469  ILE A N   1 
ATOM   3674 C CA  . ILE A 1 469 ? 15.467  78.259 50.722 1.00 39.68  ? 469  ILE A CA  1 
ATOM   3675 C C   . ILE A 1 469 ? 14.283  78.309 49.765 1.00 39.68  ? 469  ILE A C   1 
ATOM   3676 O O   . ILE A 1 469 ? 14.054  77.369 49.011 1.00 39.68  ? 469  ILE A O   1 
ATOM   3677 C CB  . ILE A 1 469 ? 15.005  77.873 52.152 1.00 28.22  ? 469  ILE A CB  1 
ATOM   3678 C CG1 . ILE A 1 469 ? 16.225  77.424 52.968 1.00 28.22  ? 469  ILE A CG1 1 
ATOM   3679 C CG2 . ILE A 1 469 ? 13.944  76.794 52.094 1.00 28.22  ? 469  ILE A CG2 1 
ATOM   3680 C CD1 . ILE A 1 469 ? 15.944  77.117 54.412 1.00 28.22  ? 469  ILE A CD1 1 
ATOM   3681 N N   . MET A 1 470 ? 13.542  79.412 49.777 1.00 39.19  ? 470  MET A N   1 
ATOM   3682 C CA  . MET A 1 470 ? 12.390  79.563 48.886 1.00 39.19  ? 470  MET A CA  1 
ATOM   3683 C C   . MET A 1 470 ? 12.807  79.537 47.416 1.00 39.19  ? 470  MET A C   1 
ATOM   3684 O O   . MET A 1 470 ? 12.046  79.109 46.547 1.00 39.19  ? 470  MET A O   1 
ATOM   3685 C CB  . MET A 1 470 ? 11.661  80.876 49.169 1.00 44.76  ? 470  MET A CB  1 
ATOM   3686 C CG  . MET A 1 470 ? 10.416  80.734 50.004 1.00 44.76  ? 470  MET A CG  1 
ATOM   3687 S SD  . MET A 1 470 ? 9.685   82.348 50.312 1.00 44.76  ? 470  MET A SD  1 
ATOM   3688 C CE  . MET A 1 470 ? 10.723  82.869 51.652 1.00 44.76  ? 470  MET A CE  1 
ATOM   3689 N N   . HIS A 1 471 ? 14.017  80.008 47.143 1.00 42.78  ? 471  HIS A N   1 
ATOM   3690 C CA  . HIS A 1 471 ? 14.512  80.042 45.782 1.00 42.78  ? 471  HIS A CA  1 
ATOM   3691 C C   . HIS A 1 471 ? 15.023  78.662 45.411 1.00 42.78  ? 471  HIS A C   1 
ATOM   3692 O O   . HIS A 1 471 ? 14.974  78.272 44.247 1.00 42.78  ? 471  HIS A O   1 
ATOM   3693 C CB  . HIS A 1 471 ? 15.632  81.076 45.645 1.00 57.08  ? 471  HIS A CB  1 
ATOM   3694 C CG  . HIS A 1 471 ? 15.986  81.394 44.226 1.00 57.08  ? 471  HIS A CG  1 
ATOM   3695 N ND1 . HIS A 1 471 ? 15.113  82.031 43.366 1.00 57.08  ? 471  HIS A ND1 1 
ATOM   3696 C CD2 . HIS A 1 471 ? 17.113  81.153 43.511 1.00 57.08  ? 471  HIS A CD2 1 
ATOM   3697 C CE1 . HIS A 1 471 ? 15.687  82.168 42.182 1.00 57.08  ? 471  HIS A CE1 1 
ATOM   3698 N NE2 . HIS A 1 471 ? 16.901  81.645 42.245 1.00 57.08  ? 471  HIS A NE2 1 
ATOM   3699 N N   . TYR A 1 472 ? 15.519  77.922 46.399 1.00 38.27  ? 472  TYR A N   1 
ATOM   3700 C CA  . TYR A 1 472 ? 16.021  76.575 46.151 1.00 38.27  ? 472  TYR A CA  1 
ATOM   3701 C C   . TYR A 1 472 ? 14.834  75.676 45.819 1.00 38.27  ? 472  TYR A C   1 
ATOM   3702 O O   . TYR A 1 472 ? 14.799  75.027 44.777 1.00 38.27  ? 472  TYR A O   1 
ATOM   3703 C CB  . TYR A 1 472 ? 16.730  76.009 47.384 1.00 42.46  ? 472  TYR A CB  1 
ATOM   3704 C CG  . TYR A 1 472 ? 18.121  76.532 47.676 1.00 42.46  ? 472  TYR A CG  1 
ATOM   3705 C CD1 . TYR A 1 472 ? 19.045  76.741 46.655 1.00 42.46  ? 472  TYR A CD1 1 
ATOM   3706 C CD2 . TYR A 1 472 ? 18.543  76.723 48.990 1.00 42.46  ? 472  TYR A CD2 1 
ATOM   3707 C CE1 . TYR A 1 472 ? 20.361  77.121 46.935 1.00 42.46  ? 472  TYR A CE1 1 
ATOM   3708 C CE2 . TYR A 1 472 ? 19.855  77.100 49.284 1.00 42.46  ? 472  TYR A CE2 1 
ATOM   3709 C CZ  . TYR A 1 472 ? 20.759  77.295 48.251 1.00 42.46  ? 472  TYR A CZ  1 
ATOM   3710 O OH  . TYR A 1 472 ? 22.056  77.650 48.542 1.00 42.46  ? 472  TYR A OH  1 
ATOM   3711 N N   . TRP A 1 473 ? 13.860  75.641 46.719 1.00 38.33  ? 473  TRP A N   1 
ATOM   3712 C CA  . TRP A 1 473 ? 12.680  74.821 46.517 1.00 38.33  ? 473  TRP A CA  1 
ATOM   3713 C C   . TRP A 1 473 ? 11.985  75.171 45.201 1.00 38.33  ? 473  TRP A C   1 
ATOM   3714 O O   . TRP A 1 473 ? 11.622  74.289 44.426 1.00 38.33  ? 473  TRP A O   1 
ATOM   3715 C CB  . TRP A 1 473 ? 11.695  75.011 47.673 1.00 31.77  ? 473  TRP A CB  1 
ATOM   3716 C CG  . TRP A 1 473 ? 11.859  74.090 48.861 1.00 31.77  ? 473  TRP A CG  1 
ATOM   3717 C CD1 . TRP A 1 473 ? 10.853  73.489 49.556 1.00 31.77  ? 473  TRP A CD1 1 
ATOM   3718 C CD2 . TRP A 1 473 ? 13.073  73.742 49.543 1.00 31.77  ? 473  TRP A CD2 1 
ATOM   3719 N NE1 . TRP A 1 473 ? 11.355  72.794 50.627 1.00 31.77  ? 473  TRP A NE1 1 
ATOM   3720 C CE2 . TRP A 1 473 ? 12.716  72.932 50.645 1.00 31.77  ? 473  TRP A CE2 1 
ATOM   3721 C CE3 . TRP A 1 473 ? 14.425  74.036 49.335 1.00 31.77  ? 473  TRP A CE3 1 
ATOM   3722 C CZ2 . TRP A 1 473 ? 13.660  72.414 51.534 1.00 31.77  ? 473  TRP A CZ2 1 
ATOM   3723 C CZ3 . TRP A 1 473 ? 15.364  73.518 50.225 1.00 31.77  ? 473  TRP A CZ3 1 
ATOM   3724 C CH2 . TRP A 1 473 ? 14.974  72.718 51.308 1.00 31.77  ? 473  TRP A CH2 1 
ATOM   3725 N N   . ALA A 1 474 ? 11.806  76.465 44.953 1.00 36.80  ? 474  ALA A N   1 
ATOM   3726 C CA  . ALA A 1 474 ? 11.131  76.926 43.743 1.00 36.80  ? 474  ALA A CA  1 
ATOM   3727 C C   . ALA A 1 474 ? 11.930  76.671 42.485 1.00 36.80  ? 474  ALA A C   1 
ATOM   3728 O O   . ALA A 1 474 ? 11.375  76.234 41.486 1.00 36.80  ? 474  ALA A O   1 
ATOM   3729 C CB  . ALA A 1 474 ? 10.807  78.404 43.858 1.00 17.16  ? 474  ALA A CB  1 
ATOM   3730 N N   . THR A 1 475 ? 13.231  76.947 42.529 1.00 38.86  ? 475  THR A N   1 
ATOM   3731 C CA  . THR A 1 475 ? 14.086  76.730 41.365 1.00 38.86  ? 475  THR A CA  1 
ATOM   3732 C C   . THR A 1 475 ? 14.163  75.248 41.056 1.00 38.86  ? 475  THR A C   1 
ATOM   3733 O O   . THR A 1 475 ? 14.285  74.850 39.895 1.00 38.86  ? 475  THR A O   1 
ATOM   3734 C CB  . THR A 1 475 ? 15.513  77.230 41.590 1.00 39.32  ? 475  THR A CB  1 
ATOM   3735 O OG1 . THR A 1 475 ? 15.487  78.635 41.856 1.00 39.32  ? 475  THR A OG1 1 
ATOM   3736 C CG2 . THR A 1 475 ? 16.372  76.960 40.352 1.00 39.32  ? 475  THR A CG2 1 
ATOM   3737 N N   . PHE A 1 476 ? 14.105  74.434 42.104 1.00 37.81  ? 476  PHE A N   1 
ATOM   3738 C CA  . PHE A 1 476 ? 14.147  73.000 41.932 1.00 37.81  ? 476  PHE A CA  1 
ATOM   3739 C C   . PHE A 1 476 ? 12.823  72.499 41.368 1.00 37.81  ? 476  PHE A C   1 
ATOM   3740 O O   . PHE A 1 476 ? 12.808  71.656 40.480 1.00 37.81  ? 476  PHE A O   1 
ATOM   3741 C CB  . PHE A 1 476 ? 14.427  72.311 43.261 1.00 34.25  ? 476  PHE A CB  1 
ATOM   3742 C CG  . PHE A 1 476 ? 14.304  70.819 43.199 1.00 34.25  ? 476  PHE A CG  1 
ATOM   3743 C CD1 . PHE A 1 476 ? 15.283  70.054 42.575 1.00 34.25  ? 476  PHE A CD1 1 
ATOM   3744 C CD2 . PHE A 1 476 ? 13.191  70.181 43.740 1.00 34.25  ? 476  PHE A CD2 1 
ATOM   3745 C CE1 . PHE A 1 476 ? 15.155  68.678 42.491 1.00 34.25  ? 476  PHE A CE1 1 
ATOM   3746 C CE2 . PHE A 1 476 ? 13.052  68.807 43.661 1.00 34.25  ? 476  PHE A CE2 1 
ATOM   3747 C CZ  . PHE A 1 476 ? 14.035  68.051 43.036 1.00 34.25  ? 476  PHE A CZ  1 
ATOM   3748 N N   . ALA A 1 477 ? 11.714  73.014 41.881 1.00 34.65  ? 477  ALA A N   1 
ATOM   3749 C CA  . ALA A 1 477 ? 10.410  72.595 41.402 1.00 34.65  ? 477  ALA A CA  1 
ATOM   3750 C C   . ALA A 1 477 ? 10.286  72.854 39.903 1.00 34.65  ? 477  ALA A C   1 
ATOM   3751 O O   . ALA A 1 477 ? 9.659   72.071 39.175 1.00 34.65  ? 477  ALA A O   1 
ATOM   3752 C CB  . ALA A 1 477 ? 9.336   73.336 42.139 1.00 22.56  ? 477  ALA A CB  1 
ATOM   3753 N N   . LYS A 1 478 ? 10.897  73.949 39.446 1.00 46.72  ? 478  LYS A N   1 
ATOM   3754 C CA  . LYS A 1 478 ? 10.849  74.340 38.038 1.00 46.72  ? 478  LYS A CA  1 
ATOM   3755 C C   . LYS A 1 478 ? 11.829  73.619 37.139 1.00 46.72  ? 478  LYS A C   1 
ATOM   3756 O O   . LYS A 1 478 ? 11.470  73.207 36.041 1.00 46.72  ? 478  LYS A O   1 
ATOM   3757 C CB  . LYS A 1 478 ? 11.131  75.840 37.869 1.00 66.80  ? 478  LYS A CB  1 
ATOM   3758 C CG  . LYS A 1 478 ? 10.093  76.770 38.452 1.00 66.80  ? 478  LYS A CG  1 
ATOM   3759 C CD  . LYS A 1 478 ? 10.642  78.196 38.580 1.00 66.80  ? 478  LYS A CD  1 
ATOM   3760 C CE  . LYS A 1 478 ? 9.748   79.064 39.486 1.00 66.80  ? 478  LYS A CE  1 
ATOM   3761 N NZ  . LYS A 1 478 ? 10.478  80.269 39.992 1.00 66.80  ? 478  LYS A NZ  1 
ATOM   3762 N N   . THR A 1 479 ? 13.066  73.474 37.600 1.00 38.48  ? 479  THR A N   1 
ATOM   3763 C CA  . THR A 1 479 ? 14.110  72.876 36.774 1.00 38.48  ? 479  THR A CA  1 
ATOM   3764 C C   . THR A 1 479 ? 14.690  71.506 37.129 1.00 38.48  ? 479  THR A C   1 
ATOM   3765 O O   . THR A 1 479 ? 15.360  70.905 36.297 1.00 38.48  ? 479  THR A O   1 
ATOM   3766 C CB  . THR A 1 479 ? 15.297  73.872 36.639 1.00 46.28  ? 479  THR A CB  1 
ATOM   3767 O OG1 . THR A 1 479 ? 16.060  73.910 37.859 1.00 46.28  ? 479  THR A OG1 1 
ATOM   3768 C CG2 . THR A 1 479 ? 14.765  75.272 36.360 1.00 46.28  ? 479  THR A CG2 1 
ATOM   3769 N N   . GLY A 1 480 ? 14.449  71.011 38.339 1.00 37.12  ? 480  GLY A N   1 
ATOM   3770 C CA  . GLY A 1 480 ? 15.015  69.723 38.722 1.00 37.12  ? 480  GLY A CA  1 
ATOM   3771 C C   . GLY A 1 480 ? 16.406  69.906 39.316 1.00 37.12  ? 480  GLY A C   1 
ATOM   3772 O O   . GLY A 1 480 ? 17.147  68.949 39.539 1.00 37.12  ? 480  GLY A O   1 
ATOM   3773 N N   . ASN A 1 481 ? 16.750  71.166 39.558 1.00 45.28  ? 481  ASN A N   1 
ATOM   3774 C CA  . ASN A 1 481 ? 18.033  71.562 40.128 1.00 45.28  ? 481  ASN A CA  1 
ATOM   3775 C C   . ASN A 1 481 ? 17.764  72.828 40.958 1.00 45.28  ? 481  ASN A C   1 
ATOM   3776 O O   . ASN A 1 481 ? 17.212  73.805 40.446 1.00 45.28  ? 481  ASN A O   1 
ATOM   3777 C CB  . ASN A 1 481 ? 19.010  71.876 39.007 1.00 46.48  ? 481  ASN A CB  1 
ATOM   3778 C CG  . ASN A 1 481 ? 20.384  72.214 39.515 1.00 46.48  ? 481  ASN A CG  1 
ATOM   3779 O OD1 . ASN A 1 481 ? 20.539  72.809 40.584 1.00 46.48  ? 481  ASN A OD1 1 
ATOM   3780 N ND2 . ASN A 1 481 ? 21.399  71.854 38.741 1.00 46.48  ? 481  ASN A ND2 1 
ATOM   3781 N N   . PRO A 1 482 ? 18.146  72.825 42.247 1.00 40.38  ? 482  PRO A N   1 
ATOM   3782 C CA  . PRO A 1 482 ? 17.934  73.972 43.133 1.00 40.38  ? 482  PRO A CA  1 
ATOM   3783 C C   . PRO A 1 482 ? 18.802  75.183 42.818 1.00 40.38  ? 482  PRO A C   1 
ATOM   3784 O O   . PRO A 1 482 ? 18.581  76.279 43.341 1.00 40.38  ? 482  PRO A O   1 
ATOM   3785 C CB  . PRO A 1 482 ? 18.234  73.390 44.509 1.00 33.21  ? 482  PRO A CB  1 
ATOM   3786 C CG  . PRO A 1 482 ? 19.319  72.419 44.219 1.00 33.21  ? 482  PRO A CG  1 
ATOM   3787 C CD  . PRO A 1 482 ? 18.799  71.725 42.978 1.00 33.21  ? 482  PRO A CD  1 
ATOM   3788 N N   . ASN A 1 483 ? 19.779  74.979 41.946 1.00 47.90  ? 483  ASN A N   1 
ATOM   3789 C CA  . ASN A 1 483 ? 20.704  76.037 41.576 1.00 47.90  ? 483  ASN A CA  1 
ATOM   3790 C C   . ASN A 1 483 ? 20.351  76.838 40.343 1.00 47.90  ? 483  ASN A C   1 
ATOM   3791 O O   . ASN A 1 483 ? 19.800  76.320 39.364 1.00 47.90  ? 483  ASN A O   1 
ATOM   3792 C CB  . ASN A 1 483 ? 22.097  75.455 41.386 1.00 49.74  ? 483  ASN A CB  1 
ATOM   3793 C CG  . ASN A 1 483 ? 22.624  74.821 42.642 1.00 49.74  ? 483  ASN A CG  1 
ATOM   3794 O OD1 . ASN A 1 483 ? 22.868  75.505 43.649 1.00 49.74  ? 483  ASN A OD1 1 
ATOM   3795 N ND2 . ASN A 1 483 ? 22.791  73.502 42.607 1.00 49.74  ? 483  ASN A ND2 1 
ATOM   3796 N N   . GLU A 1 484 ? 20.690  78.118 40.412 1.00 67.86  ? 484  GLU A N   1 
ATOM   3797 C CA  . GLU A 1 484 ? 20.488  79.049 39.314 1.00 67.86  ? 484  GLU A CA  1 
ATOM   3798 C C   . GLU A 1 484 ? 21.516  78.710 38.228 1.00 67.86  ? 484  GLU A C   1 
ATOM   3799 O O   . GLU A 1 484 ? 22.717  78.630 38.507 1.00 67.86  ? 484  GLU A O   1 
ATOM   3800 C CB  . GLU A 1 484 ? 20.700  80.475 39.821 1.00 95.15  ? 484  GLU A CB  1 
ATOM   3801 C CG  . GLU A 1 484 ? 19.501  81.015 40.559 1.00 95.15  ? 484  GLU A CG  1 
ATOM   3802 C CD  . GLU A 1 484 ? 18.388  81.347 39.586 1.00 95.15  ? 484  GLU A CD  1 
ATOM   3803 O OE1 . GLU A 1 484 ? 18.242  80.587 38.591 1.00 95.15  ? 484  GLU A OE1 1 
ATOM   3804 O OE2 . GLU A 1 484 ? 17.670  82.357 39.808 1.00 95.15  ? 484  GLU A OE2 1 
ATOM   3805 N N   . PRO A 1 485 ? 21.055  78.520 36.978 0.75 74.67  ? 485  PRO A N   1 
ATOM   3806 C CA  . PRO A 1 485 ? 21.906  78.180 35.827 0.75 74.67  ? 485  PRO A CA  1 
ATOM   3807 C C   . PRO A 1 485 ? 23.319  78.759 35.871 0.75 74.67  ? 485  PRO A C   1 
ATOM   3808 O O   . PRO A 1 485 ? 24.292  78.035 36.095 0.75 74.67  ? 485  PRO A O   1 
ATOM   3809 C CB  . PRO A 1 485 ? 21.107  78.710 34.643 0.75 66.22  ? 485  PRO A CB  1 
ATOM   3810 C CG  . PRO A 1 485 ? 19.690  78.455 35.072 0.75 66.22  ? 485  PRO A CG  1 
ATOM   3811 C CD  . PRO A 1 485 ? 19.699  78.902 36.532 0.75 66.22  ? 485  PRO A CD  1 
ATOM   3812 N N   . HIS A 1 486 ? 23.429  80.067 35.669 0.75 60.56  ? 486  HIS A N   1 
ATOM   3813 C CA  . HIS A 1 486 ? 24.731  80.716 35.667 0.75 60.56  ? 486  HIS A CA  1 
ATOM   3814 C C   . HIS A 1 486 ? 24.923  81.654 36.855 0.75 60.56  ? 486  HIS A C   1 
ATOM   3815 O O   . HIS A 1 486 ? 25.379  82.782 36.689 0.75 60.56  ? 486  HIS A O   1 
ATOM   3816 C CB  . HIS A 1 486 ? 24.908  81.503 34.366 0.75 74.19  ? 486  HIS A CB  1 
ATOM   3817 C CG  . HIS A 1 486 ? 24.547  80.728 33.136 0.75 74.19  ? 486  HIS A CG  1 
ATOM   3818 N ND1 . HIS A 1 486 ? 25.190  79.565 32.770 0.75 74.19  ? 486  HIS A ND1 1 
ATOM   3819 C CD2 . HIS A 1 486 ? 23.602  80.949 32.190 0.75 74.19  ? 486  HIS A CD2 1 
ATOM   3820 C CE1 . HIS A 1 486 ? 24.658  79.102 31.652 0.75 74.19  ? 486  HIS A CE1 1 
ATOM   3821 N NE2 . HIS A 1 486 ? 23.693  79.923 31.279 0.75 74.19  ? 486  HIS A NE2 1 
ATOM   3822 N N   . SER A 1 487 ? 24.587  81.190 38.052 0.75 47.61  ? 487  SER A N   1 
ATOM   3823 C CA  . SER A 1 487 ? 24.729  82.011 39.252 0.75 47.61  ? 487  SER A CA  1 
ATOM   3824 C C   . SER A 1 487 ? 26.176  82.132 39.732 0.75 47.61  ? 487  SER A C   1 
ATOM   3825 O O   . SER A 1 487 ? 27.042  81.358 39.332 0.75 47.61  ? 487  SER A O   1 
ATOM   3826 C CB  . SER A 1 487 ? 23.871  81.428 40.378 0.75 58.54  ? 487  SER A CB  1 
ATOM   3827 O OG  . SER A 1 487 ? 24.248  81.962 41.636 0.75 58.54  ? 487  SER A OG  1 
ATOM   3828 N N   . GLN A 1 488 ? 26.424  83.112 40.596 0.75 52.50  ? 488  GLN A N   1 
ATOM   3829 C CA  . GLN A 1 488 ? 27.752  83.334 41.159 0.75 52.50  ? 488  GLN A CA  1 
ATOM   3830 C C   . GLN A 1 488 ? 27.744  82.857 42.602 0.75 52.50  ? 488  GLN A C   1 
ATOM   3831 O O   . GLN A 1 488 ? 28.780  82.834 43.267 0.75 52.50  ? 488  GLN A O   1 
ATOM   3832 C CB  . GLN A 1 488 ? 28.112  84.819 41.132 0.75 59.40  ? 488  GLN A CB  1 
ATOM   3833 C CG  . GLN A 1 488 ? 28.123  85.434 39.751 0.75 59.40  ? 488  GLN A CG  1 
ATOM   3834 C CD  . GLN A 1 488 ? 28.993  84.658 38.787 0.75 59.40  ? 488  GLN A CD  1 
ATOM   3835 O OE1 . GLN A 1 488 ? 30.205  84.534 38.981 0.75 59.40  ? 488  GLN A OE1 1 
ATOM   3836 N NE2 . GLN A 1 488 ? 28.376  84.121 37.739 0.75 59.40  ? 488  GLN A NE2 1 
ATOM   3837 N N   . GLU A 1 489 ? 26.560  82.491 43.081 0.75 50.87  ? 489  GLU A N   1 
ATOM   3838 C CA  . GLU A 1 489 ? 26.393  82.009 44.449 0.75 50.87  ? 489  GLU A CA  1 
ATOM   3839 C C   . GLU A 1 489 ? 27.014  80.631 44.575 0.75 50.87  ? 489  GLU A C   1 
ATOM   3840 O O   . GLU A 1 489 ? 27.501  80.075 43.593 0.75 50.87  ? 489  GLU A O   1 
ATOM   3841 C CB  . GLU A 1 489 ? 24.909  81.913 44.807 0.75 80.50  ? 489  GLU A CB  1 
ATOM   3842 C CG  . GLU A 1 489 ? 24.142  83.216 44.726 0.75 80.50  ? 489  GLU A CG  1 
ATOM   3843 C CD  . GLU A 1 489 ? 24.725  84.289 45.626 0.75 80.50  ? 489  GLU A CD  1 
ATOM   3844 O OE1 . GLU A 1 489 ? 24.933  84.022 46.834 0.75 80.50  ? 489  GLU A OE1 1 
ATOM   3845 O OE2 . GLU A 1 489 ? 24.973  85.407 45.122 0.75 80.50  ? 489  GLU A OE2 1 
ATOM   3846 N N   . SER A 1 490 ? 26.984  80.084 45.789 1.00 71.61  ? 490  SER A N   1 
ATOM   3847 C CA  . SER A 1 490 ? 27.528  78.746 46.058 1.00 71.61  ? 490  SER A CA  1 
ATOM   3848 C C   . SER A 1 490 ? 26.623  77.673 45.466 1.00 71.61  ? 490  SER A C   1 
ATOM   3849 O O   . SER A 1 490 ? 25.384  77.780 45.530 1.00 71.61  ? 490  SER A O   1 
ATOM   3850 C CB  . SER A 1 490 ? 27.653  78.493 47.565 1.00 66.24  ? 490  SER A CB  1 
ATOM   3851 O OG  . SER A 1 490 ? 28.739  79.207 48.128 1.00 66.24  ? 490  SER A OG  1 
ATOM   3852 N N   . LYS A 1 491 ? 27.240  76.638 44.903 1.00 44.19  ? 491  LYS A N   1 
ATOM   3853 C CA  . LYS A 1 491 ? 26.480  75.556 44.308 1.00 44.19  ? 491  LYS A CA  1 
ATOM   3854 C C   . LYS A 1 491 ? 26.195  74.411 45.275 1.00 44.19  ? 491  LYS A C   1 
ATOM   3855 O O   . LYS A 1 491 ? 27.107  73.870 45.909 1.00 44.19  ? 491  LYS A O   1 
ATOM   3856 C CB  . LYS A 1 491 ? 27.207  75.014 43.082 1.00 65.01  ? 491  LYS A CB  1 
ATOM   3857 C CG  . LYS A 1 491 ? 27.415  76.050 41.989 1.00 65.01  ? 491  LYS A CG  1 
ATOM   3858 C CD  . LYS A 1 491 ? 26.101  76.661 41.508 1.00 65.01  ? 491  LYS A CD  1 
ATOM   3859 C CE  . LYS A 1 491 ? 26.354  77.769 40.484 1.00 65.01  ? 491  LYS A CE  1 
ATOM   3860 N NZ  . LYS A 1 491 ? 25.089  78.287 39.880 1.00 65.01  ? 491  LYS A NZ  1 
ATOM   3861 N N   . TRP A 1 492 ? 24.909  74.075 45.384 1.00 35.60  ? 492  TRP A N   1 
ATOM   3862 C CA  . TRP A 1 492 ? 24.417  72.981 46.210 1.00 35.60  ? 492  TRP A CA  1 
ATOM   3863 C C   . TRP A 1 492 ? 24.828  71.757 45.403 1.00 35.60  ? 492  TRP A C   1 
ATOM   3864 O O   . TRP A 1 492 ? 24.167  71.406 44.436 1.00 35.60  ? 492  TRP A O   1 
ATOM   3865 C CB  . TRP A 1 492 ? 22.891  73.055 46.287 1.00 31.65  ? 492  TRP A CB  1 
ATOM   3866 C CG  . TRP A 1 492 ? 22.228  72.041 47.175 1.00 31.65  ? 492  TRP A CG  1 
ATOM   3867 C CD1 . TRP A 1 492 ? 22.703  70.811 47.519 1.00 31.65  ? 492  TRP A CD1 1 
ATOM   3868 C CD2 . TRP A 1 492 ? 20.939  72.153 47.782 1.00 31.65  ? 492  TRP A CD2 1 
ATOM   3869 N NE1 . TRP A 1 492 ? 21.792  70.149 48.300 1.00 31.65  ? 492  TRP A NE1 1 
ATOM   3870 C CE2 . TRP A 1 492 ? 20.697  70.950 48.475 1.00 31.65  ? 492  TRP A CE2 1 
ATOM   3871 C CE3 . TRP A 1 492 ? 19.964  73.153 47.807 1.00 31.65  ? 492  TRP A CE3 1 
ATOM   3872 C CZ2 . TRP A 1 492 ? 19.518  70.717 49.185 1.00 31.65  ? 492  TRP A CZ2 1 
ATOM   3873 C CZ3 . TRP A 1 492 ? 18.795  72.922 48.512 1.00 31.65  ? 492  TRP A CZ3 1 
ATOM   3874 C CH2 . TRP A 1 492 ? 18.581  71.711 49.192 1.00 31.65  ? 492  TRP A CH2 1 
ATOM   3875 N N   . PRO A 1 493 ? 25.927  71.094 45.781 1.00 35.42  ? 493  PRO A N   1 
ATOM   3876 C CA  . PRO A 1 493 ? 26.350  69.923 45.019 1.00 35.42  ? 493  PRO A CA  1 
ATOM   3877 C C   . PRO A 1 493 ? 25.301  68.828 44.943 1.00 35.42  ? 493  PRO A C   1 
ATOM   3878 O O   . PRO A 1 493 ? 24.409  68.750 45.775 1.00 35.42  ? 493  PRO A O   1 
ATOM   3879 C CB  . PRO A 1 493 ? 27.604  69.480 45.753 1.00 35.71  ? 493  PRO A CB  1 
ATOM   3880 C CG  . PRO A 1 493 ? 27.285  69.820 47.148 1.00 35.71  ? 493  PRO A CG  1 
ATOM   3881 C CD  . PRO A 1 493 ? 26.700  71.202 47.025 1.00 35.71  ? 493  PRO A CD  1 
ATOM   3882 N N   . LEU A 1 494 ? 25.421  67.991 43.924 1.00 41.93  ? 494  LEU A N   1 
ATOM   3883 C CA  . LEU A 1 494 ? 24.516  66.877 43.696 1.00 41.93  ? 494  LEU A CA  1 
ATOM   3884 C C   . LEU A 1 494 ? 24.964  65.716 44.590 1.00 41.93  ? 494  LEU A C   1 
ATOM   3885 O O   . LEU A 1 494 ? 26.156  65.555 44.868 1.00 41.93  ? 494  LEU A O   1 
ATOM   3886 C CB  . LEU A 1 494 ? 24.595  66.475 42.224 1.00 33.77  ? 494  LEU A CB  1 
ATOM   3887 C CG  . LEU A 1 494 ? 23.583  65.560 41.547 1.00 33.77  ? 494  LEU A CG  1 
ATOM   3888 C CD1 . LEU A 1 494 ? 22.217  66.210 41.491 1.00 33.77  ? 494  LEU A CD1 1 
ATOM   3889 C CD2 . LEU A 1 494 ? 24.057  65.292 40.139 1.00 33.77  ? 494  LEU A CD2 1 
ATOM   3890 N N   . PHE A 1 495 ? 24.008  64.924 45.058 1.00 41.80  ? 495  PHE A N   1 
ATOM   3891 C CA  . PHE A 1 495 ? 24.322  63.785 45.901 1.00 41.80  ? 495  PHE A CA  1 
ATOM   3892 C C   . PHE A 1 495 ? 24.523  62.588 44.983 1.00 41.80  ? 495  PHE A C   1 
ATOM   3893 O O   . PHE A 1 495 ? 23.704  62.321 44.105 1.00 41.80  ? 495  PHE A O   1 
ATOM   3894 C CB  . PHE A 1 495 ? 23.181  63.545 46.893 1.00 28.47  ? 495  PHE A CB  1 
ATOM   3895 C CG  . PHE A 1 495 ? 23.344  62.309 47.748 1.00 28.47  ? 495  PHE A CG  1 
ATOM   3896 C CD1 . PHE A 1 495 ? 22.950  61.060 47.281 1.00 28.47  ? 495  PHE A CD1 1 
ATOM   3897 C CD2 . PHE A 1 495 ? 23.851  62.403 49.036 1.00 28.47  ? 495  PHE A CD2 1 
ATOM   3898 C CE1 . PHE A 1 495 ? 23.053  59.931 48.083 1.00 28.47  ? 495  PHE A CE1 1 
ATOM   3899 C CE2 . PHE A 1 495 ? 23.955  61.273 49.841 1.00 28.47  ? 495  PHE A CE2 1 
ATOM   3900 C CZ  . PHE A 1 495 ? 23.553  60.038 49.358 1.00 28.47  ? 495  PHE A CZ  1 
ATOM   3901 N N   . THR A 1 496 ? 25.625  61.876 45.186 1.00 43.02  ? 496  THR A N   1 
ATOM   3902 C CA  . THR A 1 496 ? 25.961  60.719 44.365 1.00 43.02  ? 496  THR A CA  1 
ATOM   3903 C C   . THR A 1 496 ? 26.299  59.520 45.236 1.00 43.02  ? 496  THR A C   1 
ATOM   3904 O O   . THR A 1 496 ? 26.786  59.680 46.346 1.00 43.02  ? 496  THR A O   1 
ATOM   3905 C CB  . THR A 1 496 ? 27.169  61.030 43.475 1.00 43.27  ? 496  THR A CB  1 
ATOM   3906 O OG1 . THR A 1 496 ? 28.309  61.327 44.301 1.00 43.27  ? 496  THR A OG1 1 
ATOM   3907 C CG2 . THR A 1 496 ? 26.867  62.224 42.589 1.00 43.27  ? 496  THR A CG2 1 
ATOM   3908 N N   . THR A 1 497 ? 26.054  58.320 44.726 1.00 54.11  ? 497  THR A N   1 
ATOM   3909 C CA  . THR A 1 497 ? 26.328  57.116 45.494 1.00 54.11  ? 497  THR A CA  1 
ATOM   3910 C C   . THR A 1 497 ? 27.763  57.142 45.981 1.00 54.11  ? 497  THR A C   1 
ATOM   3911 O O   . THR A 1 497 ? 28.061  56.738 47.111 1.00 54.11  ? 497  THR A O   1 
ATOM   3912 C CB  . THR A 1 497 ? 26.150  55.840 44.659 1.00 53.27  ? 497  THR A CB  1 
ATOM   3913 O OG1 . THR A 1 497 ? 24.845  55.817 44.071 1.00 53.27  ? 497  THR A OG1 1 
ATOM   3914 C CG2 . THR A 1 497 ? 26.308  54.621 45.543 1.00 53.27  ? 497  THR A CG2 1 
ATOM   3915 N N   . LYS A 1 498 ? 28.652  57.636 45.127 1.00 40.65  ? 498  LYS A N   1 
ATOM   3916 C CA  . LYS A 1 498 ? 30.058  57.692 45.467 1.00 40.65  ? 498  LYS A CA  1 
ATOM   3917 C C   . LYS A 1 498 ? 30.432  58.711 46.550 1.00 40.65  ? 498  LYS A C   1 
ATOM   3918 O O   . LYS A 1 498 ? 30.812  58.323 47.653 1.00 40.65  ? 498  LYS A O   1 
ATOM   3919 C CB  . LYS A 1 498 ? 30.864  57.950 44.200 1.00 70.96  ? 498  LYS A CB  1 
ATOM   3920 C CG  . LYS A 1 498 ? 32.374  57.910 44.415 1.00 70.96  ? 498  LYS A CG  1 
ATOM   3921 C CD  . LYS A 1 498 ? 33.101  58.084 43.092 1.00 70.96  ? 498  LYS A CD  1 
ATOM   3922 C CE  . LYS A 1 498 ? 34.601  58.196 43.281 1.00 70.96  ? 498  LYS A CE  1 
ATOM   3923 N NZ  . LYS A 1 498 ? 35.241  58.344 41.937 1.00 70.96  ? 498  LYS A NZ  1 
ATOM   3924 N N   . GLU A 1 499 ? 30.307  60.004 46.240 1.00 40.96  ? 499  GLU A N   1 
ATOM   3925 C CA  . GLU A 1 499 ? 30.668  61.087 47.174 1.00 40.96  ? 499  GLU A CA  1 
ATOM   3926 C C   . GLU A 1 499 ? 29.717  61.326 48.348 1.00 40.96  ? 499  GLU A C   1 
ATOM   3927 O O   . GLU A 1 499 ? 30.159  61.632 49.451 1.00 40.96  ? 499  GLU A O   1 
ATOM   3928 C CB  . GLU A 1 499 ? 30.824  62.412 46.419 1.00 93.54  ? 499  GLU A CB  1 
ATOM   3929 C CG  . GLU A 1 499 ? 31.578  62.328 45.093 1.00 93.54  ? 499  GLU A CG  1 
ATOM   3930 C CD  . GLU A 1 499 ? 32.905  61.596 45.222 1.00 93.54  ? 499  GLU A CD  1 
ATOM   3931 O OE1 . GLU A 1 499 ? 33.622  61.841 46.225 1.00 93.54  ? 499  GLU A OE1 1 
ATOM   3932 O OE2 . GLU A 1 499 ? 33.236  60.786 44.318 1.00 93.54  ? 499  GLU A OE2 1 
ATOM   3933 N N   . GLN A 1 500 ? 28.416  61.229 48.100 1.00 37.45  ? 500  GLN A N   1 
ATOM   3934 C CA  . GLN A 1 500 ? 27.415  61.423 49.148 1.00 37.45  ? 500  GLN A CA  1 
ATOM   3935 C C   . GLN A 1 500 ? 27.498  62.798 49.785 1.00 37.45  ? 500  GLN A C   1 
ATOM   3936 O O   . GLN A 1 500 ? 27.431  62.937 50.999 1.00 37.45  ? 500  GLN A O   1 
ATOM   3937 C CB  . GLN A 1 500 ? 27.578  60.353 50.222 1.00 44.42  ? 500  GLN A CB  1 
ATOM   3938 C CG  . GLN A 1 500 ? 27.600  58.955 49.651 1.00 44.42  ? 500  GLN A CG  1 
ATOM   3939 C CD  . GLN A 1 500 ? 27.476  57.877 50.705 1.00 44.42  ? 500  GLN A CD  1 
ATOM   3940 O OE1 . GLN A 1 500 ? 27.886  56.741 50.481 1.00 44.42  ? 500  GLN A OE1 1 
ATOM   3941 N NE2 . GLN A 1 500 ? 26.896  58.220 51.856 1.00 44.42  ? 500  GLN A NE2 1 
ATOM   3942 N N   . LYS A 1 501 ? 27.633  63.819 48.956 1.00 39.33  ? 501  LYS A N   1 
ATOM   3943 C CA  . LYS A 1 501 ? 27.739  65.175 49.453 1.00 39.33  ? 501  LYS A CA  1 
ATOM   3944 C C   . LYS A 1 501 ? 26.395  65.748 49.853 1.00 39.33  ? 501  LYS A C   1 
ATOM   3945 O O   . LYS A 1 501 ? 25.353  65.321 49.367 1.00 39.33  ? 501  LYS A O   1 
ATOM   3946 C CB  . LYS A 1 501 ? 28.362  66.071 48.385 1.00 53.30  ? 501  LYS A CB  1 
ATOM   3947 C CG  . LYS A 1 501 ? 29.732  65.606 47.915 1.00 53.30  ? 501  LYS A CG  1 
ATOM   3948 C CD  . LYS A 1 501 ? 30.346  66.593 46.932 1.00 53.30  ? 501  LYS A CD  1 
ATOM   3949 C CE  . LYS A 1 501 ? 31.709  66.122 46.483 1.00 53.30  ? 501  LYS A CE  1 
ATOM   3950 N NZ  . LYS A 1 501 ? 32.347  67.097 45.568 1.00 53.30  ? 501  LYS A NZ  1 
ATOM   3951 N N   . PHE A 1 502 ? 26.424  66.712 50.758 1.00 36.99  ? 502  PHE A N   1 
ATOM   3952 C CA  . PHE A 1 502 ? 25.214  67.379 51.180 1.00 36.99  ? 502  PHE A CA  1 
ATOM   3953 C C   . PHE A 1 502 ? 25.612  68.725 51.767 1.00 36.99  ? 502  PHE A C   1 
ATOM   3954 O O   . PHE A 1 502 ? 26.777  68.948 52.080 1.00 36.99  ? 502  PHE A O   1 
ATOM   3955 C CB  . PHE A 1 502 ? 24.441  66.535 52.195 1.00 31.32  ? 502  PHE A CB  1 
ATOM   3956 C CG  . PHE A 1 502 ? 24.975  66.606 53.595 1.00 31.32  ? 502  PHE A CG  1 
ATOM   3957 C CD1 . PHE A 1 502 ? 25.939  65.712 54.033 1.00 31.32  ? 502  PHE A CD1 1 
ATOM   3958 C CD2 . PHE A 1 502 ? 24.468  67.538 54.496 1.00 31.32  ? 502  PHE A CD2 1 
ATOM   3959 C CE1 . PHE A 1 502 ? 26.384  65.739 55.353 1.00 31.32  ? 502  PHE A CE1 1 
ATOM   3960 C CE2 . PHE A 1 502 ? 24.905  67.572 55.805 1.00 31.32  ? 502  PHE A CE2 1 
ATOM   3961 C CZ  . PHE A 1 502 ? 25.864  66.671 56.237 1.00 31.32  ? 502  PHE A CZ  1 
ATOM   3962 N N   . ILE A 1 503 ? 24.651  69.624 51.910 1.00 38.46  ? 503  ILE A N   1 
ATOM   3963 C CA  . ILE A 1 503 ? 24.948  70.940 52.444 1.00 38.46  ? 503  ILE A CA  1 
ATOM   3964 C C   . ILE A 1 503 ? 24.167  71.221 53.711 1.00 38.46  ? 503  ILE A C   1 
ATOM   3965 O O   . ILE A 1 503 ? 23.152  70.587 53.978 1.00 38.46  ? 503  ILE A O   1 
ATOM   3966 C CB  . ILE A 1 503 ? 24.570  72.030 51.452 1.00 41.36  ? 503  ILE A CB  1 
ATOM   3967 C CG1 . ILE A 1 503 ? 23.054  72.032 51.277 1.00 41.36  ? 503  ILE A CG1 1 
ATOM   3968 C CG2 . ILE A 1 503 ? 25.247  71.783 50.114 1.00 41.36  ? 503  ILE A CG2 1 
ATOM   3969 C CD1 . ILE A 1 503 ? 22.517  73.270 50.630 1.00 41.36  ? 503  ILE A CD1 1 
ATOM   3970 N N   . ASP A 1 504 ? 24.652  72.179 54.492 1.00 55.43  ? 504  ASP A N   1 
ATOM   3971 C CA  . ASP A 1 504 ? 23.969  72.592 55.708 1.00 55.43  ? 504  ASP A CA  1 
ATOM   3972 C C   . ASP A 1 504 ? 23.060  73.744 55.290 1.00 55.43  ? 504  ASP A C   1 
ATOM   3973 O O   . ASP A 1 504 ? 23.329  74.418 54.298 1.00 55.43  ? 504  ASP A O   1 
ATOM   3974 C CB  . ASP A 1 504 ? 24.965  73.092 56.756 1.00 84.49  ? 504  ASP A CB  1 
ATOM   3975 C CG  . ASP A 1 504 ? 25.652  71.959 57.505 1.00 84.49  ? 504  ASP A CG  1 
ATOM   3976 O OD1 . ASP A 1 504 ? 24.946  71.008 57.908 1.00 84.49  ? 504  ASP A OD1 1 
ATOM   3977 O OD2 . ASP A 1 504 ? 26.890  72.022 57.710 1.00 84.49  ? 504  ASP A OD2 1 
ATOM   3978 N N   . LEU A 1 505 ? 21.989  73.972 56.035 1.00 45.25  ? 505  LEU A N   1 
ATOM   3979 C CA  . LEU A 1 505 ? 21.082  75.054 55.703 1.00 45.25  ? 505  LEU A CA  1 
ATOM   3980 C C   . LEU A 1 505 ? 20.896  75.927 56.938 1.00 45.25  ? 505  LEU A C   1 
ATOM   3981 O O   . LEU A 1 505 ? 20.116  75.604 57.827 1.00 45.25  ? 505  LEU A O   1 
ATOM   3982 C CB  . LEU A 1 505 ? 19.749  74.480 55.230 1.00 25.82  ? 505  LEU A CB  1 
ATOM   3983 C CG  . LEU A 1 505 ? 19.158  75.027 53.932 1.00 25.82  ? 505  LEU A CG  1 
ATOM   3984 C CD1 . LEU A 1 505 ? 20.193  75.075 52.831 1.00 25.82  ? 505  LEU A CD1 1 
ATOM   3985 C CD2 . LEU A 1 505 ? 18.007  74.149 53.530 1.00 25.82  ? 505  LEU A CD2 1 
ATOM   3986 N N   . ASN A 1 506 ? 21.640  77.027 56.990 1.00 55.61  ? 506  ASN A N   1 
ATOM   3987 C CA  . ASN A 1 506 ? 21.581  77.967 58.107 1.00 55.61  ? 506  ASN A CA  1 
ATOM   3988 C C   . ASN A 1 506 ? 22.047  79.337 57.632 1.00 55.61  ? 506  ASN A C   1 
ATOM   3989 O O   . ASN A 1 506 ? 22.342  79.520 56.453 1.00 55.61  ? 506  ASN A O   1 
ATOM   3990 C CB  . ASN A 1 506 ? 22.486  77.499 59.236 1.00 42.99  ? 506  ASN A CB  1 
ATOM   3991 C CG  . ASN A 1 506 ? 23.896  77.292 58.777 1.00 42.99  ? 506  ASN A CG  1 
ATOM   3992 O OD1 . ASN A 1 506 ? 24.457  78.137 58.086 1.00 42.99  ? 506  ASN A OD1 1 
ATOM   3993 N ND2 . ASN A 1 506 ? 24.484  76.166 59.151 1.00 42.99  ? 506  ASN A ND2 1 
ATOM   3994 N N   . THR A 1 507 ? 22.138  80.293 58.551 1.00 49.51  ? 507  THR A N   1 
ATOM   3995 C CA  . THR A 1 507 ? 22.551  81.646 58.197 1.00 49.51  ? 507  THR A CA  1 
ATOM   3996 C C   . THR A 1 507 ? 24.055  81.827 57.995 1.00 49.51  ? 507  THR A C   1 
ATOM   3997 O O   . THR A 1 507 ? 24.540  82.946 57.955 1.00 49.51  ? 507  THR A O   1 
ATOM   3998 C CB  . THR A 1 507 ? 22.065  82.654 59.248 1.00 39.50  ? 507  THR A CB  1 
ATOM   3999 O OG1 . THR A 1 507 ? 22.473  82.221 60.548 1.00 39.50  ? 507  THR A OG1 1 
ATOM   4000 C CG2 . THR A 1 507 ? 20.558  82.760 59.217 1.00 39.50  ? 507  THR A CG2 1 
ATOM   4001 N N   . GLU A 1 508 ? 24.797  80.738 57.848 1.00 60.54  ? 508  GLU A N   1 
ATOM   4002 C CA  . GLU A 1 508 ? 26.242  80.838 57.636 1.00 60.54  ? 508  GLU A CA  1 
ATOM   4003 C C   . GLU A 1 508 ? 26.637  80.484 56.199 1.00 60.54  ? 508  GLU A C   1 
ATOM   4004 O O   . GLU A 1 508 ? 25.863  79.851 55.474 1.00 60.54  ? 508  GLU A O   1 
ATOM   4005 C CB  . GLU A 1 508 ? 26.972  79.916 58.607 1.00 92.60  ? 508  GLU A CB  1 
ATOM   4006 C CG  . GLU A 1 508 ? 26.804  80.324 60.055 1.00 92.60  ? 508  GLU A CG  1 
ATOM   4007 C CD  . GLU A 1 508 ? 27.318  79.265 61.021 1.00 92.60  ? 508  GLU A CD  1 
ATOM   4008 O OE1 . GLU A 1 508 ? 28.533  78.938 60.976 1.00 92.60  ? 508  GLU A OE1 1 
ATOM   4009 O OE2 . GLU A 1 508 ? 26.496  78.759 61.827 1.00 92.60  ? 508  GLU A OE2 1 
ATOM   4010 N N   . PRO A 1 509 ? 27.851  80.887 55.769 1.00 60.34  ? 509  PRO A N   1 
ATOM   4011 C CA  . PRO A 1 509 ? 28.315  80.595 54.405 1.00 60.34  ? 509  PRO A CA  1 
ATOM   4012 C C   . PRO A 1 509 ? 28.202  79.104 54.117 1.00 60.34  ? 509  PRO A C   1 
ATOM   4013 O O   . PRO A 1 509 ? 28.762  78.276 54.839 1.00 60.34  ? 509  PRO A O   1 
ATOM   4014 C CB  . PRO A 1 509 ? 29.766  81.066 54.420 1.00 48.12  ? 509  PRO A CB  1 
ATOM   4015 C CG  . PRO A 1 509 ? 29.752  82.164 55.435 1.00 48.12  ? 509  PRO A CG  1 
ATOM   4016 C CD  . PRO A 1 509 ? 28.898  81.585 56.535 1.00 48.12  ? 509  PRO A CD  1 
ATOM   4017 N N   . MET A 1 510 ? 27.474  78.765 53.062 1.00 59.09  ? 510  MET A N   1 
ATOM   4018 C CA  . MET A 1 510 ? 27.281  77.374 52.696 1.00 59.09  ? 510  MET A CA  1 
ATOM   4019 C C   . MET A 1 510 ? 28.527  76.517 52.880 1.00 59.09  ? 510  MET A C   1 
ATOM   4020 O O   . MET A 1 510 ? 29.636  76.939 52.551 1.00 59.09  ? 510  MET A O   1 
ATOM   4021 C CB  . MET A 1 510 ? 26.815  77.277 51.244 1.00 88.71  ? 510  MET A CB  1 
ATOM   4022 C CG  . MET A 1 510 ? 26.745  75.848 50.710 1.00 88.71  ? 510  MET A CG  1 
ATOM   4023 S SD  . MET A 1 510 ? 25.969  75.744 49.066 1.00 88.71  ? 510  MET A SD  1 
ATOM   4024 C CE  . MET A 1 510 ? 24.188  75.973 49.561 1.00 88.71  ? 510  MET A CE  1 
ATOM   4025 N N   . LYS A 1 511 ? 28.327  75.317 53.422 1.00 54.88  ? 511  LYS A N   1 
ATOM   4026 C CA  . LYS A 1 511 ? 29.403  74.352 53.628 1.00 54.88  ? 511  LYS A CA  1 
ATOM   4027 C C   . LYS A 1 511 ? 28.911  72.986 53.169 1.00 54.88  ? 511  LYS A C   1 
ATOM   4028 O O   . LYS A 1 511 ? 27.839  72.534 53.568 1.00 54.88  ? 511  LYS A O   1 
ATOM   4029 C CB  . LYS A 1 511 ? 29.787  74.244 55.100 1.00 76.33  ? 511  LYS A CB  1 
ATOM   4030 C CG  . LYS A 1 511 ? 30.338  75.510 55.726 1.00 76.33  ? 511  LYS A CG  1 
ATOM   4031 C CD  . LYS A 1 511 ? 30.900  75.175 57.115 1.00 76.33  ? 511  LYS A CD  1 
ATOM   4032 C CE  . LYS A 1 511 ? 31.346  76.406 57.908 1.00 76.33  ? 511  LYS A CE  1 
ATOM   4033 N NZ  . LYS A 1 511 ? 31.762  76.016 59.299 1.00 76.33  ? 511  LYS A NZ  1 
ATOM   4034 N N   . VAL A 1 512 ? 29.694  72.331 52.325 1.00 41.02  ? 512  VAL A N   1 
ATOM   4035 C CA  . VAL A 1 512 ? 29.338  71.011 51.839 1.00 41.02  ? 512  VAL A CA  1 
ATOM   4036 C C   . VAL A 1 512 ? 29.981  69.974 52.751 1.00 41.02  ? 512  VAL A C   1 
ATOM   4037 O O   . VAL A 1 512 ? 31.051  70.206 53.300 1.00 41.02  ? 512  VAL A O   1 
ATOM   4038 C CB  . VAL A 1 512 ? 29.839  70.799 50.401 1.00 38.63  ? 512  VAL A CB  1 
ATOM   4039 C CG1 . VAL A 1 512 ? 29.619  69.360 49.981 1.00 38.63  ? 512  VAL A CG1 1 
ATOM   4040 C CG2 . VAL A 1 512 ? 29.113  71.735 49.462 1.00 38.63  ? 512  VAL A CG2 1 
ATOM   4041 N N   . HIS A 1 513 ? 29.321  68.834 52.912 1.00 46.59  ? 513  HIS A N   1 
ATOM   4042 C CA  . HIS A 1 513 ? 29.834  67.762 53.757 1.00 46.59  ? 513  HIS A CA  1 
ATOM   4043 C C   . HIS A 1 513 ? 29.642  66.412 53.085 1.00 46.59  ? 513  HIS A C   1 
ATOM   4044 O O   . HIS A 1 513 ? 29.281  66.336 51.914 1.00 46.59  ? 513  HIS A O   1 
ATOM   4045 C CB  . HIS A 1 513 ? 29.086  67.732 55.076 1.00 59.53  ? 513  HIS A CB  1 
ATOM   4046 C CG  . HIS A 1 513 ? 29.193  68.992 55.864 1.00 59.53  ? 513  HIS A CG  1 
ATOM   4047 N ND1 . HIS A 1 513 ? 30.326  69.328 56.573 1.00 59.53  ? 513  HIS A ND1 1 
ATOM   4048 C CD2 . HIS A 1 513 ? 28.289  69.972 56.103 1.00 59.53  ? 513  HIS A CD2 1 
ATOM   4049 C CE1 . HIS A 1 513 ? 30.113  70.460 57.223 1.00 59.53  ? 513  HIS A CE1 1 
ATOM   4050 N NE2 . HIS A 1 513 ? 28.884  70.870 56.956 1.00 59.53  ? 513  HIS A NE2 1 
ATOM   4051 N N   . GLN A 1 514 ? 29.865  65.344 53.845 1.00 41.30  ? 514  GLN A N   1 
ATOM   4052 C CA  . GLN A 1 514 ? 29.693  64.005 53.320 1.00 41.30  ? 514  GLN A CA  1 
ATOM   4053 C C   . GLN A 1 514 ? 29.245  63.031 54.378 1.00 41.30  ? 514  GLN A C   1 
ATOM   4054 O O   . GLN A 1 514 ? 29.523  63.202 55.557 1.00 41.30  ? 514  GLN A O   1 
ATOM   4055 C CB  . GLN A 1 514 ? 30.985  63.501 52.702 1.00 59.08  ? 514  GLN A CB  1 
ATOM   4056 C CG  . GLN A 1 514 ? 31.335  64.164 51.404 1.00 59.08  ? 514  GLN A CG  1 
ATOM   4057 C CD  . GLN A 1 514 ? 32.661  63.678 50.880 1.00 59.08  ? 514  GLN A CD  1 
ATOM   4058 O OE1 . GLN A 1 514 ? 33.699  63.889 51.506 1.00 59.08  ? 514  GLN A OE1 1 
ATOM   4059 N NE2 . GLN A 1 514 ? 32.636  63.012 49.728 1.00 59.08  ? 514  GLN A NE2 1 
ATOM   4060 N N   . ARG A 1 515 ? 28.533  62.009 53.919 1.00 43.96  ? 515  ARG A N   1 
ATOM   4061 C CA  . ARG A 1 515 ? 28.021  60.940 54.752 1.00 43.96  ? 515  ARG A CA  1 
ATOM   4062 C C   . ARG A 1 515 ? 27.281  61.382 55.999 1.00 43.96  ? 515  ARG A C   1 
ATOM   4063 O O   . ARG A 1 515 ? 27.731  61.146 57.113 1.00 43.96  ? 515  ARG A O   1 
ATOM   4064 C CB  . ARG A 1 515 ? 29.168  60.010 55.108 1.00 63.63  ? 515  ARG A CB  1 
ATOM   4065 C CG  . ARG A 1 515 ? 29.839  59.466 53.865 1.00 63.63  ? 515  ARG A CG  1 
ATOM   4066 C CD  . ARG A 1 515 ? 30.827  58.363 54.175 1.00 63.63  ? 515  ARG A CD  1 
ATOM   4067 N NE  . ARG A 1 515 ? 31.294  57.725 52.952 1.00 63.63  ? 515  ARG A NE  1 
ATOM   4068 C CZ  . ARG A 1 515 ? 31.936  56.558 52.916 1.00 63.63  ? 515  ARG A CZ  1 
ATOM   4069 N NH1 . ARG A 1 515 ? 32.187  55.896 54.044 1.00 63.63  ? 515  ARG A NH1 1 
ATOM   4070 N NH2 . ARG A 1 515 ? 32.333  56.048 51.749 1.00 63.63  ? 515  ARG A NH2 1 
ATOM   4071 N N   . LEU A 1 516 ? 26.127  62.004 55.793 1.00 42.60  ? 516  LEU A N   1 
ATOM   4072 C CA  . LEU A 1 516 ? 25.297  62.476 56.891 1.00 42.60  ? 516  LEU A CA  1 
ATOM   4073 C C   . LEU A 1 516 ? 25.073  61.359 57.900 1.00 42.60  ? 516  LEU A C   1 
ATOM   4074 O O   . LEU A 1 516 ? 24.424  60.358 57.600 1.00 42.60  ? 516  LEU A O   1 
ATOM   4075 C CB  . LEU A 1 516 ? 23.955  62.979 56.350 1.00 35.97  ? 516  LEU A CB  1 
ATOM   4076 C CG  . LEU A 1 516 ? 22.930  63.549 57.329 1.00 35.97  ? 516  LEU A CG  1 
ATOM   4077 C CD1 . LEU A 1 516 ? 23.606  64.440 58.344 1.00 35.97  ? 516  LEU A CD1 1 
ATOM   4078 C CD2 . LEU A 1 516 ? 21.895  64.325 56.563 1.00 35.97  ? 516  LEU A CD2 1 
ATOM   4079 N N   . ARG A 1 517 ? 25.633  61.548 59.089 1.00 37.94  ? 517  ARG A N   1 
ATOM   4080 C CA  . ARG A 1 517 ? 25.552  60.604 60.203 1.00 37.94  ? 517  ARG A CA  1 
ATOM   4081 C C   . ARG A 1 517 ? 25.712  59.126 59.844 1.00 37.94  ? 517  ARG A C   1 
ATOM   4082 O O   . ARG A 1 517 ? 24.865  58.310 60.193 1.00 37.94  ? 517  ARG A O   1 
ATOM   4083 C CB  . ARG A 1 517 ? 24.246  60.833 60.981 1.00 51.09  ? 517  ARG A CB  1 
ATOM   4084 C CG  . ARG A 1 517 ? 24.160  62.243 61.581 1.00 51.09  ? 517  ARG A CG  1 
ATOM   4085 C CD  . ARG A 1 517 ? 22.937  62.460 62.450 1.00 51.09  ? 517  ARG A CD  1 
ATOM   4086 N NE  . ARG A 1 517 ? 23.019  61.718 63.703 1.00 51.09  ? 517  ARG A NE  1 
ATOM   4087 C CZ  . ARG A 1 517 ? 23.869  62.007 64.685 1.00 51.09  ? 517  ARG A CZ  1 
ATOM   4088 N NH1 . ARG A 1 517 ? 24.699  63.032 64.538 1.00 51.09  ? 517  ARG A NH1 1 
ATOM   4089 N NH2 . ARG A 1 517 ? 23.900  61.275 65.802 1.00 51.09  ? 517  ARG A NH2 1 
ATOM   4090 N N   . VAL A 1 518 ? 26.813  58.782 59.170 1.00 40.19  ? 518  VAL A N   1 
ATOM   4091 C CA  . VAL A 1 518 ? 27.085  57.396 58.761 1.00 40.19  ? 518  VAL A CA  1 
ATOM   4092 C C   . VAL A 1 518 ? 27.247  56.410 59.898 1.00 40.19  ? 518  VAL A C   1 
ATOM   4093 O O   . VAL A 1 518 ? 26.685  55.329 59.854 1.00 40.19  ? 518  VAL A O   1 
ATOM   4094 C CB  . VAL A 1 518 ? 28.364  57.272 57.919 1.00 31.28  ? 518  VAL A CB  1 
ATOM   4095 C CG1 . VAL A 1 518 ? 28.014  57.151 56.466 1.00 31.28  ? 518  VAL A CG1 1 
ATOM   4096 C CG2 . VAL A 1 518 ? 29.256  58.465 58.159 1.00 31.28  ? 518  VAL A CG2 1 
ATOM   4097 N N   . GLN A 1 519 ? 28.034  56.778 60.903 1.00 40.61  ? 519  GLN A N   1 
ATOM   4098 C CA  . GLN A 1 519 ? 28.284  55.908 62.043 1.00 40.61  ? 519  GLN A CA  1 
ATOM   4099 C C   . GLN A 1 519 ? 27.015  55.294 62.602 1.00 40.61  ? 519  GLN A C   1 
ATOM   4100 O O   . GLN A 1 519 ? 26.937  54.080 62.792 1.00 40.61  ? 519  GLN A O   1 
ATOM   4101 C CB  . GLN A 1 519 ? 28.970  56.678 63.157 1.00 47.45  ? 519  GLN A CB  1 
ATOM   4102 C CG  . GLN A 1 519 ? 29.942  55.833 63.908 1.00 47.45  ? 519  GLN A CG  1 
ATOM   4103 C CD  . GLN A 1 519 ? 30.940  55.200 62.959 1.00 47.45  ? 519  GLN A CD  1 
ATOM   4104 O OE1 . GLN A 1 519 ? 31.571  55.895 62.149 1.00 47.45  ? 519  GLN A OE1 1 
ATOM   4105 N NE2 . GLN A 1 519 ? 31.087  53.875 63.042 1.00 47.45  ? 519  GLN A NE2 1 
ATOM   4106 N N   . MET A 1 520 ? 26.026  56.146 62.868 1.00 42.60  ? 520  MET A N   1 
ATOM   4107 C CA  . MET A 1 520 ? 24.757  55.703 63.423 1.00 42.60  ? 520  MET A CA  1 
ATOM   4108 C C   . MET A 1 520 ? 23.844  55.100 62.364 1.00 42.60  ? 520  MET A C   1 
ATOM   4109 O O   . MET A 1 520 ? 23.133  54.141 62.627 1.00 42.60  ? 520  MET A O   1 
ATOM   4110 C CB  . MET A 1 520 ? 24.049  56.872 64.115 1.00 60.01  ? 520  MET A CB  1 
ATOM   4111 C CG  . MET A 1 520 ? 24.862  57.556 65.219 1.00 60.01  ? 520  MET A CG  1 
ATOM   4112 S SD  . MET A 1 520 ? 25.216  56.525 66.700 1.00 60.01  ? 520  MET A SD  1 
ATOM   4113 C CE  . MET A 1 520 ? 26.902  55.876 66.304 1.00 60.01  ? 520  MET A CE  1 
ATOM   4114 N N   . CYS A 1 521 ? 23.858  55.650 61.161 1.00 40.16  ? 521  CYS A N   1 
ATOM   4115 C CA  . CYS A 1 521 ? 23.001  55.112 60.115 1.00 40.16  ? 521  CYS A CA  1 
ATOM   4116 C C   . CYS A 1 521 ? 23.366  53.651 59.825 1.00 40.16  ? 521  CYS A C   1 
ATOM   4117 O O   . CYS A 1 521 ? 22.504  52.862 59.487 1.00 40.16  ? 521  CYS A O   1 
ATOM   4118 C CB  . CYS A 1 521 ? 23.091  55.977 58.847 1.00 24.88  ? 521  CYS A CB  1 
ATOM   4119 N N   . VAL A 1 522 ? 24.632  53.277 59.972 1.00 39.42  ? 522  VAL A N   1 
ATOM   4120 C CA  . VAL A 1 522 ? 25.019  51.883 59.733 1.00 39.42  ? 522  VAL A CA  1 
ATOM   4121 C C   . VAL A 1 522 ? 24.484  50.995 60.859 1.00 39.42  ? 522  VAL A C   1 
ATOM   4122 O O   . VAL A 1 522 ? 24.092  49.850 60.627 1.00 39.42  ? 522  VAL A O   1 
ATOM   4123 C CB  . VAL A 1 522 ? 26.557  51.701 59.651 1.00 27.92  ? 522  VAL A CB  1 
ATOM   4124 C CG1 . VAL A 1 522 ? 26.905  50.218 59.602 1.00 27.92  ? 522  VAL A CG1 1 
ATOM   4125 C CG2 . VAL A 1 522 ? 27.097  52.396 58.410 1.00 27.92  ? 522  VAL A CG2 1 
ATOM   4126 N N   . PHE A 1 523 ? 24.482  51.532 62.077 1.00 34.93  ? 523  PHE A N   1 
ATOM   4127 C CA  . PHE A 1 523 ? 23.972  50.822 63.242 1.00 34.93  ? 523  PHE A CA  1 
ATOM   4128 C C   . PHE A 1 523 ? 22.483  50.572 63.101 1.00 34.93  ? 523  PHE A C   1 
ATOM   4129 O O   . PHE A 1 523 ? 22.011  49.458 63.280 1.00 34.93  ? 523  PHE A O   1 
ATOM   4130 C CB  . PHE A 1 523 ? 24.189  51.648 64.505 1.00 34.10  ? 523  PHE A CB  1 
ATOM   4131 C CG  . PHE A 1 523 ? 23.510  51.090 65.726 1.00 34.10  ? 523  PHE A CG  1 
ATOM   4132 C CD1 . PHE A 1 523 ? 24.076  50.040 66.437 1.00 34.10  ? 523  PHE A CD1 1 
ATOM   4133 C CD2 . PHE A 1 523 ? 22.308  51.625 66.170 1.00 34.10  ? 523  PHE A CD2 1 
ATOM   4134 C CE1 . PHE A 1 523 ? 23.458  49.533 67.574 1.00 34.10  ? 523  PHE A CE1 1 
ATOM   4135 C CE2 . PHE A 1 523 ? 21.681  51.128 67.302 1.00 34.10  ? 523  PHE A CE2 1 
ATOM   4136 C CZ  . PHE A 1 523 ? 22.261  50.077 68.008 1.00 34.10  ? 523  PHE A CZ  1 
ATOM   4137 N N   . TRP A 1 524 ? 21.738  51.618 62.779 1.00 32.27  ? 524  TRP A N   1 
ATOM   4138 C CA  . TRP A 1 524 ? 20.301  51.485 62.658 1.00 32.27  ? 524  TRP A CA  1 
ATOM   4139 C C   . TRP A 1 524 ? 19.819  50.786 61.396 1.00 32.27  ? 524  TRP A C   1 
ATOM   4140 O O   . TRP A 1 524 ? 18.776  50.152 61.402 1.00 32.27  ? 524  TRP A O   1 
ATOM   4141 C CB  . TRP A 1 524 ? 19.634  52.856 62.777 1.00 30.21  ? 524  TRP A CB  1 
ATOM   4142 C CG  . TRP A 1 524 ? 19.766  53.494 64.131 1.00 30.21  ? 524  TRP A CG  1 
ATOM   4143 C CD1 . TRP A 1 524 ? 20.599  54.519 64.477 1.00 30.21  ? 524  TRP A CD1 1 
ATOM   4144 C CD2 . TRP A 1 524 ? 19.056  53.135 65.321 1.00 30.21  ? 524  TRP A CD2 1 
ATOM   4145 N NE1 . TRP A 1 524 ? 20.452  54.821 65.810 1.00 30.21  ? 524  TRP A NE1 1 
ATOM   4146 C CE2 . TRP A 1 524 ? 19.509  53.986 66.351 1.00 30.21  ? 524  TRP A CE2 1 
ATOM   4147 C CE3 . TRP A 1 524 ? 18.079  52.180 65.619 1.00 30.21  ? 524  TRP A CE3 1 
ATOM   4148 C CZ2 . TRP A 1 524 ? 19.016  53.906 67.655 1.00 30.21  ? 524  TRP A CZ2 1 
ATOM   4149 C CZ3 . TRP A 1 524 ? 17.592  52.107 66.915 1.00 30.21  ? 524  TRP A CZ3 1 
ATOM   4150 C CH2 . TRP A 1 524 ? 18.060  52.963 67.913 1.00 30.21  ? 524  TRP A CH2 1 
ATOM   4151 N N   . ASN A 1 525 ? 20.567  50.876 60.310 1.00 38.52  ? 525  ASN A N   1 
ATOM   4152 C CA  . ASN A 1 525 ? 20.114  50.229 59.095 1.00 38.52  ? 525  ASN A CA  1 
ATOM   4153 C C   . ASN A 1 525 ? 20.706  48.853 58.849 1.00 38.52  ? 525  ASN A C   1 
ATOM   4154 O O   . ASN A 1 525 ? 20.054  48.012 58.246 1.00 38.52  ? 525  ASN A O   1 
ATOM   4155 C CB  . ASN A 1 525 ? 20.368  51.123 57.876 1.00 41.09  ? 525  ASN A CB  1 
ATOM   4156 C CG  . ASN A 1 525 ? 19.623  52.447 57.957 1.00 41.09  ? 525  ASN A CG  1 
ATOM   4157 O OD1 . ASN A 1 525 ? 18.462  52.492 58.373 1.00 41.09  ? 525  ASN A OD1 1 
ATOM   4158 N ND2 . ASN A 1 525 ? 20.283  53.533 57.552 1.00 41.09  ? 525  ASN A ND2 1 
ATOM   4159 N N   . GLN A 1 526 ? 21.924  48.600 59.314 1.00 44.15  ? 526  GLN A N   1 
ATOM   4160 C CA  . GLN A 1 526 ? 22.525  47.294 59.072 1.00 44.15  ? 526  GLN A CA  1 
ATOM   4161 C C   . GLN A 1 526 ? 22.673  46.382 60.281 1.00 44.15  ? 526  GLN A C   1 
ATOM   4162 O O   . GLN A 1 526 ? 22.171  45.261 60.263 1.00 44.15  ? 526  GLN A O   1 
ATOM   4163 C CB  . GLN A 1 526 ? 23.891  47.448 58.416 1.00 74.47  ? 526  GLN A CB  1 
ATOM   4164 C CG  . GLN A 1 526 ? 23.892  48.224 57.114 1.00 74.47  ? 526  GLN A CG  1 
ATOM   4165 C CD  . GLN A 1 526 ? 25.283  48.254 56.458 1.00 74.47  ? 526  GLN A CD  1 
ATOM   4166 O OE1 . GLN A 1 526 ? 25.575  49.131 55.633 1.00 74.47  ? 526  GLN A OE1 1 
ATOM   4167 N NE2 . GLN A 1 526 ? 26.142  47.285 56.819 1.00 74.47  ? 526  GLN A NE2 1 
ATOM   4168 N N   . PHE A 1 527 ? 23.356  46.845 61.326 1.00 36.96  ? 527  PHE A N   1 
ATOM   4169 C CA  . PHE A 1 527 ? 23.575  46.012 62.502 1.00 36.96  ? 527  PHE A CA  1 
ATOM   4170 C C   . PHE A 1 527 ? 22.348  45.668 63.341 1.00 36.96  ? 527  PHE A C   1 
ATOM   4171 O O   . PHE A 1 527 ? 22.015  44.492 63.485 1.00 36.96  ? 527  PHE A O   1 
ATOM   4172 C CB  . PHE A 1 527 ? 24.640  46.629 63.416 1.00 27.54  ? 527  PHE A CB  1 
ATOM   4173 C CG  . PHE A 1 527 ? 24.970  45.777 64.617 1.00 27.54  ? 527  PHE A CG  1 
ATOM   4174 C CD1 . PHE A 1 527 ? 25.582  44.541 64.460 1.00 27.54  ? 527  PHE A CD1 1 
ATOM   4175 C CD2 . PHE A 1 527 ? 24.623  46.188 65.896 1.00 27.54  ? 527  PHE A CD2 1 
ATOM   4176 C CE1 . PHE A 1 527 ? 25.839  43.734 65.550 1.00 27.54  ? 527  PHE A CE1 1 
ATOM   4177 C CE2 . PHE A 1 527 ? 24.876  45.384 66.995 1.00 27.54  ? 527  PHE A CE2 1 
ATOM   4178 C CZ  . PHE A 1 527 ? 25.483  44.155 66.824 1.00 27.54  ? 527  PHE A CZ  1 
ATOM   4179 N N   . LEU A 1 528 ? 21.678  46.672 63.902 1.00 43.16  ? 528  LEU A N   1 
ATOM   4180 C CA  . LEU A 1 528 ? 20.519  46.405 64.754 1.00 43.16  ? 528  LEU A CA  1 
ATOM   4181 C C   . LEU A 1 528 ? 19.486  45.502 64.088 1.00 43.16  ? 528  LEU A C   1 
ATOM   4182 O O   . LEU A 1 528 ? 19.084  44.495 64.664 1.00 43.16  ? 528  LEU A O   1 
ATOM   4183 C CB  . LEU A 1 528 ? 19.853  47.705 65.226 1.00 37.04  ? 528  LEU A CB  1 
ATOM   4184 C CG  . LEU A 1 528 ? 18.912  47.490 66.424 1.00 37.04  ? 528  LEU A CG  1 
ATOM   4185 C CD1 . LEU A 1 528 ? 19.726  46.934 67.577 1.00 37.04  ? 528  LEU A CD1 1 
ATOM   4186 C CD2 . LEU A 1 528 ? 18.230  48.785 66.844 1.00 37.04  ? 528  LEU A CD2 1 
ATOM   4187 N N   . PRO A 1 529 ? 19.038  45.846 62.868 1.00 41.08  ? 529  PRO A N   1 
ATOM   4188 C CA  . PRO A 1 529 ? 18.050  45.004 62.189 1.00 41.08  ? 529  PRO A CA  1 
ATOM   4189 C C   . PRO A 1 529 ? 18.489  43.544 62.250 1.00 41.08  ? 529  PRO A C   1 
ATOM   4190 O O   . PRO A 1 529 ? 17.749  42.681 62.720 1.00 41.08  ? 529  PRO A O   1 
ATOM   4191 C CB  . PRO A 1 529 ? 18.063  45.552 60.774 1.00 38.01  ? 529  PRO A CB  1 
ATOM   4192 C CG  . PRO A 1 529 ? 18.303  46.997 61.001 1.00 38.01  ? 529  PRO A CG  1 
ATOM   4193 C CD  . PRO A 1 529 ? 19.402  46.998 62.027 1.00 38.01  ? 529  PRO A CD  1 
ATOM   4194 N N   . LYS A 1 530 ? 19.714  43.299 61.784 1.00 49.85  ? 530  LYS A N   1 
ATOM   4195 C CA  . LYS A 1 530 ? 20.348  41.976 61.767 1.00 49.85  ? 530  LYS A CA  1 
ATOM   4196 C C   . LYS A 1 530 ? 20.370  41.303 63.141 1.00 49.85  ? 530  LYS A C   1 
ATOM   4197 O O   . LYS A 1 530 ? 20.035  40.131 63.268 1.00 49.85  ? 530  LYS A O   1 
ATOM   4198 C CB  . LYS A 1 530 ? 21.780  42.114 61.240 1.00 73.76  ? 530  LYS A CB  1 
ATOM   4199 C CG  . LYS A 1 530 ? 22.582  40.828 61.206 1.00 73.76  ? 530  LYS A CG  1 
ATOM   4200 C CD  . LYS A 1 530 ? 23.851  40.997 60.370 1.00 73.76  ? 530  LYS A CD  1 
ATOM   4201 C CE  . LYS A 1 530 ? 24.617  39.674 60.251 1.00 73.76  ? 530  LYS A CE  1 
ATOM   4202 N NZ  . LYS A 1 530 ? 25.597  39.681 59.108 1.00 73.76  ? 530  LYS A NZ  1 
ATOM   4203 N N   . LEU A 1 531 ? 20.776  42.047 64.162 1.00 43.45  ? 531  LEU A N   1 
ATOM   4204 C CA  . LEU A 1 531 ? 20.826  41.524 65.523 1.00 43.45  ? 531  LEU A CA  1 
ATOM   4205 C C   . LEU A 1 531 ? 19.444  41.044 65.982 1.00 43.45  ? 531  LEU A C   1 
ATOM   4206 O O   . LEU A 1 531 ? 19.285  39.918 66.451 1.00 43.45  ? 531  LEU A O   1 
ATOM   4207 C CB  . LEU A 1 531 ? 21.355  42.610 66.466 1.00 41.68  ? 531  LEU A CB  1 
ATOM   4208 C CG  . LEU A 1 531 ? 21.452  42.278 67.956 1.00 41.68  ? 531  LEU A CG  1 
ATOM   4209 C CD1 . LEU A 1 531 ? 22.216  43.381 68.667 1.00 41.68  ? 531  LEU A CD1 1 
ATOM   4210 C CD2 . LEU A 1 531 ? 20.055  42.128 68.556 1.00 41.68  ? 531  LEU A CD2 1 
ATOM   4211 N N   . LEU A 1 532 ? 18.448  41.910 65.857 1.00 56.28  ? 532  LEU A N   1 
ATOM   4212 C CA  . LEU A 1 532 ? 17.081  41.567 66.245 1.00 56.28  ? 532  LEU A CA  1 
ATOM   4213 C C   . LEU A 1 532 ? 16.550  40.347 65.485 1.00 56.28  ? 532  LEU A C   1 
ATOM   4214 O O   . LEU A 1 532 ? 15.720  39.597 66.011 1.00 56.28  ? 532  LEU A O   1 
ATOM   4215 C CB  . LEU A 1 532 ? 16.145  42.753 66.000 1.00 43.49  ? 532  LEU A CB  1 
ATOM   4216 C CG  . LEU A 1 532 ? 16.329  43.929 66.953 1.00 43.49  ? 532  LEU A CG  1 
ATOM   4217 C CD1 . LEU A 1 532 ? 15.617  45.162 66.418 1.00 43.49  ? 532  LEU A CD1 1 
ATOM   4218 C CD2 . LEU A 1 532 ? 15.809  43.527 68.327 1.00 43.49  ? 532  LEU A CD2 1 
ATOM   4219 N N   . ASN A 1 533 ? 17.019  40.146 64.254 1.00 58.42  ? 533  ASN A N   1 
ATOM   4220 C CA  . ASN A 1 533 ? 16.556  39.005 63.470 1.00 58.42  ? 533  ASN A CA  1 
ATOM   4221 C C   . ASN A 1 533 ? 17.211  37.691 63.882 1.00 58.42  ? 533  ASN A C   1 
ATOM   4222 O O   . ASN A 1 533 ? 16.598  36.627 63.799 1.00 58.42  ? 533  ASN A O   1 
ATOM   4223 C CB  . ASN A 1 533 ? 16.798  39.223 61.980 1.00 57.01  ? 533  ASN A CB  1 
ATOM   4224 C CG  . ASN A 1 533 ? 16.237  38.098 61.143 1.00 57.01  ? 533  ASN A CG  1 
ATOM   4225 O OD1 . ASN A 1 533 ? 16.979  37.337 60.528 1.00 57.01  ? 533  ASN A OD1 1 
ATOM   4226 N ND2 . ASN A 1 533 ? 14.913  37.975 61.132 1.00 57.01  ? 533  ASN A ND2 1 
ATOM   4227 N N   . ALA A 1 534 ? 18.462  37.757 64.316 1.00 71.79  ? 534  ALA A N   1 
ATOM   4228 C CA  . ALA A 1 534 ? 19.152  36.547 64.725 1.00 71.79  ? 534  ALA A CA  1 
ATOM   4229 C C   . ALA A 1 534 ? 18.749  36.165 66.148 1.00 71.79  ? 534  ALA A C   1 
ATOM   4230 O O   . ALA A 1 534 ? 18.816  34.992 66.518 1.00 71.79  ? 534  ALA A O   1 
ATOM   4231 C CB  . ALA A 1 534 ? 20.664  36.745 64.633 1.00 60.56  ? 534  ALA A CB  1 
ATOM   4232 N N   . THR A 1 535 ? 18.322  37.149 66.940 1.00 88.42  ? 535  THR A N   1 
ATOM   4233 C CA  . THR A 1 535 ? 17.920  36.887 68.326 1.00 88.42  ? 535  THR A CA  1 
ATOM   4234 C C   . THR A 1 535 ? 16.437  37.166 68.563 1.00 88.42  ? 535  THR A C   1 
ATOM   4235 O O   . THR A 1 535 ? 15.685  37.244 67.568 1.00 88.42  ? 535  THR A O   1 
ATOM   4236 C CB  . THR A 1 535 ? 18.747  37.732 69.336 1.00 84.28  ? 535  THR A CB  1 
ATOM   4237 O OG1 . THR A 1 535 ? 18.387  39.116 69.226 1.00 84.28  ? 535  THR A OG1 1 
ATOM   4238 C CG2 . THR A 1 535 ? 20.247  37.574 69.062 1.00 84.28  ? 535  THR A CG2 1 
HETATM 4239 O O   . HOH B 2 .   ? 1.523   89.981 55.018 1.00 21.41  ? 1001 HOH A O   1 
HETATM 4240 O O   . HOH B 2 .   ? 19.607  62.429 32.490 1.00 39.31  ? 1002 HOH A O   1 
HETATM 4241 O O   . HOH B 2 .   ? -0.700  63.553 59.239 1.00 33.10  ? 1003 HOH A O   1 
HETATM 4242 O O   . HOH B 2 .   ? 21.490  57.744 60.861 1.00 47.53  ? 1004 HOH A O   1 
HETATM 4243 O O   . HOH B 2 .   ? 7.553   52.218 56.605 1.00 39.57  ? 1005 HOH A O   1 
HETATM 4244 O O   . HOH B 2 .   ? 5.201   63.562 63.234 1.00 44.96  ? 1006 HOH A O   1 
HETATM 4245 O O   . HOH B 2 .   ? -18.954 85.005 50.701 1.00 41.57  ? 1007 HOH A O   1 
HETATM 4246 O O   . HOH B 2 .   ? 27.917  63.860 46.017 1.00 49.39  ? 1008 HOH A O   1 
HETATM 4247 O O   . HOH B 2 .   ? 7.296   78.955 68.253 1.00 40.99  ? 1009 HOH A O   1 
HETATM 4248 O O   . HOH B 2 .   ? -3.769  45.887 73.263 1.00 44.98  ? 1010 HOH A O   1 
HETATM 4249 O O   . HOH B 2 .   ? -7.485  68.357 58.019 1.00 47.79  ? 1011 HOH A O   1 
HETATM 4250 O O   . HOH B 2 .   ? 4.104   80.845 51.585 1.00 39.70  ? 1012 HOH A O   1 
HETATM 4251 O O   . HOH B 2 .   ? 19.316  60.275 41.887 1.00 41.18  ? 1013 HOH A O   1 
HETATM 4252 O O   . HOH B 2 .   ? 4.464   68.749 61.823 1.00 38.60  ? 1014 HOH A O   1 
HETATM 4253 O O   . HOH B 2 .   ? 21.201  62.310 36.327 1.00 36.09  ? 1015 HOH A O   1 
HETATM 4254 O O   . HOH B 2 .   ? -10.343 66.186 69.158 1.00 40.53  ? 1016 HOH A O   1 
HETATM 4255 O O   . HOH B 2 .   ? 25.030  73.585 39.021 1.00 38.28  ? 1017 HOH A O   1 
HETATM 4256 O O   . HOH B 2 .   ? 10.828  55.968 68.870 1.00 36.55  ? 1018 HOH A O   1 
HETATM 4257 O O   . HOH B 2 .   ? 9.054   81.125 37.203 1.00 46.78  ? 1019 HOH A O   1 
HETATM 4258 O O   . HOH B 2 .   ? -4.564  85.735 39.416 1.00 44.85  ? 1020 HOH A O   1 
HETATM 4259 O O   . HOH B 2 .   ? -2.242  78.089 62.737 1.00 41.46  ? 1021 HOH A O   1 
HETATM 4260 O O   . HOH B 2 .   ? 25.456  60.536 52.615 1.00 60.52  ? 1022 HOH A O   1 
HETATM 4261 O O   . HOH B 2 .   ? 23.849  77.543 54.293 1.00 40.19  ? 1023 HOH A O   1 
HETATM 4262 O O   . HOH B 2 .   ? 7.132   71.419 39.418 1.00 77.69  ? 1024 HOH A O   1 
HETATM 4263 O O   . HOH B 2 .   ? 3.010   54.113 63.743 1.00 34.33  ? 1025 HOH A O   1 
HETATM 4264 O O   . HOH B 2 .   ? -6.862  61.677 65.124 1.00 39.97  ? 1026 HOH A O   1 
HETATM 4265 O O   . HOH B 2 .   ? -15.085 66.502 52.218 1.00 49.53  ? 1027 HOH A O   1 
HETATM 4266 O O   . HOH B 2 .   ? 22.733  79.439 61.631 1.00 54.20  ? 1028 HOH A O   1 
HETATM 4267 O O   . HOH B 2 .   ? 3.941   66.897 36.284 1.00 52.70  ? 1029 HOH A O   1 
HETATM 4268 O O   . HOH B 2 .   ? -4.794  70.937 34.256 1.00 42.73  ? 1030 HOH A O   1 
HETATM 4269 O O   . HOH B 2 .   ? 4.079   69.355 58.286 1.00 47.73  ? 1031 HOH A O   1 
HETATM 4270 O O   . HOH B 2 .   ? 21.169  82.941 54.157 1.00 48.21  ? 1032 HOH A O   1 
HETATM 4271 O O   . HOH B 2 .   ? -0.511  61.351 72.639 1.00 42.08  ? 1033 HOH A O   1 
HETATM 4272 O O   . HOH B 2 .   ? -3.946  52.205 56.434 1.00 35.44  ? 1034 HOH A O   1 
HETATM 4273 O O   . HOH B 2 .   ? -6.468  58.906 40.454 1.00 46.92  ? 1035 HOH A O   1 
HETATM 4274 O O   . HOH B 2 .   ? 16.494  89.026 52.465 1.00 42.34  ? 1036 HOH A O   1 
HETATM 4275 O O   . HOH B 2 .   ? -4.644  83.369 52.289 1.00 41.95  ? 1037 HOH A O   1 
HETATM 4276 O O   . HOH B 2 .   ? -9.205  58.268 64.883 1.00 48.42  ? 1038 HOH A O   1 
HETATM 4277 O O   . HOH B 2 .   ? 7.571   49.257 59.491 1.00 35.81  ? 1039 HOH A O   1 
HETATM 4278 O O   . HOH B 2 .   ? 18.490  50.585 45.262 1.00 38.89  ? 1040 HOH A O   1 
HETATM 4279 O O   . HOH B 2 .   ? -9.866  65.058 55.726 1.00 67.50  ? 1041 HOH A O   1 
HETATM 4280 O O   . HOH B 2 .   ? 20.709  84.590 62.799 1.00 58.59  ? 1042 HOH A O   1 
HETATM 4281 O O   . HOH B 2 .   ? 25.070  58.325 55.602 1.00 50.94  ? 1043 HOH A O   1 
HETATM 4282 O O   . HOH B 2 .   ? -9.976  62.799 59.672 1.00 46.94  ? 1044 HOH A O   1 
HETATM 4283 O O   . HOH B 2 .   ? -15.209 87.268 32.895 1.00 55.91  ? 1045 HOH A O   1 
HETATM 4284 O O   . HOH B 2 .   ? 25.103  59.158 40.649 1.00 41.21  ? 1046 HOH A O   1 
HETATM 4285 O O   . HOH B 2 .   ? 3.685   64.645 65.280 1.00 43.10  ? 1047 HOH A O   1 
HETATM 4286 O O   . HOH B 2 .   ? -6.540  83.899 38.889 1.00 46.35  ? 1048 HOH A O   1 
HETATM 4287 O O   . HOH B 2 .   ? -2.354  57.671 63.506 1.00 54.03  ? 1049 HOH A O   1 
HETATM 4288 O O   . HOH B 2 .   ? -8.340  79.690 31.909 1.00 49.36  ? 1050 HOH A O   1 
HETATM 4289 O O   . HOH B 2 .   ? -4.283  70.437 62.825 1.00 45.80  ? 1051 HOH A O   1 
HETATM 4290 O O   . HOH B 2 .   ? 24.772  66.805 85.298 1.00 49.01  ? 1052 HOH A O   1 
HETATM 4291 O O   . HOH B 2 .   ? 2.171   62.691 70.811 1.00 40.41  ? 1053 HOH A O   1 
HETATM 4292 O O   . HOH B 2 .   ? -17.926 65.755 61.698 1.00 51.98  ? 1054 HOH A O   1 
HETATM 4293 O O   . HOH B 2 .   ? 11.741  74.535 32.541 1.00 45.03  ? 1055 HOH A O   1 
HETATM 4294 O O   . HOH B 2 .   ? 5.909   81.941 64.572 1.00 46.09  ? 1056 HOH A O   1 
HETATM 4295 O O   . HOH B 2 .   ? -0.535  69.620 62.632 1.00 35.84  ? 1057 HOH A O   1 
HETATM 4296 O O   . HOH B 2 .   ? 11.719  48.173 74.079 1.00 70.34  ? 1058 HOH A O   1 
HETATM 4297 O O   . HOH B 2 .   ? -15.177 60.610 48.954 1.00 52.52  ? 1059 HOH A O   1 
HETATM 4298 O O   . HOH B 2 .   ? -2.142  75.851 52.810 1.00 83.18  ? 1060 HOH A O   1 
HETATM 4299 O O   . HOH B 2 .   ? 23.429  51.891 81.318 1.00 53.03  ? 1061 HOH A O   1 
HETATM 4300 O O   . HOH B 2 .   ? 13.609  86.895 47.076 1.00 39.36  ? 1062 HOH A O   1 
HETATM 4301 O O   . HOH B 2 .   ? -7.100  50.569 49.650 1.00 53.29  ? 1063 HOH A O   1 
HETATM 4302 O O   . HOH B 2 .   ? -1.493  70.186 52.962 1.00 49.18  ? 1064 HOH A O   1 
HETATM 4303 O O   . HOH B 2 .   ? -12.642 77.588 30.522 1.00 47.53  ? 1065 HOH A O   1 
HETATM 4304 O O   . HOH B 2 .   ? 0.058   69.708 59.958 1.00 30.88  ? 1066 HOH A O   1 
HETATM 4305 O O   . HOH B 2 .   ? -19.383 55.234 48.975 1.00 66.15  ? 1067 HOH A O   1 
HETATM 4306 O O   . HOH B 2 .   ? 28.995  59.447 61.699 1.00 42.76  ? 1068 HOH A O   1 
HETATM 4307 O O   . HOH B 2 .   ? -11.018 47.615 76.262 1.00 39.05  ? 1069 HOH A O   1 
HETATM 4308 O O   . HOH B 2 .   ? -17.876 63.882 67.571 1.00 39.18  ? 1070 HOH A O   1 
HETATM 4309 O O   . HOH B 2 .   ? 9.849   52.655 80.183 1.00 43.64  ? 1071 HOH A O   1 
HETATM 4310 O O   . HOH B 2 .   ? -3.619  69.000 79.963 1.00 36.79  ? 1072 HOH A O   1 
HETATM 4311 O O   . HOH B 2 .   ? -14.434 65.845 67.364 1.00 51.30  ? 1073 HOH A O   1 
HETATM 4312 O O   . HOH B 2 .   ? -0.122  66.832 37.360 1.00 66.24  ? 1074 HOH A O   1 
HETATM 4313 O O   . HOH B 2 .   ? -3.443  76.502 64.621 1.00 57.05  ? 1075 HOH A O   1 
HETATM 4314 O O   . HOH B 2 .   ? 21.482  84.422 56.430 1.00 47.79  ? 1076 HOH A O   1 
HETATM 4315 O O   . HOH B 2 .   ? 22.464  51.481 45.872 1.00 47.10  ? 1077 HOH A O   1 
HETATM 4316 O O   . HOH B 2 .   ? -20.282 77.328 47.500 1.00 43.45  ? 1078 HOH A O   1 
HETATM 4317 O O   . HOH B 2 .   ? -12.922 40.030 62.947 1.00 46.01  ? 1079 HOH A O   1 
HETATM 4318 O O   . HOH B 2 .   ? 22.499  73.721 65.880 1.00 44.48  ? 1080 HOH A O   1 
HETATM 4319 O O   . HOH B 2 .   ? -6.355  46.414 51.543 1.00 61.16  ? 1081 HOH A O   1 
HETATM 4320 O O   . HOH B 2 .   ? 0.506   40.754 57.600 1.00 44.46  ? 1082 HOH A O   1 
HETATM 4321 O O   . HOH B 2 .   ? 15.646  52.636 61.763 1.00 51.44  ? 1083 HOH A O   1 
HETATM 4322 O O   . HOH B 2 .   ? 22.865  72.767 76.872 1.00 45.49  ? 1084 HOH A O   1 
HETATM 4323 O O   . HOH B 2 .   ? -2.411  57.705 66.826 1.00 68.63  ? 1085 HOH A O   1 
HETATM 4324 O O   . HOH B 2 .   ? -0.500  41.380 51.569 1.00 48.36  ? 1086 HOH A O   1 
HETATM 4325 O O   . HOH B 2 .   ? 33.358  68.807 48.085 1.00 48.25  ? 1087 HOH A O   1 
HETATM 4326 O O   . HOH B 2 .   ? -15.933 72.478 54.519 1.00 54.16  ? 1088 HOH A O   1 
HETATM 4327 O O   . HOH B 2 .   ? 22.858  54.226 55.177 1.00 52.48  ? 1089 HOH A O   1 
HETATM 4328 O O   . HOH B 2 .   ? 3.700   46.201 61.436 1.00 46.26  ? 1090 HOH A O   1 
HETATM 4329 O O   . HOH B 2 .   ? 19.503  67.774 38.673 1.00 49.60  ? 1091 HOH A O   1 
HETATM 4330 O O   . HOH B 2 .   ? 13.391  69.220 57.410 1.00 61.69  ? 1092 HOH A O   1 
HETATM 4331 O O   . HOH B 2 .   ? 15.526  36.561 58.346 1.00 56.92  ? 1093 HOH A O   1 
HETATM 4332 O O   . HOH B 2 .   ? -18.605 72.624 51.490 1.00 40.36  ? 1094 HOH A O   1 
HETATM 4333 O O   . HOH B 2 .   ? 19.649  58.548 33.755 1.00 46.21  ? 1095 HOH A O   1 
HETATM 4334 O O   . HOH B 2 .   ? -15.113 47.260 45.606 1.00 49.17  ? 1096 HOH A O   1 
HETATM 4335 O O   . HOH B 2 .   ? 30.853  58.626 50.380 1.00 70.25  ? 1097 HOH A O   1 
HETATM 4336 O O   . HOH B 2 .   ? 20.534  46.919 52.087 1.00 48.87  ? 1098 HOH A O   1 
HETATM 4337 O O   . HOH B 2 .   ? 34.242  65.072 44.500 1.00 54.60  ? 1099 HOH A O   1 
HETATM 4338 O O   . HOH B 2 .   ? -2.248  68.957 67.558 1.00 37.52  ? 1100 HOH A O   1 
HETATM 4339 O O   . HOH B 2 .   ? 26.359  64.952 61.447 1.00 52.19  ? 1101 HOH A O   1 
HETATM 4340 O O   . HOH B 2 .   ? -12.665 72.405 65.964 1.00 42.20  ? 1102 HOH A O   1 
HETATM 4341 O O   . HOH B 2 .   ? 12.143  67.876 83.809 1.00 47.05  ? 1103 HOH A O   1 
HETATM 4342 O O   . HOH B 2 .   ? 30.281  58.003 66.074 1.00 53.30  ? 1104 HOH A O   1 
HETATM 4343 O O   . HOH B 2 .   ? 21.400  72.749 79.211 1.00 54.39  ? 1105 HOH A O   1 
HETATM 4344 O O   . HOH B 2 .   ? 22.182  60.715 86.734 1.00 52.73  ? 1106 HOH A O   1 
HETATM 4345 O O   . HOH B 2 .   ? -3.710  50.910 60.098 1.00 51.23  ? 1107 HOH A O   1 
HETATM 4346 O O   . HOH B 2 .   ? -7.630  85.916 32.718 1.00 46.25  ? 1108 HOH A O   1 
HETATM 4347 O O   . HOH B 2 .   ? 18.556  85.685 50.495 1.00 44.34  ? 1109 HOH A O   1 
HETATM 4348 O O   . HOH B 2 .   ? 19.457  79.210 43.367 1.00 58.79  ? 1110 HOH A O   1 
HETATM 4349 O O   . HOH B 2 .   ? 34.041  63.414 83.964 1.00 46.71  ? 1111 HOH A O   1 
HETATM 4350 O O   . HOH B 2 .   ? 28.694  65.407 43.300 1.00 50.89  ? 1112 HOH A O   1 
HETATM 4351 O O   . HOH B 2 .   ? -22.548 80.961 36.279 1.00 47.58  ? 1113 HOH A O   1 
HETATM 4352 O O   . HOH B 2 .   ? 7.310   46.894 54.040 1.00 42.87  ? 1114 HOH A O   1 
HETATM 4353 O O   . HOH B 2 .   ? -5.155  39.798 57.984 1.00 54.50  ? 1115 HOH A O   1 
HETATM 4354 O O   . HOH B 2 .   ? 12.188  51.189 59.641 1.00 50.24  ? 1116 HOH A O   1 
HETATM 4355 O O   . HOH B 2 .   ? 14.959  64.127 32.582 1.00 52.65  ? 1117 HOH A O   1 
HETATM 4356 O O   . HOH B 2 .   ? 2.595   40.376 59.555 1.00 49.43  ? 1118 HOH A O   1 
HETATM 4357 O O   . HOH B 2 .   ? -22.035 59.460 62.770 1.00 49.86  ? 1119 HOH A O   1 
HETATM 4358 O O   . HOH B 2 .   ? 1.352   43.297 55.449 1.00 55.03  ? 1120 HOH A O   1 
HETATM 4359 O O   . HOH B 2 .   ? -19.870 56.692 59.669 1.00 76.89  ? 1121 HOH A O   1 
HETATM 4360 O O   . HOH B 2 .   ? 11.489  78.079 35.641 1.00 62.90  ? 1122 HOH A O   1 
HETATM 4361 O O   . HOH B 2 .   ? 3.466   50.769 69.989 1.00 47.75  ? 1123 HOH A O   1 
HETATM 4362 O O   . HOH B 2 .   ? 6.477   90.701 69.880 1.00 54.19  ? 1124 HOH A O   1 
HETATM 4363 O O   . HOH B 2 .   ? 30.456  62.848 74.685 1.00 59.75  ? 1125 HOH A O   1 
HETATM 4364 O O   . HOH B 2 .   ? -5.197  60.566 75.192 1.00 51.83  ? 1126 HOH A O   1 
HETATM 4365 O O   . HOH B 2 .   ? 23.645  79.230 46.964 1.00 48.99  ? 1127 HOH A O   1 
HETATM 4366 O O   . HOH B 2 .   ? 30.220  76.974 45.065 1.00 49.41  ? 1128 HOH A O   1 
HETATM 4367 O O   . HOH B 2 .   ? -10.552 81.768 55.558 1.00 47.47  ? 1129 HOH A O   1 
HETATM 4368 O O   . HOH B 2 .   ? -5.573  44.879 57.676 1.00 48.77  ? 1130 HOH A O   1 
HETATM 4369 O O   . HOH B 2 .   ? 4.801   50.796 62.364 1.00 43.21  ? 1131 HOH A O   1 
HETATM 4370 O O   . HOH B 2 .   ? -6.132  49.589 61.201 1.00 48.05  ? 1132 HOH A O   1 
HETATM 4371 O O   . HOH B 2 .   ? 28.619  75.679 39.198 1.00 57.17  ? 1133 HOH A O   1 
HETATM 4372 O O   . HOH B 2 .   ? 12.006  64.795 35.345 1.00 45.92  ? 1134 HOH A O   1 
HETATM 4373 O O   . HOH B 2 .   ? 7.583   54.614 81.044 1.00 48.92  ? 1135 HOH A O   1 
HETATM 4374 O O   . HOH B 2 .   ? -15.416 67.506 49.672 1.00 40.81  ? 1136 HOH A O   1 
HETATM 4375 O O   . HOH B 2 .   ? 19.906  64.361 86.317 1.00 47.81  ? 1137 HOH A O   1 
HETATM 4376 O O   . HOH B 2 .   ? 13.977  40.212 75.893 1.00 53.19  ? 1138 HOH A O   1 
HETATM 4377 O O   . HOH B 2 .   ? 10.110  88.862 60.471 1.00 70.03  ? 1139 HOH A O   1 
HETATM 4378 O O   . HOH B 2 .   ? -1.807  51.270 73.684 1.00 63.41  ? 1140 HOH A O   1 
HETATM 4379 O O   . HOH B 2 .   ? 9.955   56.300 36.434 1.00 43.24  ? 1141 HOH A O   1 
HETATM 4380 O O   . HOH B 2 .   ? 2.039   83.785 60.803 1.00 53.99  ? 1142 HOH A O   1 
HETATM 4381 O O   . HOH B 2 .   ? 18.482  91.484 62.537 1.00 42.34  ? 1143 HOH A O   1 
HETATM 4382 O O   . HOH B 2 .   ? 0.048   75.383 78.945 1.00 58.44  ? 1144 HOH A O   1 
HETATM 4383 O O   . HOH B 2 .   ? 3.728   47.847 65.595 1.00 58.09  ? 1145 HOH A O   1 
HETATM 4384 O O   . HOH B 2 .   ? 20.681  63.191 65.205 1.00 53.67  ? 1146 HOH A O   1 
HETATM 4385 O O   . HOH B 2 .   ? -3.351  67.618 31.819 1.00 46.44  ? 1147 HOH A O   1 
HETATM 4386 O O   . HOH B 2 .   ? 3.395   81.371 32.515 1.00 49.72  ? 1148 HOH A O   1 
HETATM 4387 O O   . HOH B 2 .   ? 7.310   49.480 66.759 1.00 54.23  ? 1149 HOH A O   1 
HETATM 4388 O O   . HOH B 2 .   ? 0.376   83.620 58.012 1.00 49.93  ? 1150 HOH A O   1 
HETATM 4389 O O   . HOH B 2 .   ? -12.170 67.370 37.211 1.00 44.57  ? 1151 HOH A O   1 
HETATM 4390 O O   . HOH B 2 .   ? 15.902  59.141 87.938 1.00 58.20  ? 1152 HOH A O   1 
HETATM 4391 O O   . HOH B 2 .   ? 16.324  72.712 85.081 1.00 66.20  ? 1153 HOH A O   1 
HETATM 4392 O O   . HOH B 2 .   ? 25.208  44.192 55.746 1.00 49.87  ? 1154 HOH A O   1 
HETATM 4393 O O   . HOH B 2 .   ? -14.847 87.322 49.529 1.00 50.84  ? 1155 HOH A O   1 
HETATM 4394 O O   . HOH B 2 .   ? -8.124  71.761 52.750 1.00 61.07  ? 1156 HOH A O   1 
HETATM 4395 O O   . HOH B 2 .   ? -14.654 59.560 57.045 1.00 45.49  ? 1157 HOH A O   1 
HETATM 4396 O O   . HOH B 2 .   ? -11.711 39.077 65.446 1.00 53.03  ? 1158 HOH A O   1 
HETATM 4397 O O   . HOH B 2 .   ? 23.181  67.344 48.130 1.00 37.90  ? 1159 HOH A O   1 
HETATM 4398 O O   . HOH B 2 .   ? 7.722   78.656 36.756 1.00 57.08  ? 1160 HOH A O   1 
HETATM 4399 O O   . HOH B 2 .   ? 21.323  72.223 68.083 1.00 55.49  ? 1161 HOH A O   1 
HETATM 4400 O O   . HOH B 2 .   ? -21.898 70.376 47.601 1.00 43.91  ? 1162 HOH A O   1 
HETATM 4401 O O   . HOH B 2 .   ? 14.450  42.566 47.872 1.00 50.10  ? 1163 HOH A O   1 
HETATM 4402 O O   . HOH B 2 .   ? -1.157  79.652 67.232 1.00 48.34  ? 1164 HOH A O   1 
HETATM 4403 O O   . HOH B 2 .   ? -7.306  69.346 29.429 1.00 54.48  ? 1165 HOH A O   1 
HETATM 4404 O O   . HOH B 2 .   ? -6.683  74.572 70.320 1.00 52.01  ? 1166 HOH A O   1 
HETATM 4405 O O   . HOH B 2 .   ? 4.988   88.471 68.408 1.00 50.56  ? 1167 HOH A O   1 
HETATM 4406 O O   . HOH B 2 .   ? 10.803  43.673 54.018 1.00 57.60  ? 1168 HOH A O   1 
HETATM 4407 O O   . HOH B 2 .   ? 9.174   50.157 37.163 1.00 44.41  ? 1169 HOH A O   1 
HETATM 4408 O O   . HOH B 2 .   ? 11.772  67.451 67.683 1.00 58.88  ? 1170 HOH A O   1 
HETATM 4409 O O   . HOH B 2 .   ? 9.222   91.293 50.076 1.00 59.34  ? 1171 HOH A O   1 
HETATM 4410 O O   . HOH B 2 .   ? 14.356  51.311 56.863 1.00 46.69  ? 1172 HOH A O   1 
HETATM 4411 O O   . HOH B 2 .   ? 14.058  78.293 86.647 1.00 47.75  ? 1173 HOH A O   1 
HETATM 4412 O O   . HOH B 2 .   ? 11.823  84.237 72.222 1.00 50.89  ? 1174 HOH A O   1 
HETATM 4413 O O   . HOH B 2 .   ? -21.591 46.101 66.960 1.00 62.24  ? 1175 HOH A O   1 
HETATM 4414 O O   . HOH B 2 .   ? 9.687   80.352 65.419 1.00 60.27  ? 1176 HOH A O   1 
HETATM 4415 O O   . HOH B 2 .   ? 22.930  78.189 43.978 1.00 55.28  ? 1177 HOH A O   1 
HETATM 4416 O O   . HOH B 2 .   ? -18.969 77.832 49.908 1.00 50.71  ? 1178 HOH A O   1 
HETATM 4417 O O   . HOH B 2 .   ? 15.562  80.602 70.260 1.00 46.96  ? 1179 HOH A O   1 
HETATM 4418 O O   . HOH B 2 .   ? 13.030  43.952 75.727 1.00 75.24  ? 1180 HOH A O   1 
HETATM 4419 O O   . HOH B 2 .   ? 18.501  67.676 73.475 1.00 67.70  ? 1181 HOH A O   1 
HETATM 4420 O O   . HOH B 2 .   ? -3.553  86.949 33.782 1.00 69.16  ? 1182 HOH A O   1 
HETATM 4421 O O   . HOH B 2 .   ? 15.555  77.182 77.956 1.00 49.86  ? 1183 HOH A O   1 
HETATM 4422 O O   . HOH B 2 .   ? -21.001 83.106 34.921 1.00 59.21  ? 1184 HOH A O   1 
HETATM 4423 O O   . HOH B 2 .   ? 24.149  76.777 63.228 1.00 53.78  ? 1185 HOH A O   1 
HETATM 4424 O O   . HOH B 2 .   ? -17.805 68.912 48.870 1.00 64.24  ? 1186 HOH A O   1 
HETATM 4425 O O   . HOH B 2 .   ? 13.088  83.962 47.618 1.00 47.25  ? 1187 HOH A O   1 
HETATM 4426 O O   . HOH B 2 .   ? -9.479  70.427 54.725 1.00 64.67  ? 1188 HOH A O   1 
HETATM 4427 O O   . HOH B 2 .   ? 15.215  66.398 84.445 1.00 60.58  ? 1189 HOH A O   1 
HETATM 4428 O O   . HOH B 2 .   ? 3.261   51.521 64.785 1.00 43.42  ? 1190 HOH A O   1 
HETATM 4429 O O   . HOH B 2 .   ? 0.329   85.088 27.422 1.00 86.02  ? 1191 HOH A O   1 
HETATM 4430 O O   . HOH B 2 .   ? -11.845 38.358 51.570 1.00 58.14  ? 1192 HOH A O   1 
HETATM 4431 O O   . HOH B 2 .   ? 14.068  77.111 63.246 1.00 58.19  ? 1193 HOH A O   1 
HETATM 4432 O O   . HOH B 2 .   ? 7.217   62.720 35.234 1.00 61.86  ? 1194 HOH A O   1 
HETATM 4433 O O   . HOH B 2 .   ? 7.088   65.450 80.624 1.00 54.28  ? 1195 HOH A O   1 
HETATM 4434 O O   . HOH B 2 .   ? -24.775 55.899 59.980 1.00 52.88  ? 1196 HOH A O   1 
HETATM 4435 O O   . HOH B 2 .   ? 32.475  62.212 56.641 1.00 74.43  ? 1197 HOH A O   1 
HETATM 4436 O O   . HOH B 2 .   ? 22.290  62.084 41.815 1.00 49.61  ? 1198 HOH A O   1 
HETATM 4437 O O   . HOH B 2 .   ? 17.906  39.185 74.981 1.00 47.77  ? 1199 HOH A O   1 
HETATM 4438 O O   . HOH B 2 .   ? 5.083   41.676 57.720 1.00 51.45  ? 1200 HOH A O   1 
HETATM 4439 O O   . HOH B 2 .   ? 3.735   65.853 69.774 1.00 44.18  ? 1201 HOH A O   1 
HETATM 4440 O O   . HOH B 2 .   ? -4.564  81.082 32.130 1.00 47.68  ? 1202 HOH A O   1 
HETATM 4441 O O   . HOH B 2 .   ? 11.748  91.032 57.837 1.00 60.97  ? 1203 HOH A O   1 
HETATM 4442 O O   . HOH B 2 .   ? 25.497  61.928 74.393 1.00 56.78  ? 1204 HOH A O   1 
HETATM 4443 O O   . HOH B 2 .   ? -20.141 59.374 59.547 1.00 61.74  ? 1205 HOH A O   1 
HETATM 4444 O O   . HOH B 2 .   ? 22.108  87.638 51.982 1.00 50.78  ? 1206 HOH A O   1 
HETATM 4445 O O   . HOH B 2 .   ? 0.171   70.321 68.699 1.00 52.13  ? 1207 HOH A O   1 
HETATM 4446 O O   . HOH B 2 .   ? 25.601  49.740 77.575 1.00 71.34  ? 1208 HOH A O   1 
HETATM 4447 O O   . HOH B 2 .   ? 22.678  56.867 39.294 1.00 56.21  ? 1209 HOH A O   1 
HETATM 4448 O O   . HOH B 2 .   ? -2.059  98.078 48.731 1.00 60.84  ? 1210 HOH A O   1 
HETATM 4449 O O   . HOH B 2 .   ? -8.921  60.858 63.592 1.00 53.15  ? 1211 HOH A O   1 
HETATM 4450 O O   . HOH B 2 .   ? 14.795  75.161 86.272 1.00 49.58  ? 1212 HOH A O   1 
HETATM 4451 O O   . HOH B 2 .   ? 20.012  74.453 69.045 1.00 39.56  ? 1213 HOH A O   1 
HETATM 4452 O O   . HOH B 2 .   ? -23.047 49.337 53.372 1.00 53.73  ? 1214 HOH A O   1 
HETATM 4453 O O   . HOH B 2 .   ? -4.538  80.197 63.134 1.00 46.49  ? 1215 HOH A O   1 
HETATM 4454 O O   . HOH B 2 .   ? 23.573  84.924 48.958 1.00 63.65  ? 1216 HOH A O   1 
HETATM 4455 O O   . HOH B 2 .   ? 23.989  70.309 40.032 1.00 44.34  ? 1217 HOH A O   1 
HETATM 4456 O O   . HOH B 2 .   ? 0.532   64.475 76.292 1.00 55.68  ? 1218 HOH A O   1 
HETATM 4457 O O   . HOH B 2 .   ? -0.915  66.753 40.056 1.00 49.60  ? 1219 HOH A O   1 
HETATM 4458 O O   . HOH B 2 .   ? -24.164 80.778 42.048 1.00 47.46  ? 1220 HOH A O   1 
HETATM 4459 O O   . HOH B 2 .   ? 3.453   81.862 73.639 1.00 57.57  ? 1221 HOH A O   1 
HETATM 4460 O O   . HOH B 2 .   ? 25.559  60.525 68.997 1.00 45.08  ? 1222 HOH A O   1 
HETATM 4461 O O   . HOH B 2 .   ? -0.701  74.892 31.071 1.00 53.86  ? 1223 HOH A O   1 
HETATM 4462 O O   . HOH B 2 .   ? 15.745  43.381 45.294 1.00 68.91  ? 1224 HOH A O   1 
HETATM 4463 O O   . HOH B 2 .   ? 15.814  34.136 61.188 1.00 59.52  ? 1225 HOH A O   1 
HETATM 4464 O O   . HOH B 2 .   ? 16.693  57.752 36.310 1.00 44.18  ? 1226 HOH A O   1 
HETATM 4465 O O   . HOH B 2 .   ? 16.923  74.256 77.808 1.00 71.75  ? 1227 HOH A O   1 
HETATM 4466 O O   . HOH B 2 .   ? 18.328  75.332 37.373 1.00 50.60  ? 1228 HOH A O   1 
HETATM 4467 O O   . HOH B 2 .   ? 9.241   45.252 43.854 1.00 52.55  ? 1229 HOH A O   1 
HETATM 4468 O O   . HOH B 2 .   ? 4.707   57.202 76.795 1.00 52.46  ? 1230 HOH A O   1 
HETATM 4469 O O   . HOH B 2 .   ? -15.481 75.147 50.944 1.00 48.17  ? 1231 HOH A O   1 
HETATM 4470 O O   . HOH B 2 .   ? -13.599 51.153 49.391 1.00 44.89  ? 1232 HOH A O   1 
HETATM 4471 O O   . HOH B 2 .   ? 31.524  67.353 77.140 1.00 53.21  ? 1233 HOH A O   1 
HETATM 4472 O O   . HOH B 2 .   ? 12.787  48.705 37.168 1.00 50.68  ? 1234 HOH A O   1 
HETATM 4473 O O   . HOH B 2 .   ? 1.275   66.646 31.998 1.00 61.09  ? 1235 HOH A O   1 
HETATM 4474 O O   . HOH B 2 .   ? 26.220  70.422 75.734 1.00 48.03  ? 1236 HOH A O   1 
HETATM 4475 O O   . HOH B 2 .   ? -6.199  39.990 49.007 1.00 56.68  ? 1237 HOH A O   1 
HETATM 4476 O O   . HOH B 2 .   ? -20.273 75.746 37.357 1.00 44.10  ? 1238 HOH A O   1 
HETATM 4477 O O   . HOH B 2 .   ? 25.186  71.235 63.555 1.00 56.45  ? 1239 HOH A O   1 
HETATM 4478 O O   . HOH B 2 .   ? -2.787  77.116 31.098 1.00 60.25  ? 1240 HOH A O   1 
HETATM 4479 O O   . HOH B 2 .   ? -4.318  39.308 67.926 1.00 46.35  ? 1241 HOH A O   1 
HETATM 4480 O O   . HOH B 2 .   ? -11.802 90.255 39.996 1.00 63.72  ? 1242 HOH A O   1 
HETATM 4481 O O   . HOH B 2 .   ? -18.544 75.725 31.660 1.00 60.35  ? 1243 HOH A O   1 
HETATM 4482 O O   . HOH B 2 .   ? -21.125 47.402 57.776 1.00 57.67  ? 1244 HOH A O   1 
HETATM 4483 O O   . HOH B 2 .   ? -17.750 40.377 70.457 1.00 54.36  ? 1245 HOH A O   1 
HETATM 4484 O O   . HOH B 2 .   ? -10.924 83.036 33.949 1.00 68.77  ? 1246 HOH A O   1 
HETATM 4485 O O   . HOH B 2 .   ? 19.272  45.363 42.023 1.00 47.38  ? 1247 HOH A O   1 
HETATM 4486 O O   . HOH B 2 .   ? 22.094  86.448 47.074 1.00 52.02  ? 1248 HOH A O   1 
HETATM 4487 O O   . HOH B 2 .   ? 5.644   60.391 70.664 1.00 73.41  ? 1249 HOH A O   1 
HETATM 4488 O O   . HOH B 2 .   ? 14.494  46.416 60.149 1.00 44.97  ? 1250 HOH A O   1 
HETATM 4489 O O   . HOH B 2 .   ? 17.172  69.948 85.082 1.00 45.81  ? 1251 HOH A O   1 
HETATM 4490 O O   . HOH B 2 .   ? 24.788  80.881 50.706 1.00 58.73  ? 1252 HOH A O   1 
HETATM 4491 O O   . HOH B 2 .   ? 34.649  57.115 75.959 1.00 55.51  ? 1253 HOH A O   1 
HETATM 4492 O O   . HOH B 2 .   ? -10.272 84.840 54.187 1.00 47.79  ? 1254 HOH A O   1 
HETATM 4493 O O   . HOH B 2 .   ? 25.603  76.374 37.744 1.00 67.11  ? 1255 HOH A O   1 
HETATM 4494 O O   . HOH B 2 .   ? 12.860  80.742 41.249 1.00 84.65  ? 1256 HOH A O   1 
HETATM 4495 O O   . HOH B 2 .   ? 16.803  51.458 84.308 1.00 57.29  ? 1257 HOH A O   1 
HETATM 4496 O O   . HOH B 2 .   ? -17.312 66.371 33.892 1.00 56.36  ? 1258 HOH A O   1 
HETATM 4497 O O   . HOH B 2 .   ? -22.704 62.189 39.433 1.00 70.66  ? 1259 HOH A O   1 
HETATM 4498 O O   . HOH B 2 .   ? 33.391  61.425 53.440 1.00 57.76  ? 1260 HOH A O   1 
HETATM 4499 O O   . HOH B 2 .   ? 21.314  81.966 35.975 1.00 52.68  ? 1261 HOH A O   1 
HETATM 4500 O O   . HOH B 2 .   ? 21.421  51.106 37.797 1.00 55.53  ? 1262 HOH A O   1 
HETATM 4501 O O   . HOH B 2 .   ? 27.224  69.013 41.357 1.00 52.14  ? 1263 HOH A O   1 
HETATM 4502 O O   . HOH B 2 .   ? 12.844  37.232 68.643 1.00 58.53  ? 1264 HOH A O   1 
HETATM 4503 O O   . HOH B 2 .   ? -10.637 55.836 45.403 1.00 54.98  ? 1265 HOH A O   1 
HETATM 4504 O O   . HOH B 2 .   ? 23.226  69.609 36.832 1.00 66.25  ? 1266 HOH A O   1 
HETATM 4505 O O   . HOH B 2 .   ? 29.754  54.197 48.004 1.00 54.48  ? 1267 HOH A O   1 
HETATM 4506 O O   . HOH B 2 .   ? 14.358  72.445 87.136 1.00 51.72  ? 1268 HOH A O   1 
HETATM 4507 O O   . HOH B 2 .   ? 1.024   65.157 70.140 1.00 58.60  ? 1269 HOH A O   1 
HETATM 4508 O O   . HOH B 2 .   ? 3.815   92.238 56.161 1.00 55.93  ? 1270 HOH A O   1 
HETATM 4509 O O   . HOH B 2 .   ? -6.375  66.878 31.656 1.00 60.48  ? 1271 HOH A O   1 
HETATM 4510 O O   . HOH B 2 .   ? -24.547 78.419 36.237 1.00 57.67  ? 1272 HOH A O   1 
HETATM 4511 O O   . HOH B 2 .   ? -14.785 42.302 48.115 1.00 82.47  ? 1273 HOH A O   1 
HETATM 4512 O O   . HOH B 2 .   ? 13.131  84.054 42.392 1.00 56.86  ? 1274 HOH A O   1 
HETATM 4513 O O   . HOH B 2 .   ? -1.213  72.099 73.609 1.00 57.29  ? 1275 HOH A O   1 
HETATM 4514 O O   . HOH B 2 .   ? -22.529 79.833 46.707 1.00 61.72  ? 1276 HOH A O   1 
HETATM 4515 O O   . HOH B 2 .   ? -14.196 76.703 65.418 1.00 50.42  ? 1277 HOH A O   1 
HETATM 4516 O O   . HOH B 2 .   ? 3.867   56.477 70.685 1.00 49.00  ? 1278 HOH A O   1 
HETATM 4517 O O   . HOH B 2 .   ? 25.259  69.964 68.810 1.00 65.77  ? 1279 HOH A O   1 
HETATM 4518 O O   . HOH B 2 .   ? -16.473 65.734 36.676 1.00 64.22  ? 1280 HOH A O   1 
HETATM 4519 O O   . HOH B 2 .   ? -21.302 80.729 49.911 1.00 52.99  ? 1281 HOH A O   1 
HETATM 4520 O O   . HOH B 2 .   ? 7.213   75.107 33.068 1.00 65.46  ? 1282 HOH A O   1 
HETATM 4521 O O   . HOH B 2 .   ? -0.046  42.025 64.788 1.00 48.92  ? 1283 HOH A O   1 
HETATM 4522 O O   . HOH B 2 .   ? 5.589   58.280 36.211 1.00 58.91  ? 1284 HOH A O   1 
HETATM 4523 O O   . HOH B 2 .   ? 14.574  76.024 80.721 1.00 56.89  ? 1285 HOH A O   1 
HETATM 4524 O O   . HOH B 2 .   ? -4.230  68.272 65.806 1.00 59.82  ? 1286 HOH A O   1 
HETATM 4525 O O   . HOH B 2 .   ? 20.433  37.703 61.374 1.00 48.68  ? 1287 HOH A O   1 
HETATM 4526 O O   . HOH B 2 .   ? -10.823 42.482 45.186 1.00 59.48  ? 1288 HOH A O   1 
HETATM 4527 O O   . HOH B 2 .   ? -8.927  72.164 72.304 1.00 54.94  ? 1289 HOH A O   1 
HETATM 4528 O O   . HOH B 2 .   ? -27.671 57.523 64.111 1.00 60.86  ? 1290 HOH A O   1 
HETATM 4529 O O   . HOH B 2 .   ? -15.260 70.249 66.118 1.00 55.43  ? 1291 HOH A O   1 
HETATM 4530 O O   . HOH B 2 .   ? -9.227  44.908 50.887 1.00 53.34  ? 1292 HOH A O   1 
HETATM 4531 O O   . HOH B 2 .   ? 34.256  61.653 77.745 1.00 65.31  ? 1293 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS ALA A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS ALA A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS ALA A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS ALA A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS ALA A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 488 GLN GLN A . n 
A 1 489 GLU 489 489 489 GLU GLU A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS ALA A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   1001 1001 HOH HOH A . 
B 2 HOH 2   1002 1002 HOH HOH A . 
B 2 HOH 3   1003 1003 HOH HOH A . 
B 2 HOH 4   1004 1004 HOH HOH A . 
B 2 HOH 5   1005 1005 HOH HOH A . 
B 2 HOH 6   1006 1006 HOH HOH A . 
B 2 HOH 7   1007 1007 HOH HOH A . 
B 2 HOH 8   1008 1008 HOH HOH A . 
B 2 HOH 9   1009 1009 HOH HOH A . 
B 2 HOH 10  1010 1010 HOH HOH A . 
B 2 HOH 11  1011 1011 HOH HOH A . 
B 2 HOH 12  1012 1012 HOH HOH A . 
B 2 HOH 13  1013 1013 HOH HOH A . 
B 2 HOH 14  1014 1014 HOH HOH A . 
B 2 HOH 15  1015 1015 HOH HOH A . 
B 2 HOH 16  1016 1016 HOH HOH A . 
B 2 HOH 17  1017 1017 HOH HOH A . 
B 2 HOH 18  1018 1018 HOH HOH A . 
B 2 HOH 19  1019 1019 HOH HOH A . 
B 2 HOH 20  1020 1020 HOH HOH A . 
B 2 HOH 21  1021 1021 HOH HOH A . 
B 2 HOH 22  1022 1022 HOH HOH A . 
B 2 HOH 23  1023 1023 HOH HOH A . 
B 2 HOH 24  1024 1024 HOH HOH A . 
B 2 HOH 25  1025 1025 HOH HOH A . 
B 2 HOH 26  1026 1026 HOH HOH A . 
B 2 HOH 27  1027 1027 HOH HOH A . 
B 2 HOH 28  1028 1028 HOH HOH A . 
B 2 HOH 29  1029 1029 HOH HOH A . 
B 2 HOH 30  1030 1030 HOH HOH A . 
B 2 HOH 31  1031 1031 HOH HOH A . 
B 2 HOH 32  1032 1032 HOH HOH A . 
B 2 HOH 33  1033 1033 HOH HOH A . 
B 2 HOH 34  1034 1034 HOH HOH A . 
B 2 HOH 35  1035 1035 HOH HOH A . 
B 2 HOH 36  1036 1036 HOH HOH A . 
B 2 HOH 37  1037 1037 HOH HOH A . 
B 2 HOH 38  1038 1038 HOH HOH A . 
B 2 HOH 39  1039 1039 HOH HOH A . 
B 2 HOH 40  1040 1040 HOH HOH A . 
B 2 HOH 41  1041 1041 HOH HOH A . 
B 2 HOH 42  1042 1042 HOH HOH A . 
B 2 HOH 43  1043 1043 HOH HOH A . 
B 2 HOH 44  1044 1044 HOH HOH A . 
B 2 HOH 45  1045 1045 HOH HOH A . 
B 2 HOH 46  1046 1046 HOH HOH A . 
B 2 HOH 47  1047 1047 HOH HOH A . 
B 2 HOH 48  1048 1048 HOH HOH A . 
B 2 HOH 49  1049 1049 HOH HOH A . 
B 2 HOH 50  1050 1050 HOH HOH A . 
B 2 HOH 51  1051 1051 HOH HOH A . 
B 2 HOH 52  1052 1052 HOH HOH A . 
B 2 HOH 53  1053 1053 HOH HOH A . 
B 2 HOH 54  1054 1054 HOH HOH A . 
B 2 HOH 55  1055 1055 HOH HOH A . 
B 2 HOH 56  1056 1056 HOH HOH A . 
B 2 HOH 57  1057 1057 HOH HOH A . 
B 2 HOH 58  1058 1058 HOH HOH A . 
B 2 HOH 59  1059 1059 HOH HOH A . 
B 2 HOH 60  1060 1060 HOH HOH A . 
B 2 HOH 61  1061 1061 HOH HOH A . 
B 2 HOH 62  1062 1062 HOH HOH A . 
B 2 HOH 63  1063 1063 HOH HOH A . 
B 2 HOH 64  1064 1064 HOH HOH A . 
B 2 HOH 65  1065 1065 HOH HOH A . 
B 2 HOH 66  1066 1066 HOH HOH A . 
B 2 HOH 67  1067 1067 HOH HOH A . 
B 2 HOH 68  1068 1068 HOH HOH A . 
B 2 HOH 69  1069 1069 HOH HOH A . 
B 2 HOH 70  1070 1070 HOH HOH A . 
B 2 HOH 71  1071 1071 HOH HOH A . 
B 2 HOH 72  1072 1072 HOH HOH A . 
B 2 HOH 73  1073 1073 HOH HOH A . 
B 2 HOH 74  1074 1074 HOH HOH A . 
B 2 HOH 75  1075 1075 HOH HOH A . 
B 2 HOH 76  1076 1076 HOH HOH A . 
B 2 HOH 77  1077 1077 HOH HOH A . 
B 2 HOH 78  1078 1078 HOH HOH A . 
B 2 HOH 79  1079 1079 HOH HOH A . 
B 2 HOH 80  1080 1080 HOH HOH A . 
B 2 HOH 81  1081 1081 HOH HOH A . 
B 2 HOH 82  1082 1082 HOH HOH A . 
B 2 HOH 83  1083 1083 HOH HOH A . 
B 2 HOH 84  1084 1084 HOH HOH A . 
B 2 HOH 85  1085 1085 HOH HOH A . 
B 2 HOH 86  1086 1086 HOH HOH A . 
B 2 HOH 87  1087 1087 HOH HOH A . 
B 2 HOH 88  1088 1088 HOH HOH A . 
B 2 HOH 89  1089 1089 HOH HOH A . 
B 2 HOH 90  1090 1090 HOH HOH A . 
B 2 HOH 91  1091 1091 HOH HOH A . 
B 2 HOH 92  1092 1092 HOH HOH A . 
B 2 HOH 93  1093 1093 HOH HOH A . 
B 2 HOH 94  1094 1094 HOH HOH A . 
B 2 HOH 95  1095 1095 HOH HOH A . 
B 2 HOH 96  1096 1096 HOH HOH A . 
B 2 HOH 97  1097 1097 HOH HOH A . 
B 2 HOH 98  1098 1098 HOH HOH A . 
B 2 HOH 99  1099 1099 HOH HOH A . 
B 2 HOH 100 1100 1100 HOH HOH A . 
B 2 HOH 101 1101 1101 HOH HOH A . 
B 2 HOH 102 1102 1102 HOH HOH A . 
B 2 HOH 103 1103 1103 HOH HOH A . 
B 2 HOH 104 1104 1104 HOH HOH A . 
B 2 HOH 105 1105 1105 HOH HOH A . 
B 2 HOH 106 1106 1106 HOH HOH A . 
B 2 HOH 107 1107 1107 HOH HOH A . 
B 2 HOH 108 1108 1108 HOH HOH A . 
B 2 HOH 109 1109 1109 HOH HOH A . 
B 2 HOH 110 1110 1110 HOH HOH A . 
B 2 HOH 111 1111 1111 HOH HOH A . 
B 2 HOH 112 1112 1112 HOH HOH A . 
B 2 HOH 113 1113 1113 HOH HOH A . 
B 2 HOH 114 1114 1114 HOH HOH A . 
B 2 HOH 115 1115 1115 HOH HOH A . 
B 2 HOH 116 1116 1116 HOH HOH A . 
B 2 HOH 117 1117 1117 HOH HOH A . 
B 2 HOH 118 1118 1118 HOH HOH A . 
B 2 HOH 119 1119 1119 HOH HOH A . 
B 2 HOH 120 1120 1120 HOH HOH A . 
B 2 HOH 121 1121 1121 HOH HOH A . 
B 2 HOH 122 1122 1122 HOH HOH A . 
B 2 HOH 123 1123 1123 HOH HOH A . 
B 2 HOH 124 1124 1124 HOH HOH A . 
B 2 HOH 125 1125 1125 HOH HOH A . 
B 2 HOH 126 1126 1126 HOH HOH A . 
B 2 HOH 127 1127 1127 HOH HOH A . 
B 2 HOH 128 1128 1128 HOH HOH A . 
B 2 HOH 129 1129 1129 HOH HOH A . 
B 2 HOH 130 1130 1130 HOH HOH A . 
B 2 HOH 131 1131 1131 HOH HOH A . 
B 2 HOH 132 1132 1132 HOH HOH A . 
B 2 HOH 133 1133 1133 HOH HOH A . 
B 2 HOH 134 1134 1134 HOH HOH A . 
B 2 HOH 135 1135 1135 HOH HOH A . 
B 2 HOH 136 1136 1136 HOH HOH A . 
B 2 HOH 137 1137 1137 HOH HOH A . 
B 2 HOH 138 1138 1138 HOH HOH A . 
B 2 HOH 139 1139 1139 HOH HOH A . 
B 2 HOH 140 1140 1140 HOH HOH A . 
B 2 HOH 141 1141 1141 HOH HOH A . 
B 2 HOH 142 1142 1142 HOH HOH A . 
B 2 HOH 143 1143 1143 HOH HOH A . 
B 2 HOH 144 1144 1144 HOH HOH A . 
B 2 HOH 145 1145 1145 HOH HOH A . 
B 2 HOH 146 1146 1146 HOH HOH A . 
B 2 HOH 147 1147 1147 HOH HOH A . 
B 2 HOH 148 1148 1148 HOH HOH A . 
B 2 HOH 149 1149 1149 HOH HOH A . 
B 2 HOH 150 1150 1150 HOH HOH A . 
B 2 HOH 151 1151 1151 HOH HOH A . 
B 2 HOH 152 1152 1152 HOH HOH A . 
B 2 HOH 153 1153 1153 HOH HOH A . 
B 2 HOH 154 1154 1154 HOH HOH A . 
B 2 HOH 155 1155 1155 HOH HOH A . 
B 2 HOH 156 1156 1156 HOH HOH A . 
B 2 HOH 157 1157 1157 HOH HOH A . 
B 2 HOH 158 1158 1158 HOH HOH A . 
B 2 HOH 159 1159 1159 HOH HOH A . 
B 2 HOH 160 1160 1160 HOH HOH A . 
B 2 HOH 161 1161 1161 HOH HOH A . 
B 2 HOH 162 1162 1162 HOH HOH A . 
B 2 HOH 163 1163 1163 HOH HOH A . 
B 2 HOH 164 1164 1164 HOH HOH A . 
B 2 HOH 165 1165 1165 HOH HOH A . 
B 2 HOH 166 1166 1166 HOH HOH A . 
B 2 HOH 167 1167 1167 HOH HOH A . 
B 2 HOH 168 1168 1168 HOH HOH A . 
B 2 HOH 169 1169 1169 HOH HOH A . 
B 2 HOH 170 1170 1170 HOH HOH A . 
B 2 HOH 171 1171 1171 HOH HOH A . 
B 2 HOH 172 1172 1172 HOH HOH A . 
B 2 HOH 173 1173 1173 HOH HOH A . 
B 2 HOH 174 1174 1174 HOH HOH A . 
B 2 HOH 175 1175 1175 HOH HOH A . 
B 2 HOH 176 1176 1176 HOH HOH A . 
B 2 HOH 177 1177 1177 HOH HOH A . 
B 2 HOH 178 1178 1178 HOH HOH A . 
B 2 HOH 179 1179 1179 HOH HOH A . 
B 2 HOH 180 1180 1180 HOH HOH A . 
B 2 HOH 181 1181 1181 HOH HOH A . 
B 2 HOH 182 1182 1182 HOH HOH A . 
B 2 HOH 183 1183 1183 HOH HOH A . 
B 2 HOH 184 1184 1184 HOH HOH A . 
B 2 HOH 185 1185 1185 HOH HOH A . 
B 2 HOH 186 1186 1186 HOH HOH A . 
B 2 HOH 187 1187 1187 HOH HOH A . 
B 2 HOH 188 1188 1188 HOH HOH A . 
B 2 HOH 189 1189 1189 HOH HOH A . 
B 2 HOH 190 1190 1190 HOH HOH A . 
B 2 HOH 191 1191 1191 HOH HOH A . 
B 2 HOH 192 1192 1192 HOH HOH A . 
B 2 HOH 193 1193 1193 HOH HOH A . 
B 2 HOH 194 1194 1194 HOH HOH A . 
B 2 HOH 195 1195 1195 HOH HOH A . 
B 2 HOH 196 1196 1196 HOH HOH A . 
B 2 HOH 197 1197 1197 HOH HOH A . 
B 2 HOH 198 1198 1198 HOH HOH A . 
B 2 HOH 199 1199 1199 HOH HOH A . 
B 2 HOH 200 1200 1200 HOH HOH A . 
B 2 HOH 201 1201 1201 HOH HOH A . 
B 2 HOH 202 1202 1202 HOH HOH A . 
B 2 HOH 203 1203 1203 HOH HOH A . 
B 2 HOH 204 1204 1204 HOH HOH A . 
B 2 HOH 205 1205 1205 HOH HOH A . 
B 2 HOH 206 1206 1206 HOH HOH A . 
B 2 HOH 207 1207 1207 HOH HOH A . 
B 2 HOH 208 1208 1208 HOH HOH A . 
B 2 HOH 209 1209 1209 HOH HOH A . 
B 2 HOH 210 1210 1210 HOH HOH A . 
B 2 HOH 211 1211 1211 HOH HOH A . 
B 2 HOH 212 1212 1212 HOH HOH A . 
B 2 HOH 213 1213 1213 HOH HOH A . 
B 2 HOH 214 1214 1214 HOH HOH A . 
B 2 HOH 215 1215 1215 HOH HOH A . 
B 2 HOH 216 1216 1216 HOH HOH A . 
B 2 HOH 217 1217 1217 HOH HOH A . 
B 2 HOH 218 1218 1218 HOH HOH A . 
B 2 HOH 219 1219 1219 HOH HOH A . 
B 2 HOH 220 1220 1220 HOH HOH A . 
B 2 HOH 221 1221 1221 HOH HOH A . 
B 2 HOH 222 1222 1222 HOH HOH A . 
B 2 HOH 223 1223 1223 HOH HOH A . 
B 2 HOH 224 1224 1224 HOH HOH A . 
B 2 HOH 225 1225 1225 HOH HOH A . 
B 2 HOH 226 1226 1226 HOH HOH A . 
B 2 HOH 227 1227 1227 HOH HOH A . 
B 2 HOH 228 1228 1228 HOH HOH A . 
B 2 HOH 229 1229 1229 HOH HOH A . 
B 2 HOH 230 1230 1230 HOH HOH A . 
B 2 HOH 231 1231 1231 HOH HOH A . 
B 2 HOH 232 1232 1232 HOH HOH A . 
B 2 HOH 233 1233 1233 HOH HOH A . 
B 2 HOH 234 1234 1234 HOH HOH A . 
B 2 HOH 235 1235 1235 HOH HOH A . 
B 2 HOH 236 1236 1236 HOH HOH A . 
B 2 HOH 237 1237 1237 HOH HOH A . 
B 2 HOH 238 1238 1238 HOH HOH A . 
B 2 HOH 239 1239 1239 HOH HOH A . 
B 2 HOH 240 1240 1240 HOH HOH A . 
B 2 HOH 241 1241 1241 HOH HOH A . 
B 2 HOH 242 1242 1242 HOH HOH A . 
B 2 HOH 243 1243 1243 HOH HOH A . 
B 2 HOH 244 1244 1244 HOH HOH A . 
B 2 HOH 245 1245 1245 HOH HOH A . 
B 2 HOH 246 1246 1246 HOH HOH A . 
B 2 HOH 247 1247 1247 HOH HOH A . 
B 2 HOH 248 1248 1248 HOH HOH A . 
B 2 HOH 249 1249 1249 HOH HOH A . 
B 2 HOH 250 1250 1250 HOH HOH A . 
B 2 HOH 251 1251 1251 HOH HOH A . 
B 2 HOH 252 1252 1252 HOH HOH A . 
B 2 HOH 253 1253 1253 HOH HOH A . 
B 2 HOH 254 1254 1254 HOH HOH A . 
B 2 HOH 255 1255 1255 HOH HOH A . 
B 2 HOH 256 1256 1256 HOH HOH A . 
B 2 HOH 257 1257 1257 HOH HOH A . 
B 2 HOH 258 1258 1258 HOH HOH A . 
B 2 HOH 259 1259 1259 HOH HOH A . 
B 2 HOH 260 1260 1260 HOH HOH A . 
B 2 HOH 261 1261 1261 HOH HOH A . 
B 2 HOH 262 1262 1262 HOH HOH A . 
B 2 HOH 263 1263 1263 HOH HOH A . 
B 2 HOH 264 1264 1264 HOH HOH A . 
B 2 HOH 265 1265 1265 HOH HOH A . 
B 2 HOH 266 1266 1266 HOH HOH A . 
B 2 HOH 267 1267 1267 HOH HOH A . 
B 2 HOH 268 1268 1268 HOH HOH A . 
B 2 HOH 269 1269 1269 HOH HOH A . 
B 2 HOH 270 1270 1270 HOH HOH A . 
B 2 HOH 271 1271 1271 HOH HOH A . 
B 2 HOH 272 1272 1272 HOH HOH A . 
B 2 HOH 273 1273 1273 HOH HOH A . 
B 2 HOH 274 1274 1274 HOH HOH A . 
B 2 HOH 275 1275 1275 HOH HOH A . 
B 2 HOH 276 1276 1276 HOH HOH A . 
B 2 HOH 277 1277 1277 HOH HOH A . 
B 2 HOH 278 1278 1278 HOH HOH A . 
B 2 HOH 279 1279 1279 HOH HOH A . 
B 2 HOH 280 1280 1280 HOH HOH A . 
B 2 HOH 281 1281 1281 HOH HOH A . 
B 2 HOH 282 1282 1282 HOH HOH A . 
B 2 HOH 283 1283 1283 HOH HOH A . 
B 2 HOH 284 1284 1284 HOH HOH A . 
B 2 HOH 285 1285 1285 HOH HOH A . 
B 2 HOH 286 1286 1286 HOH HOH A . 
B 2 HOH 287 1287 1287 HOH HOH A . 
B 2 HOH 288 1288 1288 HOH HOH A . 
B 2 HOH 289 1289 1289 HOH HOH A . 
B 2 HOH 290 1290 1290 HOH HOH A . 
B 2 HOH 291 1291 1291 HOH HOH A . 
B 2 HOH 292 1292 1292 HOH HOH A . 
B 2 HOH 293 1293 1293 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 138.0450000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-01-28 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       0.5 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
SOLVE     phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 25  ? ? 179.75  -166.05 
2  1 PRO A 39  ? ? -74.86  48.62   
3  1 PHE A 45  ? ? 73.85   -11.75  
4  1 PRO A 53  ? ? -48.41  156.54  
5  1 ALA A 60  ? ? -106.25 52.29   
6  1 LEU A 95  ? ? -68.92  80.32   
7  1 SER A 108 ? ? -159.55 71.43   
8  1 LEU A 158 ? ? -113.30 79.65   
9  1 HIS A 159 ? ? -45.99  150.90  
10 1 ALA A 164 ? ? -156.31 68.06   
11 1 ASN A 167 ? ? 54.06   14.31   
12 1 SER A 200 ? ? 58.22   -118.17 
13 1 ILE A 296 ? ? -69.49  94.19   
14 1 GLU A 299 ? ? -119.03 -77.57  
15 1 THR A 303 ? ? -131.04 -154.39 
16 1 THR A 317 ? ? -155.05 -151.87 
17 1 ASP A 326 ? ? -118.67 63.89   
18 1 TRP A 378 ? ? -59.27  -4.45   
19 1 ASP A 380 ? ? -147.29 45.93   
20 1 VAL A 400 ? ? -128.91 -60.17  
21 1 GLU A 455 ? ? -44.87  -19.70  
22 1 PRO A 485 ? ? -31.99  -72.03  
23 1 MET A 510 ? ? -39.01  137.36  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A CYS 67  ? SG ? A CYS 67  SG 
2 1 Y 1 A CYS 94  ? SG ? A CYS 94  SG 
3 1 Y 1 A CYS 254 ? SG ? A CYS 254 SG 
4 1 Y 1 A CYS 265 ? SG ? A CYS 265 SG 
5 1 Y 1 A CYS 402 ? SG ? A CYS 402 SG 
6 1 Y 1 A CYS 521 ? SG ? A CYS 521 SG 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 1   ? A ASP 1   
2 1 Y 1 A ASP 2   ? A ASP 2   
3 1 Y 1 A HIS 3   ? A HIS 3   
4 1 Y 1 A ALA 536 ? A ALA 536 
5 1 Y 1 A CYS 537 ? A CYS 537 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#