data_1QIK
# 
_entry.id   1QIK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QIK         
RCSB  RCSB001191   
WWPDB D_1000001191 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1QID 'EXPERIMENTAL TIME POINT A' unspecified 
PDB 1QIE 'EXPERIMENTAL TIME POINT B' unspecified 
PDB 1QIF 'EXPERIMENTAL TIME POINT C' unspecified 
PDB 1QIG 'EXPERIMENTAL TIME POINT D' unspecified 
PDB 1QIH 'EXPERIMENTAL TIME POINT E' unspecified 
PDB 1QII 'EXPERIMENTAL TIME POINT F' unspecified 
PDB 1QIJ 'EXPERIMENTAL TIME POINT G' unspecified 
PDB 1QIK 'EXPERIMENTAL TIME POINT H' unspecified 
PDB 1QIM 'EXPERIMENTAL TIME POINT I' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QIK 
_pdbx_database_status.recvd_initial_deposition_date   1999-06-14 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kryger, G.'      1 
'Weik, M.'        2 
'Ravelli, R.B.G.' 3 
# 
_citation.id                        primary 
_citation.title                     'Specific chemical and structural damage to proteins produced by synchrotron radiation.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            97 
_citation.page_first                623 
_citation.page_last                 628 
_citation.year                      2000 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10639129 
_citation.pdbx_database_id_DOI      10.1073/pnas.97.2.623 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Weik, M.'      1  
primary 'Ravelli, R.B.' 2  
primary 'Kryger, G.'    3  
primary 'McSweeney, S.' 4  
primary 'Raves, M.L.'   5  
primary 'Harel, M.'     6  
primary 'Gros, P.'      7  
primary 'Silman, I.'    8  
primary 'Kroon, J.'     9  
primary 'Sussman, J.L.' 10 
# 
_cell.entry_id           1QIK 
_cell.length_a           112.203 
_cell.length_b           112.203 
_cell.length_c           138.073 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QIK 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat ACETYLCHOLINESTERASE 60736.516 1   3.1.1.7 ? ? ? 
2 water   nat water                18.015    284 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'Pacific electric ray' 
_entity_src_nat.pdbx_organism_scientific   'Torpedo californica' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      Torpedo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1QIK 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 537 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  558 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QIK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.8 
_exptl_crystal.density_percent_sol   68. 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_details    '30% PEG 200, 0.3 M MES, pH 5.8, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   1999-03-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9320 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             0.9320 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QIK 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             36.73 
_reflns.d_resolution_high            2.90 
_reflns.number_obs                   21801 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.081 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        20.3 
_reflns.pdbx_redundancy              1.79 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1QIK 
_refine.ls_number_reflns_obs                     21758 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           1957105.54 
_refine.ls_d_res_low                             36.73 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    95.5 
_refine.ls_R_factor_obs                          0.1990000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1990000 
_refine.ls_R_factor_R_free                       0.2260000 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.7 
_refine.ls_number_reflns_R_free                  1030 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               43.0 
_refine.aniso_B[1][1]                            4.99 
_refine.aniso_B[2][2]                            4.99 
_refine.aniso_B[3][3]                            -9.98 
_refine.aniso_B[1][2]                            5.32 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.326 
_refine.solvent_model_param_bsol                 36.79 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;BULK SOLVENT MODEL USED. ONLY PARTIAL REFINEMENT DONE. ALL SIX CYSTEINE 
RESIDUES TAKING PART IN INTRACHAIN DISULFIDE LINKAGES, CYS 67-CYS 94, CYS 402- 
CYS 521 AND CYS 254-CYS 265, WERE MODELED AND REFINED AS ALANINE RESIDUES.

TCACHE IS A GLYCOPROTEIN OF MR = 65,000, WHICH CONTAINS
THREE INTRACHAIN DISULFIDE BONDS. IN THE COURSE OF
CRYOGENIC DATA COLLECTION ON TRIGONAL CRYSTALS OF TCACHE ON
THE UNDULATOR BEAMLINE, ID14-EH4, AT THE ESRF IN GRENOBLE,
IN PREPARATION FOR TIME-RESOLVED STUDIES, WE COLLECTED A
SERIES OF NINE HIGH-QUALITY COMPLETE DATA SETS ON THE SAME
CRYSTAL. DATA COLLECTION UTILIZED THE UNATTENUATED BEAM,
AND THE DURATION PER DATA SET WAS CA. 19 MIN, FOR 3 H IN
TOTAL, AT 100K. ELECTRON DENSITY MAPS WERE OBTAINED FOR
EACH DATA SET BY ROUTINE REFINEMENT, STARTING FROM THE SAME
MODEL OF NATIVE TCACHE. FOR RESULTS, SEE:
HTTP://SGJS3.WEIZMANN.AC.IL/~KRYGER/RADIATION_DAMAGE
(LOWER CASE!)

THIS ENTRY IS THE 8TH TIME POINT (8 OF 9). SEE HTTP://
SGJS3.WEIZMANN.AC.IL/~KRYGER/RADIATION_DAMAGE (LOWER CASE!)
;
_refine.pdbx_starting_model                      'PDB ENTRY 1VXR' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1QIK 
_refine_analyze.Luzzati_coordinate_error_obs    0.31 
_refine_analyze.Luzzati_sigma_a_obs             0.41 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.36 
_refine_analyze.Luzzati_sigma_a_free            0.46 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4238 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             284 
_refine_hist.number_atoms_total               4522 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        36.73 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.9  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.90  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             4.02  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            6.23  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             7.51  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            10.76 2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.90 
_refine_ls_shell.d_res_low                        3.00 
_refine_ls_shell.number_reflns_R_work             2108 
_refine_ls_shell.R_factor_R_work                  0.2950000 
_refine_ls_shell.percent_reflns_obs               98.5 
_refine_ls_shell.R_factor_R_free                  0.3000000 
_refine_ls_shell.R_factor_R_free_error            0.030 
_refine_ls_shell.percent_reflns_R_free            4.6 
_refine_ls_shell.number_reflns_R_free             102 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP     'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER_REP.PARAM 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1QIK 
_struct.title                     
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT H) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QIK 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;RADIATION DAMAGE, TIME SERIES, DISULFIDE BOND, SERINE HYDROLASE, ALPHA/BETA HYDROLASE, NEUROTRANSMITTER CLEAVAGE, CATALYTIC TRIAD, GLYCOSYLATED PROTEIN, HYDROLASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 41  ? MET A 43  ? GLY A 41  MET A 43  5 ? 3  
HELX_P HELX_P2  2  SER A 79  ? TRP A 84  ? SER A 79  TRP A 84  1 ? 6  
HELX_P HELX_P3  3  ASP A 128 ? TYR A 130 ? ASP A 128 TYR A 130 5 ? 3  
HELX_P HELX_P4  4  LYS A 133 ? GLU A 139 ? LYS A 133 GLU A 139 1 ? 7  
HELX_P HELX_P5  5  GLY A 151 ? PHE A 155 ? GLY A 151 PHE A 155 1 ? 5  
HELX_P HELX_P6  6  VAL A 168 ? PHE A 187 ? VAL A 168 PHE A 187 1 ? 20 
HELX_P HELX_P7  7  ALA A 201 ? LEU A 211 ? ALA A 201 LEU A 211 1 ? 11 
HELX_P HELX_P8  8  PRO A 213 ? LEU A 218 ? PRO A 213 LEU A 218 1 ? 6  
HELX_P HELX_P9  9  VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P10 10 ASP A 259 ? GLU A 268 ? ASP A 259 GLU A 268 1 ? 10 
HELX_P HELX_P11 11 PRO A 271 ? VAL A 281 ? PRO A 271 VAL A 281 1 ? 11 
HELX_P HELX_P12 12 LEU A 305 ? SER A 311 ? LEU A 305 SER A 311 1 ? 7  
HELX_P HELX_P13 13 SER A 329 ? GLY A 335 ? SER A 329 GLY A 335 1 ? 7  
HELX_P HELX_P14 14 ARG A 349 ? SER A 359 ? ARG A 349 SER A 359 1 ? 11 
HELX_P HELX_P15 15 ASP A 365 ? GLN A 374 ? ASP A 365 GLN A 374 1 ? 10 
HELX_P HELX_P16 16 GLY A 384 ? ASN A 399 ? GLY A 384 ASN A 399 1 ? 16 
HELX_P HELX_P17 17 ILE A 401 ? PHE A 414 ? ILE A 401 PHE A 414 1 ? 14 
HELX_P HELX_P18 18 GLU A 434 ? MET A 436 ? GLU A 434 MET A 436 5 ? 3  
HELX_P HELX_P19 19 ILE A 444 ? VAL A 447 ? ILE A 444 VAL A 447 1 ? 4  
HELX_P HELX_P20 20 LEU A 450 ? LEU A 452 ? LEU A 450 LEU A 452 5 ? 3  
HELX_P HELX_P21 21 LYS A 454 ? LEU A 456 ? LYS A 454 LEU A 456 5 ? 3  
HELX_P HELX_P22 22 ALA A 460 ? THR A 479 ? ALA A 460 THR A 479 1 ? 20 
HELX_P HELX_P23 23 VAL A 518 ? ASN A 525 ? VAL A 518 ASN A 525 1 ? 8  
HELX_P HELX_P24 24 PHE A 527 ? ASN A 533 ? PHE A 527 ASN A 533 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.08 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 6   ? THR A 10  ? LEU A 6   THR A 10  
A 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
A 3  VAL A 57  ? ALA A 60  ? VAL A 57  ALA A 60  
B 1  MET A 16  ? PRO A 21  ? MET A 16  PRO A 21  
B 2  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
B 3  TYR A 96  ? PRO A 102 ? TYR A 96  PRO A 102 
B 4  VAL A 142 ? SER A 147 ? VAL A 142 SER A 147 
B 5  THR A 109 ? TYR A 116 ? THR A 109 TYR A 116 
B 6  THR A 193 ? GLU A 199 ? THR A 193 GLU A 199 
B 7  ARG A 220 ? SER A 226 ? ARG A 220 SER A 226 
B 8  GLN A 318 ? ASN A 324 ? GLN A 318 ASN A 324 
B 9  GLY A 417 ? PHE A 423 ? GLY A 417 PHE A 423 
B 10 PHE A 502 ? LEU A 505 ? PHE A 502 LEU A 505 
B 11 MET A 510 ? GLN A 514 ? MET A 510 GLN A 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O VAL A 8   ? O VAL A 8   N VAL A 15  ? N VAL A 15  
A 2  3  O LYS A 14  ? O LYS A 14  N TRP A 58  ? N TRP A 58  
B 1  2  N THR A 18  ? N THR A 18  O ALA A 29  ? O ALA A 29  
B 2  3  O PHE A 30  ? O PHE A 30  N ILE A 99  ? N ILE A 99  
B 3  4  O TRP A 100 ? O TRP A 100 N LEU A 143 ? N LEU A 143 
B 4  5  O VAL A 142 ? O VAL A 142 N MET A 112 ? N MET A 112 
B 5  6  N VAL A 113 ? N VAL A 113 O THR A 195 ? O THR A 195 
B 6  7  O ILE A 196 ? O ILE A 196 N ILE A 223 ? N ILE A 223 
B 7  8  O LEU A 224 ? O LEU A 224 N GLY A 322 ? N GLY A 322 
B 8  9  O LEU A 321 ? O LEU A 321 N TYR A 421 ? N TYR A 421 
B 9  10 O LEU A 420 ? O LEU A 420 N ILE A 503 ? N ILE A 503 
B 10 11 O PHE A 502 ? O PHE A 502 N HIS A 513 ? N HIS A 513 
# 
_struct_site.id                   CAT 
_struct_site.pdbx_evidence_code   Author 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    3 
_struct_site.details              'CATALYTIC TRIAD' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 CAT 3 SER A 200 ? SER A 200 . ? 1_555 ? 
2 CAT 3 GLU A 327 ? GLU A 327 . ? 1_555 ? 
3 CAT 3 HIS A 440 ? HIS A 440 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QIK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QIK 
_atom_sites.fract_transf_matrix[1][1]   0.008912 
_atom_sites.fract_transf_matrix[1][2]   0.005145 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010291 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007242 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -13.315 87.821 34.792 1.00 51.09  ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -12.697 88.296 36.069 1.00 51.09  ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -11.562 87.378 36.509 1.00 51.09  ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -11.674 86.155 36.434 1.00 51.09  ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -13.746 88.363 37.183 1.00 43.92  ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -13.138 88.723 38.416 1.00 43.92  ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -10.477 87.978 36.983 1.00 51.57  ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -9.314  87.228 37.433 1.00 51.57  ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.633  86.260 38.581 1.00 51.57  ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.993  85.212 38.729 1.00 51.57  ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -8.210  88.199 37.870 1.00 74.12  ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.891  87.504 38.159 1.00 74.12  ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.729  88.462 38.378 1.00 74.12  ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -5.756  89.243 39.359 1.00 74.12  ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -4.780  88.424 37.562 1.00 74.12  ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.627 86.600 39.389 1.00 41.38  ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -10.978 85.754 40.507 1.00 41.38  ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -11.978 84.671 40.143 1.00 41.38  ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.381 83.884 40.996 1.00 41.38  ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.532 86.608 41.639 1.00 42.01  ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.570 87.677 42.143 1.00 42.01  ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -11.246 88.490 43.224 1.00 42.01  ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -9.305  87.018 42.666 1.00 42.01  ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.386 84.618 38.886 1.00 43.78  ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -13.353 83.613 38.472 1.00 43.78  ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.662 82.605 37.568 1.00 43.78  ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -12.015 82.978 36.586 1.00 43.78  ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.513 84.286 37.739 1.00 47.52  ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.670 83.415 37.263 1.00 47.52  ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -16.354 82.742 38.432 1.00 47.52  ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.647 84.282 36.523 1.00 47.52  ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.784 81.327 37.912 1.00 37.96  ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -12.159 80.265 37.136 1.00 37.96  ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -13.149 79.165 36.817 1.00 37.96  ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.896 78.712 37.691 1.00 37.96  ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -10.969 79.643 37.887 1.00 31.55  ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -10.503 78.389 37.169 1.00 31.55  ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -9.832  80.638 37.969 1.00 31.55  ? 8    VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -13.150 78.725 35.562 1.00 39.88  ? 9    ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -14.069 77.682 35.148 1.00 39.88  ? 9    ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -13.343 76.363 34.989 1.00 39.88  ? 9    ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -12.670 76.125 33.995 1.00 39.88  ? 9    ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -14.767 78.076 33.850 1.00 61.35  ? 9    ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -15.733 77.014 33.368 1.00 61.35  ? 9    ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -16.364 76.303 34.166 1.00 61.35  ? 9    ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -15.866 76.902 32.054 1.00 61.35  ? 9    ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -13.489 75.507 35.990 1.00 43.86  ? 10   THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -12.840 74.208 35.994 1.00 43.86  ? 10   THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -13.742 73.155 35.394 1.00 43.86  ? 10   THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -14.886 73.434 35.047 1.00 43.86  ? 10   THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -12.525 73.747 37.412 1.00 40.89  ? 10   THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -13.749 73.366 38.052 1.00 40.89  ? 10   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -11.848 74.869 38.207 1.00 40.89  ? 10   THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -13.217 71.935 35.311 1.00 40.06  ? 11   LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -13.951 70.804 34.766 1.00 40.06  ? 11   LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -14.993 70.280 35.753 1.00 40.06  ? 11   LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -15.794 69.423 35.404 1.00 40.06  ? 11   LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -12.981 69.677 34.401 1.00 26.94  ? 11   LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -11.893 70.083 33.425 1.00 26.94  ? 11   LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -11.059 68.890 33.018 1.00 26.94  ? 11   LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -10.057 69.276 31.959 1.00 26.94  ? 11   LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -9.066  68.211 31.681 1.00 26.94  ? 11   LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -14.974 70.785 36.985 1.00 42.85  ? 12   SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -15.934 70.365 38.005 1.00 42.85  ? 12   SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -17.007 71.436 38.189 1.00 42.85  ? 12   SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -18.044 71.194 38.811 1.00 42.85  ? 12   SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -15.230 70.124 39.348 1.00 48.83  ? 12   SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -14.446 68.939 39.337 1.00 48.83  ? 12   SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -16.750 72.623 37.645 1.00 46.32  ? 13   GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -17.700 73.716 37.766 1.00 46.32  ? 13   GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -16.950 75.020 37.923 1.00 46.32  ? 13   GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -15.721 75.008 37.909 1.00 46.32  ? 13   GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -17.672 76.136 38.056 1.00 38.20  ? 14   LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -17.038 77.444 38.231 1.00 38.20  ? 14   LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -16.669 77.690 39.686 1.00 38.20  ? 14   LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -17.354 77.223 40.607 1.00 38.20  ? 14   LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -17.951 78.567 37.760 1.00 46.60  ? 14   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -18.105 78.651 36.257 1.00 46.60  ? 14   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -19.049 79.771 35.894 1.00 46.60  ? 14   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -19.509 79.682 34.458 1.00 46.60  ? 14   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -20.570 80.701 34.191 1.00 46.60  ? 14   LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -15.587 78.437 39.887 1.00 45.15  ? 15   VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -15.094 78.728 41.225 1.00 45.15  ? 15   VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -14.746 80.199 41.379 1.00 45.15  ? 15   VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -14.008 80.746 40.570 1.00 45.15  ? 15   VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -13.841 77.884 41.524 1.00 36.04  ? 15   VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -13.285 78.243 42.866 1.00 36.04  ? 15   VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -14.188 76.415 41.498 1.00 36.04  ? 15   VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -15.283 80.829 42.420 1.00 30.87  ? 16   MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -15.034 82.242 42.707 1.00 30.87  ? 16   MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -14.031 82.413 43.843 1.00 30.87  ? 16   MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -14.319 82.127 45.005 1.00 30.87  ? 16   MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -16.335 82.948 43.090 1.00 69.39  ? 16   MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -16.191 84.435 43.440 1.00 69.39  ? 16   MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -16.397 85.566 42.022 1.00 69.39  ? 16   MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -14.694 86.049 41.732 1.00 69.39  ? 16   MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -12.849 82.891 43.497 1.00 47.32  ? 17   GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -11.836 83.092 44.505 1.00 47.32  ? 17   GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -11.906 84.486 45.089 1.00 47.32  ? 17   GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -12.868 85.224 44.861 1.00 47.32  ? 17   GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -10.869 84.835 45.843 1.00 40.53  ? 18   THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -10.753 86.136 46.484 1.00 40.53  ? 18   THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -9.344  86.720 46.347 1.00 40.53  ? 18   THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -8.367  85.985 46.203 1.00 40.53  ? 18   THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -11.091 86.044 47.979 1.00 48.98  ? 18   THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -10.523 87.170 48.653 1.00 48.98  ? 18   THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -10.526 84.770 48.590 1.00 48.98  ? 18   THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -9.245  88.047 46.381 1.00 43.71  ? 19   ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -7.951  88.728 46.280 1.00 43.71  ? 19   ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -7.382  88.935 47.696 1.00 43.71  ? 19   ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -8.090  89.399 48.590 1.00 43.71  ? 19   ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -8.118  90.063 45.535 1.00 61.64  ? 19   ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -7.062  91.103 45.856 1.00 61.64  ? 19   ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -7.001  92.229 44.812 1.00 61.64  ? 19   ARG A CD  1 
ATOM   115  N NE  . ARG A 1 19  ? -6.153  91.878 43.670 1.00 61.64  ? 19   ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 19  ? -5.139  92.621 43.210 1.00 61.64  ? 19   ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 19  ? -4.831  93.783 43.784 1.00 61.64  ? 19   ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 19  ? -4.413  92.191 42.179 1.00 61.64  ? 19   ARG A NH2 1 
ATOM   119  N N   . VAL A 1 20  ? -6.120  88.568 47.909 1.00 40.06  ? 20   VAL A N   1 
ATOM   120  C CA  . VAL A 1 20  ? -5.517  88.714 49.237 1.00 40.06  ? 20   VAL A CA  1 
ATOM   121  C C   . VAL A 1 20  ? -4.226  89.513 49.240 1.00 40.06  ? 20   VAL A C   1 
ATOM   122  O O   . VAL A 1 20  ? -3.424  89.433 48.312 1.00 40.06  ? 20   VAL A O   1 
ATOM   123  C CB  . VAL A 1 20  ? -5.203  87.341 49.888 1.00 41.12  ? 20   VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 20  ? -6.470  86.521 50.031 1.00 41.12  ? 20   VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 20  ? -4.183  86.592 49.050 1.00 41.12  ? 20   VAL A CG2 1 
ATOM   126  N N   . PRO A 1 21  ? -4.008  90.294 50.300 1.00 33.68  ? 21   PRO A N   1 
ATOM   127  C CA  . PRO A 1 21  ? -2.798  91.105 50.409 1.00 33.68  ? 21   PRO A CA  1 
ATOM   128  C C   . PRO A 1 21  ? -1.607  90.272 50.890 1.00 33.68  ? 21   PRO A C   1 
ATOM   129  O O   . PRO A 1 21  ? -1.761  89.383 51.728 1.00 33.68  ? 21   PRO A O   1 
ATOM   130  C CB  . PRO A 1 21  ? -3.209  92.179 51.406 1.00 24.61  ? 21   PRO A CB  1 
ATOM   131  C CG  . PRO A 1 21  ? -4.104  91.433 52.327 1.00 24.61  ? 21   PRO A CG  1 
ATOM   132  C CD  . PRO A 1 21  ? -4.957  90.615 51.380 1.00 24.61  ? 21   PRO A CD  1 
ATOM   133  N N   . VAL A 1 22  ? -0.424  90.564 50.351 1.00 37.78  ? 22   VAL A N   1 
ATOM   134  C CA  . VAL A 1 22  ? 0.797   89.858 50.719 1.00 37.78  ? 22   VAL A CA  1 
ATOM   135  C C   . VAL A 1 22  ? 2.020   90.724 50.465 1.00 37.78  ? 22   VAL A C   1 
ATOM   136  O O   . VAL A 1 22  ? 2.255   91.141 49.332 1.00 37.78  ? 22   VAL A O   1 
ATOM   137  C CB  . VAL A 1 22  ? 0.946   88.532 49.921 1.00 35.69  ? 22   VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 22  ? 0.922   88.801 48.435 1.00 35.69  ? 22   VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 22  ? 2.233   87.840 50.300 1.00 35.69  ? 22   VAL A CG2 1 
ATOM   140  N N   . LEU A 1 23  ? 2.796   90.984 51.520 1.00 50.68  ? 23   LEU A N   1 
ATOM   141  C CA  . LEU A 1 23  ? 4.017   91.799 51.431 1.00 50.68  ? 23   LEU A CA  1 
ATOM   142  C C   . LEU A 1 23  ? 3.762   93.087 50.656 1.00 50.68  ? 23   LEU A C   1 
ATOM   143  O O   . LEU A 1 23  ? 4.554   93.468 49.775 1.00 50.68  ? 23   LEU A O   1 
ATOM   144  C CB  . LEU A 1 23  ? 5.142   91.016 50.739 1.00 41.77  ? 23   LEU A CB  1 
ATOM   145  C CG  . LEU A 1 23  ? 5.772   89.820 51.457 1.00 41.77  ? 23   LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 23  ? 6.842   89.196 50.571 1.00 41.77  ? 23   LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 23  ? 6.378   90.285 52.773 1.00 41.77  ? 23   LEU A CD2 1 
ATOM   148  N N   . SER A 1 24  ? 2.652   93.742 51.005 1.00 54.81  ? 24   SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? 2.176   94.983 50.378 1.00 54.81  ? 24   SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? 2.060   94.870 48.848 1.00 54.81  ? 24   SER A C   1 
ATOM   151  O O   . SER A 1 24  ? 2.699   95.595 48.093 1.00 54.81  ? 24   SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? 3.044   96.190 50.794 1.00 57.45  ? 24   SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? 4.388   96.061 50.372 1.00 57.45  ? 24   SER A OG  1 
ATOM   154  N N   . SER A 1 25  ? 1.229   93.919 48.427 1.00 36.26  ? 25   SER A N   1 
ATOM   155  C CA  . SER A 1 25  ? 0.913   93.635 47.033 1.00 36.26  ? 25   SER A CA  1 
ATOM   156  C C   . SER A 1 25  ? -0.289  92.700 47.108 1.00 36.26  ? 25   SER A C   1 
ATOM   157  O O   . SER A 1 25  ? -0.867  92.534 48.184 1.00 36.26  ? 25   SER A O   1 
ATOM   158  C CB  . SER A 1 25  ? 2.070   92.942 46.334 1.00 43.49  ? 25   SER A CB  1 
ATOM   159  O OG  . SER A 1 25  ? 1.772   92.785 44.956 1.00 43.49  ? 25   SER A OG  1 
ATOM   160  N N   . HIS A 1 26  ? -0.682  92.082 46.000 1.00 47.81  ? 26   HIS A N   1 
ATOM   161  C CA  . HIS A 1 26  ? -1.844  91.189 46.059 1.00 47.81  ? 26   HIS A CA  1 
ATOM   162  C C   . HIS A 1 26  ? -1.774  89.964 45.159 1.00 47.81  ? 26   HIS A C   1 
ATOM   163  O O   . HIS A 1 26  ? -1.107  89.982 44.129 1.00 47.81  ? 26   HIS A O   1 
ATOM   164  C CB  . HIS A 1 26  ? -3.144  91.951 45.729 1.00 72.77  ? 26   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 26  ? -3.485  93.030 46.711 1.00 72.77  ? 26   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 26  ? -3.057  94.335 46.567 1.00 72.77  ? 26   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 26  ? -4.202  92.996 47.863 1.00 72.77  ? 26   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 26  ? -3.495  95.056 47.588 1.00 72.77  ? 26   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 26  ? -4.191  94.267 48.389 1.00 72.77  ? 26   HIS A NE2 1 
ATOM   170  N N   . ILE A 1 27  ? -2.455  88.893 45.561 1.00 36.26  ? 27   ILE A N   1 
ATOM   171  C CA  . ILE A 1 27  ? -2.506  87.680 44.757 1.00 36.26  ? 27   ILE A CA  1 
ATOM   172  C C   . ILE A 1 27  ? -3.899  87.117 44.916 1.00 36.26  ? 27   ILE A C   1 
ATOM   173  O O   . ILE A 1 27  ? -4.641  87.539 45.804 1.00 36.26  ? 27   ILE A O   1 
ATOM   174  C CB  . ILE A 1 27  ? -1.490  86.597 45.202 1.00 40.91  ? 27   ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 27  ? -1.905  86.017 46.541 1.00 40.91  ? 27   ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 27  ? -0.088  87.177 45.286 1.00 40.91  ? 27   ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 27  ? -1.001  84.920 46.995 1.00 40.91  ? 27   ILE A CD1 1 
ATOM   178  N N   . SER A 1 28  ? -4.253  86.173 44.052 1.00 36.07  ? 28   SER A N   1 
ATOM   179  C CA  . SER A 1 28  ? -5.565  85.551 44.103 1.00 36.07  ? 28   SER A CA  1 
ATOM   180  C C   . SER A 1 28  ? -5.473  84.311 44.978 1.00 36.07  ? 28   SER A C   1 
ATOM   181  O O   . SER A 1 28  ? -4.415  83.695 45.093 1.00 36.07  ? 28   SER A O   1 
ATOM   182  C CB  . SER A 1 28  ? -6.017  85.144 42.703 1.00 39.06  ? 28   SER A CB  1 
ATOM   183  O OG  . SER A 1 28  ? -5.775  86.173 41.762 1.00 39.06  ? 28   SER A OG  1 
ATOM   184  N N   . ALA A 1 29  ? -6.588  83.949 45.595 1.00 28.46  ? 29   ALA A N   1 
ATOM   185  C CA  . ALA A 1 29  ? -6.634  82.780 46.442 1.00 28.46  ? 29   ALA A CA  1 
ATOM   186  C C   . ALA A 1 29  ? -7.982  82.109 46.303 1.00 28.46  ? 29   ALA A C   1 
ATOM   187  O O   . ALA A 1 29  ? -9.017  82.736 46.489 1.00 28.46  ? 29   ALA A O   1 
ATOM   188  C CB  . ALA A 1 29  ? -6.408  83.168 47.885 1.00 24.46  ? 29   ALA A CB  1 
ATOM   189  N N   . PHE A 1 30  ? -7.964  80.833 45.951 1.00 35.08  ? 30   PHE A N   1 
ATOM   190  C CA  . PHE A 1 30  ? -9.187  80.059 45.831 1.00 35.08  ? 30   PHE A CA  1 
ATOM   191  C C   . PHE A 1 30  ? -9.074  79.074 46.964 1.00 35.08  ? 30   PHE A C   1 
ATOM   192  O O   . PHE A 1 30  ? -8.308  78.125 46.888 1.00 35.08  ? 30   PHE A O   1 
ATOM   193  C CB  . PHE A 1 30  ? -9.240  79.324 44.497 1.00 32.48  ? 30   PHE A CB  1 
ATOM   194  C CG  . PHE A 1 30  ? -9.155  80.230 43.311 1.00 32.48  ? 30   PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 30  ? -7.957  80.843 42.978 1.00 32.48  ? 30   PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 30  ? -10.274 80.469 42.526 1.00 32.48  ? 30   PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 30  ? -7.870  81.676 41.880 1.00 32.48  ? 30   PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 30  ? -10.201 81.302 41.426 1.00 32.48  ? 30   PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 30  ? -8.994  81.906 41.101 1.00 32.48  ? 30   PHE A CZ  1 
ATOM   200  N N   . LEU A 1 31  ? -9.827  79.315 48.025 1.00 37.54  ? 31   LEU A N   1 
ATOM   201  C CA  . LEU A 1 31  ? -9.778  78.464 49.198 1.00 37.54  ? 31   LEU A CA  1 
ATOM   202  C C   . LEU A 1 31  ? -11.002 77.566 49.361 1.00 37.54  ? 31   LEU A C   1 
ATOM   203  O O   . LEU A 1 31  ? -12.129 77.967 49.091 1.00 37.54  ? 31   LEU A O   1 
ATOM   204  C CB  . LEU A 1 31  ? -9.607  79.352 50.425 1.00 29.84  ? 31   LEU A CB  1 
ATOM   205  C CG  . LEU A 1 31  ? -8.453  80.353 50.283 1.00 29.84  ? 31   LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 31  ? -8.473  81.352 51.417 1.00 29.84  ? 31   LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 31  ? -7.132  79.601 50.260 1.00 29.84  ? 31   LEU A CD2 1 
ATOM   208  N N   . GLY A 1 32  ? -10.766 76.334 49.788 1.00 41.07  ? 32   GLY A N   1 
ATOM   209  C CA  . GLY A 1 32  ? -11.854 75.402 50.014 1.00 41.07  ? 32   GLY A CA  1 
ATOM   210  C C   . GLY A 1 32  ? -12.505 74.740 48.817 1.00 41.07  ? 32   GLY A C   1 
ATOM   211  O O   . GLY A 1 32  ? -13.683 74.405 48.894 1.00 41.07  ? 32   GLY A O   1 
ATOM   212  N N   . ILE A 1 33  ? -11.770 74.549 47.722 1.00 41.17  ? 33   ILE A N   1 
ATOM   213  C CA  . ILE A 1 33  ? -12.335 73.894 46.541 1.00 41.17  ? 33   ILE A CA  1 
ATOM   214  C C   . ILE A 1 33  ? -12.492 72.397 46.844 1.00 41.17  ? 33   ILE A C   1 
ATOM   215  O O   . ILE A 1 33  ? -11.550 71.757 47.318 1.00 41.17  ? 33   ILE A O   1 
ATOM   216  C CB  . ILE A 1 33  ? -11.412 74.023 45.324 1.00 28.43  ? 33   ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 33  ? -11.018 75.481 45.103 1.00 28.43  ? 33   ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 33  ? -12.116 73.477 44.098 1.00 28.43  ? 33   ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 33  ? -10.103 75.693 43.920 1.00 28.43  ? 33   ILE A CD1 1 
ATOM   220  N N   . PRO A 1 34  ? -13.679 71.814 46.581 1.00 40.23  ? 34   PRO A N   1 
ATOM   221  C CA  . PRO A 1 34  ? -13.838 70.387 46.869 1.00 40.23  ? 34   PRO A CA  1 
ATOM   222  C C   . PRO A 1 34  ? -13.252 69.486 45.779 1.00 40.23  ? 34   PRO A C   1 
ATOM   223  O O   . PRO A 1 34  ? -13.279 69.850 44.606 1.00 40.23  ? 34   PRO A O   1 
ATOM   224  C CB  . PRO A 1 34  ? -15.354 70.242 46.998 1.00 32.00  ? 34   PRO A CB  1 
ATOM   225  C CG  . PRO A 1 34  ? -15.856 71.216 45.991 1.00 32.00  ? 34   PRO A CG  1 
ATOM   226  C CD  . PRO A 1 34  ? -14.977 72.423 46.225 1.00 32.00  ? 34   PRO A CD  1 
ATOM   227  N N   . PHE A 1 35  ? -12.709 68.324 46.166 1.00 40.34  ? 35   PHE A N   1 
ATOM   228  C CA  . PHE A 1 35  ? -12.150 67.375 45.192 1.00 40.34  ? 35   PHE A CA  1 
ATOM   229  C C   . PHE A 1 35  ? -12.713 65.959 45.354 1.00 40.34  ? 35   PHE A C   1 
ATOM   230  O O   . PHE A 1 35  ? -12.372 65.048 44.601 1.00 40.34  ? 35   PHE A O   1 
ATOM   231  C CB  . PHE A 1 35  ? -10.602 67.355 45.239 1.00 35.85  ? 35   PHE A CB  1 
ATOM   232  C CG  . PHE A 1 35  ? -10.008 66.859 46.536 1.00 35.85  ? 35   PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 35  ? -10.089 65.524 46.897 1.00 35.85  ? 35   PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 35  ? -9.325  67.727 47.374 1.00 35.85  ? 35   PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 35  ? -9.498  65.061 48.072 1.00 35.85  ? 35   PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 35  ? -8.730  67.271 48.554 1.00 35.85  ? 35   PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 35  ? -8.819  65.939 48.898 1.00 35.85  ? 35   PHE A CZ  1 
ATOM   238  N N   . ALA A 1 36  ? -13.595 65.782 46.327 1.00 37.59  ? 36   ALA A N   1 
ATOM   239  C CA  . ALA A 1 36  ? -14.203 64.484 46.567 1.00 37.59  ? 36   ALA A CA  1 
ATOM   240  C C   . ALA A 1 36  ? -15.562 64.669 47.229 1.00 37.59  ? 36   ALA A C   1 
ATOM   241  O O   . ALA A 1 36  ? -15.871 65.745 47.737 1.00 37.59  ? 36   ALA A O   1 
ATOM   242  C CB  . ALA A 1 36  ? -13.304 63.644 47.458 1.00 32.54  ? 36   ALA A CB  1 
ATOM   243  N N   . GLU A 1 37  ? -16.377 63.621 47.211 1.00 47.19  ? 37   GLU A N   1 
ATOM   244  C CA  . GLU A 1 37  ? -17.688 63.669 47.841 1.00 47.19  ? 37   GLU A CA  1 
ATOM   245  C C   . GLU A 1 37  ? -17.477 63.519 49.345 1.00 47.19  ? 37   GLU A C   1 
ATOM   246  O O   . GLU A 1 37  ? -16.607 62.765 49.788 1.00 47.19  ? 37   GLU A O   1 
ATOM   247  C CB  . GLU A 1 37  ? -18.562 62.525 47.329 1.00 71.77  ? 37   GLU A CB  1 
ATOM   248  C CG  . GLU A 1 37  ? -19.051 62.705 45.909 1.00 71.77  ? 37   GLU A CG  1 
ATOM   249  C CD  . GLU A 1 37  ? -20.066 63.840 45.780 1.00 71.77  ? 37   GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 37  ? -21.049 63.839 46.561 1.00 71.77  ? 37   GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 37  ? -19.891 64.728 44.901 1.00 71.77  ? 37   GLU A OE2 1 
ATOM   252  N N   . PRO A 1 38  ? -18.259 64.251 50.153 1.00 57.06  ? 38   PRO A N   1 
ATOM   253  C CA  . PRO A 1 38  ? -18.110 64.155 51.605 1.00 57.06  ? 38   PRO A CA  1 
ATOM   254  C C   . PRO A 1 38  ? -18.099 62.705 52.084 1.00 57.06  ? 38   PRO A C   1 
ATOM   255  O O   . PRO A 1 38  ? -19.078 61.980 51.929 1.00 57.06  ? 38   PRO A O   1 
ATOM   256  C CB  . PRO A 1 38  ? -19.303 64.944 52.109 1.00 39.85  ? 38   PRO A CB  1 
ATOM   257  C CG  . PRO A 1 38  ? -19.360 66.051 51.119 1.00 39.85  ? 38   PRO A CG  1 
ATOM   258  C CD  . PRO A 1 38  ? -19.197 65.325 49.796 1.00 39.85  ? 38   PRO A CD  1 
ATOM   259  N N   . PRO A 1 39  ? -16.969 62.263 52.665 1.00 50.92  ? 39   PRO A N   1 
ATOM   260  C CA  . PRO A 1 39  ? -16.785 60.902 53.175 1.00 50.92  ? 39   PRO A CA  1 
ATOM   261  C C   . PRO A 1 39  ? -17.549 60.624 54.459 1.00 50.92  ? 39   PRO A C   1 
ATOM   262  O O   . PRO A 1 39  ? -17.019 60.006 55.382 1.00 50.92  ? 39   PRO A O   1 
ATOM   263  C CB  . PRO A 1 39  ? -15.274 60.832 53.380 1.00 47.36  ? 39   PRO A CB  1 
ATOM   264  C CG  . PRO A 1 39  ? -14.965 62.216 53.837 1.00 47.36  ? 39   PRO A CG  1 
ATOM   265  C CD  . PRO A 1 39  ? -15.730 63.043 52.831 1.00 47.36  ? 39   PRO A CD  1 
ATOM   266  N N   . VAL A 1 40  ? -18.794 61.074 54.523 1.00 51.77  ? 40   VAL A N   1 
ATOM   267  C CA  . VAL A 1 40  ? -19.596 60.865 55.725 1.00 51.77  ? 40   VAL A CA  1 
ATOM   268  C C   . VAL A 1 40  ? -20.495 59.645 55.645 1.00 51.77  ? 40   VAL A C   1 
ATOM   269  O O   . VAL A 1 40  ? -20.454 58.884 54.676 1.00 51.77  ? 40   VAL A O   1 
ATOM   270  C CB  . VAL A 1 40  ? -20.470 62.076 56.005 1.00 39.13  ? 40   VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 40  ? -19.603 63.250 56.411 1.00 39.13  ? 40   VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 40  ? -21.263 62.415 54.762 1.00 39.13  ? 40   VAL A CG2 1 
ATOM   273  N N   . GLY A 1 41  ? -21.308 59.466 56.678 1.00 54.73  ? 41   GLY A N   1 
ATOM   274  C CA  . GLY A 1 41  ? -22.230 58.344 56.724 1.00 54.73  ? 41   GLY A CA  1 
ATOM   275  C C   . GLY A 1 41  ? -21.632 56.991 56.374 1.00 54.73  ? 41   GLY A C   1 
ATOM   276  O O   . GLY A 1 41  ? -20.594 56.591 56.915 1.00 54.73  ? 41   GLY A O   1 
ATOM   277  N N   . ASN A 1 42  ? -22.290 56.278 55.466 1.00 44.90  ? 42   ASN A N   1 
ATOM   278  C CA  . ASN A 1 42  ? -21.820 54.967 55.056 1.00 44.90  ? 42   ASN A CA  1 
ATOM   279  C C   . ASN A 1 42  ? -20.530 55.048 54.266 1.00 44.90  ? 42   ASN A C   1 
ATOM   280  O O   . ASN A 1 42  ? -19.970 54.028 53.863 1.00 44.90  ? 42   ASN A O   1 
ATOM   281  C CB  . ASN A 1 42  ? -22.896 54.256 54.239 1.00 79.27  ? 42   ASN A CB  1 
ATOM   282  C CG  . ASN A 1 42  ? -23.547 53.123 55.013 1.00 79.27  ? 42   ASN A CG  1 
ATOM   283  O OD1 . ASN A 1 42  ? -23.781 53.237 56.232 1.00 79.27  ? 42   ASN A OD1 1 
ATOM   284  N ND2 . ASN A 1 42  ? -23.852 52.019 54.315 1.00 79.27  ? 42   ASN A ND2 1 
ATOM   285  N N   . MET A 1 43  ? -20.054 56.264 54.040 1.00 47.45  ? 43   MET A N   1 
ATOM   286  C CA  . MET A 1 43  ? -18.813 56.416 53.313 1.00 47.45  ? 43   MET A CA  1 
ATOM   287  C C   . MET A 1 43  ? -17.567 56.409 54.215 1.00 47.45  ? 43   MET A C   1 
ATOM   288  O O   . MET A 1 43  ? -16.442 56.379 53.725 1.00 47.45  ? 43   MET A O   1 
ATOM   289  C CB  . MET A 1 43  ? -18.858 57.678 52.459 1.00 61.72  ? 43   MET A CB  1 
ATOM   290  C CG  . MET A 1 43  ? -19.559 57.468 51.132 1.00 61.72  ? 43   MET A CG  1 
ATOM   291  S SD  . MET A 1 43  ? -19.261 58.868 50.006 1.00 61.72  ? 43   MET A SD  1 
ATOM   292  C CE  . MET A 1 43  ? -17.428 58.643 49.641 1.00 61.72  ? 43   MET A CE  1 
ATOM   293  N N   . ARG A 1 44  ? -17.764 56.413 55.528 1.00 34.09  ? 44   ARG A N   1 
ATOM   294  C CA  . ARG A 1 44  ? -16.639 56.387 56.456 1.00 34.09  ? 44   ARG A CA  1 
ATOM   295  C C   . ARG A 1 44  ? -15.761 55.152 56.208 1.00 34.09  ? 44   ARG A C   1 
ATOM   296  O O   . ARG A 1 44  ? -16.266 54.067 55.929 1.00 34.09  ? 44   ARG A O   1 
ATOM   297  C CB  . ARG A 1 44  ? -17.149 56.396 57.903 1.00 27.24  ? 44   ARG A CB  1 
ATOM   298  C CG  . ARG A 1 44  ? -16.046 56.377 58.941 1.00 27.24  ? 44   ARG A CG  1 
ATOM   299  C CD  . ARG A 1 44  ? -16.585 56.418 60.356 1.00 27.24  ? 44   ARG A CD  1 
ATOM   300  N NE  . ARG A 1 44  ? -17.188 57.698 60.700 1.00 27.24  ? 44   ARG A NE  1 
ATOM   301  C CZ  . ARG A 1 44  ? -17.872 57.909 61.819 1.00 27.24  ? 44   ARG A CZ  1 
ATOM   302  N NH1 . ARG A 1 44  ? -18.034 56.927 62.692 1.00 27.24  ? 44   ARG A NH1 1 
ATOM   303  N NH2 . ARG A 1 44  ? -18.399 59.094 62.066 1.00 27.24  ? 44   ARG A NH2 1 
ATOM   304  N N   . PHE A 1 45  ? -14.447 55.338 56.308 1.00 34.16  ? 45   PHE A N   1 
ATOM   305  C CA  . PHE A 1 45  ? -13.445 54.286 56.094 1.00 34.16  ? 45   PHE A CA  1 
ATOM   306  C C   . PHE A 1 45  ? -13.412 53.807 54.658 1.00 34.16  ? 45   PHE A C   1 
ATOM   307  O O   . PHE A 1 45  ? -12.545 53.021 54.281 1.00 34.16  ? 45   PHE A O   1 
ATOM   308  C CB  . PHE A 1 45  ? -13.683 53.077 57.004 1.00 36.81  ? 45   PHE A CB  1 
ATOM   309  C CG  . PHE A 1 45  ? -13.878 53.429 58.442 1.00 36.81  ? 45   PHE A CG  1 
ATOM   310  C CD1 . PHE A 1 45  ? -12.985 54.275 59.093 1.00 36.81  ? 45   PHE A CD1 1 
ATOM   311  C CD2 . PHE A 1 45  ? -14.971 52.927 59.149 1.00 36.81  ? 45   PHE A CD2 1 
ATOM   312  C CE1 . PHE A 1 45  ? -13.177 54.624 60.429 1.00 36.81  ? 45   PHE A CE1 1 
ATOM   313  C CE2 . PHE A 1 45  ? -15.172 53.268 60.485 1.00 36.81  ? 45   PHE A CE2 1 
ATOM   314  C CZ  . PHE A 1 45  ? -14.271 54.122 61.128 1.00 36.81  ? 45   PHE A CZ  1 
ATOM   315  N N   . ARG A 1 46  ? -14.355 54.280 53.855 1.00 42.01  ? 46   ARG A N   1 
ATOM   316  C CA  . ARG A 1 46  ? -14.425 53.870 52.461 1.00 42.01  ? 46   ARG A CA  1 
ATOM   317  C C   . ARG A 1 46  ? -13.605 54.778 51.542 1.00 42.01  ? 46   ARG A C   1 
ATOM   318  O O   . ARG A 1 46  ? -13.353 55.937 51.866 1.00 42.01  ? 46   ARG A O   1 
ATOM   319  C CB  . ARG A 1 46  ? -15.883 53.837 52.006 1.00 73.49  ? 46   ARG A CB  1 
ATOM   320  C CG  . ARG A 1 46  ? -16.075 53.173 50.660 1.00 73.49  ? 46   ARG A CG  1 
ATOM   321  C CD  . ARG A 1 46  ? -17.519 53.211 50.222 1.00 73.49  ? 46   ARG A CD  1 
ATOM   322  N NE  . ARG A 1 46  ? -18.372 52.477 51.146 1.00 73.49  ? 46   ARG A NE  1 
ATOM   323  C CZ  . ARG A 1 46  ? -19.702 52.439 51.063 1.00 73.49  ? 46   ARG A CZ  1 
ATOM   324  N NH1 . ARG A 1 46  ? -20.333 53.104 50.090 1.00 73.49  ? 46   ARG A NH1 1 
ATOM   325  N NH2 . ARG A 1 46  ? -20.403 51.730 51.952 1.00 73.49  ? 46   ARG A NH2 1 
ATOM   326  N N   . ARG A 1 47  ? -13.181 54.246 50.401 1.00 36.66  ? 47   ARG A N   1 
ATOM   327  C CA  . ARG A 1 47  ? -12.396 55.024 49.453 1.00 36.66  ? 47   ARG A CA  1 
ATOM   328  C C   . ARG A 1 47  ? -13.136 56.285 48.987 1.00 36.66  ? 47   ARG A C   1 
ATOM   329  O O   . ARG A 1 47  ? -14.361 56.294 48.849 1.00 36.66  ? 47   ARG A O   1 
ATOM   330  C CB  . ARG A 1 47  ? -12.040 54.169 48.244 1.00 48.14  ? 47   ARG A CB  1 
ATOM   331  C CG  . ARG A 1 47  ? -11.098 53.021 48.535 1.00 48.14  ? 47   ARG A CG  1 
ATOM   332  C CD  . ARG A 1 47  ? -10.849 52.213 47.263 1.00 48.14  ? 47   ARG A CD  1 
ATOM   333  N NE  . ARG A 1 47  ? -9.704  51.312 47.383 1.00 48.14  ? 47   ARG A NE  1 
ATOM   334  C CZ  . ARG A 1 47  ? -9.768  50.053 47.811 1.00 48.14  ? 47   ARG A CZ  1 
ATOM   335  N NH1 . ARG A 1 47  ? -10.942 49.517 48.166 1.00 48.14  ? 47   ARG A NH1 1 
ATOM   336  N NH2 . ARG A 1 47  ? -8.650  49.331 47.884 1.00 48.14  ? 47   ARG A NH2 1 
ATOM   337  N N   . PRO A 1 48  ? -12.396 57.370 48.729 1.00 33.51  ? 48   PRO A N   1 
ATOM   338  C CA  . PRO A 1 48  ? -13.051 58.597 48.283 1.00 33.51  ? 48   PRO A CA  1 
ATOM   339  C C   . PRO A 1 48  ? -13.599 58.466 46.866 1.00 33.51  ? 48   PRO A C   1 
ATOM   340  O O   . PRO A 1 48  ? -13.038 57.732 46.050 1.00 33.51  ? 48   PRO A O   1 
ATOM   341  C CB  . PRO A 1 48  ? -11.929 59.617 48.359 1.00 33.35  ? 48   PRO A CB  1 
ATOM   342  C CG  . PRO A 1 48  ? -10.736 58.800 47.950 1.00 33.35  ? 48   PRO A CG  1 
ATOM   343  C CD  . PRO A 1 48  ? -10.931 57.541 48.763 1.00 33.35  ? 48   PRO A CD  1 
ATOM   344  N N   . GLU A 1 49  ? -14.696 59.178 46.588 1.00 39.21  ? 49   GLU A N   1 
ATOM   345  C CA  . GLU A 1 49  ? -15.310 59.188 45.259 1.00 39.21  ? 49   GLU A CA  1 
ATOM   346  C C   . GLU A 1 49  ? -15.220 60.611 44.700 1.00 39.21  ? 49   GLU A C   1 
ATOM   347  O O   . GLU A 1 49  ? -15.388 61.583 45.428 1.00 39.21  ? 49   GLU A O   1 
ATOM   348  C CB  . GLU A 1 49  ? -16.782 58.749 45.328 1.00 96.36  ? 49   GLU A CB  1 
ATOM   349  C CG  . GLU A 1 49  ? -17.040 57.261 45.666 1.00 96.36  ? 49   GLU A CG  1 
ATOM   350  C CD  . GLU A 1 49  ? -16.302 56.253 44.749 1.00 96.36  ? 49   GLU A CD  1 
ATOM   351  O OE1 . GLU A 1 49  ? -16.188 56.491 43.516 1.00 96.36  ? 49   GLU A OE1 1 
ATOM   352  O OE2 . GLU A 1 49  ? -15.850 55.201 45.270 1.00 96.36  ? 49   GLU A OE2 1 
ATOM   353  N N   . PRO A 1 50  ? -14.964 60.749 43.390 1.00 45.37  ? 50   PRO A N   1 
ATOM   354  C CA  . PRO A 1 50  ? -14.844 62.059 42.731 1.00 45.37  ? 50   PRO A CA  1 
ATOM   355  C C   . PRO A 1 50  ? -16.005 62.995 43.031 1.00 45.37  ? 50   PRO A C   1 
ATOM   356  O O   . PRO A 1 50  ? -17.156 62.574 42.999 1.00 45.37  ? 50   PRO A O   1 
ATOM   357  C CB  . PRO A 1 50  ? -14.798 61.696 41.251 1.00 38.40  ? 50   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 50  ? -14.255 60.304 41.235 1.00 38.40  ? 50   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 50  ? -14.985 59.671 42.388 1.00 38.40  ? 50   PRO A CD  1 
ATOM   360  N N   . LYS A 1 51  ? -15.719 64.262 43.311 1.00 37.30  ? 51   LYS A N   1 
ATOM   361  C CA  . LYS A 1 51  ? -16.794 65.212 43.586 1.00 37.30  ? 51   LYS A CA  1 
ATOM   362  C C   . LYS A 1 51  ? -17.643 65.423 42.343 1.00 37.30  ? 51   LYS A C   1 
ATOM   363  O O   . LYS A 1 51  ? -17.118 65.674 41.256 1.00 37.30  ? 51   LYS A O   1 
ATOM   364  C CB  . LYS A 1 51  ? -16.233 66.560 44.017 1.00 39.42  ? 51   LYS A CB  1 
ATOM   365  C CG  . LYS A 1 51  ? -17.282 67.658 44.198 1.00 39.42  ? 51   LYS A CG  1 
ATOM   366  C CD  . LYS A 1 51  ? -18.156 67.450 45.426 1.00 39.42  ? 51   LYS A CD  1 
ATOM   367  C CE  . LYS A 1 51  ? -19.015 68.686 45.688 1.00 39.42  ? 51   LYS A CE  1 
ATOM   368  N NZ  . LYS A 1 51  ? -19.920 68.532 46.869 1.00 39.42  ? 51   LYS A NZ  1 
ATOM   369  N N   . LYS A 1 52  ? -18.958 65.324 42.505 1.00 45.21  ? 52   LYS A N   1 
ATOM   370  C CA  . LYS A 1 52  ? -19.874 65.521 41.389 1.00 45.21  ? 52   LYS A CA  1 
ATOM   371  C C   . LYS A 1 52  ? -19.893 66.978 40.954 1.00 45.21  ? 52   LYS A C   1 
ATOM   372  O O   . LYS A 1 52  ? -19.938 67.891 41.785 1.00 45.21  ? 52   LYS A O   1 
ATOM   373  C CB  . LYS A 1 52  ? -21.271 65.067 41.779 1.00 68.81  ? 52   LYS A CB  1 
ATOM   374  C CG  . LYS A 1 52  ? -21.596 63.687 41.244 1.00 68.81  ? 52   LYS A CG  1 
ATOM   375  C CD  . LYS A 1 52  ? -22.719 63.028 42.029 1.00 68.81  ? 52   LYS A CD  1 
ATOM   376  C CE  . LYS A 1 52  ? -22.264 62.711 43.456 1.00 68.81  ? 52   LYS A CE  1 
ATOM   377  N NZ  . LYS A 1 52  ? -23.259 61.862 44.198 1.00 68.81  ? 52   LYS A NZ  1 
ATOM   378  N N   . PRO A 1 53  ? -19.859 67.218 39.636 1.00 39.21  ? 53   PRO A N   1 
ATOM   379  C CA  . PRO A 1 53  ? -19.868 68.584 39.111 1.00 39.21  ? 53   PRO A CA  1 
ATOM   380  C C   . PRO A 1 53  ? -20.996 69.417 39.702 1.00 39.21  ? 53   PRO A C   1 
ATOM   381  O O   . PRO A 1 53  ? -22.008 68.887 40.166 1.00 39.21  ? 53   PRO A O   1 
ATOM   382  C CB  . PRO A 1 53  ? -20.009 68.369 37.612 1.00 29.21  ? 53   PRO A CB  1 
ATOM   383  C CG  . PRO A 1 53  ? -19.288 67.075 37.402 1.00 29.21  ? 53   PRO A CG  1 
ATOM   384  C CD  . PRO A 1 53  ? -19.833 66.241 38.538 1.00 29.21  ? 53   PRO A CD  1 
ATOM   385  N N   . TRP A 1 54  ? -20.817 70.728 39.692 1.00 50.54  ? 54   TRP A N   1 
ATOM   386  C CA  . TRP A 1 54  ? -21.826 71.609 40.252 1.00 50.54  ? 54   TRP A CA  1 
ATOM   387  C C   . TRP A 1 54  ? -22.112 72.768 39.308 1.00 50.54  ? 54   TRP A C   1 
ATOM   388  O O   . TRP A 1 54  ? -21.229 73.224 38.570 1.00 50.54  ? 54   TRP A O   1 
ATOM   389  C CB  . TRP A 1 54  ? -21.342 72.142 41.601 1.00 31.11  ? 54   TRP A CB  1 
ATOM   390  C CG  . TRP A 1 54  ? -20.125 72.998 41.487 1.00 31.11  ? 54   TRP A CG  1 
ATOM   391  C CD1 . TRP A 1 54  ? -20.079 74.310 41.122 1.00 31.11  ? 54   TRP A CD1 1 
ATOM   392  C CD2 . TRP A 1 54  ? -18.769 72.589 41.679 1.00 31.11  ? 54   TRP A CD2 1 
ATOM   393  N NE1 . TRP A 1 54  ? -18.779 74.746 41.073 1.00 31.11  ? 54   TRP A NE1 1 
ATOM   394  C CE2 . TRP A 1 54  ? -17.954 73.708 41.411 1.00 31.11  ? 54   TRP A CE2 1 
ATOM   395  C CE3 . TRP A 1 54  ? -18.163 71.386 42.050 1.00 31.11  ? 54   TRP A CE3 1 
ATOM   396  C CZ2 . TRP A 1 54  ? -16.562 73.659 41.504 1.00 31.11  ? 54   TRP A CZ2 1 
ATOM   397  C CZ3 . TRP A 1 54  ? -16.777 71.338 42.140 1.00 31.11  ? 54   TRP A CZ3 1 
ATOM   398  C CH2 . TRP A 1 54  ? -15.994 72.468 41.869 1.00 31.11  ? 54   TRP A CH2 1 
ATOM   399  N N   . SER A 1 55  ? -23.356 73.231 39.329 1.00 63.01  ? 55   SER A N   1 
ATOM   400  C CA  . SER A 1 55  ? -23.768 74.358 38.501 1.00 63.01  ? 55   SER A CA  1 
ATOM   401  C C   . SER A 1 55  ? -23.632 75.611 39.348 1.00 63.01  ? 55   SER A C   1 
ATOM   402  O O   . SER A 1 55  ? -23.600 75.530 40.579 1.00 63.01  ? 55   SER A O   1 
ATOM   403  C CB  . SER A 1 55  ? -25.217 74.193 38.051 1.00 72.02  ? 55   SER A CB  1 
ATOM   404  O OG  . SER A 1 55  ? -25.347 73.053 37.215 1.00 72.02  ? 55   SER A OG  1 
ATOM   405  N N   . GLY A 1 56  ? -23.566 76.769 38.702 1.00 59.25  ? 56   GLY A N   1 
ATOM   406  C CA  . GLY A 1 56  ? -23.407 77.995 39.459 1.00 59.25  ? 56   GLY A CA  1 
ATOM   407  C C   . GLY A 1 56  ? -21.938 78.176 39.792 1.00 59.25  ? 56   GLY A C   1 
ATOM   408  O O   . GLY A 1 56  ? -21.081 77.427 39.305 1.00 59.25  ? 56   GLY A O   1 
ATOM   409  N N   . VAL A 1 57  ? -21.640 79.159 40.629 1.00 36.43  ? 57   VAL A N   1 
ATOM   410  C CA  . VAL A 1 57  ? -20.267 79.434 40.999 1.00 36.43  ? 57   VAL A CA  1 
ATOM   411  C C   . VAL A 1 57  ? -20.017 79.008 42.428 1.00 36.43  ? 57   VAL A C   1 
ATOM   412  O O   . VAL A 1 57  ? -20.823 79.277 43.307 1.00 36.43  ? 57   VAL A O   1 
ATOM   413  C CB  . VAL A 1 57  ? -19.965 80.934 40.864 1.00 41.24  ? 57   VAL A CB  1 
ATOM   414  C CG1 . VAL A 1 57  ? -18.486 81.198 41.138 1.00 41.24  ? 57   VAL A CG1 1 
ATOM   415  C CG2 . VAL A 1 57  ? -20.359 81.414 39.463 1.00 41.24  ? 57   VAL A CG2 1 
ATOM   416  N N   . TRP A 1 58  ? -18.900 78.332 42.663 1.00 39.16  ? 58   TRP A N   1 
ATOM   417  C CA  . TRP A 1 58  ? -18.573 77.895 44.007 1.00 39.16  ? 58   TRP A CA  1 
ATOM   418  C C   . TRP A 1 58  ? -17.794 78.998 44.710 1.00 39.16  ? 58   TRP A C   1 
ATOM   419  O O   . TRP A 1 58  ? -16.819 79.510 44.175 1.00 39.16  ? 58   TRP A O   1 
ATOM   420  C CB  . TRP A 1 58  ? -17.752 76.611 43.954 1.00 33.17  ? 58   TRP A CB  1 
ATOM   421  C CG  . TRP A 1 58  ? -17.361 76.111 45.303 1.00 33.17  ? 58   TRP A CG  1 
ATOM   422  C CD1 . TRP A 1 58  ? -16.364 76.595 46.111 1.00 33.17  ? 58   TRP A CD1 1 
ATOM   423  C CD2 . TRP A 1 58  ? -17.972 75.041 46.020 1.00 33.17  ? 58   TRP A CD2 1 
ATOM   424  N NE1 . TRP A 1 58  ? -16.322 75.889 47.283 1.00 33.17  ? 58   TRP A NE1 1 
ATOM   425  C CE2 . TRP A 1 58  ? -17.301 74.929 47.254 1.00 33.17  ? 58   TRP A CE2 1 
ATOM   426  C CE3 . TRP A 1 58  ? -19.025 74.165 45.742 1.00 33.17  ? 58   TRP A CE3 1 
ATOM   427  C CZ2 . TRP A 1 58  ? -17.652 73.972 48.207 1.00 33.17  ? 58   TRP A CZ2 1 
ATOM   428  C CZ3 . TRP A 1 58  ? -19.371 73.214 46.692 1.00 33.17  ? 58   TRP A CZ3 1 
ATOM   429  C CH2 . TRP A 1 58  ? -18.685 73.128 47.907 1.00 33.17  ? 58   TRP A CH2 1 
ATOM   430  N N   . ASN A 1 59  ? -18.236 79.363 45.909 1.00 50.79  ? 59   ASN A N   1 
ATOM   431  C CA  . ASN A 1 59  ? -17.591 80.412 46.700 1.00 50.79  ? 59   ASN A CA  1 
ATOM   432  C C   . ASN A 1 59  ? -16.340 79.862 47.385 1.00 50.79  ? 59   ASN A C   1 
ATOM   433  O O   . ASN A 1 59  ? -16.453 79.143 48.377 1.00 50.79  ? 59   ASN A O   1 
ATOM   434  C CB  . ASN A 1 59  ? -18.569 80.923 47.767 1.00 44.96  ? 59   ASN A CB  1 
ATOM   435  C CG  . ASN A 1 59  ? -18.106 82.210 48.416 1.00 44.96  ? 59   ASN A CG  1 
ATOM   436  O OD1 . ASN A 1 59  ? -16.908 82.488 48.456 1.00 44.96  ? 59   ASN A OD1 1 
ATOM   437  N ND2 . ASN A 1 59  ? -19.050 83.000 48.939 1.00 44.96  ? 59   ASN A ND2 1 
ATOM   438  N N   . ALA A 1 60  ? -15.157 80.194 46.873 1.00 38.02  ? 60   ALA A N   1 
ATOM   439  C CA  . ALA A 1 60  ? -13.913 79.700 47.470 1.00 38.02  ? 60   ALA A CA  1 
ATOM   440  C C   . ALA A 1 60  ? -13.063 80.834 48.019 1.00 38.02  ? 60   ALA A C   1 
ATOM   441  O O   . ALA A 1 60  ? -11.897 80.992 47.648 1.00 38.02  ? 60   ALA A O   1 
ATOM   442  C CB  . ALA A 1 60  ? -13.113 78.908 46.444 1.00 39.81  ? 60   ALA A CB  1 
ATOM   443  N N   . SER A 1 61  ? -13.642 81.610 48.925 1.00 50.57  ? 61   SER A N   1 
ATOM   444  C CA  . SER A 1 61  ? -12.942 82.750 49.495 1.00 50.57  ? 61   SER A CA  1 
ATOM   445  C C   . SER A 1 61  ? -12.604 82.594 50.968 1.00 50.57  ? 61   SER A C   1 
ATOM   446  O O   . SER A 1 61  ? -11.984 83.480 51.560 1.00 50.57  ? 61   SER A O   1 
ATOM   447  C CB  . SER A 1 61  ? -13.777 84.002 49.297 1.00 52.64  ? 61   SER A CB  1 
ATOM   448  O OG  . SER A 1 61  ? -15.044 83.809 49.893 1.00 52.64  ? 61   SER A OG  1 
ATOM   449  N N   . THR A 1 62  ? -13.029 81.482 51.561 1.00 40.17  ? 62   THR A N   1 
ATOM   450  C CA  . THR A 1 62  ? -12.723 81.205 52.959 1.00 40.17  ? 62   THR A CA  1 
ATOM   451  C C   . THR A 1 62  ? -12.298 79.750 53.126 1.00 40.17  ? 62   THR A C   1 
ATOM   452  O O   . THR A 1 62  ? -12.781 78.863 52.423 1.00 40.17  ? 62   THR A O   1 
ATOM   453  C CB  . THR A 1 62  ? -13.926 81.465 53.869 1.00 45.86  ? 62   THR A CB  1 
ATOM   454  O OG1 . THR A 1 62  ? -14.960 80.523 53.570 1.00 45.86  ? 62   THR A OG1 1 
ATOM   455  C CG2 . THR A 1 62  ? -14.445 82.879 53.670 1.00 45.86  ? 62   THR A CG2 1 
ATOM   456  N N   . TYR A 1 63  ? -11.390 79.513 54.066 1.00 40.74  ? 63   TYR A N   1 
ATOM   457  C CA  . TYR A 1 63  ? -10.892 78.172 54.332 1.00 40.74  ? 63   TYR A CA  1 
ATOM   458  C C   . TYR A 1 63  ? -11.984 77.145 54.607 1.00 40.74  ? 63   TYR A C   1 
ATOM   459  O O   . TYR A 1 63  ? -13.061 77.473 55.095 1.00 40.74  ? 63   TYR A O   1 
ATOM   460  C CB  . TYR A 1 63  ? -9.943  78.191 55.520 1.00 40.81  ? 63   TYR A CB  1 
ATOM   461  C CG  . TYR A 1 63  ? -8.527  78.615 55.205 1.00 40.81  ? 63   TYR A CG  1 
ATOM   462  C CD1 . TYR A 1 63  ? -7.828  78.071 54.121 1.00 40.81  ? 63   TYR A CD1 1 
ATOM   463  C CD2 . TYR A 1 63  ? -7.842  79.478 56.060 1.00 40.81  ? 63   TYR A CD2 1 
ATOM   464  C CE1 . TYR A 1 63  ? -6.472  78.373 53.910 1.00 40.81  ? 63   TYR A CE1 1 
ATOM   465  C CE2 . TYR A 1 63  ? -6.492  79.782 55.857 1.00 40.81  ? 63   TYR A CE2 1 
ATOM   466  C CZ  . TYR A 1 63  ? -5.816  79.226 54.791 1.00 40.81  ? 63   TYR A CZ  1 
ATOM   467  O OH  . TYR A 1 63  ? -4.477  79.507 54.653 1.00 40.81  ? 63   TYR A OH  1 
ATOM   468  N N   . PRO A 1 64  ? -11.709 75.874 54.295 1.00 36.26  ? 64   PRO A N   1 
ATOM   469  C CA  . PRO A 1 64  ? -12.658 74.783 54.511 1.00 36.26  ? 64   PRO A CA  1 
ATOM   470  C C   . PRO A 1 64  ? -12.581 74.338 55.963 1.00 36.26  ? 64   PRO A C   1 
ATOM   471  O O   . PRO A 1 64  ? -11.937 74.989 56.770 1.00 36.26  ? 64   PRO A O   1 
ATOM   472  C CB  . PRO A 1 64  ? -12.148 73.708 53.562 1.00 41.82  ? 64   PRO A CB  1 
ATOM   473  C CG  . PRO A 1 64  ? -10.670 73.888 53.665 1.00 41.82  ? 64   PRO A CG  1 
ATOM   474  C CD  . PRO A 1 64  ? -10.518 75.389 53.573 1.00 41.82  ? 64   PRO A CD  1 
ATOM   475  N N   . ASN A 1 65  ? -13.239 73.237 56.299 1.00 33.78  ? 65   ASN A N   1 
ATOM   476  C CA  . ASN A 1 65  ? -13.170 72.731 57.658 1.00 33.78  ? 65   ASN A CA  1 
ATOM   477  C C   . ASN A 1 65  ? -11.958 71.811 57.783 1.00 33.78  ? 65   ASN A C   1 
ATOM   478  O O   . ASN A 1 65  ? -11.325 71.438 56.794 1.00 33.78  ? 65   ASN A O   1 
ATOM   479  C CB  . ASN A 1 65  ? -14.437 71.959 58.015 1.00 49.55  ? 65   ASN A CB  1 
ATOM   480  C CG  . ASN A 1 65  ? -15.648 72.856 58.135 1.00 49.55  ? 65   ASN A CG  1 
ATOM   481  O OD1 . ASN A 1 65  ? -15.717 73.727 59.008 1.00 49.55  ? 65   ASN A OD1 1 
ATOM   482  N ND2 . ASN A 1 65  ? -16.615 72.649 57.253 1.00 49.55  ? 65   ASN A ND2 1 
ATOM   483  N N   . ASN A 1 66  ? -11.632 71.444 59.009 1.00 38.76  ? 66   ASN A N   1 
ATOM   484  C CA  . ASN A 1 66  ? -10.499 70.573 59.229 1.00 38.76  ? 66   ASN A CA  1 
ATOM   485  C C   . ASN A 1 66  ? -10.973 69.148 59.442 1.00 38.76  ? 66   ASN A C   1 
ATOM   486  O O   . ASN A 1 66  ? -12.057 68.916 59.972 1.00 38.76  ? 66   ASN A O   1 
ATOM   487  C CB  . ASN A 1 66  ? -9.700  71.069 60.433 1.00 41.54  ? 66   ASN A CB  1 
ATOM   488  C CG  . ASN A 1 66  ? -9.047  72.414 60.177 1.00 41.54  ? 66   ASN A CG  1 
ATOM   489  O OD1 . ASN A 1 66  ? -8.642  73.113 61.107 1.00 41.54  ? 66   ASN A OD1 1 
ATOM   490  N ND2 . ASN A 1 66  ? -8.933  72.781 58.901 1.00 41.54  ? 66   ASN A ND2 1 
ATOM   491  N N   . CYS A 1 67  ? -10.161 68.194 59.008 1.00 29.35  ? 67   CYS A N   1 
ATOM   492  C CA  . CYS A 1 67  ? -10.504 66.798 59.165 1.00 29.35  ? 67   CYS A CA  1 
ATOM   493  C C   . CYS A 1 67  ? -10.711 66.535 60.650 1.00 29.35  ? 67   CYS A C   1 
ATOM   494  O O   . CYS A 1 67  ? -10.144 67.235 61.478 1.00 29.35  ? 67   CYS A O   1 
ATOM   495  C CB  . CYS A 1 67  ? -9.379  65.927 58.614 1.00 18.90  ? 67   CYS A CB  1 
ATOM   496  N N   . GLN A 1 68  ? -11.548 65.553 60.982 1.00 40.97  ? 68   GLN A N   1 
ATOM   497  C CA  . GLN A 1 68  ? -11.796 65.184 62.381 1.00 40.97  ? 68   GLN A CA  1 
ATOM   498  C C   . GLN A 1 68  ? -10.500 64.613 62.928 1.00 40.97  ? 68   GLN A C   1 
ATOM   499  O O   . GLN A 1 68  ? -9.972  63.640 62.383 1.00 40.97  ? 68   GLN A O   1 
ATOM   500  C CB  . GLN A 1 68  ? -12.887 64.114 62.482 1.00 52.56  ? 68   GLN A CB  1 
ATOM   501  C CG  . GLN A 1 68  ? -14.304 64.640 62.417 1.00 52.56  ? 68   GLN A CG  1 
ATOM   502  C CD  . GLN A 1 68  ? -14.704 65.392 63.674 1.00 52.56  ? 68   GLN A CD  1 
ATOM   503  O OE1 . GLN A 1 68  ? -15.853 65.815 63.823 1.00 52.56  ? 68   GLN A OE1 1 
ATOM   504  N NE2 . GLN A 1 68  ? -13.756 65.561 64.589 1.00 52.56  ? 68   GLN A NE2 1 
ATOM   505  N N   . GLN A 1 69  ? -9.986  65.205 64.002 1.00 42.35  ? 69   GLN A N   1 
ATOM   506  C CA  . GLN A 1 69  ? -8.725  64.736 64.564 1.00 42.35  ? 69   GLN A CA  1 
ATOM   507  C C   . GLN A 1 69  ? -8.548  64.895 66.060 1.00 42.35  ? 69   GLN A C   1 
ATOM   508  O O   . GLN A 1 69  ? -9.386  65.475 66.760 1.00 42.35  ? 69   GLN A O   1 
ATOM   509  C CB  . GLN A 1 69  ? -7.561  65.437 63.869 1.00 32.74  ? 69   GLN A CB  1 
ATOM   510  C CG  . GLN A 1 69  ? -7.682  66.942 63.877 1.00 32.74  ? 69   GLN A CG  1 
ATOM   511  C CD  . GLN A 1 69  ? -6.576  67.617 63.092 1.00 32.74  ? 69   GLN A CD  1 
ATOM   512  O OE1 . GLN A 1 69  ? -5.459  67.794 63.588 1.00 32.74  ? 69   GLN A OE1 1 
ATOM   513  N NE2 . GLN A 1 69  ? -6.875  67.989 61.854 1.00 32.74  ? 69   GLN A NE2 1 
ATOM   514  N N   . TYR A 1 70  ? -7.431  64.354 66.529 1.00 35.58  ? 70   TYR A N   1 
ATOM   515  C CA  . TYR A 1 70  ? -7.047  64.423 67.926 1.00 35.58  ? 70   TYR A CA  1 
ATOM   516  C C   . TYR A 1 70  ? -6.431  65.798 68.116 1.00 35.58  ? 70   TYR A C   1 
ATOM   517  O O   . TYR A 1 70  ? -5.692  66.282 67.269 1.00 35.58  ? 70   TYR A O   1 
ATOM   518  C CB  . TYR A 1 70  ? -6.016  63.346 68.233 1.00 49.66  ? 70   TYR A CB  1 
ATOM   519  C CG  . TYR A 1 70  ? -5.407  63.477 69.595 1.00 49.66  ? 70   TYR A CG  1 
ATOM   520  C CD1 . TYR A 1 70  ? -6.052  62.962 70.725 1.00 49.66  ? 70   TYR A CD1 1 
ATOM   521  C CD2 . TYR A 1 70  ? -4.204  64.159 69.766 1.00 49.66  ? 70   TYR A CD2 1 
ATOM   522  C CE1 . TYR A 1 70  ? -5.505  63.133 71.995 1.00 49.66  ? 70   TYR A CE1 1 
ATOM   523  C CE2 . TYR A 1 70  ? -3.652  64.336 71.020 1.00 49.66  ? 70   TYR A CE2 1 
ATOM   524  C CZ  . TYR A 1 70  ? -4.301  63.827 72.133 1.00 49.66  ? 70   TYR A CZ  1 
ATOM   525  O OH  . TYR A 1 70  ? -3.757  64.044 73.381 1.00 49.66  ? 70   TYR A OH  1 
ATOM   526  N N   . VAL A 1 71  ? -6.741  66.443 69.225 1.00 34.02  ? 71   VAL A N   1 
ATOM   527  C CA  . VAL A 1 71  ? -6.211  67.766 69.462 1.00 34.02  ? 71   VAL A CA  1 
ATOM   528  C C   . VAL A 1 71  ? -5.311  67.755 70.660 1.00 34.02  ? 71   VAL A C   1 
ATOM   529  O O   . VAL A 1 71  ? -5.648  67.200 71.706 1.00 34.02  ? 71   VAL A O   1 
ATOM   530  C CB  . VAL A 1 71  ? -7.321  68.785 69.716 1.00 26.09  ? 71   VAL A CB  1 
ATOM   531  C CG1 . VAL A 1 71  ? -6.713  70.143 69.964 1.00 26.09  ? 71   VAL A CG1 1 
ATOM   532  C CG2 . VAL A 1 71  ? -8.269  68.822 68.539 1.00 26.09  ? 71   VAL A CG2 1 
ATOM   533  N N   . ASP A 1 72  ? -4.157  68.382 70.504 1.00 37.47  ? 72   ASP A N   1 
ATOM   534  C CA  . ASP A 1 72  ? -3.203  68.450 71.581 1.00 37.47  ? 72   ASP A CA  1 
ATOM   535  C C   . ASP A 1 72  ? -3.602  69.505 72.589 1.00 37.47  ? 72   ASP A C   1 
ATOM   536  O O   . ASP A 1 72  ? -3.867  70.655 72.234 1.00 37.47  ? 72   ASP A O   1 
ATOM   537  C CB  . ASP A 1 72  ? -1.827  68.756 71.035 1.00 56.40  ? 72   ASP A CB  1 
ATOM   538  C CG  . ASP A 1 72  ? -0.842  69.020 72.124 1.00 56.40  ? 72   ASP A CG  1 
ATOM   539  O OD1 . ASP A 1 72  ? -0.908  68.307 73.148 1.00 56.40  ? 72   ASP A OD1 1 
ATOM   540  O OD2 . ASP A 1 72  ? -0.004  69.934 71.963 1.00 56.40  ? 72   ASP A OD2 1 
ATOM   541  N N   . GLU A 1 73  ? -3.655  69.091 73.850 1.00 44.95  ? 73   GLU A N   1 
ATOM   542  C CA  . GLU A 1 73  ? -4.013  69.969 74.950 1.00 44.95  ? 73   GLU A CA  1 
ATOM   543  C C   . GLU A 1 73  ? -2.962  69.902 76.049 1.00 44.95  ? 73   GLU A C   1 
ATOM   544  O O   . GLU A 1 73  ? -3.210  70.293 77.190 1.00 44.95  ? 73   GLU A O   1 
ATOM   545  C CB  . GLU A 1 73  ? -5.369  69.577 75.523 1.00 60.88  ? 73   GLU A CB  1 
ATOM   546  C CG  . GLU A 1 73  ? -6.552  70.250 74.854 1.00 60.88  ? 73   GLU A CG  1 
ATOM   547  C CD  . GLU A 1 73  ? -7.899  69.712 75.355 1.00 60.88  ? 73   GLU A CD  1 
ATOM   548  O OE1 . GLU A 1 73  ? -8.170  69.804 76.585 1.00 60.88  ? 73   GLU A OE1 1 
ATOM   549  O OE2 . GLU A 1 73  ? -8.685  69.196 74.514 1.00 60.88  ? 73   GLU A OE2 1 
ATOM   550  N N   . GLN A 1 74  ? -1.782  69.405 75.709 1.00 43.38  ? 74   GLN A N   1 
ATOM   551  C CA  . GLN A 1 74  ? -0.712  69.314 76.689 1.00 43.38  ? 74   GLN A CA  1 
ATOM   552  C C   . GLN A 1 74  ? -0.270  70.692 77.210 1.00 43.38  ? 74   GLN A C   1 
ATOM   553  O O   . GLN A 1 74  ? 0.258   70.792 78.309 1.00 43.38  ? 74   GLN A O   1 
ATOM   554  C CB  . GLN A 1 74  ? 0.490   68.597 76.076 1.00 65.29  ? 74   GLN A CB  1 
ATOM   555  C CG  . GLN A 1 74  ? 1.659   68.411 77.031 1.00 65.29  ? 74   GLN A CG  1 
ATOM   556  C CD  . GLN A 1 74  ? 1.347   67.425 78.141 1.00 65.29  ? 74   GLN A CD  1 
ATOM   557  O OE1 . GLN A 1 74  ? 2.154   67.222 79.055 1.00 65.29  ? 74   GLN A OE1 1 
ATOM   558  N NE2 . GLN A 1 74  ? 0.175   66.797 78.065 1.00 65.29  ? 74   GLN A NE2 1 
ATOM   559  N N   . PHE A 1 75  ? -0.484  71.749 76.429 1.00 39.89  ? 75   PHE A N   1 
ATOM   560  C CA  . PHE A 1 75  ? -0.071  73.096 76.835 1.00 39.89  ? 75   PHE A CA  1 
ATOM   561  C C   . PHE A 1 75  ? -1.077  74.169 76.435 1.00 39.89  ? 75   PHE A C   1 
ATOM   562  O O   . PHE A 1 75  ? -0.818  74.976 75.536 1.00 39.89  ? 75   PHE A O   1 
ATOM   563  C CB  . PHE A 1 75  ? 1.277   73.431 76.210 1.00 31.43  ? 75   PHE A CB  1 
ATOM   564  C CG  . PHE A 1 75  ? 2.372   72.499 76.607 1.00 31.43  ? 75   PHE A CG  1 
ATOM   565  C CD1 . PHE A 1 75  ? 2.886   72.529 77.895 1.00 31.43  ? 75   PHE A CD1 1 
ATOM   566  C CD2 . PHE A 1 75  ? 2.890   71.597 75.694 1.00 31.43  ? 75   PHE A CD2 1 
ATOM   567  C CE1 . PHE A 1 75  ? 3.897   71.679 78.269 1.00 31.43  ? 75   PHE A CE1 1 
ATOM   568  C CE2 . PHE A 1 75  ? 3.904   70.737 76.053 1.00 31.43  ? 75   PHE A CE2 1 
ATOM   569  C CZ  . PHE A 1 75  ? 4.414   70.774 77.346 1.00 31.43  ? 75   PHE A CZ  1 
ATOM   570  N N   . PRO A 1 76  ? -2.238  74.201 77.109 1.00 52.26  ? 76   PRO A N   1 
ATOM   571  C CA  . PRO A 1 76  ? -3.282  75.184 76.811 1.00 52.26  ? 76   PRO A CA  1 
ATOM   572  C C   . PRO A 1 76  ? -2.711  76.597 76.742 1.00 52.26  ? 76   PRO A C   1 
ATOM   573  O O   . PRO A 1 76  ? -1.958  77.005 77.631 1.00 52.26  ? 76   PRO A O   1 
ATOM   574  C CB  . PRO A 1 76  ? -4.251  75.006 77.971 1.00 39.52  ? 76   PRO A CB  1 
ATOM   575  C CG  . PRO A 1 76  ? -4.111  73.549 78.302 1.00 39.52  ? 76   PRO A CG  1 
ATOM   576  C CD  . PRO A 1 76  ? -2.621  73.363 78.261 1.00 39.52  ? 76   PRO A CD  1 
ATOM   577  N N   . GLY A 1 77  ? -3.060  77.332 75.685 1.00 64.15  ? 77   GLY A N   1 
ATOM   578  C CA  . GLY A 1 77  ? -2.578  78.694 75.524 1.00 64.15  ? 77   GLY A CA  1 
ATOM   579  C C   . GLY A 1 77  ? -1.245  78.818 74.798 1.00 64.15  ? 77   GLY A C   1 
ATOM   580  O O   . GLY A 1 77  ? -1.053  79.727 73.988 1.00 64.15  ? 77   GLY A O   1 
ATOM   581  N N   . PHE A 1 78  ? -0.325  77.903 75.083 1.00 42.82  ? 78   PHE A N   1 
ATOM   582  C CA  . PHE A 1 78  ? 1.005   77.898 74.475 1.00 42.82  ? 78   PHE A CA  1 
ATOM   583  C C   . PHE A 1 78  ? 0.951   77.951 72.945 1.00 42.82  ? 78   PHE A C   1 
ATOM   584  O O   . PHE A 1 78  ? 0.458   77.033 72.299 1.00 42.82  ? 78   PHE A O   1 
ATOM   585  C CB  . PHE A 1 78  ? 1.740   76.639 74.927 1.00 40.04  ? 78   PHE A CB  1 
ATOM   586  C CG  . PHE A 1 78  ? 3.205   76.673 74.684 1.00 40.04  ? 78   PHE A CG  1 
ATOM   587  C CD1 . PHE A 1 78  ? 3.975   77.731 75.153 1.00 40.04  ? 78   PHE A CD1 1 
ATOM   588  C CD2 . PHE A 1 78  ? 3.836   75.620 74.022 1.00 40.04  ? 78   PHE A CD2 1 
ATOM   589  C CE1 . PHE A 1 78  ? 5.352   77.746 74.975 1.00 40.04  ? 78   PHE A CE1 1 
ATOM   590  C CE2 . PHE A 1 78  ? 5.215   75.618 73.835 1.00 40.04  ? 78   PHE A CE2 1 
ATOM   591  C CZ  . PHE A 1 78  ? 5.975   76.682 74.314 1.00 40.04  ? 78   PHE A CZ  1 
ATOM   592  N N   . SER A 1 79  ? 1.459   79.026 72.361 1.00 46.02  ? 79   SER A N   1 
ATOM   593  C CA  . SER A 1 79  ? 1.440   79.150 70.910 1.00 46.02  ? 79   SER A CA  1 
ATOM   594  C C   . SER A 1 79  ? 2.289   78.051 70.308 1.00 46.02  ? 79   SER A C   1 
ATOM   595  O O   . SER A 1 79  ? 1.983   77.515 69.241 1.00 46.02  ? 79   SER A O   1 
ATOM   596  C CB  . SER A 1 79  ? 2.006   80.494 70.484 1.00 42.59  ? 79   SER A CB  1 
ATOM   597  O OG  . SER A 1 79  ? 3.349   80.608 70.903 1.00 42.59  ? 79   SER A OG  1 
ATOM   598  N N   . GLY A 1 80  ? 3.361   77.712 71.015 1.00 50.30  ? 80   GLY A N   1 
ATOM   599  C CA  . GLY A 1 80  ? 4.276   76.691 70.544 1.00 50.30  ? 80   GLY A CA  1 
ATOM   600  C C   . GLY A 1 80  ? 3.626   75.407 70.096 1.00 50.30  ? 80   GLY A C   1 
ATOM   601  O O   . GLY A 1 80  ? 4.141   74.741 69.209 1.00 50.30  ? 80   GLY A O   1 
ATOM   602  N N   . SER A 1 81  ? 2.496   75.053 70.694 1.00 41.73  ? 81   SER A N   1 
ATOM   603  C CA  . SER A 1 81  ? 1.820   73.812 70.334 1.00 41.73  ? 81   SER A CA  1 
ATOM   604  C C   . SER A 1 81  ? 0.473   74.025 69.650 1.00 41.73  ? 81   SER A C   1 
ATOM   605  O O   . SER A 1 81  ? 0.036   73.198 68.848 1.00 41.73  ? 81   SER A O   1 
ATOM   606  C CB  . SER A 1 81  ? 1.621   72.952 71.583 1.00 34.41  ? 81   SER A CB  1 
ATOM   607  O OG  . SER A 1 81  ? 0.737   73.592 72.483 1.00 34.41  ? 81   SER A OG  1 
ATOM   608  N N   . GLU A 1 82  ? -0.188  75.131 69.963 1.00 49.28  ? 82   GLU A N   1 
ATOM   609  C CA  . GLU A 1 82  ? -1.483  75.396 69.366 1.00 49.28  ? 82   GLU A CA  1 
ATOM   610  C C   . GLU A 1 82  ? -1.402  75.810 67.908 1.00 49.28  ? 82   GLU A C   1 
ATOM   611  O O   . GLU A 1 82  ? -2.359  75.639 67.156 1.00 49.28  ? 82   GLU A O   1 
ATOM   612  C CB  . GLU A 1 82  ? -2.243  76.417 70.212 1.00 75.86  ? 82   GLU A CB  1 
ATOM   613  C CG  . GLU A 1 82  ? -2.985  75.736 71.371 1.00 75.86  ? 82   GLU A CG  1 
ATOM   614  C CD  . GLU A 1 82  ? -3.190  76.633 72.597 1.00 75.86  ? 82   GLU A CD  1 
ATOM   615  O OE1 . GLU A 1 82  ? -2.550  77.717 72.664 1.00 75.86  ? 82   GLU A OE1 1 
ATOM   616  O OE2 . GLU A 1 82  ? -3.984  76.248 73.503 1.00 75.86  ? 82   GLU A OE2 1 
ATOM   617  N N   . MET A 1 83  ? -0.252  76.317 67.487 1.00 37.42  ? 83   MET A N   1 
ATOM   618  C CA  . MET A 1 83  ? -0.094  76.720 66.097 1.00 37.42  ? 83   MET A CA  1 
ATOM   619  C C   . MET A 1 83  ? -0.150  75.497 65.194 1.00 37.42  ? 83   MET A C   1 
ATOM   620  O O   . MET A 1 83  ? 0.026   75.608 63.981 1.00 37.42  ? 83   MET A O   1 
ATOM   621  C CB  . MET A 1 83  ? 1.245   77.392 65.884 1.00 52.84  ? 83   MET A CB  1 
ATOM   622  C CG  . MET A 1 83  ? 2.369   76.402 65.887 1.00 52.84  ? 83   MET A CG  1 
ATOM   623  S SD  . MET A 1 83  ? 3.887   77.136 65.335 1.00 52.84  ? 83   MET A SD  1 
ATOM   624  C CE  . MET A 1 83  ? 4.795   77.346 66.974 1.00 52.84  ? 83   MET A CE  1 
ATOM   625  N N   . TRP A 1 84  ? -0.356  74.326 65.787 1.00 45.09  ? 84   TRP A N   1 
ATOM   626  C CA  . TRP A 1 84  ? -0.441  73.098 65.010 1.00 45.09  ? 84   TRP A CA  1 
ATOM   627  C C   . TRP A 1 84  ? -1.837  72.498 65.109 1.00 45.09  ? 84   TRP A C   1 
ATOM   628  O O   . TRP A 1 84  ? -2.227  71.689 64.273 1.00 45.09  ? 84   TRP A O   1 
ATOM   629  C CB  . TRP A 1 84  ? 0.598   72.080 65.484 1.00 37.35  ? 84   TRP A CB  1 
ATOM   630  C CG  . TRP A 1 84  ? 2.013   72.572 65.414 1.00 37.35  ? 84   TRP A CG  1 
ATOM   631  C CD1 . TRP A 1 84  ? 2.814   72.903 66.469 1.00 37.35  ? 84   TRP A CD1 1 
ATOM   632  C CD2 . TRP A 1 84  ? 2.801   72.789 64.229 1.00 37.35  ? 84   TRP A CD2 1 
ATOM   633  N NE1 . TRP A 1 84  ? 4.050   73.310 66.018 1.00 37.35  ? 84   TRP A NE1 1 
ATOM   634  C CE2 . TRP A 1 84  ? 4.068   73.250 64.650 1.00 37.35  ? 84   TRP A CE2 1 
ATOM   635  C CE3 . TRP A 1 84  ? 2.560   72.637 62.856 1.00 37.35  ? 84   TRP A CE3 1 
ATOM   636  C CZ2 . TRP A 1 84  ? 5.093   73.560 63.744 1.00 37.35  ? 84   TRP A CZ2 1 
ATOM   637  C CZ3 . TRP A 1 84  ? 3.578   72.942 61.956 1.00 37.35  ? 84   TRP A CZ3 1 
ATOM   638  C CH2 . TRP A 1 84  ? 4.829   73.400 62.408 1.00 37.35  ? 84   TRP A CH2 1 
ATOM   639  N N   . ASN A 1 85  ? -2.588  72.894 66.130 1.00 32.21  ? 85   ASN A N   1 
ATOM   640  C CA  . ASN A 1 85  ? -3.938  72.389 66.307 1.00 32.21  ? 85   ASN A CA  1 
ATOM   641  C C   . ASN A 1 85  ? -4.804  72.961 65.211 1.00 32.21  ? 85   ASN A C   1 
ATOM   642  O O   . ASN A 1 85  ? -4.449  73.967 64.609 1.00 32.21  ? 85   ASN A O   1 
ATOM   643  C CB  . ASN A 1 85  ? -4.511  72.830 67.648 1.00 46.92  ? 85   ASN A CB  1 
ATOM   644  C CG  . ASN A 1 85  ? -3.760  72.260 68.818 1.00 46.92  ? 85   ASN A CG  1 
ATOM   645  O OD1 . ASN A 1 85  ? -3.515  71.053 68.893 1.00 46.92  ? 85   ASN A OD1 1 
ATOM   646  N ND2 . ASN A 1 85  ? -3.396  73.125 69.752 1.00 46.92  ? 85   ASN A ND2 1 
ATOM   647  N N   . PRO A 1 86  ? -5.958  72.331 64.940 1.00 35.10  ? 86   PRO A N   1 
ATOM   648  C CA  . PRO A 1 86  ? -6.878  72.799 63.902 1.00 35.10  ? 86   PRO A CA  1 
ATOM   649  C C   . PRO A 1 86  ? -7.402  74.180 64.264 1.00 35.10  ? 86   PRO A C   1 
ATOM   650  O O   . PRO A 1 86  ? -7.774  74.414 65.406 1.00 35.10  ? 86   PRO A O   1 
ATOM   651  C CB  . PRO A 1 86  ? -7.987  71.755 63.929 1.00 29.77  ? 86   PRO A CB  1 
ATOM   652  C CG  . PRO A 1 86  ? -7.300  70.547 64.382 1.00 29.77  ? 86   PRO A CG  1 
ATOM   653  C CD  . PRO A 1 86  ? -6.430  71.055 65.494 1.00 29.77  ? 86   PRO A CD  1 
ATOM   654  N N   . ASN A 1 87  ? -7.425  75.085 63.292 1.00 35.16  ? 87   ASN A N   1 
ATOM   655  C CA  . ASN A 1 87  ? -7.904  76.440 63.506 1.00 35.16  ? 87   ASN A CA  1 
ATOM   656  C C   . ASN A 1 87  ? -9.305  76.641 62.916 1.00 35.16  ? 87   ASN A C   1 
ATOM   657  O O   . ASN A 1 87  ? -9.739  77.774 62.719 1.00 35.16  ? 87   ASN A O   1 
ATOM   658  C CB  . ASN A 1 87  ? -6.931  77.436 62.875 1.00 42.84  ? 87   ASN A CB  1 
ATOM   659  C CG  . ASN A 1 87  ? -6.645  77.124 61.415 1.00 42.84  ? 87   ASN A CG  1 
ATOM   660  O OD1 . ASN A 1 87  ? -7.537  76.736 60.668 1.00 42.84  ? 87   ASN A OD1 1 
ATOM   661  N ND2 . ASN A 1 87  ? -5.398  77.302 61.001 1.00 42.84  ? 87   ASN A ND2 1 
ATOM   662  N N   . ARG A 1 88  ? -10.008 75.546 62.636 1.00 35.35  ? 88   ARG A N   1 
ATOM   663  C CA  . ARG A 1 88  ? -11.355 75.607 62.064 1.00 35.35  ? 88   ARG A CA  1 
ATOM   664  C C   . ARG A 1 88  ? -12.217 74.489 62.624 1.00 35.35  ? 88   ARG A C   1 
ATOM   665  O O   . ARG A 1 88  ? -11.705 73.539 63.218 1.00 35.35  ? 88   ARG A O   1 
ATOM   666  C CB  . ARG A 1 88  ? -11.301 75.413 60.559 1.00 51.20  ? 88   ARG A CB  1 
ATOM   667  C CG  . ARG A 1 88  ? -10.393 76.336 59.835 1.00 51.20  ? 88   ARG A CG  1 
ATOM   668  C CD  . ARG A 1 88  ? -11.125 77.578 59.503 1.00 51.20  ? 88   ARG A CD  1 
ATOM   669  N NE  . ARG A 1 88  ? -10.212 78.704 59.484 1.00 51.20  ? 88   ARG A NE  1 
ATOM   670  C CZ  . ARG A 1 88  ? -10.599 79.950 59.264 1.00 51.20  ? 88   ARG A CZ  1 
ATOM   671  N NH1 . ARG A 1 88  ? -11.884 80.204 59.047 1.00 51.20  ? 88   ARG A NH1 1 
ATOM   672  N NH2 . ARG A 1 88  ? -9.707  80.931 59.256 1.00 51.20  ? 88   ARG A NH2 1 
ATOM   673  N N   . GLU A 1 89  ? -13.527 74.590 62.406 1.00 35.40  ? 89   GLU A N   1 
ATOM   674  C CA  . GLU A 1 89  ? -14.461 73.568 62.864 1.00 35.40  ? 89   GLU A CA  1 
ATOM   675  C C   . GLU A 1 89  ? -14.050 72.235 62.265 1.00 35.40  ? 89   GLU A C   1 
ATOM   676  O O   . GLU A 1 89  ? -13.824 72.143 61.064 1.00 35.40  ? 89   GLU A O   1 
ATOM   677  C CB  . GLU A 1 89  ? -15.873 73.874 62.383 1.00 86.96  ? 89   GLU A CB  1 
ATOM   678  C CG  . GLU A 1 89  ? -16.886 73.962 63.496 1.00 86.96  ? 89   GLU A CG  1 
ATOM   679  C CD  . GLU A 1 89  ? -16.993 75.374 64.049 1.00 86.96  ? 89   GLU A CD  1 
ATOM   680  O OE1 . GLU A 1 89  ? -17.650 76.229 63.393 1.00 86.96  ? 89   GLU A OE1 1 
ATOM   681  O OE2 . GLU A 1 89  ? -16.408 75.632 65.131 1.00 86.96  ? 89   GLU A OE2 1 
ATOM   682  N N   . MET A 1 90  ? -13.944 71.200 63.084 1.00 33.80  ? 90   MET A N   1 
ATOM   683  C CA  . MET A 1 90  ? -13.583 69.897 62.548 1.00 33.80  ? 90   MET A CA  1 
ATOM   684  C C   . MET A 1 90  ? -14.865 69.288 62.044 1.00 33.80  ? 90   MET A C   1 
ATOM   685  O O   . MET A 1 90  ? -15.925 69.538 62.602 1.00 33.80  ? 90   MET A O   1 
ATOM   686  C CB  . MET A 1 90  ? -12.964 69.001 63.623 1.00 44.57  ? 90   MET A CB  1 
ATOM   687  C CG  . MET A 1 90  ? -11.499 69.298 63.916 1.00 44.57  ? 90   MET A CG  1 
ATOM   688  S SD  . MET A 1 90  ? -10.900 68.272 65.260 1.00 44.57  ? 90   MET A SD  1 
ATOM   689  C CE  . MET A 1 90  ? -11.617 69.104 66.695 1.00 44.57  ? 90   MET A CE  1 
ATOM   690  N N   . SER A 1 91  ? -14.761 68.490 60.988 1.00 38.51  ? 91   SER A N   1 
ATOM   691  C CA  . SER A 1 91  ? -15.922 67.854 60.368 1.00 38.51  ? 91   SER A CA  1 
ATOM   692  C C   . SER A 1 91  ? -15.458 66.678 59.518 1.00 38.51  ? 91   SER A C   1 
ATOM   693  O O   . SER A 1 91  ? -14.396 66.747 58.895 1.00 38.51  ? 91   SER A O   1 
ATOM   694  C CB  . SER A 1 91  ? -16.645 68.878 59.477 1.00 35.08  ? 91   SER A CB  1 
ATOM   695  O OG  . SER A 1 91  ? -17.636 68.276 58.669 1.00 35.08  ? 91   SER A OG  1 
ATOM   696  N N   . GLU A 1 92  ? -16.239 65.599 59.490 1.00 49.88  ? 92   GLU A N   1 
ATOM   697  C CA  . GLU A 1 92  ? -15.869 64.451 58.676 1.00 49.88  ? 92   GLU A CA  1 
ATOM   698  C C   . GLU A 1 92  ? -15.827 64.895 57.210 1.00 49.88  ? 92   GLU A C   1 
ATOM   699  O O   . GLU A 1 92  ? -15.201 64.240 56.365 1.00 49.88  ? 92   GLU A O   1 
ATOM   700  C CB  . GLU A 1 92  ? -16.862 63.301 58.866 1.00 42.94  ? 92   GLU A CB  1 
ATOM   701  C CG  . GLU A 1 92  ? -16.432 62.269 59.910 1.00 42.94  ? 92   GLU A CG  1 
ATOM   702  C CD  . GLU A 1 92  ? -17.291 60.995 59.881 1.00 42.94  ? 92   GLU A CD  1 
ATOM   703  O OE1 . GLU A 1 92  ? -18.479 61.064 60.276 1.00 42.94  ? 92   GLU A OE1 1 
ATOM   704  O OE2 . GLU A 1 92  ? -16.784 59.924 59.453 1.00 42.94  ? 92   GLU A OE2 1 
ATOM   705  N N   . ASP A 1 93  ? -16.488 66.016 56.919 1.00 43.93  ? 93   ASP A N   1 
ATOM   706  C CA  . ASP A 1 93  ? -16.518 66.588 55.572 1.00 43.93  ? 93   ASP A CA  1 
ATOM   707  C C   . ASP A 1 93  ? -15.331 67.545 55.462 1.00 43.93  ? 93   ASP A C   1 
ATOM   708  O O   . ASP A 1 93  ? -15.482 68.770 55.560 1.00 43.93  ? 93   ASP A O   1 
ATOM   709  C CB  . ASP A 1 93  ? -17.834 67.334 55.347 1.00 54.60  ? 93   ASP A CB  1 
ATOM   710  C CG  . ASP A 1 93  ? -17.908 67.994 53.978 1.00 54.60  ? 93   ASP A CG  1 
ATOM   711  O OD1 . ASP A 1 93  ? -17.234 67.513 53.027 1.00 54.60  ? 93   ASP A OD1 1 
ATOM   712  O OD2 . ASP A 1 93  ? -18.655 68.989 53.850 1.00 54.60  ? 93   ASP A OD2 1 
ATOM   713  N N   . CYS A 1 94  ? -14.157 66.952 55.232 1.00 41.08  ? 94   CYS A N   1 
ATOM   714  C CA  . CYS A 1 94  ? -12.879 67.655 55.166 1.00 41.08  ? 94   CYS A CA  1 
ATOM   715  C C   . CYS A 1 94  ? -12.154 67.725 53.828 1.00 41.08  ? 94   CYS A C   1 
ATOM   716  O O   . CYS A 1 94  ? -11.257 68.545 53.676 1.00 41.08  ? 94   CYS A O   1 
ATOM   717  C CB  . CYS A 1 94  ? -11.927 67.029 56.197 1.00 12.73  ? 94   CYS A CB  1 
ATOM   718  N N   . LEU A 1 95  ? -12.514 66.886 52.862 1.00 40.26  ? 95   LEU A N   1 
ATOM   719  C CA  . LEU A 1 95  ? -11.781 66.863 51.593 1.00 40.26  ? 95   LEU A CA  1 
ATOM   720  C C   . LEU A 1 95  ? -11.838 68.062 50.643 1.00 40.26  ? 95   LEU A C   1 
ATOM   721  O O   . LEU A 1 95  ? -12.586 68.056 49.669 1.00 40.26  ? 95   LEU A O   1 
ATOM   722  C CB  . LEU A 1 95  ? -12.155 65.602 50.824 1.00 28.61  ? 95   LEU A CB  1 
ATOM   723  C CG  . LEU A 1 95  ? -12.026 64.342 51.667 1.00 28.61  ? 95   LEU A CG  1 
ATOM   724  C CD1 . LEU A 1 95  ? -12.296 63.128 50.805 1.00 28.61  ? 95   LEU A CD1 1 
ATOM   725  C CD2 . LEU A 1 95  ? -10.640 64.280 52.278 1.00 28.61  ? 95   LEU A CD2 1 
ATOM   726  N N   . TYR A 1 96  ? -11.024 69.076 50.910 1.00 30.25  ? 96   TYR A N   1 
ATOM   727  C CA  . TYR A 1 96  ? -10.978 70.258 50.057 1.00 30.25  ? 96   TYR A CA  1 
ATOM   728  C C   . TYR A 1 96  ? -9.528  70.678 49.823 1.00 30.25  ? 96   TYR A C   1 
ATOM   729  O O   . TYR A 1 96  ? -8.633  70.216 50.516 1.00 30.25  ? 96   TYR A O   1 
ATOM   730  C CB  . TYR A 1 96  ? -11.725 71.424 50.705 1.00 36.86  ? 96   TYR A CB  1 
ATOM   731  C CG  . TYR A 1 96  ? -13.151 71.131 51.080 1.00 36.86  ? 96   TYR A CG  1 
ATOM   732  C CD1 . TYR A 1 96  ? -13.460 70.541 52.298 1.00 36.86  ? 96   TYR A CD1 1 
ATOM   733  C CD2 . TYR A 1 96  ? -14.190 71.432 50.210 1.00 36.86  ? 96   TYR A CD2 1 
ATOM   734  C CE1 . TYR A 1 96  ? -14.767 70.255 52.644 1.00 36.86  ? 96   TYR A CE1 1 
ATOM   735  C CE2 . TYR A 1 96  ? -15.493 71.152 50.543 1.00 36.86  ? 96   TYR A CE2 1 
ATOM   736  C CZ  . TYR A 1 96  ? -15.778 70.561 51.759 1.00 36.86  ? 96   TYR A CZ  1 
ATOM   737  O OH  . TYR A 1 96  ? -17.075 70.257 52.083 1.00 36.86  ? 96   TYR A OH  1 
ATOM   738  N N   . LEU A 1 97  ? -9.289  71.542 48.846 1.00 27.47  ? 97   LEU A N   1 
ATOM   739  C CA  . LEU A 1 97  ? -7.934  71.999 48.599 1.00 27.47  ? 97   LEU A CA  1 
ATOM   740  C C   . LEU A 1 97  ? -7.867  73.517 48.418 1.00 27.47  ? 97   LEU A C   1 
ATOM   741  O O   . LEU A 1 97  ? -8.872  74.169 48.156 1.00 27.47  ? 97   LEU A O   1 
ATOM   742  C CB  . LEU A 1 97  ? -7.335  71.264 47.400 1.00 23.18  ? 97   LEU A CB  1 
ATOM   743  C CG  . LEU A 1 97  ? -7.979  71.384 46.025 1.00 23.18  ? 97   LEU A CG  1 
ATOM   744  C CD1 . LEU A 1 97  ? -7.742  72.763 45.453 1.00 23.18  ? 97   LEU A CD1 1 
ATOM   745  C CD2 . LEU A 1 97  ? -7.378  70.343 45.110 1.00 23.18  ? 97   LEU A CD2 1 
ATOM   746  N N   . ASN A 1 98  ? -6.675  74.072 48.573 1.00 40.17  ? 98   ASN A N   1 
ATOM   747  C CA  . ASN A 1 98  ? -6.474  75.508 48.473 1.00 40.17  ? 98   ASN A CA  1 
ATOM   748  C C   . ASN A 1 98  ? -5.464  75.876 47.401 1.00 40.17  ? 98   ASN A C   1 
ATOM   749  O O   . ASN A 1 98  ? -4.405  75.257 47.296 1.00 40.17  ? 98   ASN A O   1 
ATOM   750  C CB  . ASN A 1 98  ? -5.995  76.043 49.817 1.00 43.54  ? 98   ASN A CB  1 
ATOM   751  C CG  . ASN A 1 98  ? -6.929  75.677 50.953 1.00 43.54  ? 98   ASN A CG  1 
ATOM   752  O OD1 . ASN A 1 98  ? -8.073  76.118 50.996 1.00 43.54  ? 98   ASN A OD1 1 
ATOM   753  N ND2 . ASN A 1 98  ? -6.446  74.859 51.877 1.00 43.54  ? 98   ASN A ND2 1 
ATOM   754  N N   . ILE A 1 99  ? -5.785  76.898 46.615 1.00 37.99  ? 99   ILE A N   1 
ATOM   755  C CA  . ILE A 1 99  ? -4.897  77.338 45.546 1.00 37.99  ? 99   ILE A CA  1 
ATOM   756  C C   . ILE A 1 99  ? -4.511  78.813 45.652 1.00 37.99  ? 99   ILE A C   1 
ATOM   757  O O   . ILE A 1 99  ? -5.369  79.674 45.769 1.00 37.99  ? 99   ILE A O   1 
ATOM   758  C CB  . ILE A 1 99  ? -5.548  77.125 44.159 1.00 35.44  ? 99   ILE A CB  1 
ATOM   759  C CG1 . ILE A 1 99  ? -5.952  75.661 43.987 1.00 35.44  ? 99   ILE A CG1 1 
ATOM   760  C CG2 . ILE A 1 99  ? -4.576  77.539 43.067 1.00 35.44  ? 99   ILE A CG2 1 
ATOM   761  C CD1 . ILE A 1 99  ? -6.574  75.335 42.630 1.00 35.44  ? 99   ILE A CD1 1 
ATOM   762  N N   . TRP A 1 100 ? -3.217  79.098 45.613 1.00 28.42  ? 100  TRP A N   1 
ATOM   763  C CA  . TRP A 1 100 ? -2.752  80.475 45.658 1.00 28.42  ? 100  TRP A CA  1 
ATOM   764  C C   . TRP A 1 100 ? -2.154  80.758 44.300 1.00 28.42  ? 100  TRP A C   1 
ATOM   765  O O   . TRP A 1 100 ? -1.151  80.164 43.932 1.00 28.42  ? 100  TRP A O   1 
ATOM   766  C CB  . TRP A 1 100 ? -1.703  80.657 46.750 1.00 24.37  ? 100  TRP A CB  1 
ATOM   767  C CG  . TRP A 1 100 ? -2.307  80.853 48.092 1.00 24.37  ? 100  TRP A CG  1 
ATOM   768  C CD1 . TRP A 1 100 ? -2.824  82.002 48.588 1.00 24.37  ? 100  TRP A CD1 1 
ATOM   769  C CD2 . TRP A 1 100 ? -2.502  79.858 49.098 1.00 24.37  ? 100  TRP A CD2 1 
ATOM   770  N NE1 . TRP A 1 100 ? -3.331  81.794 49.841 1.00 24.37  ? 100  TRP A NE1 1 
ATOM   771  C CE2 . TRP A 1 100 ? -3.147  80.483 50.180 1.00 24.37  ? 100  TRP A CE2 1 
ATOM   772  C CE3 . TRP A 1 100 ? -2.197  78.494 49.190 1.00 24.37  ? 100  TRP A CE3 1 
ATOM   773  C CZ2 . TRP A 1 100 ? -3.490  79.795 51.344 1.00 24.37  ? 100  TRP A CZ2 1 
ATOM   774  C CZ3 . TRP A 1 100 ? -2.540  77.809 50.348 1.00 24.37  ? 100  TRP A CZ3 1 
ATOM   775  C CH2 . TRP A 1 100 ? -3.180  78.462 51.408 1.00 24.37  ? 100  TRP A CH2 1 
ATOM   776  N N   . VAL A 1 101 ? -2.784  81.649 43.543 1.00 34.86  ? 101  VAL A N   1 
ATOM   777  C CA  . VAL A 1 101 ? -2.310  81.986 42.202 1.00 34.86  ? 101  VAL A CA  1 
ATOM   778  C C   . VAL A 1 101 ? -1.786  83.418 42.110 1.00 34.86  ? 101  VAL A C   1 
ATOM   779  O O   . VAL A 1 101 ? -2.397  84.351 42.639 1.00 34.86  ? 101  VAL A O   1 
ATOM   780  C CB  . VAL A 1 101 ? -3.439  81.835 41.158 1.00 30.48  ? 101  VAL A CB  1 
ATOM   781  C CG1 . VAL A 1 101 ? -2.909  82.147 39.776 1.00 30.48  ? 101  VAL A CG1 1 
ATOM   782  C CG2 . VAL A 1 101 ? -4.014  80.439 41.202 1.00 30.48  ? 101  VAL A CG2 1 
ATOM   783  N N   . PRO A 1 102 ? -0.637  83.606 41.439 1.00 37.90  ? 102  PRO A N   1 
ATOM   784  C CA  . PRO A 1 102 ? -0.014  84.924 41.258 1.00 37.90  ? 102  PRO A CA  1 
ATOM   785  C C   . PRO A 1 102 ? -0.925  85.929 40.537 1.00 37.90  ? 102  PRO A C   1 
ATOM   786  O O   . PRO A 1 102 ? -1.988  85.569 40.018 1.00 37.90  ? 102  PRO A O   1 
ATOM   787  C CB  . PRO A 1 102 ? 1.230   84.596 40.440 1.00 28.02  ? 102  PRO A CB  1 
ATOM   788  C CG  . PRO A 1 102 ? 1.616   83.257 40.957 1.00 28.02  ? 102  PRO A CG  1 
ATOM   789  C CD  . PRO A 1 102 ? 0.282   82.535 41.016 1.00 28.02  ? 102  PRO A CD  1 
ATOM   790  N N   . SER A 1 103 ? -0.513  87.192 40.509 1.00 48.18  ? 103  SER A N   1 
ATOM   791  C CA  . SER A 1 103 ? -1.297  88.228 39.830 1.00 48.18  ? 103  SER A CA  1 
ATOM   792  C C   . SER A 1 103 ? -0.373  89.188 39.105 1.00 48.18  ? 103  SER A C   1 
ATOM   793  O O   . SER A 1 103 ? 0.492   89.798 39.717 1.00 48.18  ? 103  SER A O   1 
ATOM   794  C CB  . SER A 1 103 ? -2.146  89.025 40.822 1.00 56.36  ? 103  SER A CB  1 
ATOM   795  O OG  . SER A 1 103 ? -2.838  90.071 40.148 1.00 56.36  ? 103  SER A OG  1 
ATOM   796  N N   . PRO A 1 104 ? -0.562  89.351 37.791 1.00 53.98  ? 104  PRO A N   1 
ATOM   797  C CA  . PRO A 1 104 ? -1.595  88.672 37.006 1.00 53.98  ? 104  PRO A CA  1 
ATOM   798  C C   . PRO A 1 104 ? -1.403  87.151 36.845 1.00 53.98  ? 104  PRO A C   1 
ATOM   799  O O   . PRO A 1 104 ? -0.282  86.632 36.933 1.00 53.98  ? 104  PRO A O   1 
ATOM   800  C CB  . PRO A 1 104 ? -1.550  89.426 35.675 1.00 41.12  ? 104  PRO A CB  1 
ATOM   801  C CG  . PRO A 1 104 ? -0.100  89.757 35.541 1.00 41.12  ? 104  PRO A CG  1 
ATOM   802  C CD  . PRO A 1 104 ? 0.254   90.233 36.935 1.00 41.12  ? 104  PRO A CD  1 
ATOM   803  N N   . ARG A 1 105 ? -2.520  86.456 36.617 1.00 46.93  ? 105  ARG A N   1 
ATOM   804  C CA  . ARG A 1 105 ? -2.560  85.004 36.430 1.00 46.93  ? 105  ARG A CA  1 
ATOM   805  C C   . ARG A 1 105 ? -1.547  84.581 35.383 1.00 46.93  ? 105  ARG A C   1 
ATOM   806  O O   . ARG A 1 105 ? -1.451  85.192 34.321 1.00 46.93  ? 105  ARG A O   1 
ATOM   807  C CB  . ARG A 1 105 ? -3.962  84.575 35.977 1.00 38.39  ? 105  ARG A CB  1 
ATOM   808  C CG  . ARG A 1 105 ? -4.161  83.083 35.867 1.00 38.39  ? 105  ARG A CG  1 
ATOM   809  C CD  . ARG A 1 105 ? -5.538  82.744 35.322 1.00 38.39  ? 105  ARG A CD  1 
ATOM   810  N NE  . ARG A 1 105 ? -6.634  83.259 36.142 1.00 38.39  ? 105  ARG A NE  1 
ATOM   811  C CZ  . ARG A 1 105 ? -7.922  83.173 35.806 1.00 38.39  ? 105  ARG A CZ  1 
ATOM   812  N NH1 . ARG A 1 105 ? -8.283  82.590 34.671 1.00 38.39  ? 105  ARG A NH1 1 
ATOM   813  N NH2 . ARG A 1 105 ? -8.855  83.685 36.595 1.00 38.39  ? 105  ARG A NH2 1 
ATOM   814  N N   . PRO A 1 106 ? -0.772  83.531 35.670 1.00 42.09  ? 106  PRO A N   1 
ATOM   815  C CA  . PRO A 1 106 ? 0.229   83.056 34.712 1.00 42.09  ? 106  PRO A CA  1 
ATOM   816  C C   . PRO A 1 106 ? -0.476  82.268 33.617 1.00 42.09  ? 106  PRO A C   1 
ATOM   817  O O   . PRO A 1 106 ? -1.657  81.944 33.743 1.00 42.09  ? 106  PRO A O   1 
ATOM   818  C CB  . PRO A 1 106 ? 1.126   82.151 35.555 1.00 32.64  ? 106  PRO A CB  1 
ATOM   819  C CG  . PRO A 1 106 ? 0.830   82.548 36.973 1.00 32.64  ? 106  PRO A CG  1 
ATOM   820  C CD  . PRO A 1 106 ? -0.639  82.830 36.952 1.00 32.64  ? 106  PRO A CD  1 
ATOM   821  N N   . LYS A 1 107 ? 0.243   81.969 32.541 1.00 53.22  ? 107  LYS A N   1 
ATOM   822  C CA  . LYS A 1 107 ? -0.325  81.187 31.458 1.00 53.22  ? 107  LYS A CA  1 
ATOM   823  C C   . LYS A 1 107 ? 0.019   79.726 31.724 1.00 53.22  ? 107  LYS A C   1 
ATOM   824  O O   . LYS A 1 107 ? -0.856  78.859 31.667 1.00 53.22  ? 107  LYS A O   1 
ATOM   825  C CB  . LYS A 1 107 ? 0.250   81.633 30.122 1.00 60.24  ? 107  LYS A CB  1 
ATOM   826  C CG  . LYS A 1 107 ? 0.054   83.106 29.848 1.00 60.24  ? 107  LYS A CG  1 
ATOM   827  C CD  . LYS A 1 107 ? -1.398  83.499 30.029 1.00 60.24  ? 107  LYS A CD  1 
ATOM   828  C CE  . LYS A 1 107 ? -1.623  84.966 29.703 1.00 60.24  ? 107  LYS A CE  1 
ATOM   829  N NZ  . LYS A 1 107 ? -3.061  85.316 29.902 1.00 60.24  ? 107  LYS A NZ  1 
ATOM   830  N N   . SER A 1 108 ? 1.288   79.452 32.030 1.00 48.88  ? 108  SER A N   1 
ATOM   831  C CA  . SER A 1 108 ? 1.707   78.085 32.329 1.00 48.88  ? 108  SER A CA  1 
ATOM   832  C C   . SER A 1 108 ? 2.919   78.067 33.258 1.00 48.88  ? 108  SER A C   1 
ATOM   833  O O   . SER A 1 108 ? 4.018   77.706 32.856 1.00 48.88  ? 108  SER A O   1 
ATOM   834  C CB  . SER A 1 108 ? 2.028   77.340 31.033 1.00 50.27  ? 108  SER A CB  1 
ATOM   835  O OG  . SER A 1 108 ? 2.086   75.940 31.263 1.00 50.27  ? 108  SER A OG  1 
ATOM   836  N N   . THR A 1 109 ? 2.713   78.445 34.510 1.00 35.40  ? 109  THR A N   1 
ATOM   837  C CA  . THR A 1 109 ? 3.807   78.488 35.463 1.00 35.40  ? 109  THR A CA  1 
ATOM   838  C C   . THR A 1 109 ? 3.950   77.181 36.241 1.00 35.40  ? 109  THR A C   1 
ATOM   839  O O   . THR A 1 109 ? 3.099   76.304 36.149 1.00 35.40  ? 109  THR A O   1 
ATOM   840  C CB  . THR A 1 109 ? 3.604   79.659 36.451 1.00 42.36  ? 109  THR A CB  1 
ATOM   841  O OG1 . THR A 1 109 ? 4.724   79.743 37.337 1.00 42.36  ? 109  THR A OG1 1 
ATOM   842  C CG2 . THR A 1 109 ? 2.343   79.456 37.274 1.00 42.36  ? 109  THR A CG2 1 
ATOM   843  N N   . THR A 1 110 ? 5.036   77.063 37.004 1.00 38.17  ? 110  THR A N   1 
ATOM   844  C CA  . THR A 1 110 ? 5.321   75.883 37.824 1.00 38.17  ? 110  THR A CA  1 
ATOM   845  C C   . THR A 1 110 ? 4.342   75.708 38.974 1.00 38.17  ? 110  THR A C   1 
ATOM   846  O O   . THR A 1 110 ? 3.939   76.684 39.606 1.00 38.17  ? 110  THR A O   1 
ATOM   847  C CB  . THR A 1 110 ? 6.710   75.968 38.447 1.00 49.39  ? 110  THR A CB  1 
ATOM   848  O OG1 . THR A 1 110 ? 7.694   75.967 37.411 1.00 49.39  ? 110  THR A OG1 1 
ATOM   849  C CG2 . THR A 1 110 ? 6.946   74.794 39.375 1.00 49.39  ? 110  THR A CG2 1 
ATOM   850  N N   . VAL A 1 111 ? 3.994   74.455 39.260 1.00 32.78  ? 111  VAL A N   1 
ATOM   851  C CA  . VAL A 1 111 ? 3.063   74.129 40.336 1.00 32.78  ? 111  VAL A CA  1 
ATOM   852  C C   . VAL A 1 111 ? 3.737   73.374 41.485 1.00 32.78  ? 111  VAL A C   1 
ATOM   853  O O   . VAL A 1 111 ? 4.605   72.537 41.259 1.00 32.78  ? 111  VAL A O   1 
ATOM   854  C CB  . VAL A 1 111 ? 1.897   73.266 39.803 1.00 28.58  ? 111  VAL A CB  1 
ATOM   855  C CG1 . VAL A 1 111 ? 0.909   72.964 40.914 1.00 28.58  ? 111  VAL A CG1 1 
ATOM   856  C CG2 . VAL A 1 111 ? 1.216   73.973 38.663 1.00 28.58  ? 111  VAL A CG2 1 
ATOM   857  N N   . MET A 1 112 ? 3.334   73.682 42.714 1.00 33.17  ? 112  MET A N   1 
ATOM   858  C CA  . MET A 1 112 ? 3.854   73.020 43.903 1.00 33.17  ? 112  MET A CA  1 
ATOM   859  C C   . MET A 1 112 ? 2.687   72.586 44.773 1.00 33.17  ? 112  MET A C   1 
ATOM   860  O O   . MET A 1 112 ? 1.868   73.410 45.158 1.00 33.17  ? 112  MET A O   1 
ATOM   861  C CB  . MET A 1 112 ? 4.762   73.954 44.691 1.00 33.63  ? 112  MET A CB  1 
ATOM   862  C CG  . MET A 1 112 ? 6.072   74.204 43.994 1.00 33.63  ? 112  MET A CG  1 
ATOM   863  S SD  . MET A 1 112 ? 7.208   75.220 44.930 1.00 33.63  ? 112  MET A SD  1 
ATOM   864  C CE  . MET A 1 112 ? 7.978   74.019 45.958 1.00 33.63  ? 112  MET A CE  1 
ATOM   865  N N   . VAL A 1 113 ? 2.599   71.290 45.067 1.00 27.60  ? 113  VAL A N   1 
ATOM   866  C CA  . VAL A 1 113 ? 1.523   70.758 45.898 1.00 27.60  ? 113  VAL A CA  1 
ATOM   867  C C   . VAL A 1 113 ? 2.066   70.333 47.263 1.00 27.60  ? 113  VAL A C   1 
ATOM   868  O O   . VAL A 1 113 ? 2.918   69.458 47.363 1.00 27.60  ? 113  VAL A O   1 
ATOM   869  C CB  . VAL A 1 113 ? 0.819   69.556 45.202 1.00 21.44  ? 113  VAL A CB  1 
ATOM   870  C CG1 . VAL A 1 113 ? -0.269  68.986 46.094 1.00 21.44  ? 113  VAL A CG1 1 
ATOM   871  C CG2 . VAL A 1 113 ? 0.222   70.000 43.885 1.00 21.44  ? 113  VAL A CG2 1 
ATOM   872  N N   . TRP A 1 114 ? 1.551   70.959 48.312 1.00 32.58  ? 114  TRP A N   1 
ATOM   873  C CA  . TRP A 1 114 ? 1.981   70.689 49.675 1.00 32.58  ? 114  TRP A CA  1 
ATOM   874  C C   . TRP A 1 114 ? 1.084   69.708 50.410 1.00 32.58  ? 114  TRP A C   1 
ATOM   875  O O   . TRP A 1 114 ? -0.134  69.860 50.414 1.00 32.58  ? 114  TRP A O   1 
ATOM   876  C CB  . TRP A 1 114 ? 2.052   72.017 50.439 1.00 27.59  ? 114  TRP A CB  1 
ATOM   877  C CG  . TRP A 1 114 ? 2.185   71.913 51.920 1.00 27.59  ? 114  TRP A CG  1 
ATOM   878  C CD1 . TRP A 1 114 ? 1.201   72.101 52.845 1.00 27.59  ? 114  TRP A CD1 1 
ATOM   879  C CD2 . TRP A 1 114 ? 3.374   71.610 52.658 1.00 27.59  ? 114  TRP A CD2 1 
ATOM   880  N NE1 . TRP A 1 114 ? 1.700   71.937 54.115 1.00 27.59  ? 114  TRP A NE1 1 
ATOM   881  C CE2 . TRP A 1 114 ? 3.034   71.634 54.028 1.00 27.59  ? 114  TRP A CE2 1 
ATOM   882  C CE3 . TRP A 1 114 ? 4.696   71.322 52.296 1.00 27.59  ? 114  TRP A CE3 1 
ATOM   883  C CZ2 . TRP A 1 114 ? 3.967   71.380 55.033 1.00 27.59  ? 114  TRP A CZ2 1 
ATOM   884  C CZ3 . TRP A 1 114 ? 5.621   71.071 53.294 1.00 27.59  ? 114  TRP A CZ3 1 
ATOM   885  C CH2 . TRP A 1 114 ? 5.253   71.101 54.647 1.00 27.59  ? 114  TRP A CH2 1 
ATOM   886  N N   . ILE A 1 115 ? 1.690   68.693 51.020 1.00 29.58  ? 115  ILE A N   1 
ATOM   887  C CA  . ILE A 1 115 ? 0.955   67.701 51.794 1.00 29.58  ? 115  ILE A CA  1 
ATOM   888  C C   . ILE A 1 115 ? 1.434   67.833 53.238 1.00 29.58  ? 115  ILE A C   1 
ATOM   889  O O   . ILE A 1 115 ? 2.579   67.507 53.559 1.00 29.58  ? 115  ILE A O   1 
ATOM   890  C CB  . ILE A 1 115 ? 1.229   66.272 51.293 1.00 27.27  ? 115  ILE A CB  1 
ATOM   891  C CG1 . ILE A 1 115 ? 1.014   66.202 49.781 1.00 27.27  ? 115  ILE A CG1 1 
ATOM   892  C CG2 . ILE A 1 115 ? 0.307   65.293 51.998 1.00 27.27  ? 115  ILE A CG2 1 
ATOM   893  C CD1 . ILE A 1 115 ? 1.227   64.837 49.177 1.00 27.27  ? 115  ILE A CD1 1 
ATOM   894  N N   . TYR A 1 116 ? 0.558   68.327 54.108 1.00 31.35  ? 116  TYR A N   1 
ATOM   895  C CA  . TYR A 1 116 ? 0.917   68.537 55.499 1.00 31.35  ? 116  TYR A CA  1 
ATOM   896  C C   . TYR A 1 116 ? 1.237   67.250 56.218 1.00 31.35  ? 116  TYR A C   1 
ATOM   897  O O   . TYR A 1 116 ? 0.860   66.165 55.770 1.00 31.35  ? 116  TYR A O   1 
ATOM   898  C CB  . TYR A 1 116 ? -0.193  69.300 56.237 1.00 31.61  ? 116  TYR A CB  1 
ATOM   899  C CG  . TYR A 1 116 ? -1.545  68.621 56.284 1.00 31.61  ? 116  TYR A CG  1 
ATOM   900  C CD1 . TYR A 1 116 ? -1.768  67.506 57.092 1.00 31.61  ? 116  TYR A CD1 1 
ATOM   901  C CD2 . TYR A 1 116 ? -2.604  69.097 55.524 1.00 31.61  ? 116  TYR A CD2 1 
ATOM   902  C CE1 . TYR A 1 116 ? -3.015  66.882 57.137 1.00 31.61  ? 116  TYR A CE1 1 
ATOM   903  C CE2 . TYR A 1 116 ? -3.848  68.487 55.562 1.00 31.61  ? 116  TYR A CE2 1 
ATOM   904  C CZ  . TYR A 1 116 ? -4.050  67.381 56.366 1.00 31.61  ? 116  TYR A CZ  1 
ATOM   905  O OH  . TYR A 1 116 ? -5.283  66.769 56.381 1.00 31.61  ? 116  TYR A OH  1 
ATOM   906  N N   . GLY A 1 117 ? 1.951   67.380 57.331 1.00 43.08  ? 117  GLY A N   1 
ATOM   907  C CA  . GLY A 1 117 ? 2.319   66.222 58.123 1.00 43.08  ? 117  GLY A CA  1 
ATOM   908  C C   . GLY A 1 117 ? 1.498   66.214 59.394 1.00 43.08  ? 117  GLY A C   1 
ATOM   909  O O   . GLY A 1 117 ? 0.576   67.013 59.524 1.00 43.08  ? 117  GLY A O   1 
ATOM   910  N N   . GLY A 1 118 ? 1.823   65.327 60.332 1.00 32.14  ? 118  GLY A N   1 
ATOM   911  C CA  . GLY A 1 118 ? 1.065   65.260 61.569 1.00 32.14  ? 118  GLY A CA  1 
ATOM   912  C C   . GLY A 1 118 ? 0.969   63.870 62.165 1.00 32.14  ? 118  GLY A C   1 
ATOM   913  O O   . GLY A 1 118 ? 0.117   63.617 63.006 1.00 32.14  ? 118  GLY A O   1 
ATOM   914  N N   . GLY A 1 119 ? 1.847   62.970 61.734 1.00 32.68  ? 119  GLY A N   1 
ATOM   915  C CA  . GLY A 1 119 ? 1.842   61.617 62.255 1.00 32.68  ? 119  GLY A CA  1 
ATOM   916  C C   . GLY A 1 119 ? 0.714   60.795 61.693 1.00 32.68  ? 119  GLY A C   1 
ATOM   917  O O   . GLY A 1 119 ? 0.398   59.730 62.206 1.00 32.68  ? 119  GLY A O   1 
ATOM   918  N N   . PHE A 1 120 ? 0.099   61.282 60.628 1.00 34.93  ? 120  PHE A N   1 
ATOM   919  C CA  . PHE A 1 120 ? -1.012  60.572 60.025 1.00 34.93  ? 120  PHE A CA  1 
ATOM   920  C C   . PHE A 1 120 ? -2.215  60.562 60.967 1.00 34.93  ? 120  PHE A C   1 
ATOM   921  O O   . PHE A 1 120 ? -3.197  59.862 60.713 1.00 34.93  ? 120  PHE A O   1 
ATOM   922  C CB  . PHE A 1 120 ? -0.617  59.131 59.677 1.00 16.57  ? 120  PHE A CB  1 
ATOM   923  C CG  . PHE A 1 120 ? 0.232   59.008 58.448 1.00 16.57  ? 120  PHE A CG  1 
ATOM   924  C CD1 . PHE A 1 120 ? -0.246  59.414 57.215 1.00 16.57  ? 120  PHE A CD1 1 
ATOM   925  C CD2 . PHE A 1 120 ? 1.508   58.457 58.518 1.00 16.57  ? 120  PHE A CD2 1 
ATOM   926  C CE1 . PHE A 1 120 ? 0.530   59.272 56.074 1.00 16.57  ? 120  PHE A CE1 1 
ATOM   927  C CE2 . PHE A 1 120 ? 2.293   58.313 57.374 1.00 16.57  ? 120  PHE A CE2 1 
ATOM   928  C CZ  . PHE A 1 120 ? 1.800   58.720 56.154 1.00 16.57  ? 120  PHE A CZ  1 
ATOM   929  N N   . TYR A 1 121 ? -2.148  61.332 62.052 1.00 42.35  ? 121  TYR A N   1 
ATOM   930  C CA  . TYR A 1 121 ? -3.268  61.401 62.987 1.00 42.35  ? 121  TYR A CA  1 
ATOM   931  C C   . TYR A 1 121 ? -3.749  62.828 63.214 1.00 42.35  ? 121  TYR A C   1 
ATOM   932  O O   . TYR A 1 121 ? -4.712  63.057 63.946 1.00 42.35  ? 121  TYR A O   1 
ATOM   933  C CB  . TYR A 1 121 ? -2.905  60.768 64.335 1.00 35.94  ? 121  TYR A CB  1 
ATOM   934  C CG  . TYR A 1 121 ? -1.990  61.599 65.190 1.00 35.94  ? 121  TYR A CG  1 
ATOM   935  C CD1 . TYR A 1 121 ? -2.466  62.702 65.890 1.00 35.94  ? 121  TYR A CD1 1 
ATOM   936  C CD2 . TYR A 1 121 ? -0.637  61.295 65.277 1.00 35.94  ? 121  TYR A CD2 1 
ATOM   937  C CE1 . TYR A 1 121 ? -1.619  63.481 66.649 1.00 35.94  ? 121  TYR A CE1 1 
ATOM   938  C CE2 . TYR A 1 121 ? 0.221   62.065 66.031 1.00 35.94  ? 121  TYR A CE2 1 
ATOM   939  C CZ  . TYR A 1 121 ? -0.272  63.158 66.717 1.00 35.94  ? 121  TYR A CZ  1 
ATOM   940  O OH  . TYR A 1 121 ? 0.596   63.925 67.462 1.00 35.94  ? 121  TYR A OH  1 
ATOM   941  N N   . SER A 1 122 ? -3.087  63.789 62.586 1.00 24.83  ? 122  SER A N   1 
ATOM   942  C CA  . SER A 1 122 ? -3.464  65.176 62.751 1.00 24.83  ? 122  SER A CA  1 
ATOM   943  C C   . SER A 1 122 ? -2.974  65.964 61.571 1.00 24.83  ? 122  SER A C   1 
ATOM   944  O O   . SER A 1 122 ? -2.193  65.458 60.783 1.00 24.83  ? 122  SER A O   1 
ATOM   945  C CB  . SER A 1 122 ? -2.854  65.725 64.027 1.00 32.24  ? 122  SER A CB  1 
ATOM   946  O OG  . SER A 1 122 ? -1.477  65.410 64.079 1.00 32.24  ? 122  SER A OG  1 
ATOM   947  N N   . GLY A 1 123 ? -3.445  67.200 61.449 1.00 36.33  ? 123  GLY A N   1 
ATOM   948  C CA  . GLY A 1 123 ? -3.032  68.043 60.341 1.00 36.33  ? 123  GLY A CA  1 
ATOM   949  C C   . GLY A 1 123 ? -4.145  68.826 59.662 1.00 36.33  ? 123  GLY A C   1 
ATOM   950  O O   . GLY A 1 123 ? -5.271  68.354 59.533 1.00 36.33  ? 123  GLY A O   1 
ATOM   951  N N   . SER A 1 124 ? -3.822  70.030 59.213 1.00 31.09  ? 124  SER A N   1 
ATOM   952  C CA  . SER A 1 124 ? -4.792  70.879 58.547 1.00 31.09  ? 124  SER A CA  1 
ATOM   953  C C   . SER A 1 124 ? -4.051  71.662 57.480 1.00 31.09  ? 124  SER A C   1 
ATOM   954  O O   . SER A 1 124 ? -2.858  71.875 57.605 1.00 31.09  ? 124  SER A O   1 
ATOM   955  C CB  . SER A 1 124 ? -5.403  71.843 59.557 1.00 42.29  ? 124  SER A CB  1 
ATOM   956  O OG  . SER A 1 124 ? -5.897  71.151 60.693 1.00 42.29  ? 124  SER A OG  1 
ATOM   957  N N   . SER A 1 125 ? -4.732  72.083 56.423 1.00 43.91  ? 125  SER A N   1 
ATOM   958  C CA  . SER A 1 125 ? -4.063  72.852 55.378 1.00 43.91  ? 125  SER A CA  1 
ATOM   959  C C   . SER A 1 125 ? -4.185  74.329 55.728 1.00 43.91  ? 125  SER A C   1 
ATOM   960  O O   . SER A 1 125 ? -3.396  75.170 55.290 1.00 43.91  ? 125  SER A O   1 
ATOM   961  C CB  . SER A 1 125 ? -4.727  72.595 54.024 1.00 43.91  ? 125  SER A CB  1 
ATOM   962  O OG  . SER A 1 125 ? -6.076  73.037 54.018 1.00 43.91  ? 125  SER A OG  1 
ATOM   963  N N   . THR A 1 126 ? -5.180  74.617 56.551 1.00 41.24  ? 126  THR A N   1 
ATOM   964  C CA  . THR A 1 126 ? -5.506  75.960 56.982 1.00 41.24  ? 126  THR A CA  1 
ATOM   965  C C   . THR A 1 126 ? -4.608  76.607 58.042 1.00 41.24  ? 126  THR A C   1 
ATOM   966  O O   . THR A 1 126 ? -4.790  77.781 58.365 1.00 41.24  ? 126  THR A O   1 
ATOM   967  C CB  . THR A 1 126 ? -6.937  75.967 57.492 1.00 38.27  ? 126  THR A CB  1 
ATOM   968  O OG1 . THR A 1 126 ? -7.027  75.139 58.663 1.00 38.27  ? 126  THR A OG1 1 
ATOM   969  C CG2 . THR A 1 126 ? -7.857  75.406 56.432 1.00 38.27  ? 126  THR A CG2 1 
ATOM   970  N N   . LEU A 1 127 ? -3.654  75.870 58.598 1.00 36.62  ? 127  LEU A N   1 
ATOM   971  C CA  . LEU A 1 127 ? -2.787  76.455 59.617 1.00 36.62  ? 127  LEU A CA  1 
ATOM   972  C C   . LEU A 1 127 ? -2.057  77.650 59.037 1.00 36.62  ? 127  LEU A C   1 
ATOM   973  O O   . LEU A 1 127 ? -1.782  77.699 57.835 1.00 36.62  ? 127  LEU A O   1 
ATOM   974  C CB  . LEU A 1 127 ? -1.750  75.454 60.097 1.00 36.90  ? 127  LEU A CB  1 
ATOM   975  C CG  . LEU A 1 127 ? -2.241  74.124 60.636 1.00 36.90  ? 127  LEU A CG  1 
ATOM   976  C CD1 . LEU A 1 127 ? -1.047  73.291 61.062 1.00 36.90  ? 127  LEU A CD1 1 
ATOM   977  C CD2 . LEU A 1 127 ? -3.180  74.367 61.798 1.00 36.90  ? 127  LEU A CD2 1 
ATOM   978  N N   . ASP A 1 128 ? -1.720  78.601 59.897 1.00 43.01  ? 128  ASP A N   1 
ATOM   979  C CA  . ASP A 1 128 ? -1.018  79.801 59.466 1.00 43.01  ? 128  ASP A CA  1 
ATOM   980  C C   . ASP A 1 128 ? 0.342   79.505 58.833 1.00 43.01  ? 128  ASP A C   1 
ATOM   981  O O   . ASP A 1 128 ? 0.652   80.028 57.768 1.00 43.01  ? 128  ASP A O   1 
ATOM   982  C CB  . ASP A 1 128 ? -0.860  80.773 60.643 1.00 81.46  ? 128  ASP A CB  1 
ATOM   983  C CG  . ASP A 1 128 ? -2.215  81.226 61.218 1.00 81.46  ? 128  ASP A CG  1 
ATOM   984  O OD1 . ASP A 1 128 ? -3.194  81.290 60.427 1.00 81.46  ? 128  ASP A OD1 1 
ATOM   985  O OD2 . ASP A 1 128 ? -2.304  81.524 62.445 1.00 81.46  ? 128  ASP A OD2 1 
ATOM   986  N N   . VAL A 1 129 ? 1.152   78.670 59.472 1.00 41.38  ? 129  VAL A N   1 
ATOM   987  C CA  . VAL A 1 129 ? 2.458   78.339 58.918 1.00 41.38  ? 129  VAL A CA  1 
ATOM   988  C C   . VAL A 1 129 ? 2.396   77.745 57.523 1.00 41.38  ? 129  VAL A C   1 
ATOM   989  O O   . VAL A 1 129 ? 3.432   77.643 56.863 1.00 41.38  ? 129  VAL A O   1 
ATOM   990  C CB  . VAL A 1 129 ? 3.207   77.336 59.785 1.00 38.48  ? 129  VAL A CB  1 
ATOM   991  C CG1 . VAL A 1 129 ? 3.983   78.061 60.835 1.00 38.48  ? 129  VAL A CG1 1 
ATOM   992  C CG2 . VAL A 1 129 ? 2.225   76.363 60.419 1.00 38.48  ? 129  VAL A CG2 1 
ATOM   993  N N   . TYR A 1 130 ? 1.211   77.329 57.073 1.00 41.68  ? 130  TYR A N   1 
ATOM   994  C CA  . TYR A 1 130 ? 1.091   76.742 55.739 1.00 41.68  ? 130  TYR A CA  1 
ATOM   995  C C   . TYR A 1 130 ? 0.410   77.689 54.762 1.00 41.68  ? 130  TYR A C   1 
ATOM   996  O O   . TYR A 1 130 ? -0.324  77.241 53.883 1.00 41.68  ? 130  TYR A O   1 
ATOM   997  C CB  . TYR A 1 130 ? 0.295   75.428 55.765 1.00 32.99  ? 130  TYR A CB  1 
ATOM   998  C CG  . TYR A 1 130 ? 0.822   74.329 56.672 1.00 32.99  ? 130  TYR A CG  1 
ATOM   999  C CD1 . TYR A 1 130 ? 2.189   74.144 56.884 1.00 32.99  ? 130  TYR A CD1 1 
ATOM   1000 C CD2 . TYR A 1 130 ? -0.058  73.440 57.285 1.00 32.99  ? 130  TYR A CD2 1 
ATOM   1001 C CE1 . TYR A 1 130 ? 2.664   73.098 57.685 1.00 32.99  ? 130  TYR A CE1 1 
ATOM   1002 C CE2 . TYR A 1 130 ? 0.403   72.389 58.085 1.00 32.99  ? 130  TYR A CE2 1 
ATOM   1003 C CZ  . TYR A 1 130 ? 1.762   72.222 58.283 1.00 32.99  ? 130  TYR A CZ  1 
ATOM   1004 O OH  . TYR A 1 130 ? 2.199   71.168 59.064 1.00 32.99  ? 130  TYR A OH  1 
ATOM   1005 N N   . ASN A 1 131 ? 0.644   78.993 54.910 1.00 46.82  ? 131  ASN A N   1 
ATOM   1006 C CA  . ASN A 1 131 ? 0.032   79.988 54.022 1.00 46.82  ? 131  ASN A CA  1 
ATOM   1007 C C   . ASN A 1 131 ? 0.835   80.135 52.737 1.00 46.82  ? 131  ASN A C   1 
ATOM   1008 O O   . ASN A 1 131 ? 1.913   80.730 52.725 1.00 46.82  ? 131  ASN A O   1 
ATOM   1009 C CB  . ASN A 1 131 ? -0.058  81.351 54.703 1.00 52.79  ? 131  ASN A CB  1 
ATOM   1010 C CG  . ASN A 1 131 ? -1.133  82.231 54.092 1.00 52.79  ? 131  ASN A CG  1 
ATOM   1011 O OD1 . ASN A 1 131 ? -1.372  82.198 52.874 1.00 52.79  ? 131  ASN A OD1 1 
ATOM   1012 N ND2 . ASN A 1 131 ? -1.788  83.031 54.932 1.00 52.79  ? 131  ASN A ND2 1 
ATOM   1013 N N   . GLY A 1 132 ? 0.290   79.622 51.646 1.00 41.41  ? 132  GLY A N   1 
ATOM   1014 C CA  . GLY A 1 132 ? 1.006   79.675 50.387 1.00 41.41  ? 132  GLY A CA  1 
ATOM   1015 C C   . GLY A 1 132 ? 1.181   81.020 49.720 1.00 41.41  ? 132  GLY A C   1 
ATOM   1016 O O   . GLY A 1 132 ? 1.970   81.140 48.785 1.00 41.41  ? 132  GLY A O   1 
ATOM   1017 N N   . LYS A 1 133 ? 0.470   82.038 50.189 1.00 49.39  ? 133  LYS A N   1 
ATOM   1018 C CA  . LYS A 1 133 ? 0.573   83.345 49.560 1.00 49.39  ? 133  LYS A CA  1 
ATOM   1019 C C   . LYS A 1 133 ? 1.986   83.926 49.539 1.00 49.39  ? 133  LYS A C   1 
ATOM   1020 O O   . LYS A 1 133 ? 2.401   84.469 48.514 1.00 49.39  ? 133  LYS A O   1 
ATOM   1021 C CB  . LYS A 1 133 ? -0.397  84.331 50.208 1.00 49.35  ? 133  LYS A CB  1 
ATOM   1022 C CG  . LYS A 1 133 ? -0.010  84.795 51.583 1.00 49.35  ? 133  LYS A CG  1 
ATOM   1023 C CD  . LYS A 1 133 ? -1.079  85.737 52.101 1.00 49.35  ? 133  LYS A CD  1 
ATOM   1024 C CE  . LYS A 1 133 ? -0.590  86.567 53.271 1.00 49.35  ? 133  LYS A CE  1 
ATOM   1025 N NZ  . LYS A 1 133 ? -1.579  87.632 53.636 1.00 49.35  ? 133  LYS A NZ  1 
ATOM   1026 N N   . TYR A 1 134 ? 2.729   83.808 50.640 1.00 38.55  ? 134  TYR A N   1 
ATOM   1027 C CA  . TYR A 1 134 ? 4.088   84.347 50.675 1.00 38.55  ? 134  TYR A CA  1 
ATOM   1028 C C   . TYR A 1 134 ? 4.968   83.673 49.638 1.00 38.55  ? 134  TYR A C   1 
ATOM   1029 O O   . TYR A 1 134 ? 5.737   84.326 48.943 1.00 38.55  ? 134  TYR A O   1 
ATOM   1030 C CB  . TYR A 1 134 ? 4.725   84.154 52.048 1.00 39.27  ? 134  TYR A CB  1 
ATOM   1031 C CG  . TYR A 1 134 ? 3.983   84.819 53.167 1.00 39.27  ? 134  TYR A CG  1 
ATOM   1032 C CD1 . TYR A 1 134 ? 3.896   86.209 53.243 1.00 39.27  ? 134  TYR A CD1 1 
ATOM   1033 C CD2 . TYR A 1 134 ? 3.331   84.056 54.137 1.00 39.27  ? 134  TYR A CD2 1 
ATOM   1034 C CE1 . TYR A 1 134 ? 3.170   86.827 54.264 1.00 39.27  ? 134  TYR A CE1 1 
ATOM   1035 C CE2 . TYR A 1 134 ? 2.599   84.658 55.159 1.00 39.27  ? 134  TYR A CE2 1 
ATOM   1036 C CZ  . TYR A 1 134 ? 2.519   86.041 55.218 1.00 39.27  ? 134  TYR A CZ  1 
ATOM   1037 O OH  . TYR A 1 134 ? 1.769   86.629 56.210 1.00 39.27  ? 134  TYR A OH  1 
ATOM   1038 N N   . LEU A 1 135 ? 4.857   82.357 49.535 1.00 38.53  ? 135  LEU A N   1 
ATOM   1039 C CA  . LEU A 1 135 ? 5.672   81.615 48.590 1.00 38.53  ? 135  LEU A CA  1 
ATOM   1040 C C   . LEU A 1 135 ? 5.232   81.855 47.152 1.00 38.53  ? 135  LEU A C   1 
ATOM   1041 O O   . LEU A 1 135 ? 6.061   82.096 46.274 1.00 38.53  ? 135  LEU A O   1 
ATOM   1042 C CB  . LEU A 1 135 ? 5.619   80.123 48.923 1.00 39.60  ? 135  LEU A CB  1 
ATOM   1043 C CG  . LEU A 1 135 ? 6.517   79.169 48.140 1.00 39.60  ? 135  LEU A CG  1 
ATOM   1044 C CD1 . LEU A 1 135 ? 7.971   79.635 48.208 1.00 39.60  ? 135  LEU A CD1 1 
ATOM   1045 C CD2 . LEU A 1 135 ? 6.361   77.771 48.713 1.00 39.60  ? 135  LEU A CD2 1 
ATOM   1046 N N   . ALA A 1 136 ? 3.929   81.791 46.904 1.00 53.54  ? 136  ALA A N   1 
ATOM   1047 C CA  . ALA A 1 136 ? 3.415   82.009 45.554 1.00 53.54  ? 136  ALA A CA  1 
ATOM   1048 C C   . ALA A 1 136 ? 3.907   83.369 45.083 1.00 53.54  ? 136  ALA A C   1 
ATOM   1049 O O   . ALA A 1 136 ? 4.570   83.497 44.052 1.00 53.54  ? 136  ALA A O   1 
ATOM   1050 C CB  . ALA A 1 136 ? 1.891   81.970 45.555 1.00 28.78  ? 136  ALA A CB  1 
ATOM   1051 N N   . TYR A 1 137 ? 3.594   84.388 45.870 1.00 45.15  ? 137  TYR A N   1 
ATOM   1052 C CA  . TYR A 1 137 ? 3.991   85.743 45.547 1.00 45.15  ? 137  TYR A CA  1 
ATOM   1053 C C   . TYR A 1 137 ? 5.488   85.910 45.313 1.00 45.15  ? 137  TYR A C   1 
ATOM   1054 O O   . TYR A 1 137 ? 5.894   86.387 44.264 1.00 45.15  ? 137  TYR A O   1 
ATOM   1055 C CB  . TYR A 1 137 ? 3.556   86.679 46.658 1.00 53.92  ? 137  TYR A CB  1 
ATOM   1056 C CG  . TYR A 1 137 ? 4.038   88.070 46.425 1.00 53.92  ? 137  TYR A CG  1 
ATOM   1057 C CD1 . TYR A 1 137 ? 3.402   88.899 45.500 1.00 53.92  ? 137  TYR A CD1 1 
ATOM   1058 C CD2 . TYR A 1 137 ? 5.175   88.548 47.084 1.00 53.92  ? 137  TYR A CD2 1 
ATOM   1059 C CE1 . TYR A 1 137 ? 3.891   90.182 45.230 1.00 53.92  ? 137  TYR A CE1 1 
ATOM   1060 C CE2 . TYR A 1 137 ? 5.674   89.827 46.822 1.00 53.92  ? 137  TYR A CE2 1 
ATOM   1061 C CZ  . TYR A 1 137 ? 5.028   90.635 45.893 1.00 53.92  ? 137  TYR A CZ  1 
ATOM   1062 O OH  . TYR A 1 137 ? 5.534   91.882 45.612 1.00 53.92  ? 137  TYR A OH  1 
ATOM   1063 N N   . THR A 1 138 ? 6.307   85.510 46.283 1.00 45.04  ? 138  THR A N   1 
ATOM   1064 C CA  . THR A 1 138 ? 7.756   85.663 46.178 1.00 45.04  ? 138  THR A CA  1 
ATOM   1065 C C   . THR A 1 138 ? 8.457   84.870 45.093 1.00 45.04  ? 138  THR A C   1 
ATOM   1066 O O   . THR A 1 138 ? 9.418   85.359 44.505 1.00 45.04  ? 138  THR A O   1 
ATOM   1067 C CB  . THR A 1 138 ? 8.462   85.362 47.527 1.00 40.61  ? 138  THR A CB  1 
ATOM   1068 O OG1 . THR A 1 138 ? 8.127   86.382 48.478 1.00 40.61  ? 138  THR A OG1 1 
ATOM   1069 C CG2 . THR A 1 138 ? 9.978   85.343 47.352 1.00 40.61  ? 138  THR A CG2 1 
ATOM   1070 N N   . GLU A 1 139 ? 7.998   83.656 44.819 1.00 46.44  ? 139  GLU A N   1 
ATOM   1071 C CA  . GLU A 1 139 ? 8.645   82.838 43.799 1.00 46.44  ? 139  GLU A CA  1 
ATOM   1072 C C   . GLU A 1 139 ? 7.884   82.744 42.473 1.00 46.44  ? 139  GLU A C   1 
ATOM   1073 O O   . GLU A 1 139 ? 8.418   82.251 41.477 1.00 46.44  ? 139  GLU A O   1 
ATOM   1074 C CB  . GLU A 1 139 ? 8.908   81.439 44.355 1.00 56.29  ? 139  GLU A CB  1 
ATOM   1075 C CG  . GLU A 1 139 ? 10.036  81.382 45.383 1.00 56.29  ? 139  GLU A CG  1 
ATOM   1076 C CD  . GLU A 1 139 ? 11.389  81.896 44.839 1.00 56.29  ? 139  GLU A CD  1 
ATOM   1077 O OE1 . GLU A 1 139 ? 11.734  81.594 43.666 1.00 56.29  ? 139  GLU A OE1 1 
ATOM   1078 O OE2 . GLU A 1 139 ? 12.124  82.591 45.587 1.00 56.29  ? 139  GLU A OE2 1 
ATOM   1079 N N   . GLU A 1 140 ? 6.642   83.226 42.460 1.00 46.95  ? 140  GLU A N   1 
ATOM   1080 C CA  . GLU A 1 140 ? 5.808   83.205 41.257 1.00 46.95  ? 140  GLU A CA  1 
ATOM   1081 C C   . GLU A 1 140 ? 5.396   81.793 40.850 1.00 46.95  ? 140  GLU A C   1 
ATOM   1082 O O   . GLU A 1 140 ? 5.575   81.400 39.700 1.00 46.95  ? 140  GLU A O   1 
ATOM   1083 C CB  . GLU A 1 140 ? 6.541   83.835 40.074 1.00 102.10 ? 140  GLU A CB  1 
ATOM   1084 C CG  . GLU A 1 140 ? 7.172   85.184 40.335 1.00 102.10 ? 140  GLU A CG  1 
ATOM   1085 C CD  . GLU A 1 140 ? 7.995   85.663 39.136 1.00 102.10 ? 140  GLU A CD  1 
ATOM   1086 O OE1 . GLU A 1 140 ? 7.390   85.871 38.053 1.00 102.10 ? 140  GLU A OE1 1 
ATOM   1087 O OE2 . GLU A 1 140 ? 9.241   85.821 39.271 1.00 102.10 ? 140  GLU A OE2 1 
ATOM   1088 N N   . VAL A 1 141 ? 4.852   81.026 41.781 1.00 39.18  ? 141  VAL A N   1 
ATOM   1089 C CA  . VAL A 1 141 ? 4.420   79.680 41.457 1.00 39.18  ? 141  VAL A CA  1 
ATOM   1090 C C   . VAL A 1 141 ? 2.974   79.513 41.916 1.00 39.18  ? 141  VAL A C   1 
ATOM   1091 O O   . VAL A 1 141 ? 2.496   80.282 42.747 1.00 39.18  ? 141  VAL A O   1 
ATOM   1092 C CB  . VAL A 1 141 ? 5.314   78.616 42.169 1.00 40.11  ? 141  VAL A CB  1 
ATOM   1093 C CG1 . VAL A 1 141 ? 6.779   78.832 41.812 1.00 40.11  ? 141  VAL A CG1 1 
ATOM   1094 C CG2 . VAL A 1 141 ? 5.129   78.683 43.679 1.00 40.11  ? 141  VAL A CG2 1 
ATOM   1095 N N   . VAL A 1 142 ? 2.267   78.539 41.353 1.00 37.92  ? 142  VAL A N   1 
ATOM   1096 C CA  . VAL A 1 142 ? 0.903   78.267 41.774 1.00 37.92  ? 142  VAL A CA  1 
ATOM   1097 C C   . VAL A 1 142 ? 1.075   77.301 42.947 1.00 37.92  ? 142  VAL A C   1 
ATOM   1098 O O   . VAL A 1 142 ? 1.579   76.195 42.771 1.00 37.92  ? 142  VAL A O   1 
ATOM   1099 C CB  . VAL A 1 142 ? 0.085   77.589 40.665 1.00 19.84  ? 142  VAL A CB  1 
ATOM   1100 C CG1 . VAL A 1 142 ? -1.165  76.979 41.248 1.00 19.84  ? 142  VAL A CG1 1 
ATOM   1101 C CG2 . VAL A 1 142 ? -0.300  78.594 39.631 1.00 19.84  ? 142  VAL A CG2 1 
ATOM   1102 N N   . LEU A 1 143 ? 0.673   77.722 44.141 1.00 34.49  ? 143  LEU A N   1 
ATOM   1103 C CA  . LEU A 1 143 ? 0.815   76.894 45.329 1.00 34.49  ? 143  LEU A CA  1 
ATOM   1104 C C   . LEU A 1 143 ? -0.505  76.208 45.686 1.00 34.49  ? 143  LEU A C   1 
ATOM   1105 O O   . LEU A 1 143 ? -1.520  76.869 45.928 1.00 34.49  ? 143  LEU A O   1 
ATOM   1106 C CB  . LEU A 1 143 ? 1.294   77.770 46.495 1.00 40.52  ? 143  LEU A CB  1 
ATOM   1107 C CG  . LEU A 1 143 ? 2.104   77.188 47.656 1.00 40.52  ? 143  LEU A CG  1 
ATOM   1108 C CD1 . LEU A 1 143 ? 1.295   76.185 48.457 1.00 40.52  ? 143  LEU A CD1 1 
ATOM   1109 C CD2 . LEU A 1 143 ? 3.351   76.542 47.098 1.00 40.52  ? 143  LEU A CD2 1 
ATOM   1110 N N   . VAL A 1 144 ? -0.496  74.878 45.703 1.00 28.20  ? 144  VAL A N   1 
ATOM   1111 C CA  . VAL A 1 144 ? -1.693  74.122 46.051 1.00 28.20  ? 144  VAL A CA  1 
ATOM   1112 C C   . VAL A 1 144 ? -1.433  73.395 47.355 1.00 28.20  ? 144  VAL A C   1 
ATOM   1113 O O   . VAL A 1 144 ? -0.345  72.871 47.569 1.00 28.20  ? 144  VAL A O   1 
ATOM   1114 C CB  . VAL A 1 144 ? -2.044  73.037 44.991 1.00 24.26  ? 144  VAL A CB  1 
ATOM   1115 C CG1 . VAL A 1 144 ? -3.272  72.259 45.432 1.00 24.26  ? 144  VAL A CG1 1 
ATOM   1116 C CG2 . VAL A 1 144 ? -2.286  73.659 43.647 1.00 24.26  ? 144  VAL A CG2 1 
ATOM   1117 N N   . SER A 1 145 ? -2.415  73.377 48.241 1.00 30.21  ? 145  SER A N   1 
ATOM   1118 C CA  . SER A 1 145 ? -2.253  72.637 49.475 1.00 30.21  ? 145  SER A CA  1 
ATOM   1119 C C   . SER A 1 145 ? -3.539  71.839 49.651 1.00 30.21  ? 145  SER A C   1 
ATOM   1120 O O   . SER A 1 145 ? -4.620  72.394 49.770 1.00 30.21  ? 145  SER A O   1 
ATOM   1121 C CB  . SER A 1 145 ? -2.000  73.566 50.660 1.00 43.37  ? 145  SER A CB  1 
ATOM   1122 O OG  . SER A 1 145 ? -3.158  74.285 51.023 1.00 43.37  ? 145  SER A OG  1 
ATOM   1123 N N   . LEU A 1 146 ? -3.414  70.523 49.625 1.00 35.14  ? 146  LEU A N   1 
ATOM   1124 C CA  . LEU A 1 146 ? -4.565  69.648 49.753 1.00 35.14  ? 146  LEU A CA  1 
ATOM   1125 C C   . LEU A 1 146 ? -4.752  69.176 51.186 1.00 35.14  ? 146  LEU A C   1 
ATOM   1126 O O   . LEU A 1 146 ? -3.993  69.546 52.072 1.00 35.14  ? 146  LEU A O   1 
ATOM   1127 C CB  . LEU A 1 146 ? -4.381  68.441 48.830 1.00 33.20  ? 146  LEU A CB  1 
ATOM   1128 C CG  . LEU A 1 146 ? -3.019  67.746 48.932 1.00 33.20  ? 146  LEU A CG  1 
ATOM   1129 C CD1 . LEU A 1 146 ? -2.915  66.951 50.216 1.00 33.20  ? 146  LEU A CD1 1 
ATOM   1130 C CD2 . LEU A 1 146 ? -2.844  66.830 47.753 1.00 33.20  ? 146  LEU A CD2 1 
ATOM   1131 N N   . SER A 1 147 ? -5.777  68.364 51.403 1.00 37.04  ? 147  SER A N   1 
ATOM   1132 C CA  . SER A 1 147 ? -6.040  67.810 52.713 1.00 37.04  ? 147  SER A CA  1 
ATOM   1133 C C   . SER A 1 147 ? -6.442  66.343 52.524 1.00 37.04  ? 147  SER A C   1 
ATOM   1134 O O   . SER A 1 147 ? -6.843  65.935 51.432 1.00 37.04  ? 147  SER A O   1 
ATOM   1135 C CB  . SER A 1 147 ? -7.147  68.587 53.408 1.00 41.80  ? 147  SER A CB  1 
ATOM   1136 O OG  . SER A 1 147 ? -8.402  68.263 52.855 1.00 41.80  ? 147  SER A OG  1 
ATOM   1137 N N   . TYR A 1 148 ? -6.314  65.549 53.578 1.00 30.29  ? 148  TYR A N   1 
ATOM   1138 C CA  . TYR A 1 148 ? -6.639  64.135 53.507 1.00 30.29  ? 148  TYR A CA  1 
ATOM   1139 C C   . TYR A 1 148 ? -7.108  63.701 54.878 1.00 30.29  ? 148  TYR A C   1 
ATOM   1140 O O   . TYR A 1 148 ? -6.817  64.371 55.860 1.00 30.29  ? 148  TYR A O   1 
ATOM   1141 C CB  . TYR A 1 148 ? -5.407  63.325 53.096 1.00 23.99  ? 148  TYR A CB  1 
ATOM   1142 C CG  . TYR A 1 148 ? -4.193  63.512 53.982 1.00 23.99  ? 148  TYR A CG  1 
ATOM   1143 C CD1 . TYR A 1 148 ? -3.366  64.622 53.848 1.00 23.99  ? 148  TYR A CD1 1 
ATOM   1144 C CD2 . TYR A 1 148 ? -3.867  62.570 54.954 1.00 23.99  ? 148  TYR A CD2 1 
ATOM   1145 C CE1 . TYR A 1 148 ? -2.243  64.786 54.660 1.00 23.99  ? 148  TYR A CE1 1 
ATOM   1146 C CE2 . TYR A 1 148 ? -2.747  62.727 55.771 1.00 23.99  ? 148  TYR A CE2 1 
ATOM   1147 C CZ  . TYR A 1 148 ? -1.942  63.834 55.619 1.00 23.99  ? 148  TYR A CZ  1 
ATOM   1148 O OH  . TYR A 1 148 ? -0.837  63.981 56.427 1.00 23.99  ? 148  TYR A OH  1 
ATOM   1149 N N   . ARG A 1 149 ? -7.837  62.596 54.951 1.00 21.78  ? 149  ARG A N   1 
ATOM   1150 C CA  . ARG A 1 149 ? -8.328  62.126 56.229 1.00 21.78  ? 149  ARG A CA  1 
ATOM   1151 C C   . ARG A 1 149 ? -7.221  61.505 57.057 1.00 21.78  ? 149  ARG A C   1 
ATOM   1152 O O   . ARG A 1 149 ? -6.371  60.794 56.533 1.00 21.78  ? 149  ARG A O   1 
ATOM   1153 C CB  . ARG A 1 149 ? -9.436  61.112 56.021 1.00 29.74  ? 149  ARG A CB  1 
ATOM   1154 C CG  . ARG A 1 149 ? -10.675 61.696 55.446 1.00 29.74  ? 149  ARG A CG  1 
ATOM   1155 C CD  . ARG A 1 149 ? -11.635 60.605 55.112 1.00 29.74  ? 149  ARG A CD  1 
ATOM   1156 N NE  . ARG A 1 149 ? -11.314 59.969 53.842 1.00 29.74  ? 149  ARG A NE  1 
ATOM   1157 C CZ  . ARG A 1 149 ? -11.885 58.849 53.413 1.00 29.74  ? 149  ARG A CZ  1 
ATOM   1158 N NH1 . ARG A 1 149 ? -12.795 58.241 54.165 1.00 29.74  ? 149  ARG A NH1 1 
ATOM   1159 N NH2 . ARG A 1 149 ? -11.572 58.353 52.220 1.00 29.74  ? 149  ARG A NH2 1 
ATOM   1160 N N   . VAL A 1 150 ? -7.246  61.775 58.358 1.00 36.65  ? 150  VAL A N   1 
ATOM   1161 C CA  . VAL A 1 150 ? -6.250  61.256 59.287 1.00 36.65  ? 150  VAL A CA  1 
ATOM   1162 C C   . VAL A 1 150 ? -6.869  60.382 60.381 1.00 36.65  ? 150  VAL A C   1 
ATOM   1163 O O   . VAL A 1 150 ? -8.090  60.289 60.506 1.00 36.65  ? 150  VAL A O   1 
ATOM   1164 C CB  . VAL A 1 150 ? -5.472  62.404 59.974 1.00 29.14  ? 150  VAL A CB  1 
ATOM   1165 C CG1 . VAL A 1 150 ? -4.719  63.200 58.946 1.00 29.14  ? 150  VAL A CG1 1 
ATOM   1166 C CG2 . VAL A 1 150 ? -6.424  63.295 60.744 1.00 29.14  ? 150  VAL A CG2 1 
ATOM   1167 N N   . GLY A 1 151 ? -6.009  59.755 61.178 1.00 34.02  ? 151  GLY A N   1 
ATOM   1168 C CA  . GLY A 1 151 ? -6.479  58.900 62.249 1.00 34.02  ? 151  GLY A CA  1 
ATOM   1169 C C   . GLY A 1 151 ? -7.262  57.736 61.691 1.00 34.02  ? 151  GLY A C   1 
ATOM   1170 O O   . GLY A 1 151 ? -7.158  57.434 60.508 1.00 34.02  ? 151  GLY A O   1 
ATOM   1171 N N   . ALA A 1 152 ? -8.057  57.088 62.535 1.00 41.11  ? 152  ALA A N   1 
ATOM   1172 C CA  . ALA A 1 152 ? -8.863  55.952 62.102 1.00 41.11  ? 152  ALA A CA  1 
ATOM   1173 C C   . ALA A 1 152 ? -9.668  56.253 60.836 1.00 41.11  ? 152  ALA A C   1 
ATOM   1174 O O   . ALA A 1 152 ? -9.822  55.397 59.967 1.00 41.11  ? 152  ALA A O   1 
ATOM   1175 C CB  . ALA A 1 152 ? -9.802  55.534 63.224 1.00 39.87  ? 152  ALA A CB  1 
ATOM   1176 N N   . PHE A 1 153 ? -10.168 57.478 60.738 1.00 27.20  ? 153  PHE A N   1 
ATOM   1177 C CA  . PHE A 1 153 ? -10.978 57.908 59.609 1.00 27.20  ? 153  PHE A CA  1 
ATOM   1178 C C   . PHE A 1 153 ? -10.322 57.730 58.250 1.00 27.20  ? 153  PHE A C   1 
ATOM   1179 O O   . PHE A 1 153 ? -11.011 57.540 57.246 1.00 27.20  ? 153  PHE A O   1 
ATOM   1180 C CB  . PHE A 1 153 ? -11.369 59.368 59.803 1.00 35.07  ? 153  PHE A CB  1 
ATOM   1181 C CG  . PHE A 1 153 ? -12.111 59.623 61.073 1.00 35.07  ? 153  PHE A CG  1 
ATOM   1182 C CD1 . PHE A 1 153 ? -13.417 59.180 61.229 1.00 35.07  ? 153  PHE A CD1 1 
ATOM   1183 C CD2 . PHE A 1 153 ? -11.492 60.266 62.137 1.00 35.07  ? 153  PHE A CD2 1 
ATOM   1184 C CE1 . PHE A 1 153 ? -14.097 59.369 62.426 1.00 35.07  ? 153  PHE A CE1 1 
ATOM   1185 C CE2 . PHE A 1 153 ? -12.162 60.462 63.341 1.00 35.07  ? 153  PHE A CE2 1 
ATOM   1186 C CZ  . PHE A 1 153 ? -13.468 60.011 63.485 1.00 35.07  ? 153  PHE A CZ  1 
ATOM   1187 N N   . GLY A 1 154 ? -8.994  57.798 58.219 1.00 30.63  ? 154  GLY A N   1 
ATOM   1188 C CA  . GLY A 1 154 ? -8.281  57.663 56.964 1.00 30.63  ? 154  GLY A CA  1 
ATOM   1189 C C   . GLY A 1 154 ? -7.306  56.501 56.887 1.00 30.63  ? 154  GLY A C   1 
ATOM   1190 O O   . GLY A 1 154 ? -6.671  56.300 55.849 1.00 30.63  ? 154  GLY A O   1 
ATOM   1191 N N   . PHE A 1 155 ? -7.198  55.713 57.955 1.00 26.21  ? 155  PHE A N   1 
ATOM   1192 C CA  . PHE A 1 155 ? -6.261  54.606 57.954 1.00 26.21  ? 155  PHE A CA  1 
ATOM   1193 C C   . PHE A 1 155 ? -6.688  53.285 58.600 1.00 26.21  ? 155  PHE A C   1 
ATOM   1194 O O   . PHE A 1 155 ? -5.858  52.391 58.789 1.00 26.21  ? 155  PHE A O   1 
ATOM   1195 C CB  . PHE A 1 155 ? -4.950  55.104 58.541 1.00 19.41  ? 155  PHE A CB  1 
ATOM   1196 C CG  . PHE A 1 155 ? -4.304  56.160 57.707 1.00 19.41  ? 155  PHE A CG  1 
ATOM   1197 C CD1 . PHE A 1 155 ? -3.637  55.823 56.541 1.00 19.41  ? 155  PHE A CD1 1 
ATOM   1198 C CD2 . PHE A 1 155 ? -4.453  57.499 58.023 1.00 19.41  ? 155  PHE A CD2 1 
ATOM   1199 C CE1 . PHE A 1 155 ? -3.138  56.800 55.700 1.00 19.41  ? 155  PHE A CE1 1 
ATOM   1200 C CE2 . PHE A 1 155 ? -3.959  58.481 57.188 1.00 19.41  ? 155  PHE A CE2 1 
ATOM   1201 C CZ  . PHE A 1 155 ? -3.301  58.130 56.023 1.00 19.41  ? 155  PHE A CZ  1 
ATOM   1202 N N   . LEU A 1 156 ? -7.976  53.154 58.920 1.00 31.69  ? 156  LEU A N   1 
ATOM   1203 C CA  . LEU A 1 156 ? -8.501  51.915 59.504 1.00 31.69  ? 156  LEU A CA  1 
ATOM   1204 C C   . LEU A 1 156 ? -8.294  50.839 58.441 1.00 31.69  ? 156  LEU A C   1 
ATOM   1205 O O   . LEU A 1 156 ? -8.558  51.073 57.269 1.00 31.69  ? 156  LEU A O   1 
ATOM   1206 C CB  . LEU A 1 156 ? -9.991  52.051 59.801 1.00 32.98  ? 156  LEU A CB  1 
ATOM   1207 C CG  . LEU A 1 156 ? -10.616 50.910 60.599 1.00 32.98  ? 156  LEU A CG  1 
ATOM   1208 C CD1 . LEU A 1 156 ? -10.182 51.017 62.053 1.00 32.98  ? 156  LEU A CD1 1 
ATOM   1209 C CD2 . LEU A 1 156 ? -12.123 50.985 60.516 1.00 32.98  ? 156  LEU A CD2 1 
ATOM   1210 N N   . ALA A 1 157 ? -7.830  49.659 58.824 1.00 45.04  ? 157  ALA A N   1 
ATOM   1211 C CA  . ALA A 1 157 ? -7.591  48.655 57.804 1.00 45.04  ? 157  ALA A CA  1 
ATOM   1212 C C   . ALA A 1 157 ? -7.972  47.220 58.119 1.00 45.04  ? 157  ALA A C   1 
ATOM   1213 O O   . ALA A 1 157 ? -7.344  46.560 58.947 1.00 45.04  ? 157  ALA A O   1 
ATOM   1214 C CB  . ALA A 1 157 ? -6.137  48.711 57.378 1.00 27.76  ? 157  ALA A CB  1 
ATOM   1215 N N   . LEU A 1 158 ? -9.007  46.746 57.433 1.00 47.88  ? 158  LEU A N   1 
ATOM   1216 C CA  . LEU A 1 158 ? -9.478  45.377 57.557 1.00 47.88  ? 158  LEU A CA  1 
ATOM   1217 C C   . LEU A 1 158 ? -9.270  44.799 56.159 1.00 47.88  ? 158  LEU A C   1 
ATOM   1218 O O   . LEU A 1 158 ? -10.214 44.718 55.367 1.00 47.88  ? 158  LEU A O   1 
ATOM   1219 C CB  . LEU A 1 158 ? -10.957 45.364 57.939 1.00 27.07  ? 158  LEU A CB  1 
ATOM   1220 C CG  . LEU A 1 158 ? -11.215 45.927 59.332 1.00 27.07  ? 158  LEU A CG  1 
ATOM   1221 C CD1 . LEU A 1 158 ? -12.699 46.007 59.634 1.00 27.07  ? 158  LEU A CD1 1 
ATOM   1222 C CD2 . LEU A 1 158 ? -10.511 45.033 60.334 1.00 27.07  ? 158  LEU A CD2 1 
ATOM   1223 N N   . HIS A 1 159 ? -8.028  44.426 55.846 1.00 49.36  ? 159  HIS A N   1 
ATOM   1224 C CA  . HIS A 1 159 ? -7.693  43.880 54.528 1.00 49.36  ? 159  HIS A CA  1 
ATOM   1225 C C   . HIS A 1 159 ? -8.684  42.801 54.149 1.00 49.36  ? 159  HIS A C   1 
ATOM   1226 O O   . HIS A 1 159 ? -9.085  42.005 54.999 1.00 49.36  ? 159  HIS A O   1 
ATOM   1227 C CB  . HIS A 1 159 ? -6.291  43.279 54.530 1.00 47.70  ? 159  HIS A CB  1 
ATOM   1228 C CG  . HIS A 1 159 ? -5.768  42.958 53.165 1.00 47.70  ? 159  HIS A CG  1 
ATOM   1229 N ND1 . HIS A 1 159 ? -5.542  43.925 52.207 1.00 47.70  ? 159  HIS A ND1 1 
ATOM   1230 C CD2 . HIS A 1 159 ? -5.393  41.781 52.606 1.00 47.70  ? 159  HIS A CD2 1 
ATOM   1231 C CE1 . HIS A 1 159 ? -5.048  43.359 51.118 1.00 47.70  ? 159  HIS A CE1 1 
ATOM   1232 N NE2 . HIS A 1 159 ? -4.948  42.059 51.335 1.00 47.70  ? 159  HIS A NE2 1 
ATOM   1233 N N   . GLY A 1 160 ? -9.077  42.774 52.877 1.00 53.27  ? 160  GLY A N   1 
ATOM   1234 C CA  . GLY A 1 160 ? -10.030 41.775 52.420 1.00 53.27  ? 160  GLY A CA  1 
ATOM   1235 C C   . GLY A 1 160 ? -11.435 42.333 52.280 1.00 53.27  ? 160  GLY A C   1 
ATOM   1236 O O   . GLY A 1 160 ? -12.241 41.829 51.492 1.00 53.27  ? 160  GLY A O   1 
ATOM   1237 N N   . SER A 1 161 ? -11.727 43.379 53.048 1.00 61.53  ? 161  SER A N   1 
ATOM   1238 C CA  . SER A 1 161 ? -13.038 44.022 53.023 1.00 61.53  ? 161  SER A CA  1 
ATOM   1239 C C   . SER A 1 161 ? -12.985 45.306 52.208 1.00 61.53  ? 161  SER A C   1 
ATOM   1240 O O   . SER A 1 161 ? -12.041 46.082 52.333 1.00 61.53  ? 161  SER A O   1 
ATOM   1241 C CB  . SER A 1 161 ? -13.485 44.354 54.447 1.00 68.26  ? 161  SER A CB  1 
ATOM   1242 O OG  . SER A 1 161 ? -14.619 45.204 54.430 1.00 68.26  ? 161  SER A OG  1 
ATOM   1243 N N   . GLN A 1 162 ? -13.993 45.545 51.381 1.00 52.71  ? 162  GLN A N   1 
ATOM   1244 C CA  . GLN A 1 162 ? -13.998 46.765 50.584 1.00 52.71  ? 162  GLN A CA  1 
ATOM   1245 C C   . GLN A 1 162 ? -14.647 47.914 51.358 1.00 52.71  ? 162  GLN A C   1 
ATOM   1246 O O   . GLN A 1 162 ? -14.815 49.008 50.826 1.00 52.71  ? 162  GLN A O   1 
ATOM   1247 C CB  . GLN A 1 162 ? -14.746 46.540 49.269 1.00 80.67  ? 162  GLN A CB  1 
ATOM   1248 C CG  . GLN A 1 162 ? -14.218 45.372 48.427 1.00 80.67  ? 162  GLN A CG  1 
ATOM   1249 C CD  . GLN A 1 162 ? -12.754 45.547 47.993 1.00 80.67  ? 162  GLN A CD  1 
ATOM   1250 O OE1 . GLN A 1 162 ? -12.340 46.643 47.572 1.00 80.67  ? 162  GLN A OE1 1 
ATOM   1251 N NE2 . GLN A 1 162 ? -11.967 44.463 48.079 1.00 80.67  ? 162  GLN A NE2 1 
ATOM   1252 N N   . GLU A 1 163 ? -15.011 47.672 52.612 1.00 50.12  ? 163  GLU A N   1 
ATOM   1253 C CA  . GLU A 1 163 ? -15.635 48.721 53.414 1.00 50.12  ? 163  GLU A CA  1 
ATOM   1254 C C   . GLU A 1 163 ? -14.625 49.589 54.152 1.00 50.12  ? 163  GLU A C   1 
ATOM   1255 O O   . GLU A 1 163 ? -14.943 50.707 54.569 1.00 50.12  ? 163  GLU A O   1 
ATOM   1256 C CB  . GLU A 1 163 ? -16.623 48.116 54.419 1.00 75.20  ? 163  GLU A CB  1 
ATOM   1257 C CG  . GLU A 1 163 ? -17.899 47.614 53.765 1.00 75.20  ? 163  GLU A CG  1 
ATOM   1258 C CD  . GLU A 1 163 ? -18.377 48.555 52.655 1.00 75.20  ? 163  GLU A CD  1 
ATOM   1259 O OE1 . GLU A 1 163 ? -18.512 49.783 52.910 1.00 75.20  ? 163  GLU A OE1 1 
ATOM   1260 O OE2 . GLU A 1 163 ? -18.611 48.059 51.523 1.00 75.20  ? 163  GLU A OE2 1 
ATOM   1261 N N   . ALA A 1 164 ? -13.414 49.059 54.311 1.00 50.04  ? 164  ALA A N   1 
ATOM   1262 C CA  . ALA A 1 164 ? -12.307 49.745 54.988 1.00 50.04  ? 164  ALA A CA  1 
ATOM   1263 C C   . ALA A 1 164 ? -11.034 49.043 54.510 1.00 50.04  ? 164  ALA A C   1 
ATOM   1264 O O   . ALA A 1 164 ? -10.342 48.370 55.274 1.00 50.04  ? 164  ALA A O   1 
ATOM   1265 C CB  . ALA A 1 164 ? -12.451 49.622 56.514 1.00 16.07  ? 164  ALA A CB  1 
ATOM   1266 N N   . PRO A 1 165 ? -10.722 49.187 53.219 1.00 44.85  ? 165  PRO A N   1 
ATOM   1267 C CA  . PRO A 1 165 ? -9.537  48.557 52.644 1.00 44.85  ? 165  PRO A CA  1 
ATOM   1268 C C   . PRO A 1 165 ? -8.248  49.032 53.293 1.00 44.85  ? 165  PRO A C   1 
ATOM   1269 O O   . PRO A 1 165 ? -7.287  48.271 53.417 1.00 44.85  ? 165  PRO A O   1 
ATOM   1270 C CB  . PRO A 1 165 ? -9.629  48.948 51.173 1.00 31.51  ? 165  PRO A CB  1 
ATOM   1271 C CG  . PRO A 1 165 ? -10.228 50.300 51.231 1.00 31.51  ? 165  PRO A CG  1 
ATOM   1272 C CD  . PRO A 1 165 ? -11.332 50.124 52.259 1.00 31.51  ? 165  PRO A CD  1 
ATOM   1273 N N   . GLY A 1 166 ? -8.241  50.293 53.713 1.00 37.25  ? 166  GLY A N   1 
ATOM   1274 C CA  . GLY A 1 166 ? -7.055  50.862 54.321 1.00 37.25  ? 166  GLY A CA  1 
ATOM   1275 C C   . GLY A 1 166 ? -6.425  51.799 53.316 1.00 37.25  ? 166  GLY A C   1 
ATOM   1276 O O   . GLY A 1 166 ? -6.753  51.750 52.137 1.00 37.25  ? 166  GLY A O   1 
ATOM   1277 N N   . ASN A 1 167 ? -5.534  52.661 53.778 1.00 28.86  ? 167  ASN A N   1 
ATOM   1278 C CA  . ASN A 1 167 ? -4.868  53.602 52.896 1.00 28.86  ? 167  ASN A CA  1 
ATOM   1279 C C   . ASN A 1 167 ? -5.831  54.542 52.196 1.00 28.86  ? 167  ASN A C   1 
ATOM   1280 O O   . ASN A 1 167 ? -5.470  55.186 51.214 1.00 28.86  ? 167  ASN A O   1 
ATOM   1281 C CB  . ASN A 1 167 ? -4.045  52.856 51.843 1.00 33.30  ? 167  ASN A CB  1 
ATOM   1282 C CG  . ASN A 1 167 ? -2.958  52.005 52.452 1.00 33.30  ? 167  ASN A CG  1 
ATOM   1283 O OD1 . ASN A 1 167 ? -2.479  52.288 53.539 1.00 33.30  ? 167  ASN A OD1 1 
ATOM   1284 N ND2 . ASN A 1 167 ? -2.550  50.967 51.745 1.00 33.30  ? 167  ASN A ND2 1 
ATOM   1285 N N   . VAL A 1 168 ? -7.056  54.645 52.686 1.00 41.48  ? 168  VAL A N   1 
ATOM   1286 C CA  . VAL A 1 168 ? -7.991  55.537 52.018 1.00 41.48  ? 168  VAL A CA  1 
ATOM   1287 C C   . VAL A 1 168 ? -7.514  56.977 52.184 1.00 41.48  ? 168  VAL A C   1 
ATOM   1288 O O   . VAL A 1 168 ? -7.929  57.874 51.449 1.00 41.48  ? 168  VAL A O   1 
ATOM   1289 C CB  . VAL A 1 168 ? -9.458  55.368 52.543 1.00 34.51  ? 168  VAL A CB  1 
ATOM   1290 C CG1 . VAL A 1 168 ? -9.838  53.895 52.533 1.00 34.51  ? 168  VAL A CG1 1 
ATOM   1291 C CG2 . VAL A 1 168 ? -9.617  55.970 53.924 1.00 34.51  ? 168  VAL A CG2 1 
ATOM   1292 N N   . GLY A 1 169 ? -6.620  57.190 53.142 1.00 27.02  ? 169  GLY A N   1 
ATOM   1293 C CA  . GLY A 1 169 ? -6.093  58.525 53.360 1.00 27.02  ? 169  GLY A CA  1 
ATOM   1294 C C   . GLY A 1 169 ? -5.083  58.906 52.293 1.00 27.02  ? 169  GLY A C   1 
ATOM   1295 O O   . GLY A 1 169 ? -4.931  60.076 51.963 1.00 27.02  ? 169  GLY A O   1 
ATOM   1296 N N   . LEU A 1 170 ? -4.380  57.909 51.764 1.00 28.99  ? 170  LEU A N   1 
ATOM   1297 C CA  . LEU A 1 170 ? -3.391  58.138 50.723 1.00 28.99  ? 170  LEU A CA  1 
ATOM   1298 C C   . LEU A 1 170 ? -4.119  58.340 49.413 1.00 28.99  ? 170  LEU A C   1 
ATOM   1299 O O   . LEU A 1 170 ? -3.664  59.085 48.550 1.00 28.99  ? 170  LEU A O   1 
ATOM   1300 C CB  . LEU A 1 170 ? -2.440  56.953 50.617 1.00 19.86  ? 170  LEU A CB  1 
ATOM   1301 C CG  . LEU A 1 170 ? -1.414  56.894 51.736 1.00 19.86  ? 170  LEU A CG  1 
ATOM   1302 C CD1 . LEU A 1 170 ? -0.594  55.651 51.599 1.00 19.86  ? 170  LEU A CD1 1 
ATOM   1303 C CD2 . LEU A 1 170 ? -0.533  58.116 51.680 1.00 19.86  ? 170  LEU A CD2 1 
ATOM   1304 N N   . LEU A 1 171 ? -5.261  57.670 49.276 1.00 41.46  ? 171  LEU A N   1 
ATOM   1305 C CA  . LEU A 1 171 ? -6.074  57.803 48.083 1.00 41.46  ? 171  LEU A CA  1 
ATOM   1306 C C   . LEU A 1 171 ? -6.625  59.221 48.021 1.00 41.46  ? 171  LEU A C   1 
ATOM   1307 O O   . LEU A 1 171 ? -6.647  59.820 46.953 1.00 41.46  ? 171  LEU A O   1 
ATOM   1308 C CB  . LEU A 1 171 ? -7.209  56.792 48.099 1.00 28.88  ? 171  LEU A CB  1 
ATOM   1309 C CG  . LEU A 1 171 ? -6.760  55.335 48.039 1.00 28.88  ? 171  LEU A CG  1 
ATOM   1310 C CD1 . LEU A 1 171 ? -7.983  54.468 47.913 1.00 28.88  ? 171  LEU A CD1 1 
ATOM   1311 C CD2 . LEU A 1 171 ? -5.834  55.106 46.864 1.00 28.88  ? 171  LEU A CD2 1 
ATOM   1312 N N   . ASP A 1 172 ? -7.063  59.758 49.162 1.00 37.77  ? 172  ASP A N   1 
ATOM   1313 C CA  . ASP A 1 172 ? -7.569  61.131 49.219 1.00 37.77  ? 172  ASP A CA  1 
ATOM   1314 C C   . ASP A 1 172 ? -6.545  62.059 48.566 1.00 37.77  ? 172  ASP A C   1 
ATOM   1315 O O   . ASP A 1 172 ? -6.880  62.888 47.727 1.00 37.77  ? 172  ASP A O   1 
ATOM   1316 C CB  . ASP A 1 172 ? -7.773  61.595 50.667 1.00 49.01  ? 172  ASP A CB  1 
ATOM   1317 C CG  . ASP A 1 172 ? -9.028  61.028 51.311 1.00 49.01  ? 172  ASP A CG  1 
ATOM   1318 O OD1 . ASP A 1 172 ? -9.969  60.665 50.576 1.00 49.01  ? 172  ASP A OD1 1 
ATOM   1319 O OD2 . ASP A 1 172 ? -9.082  60.970 52.562 1.00 49.01  ? 172  ASP A OD2 1 
ATOM   1320 N N   . GLN A 1 173 ? -5.291  61.918 48.976 1.00 35.02  ? 173  GLN A N   1 
ATOM   1321 C CA  . GLN A 1 173 ? -4.210  62.725 48.433 1.00 35.02  ? 173  GLN A CA  1 
ATOM   1322 C C   . GLN A 1 173 ? -4.086  62.502 46.936 1.00 35.02  ? 173  GLN A C   1 
ATOM   1323 O O   . GLN A 1 173 ? -3.868  63.445 46.174 1.00 35.02  ? 173  GLN A O   1 
ATOM   1324 C CB  . GLN A 1 173 ? -2.883  62.347 49.080 1.00 28.79  ? 173  GLN A CB  1 
ATOM   1325 C CG  . GLN A 1 173 ? -2.694  62.762 50.512 1.00 28.79  ? 173  GLN A CG  1 
ATOM   1326 C CD  . GLN A 1 173 ? -1.512  62.053 51.108 1.00 28.79  ? 173  GLN A CD  1 
ATOM   1327 O OE1 . GLN A 1 173 ? -0.551  61.748 50.411 1.00 28.79  ? 173  GLN A OE1 1 
ATOM   1328 N NE2 . GLN A 1 173 ? -1.568  61.783 52.396 1.00 28.79  ? 173  GLN A NE2 1 
ATOM   1329 N N   . ARG A 1 174 ? -4.214  61.246 46.512 1.00 27.73  ? 174  ARG A N   1 
ATOM   1330 C CA  . ARG A 1 174 ? -4.085  60.927 45.099 1.00 27.73  ? 174  ARG A CA  1 
ATOM   1331 C C   . ARG A 1 174 ? -5.199  61.590 44.328 1.00 27.73  ? 174  ARG A C   1 
ATOM   1332 O O   . ARG A 1 174 ? -5.007  62.029 43.206 1.00 27.73  ? 174  ARG A O   1 
ATOM   1333 C CB  . ARG A 1 174 ? -4.111  59.412 44.863 1.00 31.60  ? 174  ARG A CB  1 
ATOM   1334 C CG  . ARG A 1 174 ? -3.885  59.062 43.403 1.00 31.60  ? 174  ARG A CG  1 
ATOM   1335 C CD  . ARG A 1 174 ? -4.048  57.586 43.114 1.00 31.60  ? 174  ARG A CD  1 
ATOM   1336 N NE  . ARG A 1 174 ? -2.990  56.787 43.714 1.00 31.60  ? 174  ARG A NE  1 
ATOM   1337 C CZ  . ARG A 1 174 ? -3.062  55.472 43.869 1.00 31.60  ? 174  ARG A CZ  1 
ATOM   1338 N NH1 . ARG A 1 174 ? -4.139  54.821 43.465 1.00 31.60  ? 174  ARG A NH1 1 
ATOM   1339 N NH2 . ARG A 1 174 ? -2.071  54.812 44.445 1.00 31.60  ? 174  ARG A NH2 1 
ATOM   1340 N N   . MET A 1 175 ? -6.362  61.672 44.954 1.00 26.90  ? 175  MET A N   1 
ATOM   1341 C CA  . MET A 1 175 ? -7.521  62.282 44.334 1.00 26.90  ? 175  MET A CA  1 
ATOM   1342 C C   . MET A 1 175 ? -7.223  63.740 44.110 1.00 26.90  ? 175  MET A C   1 
ATOM   1343 O O   . MET A 1 175 ? -7.412  64.262 43.024 1.00 26.90  ? 175  MET A O   1 
ATOM   1344 C CB  . MET A 1 175 ? -8.732  62.164 45.245 1.00 52.77  ? 175  MET A CB  1 
ATOM   1345 C CG  . MET A 1 175 ? -10.024 62.615 44.604 1.00 52.77  ? 175  MET A CG  1 
ATOM   1346 S SD  . MET A 1 175 ? -11.083 61.213 44.195 1.00 52.77  ? 175  MET A SD  1 
ATOM   1347 C CE  . MET A 1 175 ? -12.444 61.539 45.258 1.00 52.77  ? 175  MET A CE  1 
ATOM   1348 N N   . ALA A 1 176 ? -6.761  64.395 45.163 1.00 28.25  ? 176  ALA A N   1 
ATOM   1349 C CA  . ALA A 1 176 ? -6.425  65.796 45.090 1.00 28.25  ? 176  ALA A CA  1 
ATOM   1350 C C   . ALA A 1 176 ? -5.409  65.999 43.975 1.00 28.25  ? 176  ALA A C   1 
ATOM   1351 O O   . ALA A 1 176 ? -5.513  66.944 43.196 1.00 28.25  ? 176  ALA A O   1 
ATOM   1352 C CB  . ALA A 1 176 ? -5.866  66.252 46.404 1.00 25.77  ? 176  ALA A CB  1 
ATOM   1353 N N   . LEU A 1 177 ? -4.427  65.110 43.881 1.00 26.26  ? 177  LEU A N   1 
ATOM   1354 C CA  . LEU A 1 177 ? -3.431  65.243 42.831 1.00 26.26  ? 177  LEU A CA  1 
ATOM   1355 C C   . LEU A 1 177 ? -4.031  65.049 41.448 1.00 26.26  ? 177  LEU A C   1 
ATOM   1356 O O   . LEU A 1 177 ? -3.627  65.697 40.491 1.00 26.26  ? 177  LEU A O   1 
ATOM   1357 C CB  . LEU A 1 177 ? -2.300  64.254 43.046 1.00 33.57  ? 177  LEU A CB  1 
ATOM   1358 C CG  . LEU A 1 177 ? -1.338  64.653 44.160 1.00 33.57  ? 177  LEU A CG  1 
ATOM   1359 C CD1 . LEU A 1 177 ? -0.402  63.482 44.442 1.00 33.57  ? 177  LEU A CD1 1 
ATOM   1360 C CD2 . LEU A 1 177 ? -0.558  65.902 43.774 1.00 33.57  ? 177  LEU A CD2 1 
ATOM   1361 N N   . GLN A 1 178 ? -5.002  64.153 41.342 1.00 34.00  ? 178  GLN A N   1 
ATOM   1362 C CA  . GLN A 1 178 ? -5.648  63.896 40.064 1.00 34.00  ? 178  GLN A CA  1 
ATOM   1363 C C   . GLN A 1 178 ? -6.330  65.169 39.587 1.00 34.00  ? 178  GLN A C   1 
ATOM   1364 O O   . GLN A 1 178 ? -6.318  65.471 38.403 1.00 34.00  ? 178  GLN A O   1 
ATOM   1365 C CB  . GLN A 1 178 ? -6.674  62.767 40.202 1.00 36.77  ? 178  GLN A CB  1 
ATOM   1366 C CG  . GLN A 1 178 ? -7.327  62.316 38.893 1.00 36.77  ? 178  GLN A CG  1 
ATOM   1367 C CD  . GLN A 1 178 ? -6.347  61.674 37.930 1.00 36.77  ? 178  GLN A CD  1 
ATOM   1368 O OE1 . GLN A 1 178 ? -5.661  60.709 38.277 1.00 36.77  ? 178  GLN A OE1 1 
ATOM   1369 N NE2 . GLN A 1 178 ? -6.278  62.205 36.708 1.00 36.77  ? 178  GLN A NE2 1 
ATOM   1370 N N   . TRP A 1 179 ? -6.912  65.917 40.517 1.00 33.63  ? 179  TRP A N   1 
ATOM   1371 C CA  . TRP A 1 179 ? -7.602  67.158 40.191 1.00 33.63  ? 179  TRP A CA  1 
ATOM   1372 C C   . TRP A 1 179 ? -6.589  68.214 39.758 1.00 33.63  ? 179  TRP A C   1 
ATOM   1373 O O   . TRP A 1 179 ? -6.806  68.906 38.769 1.00 33.63  ? 179  TRP A O   1 
ATOM   1374 C CB  . TRP A 1 179 ? -8.383  67.662 41.401 1.00 25.14  ? 179  TRP A CB  1 
ATOM   1375 C CG  . TRP A 1 179 ? -9.519  68.580 41.099 1.00 25.14  ? 179  TRP A CG  1 
ATOM   1376 C CD1 . TRP A 1 179 ? -10.803 68.227 40.821 1.00 25.14  ? 179  TRP A CD1 1 
ATOM   1377 C CD2 . TRP A 1 179 ? -9.489  70.006 41.107 1.00 25.14  ? 179  TRP A CD2 1 
ATOM   1378 N NE1 . TRP A 1 179 ? -11.583 69.346 40.663 1.00 25.14  ? 179  TRP A NE1 1 
ATOM   1379 C CE2 . TRP A 1 179 ? -10.797 70.453 40.834 1.00 25.14  ? 179  TRP A CE2 1 
ATOM   1380 C CE3 . TRP A 1 179 ? -8.485  70.952 41.321 1.00 25.14  ? 179  TRP A CE3 1 
ATOM   1381 C CZ2 . TRP A 1 179 ? -11.126 71.804 40.772 1.00 25.14  ? 179  TRP A CZ2 1 
ATOM   1382 C CZ3 . TRP A 1 179 ? -8.816  72.299 41.259 1.00 25.14  ? 179  TRP A CZ3 1 
ATOM   1383 C CH2 . TRP A 1 179 ? -10.125 72.709 40.986 1.00 25.14  ? 179  TRP A CH2 1 
ATOM   1384 N N   . VAL A 1 180 ? -5.483  68.347 40.489 1.00 36.13  ? 180  VAL A N   1 
ATOM   1385 C CA  . VAL A 1 180 ? -4.469  69.332 40.119 1.00 36.13  ? 180  VAL A CA  1 
ATOM   1386 C C   . VAL A 1 180 ? -3.995  69.015 38.703 1.00 36.13  ? 180  VAL A C   1 
ATOM   1387 O O   . VAL A 1 180 ? -3.625  69.897 37.935 1.00 36.13  ? 180  VAL A O   1 
ATOM   1388 C CB  . VAL A 1 180 ? -3.241  69.290 41.071 1.00 29.20  ? 180  VAL A CB  1 
ATOM   1389 C CG1 . VAL A 1 180 ? -2.146  70.226 40.575 1.00 29.20  ? 180  VAL A CG1 1 
ATOM   1390 C CG2 . VAL A 1 180 ? -3.658  69.675 42.464 1.00 29.20  ? 180  VAL A CG2 1 
ATOM   1391 N N   . HIS A 1 181 ? -4.026  67.743 38.353 1.00 32.74  ? 181  HIS A N   1 
ATOM   1392 C CA  . HIS A 1 181 ? -3.582  67.328 37.044 1.00 32.74  ? 181  HIS A CA  1 
ATOM   1393 C C   . HIS A 1 181 ? -4.602  67.593 35.956 1.00 32.74  ? 181  HIS A C   1 
ATOM   1394 O O   . HIS A 1 181 ? -4.238  67.872 34.823 1.00 32.74  ? 181  HIS A O   1 
ATOM   1395 C CB  . HIS A 1 181 ? -3.231  65.850 37.086 1.00 45.31  ? 181  HIS A CB  1 
ATOM   1396 C CG  . HIS A 1 181 ? -2.694  65.323 35.799 1.00 45.31  ? 181  HIS A CG  1 
ATOM   1397 N ND1 . HIS A 1 181 ? -3.508  64.878 34.780 1.00 45.31  ? 181  HIS A ND1 1 
ATOM   1398 C CD2 . HIS A 1 181 ? -1.422  65.176 35.359 1.00 45.31  ? 181  HIS A CD2 1 
ATOM   1399 C CE1 . HIS A 1 181 ? -2.760  64.477 33.768 1.00 45.31  ? 181  HIS A CE1 1 
ATOM   1400 N NE2 . HIS A 1 181 ? -1.490  64.647 34.094 1.00 45.31  ? 181  HIS A NE2 1 
ATOM   1401 N N   . ASP A 1 182 ? -5.881  67.515 36.293 1.00 39.74  ? 182  ASP A N   1 
ATOM   1402 C CA  . ASP A 1 182 ? -6.921  67.745 35.304 1.00 39.74  ? 182  ASP A CA  1 
ATOM   1403 C C   . ASP A 1 182 ? -7.395  69.188 35.248 1.00 39.74  ? 182  ASP A C   1 
ATOM   1404 O O   . ASP A 1 182 ? -8.102  69.563 34.314 1.00 39.74  ? 182  ASP A O   1 
ATOM   1405 C CB  . ASP A 1 182 ? -8.146  66.866 35.585 1.00 61.70  ? 182  ASP A CB  1 
ATOM   1406 C CG  . ASP A 1 182 ? -7.820  65.376 35.638 1.00 61.70  ? 182  ASP A CG  1 
ATOM   1407 O OD1 . ASP A 1 182 ? -6.957  64.914 34.852 1.00 61.70  ? 182  ASP A OD1 1 
ATOM   1408 O OD2 . ASP A 1 182 ? -8.446  64.656 36.457 1.00 61.70  ? 182  ASP A OD2 1 
ATOM   1409 N N   . ASN A 1 183 ? -7.004  70.010 36.217 1.00 31.61  ? 183  ASN A N   1 
ATOM   1410 C CA  . ASN A 1 183 ? -7.503  71.377 36.243 1.00 31.61  ? 183  ASN A CA  1 
ATOM   1411 C C   . ASN A 1 183 ? -6.567  72.542 36.539 1.00 31.61  ? 183  ASN A C   1 
ATOM   1412 O O   . ASN A 1 183 ? -6.920  73.694 36.275 1.00 31.61  ? 183  ASN A O   1 
ATOM   1413 C CB  . ASN A 1 183 ? -8.659  71.446 37.234 1.00 42.89  ? 183  ASN A CB  1 
ATOM   1414 C CG  . ASN A 1 183 ? -9.788  70.505 36.880 1.00 42.89  ? 183  ASN A CG  1 
ATOM   1415 O OD1 . ASN A 1 183 ? -10.533 70.741 35.922 1.00 42.89  ? 183  ASN A OD1 1 
ATOM   1416 N ND2 . ASN A 1 183 ? -9.921  69.423 37.646 1.00 42.89  ? 183  ASN A ND2 1 
ATOM   1417 N N   . ILE A 1 184 ? -5.387  72.279 37.083 1.00 32.60  ? 184  ILE A N   1 
ATOM   1418 C CA  . ILE A 1 184 ? -4.498  73.376 37.424 1.00 32.60  ? 184  ILE A CA  1 
ATOM   1419 C C   . ILE A 1 184 ? -4.184  74.289 36.233 1.00 32.60  ? 184  ILE A C   1 
ATOM   1420 O O   . ILE A 1 184 ? -3.752  75.430 36.408 1.00 32.60  ? 184  ILE A O   1 
ATOM   1421 C CB  . ILE A 1 184 ? -3.190  72.849 38.067 1.00 20.91  ? 184  ILE A CB  1 
ATOM   1422 C CG1 . ILE A 1 184 ? -2.585  73.928 38.970 1.00 20.91  ? 184  ILE A CG1 1 
ATOM   1423 C CG2 . ILE A 1 184 ? -2.204  72.417 36.999 1.00 20.91  ? 184  ILE A CG2 1 
ATOM   1424 C CD1 . ILE A 1 184 ? -3.464  74.315 40.151 1.00 20.91  ? 184  ILE A CD1 1 
ATOM   1425 N N   . GLN A 1 185 ? -4.427  73.800 35.021 1.00 38.95  ? 185  GLN A N   1 
ATOM   1426 C CA  . GLN A 1 185 ? -4.141  74.584 33.835 1.00 38.95  ? 185  GLN A CA  1 
ATOM   1427 C C   . GLN A 1 185 ? -5.075  75.775 33.737 1.00 38.95  ? 185  GLN A C   1 
ATOM   1428 O O   . GLN A 1 185 ? -4.727  76.794 33.147 1.00 38.95  ? 185  GLN A O   1 
ATOM   1429 C CB  . GLN A 1 185 ? -4.279  73.722 32.594 1.00 48.45  ? 185  GLN A CB  1 
ATOM   1430 C CG  . GLN A 1 185 ? -5.711  73.458 32.213 1.00 48.45  ? 185  GLN A CG  1 
ATOM   1431 C CD  . GLN A 1 185 ? -5.865  72.287 31.259 1.00 48.45  ? 185  GLN A CD  1 
ATOM   1432 O OE1 . GLN A 1 185 ? -5.684  71.124 31.640 1.00 48.45  ? 185  GLN A OE1 1 
ATOM   1433 N NE2 . GLN A 1 185 ? -6.202  72.588 30.009 1.00 48.45  ? 185  GLN A NE2 1 
ATOM   1434 N N   . PHE A 1 186 ? -6.264  75.660 34.311 1.00 43.60  ? 186  PHE A N   1 
ATOM   1435 C CA  . PHE A 1 186 ? -7.210  76.765 34.254 1.00 43.60  ? 186  PHE A CA  1 
ATOM   1436 C C   . PHE A 1 186 ? -6.894  77.808 35.317 1.00 43.60  ? 186  PHE A C   1 
ATOM   1437 O O   . PHE A 1 186 ? -7.582  78.822 35.431 1.00 43.60  ? 186  PHE A O   1 
ATOM   1438 C CB  . PHE A 1 186 ? -8.634  76.244 34.419 1.00 28.05  ? 186  PHE A CB  1 
ATOM   1439 C CG  . PHE A 1 186 ? -8.988  75.190 33.431 1.00 28.05  ? 186  PHE A CG  1 
ATOM   1440 C CD1 . PHE A 1 186 ? -9.000  75.474 32.076 1.00 28.05  ? 186  PHE A CD1 1 
ATOM   1441 C CD2 . PHE A 1 186 ? -9.235  73.889 33.841 1.00 28.05  ? 186  PHE A CD2 1 
ATOM   1442 C CE1 . PHE A 1 186 ? -9.245  74.477 31.145 1.00 28.05  ? 186  PHE A CE1 1 
ATOM   1443 C CE2 . PHE A 1 186 ? -9.481  72.881 32.912 1.00 28.05  ? 186  PHE A CE2 1 
ATOM   1444 C CZ  . PHE A 1 186 ? -9.484  73.177 31.565 1.00 28.05  ? 186  PHE A CZ  1 
ATOM   1445 N N   . PHE A 1 187 ? -5.852  77.556 36.101 1.00 40.98  ? 187  PHE A N   1 
ATOM   1446 C CA  . PHE A 1 187 ? -5.453  78.501 37.135 1.00 40.98  ? 187  PHE A CA  1 
ATOM   1447 C C   . PHE A 1 187 ? -4.121  79.128 36.772 1.00 40.98  ? 187  PHE A C   1 
ATOM   1448 O O   . PHE A 1 187 ? -3.560  79.888 37.548 1.00 40.98  ? 187  PHE A O   1 
ATOM   1449 C CB  . PHE A 1 187 ? -5.343  77.819 38.507 1.00 24.94  ? 187  PHE A CB  1 
ATOM   1450 C CG  . PHE A 1 187 ? -6.660  77.360 39.064 1.00 24.94  ? 187  PHE A CG  1 
ATOM   1451 C CD1 . PHE A 1 187 ? -7.171  76.110 38.736 1.00 24.94  ? 187  PHE A CD1 1 
ATOM   1452 C CD2 . PHE A 1 187 ? -7.396  78.189 39.913 1.00 24.94  ? 187  PHE A CD2 1 
ATOM   1453 C CE1 . PHE A 1 187 ? -8.396  75.688 39.247 1.00 24.94  ? 187  PHE A CE1 1 
ATOM   1454 C CE2 . PHE A 1 187 ? -8.625  77.780 40.430 1.00 24.94  ? 187  PHE A CE2 1 
ATOM   1455 C CZ  . PHE A 1 187 ? -9.128  76.529 40.098 1.00 24.94  ? 187  PHE A CZ  1 
ATOM   1456 N N   . GLY A 1 188 ? -3.625  78.804 35.583 1.00 42.40  ? 188  GLY A N   1 
ATOM   1457 C CA  . GLY A 1 188 ? -2.350  79.339 35.139 1.00 42.40  ? 188  GLY A CA  1 
ATOM   1458 C C   . GLY A 1 188 ? -1.201  78.363 35.344 1.00 42.40  ? 188  GLY A C   1 
ATOM   1459 O O   . GLY A 1 188 ? -0.060  78.616 34.924 1.00 42.40  ? 188  GLY A O   1 
ATOM   1460 N N   . GLY A 1 189 ? -1.506  77.235 35.982 1.00 43.18  ? 189  GLY A N   1 
ATOM   1461 C CA  . GLY A 1 189 ? -0.492  76.238 36.250 1.00 43.18  ? 189  GLY A CA  1 
ATOM   1462 C C   . GLY A 1 189 ? -0.259  75.244 35.135 1.00 43.18  ? 189  GLY A C   1 
ATOM   1463 O O   . GLY A 1 189 ? -1.153  74.955 34.335 1.00 43.18  ? 189  GLY A O   1 
ATOM   1464 N N   . ASP A 1 190 ? 0.963   74.722 35.084 1.00 45.17  ? 190  ASP A N   1 
ATOM   1465 C CA  . ASP A 1 190 ? 1.358   73.741 34.088 1.00 45.17  ? 190  ASP A CA  1 
ATOM   1466 C C   . ASP A 1 190 ? 1.318   72.368 34.766 1.00 45.17  ? 190  ASP A C   1 
ATOM   1467 O O   . ASP A 1 190 ? 2.102   72.082 35.670 1.00 45.17  ? 190  ASP A O   1 
ATOM   1468 C CB  . ASP A 1 190 ? 2.758   74.082 33.571 1.00 58.46  ? 190  ASP A CB  1 
ATOM   1469 C CG  . ASP A 1 190 ? 3.343   72.995 32.683 1.00 58.46  ? 190  ASP A CG  1 
ATOM   1470 O OD1 . ASP A 1 190 ? 2.563   72.274 32.018 1.00 58.46  ? 190  ASP A OD1 1 
ATOM   1471 O OD2 . ASP A 1 190 ? 4.594   72.868 32.641 1.00 58.46  ? 190  ASP A OD2 1 
ATOM   1472 N N   . PRO A 1 191 ? 0.384   71.502 34.341 1.00 39.97  ? 191  PRO A N   1 
ATOM   1473 C CA  . PRO A 1 191 ? 0.236   70.167 34.914 1.00 39.97  ? 191  PRO A CA  1 
ATOM   1474 C C   . PRO A 1 191 ? 1.403   69.212 34.703 1.00 39.97  ? 191  PRO A C   1 
ATOM   1475 O O   . PRO A 1 191 ? 1.591   68.296 35.493 1.00 39.97  ? 191  PRO A O   1 
ATOM   1476 C CB  . PRO A 1 191 ? -1.049  69.671 34.267 1.00 24.68  ? 191  PRO A CB  1 
ATOM   1477 C CG  . PRO A 1 191 ? -0.985  70.283 32.933 1.00 24.68  ? 191  PRO A CG  1 
ATOM   1478 C CD  . PRO A 1 191 ? -0.571  71.690 33.237 1.00 24.68  ? 191  PRO A CD  1 
ATOM   1479 N N   . LYS A 1 192 ? 2.186   69.416 33.649 1.00 62.84  ? 192  LYS A N   1 
ATOM   1480 C CA  . LYS A 1 192 ? 3.320   68.533 33.379 1.00 62.84  ? 192  LYS A CA  1 
ATOM   1481 C C   . LYS A 1 192 ? 4.565   68.953 34.169 1.00 62.84  ? 192  LYS A C   1 
ATOM   1482 O O   . LYS A 1 192 ? 5.676   68.480 33.900 1.00 62.84  ? 192  LYS A O   1 
ATOM   1483 C CB  . LYS A 1 192 ? 3.645   68.503 31.874 1.00 69.83  ? 192  LYS A CB  1 
ATOM   1484 C CG  . LYS A 1 192 ? 4.095   69.865 31.305 1.00 69.83  ? 192  LYS A CG  1 
ATOM   1485 C CD  . LYS A 1 192 ? 4.693   69.794 29.870 1.00 69.83  ? 192  LYS A CD  1 
ATOM   1486 C CE  . LYS A 1 192 ? 3.700   69.309 28.779 1.00 69.83  ? 192  LYS A CE  1 
ATOM   1487 N NZ  . LYS A 1 192 ? 3.503   67.820 28.697 1.00 69.83  ? 192  LYS A NZ  1 
ATOM   1488 N N   . THR A 1 193 ? 4.386   69.840 35.142 1.00 41.58  ? 193  THR A N   1 
ATOM   1489 C CA  . THR A 1 193 ? 5.501   70.297 35.963 1.00 41.58  ? 193  THR A CA  1 
ATOM   1490 C C   . THR A 1 193 ? 5.022   70.616 37.367 1.00 41.58  ? 193  THR A C   1 
ATOM   1491 O O   . THR A 1 193 ? 5.070   71.753 37.832 1.00 41.58  ? 193  THR A O   1 
ATOM   1492 C CB  . THR A 1 193 ? 6.181   71.528 35.344 1.00 63.84  ? 193  THR A CB  1 
ATOM   1493 O OG1 . THR A 1 193 ? 6.755   71.157 34.085 1.00 63.84  ? 193  THR A OG1 1 
ATOM   1494 C CG2 . THR A 1 193 ? 7.291   72.049 36.248 1.00 63.84  ? 193  THR A CG2 1 
ATOM   1495 N N   . VAL A 1 194 ? 4.558   69.583 38.045 1.00 33.66  ? 194  VAL A N   1 
ATOM   1496 C CA  . VAL A 1 194 ? 4.066   69.742 39.394 1.00 33.66  ? 194  VAL A CA  1 
ATOM   1497 C C   . VAL A 1 194 ? 4.984   69.028 40.367 1.00 33.66  ? 194  VAL A C   1 
ATOM   1498 O O   . VAL A 1 194 ? 5.344   67.880 40.159 1.00 33.66  ? 194  VAL A O   1 
ATOM   1499 C CB  . VAL A 1 194 ? 2.632   69.194 39.498 1.00 38.99  ? 194  VAL A CB  1 
ATOM   1500 C CG1 . VAL A 1 194 ? 2.523   67.939 38.672 1.00 38.99  ? 194  VAL A CG1 1 
ATOM   1501 C CG2 . VAL A 1 194 ? 2.262   68.913 40.946 1.00 38.99  ? 194  VAL A CG2 1 
ATOM   1502 N N   . THR A 1 195 ? 5.369   69.735 41.423 1.00 36.07  ? 195  THR A N   1 
ATOM   1503 C CA  . THR A 1 195 ? 6.247   69.200 42.454 1.00 36.07  ? 195  THR A CA  1 
ATOM   1504 C C   . THR A 1 195 ? 5.445   68.973 43.722 1.00 36.07  ? 195  THR A C   1 
ATOM   1505 O O   . THR A 1 195 ? 4.798   69.891 44.200 1.00 36.07  ? 195  THR A O   1 
ATOM   1506 C CB  . THR A 1 195 ? 7.357   70.206 42.825 1.00 27.14  ? 195  THR A CB  1 
ATOM   1507 O OG1 . THR A 1 195 ? 8.095   70.581 41.653 1.00 27.14  ? 195  THR A OG1 1 
ATOM   1508 C CG2 . THR A 1 195 ? 8.289   69.602 43.851 1.00 27.14  ? 195  THR A CG2 1 
ATOM   1509 N N   . ILE A 1 196 ? 5.452   67.767 44.272 1.00 31.61  ? 196  ILE A N   1 
ATOM   1510 C CA  . ILE A 1 196 ? 4.736   67.589 45.521 1.00 31.61  ? 196  ILE A CA  1 
ATOM   1511 C C   . ILE A 1 196 ? 5.809   67.608 46.601 1.00 31.61  ? 196  ILE A C   1 
ATOM   1512 O O   . ILE A 1 196 ? 6.918   67.126 46.387 1.00 31.61  ? 196  ILE A O   1 
ATOM   1513 C CB  . ILE A 1 196 ? 3.935   66.273 45.555 1.00 33.69  ? 196  ILE A CB  1 
ATOM   1514 C CG1 . ILE A 1 196 ? 4.858   65.072 45.556 1.00 33.69  ? 196  ILE A CG1 1 
ATOM   1515 C CG2 . ILE A 1 196 ? 3.053   66.180 44.340 1.00 33.69  ? 196  ILE A CG2 1 
ATOM   1516 C CD1 . ILE A 1 196 ? 4.101   63.760 45.558 1.00 33.69  ? 196  ILE A CD1 1 
ATOM   1517 N N   . PHE A 1 197 ? 5.510   68.219 47.738 1.00 25.79  ? 197  PHE A N   1 
ATOM   1518 C CA  . PHE A 1 197 ? 6.477   68.273 48.827 1.00 25.79  ? 197  PHE A CA  1 
ATOM   1519 C C   . PHE A 1 197 ? 5.788   68.171 50.171 1.00 25.79  ? 197  PHE A C   1 
ATOM   1520 O O   . PHE A 1 197 ? 4.686   68.661 50.338 1.00 25.79  ? 197  PHE A O   1 
ATOM   1521 C CB  . PHE A 1 197 ? 7.351   69.541 48.737 1.00 38.54  ? 197  PHE A CB  1 
ATOM   1522 C CG  . PHE A 1 197 ? 6.630   70.853 48.998 1.00 38.54  ? 197  PHE A CG  1 
ATOM   1523 C CD1 . PHE A 1 197 ? 5.506   71.221 48.276 1.00 38.54  ? 197  PHE A CD1 1 
ATOM   1524 C CD2 . PHE A 1 197 ? 7.145   71.761 49.922 1.00 38.54  ? 197  PHE A CD2 1 
ATOM   1525 C CE1 . PHE A 1 197 ? 4.911   72.471 48.465 1.00 38.54  ? 197  PHE A CE1 1 
ATOM   1526 C CE2 . PHE A 1 197 ? 6.552   73.012 50.112 1.00 38.54  ? 197  PHE A CE2 1 
ATOM   1527 C CZ  . PHE A 1 197 ? 5.436   73.363 49.380 1.00 38.54  ? 197  PHE A CZ  1 
ATOM   1528 N N   . GLY A 1 198 ? 6.425   67.504 51.125 1.00 24.70  ? 198  GLY A N   1 
ATOM   1529 C CA  . GLY A 1 198 ? 5.806   67.350 52.426 1.00 24.70  ? 198  GLY A CA  1 
ATOM   1530 C C   . GLY A 1 198 ? 6.791   67.364 53.565 1.00 24.70  ? 198  GLY A C   1 
ATOM   1531 O O   . GLY A 1 198 ? 7.987   67.474 53.349 1.00 24.70  ? 198  GLY A O   1 
ATOM   1532 N N   . GLU A 1 199 ? 6.271   67.252 54.781 1.00 40.97  ? 199  GLU A N   1 
ATOM   1533 C CA  . GLU A 1 199 ? 7.086   67.248 55.989 1.00 40.97  ? 199  GLU A CA  1 
ATOM   1534 C C   . GLU A 1 199 ? 6.499   66.258 56.996 1.00 40.97  ? 199  GLU A C   1 
ATOM   1535 O O   . GLU A 1 199 ? 5.291   66.216 57.168 1.00 40.97  ? 199  GLU A O   1 
ATOM   1536 C CB  . GLU A 1 199 ? 7.126   68.661 56.571 1.00 76.05  ? 199  GLU A CB  1 
ATOM   1537 C CG  . GLU A 1 199 ? 8.045   68.858 57.773 1.00 76.05  ? 199  GLU A CG  1 
ATOM   1538 C CD  . GLU A 1 199 ? 7.293   68.763 59.092 1.00 76.05  ? 199  GLU A CD  1 
ATOM   1539 O OE1 . GLU A 1 199 ? 6.185   69.357 59.184 1.00 76.05  ? 199  GLU A OE1 1 
ATOM   1540 O OE2 . GLU A 1 199 ? 7.803   68.106 60.037 1.00 76.05  ? 199  GLU A OE2 1 
ATOM   1541 N N   . SER A 1 200 ? 7.355   65.463 57.645 1.00 37.81  ? 200  SER A N   1 
ATOM   1542 C CA  . SER A 1 200 ? 6.951   64.452 58.640 1.00 37.81  ? 200  SER A CA  1 
ATOM   1543 C C   . SER A 1 200 ? 6.085   63.424 57.916 1.00 37.81  ? 200  SER A C   1 
ATOM   1544 O O   . SER A 1 200 ? 6.552   62.815 56.966 1.00 37.81  ? 200  SER A O   1 
ATOM   1545 C CB  . SER A 1 200 ? 6.201   65.107 59.822 1.00 37.10  ? 200  SER A CB  1 
ATOM   1546 O OG  . SER A 1 200 ? 5.942   64.192 60.886 1.00 37.10  ? 200  SER A OG  1 
ATOM   1547 N N   . ALA A 1 201 ? 4.839   63.224 58.330 1.00 32.02  ? 201  ALA A N   1 
ATOM   1548 C CA  . ALA A 1 201 ? 3.993   62.251 57.639 1.00 32.02  ? 201  ALA A CA  1 
ATOM   1549 C C   . ALA A 1 201 ? 3.797   62.661 56.186 1.00 32.02  ? 201  ALA A C   1 
ATOM   1550 O O   . ALA A 1 201 ? 3.510   61.832 55.331 1.00 32.02  ? 201  ALA A O   1 
ATOM   1551 C CB  . ALA A 1 201 ? 2.641   62.134 58.324 1.00 37.56  ? 201  ALA A CB  1 
ATOM   1552 N N   . GLY A 1 202 ? 3.941   63.954 55.917 1.00 31.77  ? 202  GLY A N   1 
ATOM   1553 C CA  . GLY A 1 202 ? 3.774   64.450 54.569 1.00 31.77  ? 202  GLY A CA  1 
ATOM   1554 C C   . GLY A 1 202 ? 4.969   64.062 53.740 1.00 31.77  ? 202  GLY A C   1 
ATOM   1555 O O   . GLY A 1 202 ? 4.845   63.792 52.555 1.00 31.77  ? 202  GLY A O   1 
ATOM   1556 N N   . GLY A 1 203 ? 6.137   64.040 54.371 1.00 35.74  ? 203  GLY A N   1 
ATOM   1557 C CA  . GLY A 1 203 ? 7.344   63.668 53.665 1.00 35.74  ? 203  GLY A CA  1 
ATOM   1558 C C   . GLY A 1 203 ? 7.302   62.188 53.372 1.00 35.74  ? 203  GLY A C   1 
ATOM   1559 O O   . GLY A 1 203 ? 7.868   61.714 52.396 1.00 35.74  ? 203  GLY A O   1 
ATOM   1560 N N   . ALA A 1 204 ? 6.625   61.450 54.239 1.00 32.84  ? 204  ALA A N   1 
ATOM   1561 C CA  . ALA A 1 204 ? 6.494   60.017 54.066 1.00 32.84  ? 204  ALA A CA  1 
ATOM   1562 C C   . ALA A 1 204 ? 5.433   59.714 53.004 1.00 32.84  ? 204  ALA A C   1 
ATOM   1563 O O   . ALA A 1 204 ? 5.513   58.705 52.311 1.00 32.84  ? 204  ALA A O   1 
ATOM   1564 C CB  . ALA A 1 204 ? 6.124   59.370 55.388 1.00 31.83  ? 204  ALA A CB  1 
ATOM   1565 N N   . SER A 1 205 ? 4.442   60.589 52.882 1.00 33.86  ? 205  SER A N   1 
ATOM   1566 C CA  . SER A 1 205 ? 3.391   60.408 51.894 1.00 33.86  ? 205  SER A CA  1 
ATOM   1567 C C   . SER A 1 205 ? 3.959   60.634 50.497 1.00 33.86  ? 205  SER A C   1 
ATOM   1568 O O   . SER A 1 205 ? 3.634   59.908 49.559 1.00 33.86  ? 205  SER A O   1 
ATOM   1569 C CB  . SER A 1 205 ? 2.251   61.391 52.139 1.00 31.08  ? 205  SER A CB  1 
ATOM   1570 O OG  . SER A 1 205 ? 1.646   61.155 53.390 1.00 31.08  ? 205  SER A OG  1 
ATOM   1571 N N   . VAL A 1 206 ? 4.803   61.651 50.361 1.00 34.79  ? 206  VAL A N   1 
ATOM   1572 C CA  . VAL A 1 206 ? 5.415   61.953 49.078 1.00 34.79  ? 206  VAL A CA  1 
ATOM   1573 C C   . VAL A 1 206 ? 6.146   60.710 48.648 1.00 34.79  ? 206  VAL A C   1 
ATOM   1574 O O   . VAL A 1 206 ? 5.895   60.171 47.582 1.00 34.79  ? 206  VAL A O   1 
ATOM   1575 C CB  . VAL A 1 206 ? 6.429   63.113 49.180 1.00 29.08  ? 206  VAL A CB  1 
ATOM   1576 C CG1 . VAL A 1 206 ? 7.322   63.121 47.969 1.00 29.08  ? 206  VAL A CG1 1 
ATOM   1577 C CG2 . VAL A 1 206 ? 5.705   64.434 49.282 1.00 29.08  ? 206  VAL A CG2 1 
ATOM   1578 N N   . GLY A 1 207 ? 7.044   60.250 49.507 1.00 34.69  ? 207  GLY A N   1 
ATOM   1579 C CA  . GLY A 1 207 ? 7.818   59.060 49.215 1.00 34.69  ? 207  GLY A CA  1 
ATOM   1580 C C   . GLY A 1 207 ? 6.952   57.871 48.873 1.00 34.69  ? 207  GLY A C   1 
ATOM   1581 O O   . GLY A 1 207 ? 7.370   56.981 48.132 1.00 34.69  ? 207  GLY A O   1 
ATOM   1582 N N   . MET A 1 208 ? 5.740   57.861 49.410 1.00 43.11  ? 208  MET A N   1 
ATOM   1583 C CA  . MET A 1 208 ? 4.813   56.774 49.152 1.00 43.11  ? 208  MET A CA  1 
ATOM   1584 C C   . MET A 1 208 ? 4.170   56.864 47.781 1.00 43.11  ? 208  MET A C   1 
ATOM   1585 O O   . MET A 1 208 ? 3.761   55.848 47.233 1.00 43.11  ? 208  MET A O   1 
ATOM   1586 C CB  . MET A 1 208 ? 3.751   56.716 50.241 1.00 36.35  ? 208  MET A CB  1 
ATOM   1587 C CG  . MET A 1 208 ? 4.100   55.723 51.304 1.00 36.35  ? 208  MET A CG  1 
ATOM   1588 S SD  . MET A 1 208 ? 3.275   56.006 52.849 1.00 36.35  ? 208  MET A SD  1 
ATOM   1589 C CE  . MET A 1 208 ? 4.469   55.363 53.982 1.00 36.35  ? 208  MET A CE  1 
ATOM   1590 N N   . HIS A 1 209 ? 4.081   58.067 47.222 1.00 33.67  ? 209  HIS A N   1 
ATOM   1591 C CA  . HIS A 1 209 ? 3.497   58.226 45.899 1.00 33.67  ? 209  HIS A CA  1 
ATOM   1592 C C   . HIS A 1 209 ? 4.544   57.911 44.862 1.00 33.67  ? 209  HIS A C   1 
ATOM   1593 O O   . HIS A 1 209 ? 4.225   57.554 43.736 1.00 33.67  ? 209  HIS A O   1 
ATOM   1594 C CB  . HIS A 1 209 ? 2.982   59.638 45.702 1.00 35.64  ? 209  HIS A CB  1 
ATOM   1595 C CG  . HIS A 1 209 ? 1.740   59.922 46.476 1.00 35.64  ? 209  HIS A CG  1 
ATOM   1596 N ND1 . HIS A 1 209 ? 0.559   59.256 46.243 1.00 35.64  ? 209  HIS A ND1 1 
ATOM   1597 C CD2 . HIS A 1 209 ? 1.505   60.762 47.511 1.00 35.64  ? 209  HIS A CD2 1 
ATOM   1598 C CE1 . HIS A 1 209 ? -0.352  59.673 47.103 1.00 35.64  ? 209  HIS A CE1 1 
ATOM   1599 N NE2 . HIS A 1 209 ? 0.196   60.587 47.884 1.00 35.64  ? 209  HIS A NE2 1 
ATOM   1600 N N   . ILE A 1 210 ? 5.801   58.050 45.256 1.00 32.86  ? 210  ILE A N   1 
ATOM   1601 C CA  . ILE A 1 210 ? 6.921   57.749 44.384 1.00 32.86  ? 210  ILE A CA  1 
ATOM   1602 C C   . ILE A 1 210 ? 6.988   56.230 44.200 1.00 32.86  ? 210  ILE A C   1 
ATOM   1603 O O   . ILE A 1 210 ? 7.374   55.749 43.138 1.00 32.86  ? 210  ILE A O   1 
ATOM   1604 C CB  . ILE A 1 210 ? 8.242   58.268 45.009 1.00 26.65  ? 210  ILE A CB  1 
ATOM   1605 C CG1 . ILE A 1 210 ? 8.296   59.780 44.870 1.00 26.65  ? 210  ILE A CG1 1 
ATOM   1606 C CG2 . ILE A 1 210 ? 9.445   57.634 44.353 1.00 26.65  ? 210  ILE A CG2 1 
ATOM   1607 C CD1 . ILE A 1 210 ? 9.478   60.393 45.516 1.00 26.65  ? 210  ILE A CD1 1 
ATOM   1608 N N   . LEU A 1 211 ? 6.594   55.486 45.237 1.00 47.26  ? 211  LEU A N   1 
ATOM   1609 C CA  . LEU A 1 211 ? 6.612   54.024 45.219 1.00 47.26  ? 211  LEU A CA  1 
ATOM   1610 C C   . LEU A 1 211 ? 5.361   53.407 44.585 1.00 47.26  ? 211  LEU A C   1 
ATOM   1611 O O   . LEU A 1 211 ? 5.459   52.519 43.741 1.00 47.26  ? 211  LEU A O   1 
ATOM   1612 C CB  . LEU A 1 211 ? 6.773   53.483 46.644 1.00 31.40  ? 211  LEU A CB  1 
ATOM   1613 C CG  . LEU A 1 211 ? 8.024   53.863 47.442 1.00 31.40  ? 211  LEU A CG  1 
ATOM   1614 C CD1 . LEU A 1 211 ? 7.868   53.418 48.876 1.00 31.40  ? 211  LEU A CD1 1 
ATOM   1615 C CD2 . LEU A 1 211 ? 9.239   53.220 46.835 1.00 31.40  ? 211  LEU A CD2 1 
ATOM   1616 N N   . SER A 1 212 ? 4.187   53.877 44.991 1.00 41.47  ? 212  SER A N   1 
ATOM   1617 C CA  . SER A 1 212 ? 2.923   53.366 44.467 1.00 41.47  ? 212  SER A CA  1 
ATOM   1618 C C   . SER A 1 212 ? 2.683   53.609 42.976 1.00 41.47  ? 212  SER A C   1 
ATOM   1619 O O   . SER A 1 212 ? 2.629   54.759 42.527 1.00 41.47  ? 212  SER A O   1 
ATOM   1620 C CB  . SER A 1 212 ? 1.771   53.984 45.241 1.00 45.60  ? 212  SER A CB  1 
ATOM   1621 O OG  . SER A 1 212 ? 0.568   53.846 44.512 1.00 45.60  ? 212  SER A OG  1 
ATOM   1622 N N   . PRO A 1 213 ? 2.498   52.530 42.189 1.00 44.93  ? 213  PRO A N   1 
ATOM   1623 C CA  . PRO A 1 213 ? 2.258   52.636 40.742 1.00 44.93  ? 213  PRO A CA  1 
ATOM   1624 C C   . PRO A 1 213 ? 1.110   53.567 40.398 1.00 44.93  ? 213  PRO A C   1 
ATOM   1625 O O   . PRO A 1 213 ? 1.208   54.356 39.470 1.00 44.93  ? 213  PRO A O   1 
ATOM   1626 C CB  . PRO A 1 213 ? 1.948   51.205 40.340 1.00 30.93  ? 213  PRO A CB  1 
ATOM   1627 C CG  . PRO A 1 213 ? 2.781   50.421 41.290 1.00 30.93  ? 213  PRO A CG  1 
ATOM   1628 C CD  . PRO A 1 213 ? 2.543   51.118 42.602 1.00 30.93  ? 213  PRO A CD  1 
ATOM   1629 N N   . GLY A 1 214 ? 0.021   53.478 41.153 1.00 37.40  ? 214  GLY A N   1 
ATOM   1630 C CA  . GLY A 1 214 ? -1.128  54.322 40.878 1.00 37.40  ? 214  GLY A CA  1 
ATOM   1631 C C   . GLY A 1 214 ? -0.962  55.830 40.993 1.00 37.40  ? 214  GLY A C   1 
ATOM   1632 O O   . GLY A 1 214 ? -1.830  56.573 40.553 1.00 37.40  ? 214  GLY A O   1 
ATOM   1633 N N   . SER A 1 215 ? 0.134   56.305 41.575 1.00 44.99  ? 215  SER A N   1 
ATOM   1634 C CA  . SER A 1 215 ? 0.320   57.746 41.729 1.00 44.99  ? 215  SER A CA  1 
ATOM   1635 C C   . SER A 1 215 ? 1.467   58.294 40.901 1.00 44.99  ? 215  SER A C   1 
ATOM   1636 O O   . SER A 1 215 ? 1.458   59.454 40.514 1.00 44.99  ? 215  SER A O   1 
ATOM   1637 C CB  . SER A 1 215 ? 0.585   58.091 43.196 1.00 38.66  ? 215  SER A CB  1 
ATOM   1638 O OG  . SER A 1 215 ? -0.453  57.637 44.045 1.00 38.66  ? 215  SER A OG  1 
ATOM   1639 N N   . ARG A 1 216 ? 2.456   57.454 40.631 1.00 39.11  ? 216  ARG A N   1 
ATOM   1640 C CA  . ARG A 1 216 ? 3.649   57.864 39.893 1.00 39.11  ? 216  ARG A CA  1 
ATOM   1641 C C   . ARG A 1 216 ? 3.435   58.846 38.743 1.00 39.11  ? 216  ARG A C   1 
ATOM   1642 O O   . ARG A 1 216 ? 4.168   59.822 38.627 1.00 39.11  ? 216  ARG A O   1 
ATOM   1643 C CB  . ARG A 1 216 ? 4.408   56.622 39.385 1.00 39.76  ? 216  ARG A CB  1 
ATOM   1644 C CG  . ARG A 1 216 ? 4.290   55.393 40.302 1.00 39.76  ? 216  ARG A CG  1 
ATOM   1645 C CD  . ARG A 1 216 ? 5.634   54.841 40.741 1.00 39.76  ? 216  ARG A CD  1 
ATOM   1646 N NE  . ARG A 1 216 ? 6.256   53.963 39.754 1.00 39.76  ? 216  ARG A NE  1 
ATOM   1647 C CZ  . ARG A 1 216 ? 6.481   52.660 39.935 1.00 39.76  ? 216  ARG A CZ  1 
ATOM   1648 N NH1 . ARG A 1 216 ? 6.141   52.054 41.071 1.00 39.76  ? 216  ARG A NH1 1 
ATOM   1649 N NH2 . ARG A 1 216 ? 7.050   51.955 38.969 1.00 39.76  ? 216  ARG A NH2 1 
ATOM   1650 N N   . ASP A 1 217 ? 2.427   58.617 37.910 1.00 38.70  ? 217  ASP A N   1 
ATOM   1651 C CA  . ASP A 1 217 ? 2.197   59.491 36.753 1.00 38.70  ? 217  ASP A CA  1 
ATOM   1652 C C   . ASP A 1 217 ? 1.592   60.885 37.023 1.00 38.70  ? 217  ASP A C   1 
ATOM   1653 O O   . ASP A 1 217 ? 1.445   61.683 36.093 1.00 38.70  ? 217  ASP A O   1 
ATOM   1654 C CB  . ASP A 1 217 ? 1.308   58.776 35.708 1.00 70.73  ? 217  ASP A CB  1 
ATOM   1655 C CG  . ASP A 1 217 ? 1.765   57.328 35.388 1.00 70.73  ? 217  ASP A CG  1 
ATOM   1656 O OD1 . ASP A 1 217 ? 2.937   56.970 35.667 1.00 70.73  ? 217  ASP A OD1 1 
ATOM   1657 O OD2 . ASP A 1 217 ? 0.936   56.550 34.835 1.00 70.73  ? 217  ASP A OD2 1 
ATOM   1658 N N   . LEU A 1 218 ? 1.260   61.197 38.274 1.00 38.85  ? 218  LEU A N   1 
ATOM   1659 C CA  . LEU A 1 218 ? 0.631   62.479 38.589 1.00 38.85  ? 218  LEU A CA  1 
ATOM   1660 C C   . LEU A 1 218 ? 1.479   63.645 39.080 1.00 38.85  ? 218  LEU A C   1 
ATOM   1661 O O   . LEU A 1 218 ? 0.928   64.644 39.547 1.00 38.85  ? 218  LEU A O   1 
ATOM   1662 C CB  . LEU A 1 218 ? -0.509  62.263 39.578 1.00 33.45  ? 218  LEU A CB  1 
ATOM   1663 C CG  . LEU A 1 218 ? -1.658  61.433 39.011 1.00 33.45  ? 218  LEU A CG  1 
ATOM   1664 C CD1 . LEU A 1 218 ? -2.792  61.329 40.022 1.00 33.45  ? 218  LEU A CD1 1 
ATOM   1665 C CD2 . LEU A 1 218 ? -2.132  62.071 37.721 1.00 33.45  ? 218  LEU A CD2 1 
ATOM   1666 N N   . PHE A 1 219 ? 2.801   63.528 39.000 1.00 23.44  ? 219  PHE A N   1 
ATOM   1667 C CA  . PHE A 1 219 ? 3.683   64.608 39.409 1.00 23.44  ? 219  PHE A CA  1 
ATOM   1668 C C   . PHE A 1 219 ? 5.016   64.423 38.725 1.00 23.44  ? 219  PHE A C   1 
ATOM   1669 O O   . PHE A 1 219 ? 5.283   63.365 38.176 1.00 23.44  ? 219  PHE A O   1 
ATOM   1670 C CB  . PHE A 1 219 ? 3.845   64.680 40.931 1.00 32.29  ? 219  PHE A CB  1 
ATOM   1671 C CG  . PHE A 1 219 ? 4.405   63.446 41.548 1.00 32.29  ? 219  PHE A CG  1 
ATOM   1672 C CD1 . PHE A 1 219 ? 3.580   62.371 41.858 1.00 32.29  ? 219  PHE A CD1 1 
ATOM   1673 C CD2 . PHE A 1 219 ? 5.762   63.350 41.817 1.00 32.29  ? 219  PHE A CD2 1 
ATOM   1674 C CE1 . PHE A 1 219 ? 4.097   61.216 42.427 1.00 32.29  ? 219  PHE A CE1 1 
ATOM   1675 C CE2 . PHE A 1 219 ? 6.294   62.201 42.387 1.00 32.29  ? 219  PHE A CE2 1 
ATOM   1676 C CZ  . PHE A 1 219 ? 5.460   61.129 42.693 1.00 32.29  ? 219  PHE A CZ  1 
ATOM   1677 N N   . ARG A 1 220 ? 5.840   65.464 38.760 1.00 32.55  ? 220  ARG A N   1 
ATOM   1678 C CA  . ARG A 1 220 ? 7.133   65.491 38.095 1.00 32.55  ? 220  ARG A CA  1 
ATOM   1679 C C   . ARG A 1 220 ? 8.338   65.317 39.027 1.00 32.55  ? 220  ARG A C   1 
ATOM   1680 O O   . ARG A 1 220 ? 9.179   64.444 38.812 1.00 32.55  ? 220  ARG A O   1 
ATOM   1681 C CB  . ARG A 1 220 ? 7.209   66.814 37.323 1.00 45.56  ? 220  ARG A CB  1 
ATOM   1682 C CG  . ARG A 1 220 ? 8.491   67.134 36.592 1.00 45.56  ? 220  ARG A CG  1 
ATOM   1683 C CD  . ARG A 1 220 ? 8.797   66.152 35.497 1.00 45.56  ? 220  ARG A CD  1 
ATOM   1684 N NE  . ARG A 1 220 ? 9.788   66.680 34.562 1.00 45.56  ? 220  ARG A NE  1 
ATOM   1685 C CZ  . ARG A 1 220 ? 9.508   67.554 33.597 1.00 45.56  ? 220  ARG A CZ  1 
ATOM   1686 N NH1 . ARG A 1 220 ? 8.263   68.004 33.432 1.00 45.56  ? 220  ARG A NH1 1 
ATOM   1687 N NH2 . ARG A 1 220 ? 10.473  67.975 32.791 1.00 45.56  ? 220  ARG A NH2 1 
ATOM   1688 N N   . ARG A 1 221 ? 8.426   66.147 40.060 1.00 33.20  ? 221  ARG A N   1 
ATOM   1689 C CA  . ARG A 1 221 ? 9.526   66.082 41.014 1.00 33.20  ? 221  ARG A CA  1 
ATOM   1690 C C   . ARG A 1 221 ? 8.962   65.966 42.411 1.00 33.20  ? 221  ARG A C   1 
ATOM   1691 O O   . ARG A 1 221 ? 7.760   66.147 42.615 1.00 33.20  ? 221  ARG A O   1 
ATOM   1692 C CB  . ARG A 1 221 ? 10.374  67.345 40.944 1.00 33.43  ? 221  ARG A CB  1 
ATOM   1693 C CG  . ARG A 1 221 ? 11.084  67.550 39.652 1.00 33.43  ? 221  ARG A CG  1 
ATOM   1694 C CD  . ARG A 1 221 ? 11.704  68.910 39.642 1.00 33.43  ? 221  ARG A CD  1 
ATOM   1695 N NE  . ARG A 1 221 ? 11.396  69.579 38.395 1.00 33.43  ? 221  ARG A NE  1 
ATOM   1696 C CZ  . ARG A 1 221 ? 11.830  69.160 37.218 1.00 33.43  ? 221  ARG A CZ  1 
ATOM   1697 N NH1 . ARG A 1 221 ? 12.597  68.086 37.143 1.00 33.43  ? 221  ARG A NH1 1 
ATOM   1698 N NH2 . ARG A 1 221 ? 11.469  69.788 36.114 1.00 33.43  ? 221  ARG A NH2 1 
ATOM   1699 N N   . ALA A 1 222 ? 9.837   65.695 43.376 1.00 28.12  ? 222  ALA A N   1 
ATOM   1700 C CA  . ALA A 1 222 ? 9.415   65.548 44.758 1.00 28.12  ? 222  ALA A CA  1 
ATOM   1701 C C   . ALA A 1 222 ? 10.405  66.113 45.755 1.00 28.12  ? 222  ALA A C   1 
ATOM   1702 O O   . ALA A 1 222 ? 11.612  66.023 45.564 1.00 28.12  ? 222  ALA A O   1 
ATOM   1703 C CB  . ALA A 1 222 ? 9.171   64.086 45.063 1.00 13.40  ? 222  ALA A CB  1 
ATOM   1704 N N   . ILE A 1 223 ? 9.863   66.705 46.819 1.00 30.43  ? 223  ILE A N   1 
ATOM   1705 C CA  . ILE A 1 223 ? 10.648  67.267 47.916 1.00 30.43  ? 223  ILE A CA  1 
ATOM   1706 C C   . ILE A 1 223 ? 10.141  66.620 49.212 1.00 30.43  ? 223  ILE A C   1 
ATOM   1707 O O   . ILE A 1 223 ? 8.958   66.708 49.526 1.00 30.43  ? 223  ILE A O   1 
ATOM   1708 C CB  . ILE A 1 223 ? 10.462  68.797 48.025 1.00 21.70  ? 223  ILE A CB  1 
ATOM   1709 C CG1 . ILE A 1 223 ? 10.867  69.466 46.722 1.00 21.70  ? 223  ILE A CG1 1 
ATOM   1710 C CG2 . ILE A 1 223 ? 11.310  69.353 49.149 1.00 21.70  ? 223  ILE A CG2 1 
ATOM   1711 C CD1 . ILE A 1 223 ? 10.712  70.952 46.746 1.00 21.70  ? 223  ILE A CD1 1 
ATOM   1712 N N   . LEU A 1 224 ? 11.023  65.954 49.951 1.00 39.56  ? 224  LEU A N   1 
ATOM   1713 C CA  . LEU A 1 224 ? 10.636  65.305 51.211 1.00 39.56  ? 224  LEU A CA  1 
ATOM   1714 C C   . LEU A 1 224 ? 11.380  65.931 52.378 1.00 39.56  ? 224  LEU A C   1 
ATOM   1715 O O   . LEU A 1 224 ? 12.605  65.995 52.369 1.00 39.56  ? 224  LEU A O   1 
ATOM   1716 C CB  . LEU A 1 224 ? 10.956  63.805 51.187 1.00 29.18  ? 224  LEU A CB  1 
ATOM   1717 C CG  . LEU A 1 224 ? 10.349  62.867 50.140 1.00 29.18  ? 224  LEU A CG  1 
ATOM   1718 C CD1 . LEU A 1 224 ? 11.012  63.056 48.787 1.00 29.18  ? 224  LEU A CD1 1 
ATOM   1719 C CD2 . LEU A 1 224 ? 10.541  61.442 50.618 1.00 29.18  ? 224  LEU A CD2 1 
ATOM   1720 N N   . GLN A 1 225 ? 10.653  66.373 53.394 1.00 29.98  ? 225  GLN A N   1 
ATOM   1721 C CA  . GLN A 1 225 ? 11.287  66.995 54.546 1.00 29.98  ? 225  GLN A CA  1 
ATOM   1722 C C   . GLN A 1 225 ? 11.080  66.198 55.828 1.00 29.98  ? 225  GLN A C   1 
ATOM   1723 O O   . GLN A 1 225 ? 9.961   65.898 56.214 1.00 29.98  ? 225  GLN A O   1 
ATOM   1724 C CB  . GLN A 1 225 ? 10.747  68.412 54.718 1.00 43.07  ? 225  GLN A CB  1 
ATOM   1725 C CG  . GLN A 1 225 ? 10.683  69.178 53.409 1.00 43.07  ? 225  GLN A CG  1 
ATOM   1726 C CD  . GLN A 1 225 ? 10.107  70.567 53.571 1.00 43.07  ? 225  GLN A CD  1 
ATOM   1727 O OE1 . GLN A 1 225 ? 9.633   71.175 52.605 1.00 43.07  ? 225  GLN A OE1 1 
ATOM   1728 N NE2 . GLN A 1 225 ? 10.153  71.084 54.794 1.00 43.07  ? 225  GLN A NE2 1 
ATOM   1729 N N   . SER A 1 226 ? 12.172  65.840 56.482 1.00 48.90  ? 226  SER A N   1 
ATOM   1730 C CA  . SER A 1 226 ? 12.096  65.106 57.735 1.00 48.90  ? 226  SER A CA  1 
ATOM   1731 C C   . SER A 1 226 ? 11.098  63.955 57.685 1.00 48.90  ? 226  SER A C   1 
ATOM   1732 O O   . SER A 1 226 ? 10.312  63.769 58.616 1.00 48.90  ? 226  SER A O   1 
ATOM   1733 C CB  . SER A 1 226 ? 11.718  66.064 58.876 1.00 57.79  ? 226  SER A CB  1 
ATOM   1734 O OG  . SER A 1 226 ? 12.643  67.140 58.989 1.00 57.79  ? 226  SER A OG  1 
ATOM   1735 N N   . GLY A 1 227 ? 11.125  63.180 56.607 1.00 46.04  ? 227  GLY A N   1 
ATOM   1736 C CA  . GLY A 1 227 ? 10.206  62.065 56.512 1.00 46.04  ? 227  GLY A CA  1 
ATOM   1737 C C   . GLY A 1 227 ? 10.396  61.241 55.259 1.00 46.04  ? 227  GLY A C   1 
ATOM   1738 O O   . GLY A 1 227 ? 10.553  61.791 54.175 1.00 46.04  ? 227  GLY A O   1 
ATOM   1739 N N   . SER A 1 228 ? 10.399  59.919 55.411 1.00 34.29  ? 228  SER A N   1 
ATOM   1740 C CA  . SER A 1 228 ? 10.544  59.011 54.285 1.00 34.29  ? 228  SER A CA  1 
ATOM   1741 C C   . SER A 1 228 ? 9.582   57.851 54.503 1.00 34.29  ? 228  SER A C   1 
ATOM   1742 O O   . SER A 1 228 ? 9.255   57.516 55.631 1.00 34.29  ? 228  SER A O   1 
ATOM   1743 C CB  . SER A 1 228 ? 11.982  58.508 54.171 1.00 43.89  ? 228  SER A CB  1 
ATOM   1744 O OG  . SER A 1 228 ? 12.322  57.662 55.242 1.00 43.89  ? 228  SER A OG  1 
ATOM   1745 N N   . PRO A 1 229 ? 9.130   57.211 53.418 1.00 36.78  ? 229  PRO A N   1 
ATOM   1746 C CA  . PRO A 1 229 ? 8.188   56.084 53.449 1.00 36.78  ? 229  PRO A CA  1 
ATOM   1747 C C   . PRO A 1 229 ? 8.568   54.892 54.302 1.00 36.78  ? 229  PRO A C   1 
ATOM   1748 O O   . PRO A 1 229 ? 7.703   54.244 54.887 1.00 36.78  ? 229  PRO A O   1 
ATOM   1749 C CB  . PRO A 1 229 ? 8.067   55.707 51.981 1.00 43.86  ? 229  PRO A CB  1 
ATOM   1750 C CG  . PRO A 1 229 ? 9.454   56.010 51.458 1.00 43.86  ? 229  PRO A CG  1 
ATOM   1751 C CD  . PRO A 1 229 ? 9.733   57.353 52.079 1.00 43.86  ? 229  PRO A CD  1 
ATOM   1752 N N   . ASN A 1 230 ? 9.863   54.607 54.371 1.00 36.43  ? 230  ASN A N   1 
ATOM   1753 C CA  . ASN A 1 230 ? 10.365  53.466 55.132 1.00 36.43  ? 230  ASN A CA  1 
ATOM   1754 C C   . ASN A 1 230 ? 10.650  53.748 56.605 1.00 36.43  ? 230  ASN A C   1 
ATOM   1755 O O   . ASN A 1 230 ? 11.482  53.090 57.218 1.00 36.43  ? 230  ASN A O   1 
ATOM   1756 C CB  . ASN A 1 230 ? 11.622  52.916 54.457 1.00 40.99  ? 230  ASN A CB  1 
ATOM   1757 C CG  . ASN A 1 230 ? 12.738  53.934 54.383 1.00 40.99  ? 230  ASN A CG  1 
ATOM   1758 O OD1 . ASN A 1 230 ? 12.528  55.076 53.972 1.00 40.99  ? 230  ASN A OD1 1 
ATOM   1759 N ND2 . ASN A 1 230 ? 13.940  53.526 54.774 1.00 40.99  ? 230  ASN A ND2 1 
ATOM   1760 N N   . CYS A 1 231 ? 9.956   54.722 57.178 1.00 37.73  ? 231  CYS A N   1 
ATOM   1761 C CA  . CYS A 1 231 ? 10.156  55.050 58.582 1.00 37.73  ? 231  CYS A CA  1 
ATOM   1762 C C   . CYS A 1 231 ? 9.416   54.016 59.422 1.00 37.73  ? 231  CYS A C   1 
ATOM   1763 O O   . CYS A 1 231 ? 8.331   53.593 59.058 1.00 37.73  ? 231  CYS A O   1 
ATOM   1764 C CB  . CYS A 1 231 ? 9.631   56.464 58.867 1.00 40.25  ? 231  CYS A CB  1 
ATOM   1765 S SG  . CYS A 1 231 ? 10.679  57.826 58.229 1.00 40.25  ? 231  CYS A SG  1 
ATOM   1766 N N   . PRO A 1 232 ? 9.986   53.605 60.564 1.00 29.46  ? 232  PRO A N   1 
ATOM   1767 C CA  . PRO A 1 232 ? 9.355   52.608 61.434 1.00 29.46  ? 232  PRO A CA  1 
ATOM   1768 C C   . PRO A 1 232 ? 7.947   52.936 61.925 1.00 29.46  ? 232  PRO A C   1 
ATOM   1769 O O   . PRO A 1 232 ? 7.251   52.062 62.438 1.00 29.46  ? 232  PRO A O   1 
ATOM   1770 C CB  . PRO A 1 232 ? 10.355  52.479 62.585 1.00 28.29  ? 232  PRO A CB  1 
ATOM   1771 C CG  . PRO A 1 232 ? 10.914  53.832 62.693 1.00 28.29  ? 232  PRO A CG  1 
ATOM   1772 C CD  . PRO A 1 232 ? 11.153  54.202 61.235 1.00 28.29  ? 232  PRO A CD  1 
ATOM   1773 N N   . TRP A 1 233 ? 7.526   54.186 61.757 1.00 27.51  ? 233  TRP A N   1 
ATOM   1774 C CA  . TRP A 1 233 ? 6.208   54.626 62.205 1.00 27.51  ? 233  TRP A CA  1 
ATOM   1775 C C   . TRP A 1 233 ? 5.230   54.882 61.067 1.00 27.51  ? 233  TRP A C   1 
ATOM   1776 O O   . TRP A 1 233 ? 4.031   54.958 61.293 1.00 27.51  ? 233  TRP A O   1 
ATOM   1777 C CB  . TRP A 1 233 ? 6.334   55.913 63.019 1.00 30.91  ? 233  TRP A CB  1 
ATOM   1778 C CG  . TRP A 1 233 ? 7.167   56.957 62.336 1.00 30.91  ? 233  TRP A CG  1 
ATOM   1779 C CD1 . TRP A 1 233 ? 8.496   57.167 62.504 1.00 30.91  ? 233  TRP A CD1 1 
ATOM   1780 C CD2 . TRP A 1 233 ? 6.742   57.887 61.335 1.00 30.91  ? 233  TRP A CD2 1 
ATOM   1781 N NE1 . TRP A 1 233 ? 8.934   58.165 61.674 1.00 30.91  ? 233  TRP A NE1 1 
ATOM   1782 C CE2 . TRP A 1 233 ? 7.877   58.626 60.943 1.00 30.91  ? 233  TRP A CE2 1 
ATOM   1783 C CE3 . TRP A 1 233 ? 5.515   58.168 60.729 1.00 30.91  ? 233  TRP A CE3 1 
ATOM   1784 C CZ2 . TRP A 1 233 ? 7.825   59.624 59.975 1.00 30.91  ? 233  TRP A CZ2 1 
ATOM   1785 C CZ3 . TRP A 1 233 ? 5.463   59.163 59.764 1.00 30.91  ? 233  TRP A CZ3 1 
ATOM   1786 C CH2 . TRP A 1 233 ? 6.612   59.879 59.398 1.00 30.91  ? 233  TRP A CH2 1 
ATOM   1787 N N   . ALA A 1 234 ? 5.745   55.012 59.853 1.00 22.05  ? 234  ALA A N   1 
ATOM   1788 C CA  . ALA A 1 234 ? 4.925   55.306 58.698 1.00 22.05  ? 234  ALA A CA  1 
ATOM   1789 C C   . ALA A 1 234 ? 4.065   54.187 58.161 1.00 22.05  ? 234  ALA A C   1 
ATOM   1790 O O   . ALA A 1 234 ? 3.205   54.441 57.335 1.00 22.05  ? 234  ALA A O   1 
ATOM   1791 C CB  . ALA A 1 234 ? 5.785   55.833 57.602 1.00 17.82  ? 234  ALA A CB  1 
ATOM   1792 N N   . SER A 1 235 ? 4.277   52.949 58.597 1.00 35.77  ? 235  SER A N   1 
ATOM   1793 C CA  . SER A 1 235 ? 3.444   51.862 58.081 1.00 35.77  ? 235  SER A CA  1 
ATOM   1794 C C   . SER A 1 235 ? 3.400   50.579 58.893 1.00 35.77  ? 235  SER A C   1 
ATOM   1795 O O   . SER A 1 235 ? 4.261   50.330 59.724 1.00 35.77  ? 235  SER A O   1 
ATOM   1796 C CB  . SER A 1 235 ? 3.836   51.528 56.638 1.00 36.83  ? 235  SER A CB  1 
ATOM   1797 O OG  . SER A 1 235 ? 5.146   51.010 56.552 1.00 36.83  ? 235  SER A OG  1 
ATOM   1798 N N   . VAL A 1 236 ? 2.374   49.774 58.632 1.00 31.97  ? 236  VAL A N   1 
ATOM   1799 C CA  . VAL A 1 236 ? 2.159   48.505 59.320 1.00 31.97  ? 236  VAL A CA  1 
ATOM   1800 C C   . VAL A 1 236 ? 1.728   47.396 58.359 1.00 31.97  ? 236  VAL A C   1 
ATOM   1801 O O   . VAL A 1 236 ? 1.393   47.641 57.203 1.00 31.97  ? 236  VAL A O   1 
ATOM   1802 C CB  . VAL A 1 236 ? 1.055   48.628 60.399 1.00 31.30  ? 236  VAL A CB  1 
ATOM   1803 C CG1 . VAL A 1 236 ? 1.435   49.668 61.422 1.00 31.30  ? 236  VAL A CG1 1 
ATOM   1804 C CG2 . VAL A 1 236 ? -0.271  48.986 59.750 1.00 31.30  ? 236  VAL A CG2 1 
ATOM   1805 N N   . SER A 1 237 ? 1.732   46.171 58.861 1.00 28.54  ? 237  SER A N   1 
ATOM   1806 C CA  . SER A 1 237 ? 1.338   45.009 58.081 1.00 28.54  ? 237  SER A CA  1 
ATOM   1807 C C   . SER A 1 237 ? -0.168  44.859 58.184 1.00 28.54  ? 237  SER A C   1 
ATOM   1808 O O   . SER A 1 237 ? -0.777  45.367 59.123 1.00 28.54  ? 237  SER A O   1 
ATOM   1809 C CB  . SER A 1 237 ? 1.997   43.766 58.653 1.00 34.25  ? 237  SER A CB  1 
ATOM   1810 O OG  . SER A 1 237 ? 1.548   43.553 59.983 1.00 34.25  ? 237  SER A OG  1 
ATOM   1811 N N   . VAL A 1 238 ? -0.777  44.153 57.240 1.00 31.03  ? 238  VAL A N   1 
ATOM   1812 C CA  . VAL A 1 238 ? -2.218  43.977 57.292 1.00 31.03  ? 238  VAL A CA  1 
ATOM   1813 C C   . VAL A 1 238 ? -2.587  43.289 58.588 1.00 31.03  ? 238  VAL A C   1 
ATOM   1814 O O   . VAL A 1 238 ? -3.612  43.602 59.197 1.00 31.03  ? 238  VAL A O   1 
ATOM   1815 C CB  . VAL A 1 238 ? -2.717  43.150 56.122 1.00 32.49  ? 238  VAL A CB  1 
ATOM   1816 C CG1 . VAL A 1 238 ? -2.341  43.831 54.827 1.00 32.49  ? 238  VAL A CG1 1 
ATOM   1817 C CG2 . VAL A 1 238 ? -2.116  41.788 56.174 1.00 32.49  ? 238  VAL A CG2 1 
ATOM   1818 N N   . ALA A 1 239 ? -1.740  42.362 59.020 1.00 32.21  ? 239  ALA A N   1 
ATOM   1819 C CA  . ALA A 1 239 ? -1.975  41.636 60.262 1.00 32.21  ? 239  ALA A CA  1 
ATOM   1820 C C   . ALA A 1 239 ? -2.069  42.597 61.438 1.00 32.21  ? 239  ALA A C   1 
ATOM   1821 O O   . ALA A 1 239 ? -2.990  42.502 62.240 1.00 32.21  ? 239  ALA A O   1 
ATOM   1822 C CB  . ALA A 1 239 ? -0.869  40.641 60.507 1.00 27.39  ? 239  ALA A CB  1 
ATOM   1823 N N   . GLU A 1 240 ? -1.116  43.522 61.548 1.00 37.90  ? 240  GLU A N   1 
ATOM   1824 C CA  . GLU A 1 240 ? -1.148  44.484 62.646 1.00 37.90  ? 240  GLU A CA  1 
ATOM   1825 C C   . GLU A 1 240 ? -2.284  45.489 62.460 1.00 37.90  ? 240  GLU A C   1 
ATOM   1826 O O   . GLU A 1 240 ? -2.898  45.933 63.432 1.00 37.90  ? 240  GLU A O   1 
ATOM   1827 C CB  . GLU A 1 240 ? 0.187   45.224 62.765 1.00 54.78  ? 240  GLU A CB  1 
ATOM   1828 C CG  . GLU A 1 240 ? 0.167   46.358 63.801 1.00 54.78  ? 240  GLU A CG  1 
ATOM   1829 C CD  . GLU A 1 240 ? -0.038  45.896 65.255 1.00 54.78  ? 240  GLU A CD  1 
ATOM   1830 O OE1 . GLU A 1 240 ? -0.907  45.042 65.527 1.00 54.78  ? 240  GLU A OE1 1 
ATOM   1831 O OE2 . GLU A 1 240 ? 0.668   46.412 66.143 1.00 54.78  ? 240  GLU A OE2 1 
ATOM   1832 N N   . GLY A 1 241 ? -2.562  45.849 61.212 1.00 34.65  ? 241  GLY A N   1 
ATOM   1833 C CA  . GLY A 1 241 ? -3.645  46.776 60.949 1.00 34.65  ? 241  GLY A CA  1 
ATOM   1834 C C   . GLY A 1 241 ? -4.948  46.136 61.382 1.00 34.65  ? 241  GLY A C   1 
ATOM   1835 O O   . GLY A 1 241 ? -5.822  46.772 61.966 1.00 34.65  ? 241  GLY A O   1 
ATOM   1836 N N   . ARG A 1 242 ? -5.079  44.850 61.098 1.00 42.01  ? 242  ARG A N   1 
ATOM   1837 C CA  . ARG A 1 242 ? -6.279  44.140 61.485 1.00 42.01  ? 242  ARG A CA  1 
ATOM   1838 C C   . ARG A 1 242 ? -6.388  44.062 63.023 1.00 42.01  ? 242  ARG A C   1 
ATOM   1839 O O   . ARG A 1 242 ? -7.461  44.251 63.594 1.00 42.01  ? 242  ARG A O   1 
ATOM   1840 C CB  . ARG A 1 242 ? -6.272  42.747 60.850 1.00 48.70  ? 242  ARG A CB  1 
ATOM   1841 C CG  . ARG A 1 242 ? -7.531  41.939 61.127 1.00 48.70  ? 242  ARG A CG  1 
ATOM   1842 C CD  . ARG A 1 242 ? -7.634  40.730 60.215 1.00 48.70  ? 242  ARG A CD  1 
ATOM   1843 N NE  . ARG A 1 242 ? -8.253  41.064 58.937 1.00 48.70  ? 242  ARG A NE  1 
ATOM   1844 C CZ  . ARG A 1 242 ? -9.546  41.354 58.788 1.00 48.70  ? 242  ARG A CZ  1 
ATOM   1845 N NH1 . ARG A 1 242 ? -10.365 41.351 59.839 1.00 48.70  ? 242  ARG A NH1 1 
ATOM   1846 N NH2 . ARG A 1 242 ? -10.023 41.640 57.582 1.00 48.70  ? 242  ARG A NH2 1 
ATOM   1847 N N   . ARG A 1 243 ? -5.266  43.809 63.685 1.00 29.90  ? 243  ARG A N   1 
ATOM   1848 C CA  . ARG A 1 243 ? -5.226  43.708 65.134 1.00 29.90  ? 243  ARG A CA  1 
ATOM   1849 C C   . ARG A 1 243 ? -5.733  44.977 65.818 1.00 29.90  ? 243  ARG A C   1 
ATOM   1850 O O   . ARG A 1 243 ? -6.535  44.901 66.749 1.00 29.90  ? 243  ARG A O   1 
ATOM   1851 C CB  . ARG A 1 243 ? -3.801  43.434 65.582 1.00 36.27  ? 243  ARG A CB  1 
ATOM   1852 C CG  . ARG A 1 243 ? -3.684  42.922 66.989 1.00 36.27  ? 243  ARG A CG  1 
ATOM   1853 C CD  . ARG A 1 243 ? -2.441  43.470 67.649 1.00 36.27  ? 243  ARG A CD  1 
ATOM   1854 N NE  . ARG A 1 243 ? -2.805  44.367 68.738 1.00 36.27  ? 243  ARG A NE  1 
ATOM   1855 C CZ  . ARG A 1 243 ? -2.386  45.622 68.858 1.00 36.27  ? 243  ARG A CZ  1 
ATOM   1856 N NH1 . ARG A 1 243 ? -1.572  46.156 67.949 1.00 36.27  ? 243  ARG A NH1 1 
ATOM   1857 N NH2 . ARG A 1 243 ? -2.787  46.342 69.898 1.00 36.27  ? 243  ARG A NH2 1 
ATOM   1858 N N   . ARG A 1 244 ? -5.259  46.136 65.356 1.00 26.32  ? 244  ARG A N   1 
ATOM   1859 C CA  . ARG A 1 244 ? -5.661  47.430 65.911 1.00 26.32  ? 244  ARG A CA  1 
ATOM   1860 C C   . ARG A 1 244 ? -7.078  47.836 65.525 1.00 26.32  ? 244  ARG A C   1 
ATOM   1861 O O   . ARG A 1 244 ? -7.727  48.591 66.246 1.00 26.32  ? 244  ARG A O   1 
ATOM   1862 C CB  . ARG A 1 244 ? -4.705  48.531 65.456 1.00 30.90  ? 244  ARG A CB  1 
ATOM   1863 C CG  . ARG A 1 244 ? -3.263  48.318 65.856 1.00 30.90  ? 244  ARG A CG  1 
ATOM   1864 C CD  . ARG A 1 244 ? -2.392  49.461 65.394 1.00 30.90  ? 244  ARG A CD  1 
ATOM   1865 N NE  . ARG A 1 244 ? -0.987  49.113 65.534 1.00 30.90  ? 244  ARG A NE  1 
ATOM   1866 C CZ  . ARG A 1 244 ? 0.024   49.912 65.225 1.00 30.90  ? 244  ARG A CZ  1 
ATOM   1867 N NH1 . ARG A 1 244 ? -0.191  51.130 64.753 1.00 30.90  ? 244  ARG A NH1 1 
ATOM   1868 N NH2 . ARG A 1 244 ? 1.258   49.484 65.393 1.00 30.90  ? 244  ARG A NH2 1 
ATOM   1869 N N   . ALA A 1 245 ? -7.548  47.360 64.374 1.00 32.08  ? 245  ALA A N   1 
ATOM   1870 C CA  . ALA A 1 245 ? -8.900  47.673 63.919 1.00 32.08  ? 245  ALA A CA  1 
ATOM   1871 C C   . ALA A 1 245 ? -9.868  47.041 64.906 1.00 32.08  ? 245  ALA A C   1 
ATOM   1872 O O   . ALA A 1 245 ? -10.837 47.658 65.346 1.00 32.08  ? 245  ALA A O   1 
ATOM   1873 C CB  . ALA A 1 245 ? -9.122  47.106 62.544 1.00 41.89  ? 245  ALA A CB  1 
ATOM   1874 N N   . VAL A 1 246 ? -9.579  45.793 65.253 1.00 44.69  ? 246  VAL A N   1 
ATOM   1875 C CA  . VAL A 1 246 ? -10.382 45.040 66.196 1.00 44.69  ? 246  VAL A CA  1 
ATOM   1876 C C   . VAL A 1 246 ? -10.331 45.630 67.602 1.00 44.69  ? 246  VAL A C   1 
ATOM   1877 O O   . VAL A 1 246 ? -11.370 45.868 68.218 1.00 44.69  ? 246  VAL A O   1 
ATOM   1878 C CB  . VAL A 1 246 ? -9.903  43.596 66.266 1.00 24.14  ? 246  VAL A CB  1 
ATOM   1879 C CG1 . VAL A 1 246 ? -10.579 42.882 67.426 1.00 24.14  ? 246  VAL A CG1 1 
ATOM   1880 C CG2 . VAL A 1 246 ? -10.182 42.908 64.946 1.00 24.14  ? 246  VAL A CG2 1 
ATOM   1881 N N   . GLU A 1 247 ? -9.120  45.851 68.106 1.00 31.63  ? 247  GLU A N   1 
ATOM   1882 C CA  . GLU A 1 247 ? -8.933  46.404 69.440 1.00 31.63  ? 247  GLU A CA  1 
ATOM   1883 C C   . GLU A 1 247 ? -9.673  47.722 69.568 1.00 31.63  ? 247  GLU A C   1 
ATOM   1884 O O   . GLU A 1 247 ? -10.243 48.015 70.613 1.00 31.63  ? 247  GLU A O   1 
ATOM   1885 C CB  . GLU A 1 247 ? -7.448  46.602 69.721 1.00 77.93  ? 247  GLU A CB  1 
ATOM   1886 C CG  . GLU A 1 247 ? -7.085  46.739 71.199 1.00 77.93  ? 247  GLU A CG  1 
ATOM   1887 C CD  . GLU A 1 247 ? -7.586  45.568 72.072 1.00 77.93  ? 247  GLU A CD  1 
ATOM   1888 O OE1 . GLU A 1 247 ? -7.712  44.431 71.546 1.00 77.93  ? 247  GLU A OE1 1 
ATOM   1889 O OE2 . GLU A 1 247 ? -7.838  45.792 73.288 1.00 77.93  ? 247  GLU A OE2 1 
ATOM   1890 N N   . LEU A 1 248 ? -9.669  48.521 68.508 1.00 32.87  ? 248  LEU A N   1 
ATOM   1891 C CA  . LEU A 1 248 ? -10.393 49.784 68.541 1.00 32.87  ? 248  LEU A CA  1 
ATOM   1892 C C   . LEU A 1 248 ? -11.850 49.433 68.787 1.00 32.87  ? 248  LEU A C   1 
ATOM   1893 O O   . LEU A 1 248 ? -12.519 50.050 69.612 1.00 32.87  ? 248  LEU A O   1 
ATOM   1894 C CB  . LEU A 1 248 ? -10.280 50.525 67.210 1.00 17.63  ? 248  LEU A CB  1 
ATOM   1895 C CG  . LEU A 1 248 ? -11.200 51.741 67.101 1.00 17.63  ? 248  LEU A CG  1 
ATOM   1896 C CD1 . LEU A 1 248 ? -10.717 52.796 68.044 1.00 17.63  ? 248  LEU A CD1 1 
ATOM   1897 C CD2 . LEU A 1 248 ? -11.225 52.284 65.693 1.00 17.63  ? 248  LEU A CD2 1 
ATOM   1898 N N   . GLY A 1 249 ? -12.330 48.423 68.062 1.00 41.69  ? 249  GLY A N   1 
ATOM   1899 C CA  . GLY A 1 249 ? -13.709 47.988 68.197 1.00 41.69  ? 249  GLY A CA  1 
ATOM   1900 C C   . GLY A 1 249 ? -14.015 47.477 69.588 1.00 41.69  ? 249  GLY A C   1 
ATOM   1901 O O   . GLY A 1 249 ? -15.127 47.636 70.091 1.00 41.69  ? 249  GLY A O   1 
ATOM   1902 N N   . ARG A 1 250 ? -13.019 46.869 70.216 1.00 43.94  ? 250  ARG A N   1 
ATOM   1903 C CA  . ARG A 1 250 ? -13.180 46.334 71.556 1.00 43.94  ? 250  ARG A CA  1 
ATOM   1904 C C   . ARG A 1 250 ? -13.319 47.433 72.631 1.00 43.94  ? 250  ARG A C   1 
ATOM   1905 O O   . ARG A 1 250 ? -13.954 47.217 73.664 1.00 43.94  ? 250  ARG A O   1 
ATOM   1906 C CB  . ARG A 1 250 ? -11.991 45.437 71.886 1.00 53.51  ? 250  ARG A CB  1 
ATOM   1907 C CG  . ARG A 1 250 ? -12.178 44.590 73.127 1.00 53.51  ? 250  ARG A CG  1 
ATOM   1908 C CD  . ARG A 1 250 ? -10.879 43.902 73.497 1.00 53.51  ? 250  ARG A CD  1 
ATOM   1909 N NE  . ARG A 1 250 ? -10.271 43.227 72.352 1.00 53.51  ? 250  ARG A NE  1 
ATOM   1910 C CZ  . ARG A 1 250 ? -10.797 42.177 71.728 1.00 53.51  ? 250  ARG A CZ  1 
ATOM   1911 N NH1 . ARG A 1 250 ? -11.958 41.668 72.132 1.00 53.51  ? 250  ARG A NH1 1 
ATOM   1912 N NH2 . ARG A 1 250 ? -10.155 41.628 70.702 1.00 53.51  ? 250  ARG A NH2 1 
ATOM   1913 N N   . ASN A 1 251 ? -12.724 48.602 72.389 1.00 51.14  ? 251  ASN A N   1 
ATOM   1914 C CA  . ASN A 1 251 ? -12.781 49.724 73.333 1.00 51.14  ? 251  ASN A CA  1 
ATOM   1915 C C   . ASN A 1 251 ? -14.133 50.446 73.292 1.00 51.14  ? 251  ASN A C   1 
ATOM   1916 O O   . ASN A 1 251 ? -14.531 51.121 74.247 1.00 51.14  ? 251  ASN A O   1 
ATOM   1917 C CB  . ASN A 1 251 ? -11.681 50.749 73.024 1.00 38.73  ? 251  ASN A CB  1 
ATOM   1918 C CG  . ASN A 1 251 ? -10.318 50.353 73.564 1.00 38.73  ? 251  ASN A CG  1 
ATOM   1919 O OD1 . ASN A 1 251 ? -9.708  51.110 74.322 1.00 38.73  ? 251  ASN A OD1 1 
ATOM   1920 N ND2 . ASN A 1 251 ? -9.823  49.180 73.162 1.00 38.73  ? 251  ASN A ND2 1 
ATOM   1921 N N   . LEU A 1 252 ? -14.825 50.335 72.167 1.00 51.89  ? 252  LEU A N   1 
ATOM   1922 C CA  . LEU A 1 252 ? -16.122 50.973 72.035 1.00 51.89  ? 252  LEU A CA  1 
ATOM   1923 C C   . LEU A 1 252 ? -17.212 49.918 72.157 1.00 51.89  ? 252  LEU A C   1 
ATOM   1924 O O   . LEU A 1 252 ? -18.358 50.148 71.785 1.00 51.89  ? 252  LEU A O   1 
ATOM   1925 C CB  . LEU A 1 252 ? -16.224 51.692 70.692 1.00 43.18  ? 252  LEU A CB  1 
ATOM   1926 C CG  . LEU A 1 252 ? -15.157 52.770 70.516 1.00 43.18  ? 252  LEU A CG  1 
ATOM   1927 C CD1 . LEU A 1 252 ? -15.358 53.455 69.179 1.00 43.18  ? 252  LEU A CD1 1 
ATOM   1928 C CD2 . LEU A 1 252 ? -15.232 53.780 71.661 1.00 43.18  ? 252  LEU A CD2 1 
ATOM   1929 N N   . ASN A 1 253 ? -16.841 48.754 72.676 1.00 51.51  ? 253  ASN A N   1 
ATOM   1930 C CA  . ASN A 1 253 ? -17.795 47.671 72.864 1.00 51.51  ? 253  ASN A CA  1 
ATOM   1931 C C   . ASN A 1 253 ? -18.557 47.379 71.580 1.00 51.51  ? 253  ASN A C   1 
ATOM   1932 O O   . ASN A 1 253 ? -19.767 47.587 71.510 1.00 51.51  ? 253  ASN A O   1 
ATOM   1933 C CB  . ASN A 1 253 ? -18.785 48.061 73.959 1.00 99.25  ? 253  ASN A CB  1 
ATOM   1934 C CG  . ASN A 1 253 ? -18.115 48.807 75.108 1.00 99.25  ? 253  ASN A CG  1 
ATOM   1935 O OD1 . ASN A 1 253 ? -17.220 48.270 75.788 1.00 99.25  ? 253  ASN A OD1 1 
ATOM   1936 N ND2 . ASN A 1 253 ? -18.540 50.058 75.329 1.00 99.25  ? 253  ASN A ND2 1 
ATOM   1937 N N   . CYS A 1 254 ? -17.859 46.902 70.562 1.00 44.28  ? 254  CYS A N   1 
ATOM   1938 C CA  . CYS A 1 254 ? -18.523 46.606 69.306 1.00 44.28  ? 254  CYS A CA  1 
ATOM   1939 C C   . CYS A 1 254 ? -18.590 45.107 69.102 1.00 44.28  ? 254  CYS A C   1 
ATOM   1940 O O   . CYS A 1 254 ? -17.772 44.359 69.642 1.00 44.28  ? 254  CYS A O   1 
ATOM   1941 C CB  . CYS A 1 254 ? -17.774 47.259 68.140 1.00 34.08  ? 254  CYS A CB  1 
ATOM   1942 N N   . ASN A 1 255 ? -19.574 44.667 68.326 1.00 52.08  ? 255  ASN A N   1 
ATOM   1943 C CA  . ASN A 1 255 ? -19.729 43.253 68.027 1.00 52.08  ? 255  ASN A CA  1 
ATOM   1944 C C   . ASN A 1 255 ? -18.522 42.882 67.165 1.00 52.08  ? 255  ASN A C   1 
ATOM   1945 O O   . ASN A 1 255 ? -18.272 43.516 66.135 1.00 52.08  ? 255  ASN A O   1 
ATOM   1946 C CB  . ASN A 1 255 ? -21.020 43.037 67.249 1.00 61.65  ? 255  ASN A CB  1 
ATOM   1947 C CG  . ASN A 1 255 ? -21.285 41.580 66.973 1.00 61.65  ? 255  ASN A CG  1 
ATOM   1948 O OD1 . ASN A 1 255 ? -20.368 40.819 66.625 1.00 61.65  ? 255  ASN A OD1 1 
ATOM   1949 N ND2 . ASN A 1 255 ? -22.545 41.174 67.107 1.00 61.65  ? 255  ASN A ND2 1 
ATOM   1950 N N   . LEU A 1 256 ? -17.779 41.858 67.569 1.00 49.60  ? 256  LEU A N   1 
ATOM   1951 C CA  . LEU A 1 256 ? -16.588 41.488 66.813 1.00 49.60  ? 256  LEU A CA  1 
ATOM   1952 C C   . LEU A 1 256 ? -16.653 40.154 66.069 1.00 49.60  ? 256  LEU A C   1 
ATOM   1953 O O   . LEU A 1 256 ? -15.614 39.526 65.831 1.00 49.60  ? 256  LEU A O   1 
ATOM   1954 C CB  . LEU A 1 256 ? -15.375 41.477 67.749 1.00 39.87  ? 256  LEU A CB  1 
ATOM   1955 C CG  . LEU A 1 256 ? -15.294 42.652 68.726 1.00 39.87  ? 256  LEU A CG  1 
ATOM   1956 C CD1 . LEU A 1 256 ? -14.039 42.517 69.574 1.00 39.87  ? 256  LEU A CD1 1 
ATOM   1957 C CD2 . LEU A 1 256 ? -15.289 43.972 67.962 1.00 39.87  ? 256  LEU A CD2 1 
ATOM   1958 N N   . ASN A 1 257 ? -17.849 39.724 65.682 1.00 57.84  ? 257  ASN A N   1 
ATOM   1959 C CA  . ASN A 1 257 ? -17.980 38.446 64.986 1.00 57.84  ? 257  ASN A CA  1 
ATOM   1960 C C   . ASN A 1 257 ? -17.511 38.463 63.536 1.00 57.84  ? 257  ASN A C   1 
ATOM   1961 O O   . ASN A 1 257 ? -17.181 37.419 62.978 1.00 57.84  ? 257  ASN A O   1 
ATOM   1962 C CB  . ASN A 1 257 ? -19.433 37.964 65.025 1.00 82.52  ? 257  ASN A CB  1 
ATOM   1963 C CG  . ASN A 1 257 ? -19.900 37.637 66.433 1.00 82.52  ? 257  ASN A CG  1 
ATOM   1964 O OD1 . ASN A 1 257 ? -19.187 36.969 67.193 1.00 82.52  ? 257  ASN A OD1 1 
ATOM   1965 N ND2 . ASN A 1 257 ? -21.104 38.098 66.790 1.00 82.52  ? 257  ASN A ND2 1 
ATOM   1966 N N   . SER A 1 258 ? -17.482 39.638 62.923 1.00 65.26  ? 258  SER A N   1 
ATOM   1967 C CA  . SER A 1 258 ? -17.074 39.735 61.525 1.00 65.26  ? 258  SER A CA  1 
ATOM   1968 C C   . SER A 1 258 ? -16.692 41.169 61.157 1.00 65.26  ? 258  SER A C   1 
ATOM   1969 O O   . SER A 1 258 ? -16.999 42.119 61.894 1.00 65.26  ? 258  SER A O   1 
ATOM   1970 C CB  . SER A 1 258 ? -18.221 39.270 60.626 1.00 52.07  ? 258  SER A CB  1 
ATOM   1971 O OG  . SER A 1 258 ? -19.403 40.021 60.884 1.00 52.07  ? 258  SER A OG  1 
ATOM   1972 N N   . ASP A 1 259 ? -16.035 41.338 60.013 1.00 49.19  ? 259  ASP A N   1 
ATOM   1973 C CA  . ASP A 1 259 ? -15.642 42.678 59.601 1.00 49.19  ? 259  ASP A CA  1 
ATOM   1974 C C   . ASP A 1 259 ? -16.856 43.591 59.447 1.00 49.19  ? 259  ASP A C   1 
ATOM   1975 O O   . ASP A 1 259 ? -16.860 44.712 59.959 1.00 49.19  ? 259  ASP A O   1 
ATOM   1976 C CB  . ASP A 1 259 ? -14.831 42.612 58.305 1.00 77.05  ? 259  ASP A CB  1 
ATOM   1977 C CG  . ASP A 1 259 ? -13.493 41.879 58.494 1.00 77.05  ? 259  ASP A CG  1 
ATOM   1978 O OD1 . ASP A 1 259 ? -13.205 41.458 59.644 1.00 77.05  ? 259  ASP A OD1 1 
ATOM   1979 O OD2 . ASP A 1 259 ? -12.730 41.723 57.503 1.00 77.05  ? 259  ASP A OD2 1 
ATOM   1980 N N   . GLU A 1 260 ? -17.891 43.096 58.772 1.00 49.12  ? 260  GLU A N   1 
ATOM   1981 C CA  . GLU A 1 260 ? -19.112 43.866 58.547 1.00 49.12  ? 260  GLU A CA  1 
ATOM   1982 C C   . GLU A 1 260 ? -19.697 44.225 59.894 1.00 49.12  ? 260  GLU A C   1 
ATOM   1983 O O   . GLU A 1 260 ? -20.183 45.334 60.123 1.00 49.12  ? 260  GLU A O   1 
ATOM   1984 C CB  . GLU A 1 260 ? -20.132 43.030 57.779 1.00 102.21 ? 260  GLU A CB  1 
ATOM   1985 C CG  . GLU A 1 260 ? -19.560 42.229 56.596 1.00 102.21 ? 260  GLU A CG  1 
ATOM   1986 C CD  . GLU A 1 260 ? -18.622 41.081 57.031 1.00 102.21 ? 260  GLU A CD  1 
ATOM   1987 O OE1 . GLU A 1 260 ? -18.919 40.392 58.045 1.00 102.21 ? 260  GLU A OE1 1 
ATOM   1988 O OE2 . GLU A 1 260 ? -17.592 40.859 56.343 1.00 102.21 ? 260  GLU A OE2 1 
ATOM   1989 N N   . GLU A 1 261 ? -19.653 43.247 60.781 1.00 57.60  ? 261  GLU A N   1 
ATOM   1990 C CA  . GLU A 1 261 ? -20.154 43.386 62.137 1.00 57.60  ? 261  GLU A CA  1 
ATOM   1991 C C   . GLU A 1 261 ? -19.449 44.570 62.827 1.00 57.60  ? 261  GLU A C   1 
ATOM   1992 O O   . GLU A 1 261 ? -20.095 45.451 63.406 1.00 57.60  ? 261  GLU A O   1 
ATOM   1993 C CB  . GLU A 1 261 ? -19.852 42.089 62.890 1.00 101.53 ? 261  GLU A CB  1 
ATOM   1994 C CG  . GLU A 1 261 ? -20.768 41.788 64.032 1.00 101.53 ? 261  GLU A CG  1 
ATOM   1995 C CD  . GLU A 1 261 ? -22.177 41.493 63.559 1.00 101.53 ? 261  GLU A CD  1 
ATOM   1996 O OE1 . GLU A 1 261 ? -22.321 40.664 62.614 1.00 101.53 ? 261  GLU A OE1 1 
ATOM   1997 O OE2 . GLU A 1 261 ? -23.131 42.086 64.135 1.00 101.53 ? 261  GLU A OE2 1 
ATOM   1998 N N   . LEU A 1 262 ? -18.118 44.564 62.755 1.00 38.77  ? 262  LEU A N   1 
ATOM   1999 C CA  . LEU A 1 262 ? -17.279 45.593 63.358 1.00 38.77  ? 262  LEU A CA  1 
ATOM   2000 C C   . LEU A 1 262 ? -17.419 46.951 62.680 1.00 38.77  ? 262  LEU A C   1 
ATOM   2001 O O   . LEU A 1 262 ? -17.725 47.942 63.325 1.00 38.77  ? 262  LEU A O   1 
ATOM   2002 C CB  . LEU A 1 262 ? -15.820 45.139 63.314 1.00 28.85  ? 262  LEU A CB  1 
ATOM   2003 C CG  . LEU A 1 262 ? -14.713 46.132 63.650 1.00 28.85  ? 262  LEU A CG  1 
ATOM   2004 C CD1 . LEU A 1 262 ? -14.846 46.595 65.062 1.00 28.85  ? 262  LEU A CD1 1 
ATOM   2005 C CD2 . LEU A 1 262 ? -13.377 45.462 63.447 1.00 28.85  ? 262  LEU A CD2 1 
ATOM   2006 N N   . ILE A 1 263 ? -17.190 46.992 61.375 1.00 39.77  ? 263  ILE A N   1 
ATOM   2007 C CA  . ILE A 1 263 ? -17.288 48.234 60.618 1.00 39.77  ? 263  ILE A CA  1 
ATOM   2008 C C   . ILE A 1 263 ? -18.595 48.979 60.873 1.00 39.77  ? 263  ILE A C   1 
ATOM   2009 O O   . ILE A 1 263 ? -18.592 50.188 61.089 1.00 39.77  ? 263  ILE A O   1 
ATOM   2010 C CB  . ILE A 1 263 ? -17.170 47.968 59.107 1.00 31.74  ? 263  ILE A CB  1 
ATOM   2011 C CG1 . ILE A 1 263 ? -15.852 47.255 58.813 1.00 31.74  ? 263  ILE A CG1 1 
ATOM   2012 C CG2 . ILE A 1 263 ? -17.254 49.277 58.343 1.00 31.74  ? 263  ILE A CG2 1 
ATOM   2013 C CD1 . ILE A 1 263 ? -15.779 46.677 57.428 1.00 31.74  ? 263  ILE A CD1 1 
ATOM   2014 N N   . HIS A 1 264 ? -19.712 48.261 60.840 1.00 45.86  ? 264  HIS A N   1 
ATOM   2015 C CA  . HIS A 1 264 ? -21.011 48.883 61.069 1.00 45.86  ? 264  HIS A CA  1 
ATOM   2016 C C   . HIS A 1 264 ? -21.064 49.560 62.439 1.00 45.86  ? 264  HIS A C   1 
ATOM   2017 O O   . HIS A 1 264 ? -21.523 50.696 62.557 1.00 45.86  ? 264  HIS A O   1 
ATOM   2018 C CB  . HIS A 1 264 ? -22.137 47.845 60.940 1.00 73.40  ? 264  HIS A CB  1 
ATOM   2019 C CG  . HIS A 1 264 ? -23.487 48.366 61.336 1.00 73.40  ? 264  HIS A CG  1 
ATOM   2020 N ND1 . HIS A 1 264 ? -23.830 48.637 62.647 1.00 73.40  ? 264  HIS A ND1 1 
ATOM   2021 C CD2 . HIS A 1 264 ? -24.560 48.725 60.588 1.00 73.40  ? 264  HIS A CD2 1 
ATOM   2022 C CE1 . HIS A 1 264 ? -25.049 49.147 62.689 1.00 73.40  ? 264  HIS A CE1 1 
ATOM   2023 N NE2 . HIS A 1 264 ? -25.514 49.211 61.453 1.00 73.40  ? 264  HIS A NE2 1 
ATOM   2024 N N   . CYS A 1 265 ? -20.592 48.879 63.476 1.00 47.50  ? 265  CYS A N   1 
ATOM   2025 C CA  . CYS A 1 265 ? -20.613 49.466 64.813 1.00 47.50  ? 265  CYS A CA  1 
ATOM   2026 C C   . CYS A 1 265 ? -19.808 50.761 64.812 1.00 47.50  ? 265  CYS A C   1 
ATOM   2027 O O   . CYS A 1 265 ? -20.229 51.761 65.383 1.00 47.50  ? 265  CYS A O   1 
ATOM   2028 C CB  . CYS A 1 265 ? -20.044 48.473 65.854 1.00 38.31  ? 265  CYS A CB  1 
ATOM   2029 N N   . LEU A 1 266 ? -18.655 50.741 64.153 1.00 41.85  ? 266  LEU A N   1 
ATOM   2030 C CA  . LEU A 1 266 ? -17.798 51.913 64.088 1.00 41.85  ? 266  LEU A CA  1 
ATOM   2031 C C   . LEU A 1 266 ? -18.427 53.057 63.288 1.00 41.85  ? 266  LEU A C   1 
ATOM   2032 O O   . LEU A 1 266 ? -18.267 54.225 63.638 1.00 41.85  ? 266  LEU A O   1 
ATOM   2033 C CB  . LEU A 1 266 ? -16.440 51.525 63.497 1.00 29.99  ? 266  LEU A CB  1 
ATOM   2034 C CG  . LEU A 1 266 ? -15.583 50.586 64.349 1.00 29.99  ? 266  LEU A CG  1 
ATOM   2035 C CD1 . LEU A 1 266 ? -14.477 50.003 63.502 1.00 29.99  ? 266  LEU A CD1 1 
ATOM   2036 C CD2 . LEU A 1 266 ? -15.009 51.334 65.530 1.00 29.99  ? 266  LEU A CD2 1 
ATOM   2037 N N   . ARG A 1 267 ? -19.146 52.733 62.221 1.00 42.86  ? 267  ARG A N   1 
ATOM   2038 C CA  . ARG A 1 267 ? -19.782 53.778 61.421 1.00 42.86  ? 267  ARG A CA  1 
ATOM   2039 C C   . ARG A 1 267 ? -20.917 54.480 62.160 1.00 42.86  ? 267  ARG A C   1 
ATOM   2040 O O   . ARG A 1 267 ? -21.327 55.575 61.779 1.00 42.86  ? 267  ARG A O   1 
ATOM   2041 C CB  . ARG A 1 267 ? -20.303 53.212 60.096 1.00 43.69  ? 267  ARG A CB  1 
ATOM   2042 C CG  . ARG A 1 267 ? -19.203 52.970 59.098 1.00 43.69  ? 267  ARG A CG  1 
ATOM   2043 C CD  . ARG A 1 267 ? -19.728 52.559 57.754 1.00 43.69  ? 267  ARG A CD  1 
ATOM   2044 N NE  . ARG A 1 267 ? -18.625 52.306 56.835 1.00 43.69  ? 267  ARG A NE  1 
ATOM   2045 C CZ  . ARG A 1 267 ? -18.767 51.769 55.628 1.00 43.69  ? 267  ARG A CZ  1 
ATOM   2046 N NH1 . ARG A 1 267 ? -19.976 51.431 55.190 1.00 43.69  ? 267  ARG A NH1 1 
ATOM   2047 N NH2 . ARG A 1 267 ? -17.700 51.553 54.866 1.00 43.69  ? 267  ARG A NH2 1 
ATOM   2048 N N   . GLU A 1 268 ? -21.419 53.863 63.223 1.00 47.80  ? 268  GLU A N   1 
ATOM   2049 C CA  . GLU A 1 268 ? -22.501 54.477 63.982 1.00 47.80  ? 268  GLU A CA  1 
ATOM   2050 C C   . GLU A 1 268 ? -22.036 55.306 65.173 1.00 47.80  ? 268  GLU A C   1 
ATOM   2051 O O   . GLU A 1 268 ? -22.858 55.871 65.900 1.00 47.80  ? 268  GLU A O   1 
ATOM   2052 C CB  . GLU A 1 268 ? -23.502 53.412 64.441 1.00 101.98 ? 268  GLU A CB  1 
ATOM   2053 C CG  . GLU A 1 268 ? -24.265 52.829 63.266 1.00 101.98 ? 268  GLU A CG  1 
ATOM   2054 C CD  . GLU A 1 268 ? -24.809 53.936 62.352 1.00 101.98 ? 268  GLU A CD  1 
ATOM   2055 O OE1 . GLU A 1 268 ? -25.762 54.640 62.790 1.00 101.98 ? 268  GLU A OE1 1 
ATOM   2056 O OE2 . GLU A 1 268 ? -24.273 54.112 61.213 1.00 101.98 ? 268  GLU A OE2 1 
ATOM   2057 N N   . LYS A 1 269 ? -20.724 55.388 65.363 1.00 40.41  ? 269  LYS A N   1 
ATOM   2058 C CA  . LYS A 1 269 ? -20.177 56.154 66.464 1.00 40.41  ? 269  LYS A CA  1 
ATOM   2059 C C   . LYS A 1 269 ? -19.870 57.578 66.043 1.00 40.41  ? 269  LYS A C   1 
ATOM   2060 O O   . LYS A 1 269 ? -19.526 57.831 64.886 1.00 40.41  ? 269  LYS A O   1 
ATOM   2061 C CB  . LYS A 1 269 ? -18.912 55.486 66.989 1.00 52.48  ? 269  LYS A CB  1 
ATOM   2062 C CG  . LYS A 1 269 ? -19.177 54.154 67.664 1.00 52.48  ? 269  LYS A CG  1 
ATOM   2063 C CD  . LYS A 1 269 ? -20.188 54.327 68.790 1.00 52.48  ? 269  LYS A CD  1 
ATOM   2064 C CE  . LYS A 1 269 ? -20.505 53.006 69.461 1.00 52.48  ? 269  LYS A CE  1 
ATOM   2065 N NZ  . LYS A 1 269 ? -19.274 52.415 70.062 1.00 52.48  ? 269  LYS A NZ  1 
ATOM   2066 N N   . LYS A 1 270 ? -20.018 58.511 66.981 1.00 45.85  ? 270  LYS A N   1 
ATOM   2067 C CA  . LYS A 1 270 ? -19.729 59.918 66.716 1.00 45.85  ? 270  LYS A CA  1 
ATOM   2068 C C   . LYS A 1 270 ? -18.217 60.016 66.551 1.00 45.85  ? 270  LYS A C   1 
ATOM   2069 O O   . LYS A 1 270 ? -17.472 59.280 67.195 1.00 45.85  ? 270  LYS A O   1 
ATOM   2070 C CB  . LYS A 1 270 ? -20.162 60.800 67.892 1.00 79.35  ? 270  LYS A CB  1 
ATOM   2071 C CG  . LYS A 1 270 ? -21.656 60.885 68.162 1.00 79.35  ? 270  LYS A CG  1 
ATOM   2072 C CD  . LYS A 1 270 ? -21.900 61.654 69.485 1.00 79.35  ? 270  LYS A CD  1 
ATOM   2073 C CE  . LYS A 1 270 ? -23.388 61.892 69.776 1.00 79.35  ? 270  LYS A CE  1 
ATOM   2074 N NZ  . LYS A 1 270 ? -24.161 60.613 69.859 1.00 79.35  ? 270  LYS A NZ  1 
ATOM   2075 N N   . PRO A 1 271 ? -17.744 60.943 65.715 1.00 31.56  ? 271  PRO A N   1 
ATOM   2076 C CA  . PRO A 1 271 ? -16.309 61.122 65.473 1.00 31.56  ? 271  PRO A CA  1 
ATOM   2077 C C   . PRO A 1 271 ? -15.417 61.183 66.716 1.00 31.56  ? 271  PRO A C   1 
ATOM   2078 O O   . PRO A 1 271 ? -14.370 60.551 66.764 1.00 31.56  ? 271  PRO A O   1 
ATOM   2079 C CB  . PRO A 1 271 ? -16.251 62.425 64.677 1.00 50.05  ? 271  PRO A CB  1 
ATOM   2080 C CG  . PRO A 1 271 ? -17.574 62.450 63.971 1.00 50.05  ? 271  PRO A CG  1 
ATOM   2081 C CD  . PRO A 1 271 ? -18.518 62.002 65.051 1.00 50.05  ? 271  PRO A CD  1 
ATOM   2082 N N   . GLN A 1 272 ? -15.835 61.938 67.723 1.00 36.02  ? 272  GLN A N   1 
ATOM   2083 C CA  . GLN A 1 272 ? -15.023 62.098 68.926 1.00 36.02  ? 272  GLN A CA  1 
ATOM   2084 C C   . GLN A 1 272 ? -14.926 60.868 69.818 1.00 36.02  ? 272  GLN A C   1 
ATOM   2085 O O   . GLN A 1 272 ? -14.162 60.852 70.778 1.00 36.02  ? 272  GLN A O   1 
ATOM   2086 C CB  . GLN A 1 272 ? -15.541 63.283 69.747 1.00 49.03  ? 272  GLN A CB  1 
ATOM   2087 C CG  . GLN A 1 272 ? -14.597 63.747 70.854 1.00 49.03  ? 272  GLN A CG  1 
ATOM   2088 C CD  . GLN A 1 272 ? -13.194 64.009 70.343 1.00 49.03  ? 272  GLN A CD  1 
ATOM   2089 O OE1 . GLN A 1 272 ? -12.997 64.710 69.339 1.00 49.03  ? 272  GLN A OE1 1 
ATOM   2090 N NE2 . GLN A 1 272 ? -12.205 63.448 71.032 1.00 49.03  ? 272  GLN A NE2 1 
ATOM   2091 N N   . GLU A 1 273 ? -15.686 59.831 69.494 1.00 50.23  ? 273  GLU A N   1 
ATOM   2092 C CA  . GLU A 1 273 ? -15.675 58.614 70.298 1.00 50.23  ? 273  GLU A CA  1 
ATOM   2093 C C   . GLU A 1 273 ? -14.578 57.659 69.850 1.00 50.23  ? 273  GLU A C   1 
ATOM   2094 O O   . GLU A 1 273 ? -14.037 56.908 70.663 1.00 50.23  ? 273  GLU A O   1 
ATOM   2095 C CB  . GLU A 1 273 ? -17.041 57.933 70.217 1.00 85.91  ? 273  GLU A CB  1 
ATOM   2096 C CG  . GLU A 1 273 ? -18.193 58.920 70.352 1.00 85.91  ? 273  GLU A CG  1 
ATOM   2097 C CD  . GLU A 1 273 ? -19.542 58.241 70.452 1.00 85.91  ? 273  GLU A CD  1 
ATOM   2098 O OE1 . GLU A 1 273 ? -19.753 57.502 71.446 1.00 85.91  ? 273  GLU A OE1 1 
ATOM   2099 O OE2 . GLU A 1 273 ? -20.383 58.446 69.542 1.00 85.91  ? 273  GLU A OE2 1 
ATOM   2100 N N   . LEU A 1 274 ? -14.268 57.677 68.555 1.00 46.59  ? 274  LEU A N   1 
ATOM   2101 C CA  . LEU A 1 274 ? -13.212 56.830 68.026 1.00 46.59  ? 274  LEU A CA  1 
ATOM   2102 C C   . LEU A 1 274 ? -11.895 57.474 68.413 1.00 46.59  ? 274  LEU A C   1 
ATOM   2103 O O   . LEU A 1 274 ? -10.903 56.794 68.647 1.00 46.59  ? 274  LEU A O   1 
ATOM   2104 C CB  . LEU A 1 274 ? -13.309 56.715 66.506 1.00 37.90  ? 274  LEU A CB  1 
ATOM   2105 C CG  . LEU A 1 274 ? -14.208 55.604 65.954 1.00 37.90  ? 274  LEU A CG  1 
ATOM   2106 C CD1 . LEU A 1 274 ? -15.592 55.707 66.555 1.00 37.90  ? 274  LEU A CD1 1 
ATOM   2107 C CD2 . LEU A 1 274 ? -14.291 55.711 64.448 1.00 37.90  ? 274  LEU A CD2 1 
ATOM   2108 N N   . ILE A 1 275 ? -11.900 58.796 68.496 1.00 49.05  ? 275  ILE A N   1 
ATOM   2109 C CA  . ILE A 1 275 ? -10.709 59.551 68.859 1.00 49.05  ? 275  ILE A CA  1 
ATOM   2110 C C   . ILE A 1 275 ? -10.376 59.415 70.346 1.00 49.05  ? 275  ILE A C   1 
ATOM   2111 O O   . ILE A 1 275 ? -9.210  59.339 70.727 1.00 49.05  ? 275  ILE A O   1 
ATOM   2112 C CB  . ILE A 1 275 ? -10.891 61.050 68.511 1.00 37.85  ? 275  ILE A CB  1 
ATOM   2113 C CG1 . ILE A 1 275 ? -11.067 61.207 66.997 1.00 37.85  ? 275  ILE A CG1 1 
ATOM   2114 C CG2 . ILE A 1 275 ? -9.715  61.860 69.026 1.00 37.85  ? 275  ILE A CG2 1 
ATOM   2115 C CD1 . ILE A 1 275 ? -11.238 62.639 66.539 1.00 37.85  ? 275  ILE A CD1 1 
ATOM   2116 N N   . ASP A 1 276 ? -11.393 59.378 71.193 1.00 44.49  ? 276  ASP A N   1 
ATOM   2117 C CA  . ASP A 1 276 ? -11.146 59.261 72.622 1.00 44.49  ? 276  ASP A CA  1 
ATOM   2118 C C   . ASP A 1 276 ? -10.394 57.990 72.996 1.00 44.49  ? 276  ASP A C   1 
ATOM   2119 O O   . ASP A 1 276 ? -9.675  57.970 73.991 1.00 44.49  ? 276  ASP A O   1 
ATOM   2120 C CB  . ASP A 1 276 ? -12.460 59.301 73.418 1.00 77.23  ? 276  ASP A CB  1 
ATOM   2121 C CG  . ASP A 1 276 ? -13.137 60.672 73.387 1.00 77.23  ? 276  ASP A CG  1 
ATOM   2122 O OD1 . ASP A 1 276 ? -12.427 61.698 73.514 1.00 77.23  ? 276  ASP A OD1 1 
ATOM   2123 O OD2 . ASP A 1 276 ? -14.384 60.724 73.256 1.00 77.23  ? 276  ASP A OD2 1 
ATOM   2124 N N   . VAL A 1 277 ? -10.551 56.931 72.207 1.00 38.79  ? 277  VAL A N   1 
ATOM   2125 C CA  . VAL A 1 277 ? -9.895  55.665 72.528 1.00 38.79  ? 277  VAL A CA  1 
ATOM   2126 C C   . VAL A 1 277 ? -8.784  55.247 71.566 1.00 38.79  ? 277  VAL A C   1 
ATOM   2127 O O   . VAL A 1 277 ? -8.098  54.255 71.785 1.00 38.79  ? 277  VAL A O   1 
ATOM   2128 C CB  . VAL A 1 277 ? -10.945 54.539 72.643 1.00 29.98  ? 277  VAL A CB  1 
ATOM   2129 C CG1 . VAL A 1 277 ? -11.752 54.716 73.925 1.00 29.98  ? 277  VAL A CG1 1 
ATOM   2130 C CG2 . VAL A 1 277 ? -11.870 54.574 71.440 1.00 29.98  ? 277  VAL A CG2 1 
ATOM   2131 N N   . GLU A 1 278 ? -8.608  56.032 70.515 1.00 41.92  ? 278  GLU A N   1 
ATOM   2132 C CA  . GLU A 1 278 ? -7.592  55.811 69.491 1.00 41.92  ? 278  GLU A CA  1 
ATOM   2133 C C   . GLU A 1 278 ? -6.206  55.352 69.988 1.00 41.92  ? 278  GLU A C   1 
ATOM   2134 O O   . GLU A 1 278 ? -5.663  54.358 69.507 1.00 41.92  ? 278  GLU A O   1 
ATOM   2135 C CB  . GLU A 1 278 ? -7.433  57.105 68.695 1.00 78.66  ? 278  GLU A CB  1 
ATOM   2136 C CG  . GLU A 1 278 ? -6.386  57.060 67.607 1.00 78.66  ? 278  GLU A CG  1 
ATOM   2137 C CD  . GLU A 1 278 ? -6.155  58.422 66.954 1.00 78.66  ? 278  GLU A CD  1 
ATOM   2138 O OE1 . GLU A 1 278 ? -7.084  58.956 66.291 1.00 78.66  ? 278  GLU A OE1 1 
ATOM   2139 O OE2 . GLU A 1 278 ? -5.030  58.954 67.113 1.00 78.66  ? 278  GLU A OE2 1 
ATOM   2140 N N   . TRP A 1 279 ? -5.634  56.075 70.943 1.00 43.24  ? 279  TRP A N   1 
ATOM   2141 C CA  . TRP A 1 279 ? -4.308  55.745 71.451 1.00 43.24  ? 279  TRP A CA  1 
ATOM   2142 C C   . TRP A 1 279 ? -4.169  54.477 72.264 1.00 43.24  ? 279  TRP A C   1 
ATOM   2143 O O   . TRP A 1 279 ? -3.060  54.118 72.646 1.00 43.24  ? 279  TRP A O   1 
ATOM   2144 C CB  . TRP A 1 279 ? -3.753  56.906 72.275 1.00 47.10  ? 279  TRP A CB  1 
ATOM   2145 C CG  . TRP A 1 279 ? -3.520  58.115 71.465 1.00 47.10  ? 279  TRP A CG  1 
ATOM   2146 C CD1 . TRP A 1 279 ? -4.393  59.135 71.250 1.00 47.10  ? 279  TRP A CD1 1 
ATOM   2147 C CD2 . TRP A 1 279 ? -2.368  58.397 70.679 1.00 47.10  ? 279  TRP A CD2 1 
ATOM   2148 N NE1 . TRP A 1 279 ? -3.858  60.040 70.373 1.00 47.10  ? 279  TRP A NE1 1 
ATOM   2149 C CE2 . TRP A 1 279 ? -2.612  59.611 70.004 1.00 47.10  ? 279  TRP A CE2 1 
ATOM   2150 C CE3 . TRP A 1 279 ? -1.147  57.738 70.473 1.00 47.10  ? 279  TRP A CE3 1 
ATOM   2151 C CZ2 . TRP A 1 279 ? -1.675  60.189 69.130 1.00 47.10  ? 279  TRP A CZ2 1 
ATOM   2152 C CZ3 . TRP A 1 279 ? -0.210  58.305 69.604 1.00 47.10  ? 279  TRP A CZ3 1 
ATOM   2153 C CH2 . TRP A 1 279 ? -0.483  59.522 68.944 1.00 47.10  ? 279  TRP A CH2 1 
ATOM   2154 N N   . ASN A 1 280 ? -5.275  53.795 72.531 1.00 35.33  ? 280  ASN A N   1 
ATOM   2155 C CA  . ASN A 1 280 ? -5.218  52.574 73.321 1.00 35.33  ? 280  ASN A CA  1 
ATOM   2156 C C   . ASN A 1 280 ? -4.875  51.334 72.525 1.00 35.33  ? 280  ASN A C   1 
ATOM   2157 O O   . ASN A 1 280 ? -4.653  50.281 73.095 1.00 35.33  ? 280  ASN A O   1 
ATOM   2158 C CB  . ASN A 1 280 ? -6.547  52.331 74.023 1.00 39.99  ? 280  ASN A CB  1 
ATOM   2159 C CG  . ASN A 1 280 ? -6.961  53.485 74.884 1.00 39.99  ? 280  ASN A CG  1 
ATOM   2160 O OD1 . ASN A 1 280 ? -6.154  54.369 75.183 1.00 39.99  ? 280  ASN A OD1 1 
ATOM   2161 N ND2 . ASN A 1 280 ? -8.218  53.490 75.300 1.00 39.99  ? 280  ASN A ND2 1 
ATOM   2162 N N   . VAL A 1 281 ? -4.818  51.443 71.212 1.00 29.53  ? 281  VAL A N   1 
ATOM   2163 C CA  . VAL A 1 281 ? -4.540  50.262 70.423 1.00 29.53  ? 281  VAL A CA  1 
ATOM   2164 C C   . VAL A 1 281 ? -3.071  49.988 70.160 1.00 29.53  ? 281  VAL A C   1 
ATOM   2165 O O   . VAL A 1 281 ? -2.728  48.931 69.654 1.00 29.53  ? 281  VAL A O   1 
ATOM   2166 C CB  . VAL A 1 281 ? -5.306  50.313 69.083 1.00 34.37  ? 281  VAL A CB  1 
ATOM   2167 C CG1 . VAL A 1 281 ? -6.800  50.462 69.348 1.00 34.37  ? 281  VAL A CG1 1 
ATOM   2168 C CG2 . VAL A 1 281 ? -4.797  51.460 68.231 1.00 34.37  ? 281  VAL A CG2 1 
ATOM   2169 N N   . LEU A 1 282 ? -2.195  50.925 70.499 1.00 36.05  ? 282  LEU A N   1 
ATOM   2170 C CA  . LEU A 1 282 ? -0.768  50.700 70.282 1.00 36.05  ? 282  LEU A CA  1 
ATOM   2171 C C   . LEU A 1 282 ? -0.316  49.440 71.000 1.00 36.05  ? 282  LEU A C   1 
ATOM   2172 O O   . LEU A 1 282 ? -0.688  49.194 72.145 1.00 36.05  ? 282  LEU A O   1 
ATOM   2173 C CB  . LEU A 1 282 ? 0.058   51.880 70.774 1.00 30.99  ? 282  LEU A CB  1 
ATOM   2174 C CG  . LEU A 1 282 ? -0.031  53.142 69.928 1.00 30.99  ? 282  LEU A CG  1 
ATOM   2175 C CD1 . LEU A 1 282 ? 0.777   54.235 70.583 1.00 30.99  ? 282  LEU A CD1 1 
ATOM   2176 C CD2 . LEU A 1 282 ? 0.495   52.865 68.532 1.00 30.99  ? 282  LEU A CD2 1 
ATOM   2177 N N   . PRO A 1 283 ? 0.503   48.623 70.328 1.00 41.39  ? 283  PRO A N   1 
ATOM   2178 C CA  . PRO A 1 283 ? 1.011   47.371 70.891 1.00 41.39  ? 283  PRO A CA  1 
ATOM   2179 C C   . PRO A 1 283 ? 2.061   47.504 71.992 1.00 41.39  ? 283  PRO A C   1 
ATOM   2180 O O   . PRO A 1 283 ? 2.250   46.581 72.782 1.00 41.39  ? 283  PRO A O   1 
ATOM   2181 C CB  . PRO A 1 283 ? 1.546   46.646 69.662 1.00 44.35  ? 283  PRO A CB  1 
ATOM   2182 C CG  . PRO A 1 283 ? 2.069   47.767 68.841 1.00 44.35  ? 283  PRO A CG  1 
ATOM   2183 C CD  . PRO A 1 283 ? 0.964   48.795 68.937 1.00 44.35  ? 283  PRO A CD  1 
ATOM   2184 N N   . PHE A 1 284 ? 2.742   48.641 72.053 1.00 41.18  ? 284  PHE A N   1 
ATOM   2185 C CA  . PHE A 1 284 ? 3.771   48.824 73.062 1.00 41.18  ? 284  PHE A CA  1 
ATOM   2186 C C   . PHE A 1 284 ? 3.724   50.182 73.717 1.00 41.18  ? 284  PHE A C   1 
ATOM   2187 O O   . PHE A 1 284 ? 3.098   51.113 73.219 1.00 41.18  ? 284  PHE A O   1 
ATOM   2188 C CB  . PHE A 1 284 ? 5.154   48.683 72.452 1.00 40.65  ? 284  PHE A CB  1 
ATOM   2189 C CG  . PHE A 1 284 ? 5.371   47.408 71.701 1.00 40.65  ? 284  PHE A CG  1 
ATOM   2190 C CD1 . PHE A 1 284 ? 5.434   46.193 72.368 1.00 40.65  ? 284  PHE A CD1 1 
ATOM   2191 C CD2 . PHE A 1 284 ? 5.580   47.433 70.320 1.00 40.65  ? 284  PHE A CD2 1 
ATOM   2192 C CE1 . PHE A 1 284 ? 5.711   45.016 71.670 1.00 40.65  ? 284  PHE A CE1 1 
ATOM   2193 C CE2 . PHE A 1 284 ? 5.857   46.269 69.616 1.00 40.65  ? 284  PHE A CE2 1 
ATOM   2194 C CZ  . PHE A 1 284 ? 5.925   45.054 70.292 1.00 40.65  ? 284  PHE A CZ  1 
ATOM   2195 N N   . ASP A 1 285 ? 4.402   50.274 74.854 1.00 38.42  ? 285  ASP A N   1 
ATOM   2196 C CA  . ASP A 1 285 ? 4.528   51.518 75.591 1.00 38.42  ? 285  ASP A CA  1 
ATOM   2197 C C   . ASP A 1 285 ? 5.563   52.150 74.669 1.00 38.42  ? 285  ASP A C   1 
ATOM   2198 O O   . ASP A 1 285 ? 6.695   51.682 74.591 1.00 38.42  ? 285  ASP A O   1 
ATOM   2199 C CB  . ASP A 1 285 ? 5.105   51.208 76.972 1.00 80.82  ? 285  ASP A CB  1 
ATOM   2200 C CG  . ASP A 1 285 ? 5.353   52.453 77.809 1.00 80.82  ? 285  ASP A CG  1 
ATOM   2201 O OD1 . ASP A 1 285 ? 5.334   53.570 77.224 1.00 80.82  ? 285  ASP A OD1 1 
ATOM   2202 O OD2 . ASP A 1 285 ? 5.582   52.306 79.047 1.00 80.82  ? 285  ASP A OD2 1 
ATOM   2203 N N   . SER A 1 286 ? 5.193   53.196 73.950 1.00 46.56  ? 286  SER A N   1 
ATOM   2204 C CA  . SER A 1 286 ? 6.135   53.746 72.992 1.00 46.56  ? 286  SER A CA  1 
ATOM   2205 C C   . SER A 1 286 ? 6.147   55.250 72.771 1.00 46.56  ? 286  SER A C   1 
ATOM   2206 O O   . SER A 1 286 ? 5.249   55.968 73.194 1.00 46.56  ? 286  SER A O   1 
ATOM   2207 C CB  . SER A 1 286 ? 5.902   53.058 71.656 1.00 46.88  ? 286  SER A CB  1 
ATOM   2208 O OG  . SER A 1 286 ? 4.513   53.078 71.339 1.00 46.88  ? 286  SER A OG  1 
ATOM   2209 N N   . ILE A 1 287 ? 7.180   55.708 72.075 1.00 34.85  ? 287  ILE A N   1 
ATOM   2210 C CA  . ILE A 1 287 ? 7.358   57.115 71.762 1.00 34.85  ? 287  ILE A CA  1 
ATOM   2211 C C   . ILE A 1 287 ? 7.538   57.169 70.246 1.00 34.85  ? 287  ILE A C   1 
ATOM   2212 O O   . ILE A 1 287 ? 8.186   56.304 69.665 1.00 34.85  ? 287  ILE A O   1 
ATOM   2213 C CB  . ILE A 1 287 ? 8.609   57.672 72.501 1.00 32.38  ? 287  ILE A CB  1 
ATOM   2214 C CG1 . ILE A 1 287 ? 8.743   59.166 72.289 1.00 32.38  ? 287  ILE A CG1 1 
ATOM   2215 C CG2 . ILE A 1 287 ? 9.863   57.027 71.978 1.00 32.38  ? 287  ILE A CG2 1 
ATOM   2216 C CD1 . ILE A 1 287 ? 10.000  59.732 72.916 1.00 32.38  ? 287  ILE A CD1 1 
ATOM   2217 N N   . PHE A 1 288 ? 6.925   58.153 69.606 1.00 31.54  ? 288  PHE A N   1 
ATOM   2218 C CA  . PHE A 1 288 ? 7.023   58.317 68.162 1.00 31.54  ? 288  PHE A CA  1 
ATOM   2219 C C   . PHE A 1 288 ? 6.363   57.180 67.366 1.00 31.54  ? 288  PHE A C   1 
ATOM   2220 O O   . PHE A 1 288 ? 6.904   56.713 66.362 1.00 31.54  ? 288  PHE A O   1 
ATOM   2221 C CB  . PHE A 1 288 ? 8.488   58.447 67.753 1.00 26.82  ? 288  PHE A CB  1 
ATOM   2222 C CG  . PHE A 1 288 ? 8.718   59.371 66.596 1.00 26.82  ? 288  PHE A CG  1 
ATOM   2223 C CD1 . PHE A 1 288 ? 7.966   59.261 65.437 1.00 26.82  ? 288  PHE A CD1 1 
ATOM   2224 C CD2 . PHE A 1 288 ? 9.705   60.341 66.659 1.00 26.82  ? 288  PHE A CD2 1 
ATOM   2225 C CE1 . PHE A 1 288 ? 8.193   60.099 64.360 1.00 26.82  ? 288  PHE A CE1 1 
ATOM   2226 C CE2 . PHE A 1 288 ? 9.939   61.180 65.589 1.00 26.82  ? 288  PHE A CE2 1 
ATOM   2227 C CZ  . PHE A 1 288 ? 9.183   61.059 64.437 1.00 26.82  ? 288  PHE A CZ  1 
ATOM   2228 N N   . ARG A 1 289 ? 5.195   56.738 67.820 1.00 34.94  ? 289  ARG A N   1 
ATOM   2229 C CA  . ARG A 1 289 ? 4.449   55.684 67.149 1.00 34.94  ? 289  ARG A CA  1 
ATOM   2230 C C   . ARG A 1 289 ? 2.994   56.114 67.175 1.00 34.94  ? 289  ARG A C   1 
ATOM   2231 O O   . ARG A 1 289 ? 2.536   56.703 68.151 1.00 34.94  ? 289  ARG A O   1 
ATOM   2232 C CB  . ARG A 1 289 ? 4.624   54.343 67.863 1.00 25.43  ? 289  ARG A CB  1 
ATOM   2233 C CG  . ARG A 1 289 ? 6.031   53.771 67.810 1.00 25.43  ? 289  ARG A CG  1 
ATOM   2234 C CD  . ARG A 1 289 ? 6.492   53.486 66.391 1.00 25.43  ? 289  ARG A CD  1 
ATOM   2235 N NE  . ARG A 1 289 ? 7.647   52.584 66.347 1.00 25.43  ? 289  ARG A NE  1 
ATOM   2236 C CZ  . ARG A 1 289 ? 8.919   52.965 66.301 1.00 25.43  ? 289  ARG A CZ  1 
ATOM   2237 N NH1 . ARG A 1 289 ? 9.235   54.243 66.285 1.00 25.43  ? 289  ARG A NH1 1 
ATOM   2238 N NH2 . ARG A 1 289 ? 9.876   52.055 66.283 1.00 25.43  ? 289  ARG A NH2 1 
ATOM   2239 N N   . PHE A 1 290 ? 2.272   55.818 66.100 1.00 31.44  ? 290  PHE A N   1 
ATOM   2240 C CA  . PHE A 1 290 ? 0.886   56.217 65.982 1.00 31.44  ? 290  PHE A CA  1 
ATOM   2241 C C   . PHE A 1 290 ? -0.020  55.056 65.626 1.00 31.44  ? 290  PHE A C   1 
ATOM   2242 O O   . PHE A 1 290 ? 0.378   54.144 64.916 1.00 31.44  ? 290  PHE A O   1 
ATOM   2243 C CB  . PHE A 1 290 ? 0.826   57.322 64.954 1.00 28.49  ? 290  PHE A CB  1 
ATOM   2244 C CG  . PHE A 1 290 ? 1.951   58.296 65.095 1.00 28.49  ? 290  PHE A CG  1 
ATOM   2245 C CD1 . PHE A 1 290 ? 2.102   59.029 66.268 1.00 28.49  ? 290  PHE A CD1 1 
ATOM   2246 C CD2 . PHE A 1 290 ? 2.906   58.428 64.099 1.00 28.49  ? 290  PHE A CD2 1 
ATOM   2247 C CE1 . PHE A 1 290 ? 3.180   59.870 66.450 1.00 28.49  ? 290  PHE A CE1 1 
ATOM   2248 C CE2 . PHE A 1 290 ? 3.994   59.272 64.274 1.00 28.49  ? 290  PHE A CE2 1 
ATOM   2249 C CZ  . PHE A 1 290 ? 4.130   59.993 65.453 1.00 28.49  ? 290  PHE A CZ  1 
ATOM   2250 N N   . SER A 1 291 ? -1.248  55.105 66.127 1.00 33.58  ? 291  SER A N   1 
ATOM   2251 C CA  . SER A 1 291 ? -2.219  54.037 65.934 1.00 33.58  ? 291  SER A CA  1 
ATOM   2252 C C   . SER A 1 291 ? -2.541  53.629 64.513 1.00 33.58  ? 291  SER A C   1 
ATOM   2253 O O   . SER A 1 291 ? -2.155  52.553 64.057 1.00 33.58  ? 291  SER A O   1 
ATOM   2254 C CB  . SER A 1 291 ? -3.515  54.394 66.650 1.00 46.87  ? 291  SER A CB  1 
ATOM   2255 O OG  . SER A 1 291 ? -3.334  54.358 68.053 1.00 46.87  ? 291  SER A OG  1 
ATOM   2256 N N   . PHE A 1 292 ? -3.267  54.487 63.815 1.00 43.28  ? 292  PHE A N   1 
ATOM   2257 C CA  . PHE A 1 292 ? -3.664  54.190 62.453 1.00 43.28  ? 292  PHE A CA  1 
ATOM   2258 C C   . PHE A 1 292 ? -2.812  54.907 61.415 1.00 43.28  ? 292  PHE A C   1 
ATOM   2259 O O   . PHE A 1 292 ? -2.837  56.129 61.294 1.00 43.28  ? 292  PHE A O   1 
ATOM   2260 C CB  . PHE A 1 292 ? -5.141  54.519 62.313 1.00 38.47  ? 292  PHE A CB  1 
ATOM   2261 C CG  . PHE A 1 292 ? -5.969  53.876 63.370 1.00 38.47  ? 292  PHE A CG  1 
ATOM   2262 C CD1 . PHE A 1 292 ? -6.247  52.518 63.316 1.00 38.47  ? 292  PHE A CD1 1 
ATOM   2263 C CD2 . PHE A 1 292 ? -6.404  54.606 64.467 1.00 38.47  ? 292  PHE A CD2 1 
ATOM   2264 C CE1 . PHE A 1 292 ? -6.947  51.894 64.344 1.00 38.47  ? 292  PHE A CE1 1 
ATOM   2265 C CE2 . PHE A 1 292 ? -7.101  53.994 65.496 1.00 38.47  ? 292  PHE A CE2 1 
ATOM   2266 C CZ  . PHE A 1 292 ? -7.372  52.634 65.435 1.00 38.47  ? 292  PHE A CZ  1 
ATOM   2267 N N   . VAL A 1 293 ? -2.050  54.107 60.678 1.00 25.98  ? 293  VAL A N   1 
ATOM   2268 C CA  . VAL A 1 293 ? -1.138  54.591 59.663 1.00 25.98  ? 293  VAL A CA  1 
ATOM   2269 C C   . VAL A 1 293 ? -1.234  53.703 58.438 1.00 25.98  ? 293  VAL A C   1 
ATOM   2270 O O   . VAL A 1 293 ? -1.874  52.660 58.479 1.00 25.98  ? 293  VAL A O   1 
ATOM   2271 C CB  . VAL A 1 293 ? 0.325   54.549 60.177 1.00 21.42  ? 293  VAL A CB  1 
ATOM   2272 C CG1 . VAL A 1 293 ? 0.539   55.607 61.237 1.00 21.42  ? 293  VAL A CG1 1 
ATOM   2273 C CG2 . VAL A 1 293 ? 0.651   53.161 60.730 1.00 21.42  ? 293  VAL A CG2 1 
ATOM   2274 N N   . PRO A 1 294 ? -0.608  54.114 57.323 1.00 34.30  ? 294  PRO A N   1 
ATOM   2275 C CA  . PRO A 1 294 ? -0.644  53.313 56.104 1.00 34.30  ? 294  PRO A CA  1 
ATOM   2276 C C   . PRO A 1 294 ? -0.272  51.847 56.344 1.00 34.30  ? 294  PRO A C   1 
ATOM   2277 O O   . PRO A 1 294 ? 0.495   51.532 57.237 1.00 34.30  ? 294  PRO A O   1 
ATOM   2278 C CB  . PRO A 1 294 ? 0.352   54.039 55.209 1.00 28.31  ? 294  PRO A CB  1 
ATOM   2279 C CG  . PRO A 1 294 ? 0.093   55.449 55.542 1.00 28.31  ? 294  PRO A CG  1 
ATOM   2280 C CD  . PRO A 1 294 ? 0.008   55.425 57.053 1.00 28.31  ? 294  PRO A CD  1 
ATOM   2281 N N   . VAL A 1 295 ? -0.833  50.957 55.538 1.00 31.15  ? 295  VAL A N   1 
ATOM   2282 C CA  . VAL A 1 295 ? -0.569  49.531 55.651 1.00 31.15  ? 295  VAL A CA  1 
ATOM   2283 C C   . VAL A 1 295 ? -0.120  48.941 54.320 1.00 31.15  ? 295  VAL A C   1 
ATOM   2284 O O   . VAL A 1 295 ? -0.696  49.233 53.276 1.00 31.15  ? 295  VAL A O   1 
ATOM   2285 C CB  . VAL A 1 295 ? -1.818  48.782 56.105 1.00 29.20  ? 295  VAL A CB  1 
ATOM   2286 C CG1 . VAL A 1 295 ? -3.004  49.272 55.332 1.00 29.20  ? 295  VAL A CG1 1 
ATOM   2287 C CG2 . VAL A 1 295 ? -1.652  47.304 55.865 1.00 29.20  ? 295  VAL A CG2 1 
ATOM   2288 N N   . ILE A 1 296 ? 0.914   48.112 54.372 1.00 36.20  ? 296  ILE A N   1 
ATOM   2289 C CA  . ILE A 1 296 ? 1.440   47.464 53.182 1.00 36.20  ? 296  ILE A CA  1 
ATOM   2290 C C   . ILE A 1 296 ? 0.414   46.420 52.775 1.00 36.20  ? 296  ILE A C   1 
ATOM   2291 O O   . ILE A 1 296 ? 0.517   45.255 53.141 1.00 36.20  ? 296  ILE A O   1 
ATOM   2292 C CB  . ILE A 1 296 ? 2.775   46.787 53.488 1.00 28.47  ? 296  ILE A CB  1 
ATOM   2293 C CG1 . ILE A 1 296 ? 3.724   47.804 54.125 1.00 28.47  ? 296  ILE A CG1 1 
ATOM   2294 C CG2 . ILE A 1 296 ? 3.362   46.201 52.219 1.00 28.47  ? 296  ILE A CG2 1 
ATOM   2295 C CD1 . ILE A 1 296 ? 3.938   49.043 53.293 1.00 28.47  ? 296  ILE A CD1 1 
ATOM   2296 N N   . ASP A 1 297 ? -0.578  46.859 52.008 1.00 56.61  ? 297  ASP A N   1 
ATOM   2297 C CA  . ASP A 1 297 ? -1.685  46.012 51.581 1.00 56.61  ? 297  ASP A CA  1 
ATOM   2298 C C   . ASP A 1 297 ? -1.439  45.091 50.400 1.00 56.61  ? 297  ASP A C   1 
ATOM   2299 O O   . ASP A 1 297 ? -1.884  43.953 50.408 1.00 56.61  ? 297  ASP A O   1 
ATOM   2300 C CB  . ASP A 1 297 ? -2.902  46.886 51.268 1.00 59.93  ? 297  ASP A CB  1 
ATOM   2301 C CG  . ASP A 1 297 ? -2.645  47.863 50.115 1.00 59.93  ? 297  ASP A CG  1 
ATOM   2302 O OD1 . ASP A 1 297 ? -1.531  47.840 49.530 1.00 59.93  ? 297  ASP A OD1 1 
ATOM   2303 O OD2 . ASP A 1 297 ? -3.561  48.659 49.793 1.00 59.93  ? 297  ASP A OD2 1 
ATOM   2304 N N   . GLY A 1 298 ? -0.752  45.575 49.377 1.00 63.31  ? 298  GLY A N   1 
ATOM   2305 C CA  . GLY A 1 298 ? -0.519  44.751 48.204 1.00 63.31  ? 298  GLY A CA  1 
ATOM   2306 C C   . GLY A 1 298 ? -1.115  45.429 46.980 1.00 63.31  ? 298  GLY A C   1 
ATOM   2307 O O   . GLY A 1 298 ? -0.945  44.978 45.844 1.00 63.31  ? 298  GLY A O   1 
ATOM   2308 N N   . GLU A 1 299 ? -1.816  46.533 47.211 1.00 50.31  ? 299  GLU A N   1 
ATOM   2309 C CA  . GLU A 1 299 ? -2.433  47.280 46.127 1.00 50.31  ? 299  GLU A CA  1 
ATOM   2310 C C   . GLU A 1 299 ? -1.755  48.635 45.993 1.00 50.31  ? 299  GLU A C   1 
ATOM   2311 O O   . GLU A 1 299 ? -1.051  48.885 45.015 1.00 50.31  ? 299  GLU A O   1 
ATOM   2312 C CB  . GLU A 1 299 ? -3.916  47.445 46.416 1.00 101.57 ? 299  GLU A CB  1 
ATOM   2313 C CG  . GLU A 1 299 ? -4.593  46.114 46.641 1.00 101.57 ? 299  GLU A CG  1 
ATOM   2314 C CD  . GLU A 1 299 ? -5.829  46.241 47.502 1.00 101.57 ? 299  GLU A CD  1 
ATOM   2315 O OE1 . GLU A 1 299 ? -6.794  46.913 47.059 1.00 101.57 ? 299  GLU A OE1 1 
ATOM   2316 O OE2 . GLU A 1 299 ? -5.826  45.674 48.623 1.00 101.57 ? 299  GLU A OE2 1 
ATOM   2317 N N   . PHE A 1 300 ? -1.964  49.510 46.972 1.00 41.87  ? 300  PHE A N   1 
ATOM   2318 C CA  . PHE A 1 300 ? -1.330  50.814 46.932 1.00 41.87  ? 300  PHE A CA  1 
ATOM   2319 C C   . PHE A 1 300 ? 0.170   50.522 46.867 1.00 41.87  ? 300  PHE A C   1 
ATOM   2320 O O   . PHE A 1 300 ? 0.919   51.195 46.165 1.00 41.87  ? 300  PHE A O   1 
ATOM   2321 C CB  . PHE A 1 300 ? -1.685  51.614 48.187 1.00 37.13  ? 300  PHE A CB  1 
ATOM   2322 C CG  . PHE A 1 300 ? -1.453  53.096 48.047 1.00 37.13  ? 300  PHE A CG  1 
ATOM   2323 C CD1 . PHE A 1 300 ? -0.168  53.625 48.105 1.00 37.13  ? 300  PHE A CD1 1 
ATOM   2324 C CD2 . PHE A 1 300 ? -2.521  53.960 47.846 1.00 37.13  ? 300  PHE A CD2 1 
ATOM   2325 C CE1 . PHE A 1 300 ? 0.045   54.996 47.966 1.00 37.13  ? 300  PHE A CE1 1 
ATOM   2326 C CE2 . PHE A 1 300 ? -2.320  55.321 47.705 1.00 37.13  ? 300  PHE A CE2 1 
ATOM   2327 C CZ  . PHE A 1 300 ? -1.035  55.845 47.765 1.00 37.13  ? 300  PHE A CZ  1 
ATOM   2328 N N   . PHE A 1 301 ? 0.598   49.494 47.591 1.00 43.90  ? 301  PHE A N   1 
ATOM   2329 C CA  . PHE A 1 301 ? 1.996   49.092 47.582 1.00 43.90  ? 301  PHE A CA  1 
ATOM   2330 C C   . PHE A 1 301 ? 2.074   47.667 47.032 1.00 43.90  ? 301  PHE A C   1 
ATOM   2331 O O   . PHE A 1 301 ? 1.640   46.716 47.687 1.00 43.90  ? 301  PHE A O   1 
ATOM   2332 C CB  . PHE A 1 301 ? 2.580   49.135 48.997 1.00 37.81  ? 301  PHE A CB  1 
ATOM   2333 C CG  . PHE A 1 301 ? 2.484   50.481 49.653 1.00 37.81  ? 301  PHE A CG  1 
ATOM   2334 C CD1 . PHE A 1 301 ? 3.224   51.564 49.171 1.00 37.81  ? 301  PHE A CD1 1 
ATOM   2335 C CD2 . PHE A 1 301 ? 1.649   50.673 50.750 1.00 37.81  ? 301  PHE A CD2 1 
ATOM   2336 C CE1 . PHE A 1 301 ? 3.133   52.816 49.771 1.00 37.81  ? 301  PHE A CE1 1 
ATOM   2337 C CE2 . PHE A 1 301 ? 1.549   51.918 51.359 1.00 37.81  ? 301  PHE A CE2 1 
ATOM   2338 C CZ  . PHE A 1 301 ? 2.292   52.992 50.870 1.00 37.81  ? 301  PHE A CZ  1 
ATOM   2339 N N   . PRO A 1 302 ? 2.606   47.500 45.809 1.00 44.31  ? 302  PRO A N   1 
ATOM   2340 C CA  . PRO A 1 302 ? 2.742   46.189 45.170 1.00 44.31  ? 302  PRO A CA  1 
ATOM   2341 C C   . PRO A 1 302 ? 3.298   45.111 46.099 1.00 44.31  ? 302  PRO A C   1 
ATOM   2342 O O   . PRO A 1 302 ? 2.641   44.111 46.363 1.00 44.31  ? 302  PRO A O   1 
ATOM   2343 C CB  . PRO A 1 302 ? 3.670   46.486 44.010 1.00 40.93  ? 302  PRO A CB  1 
ATOM   2344 C CG  . PRO A 1 302 ? 3.196   47.830 43.589 1.00 40.93  ? 302  PRO A CG  1 
ATOM   2345 C CD  . PRO A 1 302 ? 3.047   48.566 44.892 1.00 40.93  ? 302  PRO A CD  1 
ATOM   2346 N N   . THR A 1 303 ? 4.508   45.328 46.598 1.00 37.25  ? 303  THR A N   1 
ATOM   2347 C CA  . THR A 1 303 ? 5.154   44.377 47.493 1.00 37.25  ? 303  THR A CA  1 
ATOM   2348 C C   . THR A 1 303 ? 5.590   45.099 48.759 1.00 37.25  ? 303  THR A C   1 
ATOM   2349 O O   . THR A 1 303 ? 4.984   46.083 49.148 1.00 37.25  ? 303  THR A O   1 
ATOM   2350 C CB  . THR A 1 303 ? 6.379   43.780 46.823 1.00 46.19  ? 303  THR A CB  1 
ATOM   2351 O OG1 . THR A 1 303 ? 7.332   44.817 46.568 1.00 46.19  ? 303  THR A OG1 1 
ATOM   2352 C CG2 . THR A 1 303 ? 5.989   43.149 45.502 1.00 46.19  ? 303  THR A CG2 1 
ATOM   2353 N N   . SER A 1 304 ? 6.637   44.617 49.410 1.00 37.96  ? 304  SER A N   1 
ATOM   2354 C CA  . SER A 1 304 ? 7.115   45.276 50.618 1.00 37.96  ? 304  SER A CA  1 
ATOM   2355 C C   . SER A 1 304 ? 7.945   46.482 50.192 1.00 37.96  ? 304  SER A C   1 
ATOM   2356 O O   . SER A 1 304 ? 8.530   46.478 49.111 1.00 37.96  ? 304  SER A O   1 
ATOM   2357 C CB  . SER A 1 304 ? 8.005   44.343 51.417 1.00 43.57  ? 304  SER A CB  1 
ATOM   2358 O OG  . SER A 1 304 ? 9.291   44.295 50.827 1.00 43.57  ? 304  SER A OG  1 
ATOM   2359 N N   . LEU A 1 305 ? 8.024   47.505 51.036 1.00 43.05  ? 305  LEU A N   1 
ATOM   2360 C CA  . LEU A 1 305 ? 8.792   48.688 50.675 1.00 43.05  ? 305  LEU A CA  1 
ATOM   2361 C C   . LEU A 1 305 ? 10.267  48.394 50.410 1.00 43.05  ? 305  LEU A C   1 
ATOM   2362 O O   . LEU A 1 305 ? 10.853  48.908 49.451 1.00 43.05  ? 305  LEU A O   1 
ATOM   2363 C CB  . LEU A 1 305 ? 8.667   49.758 51.765 1.00 43.66  ? 305  LEU A CB  1 
ATOM   2364 C CG  . LEU A 1 305 ? 7.246   50.274 52.032 1.00 43.66  ? 305  LEU A CG  1 
ATOM   2365 C CD1 . LEU A 1 305 ? 7.286   51.330 53.139 1.00 43.66  ? 305  LEU A CD1 1 
ATOM   2366 C CD2 . LEU A 1 305 ? 6.642   50.843 50.741 1.00 43.66  ? 305  LEU A CD2 1 
ATOM   2367 N N   . GLU A 1 306 ? 10.864  47.553 51.244 1.00 52.23  ? 306  GLU A N   1 
ATOM   2368 C CA  . GLU A 1 306 ? 12.276  47.239 51.099 1.00 52.23  ? 306  GLU A CA  1 
ATOM   2369 C C   . GLU A 1 306 ? 12.658  46.589 49.777 1.00 52.23  ? 306  GLU A C   1 
ATOM   2370 O O   . GLU A 1 306 ? 13.718  46.894 49.219 1.00 52.23  ? 306  GLU A O   1 
ATOM   2371 C CB  . GLU A 1 306 ? 12.749  46.354 52.248 1.00 94.92  ? 306  GLU A CB  1 
ATOM   2372 C CG  . GLU A 1 306 ? 14.255  46.429 52.427 1.00 94.92  ? 306  GLU A CG  1 
ATOM   2373 C CD  . GLU A 1 306 ? 14.773  47.878 52.320 1.00 94.92  ? 306  GLU A CD  1 
ATOM   2374 O OE1 . GLU A 1 306 ? 14.286  48.750 53.095 1.00 94.92  ? 306  GLU A OE1 1 
ATOM   2375 O OE2 . GLU A 1 306 ? 15.657  48.141 51.458 1.00 94.92  ? 306  GLU A OE2 1 
ATOM   2376 N N   . SER A 1 307 ? 11.809  45.691 49.278 1.00 43.59  ? 307  SER A N   1 
ATOM   2377 C CA  . SER A 1 307 ? 12.086  45.016 48.012 1.00 43.59  ? 307  SER A CA  1 
ATOM   2378 C C   . SER A 1 307 ? 11.822  45.949 46.840 1.00 43.59  ? 307  SER A C   1 
ATOM   2379 O O   . SER A 1 307 ? 12.426  45.815 45.781 1.00 43.59  ? 307  SER A O   1 
ATOM   2380 C CB  . SER A 1 307 ? 11.225  43.768 47.869 1.00 44.95  ? 307  SER A CB  1 
ATOM   2381 O OG  . SER A 1 307 ? 9.859   44.110 47.795 1.00 44.95  ? 307  SER A OG  1 
ATOM   2382 N N   . MET A 1 308 ? 10.910  46.891 47.027 1.00 35.13  ? 308  MET A N   1 
ATOM   2383 C CA  . MET A 1 308 ? 10.608  47.842 45.975 1.00 35.13  ? 308  MET A CA  1 
ATOM   2384 C C   . MET A 1 308 ? 11.827  48.734 45.789 1.00 35.13  ? 308  MET A C   1 
ATOM   2385 O O   . MET A 1 308 ? 12.257  48.993 44.664 1.00 35.13  ? 308  MET A O   1 
ATOM   2386 C CB  . MET A 1 308 ? 9.391   48.689 46.353 1.00 53.66  ? 308  MET A CB  1 
ATOM   2387 C CG  . MET A 1 308 ? 8.071   47.964 46.201 1.00 53.66  ? 308  MET A CG  1 
ATOM   2388 S SD  . MET A 1 308 ? 6.665   49.054 46.460 1.00 53.66  ? 308  MET A SD  1 
ATOM   2389 C CE  . MET A 1 308 ? 6.894   50.266 45.128 1.00 53.66  ? 308  MET A CE  1 
ATOM   2390 N N   . LEU A 1 309 ? 12.383  49.196 46.908 1.00 40.90  ? 309  LEU A N   1 
ATOM   2391 C CA  . LEU A 1 309 ? 13.553  50.050 46.869 1.00 40.90  ? 309  LEU A CA  1 
ATOM   2392 C C   . LEU A 1 309 ? 14.765  49.319 46.296 1.00 40.90  ? 309  LEU A C   1 
ATOM   2393 O O   . LEU A 1 309 ? 15.608  49.934 45.637 1.00 40.90  ? 309  LEU A O   1 
ATOM   2394 C CB  . LEU A 1 309 ? 13.877  50.568 48.267 1.00 35.08  ? 309  LEU A CB  1 
ATOM   2395 C CG  . LEU A 1 309 ? 12.965  51.663 48.822 1.00 35.08  ? 309  LEU A CG  1 
ATOM   2396 C CD1 . LEU A 1 309 ? 13.380  52.005 50.235 1.00 35.08  ? 309  LEU A CD1 1 
ATOM   2397 C CD2 . LEU A 1 309 ? 13.049  52.892 47.936 1.00 35.08  ? 309  LEU A CD2 1 
ATOM   2398 N N   . ASN A 1 310 ? 14.861  48.011 46.537 1.00 35.74  ? 310  ASN A N   1 
ATOM   2399 C CA  . ASN A 1 310 ? 15.992  47.236 46.027 1.00 35.74  ? 310  ASN A CA  1 
ATOM   2400 C C   . ASN A 1 310 ? 15.840  46.825 44.579 1.00 35.74  ? 310  ASN A C   1 
ATOM   2401 O O   . ASN A 1 310 ? 16.822  46.541 43.903 1.00 35.74  ? 310  ASN A O   1 
ATOM   2402 C CB  . ASN A 1 310 ? 16.228  45.999 46.893 1.00 72.28  ? 310  ASN A CB  1 
ATOM   2403 C CG  . ASN A 1 310 ? 16.979  46.331 48.175 1.00 72.28  ? 310  ASN A CG  1 
ATOM   2404 O OD1 . ASN A 1 310 ? 18.077  46.894 48.127 1.00 72.28  ? 310  ASN A OD1 1 
ATOM   2405 N ND2 . ASN A 1 310 ? 16.389  45.993 49.328 1.00 72.28  ? 310  ASN A ND2 1 
ATOM   2406 N N   . SER A 1 311 ? 14.609  46.796 44.096 1.00 40.81  ? 311  SER A N   1 
ATOM   2407 C CA  . SER A 1 311 ? 14.373  46.420 42.714 1.00 40.81  ? 311  SER A CA  1 
ATOM   2408 C C   . SER A 1 311 ? 14.275  47.625 41.777 1.00 40.81  ? 311  SER A C   1 
ATOM   2409 O O   . SER A 1 311 ? 14.174  47.453 40.572 1.00 40.81  ? 311  SER A O   1 
ATOM   2410 C CB  . SER A 1 311 ? 13.105  45.566 42.605 1.00 49.64  ? 311  SER A CB  1 
ATOM   2411 O OG  . SER A 1 311 ? 11.993  46.193 43.216 1.00 49.64  ? 311  SER A OG  1 
ATOM   2412 N N   . GLY A 1 312 ? 14.318  48.839 42.322 1.00 43.08  ? 312  GLY A N   1 
ATOM   2413 C CA  . GLY A 1 312 ? 14.227  50.024 41.483 1.00 43.08  ? 312  GLY A CA  1 
ATOM   2414 C C   . GLY A 1 312 ? 12.803  50.246 41.002 1.00 43.08  ? 312  GLY A C   1 
ATOM   2415 O O   . GLY A 1 312 ? 12.539  50.995 40.065 1.00 43.08  ? 312  GLY A O   1 
ATOM   2416 N N   . ASN A 1 313 ? 11.874  49.577 41.660 1.00 45.21  ? 313  ASN A N   1 
ATOM   2417 C CA  . ASN A 1 313 ? 10.473  49.685 41.314 1.00 45.21  ? 313  ASN A CA  1 
ATOM   2418 C C   . ASN A 1 313 ? 9.887   50.970 41.914 1.00 45.21  ? 313  ASN A C   1 
ATOM   2419 O O   . ASN A 1 313 ? 9.304   50.966 43.005 1.00 45.21  ? 313  ASN A O   1 
ATOM   2420 C CB  . ASN A 1 313 ? 9.743   48.437 41.828 1.00 41.72  ? 313  ASN A CB  1 
ATOM   2421 C CG  . ASN A 1 313 ? 8.290   48.420 41.452 1.00 41.72  ? 313  ASN A CG  1 
ATOM   2422 O OD1 . ASN A 1 313 ? 7.842   49.219 40.627 1.00 41.72  ? 313  ASN A OD1 1 
ATOM   2423 N ND2 . ASN A 1 313 ? 7.536   47.508 42.055 1.00 41.72  ? 313  ASN A ND2 1 
ATOM   2424 N N   . PHE A 1 314 ? 10.066  52.078 41.203 1.00 38.62  ? 314  PHE A N   1 
ATOM   2425 C CA  . PHE A 1 314 ? 9.561   53.370 41.662 1.00 38.62  ? 314  PHE A CA  1 
ATOM   2426 C C   . PHE A 1 314 ? 9.871   54.497 40.682 1.00 38.62  ? 314  PHE A C   1 
ATOM   2427 O O   . PHE A 1 314 ? 10.809  54.413 39.896 1.00 38.62  ? 314  PHE A O   1 
ATOM   2428 C CB  . PHE A 1 314 ? 10.119  53.702 43.057 1.00 27.47  ? 314  PHE A CB  1 
ATOM   2429 C CG  . PHE A 1 314 ? 11.617  53.681 43.146 1.00 27.47  ? 314  PHE A CG  1 
ATOM   2430 C CD1 . PHE A 1 314 ? 12.374  54.730 42.642 1.00 27.47  ? 314  PHE A CD1 1 
ATOM   2431 C CD2 . PHE A 1 314 ? 12.274  52.599 43.725 1.00 27.47  ? 314  PHE A CD2 1 
ATOM   2432 C CE1 . PHE A 1 314 ? 13.760  54.700 42.711 1.00 27.47  ? 314  PHE A CE1 1 
ATOM   2433 C CE2 . PHE A 1 314 ? 13.660  52.564 43.797 1.00 27.47  ? 314  PHE A CE2 1 
ATOM   2434 C CZ  . PHE A 1 314 ? 14.404  53.614 43.289 1.00 27.47  ? 314  PHE A CZ  1 
ATOM   2435 N N   . LYS A 1 315 ? 9.079   55.557 40.736 1.00 32.52  ? 315  LYS A N   1 
ATOM   2436 C CA  . LYS A 1 315 ? 9.257   56.687 39.836 1.00 32.52  ? 315  LYS A CA  1 
ATOM   2437 C C   . LYS A 1 315 ? 10.648  57.303 39.871 1.00 32.52  ? 315  LYS A C   1 
ATOM   2438 O O   . LYS A 1 315 ? 11.054  57.886 40.879 1.00 32.52  ? 315  LYS A O   1 
ATOM   2439 C CB  . LYS A 1 315 ? 8.223   57.760 40.153 1.00 29.28  ? 315  LYS A CB  1 
ATOM   2440 C CG  . LYS A 1 315 ? 8.253   58.942 39.219 1.00 29.28  ? 315  LYS A CG  1 
ATOM   2441 C CD  . LYS A 1 315 ? 7.305   60.029 39.693 1.00 29.28  ? 315  LYS A CD  1 
ATOM   2442 C CE  . LYS A 1 315 ? 7.330   61.204 38.754 1.00 29.28  ? 315  LYS A CE  1 
ATOM   2443 N NZ  . LYS A 1 315 ? 6.968   60.760 37.386 1.00 29.28  ? 315  LYS A NZ  1 
ATOM   2444 N N   . LYS A 1 316 ? 11.380  57.174 38.768 1.00 31.13  ? 316  LYS A N   1 
ATOM   2445 C CA  . LYS A 1 316 ? 12.715  57.751 38.678 1.00 31.13  ? 316  LYS A CA  1 
ATOM   2446 C C   . LYS A 1 316 ? 12.598  59.196 38.196 1.00 31.13  ? 316  LYS A C   1 
ATOM   2447 O O   . LYS A 1 316 ? 12.175  59.448 37.072 1.00 31.13  ? 316  LYS A O   1 
ATOM   2448 C CB  . LYS A 1 316 ? 13.593  56.953 37.705 1.00 39.51  ? 316  LYS A CB  1 
ATOM   2449 C CG  . LYS A 1 316 ? 13.837  55.511 38.111 1.00 39.51  ? 316  LYS A CG  1 
ATOM   2450 C CD  . LYS A 1 316 ? 12.886  54.581 37.395 1.00 39.51  ? 316  LYS A CD  1 
ATOM   2451 C CE  . LYS A 1 316 ? 12.777  53.223 38.084 1.00 39.51  ? 316  LYS A CE  1 
ATOM   2452 N NZ  . LYS A 1 316 ? 14.056  52.478 38.133 1.00 39.51  ? 316  LYS A NZ  1 
ATOM   2453 N N   . THR A 1 317 ? 12.963  60.141 39.056 1.00 40.20  ? 317  THR A N   1 
ATOM   2454 C CA  . THR A 1 317 ? 12.902  61.569 38.732 1.00 40.20  ? 317  THR A CA  1 
ATOM   2455 C C   . THR A 1 317 ? 13.964  62.295 39.571 1.00 40.20  ? 317  THR A C   1 
ATOM   2456 O O   . THR A 1 317 ? 15.027  61.734 39.823 1.00 40.20  ? 317  THR A O   1 
ATOM   2457 C CB  . THR A 1 317 ? 11.469  62.119 39.014 1.00 40.51  ? 317  THR A CB  1 
ATOM   2458 O OG1 . THR A 1 317 ? 11.457  63.544 38.865 1.00 40.51  ? 317  THR A OG1 1 
ATOM   2459 C CG2 . THR A 1 317 ? 10.999  61.729 40.402 1.00 40.51  ? 317  THR A CG2 1 
ATOM   2460 N N   . GLN A 1 318 ? 13.724  63.539 39.969 1.00 30.87  ? 318  GLN A N   1 
ATOM   2461 C CA  . GLN A 1 318 ? 14.694  64.221 40.826 1.00 30.87  ? 318  GLN A CA  1 
ATOM   2462 C C   . GLN A 1 318 ? 14.018  64.403 42.163 1.00 30.87  ? 318  GLN A C   1 
ATOM   2463 O O   . GLN A 1 318 ? 12.805  64.492 42.230 1.00 30.87  ? 318  GLN A O   1 
ATOM   2464 C CB  . GLN A 1 318 ? 15.078  65.617 40.316 1.00 34.98  ? 318  GLN A CB  1 
ATOM   2465 C CG  . GLN A 1 318 ? 15.781  65.676 39.001 1.00 34.98  ? 318  GLN A CG  1 
ATOM   2466 C CD  . GLN A 1 318 ? 14.815  65.517 37.881 1.00 34.98  ? 318  GLN A CD  1 
ATOM   2467 O OE1 . GLN A 1 318 ? 13.722  66.068 37.930 1.00 34.98  ? 318  GLN A OE1 1 
ATOM   2468 N NE2 . GLN A 1 318 ? 15.200  64.769 36.855 1.00 34.98  ? 318  GLN A NE2 1 
ATOM   2469 N N   . ILE A 1 319 ? 14.795  64.444 43.229 1.00 39.37  ? 319  ILE A N   1 
ATOM   2470 C CA  . ILE A 1 319 ? 14.234  64.667 44.546 1.00 39.37  ? 319  ILE A CA  1 
ATOM   2471 C C   . ILE A 1 319 ? 15.228  65.488 45.334 1.00 39.37  ? 319  ILE A C   1 
ATOM   2472 O O   . ILE A 1 319 ? 16.438  65.410 45.110 1.00 39.37  ? 319  ILE A O   1 
ATOM   2473 C CB  . ILE A 1 319 ? 13.963  63.360 45.319 1.00 34.58  ? 319  ILE A CB  1 
ATOM   2474 C CG1 . ILE A 1 319 ? 15.240  62.535 45.403 1.00 34.58  ? 319  ILE A CG1 1 
ATOM   2475 C CG2 . ILE A 1 319 ? 12.841  62.586 44.675 1.00 34.58  ? 319  ILE A CG2 1 
ATOM   2476 C CD1 . ILE A 1 319 ? 15.107  61.313 46.259 1.00 34.58  ? 319  ILE A CD1 1 
ATOM   2477 N N   . LEU A 1 320 ? 14.699  66.292 46.244 1.00 34.30  ? 320  LEU A N   1 
ATOM   2478 C CA  . LEU A 1 320 ? 15.498  67.139 47.105 1.00 34.30  ? 320  LEU A CA  1 
ATOM   2479 C C   . LEU A 1 320 ? 14.955  66.838 48.498 1.00 34.30  ? 320  LEU A C   1 
ATOM   2480 O O   . LEU A 1 320 ? 13.771  67.027 48.748 1.00 34.30  ? 320  LEU A O   1 
ATOM   2481 C CB  . LEU A 1 320 ? 15.277  68.607 46.722 1.00 24.23  ? 320  LEU A CB  1 
ATOM   2482 C CG  . LEU A 1 320 ? 16.006  69.723 47.472 1.00 24.23  ? 320  LEU A CG  1 
ATOM   2483 C CD1 . LEU A 1 320 ? 15.968  70.985 46.653 1.00 24.23  ? 320  LEU A CD1 1 
ATOM   2484 C CD2 . LEU A 1 320 ? 15.369  69.957 48.820 1.00 24.23  ? 320  LEU A CD2 1 
ATOM   2485 N N   . LEU A 1 321 ? 15.792  66.341 49.399 1.00 32.80  ? 321  LEU A N   1 
ATOM   2486 C CA  . LEU A 1 321 ? 15.300  66.032 50.732 1.00 32.80  ? 321  LEU A CA  1 
ATOM   2487 C C   . LEU A 1 321 ? 16.332  66.285 51.822 1.00 32.80  ? 321  LEU A C   1 
ATOM   2488 O O   . LEU A 1 321 ? 17.523  66.394 51.550 1.00 32.80  ? 321  LEU A O   1 
ATOM   2489 C CB  . LEU A 1 321 ? 14.794  64.584 50.778 1.00 34.74  ? 321  LEU A CB  1 
ATOM   2490 C CG  . LEU A 1 321 ? 15.749  63.393 50.722 1.00 34.74  ? 321  LEU A CG  1 
ATOM   2491 C CD1 . LEU A 1 321 ? 14.962  62.152 50.351 1.00 34.74  ? 321  LEU A CD1 1 
ATOM   2492 C CD2 . LEU A 1 321 ? 16.834  63.636 49.711 1.00 34.74  ? 321  LEU A CD2 1 
ATOM   2493 N N   . GLY A 1 322 ? 15.864  66.391 53.060 1.00 34.96  ? 322  GLY A N   1 
ATOM   2494 C CA  . GLY A 1 322 ? 16.772  66.648 54.159 1.00 34.96  ? 322  GLY A CA  1 
ATOM   2495 C C   . GLY A 1 322 ? 16.109  66.472 55.506 1.00 34.96  ? 322  GLY A C   1 
ATOM   2496 O O   . GLY A 1 322 ? 14.954  66.076 55.578 1.00 34.96  ? 322  GLY A O   1 
ATOM   2497 N N   . VAL A 1 323 ? 16.836  66.779 56.574 1.00 26.04  ? 323  VAL A N   1 
ATOM   2498 C CA  . VAL A 1 323 ? 16.310  66.617 57.917 1.00 26.04  ? 323  VAL A CA  1 
ATOM   2499 C C   . VAL A 1 323 ? 16.712  67.764 58.827 1.00 26.04  ? 323  VAL A C   1 
ATOM   2500 O O   . VAL A 1 323 ? 17.506  68.621 58.448 1.00 26.04  ? 323  VAL A O   1 
ATOM   2501 C CB  . VAL A 1 323 ? 16.834  65.310 58.552 1.00 25.38  ? 323  VAL A CB  1 
ATOM   2502 C CG1 . VAL A 1 323 ? 16.445  64.125 57.704 1.00 25.38  ? 323  VAL A CG1 1 
ATOM   2503 C CG2 . VAL A 1 323 ? 18.329  65.367 58.697 1.00 25.38  ? 323  VAL A CG2 1 
ATOM   2504 N N   . ASN A 1 324 ? 16.148  67.773 60.031 1.00 33.08  ? 324  ASN A N   1 
ATOM   2505 C CA  . ASN A 1 324 ? 16.476  68.781 61.026 1.00 33.08  ? 324  ASN A CA  1 
ATOM   2506 C C   . ASN A 1 324 ? 17.527  68.230 61.976 1.00 33.08  ? 324  ASN A C   1 
ATOM   2507 O O   . ASN A 1 324 ? 17.626  67.024 62.178 1.00 33.08  ? 324  ASN A O   1 
ATOM   2508 C CB  . ASN A 1 324 ? 15.248  69.184 61.829 1.00 48.26  ? 324  ASN A CB  1 
ATOM   2509 C CG  . ASN A 1 324 ? 14.292  70.004 61.027 1.00 48.26  ? 324  ASN A CG  1 
ATOM   2510 O OD1 . ASN A 1 324 ? 14.671  70.604 60.019 1.00 48.26  ? 324  ASN A OD1 1 
ATOM   2511 N ND2 . ASN A 1 324 ? 13.042  70.054 61.467 1.00 48.26  ? 324  ASN A ND2 1 
ATOM   2512 N N   . LYS A 1 325 ? 18.308  69.119 62.572 1.00 37.50  ? 325  LYS A N   1 
ATOM   2513 C CA  . LYS A 1 325 ? 19.353  68.689 63.482 1.00 37.50  ? 325  LYS A CA  1 
ATOM   2514 C C   . LYS A 1 325 ? 18.805  67.921 64.672 1.00 37.50  ? 325  LYS A C   1 
ATOM   2515 O O   . LYS A 1 325 ? 19.361  66.900 65.057 1.00 37.50  ? 325  LYS A O   1 
ATOM   2516 C CB  . LYS A 1 325 ? 20.158  69.893 63.974 1.00 38.25  ? 325  LYS A CB  1 
ATOM   2517 C CG  . LYS A 1 325 ? 21.327  69.523 64.845 1.00 38.25  ? 325  LYS A CG  1 
ATOM   2518 C CD  . LYS A 1 325 ? 22.097  70.754 65.286 1.00 38.25  ? 325  LYS A CD  1 
ATOM   2519 C CE  . LYS A 1 325 ? 23.247  70.390 66.214 1.00 38.25  ? 325  LYS A CE  1 
ATOM   2520 N NZ  . LYS A 1 325 ? 22.747  69.672 67.420 1.00 38.25  ? 325  LYS A NZ  1 
ATOM   2521 N N   . ASP A 1 326 ? 17.700  68.389 65.237 1.00 43.22  ? 326  ASP A N   1 
ATOM   2522 C CA  . ASP A 1 326 ? 17.159  67.737 66.413 1.00 43.22  ? 326  ASP A CA  1 
ATOM   2523 C C   . ASP A 1 326 ? 15.707  67.299 66.310 1.00 43.22  ? 326  ASP A C   1 
ATOM   2524 O O   . ASP A 1 326 ? 14.823  67.830 66.974 1.00 43.22  ? 326  ASP A O   1 
ATOM   2525 C CB  . ASP A 1 326 ? 17.376  68.653 67.621 1.00 51.03  ? 326  ASP A CB  1 
ATOM   2526 C CG  . ASP A 1 326 ? 18.863  68.984 67.839 1.00 51.03  ? 326  ASP A CG  1 
ATOM   2527 O OD1 . ASP A 1 326 ? 19.648  68.035 68.063 1.00 51.03  ? 326  ASP A OD1 1 
ATOM   2528 O OD2 . ASP A 1 326 ? 19.254  70.179 67.777 1.00 51.03  ? 326  ASP A OD2 1 
ATOM   2529 N N   . GLU A 1 327 ? 15.480  66.294 65.480 1.00 52.07  ? 327  GLU A N   1 
ATOM   2530 C CA  . GLU A 1 327 ? 14.156  65.745 65.257 1.00 52.07  ? 327  GLU A CA  1 
ATOM   2531 C C   . GLU A 1 327 ? 13.548  65.097 66.512 1.00 52.07  ? 327  GLU A C   1 
ATOM   2532 O O   . GLU A 1 327 ? 12.346  65.191 66.746 1.00 52.07  ? 327  GLU A O   1 
ATOM   2533 C CB  . GLU A 1 327 ? 14.234  64.702 64.139 1.00 78.38  ? 327  GLU A CB  1 
ATOM   2534 C CG  . GLU A 1 327 ? 14.918  65.195 62.867 1.00 78.38  ? 327  GLU A CG  1 
ATOM   2535 C CD  . GLU A 1 327 ? 13.947  65.860 61.896 1.00 78.38  ? 327  GLU A CD  1 
ATOM   2536 O OE1 . GLU A 1 327 ? 12.944  66.446 62.369 1.00 78.38  ? 327  GLU A OE1 1 
ATOM   2537 O OE2 . GLU A 1 327 ? 14.187  65.805 60.664 1.00 78.38  ? 327  GLU A OE2 1 
ATOM   2538 N N   . GLY A 1 328 ? 14.372  64.443 67.322 1.00 39.86  ? 328  GLY A N   1 
ATOM   2539 C CA  . GLY A 1 328 ? 13.847  63.773 68.501 1.00 39.86  ? 328  GLY A CA  1 
ATOM   2540 C C   . GLY A 1 328 ? 13.138  64.579 69.584 1.00 39.86  ? 328  GLY A C   1 
ATOM   2541 O O   . GLY A 1 328 ? 11.965  64.339 69.876 1.00 39.86  ? 328  GLY A O   1 
ATOM   2542 N N   . SER A 1 329 ? 13.850  65.535 70.179 1.00 46.33  ? 329  SER A N   1 
ATOM   2543 C CA  . SER A 1 329 ? 13.334  66.361 71.274 1.00 46.33  ? 329  SER A CA  1 
ATOM   2544 C C   . SER A 1 329 ? 11.825  66.509 71.438 1.00 46.33  ? 329  SER A C   1 
ATOM   2545 O O   . SER A 1 329 ? 11.303  66.288 72.527 1.00 46.33  ? 329  SER A O   1 
ATOM   2546 C CB  . SER A 1 329 ? 13.983  67.746 71.245 1.00 40.17  ? 329  SER A CB  1 
ATOM   2547 O OG  . SER A 1 329 ? 13.830  68.336 69.982 1.00 40.17  ? 329  SER A OG  1 
ATOM   2548 N N   . PHE A 1 330 ? 11.110  66.863 70.383 1.00 40.22  ? 330  PHE A N   1 
ATOM   2549 C CA  . PHE A 1 330 ? 9.668   67.040 70.514 1.00 40.22  ? 330  PHE A CA  1 
ATOM   2550 C C   . PHE A 1 330 ? 8.891   65.860 71.101 1.00 40.22  ? 330  PHE A C   1 
ATOM   2551 O O   . PHE A 1 330 ? 7.882   66.068 71.768 1.00 40.22  ? 330  PHE A O   1 
ATOM   2552 C CB  . PHE A 1 330 ? 9.059   67.395 69.172 1.00 57.16  ? 330  PHE A CB  1 
ATOM   2553 C CG  . PHE A 1 330 ? 7.947   68.378 69.271 1.00 57.16  ? 330  PHE A CG  1 
ATOM   2554 C CD1 . PHE A 1 330 ? 6.845   68.118 70.070 1.00 57.16  ? 330  PHE A CD1 1 
ATOM   2555 C CD2 . PHE A 1 330 ? 8.002   69.581 68.573 1.00 57.16  ? 330  PHE A CD2 1 
ATOM   2556 C CE1 . PHE A 1 330 ? 5.806   69.044 70.179 1.00 57.16  ? 330  PHE A CE1 1 
ATOM   2557 C CE2 . PHE A 1 330 ? 6.971   70.516 68.674 1.00 57.16  ? 330  PHE A CE2 1 
ATOM   2558 C CZ  . PHE A 1 330 ? 5.870   70.243 69.483 1.00 57.16  ? 330  PHE A CZ  1 
ATOM   2559 N N   . PHE A 1 331 ? 9.346   64.628 70.869 1.00 40.07  ? 331  PHE A N   1 
ATOM   2560 C CA  . PHE A 1 331 ? 8.637   63.456 71.386 1.00 40.07  ? 331  PHE A CA  1 
ATOM   2561 C C   . PHE A 1 331 ? 9.074   63.027 72.764 1.00 40.07  ? 331  PHE A C   1 
ATOM   2562 O O   . PHE A 1 331 ? 8.343   62.318 73.449 1.00 40.07  ? 331  PHE A O   1 
ATOM   2563 C CB  . PHE A 1 331 ? 8.778   62.278 70.435 1.00 31.26  ? 331  PHE A CB  1 
ATOM   2564 C CG  . PHE A 1 331 ? 8.258   62.559 69.082 1.00 31.26  ? 331  PHE A CG  1 
ATOM   2565 C CD1 . PHE A 1 331 ? 8.988   63.343 68.197 1.00 31.26  ? 331  PHE A CD1 1 
ATOM   2566 C CD2 . PHE A 1 331 ? 7.014   62.091 68.697 1.00 31.26  ? 331  PHE A CD2 1 
ATOM   2567 C CE1 . PHE A 1 331 ? 8.483   63.662 66.940 1.00 31.26  ? 331  PHE A CE1 1 
ATOM   2568 C CE2 . PHE A 1 331 ? 6.497   62.401 67.446 1.00 31.26  ? 331  PHE A CE2 1 
ATOM   2569 C CZ  . PHE A 1 331 ? 7.234   63.190 66.564 1.00 31.26  ? 331  PHE A CZ  1 
ATOM   2570 N N   . LEU A 1 332 ? 10.272  63.428 73.165 1.00 46.70  ? 332  LEU A N   1 
ATOM   2571 C CA  . LEU A 1 332 ? 10.766  63.086 74.494 1.00 46.70  ? 332  LEU A CA  1 
ATOM   2572 C C   . LEU A 1 332 ? 10.028  63.985 75.495 1.00 46.70  ? 332  LEU A C   1 
ATOM   2573 O O   . LEU A 1 332 ? 9.692   63.576 76.606 1.00 46.70  ? 332  LEU A O   1 
ATOM   2574 C CB  . LEU A 1 332 ? 12.280  63.323 74.568 1.00 36.97  ? 332  LEU A CB  1 
ATOM   2575 C CG  . LEU A 1 332 ? 13.148  62.371 73.743 1.00 36.97  ? 332  LEU A CG  1 
ATOM   2576 C CD1 . LEU A 1 332 ? 14.527  62.946 73.549 1.00 36.97  ? 332  LEU A CD1 1 
ATOM   2577 C CD2 . LEU A 1 332 ? 13.228  61.045 74.437 1.00 36.97  ? 332  LEU A CD2 1 
ATOM   2578 N N   . LEU A 1 333 ? 9.762   65.213 75.071 1.00 44.87  ? 333  LEU A N   1 
ATOM   2579 C CA  . LEU A 1 333 ? 9.071   66.184 75.898 1.00 44.87  ? 333  LEU A CA  1 
ATOM   2580 C C   . LEU A 1 333 ? 7.688   65.696 76.298 1.00 44.87  ? 333  LEU A C   1 
ATOM   2581 O O   . LEU A 1 333 ? 7.285   65.821 77.453 1.00 44.87  ? 333  LEU A O   1 
ATOM   2582 C CB  . LEU A 1 333 ? 8.939   67.500 75.140 1.00 33.41  ? 333  LEU A CB  1 
ATOM   2583 C CG  . LEU A 1 333 ? 8.117   68.594 75.805 1.00 33.41  ? 333  LEU A CG  1 
ATOM   2584 C CD1 . LEU A 1 333 ? 8.718   68.945 77.170 1.00 33.41  ? 333  LEU A CD1 1 
ATOM   2585 C CD2 . LEU A 1 333 ? 8.090   69.801 74.881 1.00 33.41  ? 333  LEU A CD2 1 
ATOM   2586 N N   . TYR A 1 334 ? 6.964   65.141 75.334 1.00 45.52  ? 334  TYR A N   1 
ATOM   2587 C CA  . TYR A 1 334 ? 5.620   64.657 75.572 1.00 45.52  ? 334  TYR A CA  1 
ATOM   2588 C C   . TYR A 1 334 ? 5.540   63.279 76.184 1.00 45.52  ? 334  TYR A C   1 
ATOM   2589 O O   . TYR A 1 334 ? 4.592   62.999 76.905 1.00 45.52  ? 334  TYR A O   1 
ATOM   2590 C CB  . TYR A 1 334 ? 4.815   64.629 74.270 1.00 36.99  ? 334  TYR A CB  1 
ATOM   2591 C CG  . TYR A 1 334 ? 4.262   65.959 73.825 1.00 36.99  ? 334  TYR A CG  1 
ATOM   2592 C CD1 . TYR A 1 334 ? 5.104   67.038 73.577 1.00 36.99  ? 334  TYR A CD1 1 
ATOM   2593 C CD2 . TYR A 1 334 ? 2.894   66.137 73.637 1.00 36.99  ? 334  TYR A CD2 1 
ATOM   2594 C CE1 . TYR A 1 334 ? 4.600   68.271 73.151 1.00 36.99  ? 334  TYR A CE1 1 
ATOM   2595 C CE2 . TYR A 1 334 ? 2.376   67.367 73.210 1.00 36.99  ? 334  TYR A CE2 1 
ATOM   2596 C CZ  . TYR A 1 334 ? 3.237   68.434 72.967 1.00 36.99  ? 334  TYR A CZ  1 
ATOM   2597 O OH  . TYR A 1 334 ? 2.748   69.659 72.547 1.00 36.99  ? 334  TYR A OH  1 
ATOM   2598 N N   . GLY A 1 335 ? 6.511   62.409 75.926 1.00 35.52  ? 335  GLY A N   1 
ATOM   2599 C CA  . GLY A 1 335 ? 6.375   61.070 76.465 1.00 35.52  ? 335  GLY A CA  1 
ATOM   2600 C C   . GLY A 1 335 ? 7.449   60.423 77.307 1.00 35.52  ? 335  GLY A C   1 
ATOM   2601 O O   . GLY A 1 335 ? 7.165   59.461 78.030 1.00 35.52  ? 335  GLY A O   1 
ATOM   2602 N N   . ALA A 1 336 ? 8.678   60.909 77.220 1.00 41.44  ? 336  ALA A N   1 
ATOM   2603 C CA  . ALA A 1 336 ? 9.753   60.316 78.001 1.00 41.44  ? 336  ALA A CA  1 
ATOM   2604 C C   . ALA A 1 336 ? 9.852   60.972 79.369 1.00 41.44  ? 336  ALA A C   1 
ATOM   2605 O O   . ALA A 1 336 ? 9.888   62.189 79.484 1.00 41.44  ? 336  ALA A O   1 
ATOM   2606 C CB  . ALA A 1 336 ? 11.067  60.448 77.260 1.00 50.28  ? 336  ALA A CB  1 
ATOM   2607 N N   . PRO A 1 337 ? 9.898   60.170 80.431 1.00 51.00  ? 337  PRO A N   1 
ATOM   2608 C CA  . PRO A 1 337 ? 9.994   60.727 81.785 1.00 51.00  ? 337  PRO A CA  1 
ATOM   2609 C C   . PRO A 1 337 ? 11.324  61.452 82.034 1.00 51.00  ? 337  PRO A C   1 
ATOM   2610 O O   . PRO A 1 337 ? 12.407  60.942 81.705 1.00 51.00  ? 337  PRO A O   1 
ATOM   2611 C CB  . PRO A 1 337 ? 9.830   59.498 82.668 1.00 55.71  ? 337  PRO A CB  1 
ATOM   2612 C CG  . PRO A 1 337 ? 10.535  58.432 81.847 1.00 55.71  ? 337  PRO A CG  1 
ATOM   2613 C CD  . PRO A 1 337 ? 9.991   58.700 80.453 1.00 55.71  ? 337  PRO A CD  1 
ATOM   2614 N N   . GLY A 1 338 ? 11.237  62.648 82.606 1.00 39.00  ? 338  GLY A N   1 
ATOM   2615 C CA  . GLY A 1 338 ? 12.437  63.408 82.888 1.00 39.00  ? 338  GLY A CA  1 
ATOM   2616 C C   . GLY A 1 338 ? 12.498  64.724 82.147 1.00 39.00  ? 338  GLY A C   1 
ATOM   2617 O O   . GLY A 1 338 ? 13.213  65.626 82.575 1.00 39.00  ? 338  GLY A O   1 
ATOM   2618 N N   . PHE A 1 339 ? 11.745  64.842 81.051 1.00 48.37  ? 339  PHE A N   1 
ATOM   2619 C CA  . PHE A 1 339 ? 11.735  66.057 80.236 1.00 48.37  ? 339  PHE A CA  1 
ATOM   2620 C C   . PHE A 1 339 ? 10.608  67.021 80.596 1.00 48.37  ? 339  PHE A C   1 
ATOM   2621 O O   . PHE A 1 339 ? 9.468   66.609 80.790 1.00 48.37  ? 339  PHE A O   1 
ATOM   2622 C CB  . PHE A 1 339 ? 11.646  65.687 78.752 1.00 28.78  ? 339  PHE A CB  1 
ATOM   2623 C CG  . PHE A 1 339 ? 12.760  64.791 78.284 1.00 28.78  ? 339  PHE A CG  1 
ATOM   2624 C CD1 . PHE A 1 339 ? 12.827  63.469 78.697 1.00 28.78  ? 339  PHE A CD1 1 
ATOM   2625 C CD2 . PHE A 1 339 ? 13.748  65.274 77.441 1.00 28.78  ? 339  PHE A CD2 1 
ATOM   2626 C CE1 . PHE A 1 339 ? 13.859  62.640 78.277 1.00 28.78  ? 339  PHE A CE1 1 
ATOM   2627 C CE2 . PHE A 1 339 ? 14.789  64.455 77.014 1.00 28.78  ? 339  PHE A CE2 1 
ATOM   2628 C CZ  . PHE A 1 339 ? 14.843  63.133 77.433 1.00 28.78  ? 339  PHE A CZ  1 
ATOM   2629 N N   . SER A 1 340 ? 10.932  68.308 80.686 1.00 38.75  ? 340  SER A N   1 
ATOM   2630 C CA  . SER A 1 340 ? 9.944   69.336 81.026 1.00 38.75  ? 340  SER A CA  1 
ATOM   2631 C C   . SER A 1 340 ? 10.101  70.548 80.134 1.00 38.75  ? 340  SER A C   1 
ATOM   2632 O O   . SER A 1 340 ? 11.215  70.972 79.844 1.00 38.75  ? 340  SER A O   1 
ATOM   2633 C CB  . SER A 1 340 ? 10.100  69.793 82.482 1.00 77.98  ? 340  SER A CB  1 
ATOM   2634 O OG  . SER A 1 340 ? 9.733   68.776 83.400 1.00 77.98  ? 340  SER A OG  1 
ATOM   2635 N N   . LYS A 1 341 ? 8.983   71.120 79.715 1.00 35.05  ? 341  LYS A N   1 
ATOM   2636 C CA  . LYS A 1 341 ? 9.033   72.288 78.857 1.00 35.05  ? 341  LYS A CA  1 
ATOM   2637 C C   . LYS A 1 341 ? 9.713   73.447 79.564 1.00 35.05  ? 341  LYS A C   1 
ATOM   2638 O O   . LYS A 1 341 ? 10.205  74.362 78.919 1.00 35.05  ? 341  LYS A O   1 
ATOM   2639 C CB  . LYS A 1 341 ? 7.623   72.722 78.448 1.00 44.95  ? 341  LYS A CB  1 
ATOM   2640 C CG  . LYS A 1 341 ? 7.624   73.871 77.446 1.00 44.95  ? 341  LYS A CG  1 
ATOM   2641 C CD  . LYS A 1 341 ? 6.231   74.406 77.140 1.00 44.95  ? 341  LYS A CD  1 
ATOM   2642 C CE  . LYS A 1 341 ? 5.651   75.160 78.331 1.00 44.95  ? 341  LYS A CE  1 
ATOM   2643 N NZ  . LYS A 1 341 ? 6.484   76.315 78.769 1.00 44.95  ? 341  LYS A NZ  1 
ATOM   2644 N N   . ASP A 1 342 ? 9.757   73.407 80.889 1.00 41.02  ? 342  ASP A N   1 
ATOM   2645 C CA  . ASP A 1 342 ? 10.344  74.510 81.629 1.00 41.02  ? 342  ASP A CA  1 
ATOM   2646 C C   . ASP A 1 342 ? 11.636  74.243 82.397 1.00 41.02  ? 342  ASP A C   1 
ATOM   2647 O O   . ASP A 1 342 ? 12.000  75.039 83.254 1.00 41.02  ? 342  ASP A O   1 
ATOM   2648 C CB  . ASP A 1 342 ? 9.302   75.118 82.595 1.00 72.46  ? 342  ASP A CB  1 
ATOM   2649 C CG  . ASP A 1 342 ? 8.098   75.763 81.870 1.00 72.46  ? 342  ASP A CG  1 
ATOM   2650 O OD1 . ASP A 1 342 ? 8.276   76.395 80.801 1.00 72.46  ? 342  ASP A OD1 1 
ATOM   2651 O OD2 . ASP A 1 342 ? 6.959   75.658 82.384 1.00 72.46  ? 342  ASP A OD2 1 
ATOM   2652 N N   . SER A 1 343 ? 12.334  73.146 82.124 1.00 36.67  ? 343  SER A N   1 
ATOM   2653 C CA  . SER A 1 343 ? 13.595  72.886 82.827 1.00 36.67  ? 343  SER A CA  1 
ATOM   2654 C C   . SER A 1 343 ? 14.671  72.487 81.833 1.00 36.67  ? 343  SER A C   1 
ATOM   2655 O O   . SER A 1 343 ? 14.382  72.272 80.659 1.00 36.67  ? 343  SER A O   1 
ATOM   2656 C CB  . SER A 1 343 ? 13.430  71.781 83.870 1.00 44.52  ? 343  SER A CB  1 
ATOM   2657 O OG  . SER A 1 343 ? 13.185  70.523 83.268 1.00 44.52  ? 343  SER A OG  1 
ATOM   2658 N N   . GLU A 1 344 ? 15.914  72.394 82.288 1.00 39.07  ? 344  GLU A N   1 
ATOM   2659 C CA  . GLU A 1 344 ? 16.996  72.008 81.389 1.00 39.07  ? 344  GLU A CA  1 
ATOM   2660 C C   . GLU A 1 344 ? 16.871  70.537 81.035 1.00 39.07  ? 344  GLU A C   1 
ATOM   2661 O O   . GLU A 1 344 ? 17.583  70.027 80.162 1.00 39.07  ? 344  GLU A O   1 
ATOM   2662 C CB  . GLU A 1 344 ? 18.349  72.232 82.039 1.00 81.11  ? 344  GLU A CB  1 
ATOM   2663 C CG  . GLU A 1 344 ? 18.821  73.658 82.067 1.00 81.11  ? 344  GLU A CG  1 
ATOM   2664 C CD  . GLU A 1 344 ? 20.248  73.733 82.570 1.00 81.11  ? 344  GLU A CD  1 
ATOM   2665 O OE1 . GLU A 1 344 ? 20.482  73.396 83.761 1.00 81.11  ? 344  GLU A OE1 1 
ATOM   2666 O OE2 . GLU A 1 344 ? 21.137  74.107 81.764 1.00 81.11  ? 344  GLU A OE2 1 
ATOM   2667 N N   . SER A 1 345 ? 15.971  69.861 81.743 1.00 39.58  ? 345  SER A N   1 
ATOM   2668 C CA  . SER A 1 345 ? 15.705  68.450 81.526 1.00 39.58  ? 345  SER A CA  1 
ATOM   2669 C C   . SER A 1 345 ? 16.964  67.591 81.455 1.00 39.58  ? 345  SER A C   1 
ATOM   2670 O O   . SER A 1 345 ? 17.188  66.868 80.480 1.00 39.58  ? 345  SER A O   1 
ATOM   2671 C CB  . SER A 1 345 ? 14.885  68.269 80.245 1.00 37.10  ? 345  SER A CB  1 
ATOM   2672 O OG  . SER A 1 345 ? 13.664  68.984 80.315 1.00 37.10  ? 345  SER A OG  1 
ATOM   2673 N N   . LYS A 1 346 ? 17.799  67.673 82.479 1.00 36.10  ? 346  LYS A N   1 
ATOM   2674 C CA  . LYS A 1 346 ? 18.989  66.849 82.502 1.00 36.10  ? 346  LYS A CA  1 
ATOM   2675 C C   . LYS A 1 346 ? 18.486  65.455 82.884 1.00 36.10  ? 346  LYS A C   1 
ATOM   2676 O O   . LYS A 1 346 ? 17.672  65.304 83.792 1.00 36.10  ? 346  LYS A O   1 
ATOM   2677 C CB  . LYS A 1 346 ? 19.973  67.409 83.514 1.00 61.05  ? 346  LYS A CB  1 
ATOM   2678 C CG  . LYS A 1 346 ? 20.464  68.788 83.111 1.00 61.05  ? 346  LYS A CG  1 
ATOM   2679 C CD  . LYS A 1 346 ? 21.290  69.463 84.201 1.00 61.05  ? 346  LYS A CD  1 
ATOM   2680 C CE  . LYS A 1 346 ? 21.799  70.827 83.711 1.00 61.05  ? 346  LYS A CE  1 
ATOM   2681 N NZ  . LYS A 1 346 ? 22.465  71.629 84.782 1.00 61.05  ? 346  LYS A NZ  1 
ATOM   2682 N N   . ILE A 1 347 ? 18.950  64.436 82.173 1.00 47.70  ? 347  ILE A N   1 
ATOM   2683 C CA  . ILE A 1 347 ? 18.478  63.077 82.413 1.00 47.70  ? 347  ILE A CA  1 
ATOM   2684 C C   . ILE A 1 347 ? 19.477  62.170 83.133 1.00 47.70  ? 347  ILE A C   1 
ATOM   2685 O O   . ILE A 1 347 ? 20.669  62.117 82.802 1.00 47.70  ? 347  ILE A O   1 
ATOM   2686 C CB  . ILE A 1 347 ? 18.040  62.416 81.061 1.00 38.56  ? 347  ILE A CB  1 
ATOM   2687 C CG1 . ILE A 1 347 ? 17.025  63.309 80.354 1.00 38.56  ? 347  ILE A CG1 1 
ATOM   2688 C CG2 . ILE A 1 347 ? 17.385  61.075 81.306 1.00 38.56  ? 347  ILE A CG2 1 
ATOM   2689 C CD1 . ILE A 1 347 ? 15.765  63.535 81.161 1.00 38.56  ? 347  ILE A CD1 1 
ATOM   2690 N N   . SER A 1 348 ? 18.958  61.452 84.121 1.00 45.74  ? 348  SER A N   1 
ATOM   2691 C CA  . SER A 1 348 ? 19.741  60.528 84.923 1.00 45.74  ? 348  SER A CA  1 
ATOM   2692 C C   . SER A 1 348 ? 19.890  59.206 84.191 1.00 45.74  ? 348  SER A C   1 
ATOM   2693 O O   . SER A 1 348 ? 19.252  58.988 83.173 1.00 45.74  ? 348  SER A O   1 
ATOM   2694 C CB  . SER A 1 348 ? 19.016  60.265 86.229 1.00 40.51  ? 348  SER A CB  1 
ATOM   2695 O OG  . SER A 1 348 ? 17.751  59.675 85.964 1.00 40.51  ? 348  SER A OG  1 
ATOM   2696 N N   . ARG A 1 349 ? 20.714  58.313 84.725 1.00 59.02  ? 349  ARG A N   1 
ATOM   2697 C CA  . ARG A 1 349 ? 20.899  57.009 84.113 1.00 59.02  ? 349  ARG A CA  1 
ATOM   2698 C C   . ARG A 1 349 ? 19.568  56.279 84.041 1.00 59.02  ? 349  ARG A C   1 
ATOM   2699 O O   . ARG A 1 349 ? 19.204  55.767 82.987 1.00 59.02  ? 349  ARG A O   1 
ATOM   2700 C CB  . ARG A 1 349 ? 21.872  56.163 84.929 1.00 50.38  ? 349  ARG A CB  1 
ATOM   2701 C CG  . ARG A 1 349 ? 23.319  56.246 84.494 1.00 50.38  ? 349  ARG A CG  1 
ATOM   2702 C CD  . ARG A 1 349 ? 23.554  55.453 83.238 1.00 50.38  ? 349  ARG A CD  1 
ATOM   2703 N NE  . ARG A 1 349 ? 23.673  56.327 82.084 1.00 50.38  ? 349  ARG A NE  1 
ATOM   2704 C CZ  . ARG A 1 349 ? 23.925  55.897 80.851 1.00 50.38  ? 349  ARG A CZ  1 
ATOM   2705 N NH1 . ARG A 1 349 ? 24.085  54.596 80.623 1.00 50.38  ? 349  ARG A NH1 1 
ATOM   2706 N NH2 . ARG A 1 349 ? 24.005  56.763 79.846 1.00 50.38  ? 349  ARG A NH2 1 
ATOM   2707 N N   . GLU A 1 350 ? 18.837  56.237 85.152 1.00 59.04  ? 350  GLU A N   1 
ATOM   2708 C CA  . GLU A 1 350 ? 17.559  55.520 85.183 1.00 59.04  ? 350  GLU A CA  1 
ATOM   2709 C C   . GLU A 1 350 ? 16.594  56.013 84.112 1.00 59.04  ? 350  GLU A C   1 
ATOM   2710 O O   . GLU A 1 350 ? 16.034  55.201 83.370 1.00 59.04  ? 350  GLU A O   1 
ATOM   2711 C CB  . GLU A 1 350 ? 16.878  55.616 86.561 1.00 102.21 ? 350  GLU A CB  1 
ATOM   2712 C CG  . GLU A 1 350 ? 17.730  56.206 87.673 1.00 102.21 ? 350  GLU A CG  1 
ATOM   2713 C CD  . GLU A 1 350 ? 19.000  55.408 87.948 1.00 102.21 ? 350  GLU A CD  1 
ATOM   2714 O OE1 . GLU A 1 350 ? 19.891  55.330 87.057 1.00 102.21 ? 350  GLU A OE1 1 
ATOM   2715 O OE2 . GLU A 1 350 ? 19.105  54.856 89.069 1.00 102.21 ? 350  GLU A OE2 1 
ATOM   2716 N N   . ASP A 1 351 ? 16.392  57.328 84.021 1.00 43.62  ? 351  ASP A N   1 
ATOM   2717 C CA  . ASP A 1 351 ? 15.481  57.861 83.007 1.00 43.62  ? 351  ASP A CA  1 
ATOM   2718 C C   . ASP A 1 351 ? 16.011  57.651 81.586 1.00 43.62  ? 351  ASP A C   1 
ATOM   2719 O O   . ASP A 1 351 ? 15.239  57.429 80.653 1.00 43.62  ? 351  ASP A O   1 
ATOM   2720 C CB  . ASP A 1 351 ? 15.191  59.346 83.254 1.00 90.43  ? 351  ASP A CB  1 
ATOM   2721 C CG  . ASP A 1 351 ? 14.312  59.577 84.497 1.00 90.43  ? 351  ASP A CG  1 
ATOM   2722 O OD1 . ASP A 1 351 ? 13.447  58.708 84.803 1.00 90.43  ? 351  ASP A OD1 1 
ATOM   2723 O OD2 . ASP A 1 351 ? 14.477  60.635 85.163 1.00 90.43  ? 351  ASP A OD2 1 
ATOM   2724 N N   . PHE A 1 352 ? 17.329  57.709 81.429 1.00 35.08  ? 352  PHE A N   1 
ATOM   2725 C CA  . PHE A 1 352 ? 17.931  57.497 80.126 1.00 35.08  ? 352  PHE A CA  1 
ATOM   2726 C C   . PHE A 1 352 ? 17.478  56.147 79.621 1.00 35.08  ? 352  PHE A C   1 
ATOM   2727 O O   . PHE A 1 352 ? 16.911  56.027 78.531 1.00 35.08  ? 352  PHE A O   1 
ATOM   2728 C CB  . PHE A 1 352 ? 19.450  57.474 80.218 1.00 33.08  ? 352  PHE A CB  1 
ATOM   2729 C CG  . PHE A 1 352 ? 20.123  57.207 78.907 1.00 33.08  ? 352  PHE A CG  1 
ATOM   2730 C CD1 . PHE A 1 352 ? 20.296  58.224 77.985 1.00 33.08  ? 352  PHE A CD1 1 
ATOM   2731 C CD2 . PHE A 1 352 ? 20.541  55.924 78.575 1.00 33.08  ? 352  PHE A CD2 1 
ATOM   2732 C CE1 . PHE A 1 352 ? 20.873  57.970 76.752 1.00 33.08  ? 352  PHE A CE1 1 
ATOM   2733 C CE2 . PHE A 1 352 ? 21.120  55.658 77.339 1.00 33.08  ? 352  PHE A CE2 1 
ATOM   2734 C CZ  . PHE A 1 352 ? 21.285  56.686 76.425 1.00 33.08  ? 352  PHE A CZ  1 
ATOM   2735 N N   . MET A 1 353 ? 17.737  55.124 80.422 1.00 41.54  ? 353  MET A N   1 
ATOM   2736 C CA  . MET A 1 353 ? 17.365  53.781 80.039 1.00 41.54  ? 353  MET A CA  1 
ATOM   2737 C C   . MET A 1 353 ? 15.867  53.601 79.901 1.00 41.54  ? 353  MET A C   1 
ATOM   2738 O O   . MET A 1 353 ? 15.420  52.764 79.126 1.00 41.54  ? 353  MET A O   1 
ATOM   2739 C CB  . MET A 1 353 ? 17.969  52.785 81.008 1.00 73.01  ? 353  MET A CB  1 
ATOM   2740 C CG  . MET A 1 353 ? 19.487  52.766 80.910 1.00 73.01  ? 353  MET A CG  1 
ATOM   2741 S SD  . MET A 1 353 ? 20.211  51.518 81.977 1.00 73.01  ? 353  MET A SD  1 
ATOM   2742 C CE  . MET A 1 353 ? 19.695  52.132 83.655 1.00 73.01  ? 353  MET A CE  1 
ATOM   2743 N N   . SER A 1 354 ? 15.082  54.378 80.634 1.00 40.32  ? 354  SER A N   1 
ATOM   2744 C CA  . SER A 1 354 ? 13.642  54.277 80.467 1.00 40.32  ? 354  SER A CA  1 
ATOM   2745 C C   . SER A 1 354 ? 13.339  54.882 79.100 1.00 40.32  ? 354  SER A C   1 
ATOM   2746 O O   . SER A 1 354 ? 12.332  54.562 78.477 1.00 40.32  ? 354  SER A O   1 
ATOM   2747 C CB  . SER A 1 354 ? 12.905  55.076 81.528 1.00 45.65  ? 354  SER A CB  1 
ATOM   2748 O OG  . SER A 1 354 ? 13.162  54.540 82.803 1.00 45.65  ? 354  SER A OG  1 
ATOM   2749 N N   . GLY A 1 355 ? 14.224  55.762 78.638 1.00 31.77  ? 355  GLY A N   1 
ATOM   2750 C CA  . GLY A 1 355 ? 14.032  56.401 77.351 1.00 31.77  ? 355  GLY A CA  1 
ATOM   2751 C C   . GLY A 1 355 ? 14.298  55.468 76.188 1.00 31.77  ? 355  GLY A C   1 
ATOM   2752 O O   . GLY A 1 355 ? 13.550  55.438 75.211 1.00 31.77  ? 355  GLY A O   1 
ATOM   2753 N N   . VAL A 1 356 ? 15.373  54.698 76.288 1.00 42.97  ? 356  VAL A N   1 
ATOM   2754 C CA  . VAL A 1 356 ? 15.717  53.765 75.226 1.00 42.97  ? 356  VAL A CA  1 
ATOM   2755 C C   . VAL A 1 356 ? 14.654  52.678 75.100 1.00 42.97  ? 356  VAL A C   1 
ATOM   2756 O O   . VAL A 1 356 ? 14.423  52.143 74.020 1.00 42.97  ? 356  VAL A O   1 
ATOM   2757 C CB  . VAL A 1 356 ? 17.082  53.117 75.483 1.00 30.60  ? 356  VAL A CB  1 
ATOM   2758 C CG1 . VAL A 1 356 ? 17.374  52.100 74.405 1.00 30.60  ? 356  VAL A CG1 1 
ATOM   2759 C CG2 . VAL A 1 356 ? 18.156  54.186 75.520 1.00 30.60  ? 356  VAL A CG2 1 
ATOM   2760 N N   . LYS A 1 357 ? 13.997  52.353 76.202 1.00 40.95  ? 357  LYS A N   1 
ATOM   2761 C CA  . LYS A 1 357 ? 12.963  51.333 76.168 1.00 40.95  ? 357  LYS A CA  1 
ATOM   2762 C C   . LYS A 1 357 ? 11.778  51.886 75.392 1.00 40.95  ? 357  LYS A C   1 
ATOM   2763 O O   . LYS A 1 357 ? 11.186  51.191 74.575 1.00 40.95  ? 357  LYS A O   1 
ATOM   2764 C CB  . LYS A 1 357 ? 12.541  50.957 77.595 1.00 60.66  ? 357  LYS A CB  1 
ATOM   2765 C CG  . LYS A 1 357 ? 11.529  49.806 77.690 1.00 60.66  ? 357  LYS A CG  1 
ATOM   2766 C CD  . LYS A 1 357 ? 12.095  48.506 77.139 1.00 60.66  ? 357  LYS A CD  1 
ATOM   2767 C CE  . LYS A 1 357 ? 11.032  47.417 77.032 1.00 60.66  ? 357  LYS A CE  1 
ATOM   2768 N NZ  . LYS A 1 357 ? 11.569  46.223 76.296 1.00 60.66  ? 357  LYS A NZ  1 
ATOM   2769 N N   . LEU A 1 358 ? 11.446  53.146 75.651 1.00 30.62  ? 358  LEU A N   1 
ATOM   2770 C CA  . LEU A 1 358 ? 10.339  53.816 74.984 1.00 30.62  ? 358  LEU A CA  1 
ATOM   2771 C C   . LEU A 1 358 ? 10.612  54.110 73.496 1.00 30.62  ? 358  LEU A C   1 
ATOM   2772 O O   . LEU A 1 358 ? 9.688   54.125 72.689 1.00 30.62  ? 358  LEU A O   1 
ATOM   2773 C CB  . LEU A 1 358 ? 10.018  55.122 75.721 1.00 21.78  ? 358  LEU A CB  1 
ATOM   2774 C CG  . LEU A 1 358 ? 8.810   55.234 76.661 1.00 21.78  ? 358  LEU A CG  1 
ATOM   2775 C CD1 . LEU A 1 358 ? 8.747   54.077 77.621 1.00 21.78  ? 358  LEU A CD1 1 
ATOM   2776 C CD2 . LEU A 1 358 ? 8.905   56.539 77.423 1.00 21.78  ? 358  LEU A CD2 1 
ATOM   2777 N N   . SER A 1 359 ? 11.877  54.331 73.135 1.00 42.21  ? 359  SER A N   1 
ATOM   2778 C CA  . SER A 1 359 ? 12.253  54.651 71.754 1.00 42.21  ? 359  SER A CA  1 
ATOM   2779 C C   . SER A 1 359 ? 12.373  53.470 70.812 1.00 42.21  ? 359  SER A C   1 
ATOM   2780 O O   . SER A 1 359 ? 12.069  53.588 69.632 1.00 42.21  ? 359  SER A O   1 
ATOM   2781 C CB  . SER A 1 359 ? 13.566  55.415 71.736 1.00 37.13  ? 359  SER A CB  1 
ATOM   2782 O OG  . SER A 1 359 ? 13.481  56.541 72.584 1.00 37.13  ? 359  SER A OG  1 
ATOM   2783 N N   . VAL A 1 360 ? 12.846  52.342 71.317 1.00 39.83  ? 360  VAL A N   1 
ATOM   2784 C CA  . VAL A 1 360 ? 12.965  51.159 70.483 1.00 39.83  ? 360  VAL A CA  1 
ATOM   2785 C C   . VAL A 1 360 ? 12.061  50.114 71.113 1.00 39.83  ? 360  VAL A C   1 
ATOM   2786 O O   . VAL A 1 360 ? 12.521  49.101 71.644 1.00 39.83  ? 360  VAL A O   1 
ATOM   2787 C CB  . VAL A 1 360 ? 14.405  50.639 70.446 1.00 37.45  ? 360  VAL A CB  1 
ATOM   2788 C CG1 . VAL A 1 360 ? 14.510  49.481 69.464 1.00 37.45  ? 360  VAL A CG1 1 
ATOM   2789 C CG2 . VAL A 1 360 ? 15.348  51.768 70.063 1.00 37.45  ? 360  VAL A CG2 1 
ATOM   2790 N N   . PRO A 1 361 ? 10.746  50.342 71.035 1.00 48.44  ? 361  PRO A N   1 
ATOM   2791 C CA  . PRO A 1 361 ? 9.698   49.482 71.583 1.00 48.44  ? 361  PRO A CA  1 
ATOM   2792 C C   . PRO A 1 361 ? 9.722   48.022 71.123 1.00 48.44  ? 361  PRO A C   1 
ATOM   2793 O O   . PRO A 1 361 ? 9.321   47.118 71.860 1.00 48.44  ? 361  PRO A O   1 
ATOM   2794 C CB  . PRO A 1 361 ? 8.433   50.206 71.153 1.00 39.37  ? 361  PRO A CB  1 
ATOM   2795 C CG  . PRO A 1 361 ? 8.815   50.728 69.804 1.00 39.37  ? 361  PRO A CG  1 
ATOM   2796 C CD  . PRO A 1 361 ? 10.174  51.305 70.077 1.00 39.37  ? 361  PRO A CD  1 
ATOM   2797 N N   . HIS A 1 362 ? 10.194  47.798 69.904 1.00 67.57  ? 362  HIS A N   1 
ATOM   2798 C CA  . HIS A 1 362 ? 10.243  46.459 69.329 1.00 67.57  ? 362  HIS A CA  1 
ATOM   2799 C C   . HIS A 1 362 ? 11.600  45.789 69.519 1.00 67.57  ? 362  HIS A C   1 
ATOM   2800 O O   . HIS A 1 362 ? 12.006  44.978 68.675 1.00 67.57  ? 362  HIS A O   1 
ATOM   2801 C CB  . HIS A 1 362 ? 9.960   46.545 67.829 1.00 75.48  ? 362  HIS A CB  1 
ATOM   2802 C CG  . HIS A 1 362 ? 10.970  47.360 67.083 1.00 75.48  ? 362  HIS A CG  1 
ATOM   2803 N ND1 . HIS A 1 362 ? 11.121  48.718 67.276 1.00 75.48  ? 362  HIS A ND1 1 
ATOM   2804 C CD2 . HIS A 1 362 ? 11.903  47.005 66.165 1.00 75.48  ? 362  HIS A CD2 1 
ATOM   2805 C CE1 . HIS A 1 362 ? 12.102  49.164 66.508 1.00 75.48  ? 362  HIS A CE1 1 
ATOM   2806 N NE2 . HIS A 1 362 ? 12.595  48.145 65.824 1.00 75.48  ? 362  HIS A NE2 1 
ATOM   2807 N N   . ALA A 1 363 ? 12.307  46.110 70.600 1.00 42.51  ? 363  ALA A N   1 
ATOM   2808 C CA  . ALA A 1 363 ? 13.626  45.521 70.798 1.00 42.51  ? 363  ALA A CA  1 
ATOM   2809 C C   . ALA A 1 363 ? 13.765  44.677 72.045 1.00 42.51  ? 363  ALA A C   1 
ATOM   2810 O O   . ALA A 1 363 ? 13.335  45.076 73.131 1.00 42.51  ? 363  ALA A O   1 
ATOM   2811 C CB  . ALA A 1 363 ? 14.678  46.613 70.803 1.00 50.49  ? 363  ALA A CB  1 
ATOM   2812 N N   . ASN A 1 364 ? 14.378  43.506 71.885 1.00 41.73  ? 364  ASN A N   1 
ATOM   2813 C CA  . ASN A 1 364 ? 14.601  42.605 73.009 1.00 41.73  ? 364  ASN A CA  1 
ATOM   2814 C C   . ASN A 1 364 ? 15.657  43.218 73.917 1.00 41.73  ? 364  ASN A C   1 
ATOM   2815 O O   . ASN A 1 364 ? 16.221  44.270 73.605 1.00 41.73  ? 364  ASN A O   1 
ATOM   2816 C CB  . ASN A 1 364 ? 15.070  41.233 72.531 1.00 42.12  ? 364  ASN A CB  1 
ATOM   2817 C CG  . ASN A 1 364 ? 16.321  41.300 71.694 1.00 42.12  ? 364  ASN A CG  1 
ATOM   2818 O OD1 . ASN A 1 364 ? 16.989  42.325 71.638 1.00 42.12  ? 364  ASN A OD1 1 
ATOM   2819 N ND2 . ASN A 1 364 ? 16.653  40.196 71.044 1.00 42.12  ? 364  ASN A ND2 1 
ATOM   2820 N N   . ASP A 1 365 ? 15.938  42.555 75.034 1.00 60.85  ? 365  ASP A N   1 
ATOM   2821 C CA  . ASP A 1 365 ? 16.900  43.076 75.989 1.00 60.85  ? 365  ASP A CA  1 
ATOM   2822 C C   . ASP A 1 365 ? 18.325  43.171 75.460 1.00 60.85  ? 365  ASP A C   1 
ATOM   2823 O O   . ASP A 1 365 ? 19.157  43.911 76.002 1.00 60.85  ? 365  ASP A O   1 
ATOM   2824 C CB  . ASP A 1 365 ? 16.842  42.255 77.278 1.00 99.16  ? 365  ASP A CB  1 
ATOM   2825 C CG  . ASP A 1 365 ? 15.737  42.749 78.238 1.00 99.16  ? 365  ASP A CG  1 
ATOM   2826 O OD1 . ASP A 1 365 ? 14.868  43.543 77.788 1.00 99.16  ? 365  ASP A OD1 1 
ATOM   2827 O OD2 . ASP A 1 365 ? 15.732  42.349 79.440 1.00 99.16  ? 365  ASP A OD2 1 
ATOM   2828 N N   . LEU A 1 366 ? 18.617  42.445 74.391 1.00 40.00  ? 366  LEU A N   1 
ATOM   2829 C CA  . LEU A 1 366 ? 19.953  42.514 73.846 1.00 40.00  ? 366  LEU A CA  1 
ATOM   2830 C C   . LEU A 1 366 ? 20.052  43.782 73.006 1.00 40.00  ? 366  LEU A C   1 
ATOM   2831 O O   . LEU A 1 366 ? 21.067  44.473 73.038 1.00 40.00  ? 366  LEU A O   1 
ATOM   2832 C CB  . LEU A 1 366 ? 20.244  41.276 73.004 1.00 51.46  ? 366  LEU A CB  1 
ATOM   2833 C CG  . LEU A 1 366 ? 21.702  41.143 72.567 1.00 51.46  ? 366  LEU A CG  1 
ATOM   2834 C CD1 . LEU A 1 366 ? 22.616  41.392 73.765 1.00 51.46  ? 366  LEU A CD1 1 
ATOM   2835 C CD2 . LEU A 1 366 ? 21.936  39.761 71.966 1.00 51.46  ? 366  LEU A CD2 1 
ATOM   2836 N N   . GLY A 1 367 ? 18.983  44.093 72.271 1.00 31.30  ? 367  GLY A N   1 
ATOM   2837 C CA  . GLY A 1 367 ? 18.957  45.286 71.431 1.00 31.30  ? 367  GLY A CA  1 
ATOM   2838 C C   . GLY A 1 367 ? 19.027  46.560 72.249 1.00 31.30  ? 367  GLY A C   1 
ATOM   2839 O O   . GLY A 1 367 ? 19.741  47.489 71.907 1.00 31.30  ? 367  GLY A O   1 
ATOM   2840 N N   . LEU A 1 368 ? 18.275  46.596 73.342 1.00 36.08  ? 368  LEU A N   1 
ATOM   2841 C CA  . LEU A 1 368 ? 18.267  47.751 74.223 1.00 36.08  ? 368  LEU A CA  1 
ATOM   2842 C C   . LEU A 1 368 ? 19.676  48.008 74.709 1.00 36.08  ? 368  LEU A C   1 
ATOM   2843 O O   . LEU A 1 368 ? 20.048  49.145 74.974 1.00 36.08  ? 368  LEU A O   1 
ATOM   2844 C CB  . LEU A 1 368 ? 17.355  47.505 75.420 1.00 29.29  ? 368  LEU A CB  1 
ATOM   2845 C CG  . LEU A 1 368 ? 15.871  47.408 75.090 1.00 29.29  ? 368  LEU A CG  1 
ATOM   2846 C CD1 . LEU A 1 368 ? 15.114  46.939 76.308 1.00 29.29  ? 368  LEU A CD1 1 
ATOM   2847 C CD2 . LEU A 1 368 ? 15.362  48.754 74.618 1.00 29.29  ? 368  LEU A CD2 1 
ATOM   2848 N N   . ASP A 1 369 ? 20.458  46.944 74.836 1.00 45.97  ? 369  ASP A N   1 
ATOM   2849 C CA  . ASP A 1 369 ? 21.838  47.072 75.277 1.00 45.97  ? 369  ASP A CA  1 
ATOM   2850 C C   . ASP A 1 369 ? 22.687  47.605 74.147 1.00 45.97  ? 369  ASP A C   1 
ATOM   2851 O O   . ASP A 1 369 ? 23.548  48.452 74.365 1.00 45.97  ? 369  ASP A O   1 
ATOM   2852 C CB  . ASP A 1 369 ? 22.377  45.728 75.750 1.00 95.92  ? 369  ASP A CB  1 
ATOM   2853 C CG  . ASP A 1 369 ? 21.852  45.353 77.123 1.00 95.92  ? 369  ASP A CG  1 
ATOM   2854 O OD1 . ASP A 1 369 ? 20.907  46.042 77.591 1.00 95.92  ? 369  ASP A OD1 1 
ATOM   2855 O OD2 . ASP A 1 369 ? 22.374  44.382 77.737 1.00 95.92  ? 369  ASP A OD2 1 
ATOM   2856 N N   . ALA A 1 370 ? 22.450  47.117 72.936 1.00 35.64  ? 370  ALA A N   1 
ATOM   2857 C CA  . ALA A 1 370 ? 23.215  47.605 71.809 1.00 35.64  ? 370  ALA A CA  1 
ATOM   2858 C C   . ALA A 1 370 ? 22.989  49.109 71.717 1.00 35.64  ? 370  ALA A C   1 
ATOM   2859 O O   . ALA A 1 370 ? 23.940  49.878 71.740 1.00 35.64  ? 370  ALA A O   1 
ATOM   2860 C CB  . ALA A 1 370 ? 22.778  46.926 70.535 1.00 26.07  ? 370  ALA A CB  1 
ATOM   2861 N N   . VAL A 1 371 ? 21.737  49.543 71.648 1.00 30.55  ? 371  VAL A N   1 
ATOM   2862 C CA  . VAL A 1 371 ? 21.448  50.973 71.550 1.00 30.55  ? 371  VAL A CA  1 
ATOM   2863 C C   . VAL A 1 371 ? 22.123  51.805 72.650 1.00 30.55  ? 371  VAL A C   1 
ATOM   2864 O O   . VAL A 1 371 ? 22.710  52.859 72.376 1.00 30.55  ? 371  VAL A O   1 
ATOM   2865 C CB  . VAL A 1 371 ? 19.928  51.238 71.585 1.00 32.02  ? 371  VAL A CB  1 
ATOM   2866 C CG1 . VAL A 1 371 ? 19.669  52.719 71.519 1.00 32.02  ? 371  VAL A CG1 1 
ATOM   2867 C CG2 . VAL A 1 371 ? 19.244  50.538 70.420 1.00 32.02  ? 371  VAL A CG2 1 
ATOM   2868 N N   . THR A 1 372 ? 22.040  51.321 73.888 1.00 29.57  ? 372  THR A N   1 
ATOM   2869 C CA  . THR A 1 372 ? 22.626  51.995 75.051 1.00 29.57  ? 372  THR A CA  1 
ATOM   2870 C C   . THR A 1 372 ? 24.142  52.116 74.987 1.00 29.57  ? 372  THR A C   1 
ATOM   2871 O O   . THR A 1 372 ? 24.708  53.147 75.347 1.00 29.57  ? 372  THR A O   1 
ATOM   2872 C CB  . THR A 1 372 ? 22.264  51.257 76.345 1.00 38.71  ? 372  THR A CB  1 
ATOM   2873 O OG1 . THR A 1 372 ? 20.878  51.472 76.652 1.00 38.71  ? 372  THR A OG1 1 
ATOM   2874 C CG2 . THR A 1 372 ? 23.135  51.742 77.495 1.00 38.71  ? 372  THR A CG2 1 
ATOM   2875 N N   . LEU A 1 373 ? 24.793  51.045 74.547 1.00 45.55  ? 373  LEU A N   1 
ATOM   2876 C CA  . LEU A 1 373 ? 26.241  51.019 74.414 1.00 45.55  ? 373  LEU A CA  1 
ATOM   2877 C C   . LEU A 1 373 ? 26.682  51.999 73.331 1.00 45.55  ? 373  LEU A C   1 
ATOM   2878 O O   . LEU A 1 373 ? 27.642  52.744 73.515 1.00 45.55  ? 373  LEU A O   1 
ATOM   2879 C CB  . LEU A 1 373 ? 26.716  49.606 74.059 1.00 42.47  ? 373  LEU A CB  1 
ATOM   2880 C CG  . LEU A 1 373 ? 28.174  49.459 73.601 1.00 42.47  ? 373  LEU A CG  1 
ATOM   2881 C CD1 . LEU A 1 373 ? 29.124  50.062 74.636 1.00 42.47  ? 373  LEU A CD1 1 
ATOM   2882 C CD2 . LEU A 1 373 ? 28.494  47.999 73.390 1.00 42.47  ? 373  LEU A CD2 1 
ATOM   2883 N N   . GLN A 1 374 ? 25.963  52.000 72.213 1.00 36.79  ? 374  GLN A N   1 
ATOM   2884 C CA  . GLN A 1 374 ? 26.254  52.872 71.070 1.00 36.79  ? 374  GLN A CA  1 
ATOM   2885 C C   . GLN A 1 374 ? 26.043  54.354 71.344 1.00 36.79  ? 374  GLN A C   1 
ATOM   2886 O O   . GLN A 1 374 ? 26.591  55.201 70.648 1.00 36.79  ? 374  GLN A O   1 
ATOM   2887 C CB  . GLN A 1 374 ? 25.360  52.486 69.886 1.00 42.05  ? 374  GLN A CB  1 
ATOM   2888 C CG  . GLN A 1 374 ? 25.744  53.120 68.577 1.00 42.05  ? 374  GLN A CG  1 
ATOM   2889 C CD  . GLN A 1 374 ? 26.990  52.477 67.995 1.00 42.05  ? 374  GLN A CD  1 
ATOM   2890 O OE1 . GLN A 1 374 ? 27.396  52.786 66.874 1.00 42.05  ? 374  GLN A OE1 1 
ATOM   2891 N NE2 . GLN A 1 374 ? 27.604  51.571 68.757 1.00 42.05  ? 374  GLN A NE2 1 
ATOM   2892 N N   . TYR A 1 375 ? 25.238  54.659 72.354 1.00 38.79  ? 375  TYR A N   1 
ATOM   2893 C CA  . TYR A 1 375 ? 24.906  56.041 72.673 1.00 38.79  ? 375  TYR A CA  1 
ATOM   2894 C C   . TYR A 1 375 ? 25.311  56.549 74.053 1.00 38.79  ? 375  TYR A C   1 
ATOM   2895 O O   . TYR A 1 375 ? 24.750  57.524 74.541 1.00 38.79  ? 375  TYR A O   1 
ATOM   2896 C CB  . TYR A 1 375 ? 23.402  56.229 72.479 1.00 22.01  ? 375  TYR A CB  1 
ATOM   2897 C CG  . TYR A 1 375 ? 23.010  56.443 71.041 1.00 22.01  ? 375  TYR A CG  1 
ATOM   2898 C CD1 . TYR A 1 375 ? 23.131  57.703 70.454 1.00 22.01  ? 375  TYR A CD1 1 
ATOM   2899 C CD2 . TYR A 1 375 ? 22.533  55.390 70.257 1.00 22.01  ? 375  TYR A CD2 1 
ATOM   2900 C CE1 . TYR A 1 375 ? 22.785  57.915 69.133 1.00 22.01  ? 375  TYR A CE1 1 
ATOM   2901 C CE2 . TYR A 1 375 ? 22.186  55.594 68.927 1.00 22.01  ? 375  TYR A CE2 1 
ATOM   2902 C CZ  . TYR A 1 375 ? 22.315  56.861 68.379 1.00 22.01  ? 375  TYR A CZ  1 
ATOM   2903 O OH  . TYR A 1 375 ? 21.965  57.095 67.079 1.00 22.01  ? 375  TYR A OH  1 
ATOM   2904 N N   . THR A 1 376 ? 26.294  55.907 74.672 1.00 36.48  ? 376  THR A N   1 
ATOM   2905 C CA  . THR A 1 376 ? 26.739  56.309 76.001 1.00 36.48  ? 376  THR A CA  1 
ATOM   2906 C C   . THR A 1 376 ? 28.233  56.567 76.112 1.00 36.48  ? 376  THR A C   1 
ATOM   2907 O O   . THR A 1 376 ? 29.041  55.720 75.744 1.00 36.48  ? 376  THR A O   1 
ATOM   2908 C CB  . THR A 1 376 ? 26.401  55.232 77.019 1.00 34.42  ? 376  THR A CB  1 
ATOM   2909 O OG1 . THR A 1 376 ? 24.983  55.101 77.117 1.00 34.42  ? 376  THR A OG1 1 
ATOM   2910 C CG2 . THR A 1 376 ? 26.976  55.575 78.363 1.00 34.42  ? 376  THR A CG2 1 
ATOM   2911 N N   . ASP A 1 377 ? 28.603  57.733 76.626 1.00 40.60  ? 377  ASP A N   1 
ATOM   2912 C CA  . ASP A 1 377 ? 30.014  58.059 76.822 1.00 40.60  ? 377  ASP A CA  1 
ATOM   2913 C C   . ASP A 1 377 ? 30.386  57.594 78.226 1.00 40.60  ? 377  ASP A C   1 
ATOM   2914 O O   . ASP A 1 377 ? 30.215  58.344 79.189 1.00 40.60  ? 377  ASP A O   1 
ATOM   2915 C CB  . ASP A 1 377 ? 30.244  59.564 76.706 1.00 59.68  ? 377  ASP A CB  1 
ATOM   2916 C CG  . ASP A 1 377 ? 31.610  59.970 77.207 1.00 59.68  ? 377  ASP A CG  1 
ATOM   2917 O OD1 . ASP A 1 377 ? 32.520  59.108 77.204 1.00 59.68  ? 377  ASP A OD1 1 
ATOM   2918 O OD2 . ASP A 1 377 ? 31.785  61.143 77.600 1.00 59.68  ? 377  ASP A OD2 1 
ATOM   2919 N N   . TRP A 1 378 ? 30.899  56.369 78.340 1.00 41.20  ? 378  TRP A N   1 
ATOM   2920 C CA  . TRP A 1 378 ? 31.236  55.810 79.647 1.00 41.20  ? 378  TRP A CA  1 
ATOM   2921 C C   . TRP A 1 378 ? 32.306  56.553 80.426 1.00 41.20  ? 378  TRP A C   1 
ATOM   2922 O O   . TRP A 1 378 ? 32.600  56.213 81.577 1.00 41.20  ? 378  TRP A O   1 
ATOM   2923 C CB  . TRP A 1 378 ? 31.602  54.334 79.522 1.00 48.27  ? 378  TRP A CB  1 
ATOM   2924 C CG  . TRP A 1 378 ? 30.496  53.531 78.907 1.00 48.27  ? 378  TRP A CG  1 
ATOM   2925 C CD1 . TRP A 1 378 ? 30.378  53.163 77.594 1.00 48.27  ? 378  TRP A CD1 1 
ATOM   2926 C CD2 . TRP A 1 378 ? 29.304  53.078 79.555 1.00 48.27  ? 378  TRP A CD2 1 
ATOM   2927 N NE1 . TRP A 1 378 ? 29.185  52.515 77.384 1.00 48.27  ? 378  TRP A NE1 1 
ATOM   2928 C CE2 . TRP A 1 378 ? 28.506  52.448 78.570 1.00 48.27  ? 378  TRP A CE2 1 
ATOM   2929 C CE3 . TRP A 1 378 ? 28.831  53.146 80.871 1.00 48.27  ? 378  TRP A CE3 1 
ATOM   2930 C CZ2 . TRP A 1 378 ? 27.257  51.890 78.861 1.00 48.27  ? 378  TRP A CZ2 1 
ATOM   2931 C CZ3 . TRP A 1 378 ? 27.590  52.592 81.162 1.00 48.27  ? 378  TRP A CZ3 1 
ATOM   2932 C CH2 . TRP A 1 378 ? 26.816  51.971 80.157 1.00 48.27  ? 378  TRP A CH2 1 
ATOM   2933 N N   . MET A 1 379 ? 32.893  57.572 79.814 1.00 59.20  ? 379  MET A N   1 
ATOM   2934 C CA  . MET A 1 379 ? 33.875  58.352 80.536 1.00 59.20  ? 379  MET A CA  1 
ATOM   2935 C C   . MET A 1 379 ? 33.134  59.434 81.287 1.00 59.20  ? 379  MET A C   1 
ATOM   2936 O O   . MET A 1 379 ? 33.720  60.097 82.134 1.00 59.20  ? 379  MET A O   1 
ATOM   2937 C CB  . MET A 1 379 ? 34.860  59.021 79.598 1.00 69.53  ? 379  MET A CB  1 
ATOM   2938 C CG  . MET A 1 379 ? 35.893  58.102 79.023 1.00 69.53  ? 379  MET A CG  1 
ATOM   2939 S SD  . MET A 1 379 ? 37.286  59.070 78.369 1.00 69.53  ? 379  MET A SD  1 
ATOM   2940 C CE  . MET A 1 379 ? 36.497  59.976 76.925 1.00 69.53  ? 379  MET A CE  1 
ATOM   2941 N N   . ASP A 1 380 ? 31.850  59.611 80.974 1.00 53.56  ? 380  ASP A N   1 
ATOM   2942 C CA  . ASP A 1 380 ? 31.017  60.649 81.602 1.00 53.56  ? 380  ASP A CA  1 
ATOM   2943 C C   . ASP A 1 380 ? 29.549  60.152 81.682 1.00 53.56  ? 380  ASP A C   1 
ATOM   2944 O O   . ASP A 1 380 ? 28.584  60.921 81.508 1.00 53.56  ? 380  ASP A O   1 
ATOM   2945 C CB  . ASP A 1 380 ? 31.141  61.933 80.752 1.00 54.99  ? 380  ASP A CB  1 
ATOM   2946 C CG  . ASP A 1 380 ? 30.741  63.203 81.505 1.00 54.99  ? 380  ASP A CG  1 
ATOM   2947 O OD1 . ASP A 1 380 ? 30.807  63.229 82.761 1.00 54.99  ? 380  ASP A OD1 1 
ATOM   2948 O OD2 . ASP A 1 380 ? 30.381  64.190 80.821 1.00 54.99  ? 380  ASP A OD2 1 
ATOM   2949 N N   . ASP A 1 381 ? 29.405  58.858 81.974 1.00 59.24  ? 381  ASP A N   1 
ATOM   2950 C CA  . ASP A 1 381 ? 28.102  58.197 82.048 1.00 59.24  ? 381  ASP A CA  1 
ATOM   2951 C C   . ASP A 1 381 ? 26.991  58.874 82.864 1.00 59.24  ? 381  ASP A C   1 
ATOM   2952 O O   . ASP A 1 381 ? 25.800  58.659 82.593 1.00 59.24  ? 381  ASP A O   1 
ATOM   2953 C CB  . ASP A 1 381 ? 28.285  56.744 82.514 1.00 69.59  ? 381  ASP A CB  1 
ATOM   2954 C CG  . ASP A 1 381 ? 28.781  56.635 83.947 1.00 69.59  ? 381  ASP A CG  1 
ATOM   2955 O OD1 . ASP A 1 381 ? 29.830  57.243 84.285 1.00 69.59  ? 381  ASP A OD1 1 
ATOM   2956 O OD2 . ASP A 1 381 ? 28.116  55.917 84.737 1.00 69.59  ? 381  ASP A OD2 1 
ATOM   2957 N N   . ASN A 1 382 ? 27.354  59.687 83.853 1.00 81.18  ? 382  ASN A N   1 
ATOM   2958 C CA  . ASN A 1 382 ? 26.331  60.364 84.653 1.00 81.18  ? 382  ASN A CA  1 
ATOM   2959 C C   . ASN A 1 382 ? 26.166  61.853 84.404 1.00 81.18  ? 382  ASN A C   1 
ATOM   2960 O O   . ASN A 1 382 ? 25.718  62.603 85.277 1.00 81.18  ? 382  ASN A O   1 
ATOM   2961 C CB  . ASN A 1 382 ? 26.571  60.115 86.128 1.00 68.51  ? 382  ASN A CB  1 
ATOM   2962 C CG  . ASN A 1 382 ? 25.838  58.903 86.601 1.00 68.51  ? 382  ASN A CG  1 
ATOM   2963 O OD1 . ASN A 1 382 ? 24.605  58.853 86.526 1.00 68.51  ? 382  ASN A OD1 1 
ATOM   2964 N ND2 . ASN A 1 382 ? 26.576  57.898 87.068 1.00 68.51  ? 382  ASN A ND2 1 
ATOM   2965 N N   . ASN A 1 383 ? 26.530  62.265 83.194 1.00 51.04  ? 383  ASN A N   1 
ATOM   2966 C CA  . ASN A 1 383 ? 26.425  63.649 82.775 1.00 51.04  ? 383  ASN A CA  1 
ATOM   2967 C C   . ASN A 1 383 ? 25.007  63.836 82.238 1.00 51.04  ? 383  ASN A C   1 
ATOM   2968 O O   . ASN A 1 383 ? 24.684  63.399 81.130 1.00 51.04  ? 383  ASN A O   1 
ATOM   2969 C CB  . ASN A 1 383 ? 27.458  63.916 81.685 1.00 48.28  ? 383  ASN A CB  1 
ATOM   2970 C CG  . ASN A 1 383 ? 27.443  65.337 81.206 1.00 48.28  ? 383  ASN A CG  1 
ATOM   2971 O OD1 . ASN A 1 383 ? 28.264  65.726 80.379 1.00 48.28  ? 383  ASN A OD1 1 
ATOM   2972 N ND2 . ASN A 1 383 ? 26.507  66.126 81.717 1.00 48.28  ? 383  ASN A ND2 1 
ATOM   2973 N N   . GLY A 1 384 ? 24.165  64.475 83.044 1.00 42.72  ? 384  GLY A N   1 
ATOM   2974 C CA  . GLY A 1 384 ? 22.785  64.706 82.670 1.00 42.72  ? 384  GLY A CA  1 
ATOM   2975 C C   . GLY A 1 384 ? 22.558  65.377 81.332 1.00 42.72  ? 384  GLY A C   1 
ATOM   2976 O O   . GLY A 1 384 ? 21.538  65.123 80.697 1.00 42.72  ? 384  GLY A O   1 
ATOM   2977 N N   . ILE A 1 385 ? 23.475  66.238 80.895 1.00 36.61  ? 385  ILE A N   1 
ATOM   2978 C CA  . ILE A 1 385 ? 23.291  66.892 79.611 1.00 36.61  ? 385  ILE A CA  1 
ATOM   2979 C C   . ILE A 1 385 ? 23.659  65.947 78.483 1.00 36.61  ? 385  ILE A C   1 
ATOM   2980 O O   . ILE A 1 385 ? 23.140  66.064 77.380 1.00 36.61  ? 385  ILE A O   1 
ATOM   2981 C CB  . ILE A 1 385 ? 24.114  68.188 79.499 1.00 37.51  ? 385  ILE A CB  1 
ATOM   2982 C CG1 . ILE A 1 385 ? 23.501  69.252 80.401 1.00 37.51  ? 385  ILE A CG1 1 
ATOM   2983 C CG2 . ILE A 1 385 ? 24.102  68.706 78.078 1.00 37.51  ? 385  ILE A CG2 1 
ATOM   2984 C CD1 . ILE A 1 385 ? 24.134  70.592 80.237 1.00 37.51  ? 385  ILE A CD1 1 
ATOM   2985 N N   . LYS A 1 386 ? 24.547  64.998 78.751 1.00 41.32  ? 386  LYS A N   1 
ATOM   2986 C CA  . LYS A 1 386 ? 24.928  64.043 77.716 1.00 41.32  ? 386  LYS A CA  1 
ATOM   2987 C C   . LYS A 1 386 ? 23.876  62.947 77.548 1.00 41.32  ? 386  LYS A C   1 
ATOM   2988 O O   . LYS A 1 386 ? 23.641  62.467 76.438 1.00 41.32  ? 386  LYS A O   1 
ATOM   2989 C CB  . LYS A 1 386 ? 26.301  63.450 78.021 1.00 36.09  ? 386  LYS A CB  1 
ATOM   2990 C CG  . LYS A 1 386 ? 27.424  64.375 77.619 1.00 36.09  ? 386  LYS A CG  1 
ATOM   2991 C CD  . LYS A 1 386 ? 28.779  63.726 77.810 1.00 36.09  ? 386  LYS A CD  1 
ATOM   2992 C CE  . LYS A 1 386 ? 29.906  64.604 77.266 1.00 36.09  ? 386  LYS A CE  1 
ATOM   2993 N NZ  . LYS A 1 386 ? 31.251  64.162 77.761 1.00 36.09  ? 386  LYS A NZ  1 
ATOM   2994 N N   . ASN A 1 387 ? 23.236  62.560 78.646 1.00 31.45  ? 387  ASN A N   1 
ATOM   2995 C CA  . ASN A 1 387 ? 22.197  61.549 78.578 1.00 31.45  ? 387  ASN A CA  1 
ATOM   2996 C C   . ASN A 1 387 ? 20.967  62.151 77.903 1.00 31.45  ? 387  ASN A C   1 
ATOM   2997 O O   . ASN A 1 387 ? 20.220  61.461 77.220 1.00 31.45  ? 387  ASN A O   1 
ATOM   2998 C CB  . ASN A 1 387 ? 21.840  61.047 79.977 1.00 42.52  ? 387  ASN A CB  1 
ATOM   2999 C CG  . ASN A 1 387 ? 22.998  60.334 80.650 1.00 42.52  ? 387  ASN A CG  1 
ATOM   3000 O OD1 . ASN A 1 387 ? 23.773  59.640 79.995 1.00 42.52  ? 387  ASN A OD1 1 
ATOM   3001 N ND2 . ASN A 1 387 ? 23.110  60.485 81.963 1.00 42.52  ? 387  ASN A ND2 1 
ATOM   3002 N N   . ARG A 1 388 ? 20.765  63.448 78.089 1.00 39.94  ? 388  ARG A N   1 
ATOM   3003 C CA  . ARG A 1 388 ? 19.635  64.131 77.472 1.00 39.94  ? 388  ARG A CA  1 
ATOM   3004 C C   . ARG A 1 388 ? 19.869  64.235 75.974 1.00 39.94  ? 388  ARG A C   1 
ATOM   3005 O O   . ARG A 1 388 ? 19.010  63.876 75.172 1.00 39.94  ? 388  ARG A O   1 
ATOM   3006 C CB  . ARG A 1 388 ? 19.465  65.533 78.054 1.00 35.40  ? 388  ARG A CB  1 
ATOM   3007 C CG  . ARG A 1 388 ? 18.395  66.356 77.366 1.00 35.40  ? 388  ARG A CG  1 
ATOM   3008 C CD  . ARG A 1 388 ? 18.970  67.639 76.780 1.00 35.40  ? 388  ARG A CD  1 
ATOM   3009 N NE  . ARG A 1 388 ? 19.072  68.692 77.782 1.00 35.40  ? 388  ARG A NE  1 
ATOM   3010 C CZ  . ARG A 1 388 ? 19.969  69.665 77.742 1.00 35.40  ? 388  ARG A CZ  1 
ATOM   3011 N NH1 . ARG A 1 388 ? 20.847  69.711 76.751 1.00 35.40  ? 388  ARG A NH1 1 
ATOM   3012 N NH2 . ARG A 1 388 ? 19.981  70.592 78.686 1.00 35.40  ? 388  ARG A NH2 1 
ATOM   3013 N N   . ASP A 1 389 ? 21.040  64.721 75.587 1.00 38.74  ? 389  ASP A N   1 
ATOM   3014 C CA  . ASP A 1 389 ? 21.335  64.852 74.173 1.00 38.74  ? 389  ASP A CA  1 
ATOM   3015 C C   . ASP A 1 389 ? 21.500  63.516 73.472 1.00 38.74  ? 389  ASP A C   1 
ATOM   3016 O O   . ASP A 1 389 ? 21.350  63.436 72.252 1.00 38.74  ? 389  ASP A O   1 
ATOM   3017 C CB  . ASP A 1 389 ? 22.569  65.716 73.973 1.00 52.41  ? 389  ASP A CB  1 
ATOM   3018 C CG  . ASP A 1 389 ? 22.334  67.153 74.389 1.00 52.41  ? 389  ASP A CG  1 
ATOM   3019 O OD1 . ASP A 1 389 ? 21.163  67.608 74.346 1.00 52.41  ? 389  ASP A OD1 1 
ATOM   3020 O OD2 . ASP A 1 389 ? 23.320  67.829 74.750 1.00 52.41  ? 389  ASP A OD2 1 
ATOM   3021 N N   . GLY A 1 390 ? 21.805  62.469 74.236 1.00 34.19  ? 390  GLY A N   1 
ATOM   3022 C CA  . GLY A 1 390 ? 21.941  61.150 73.645 1.00 34.19  ? 390  GLY A CA  1 
ATOM   3023 C C   . GLY A 1 390 ? 20.559  60.604 73.319 1.00 34.19  ? 390  GLY A C   1 
ATOM   3024 O O   . GLY A 1 390 ? 20.327  60.019 72.265 1.00 34.19  ? 390  GLY A O   1 
ATOM   3025 N N   . LEU A 1 391 ? 19.631  60.808 74.246 1.00 40.22  ? 391  LEU A N   1 
ATOM   3026 C CA  . LEU A 1 391 ? 18.261  60.361 74.082 1.00 40.22  ? 391  LEU A CA  1 
ATOM   3027 C C   . LEU A 1 391 ? 17.675  61.096 72.881 1.00 40.22  ? 391  LEU A C   1 
ATOM   3028 O O   . LEU A 1 391 ? 17.040  60.509 72.004 1.00 40.22  ? 391  LEU A O   1 
ATOM   3029 C CB  . LEU A 1 391 ? 17.478  60.690 75.349 1.00 30.32  ? 391  LEU A CB  1 
ATOM   3030 C CG  . LEU A 1 391 ? 16.535  59.617 75.894 1.00 30.32  ? 391  LEU A CG  1 
ATOM   3031 C CD1 . LEU A 1 391 ? 17.110  58.232 75.616 1.00 30.32  ? 391  LEU A CD1 1 
ATOM   3032 C CD2 . LEU A 1 391 ? 16.327  59.833 77.397 1.00 30.32  ? 391  LEU A CD2 1 
ATOM   3033 N N   . ASP A 1 392 ? 17.910  62.396 72.847 1.00 41.51  ? 392  ASP A N   1 
ATOM   3034 C CA  . ASP A 1 392 ? 17.424  63.216 71.761 1.00 41.51  ? 392  ASP A CA  1 
ATOM   3035 C C   . ASP A 1 392 ? 17.937  62.632 70.442 1.00 41.51  ? 392  ASP A C   1 
ATOM   3036 O O   . ASP A 1 392 ? 17.198  62.553 69.469 1.00 41.51  ? 392  ASP A O   1 
ATOM   3037 C CB  . ASP A 1 392 ? 17.915  64.650 71.952 1.00 66.54  ? 392  ASP A CB  1 
ATOM   3038 C CG  . ASP A 1 392 ? 17.202  65.642 71.052 1.00 66.54  ? 392  ASP A CG  1 
ATOM   3039 O OD1 . ASP A 1 392 ? 17.132  65.409 69.821 1.00 66.54  ? 392  ASP A OD1 1 
ATOM   3040 O OD2 . ASP A 1 392 ? 16.721  66.670 71.579 1.00 66.54  ? 392  ASP A OD2 1 
ATOM   3041 N N   . ASP A 1 393 ? 19.197  62.209 70.405 1.00 27.61  ? 393  ASP A N   1 
ATOM   3042 C CA  . ASP A 1 393 ? 19.748  61.632 69.182 1.00 27.61  ? 393  ASP A CA  1 
ATOM   3043 C C   . ASP A 1 393 ? 19.129  60.291 68.813 1.00 27.61  ? 393  ASP A C   1 
ATOM   3044 O O   . ASP A 1 393 ? 18.777  60.071 67.668 1.00 27.61  ? 393  ASP A O   1 
ATOM   3045 C CB  . ASP A 1 393 ? 21.257  61.448 69.299 1.00 76.03  ? 393  ASP A CB  1 
ATOM   3046 C CG  . ASP A 1 393 ? 22.033  62.730 69.033 1.00 76.03  ? 393  ASP A CG  1 
ATOM   3047 O OD1 . ASP A 1 393 ? 21.509  63.599 68.298 1.00 76.03  ? 393  ASP A OD1 1 
ATOM   3048 O OD2 . ASP A 1 393 ? 23.179  62.857 69.538 1.00 76.03  ? 393  ASP A OD2 1 
ATOM   3049 N N   . ILE A 1 394 ? 19.015  59.386 69.778 1.00 28.04  ? 394  ILE A N   1 
ATOM   3050 C CA  . ILE A 1 394 ? 18.433  58.075 69.513 1.00 28.04  ? 394  ILE A CA  1 
ATOM   3051 C C   . ILE A 1 394 ? 17.080  58.212 68.827 1.00 28.04  ? 394  ILE A C   1 
ATOM   3052 O O   . ILE A 1 394 ? 16.843  57.627 67.783 1.00 28.04  ? 394  ILE A O   1 
ATOM   3053 C CB  . ILE A 1 394 ? 18.224  57.271 70.814 1.00 22.19  ? 394  ILE A CB  1 
ATOM   3054 C CG1 . ILE A 1 394 ? 19.562  56.879 71.418 1.00 22.19  ? 394  ILE A CG1 1 
ATOM   3055 C CG2 . ILE A 1 394 ? 17.407  56.029 70.537 1.00 22.19  ? 394  ILE A CG2 1 
ATOM   3056 C CD1 . ILE A 1 394 ? 19.430  56.095 72.708 1.00 22.19  ? 394  ILE A CD1 1 
ATOM   3057 N N   . VAL A 1 395 ? 16.197  58.997 69.427 1.00 28.37  ? 395  VAL A N   1 
ATOM   3058 C CA  . VAL A 1 395 ? 14.862  59.193 68.901 1.00 28.37  ? 395  VAL A CA  1 
ATOM   3059 C C   . VAL A 1 395 ? 14.863  59.721 67.469 1.00 28.37  ? 395  VAL A C   1 
ATOM   3060 O O   . VAL A 1 395 ? 14.092  59.261 66.632 1.00 28.37  ? 395  VAL A O   1 
ATOM   3061 C CB  . VAL A 1 395 ? 14.078  60.145 69.811 1.00 23.58  ? 395  VAL A CB  1 
ATOM   3062 C CG1 . VAL A 1 395 ? 12.618  60.136 69.446 1.00 23.58  ? 395  VAL A CG1 1 
ATOM   3063 C CG2 . VAL A 1 395 ? 14.256  59.732 71.246 1.00 23.58  ? 395  VAL A CG2 1 
ATOM   3064 N N   . GLY A 1 396 ? 15.732  60.681 67.181 1.00 33.37  ? 396  GLY A N   1 
ATOM   3065 C CA  . GLY A 1 396 ? 15.799  61.231 65.839 1.00 33.37  ? 396  GLY A CA  1 
ATOM   3066 C C   . GLY A 1 396 ? 16.450  60.322 64.808 1.00 33.37  ? 396  GLY A C   1 
ATOM   3067 O O   . GLY A 1 396 ? 15.926  60.148 63.708 1.00 33.37  ? 396  GLY A O   1 
ATOM   3068 N N   . ASP A 1 397 ? 17.597  59.744 65.154 1.00 27.24  ? 397  ASP A N   1 
ATOM   3069 C CA  . ASP A 1 397 ? 18.309  58.865 64.243 1.00 27.24  ? 397  ASP A CA  1 
ATOM   3070 C C   . ASP A 1 397 ? 17.460  57.679 63.833 1.00 27.24  ? 397  ASP A C   1 
ATOM   3071 O O   . ASP A 1 397 ? 17.322  57.388 62.660 1.00 27.24  ? 397  ASP A O   1 
ATOM   3072 C CB  . ASP A 1 397 ? 19.607  58.365 64.878 1.00 36.78  ? 397  ASP A CB  1 
ATOM   3073 C CG  . ASP A 1 397 ? 20.670  59.449 64.987 1.00 36.78  ? 397  ASP A CG  1 
ATOM   3074 O OD1 . ASP A 1 397 ? 20.482  60.551 64.425 1.00 36.78  ? 397  ASP A OD1 1 
ATOM   3075 O OD2 . ASP A 1 397 ? 21.709  59.193 65.637 1.00 36.78  ? 397  ASP A OD2 1 
ATOM   3076 N N   . HIS A 1 398 ? 16.887  56.997 64.806 1.00 29.59  ? 398  HIS A N   1 
ATOM   3077 C CA  . HIS A 1 398 ? 16.056  55.834 64.544 1.00 29.59  ? 398  HIS A CA  1 
ATOM   3078 C C   . HIS A 1 398 ? 14.740  56.115 63.807 1.00 29.59  ? 398  HIS A C   1 
ATOM   3079 O O   . HIS A 1 398 ? 14.270  55.297 63.023 1.00 29.59  ? 398  HIS A O   1 
ATOM   3080 C CB  . HIS A 1 398 ? 15.747  55.139 65.867 1.00 30.30  ? 398  HIS A CB  1 
ATOM   3081 C CG  . HIS A 1 398 ? 14.638  54.141 65.779 1.00 30.30  ? 398  HIS A CG  1 
ATOM   3082 N ND1 . HIS A 1 398 ? 14.707  53.019 64.983 1.00 30.30  ? 398  HIS A ND1 1 
ATOM   3083 C CD2 . HIS A 1 398 ? 13.437  54.089 66.401 1.00 30.30  ? 398  HIS A CD2 1 
ATOM   3084 C CE1 . HIS A 1 398 ? 13.598  52.315 65.122 1.00 30.30  ? 398  HIS A CE1 1 
ATOM   3085 N NE2 . HIS A 1 398 ? 12.812  52.943 65.977 1.00 30.30  ? 398  HIS A NE2 1 
ATOM   3086 N N   . ASN A 1 399 ? 14.154  57.275 64.056 1.00 28.15  ? 399  ASN A N   1 
ATOM   3087 C CA  . ASN A 1 399 ? 12.887  57.613 63.456 1.00 28.15  ? 399  ASN A CA  1 
ATOM   3088 C C   . ASN A 1 399 ? 12.856  58.481 62.216 1.00 28.15  ? 399  ASN A C   1 
ATOM   3089 O O   . ASN A 1 399 ? 11.911  58.406 61.443 1.00 28.15  ? 399  ASN A O   1 
ATOM   3090 C CB  . ASN A 1 399 ? 12.012  58.231 64.522 1.00 29.09  ? 399  ASN A CB  1 
ATOM   3091 C CG  . ASN A 1 399 ? 11.569  57.226 65.524 1.00 29.09  ? 399  ASN A CG  1 
ATOM   3092 O OD1 . ASN A 1 399 ? 10.755  56.366 65.221 1.00 29.09  ? 399  ASN A OD1 1 
ATOM   3093 N ND2 . ASN A 1 399 ? 12.110  57.303 66.723 1.00 29.09  ? 399  ASN A ND2 1 
ATOM   3094 N N   . VAL A 1 400 ? 13.869  59.306 62.005 1.00 29.28  ? 400  VAL A N   1 
ATOM   3095 C CA  . VAL A 1 400 ? 13.847  60.169 60.842 1.00 29.28  ? 400  VAL A CA  1 
ATOM   3096 C C   . VAL A 1 400 ? 15.110  60.135 60.001 1.00 29.28  ? 400  VAL A C   1 
ATOM   3097 O O   . VAL A 1 400 ? 15.055  59.862 58.802 1.00 29.28  ? 400  VAL A O   1 
ATOM   3098 C CB  . VAL A 1 400 ? 13.566  61.622 61.267 1.00 25.39  ? 400  VAL A CB  1 
ATOM   3099 C CG1 . VAL A 1 400 ? 13.483  62.518 60.056 1.00 25.39  ? 400  VAL A CG1 1 
ATOM   3100 C CG2 . VAL A 1 400 ? 12.271  61.681 62.049 1.00 25.39  ? 400  VAL A CG2 1 
ATOM   3101 N N   . ILE A 1 401 ? 16.253  60.383 60.630 1.00 33.87  ? 401  ILE A N   1 
ATOM   3102 C CA  . ILE A 1 401 ? 17.508  60.431 59.896 1.00 33.87  ? 401  ILE A CA  1 
ATOM   3103 C C   . ILE A 1 401 ? 18.053  59.128 59.330 1.00 33.87  ? 401  ILE A C   1 
ATOM   3104 O O   . ILE A 1 401 ? 18.265  59.040 58.131 1.00 33.87  ? 401  ILE A O   1 
ATOM   3105 C CB  . ILE A 1 401 ? 18.585  61.131 60.730 1.00 31.52  ? 401  ILE A CB  1 
ATOM   3106 C CG1 . ILE A 1 401 ? 18.099  62.541 61.083 1.00 31.52  ? 401  ILE A CG1 1 
ATOM   3107 C CG2 . ILE A 1 401 ? 19.874  61.235 59.938 1.00 31.52  ? 401  ILE A CG2 1 
ATOM   3108 C CD1 . ILE A 1 401 ? 18.930  63.232 62.131 1.00 31.52  ? 401  ILE A CD1 1 
ATOM   3109 N N   . CYS A 1 402 ? 18.291  58.112 60.149 1.00 28.25  ? 402  CYS A N   1 
ATOM   3110 C CA  . CYS A 1 402 ? 18.811  56.875 59.589 1.00 28.25  ? 402  CYS A CA  1 
ATOM   3111 C C   . CYS A 1 402 ? 17.825  56.246 58.579 1.00 28.25  ? 402  CYS A C   1 
ATOM   3112 O O   . CYS A 1 402 ? 18.234  55.546 57.657 1.00 28.25  ? 402  CYS A O   1 
ATOM   3113 C CB  . CYS A 1 402 ? 19.176  55.898 60.700 1.00 12.11  ? 402  CYS A CB  1 
ATOM   3114 N N   . PRO A 1 403 ? 16.513  56.478 58.739 1.00 35.20  ? 403  PRO A N   1 
ATOM   3115 C CA  . PRO A 1 403 ? 15.596  55.883 57.760 1.00 35.20  ? 403  PRO A CA  1 
ATOM   3116 C C   . PRO A 1 403 ? 15.622  56.634 56.420 1.00 35.20  ? 403  PRO A C   1 
ATOM   3117 O O   . PRO A 1 403 ? 15.490  56.024 55.358 1.00 35.20  ? 403  PRO A O   1 
ATOM   3118 C CB  . PRO A 1 403 ? 14.239  55.999 58.444 1.00 29.82  ? 403  PRO A CB  1 
ATOM   3119 C CG  . PRO A 1 403 ? 14.581  55.922 59.864 1.00 29.82  ? 403  PRO A CG  1 
ATOM   3120 C CD  . PRO A 1 403 ? 15.783  56.810 59.969 1.00 29.82  ? 403  PRO A CD  1 
ATOM   3121 N N   . LEU A 1 404 ? 15.783  57.955 56.473 1.00 23.37  ? 404  LEU A N   1 
ATOM   3122 C CA  . LEU A 1 404 ? 15.824  58.767 55.268 1.00 23.37  ? 404  LEU A CA  1 
ATOM   3123 C C   . LEU A 1 404 ? 17.128  58.540 54.503 1.00 23.37  ? 404  LEU A C   1 
ATOM   3124 O O   . LEU A 1 404 ? 17.144  58.531 53.278 1.00 23.37  ? 404  LEU A O   1 
ATOM   3125 C CB  . LEU A 1 404 ? 15.662  60.245 55.628 1.00 38.41  ? 404  LEU A CB  1 
ATOM   3126 C CG  . LEU A 1 404 ? 15.399  61.263 54.505 1.00 38.41  ? 404  LEU A CG  1 
ATOM   3127 C CD1 . LEU A 1 404 ? 14.105  62.022 54.780 1.00 38.41  ? 404  LEU A CD1 1 
ATOM   3128 C CD2 . LEU A 1 404 ? 16.562  62.236 54.405 1.00 38.41  ? 404  LEU A CD2 1 
ATOM   3129 N N   . MET A 1 405 ? 18.224  58.350 55.224 1.00 35.84  ? 405  MET A N   1 
ATOM   3130 C CA  . MET A 1 405 ? 19.508  58.103 54.585 1.00 35.84  ? 405  MET A CA  1 
ATOM   3131 C C   . MET A 1 405 ? 19.514  56.754 53.871 1.00 35.84  ? 405  MET A C   1 
ATOM   3132 O O   . MET A 1 405 ? 20.247  56.551 52.905 1.00 35.84  ? 405  MET A O   1 
ATOM   3133 C CB  . MET A 1 405 ? 20.641  58.147 55.606 1.00 43.10  ? 405  MET A CB  1 
ATOM   3134 C CG  . MET A 1 405 ? 21.037  59.551 56.030 1.00 43.10  ? 405  MET A CG  1 
ATOM   3135 S SD  . MET A 1 405 ? 21.295  60.671 54.634 1.00 43.10  ? 405  MET A SD  1 
ATOM   3136 C CE  . MET A 1 405 ? 22.816  60.045 53.925 1.00 43.10  ? 405  MET A CE  1 
ATOM   3137 N N   . HIS A 1 406 ? 18.703  55.825 54.353 1.00 43.05  ? 406  HIS A N   1 
ATOM   3138 C CA  . HIS A 1 406 ? 18.613  54.512 53.725 1.00 43.05  ? 406  HIS A CA  1 
ATOM   3139 C C   . HIS A 1 406 ? 17.792  54.658 52.429 1.00 43.05  ? 406  HIS A C   1 
ATOM   3140 O O   . HIS A 1 406 ? 18.046  53.989 51.435 1.00 43.05  ? 406  HIS A O   1 
ATOM   3141 C CB  . HIS A 1 406 ? 17.946  53.519 54.689 1.00 51.06  ? 406  HIS A CB  1 
ATOM   3142 C CG  . HIS A 1 406 ? 17.744  52.153 54.111 1.00 51.06  ? 406  HIS A CG  1 
ATOM   3143 N ND1 . HIS A 1 406 ? 18.787  51.286 53.865 1.00 51.06  ? 406  HIS A ND1 1 
ATOM   3144 C CD2 . HIS A 1 406 ? 16.621  51.520 53.691 1.00 51.06  ? 406  HIS A CD2 1 
ATOM   3145 C CE1 . HIS A 1 406 ? 18.317  50.180 53.317 1.00 51.06  ? 406  HIS A CE1 1 
ATOM   3146 N NE2 . HIS A 1 406 ? 17.005  50.295 53.199 1.00 51.06  ? 406  HIS A NE2 1 
ATOM   3147 N N   . PHE A 1 407 ? 16.809  55.549 52.446 1.00 45.54  ? 407  PHE A N   1 
ATOM   3148 C CA  . PHE A 1 407 ? 15.972  55.780 51.277 1.00 45.54  ? 407  PHE A CA  1 
ATOM   3149 C C   . PHE A 1 407 ? 16.778  56.504 50.197 1.00 45.54  ? 407  PHE A C   1 
ATOM   3150 O O   . PHE A 1 407 ? 16.850  56.059 49.053 1.00 45.54  ? 407  PHE A O   1 
ATOM   3151 C CB  . PHE A 1 407 ? 14.761  56.628 51.666 1.00 30.57  ? 407  PHE A CB  1 
ATOM   3152 C CG  . PHE A 1 407 ? 13.912  57.035 50.507 1.00 30.57  ? 407  PHE A CG  1 
ATOM   3153 C CD1 . PHE A 1 407 ? 13.171  56.095 49.807 1.00 30.57  ? 407  PHE A CD1 1 
ATOM   3154 C CD2 . PHE A 1 407 ? 13.853  58.358 50.108 1.00 30.57  ? 407  PHE A CD2 1 
ATOM   3155 C CE1 . PHE A 1 407 ? 12.380  56.473 48.724 1.00 30.57  ? 407  PHE A CE1 1 
ATOM   3156 C CE2 . PHE A 1 407 ? 13.067  58.739 49.029 1.00 30.57  ? 407  PHE A CE2 1 
ATOM   3157 C CZ  . PHE A 1 407 ? 12.330  57.793 48.339 1.00 30.57  ? 407  PHE A CZ  1 
ATOM   3158 N N   . VAL A 1 408 ? 17.391  57.621 50.580 1.00 35.87  ? 408  VAL A N   1 
ATOM   3159 C CA  . VAL A 1 408 ? 18.174  58.419 49.657 1.00 35.87  ? 408  VAL A CA  1 
ATOM   3160 C C   . VAL A 1 408 ? 19.279  57.602 49.029 1.00 35.87  ? 408  VAL A C   1 
ATOM   3161 O O   . VAL A 1 408 ? 19.604  57.792 47.865 1.00 35.87  ? 408  VAL A O   1 
ATOM   3162 C CB  . VAL A 1 408 ? 18.792  59.639 50.360 1.00 40.07  ? 408  VAL A CB  1 
ATOM   3163 C CG1 . VAL A 1 408 ? 19.657  59.179 51.502 1.00 40.07  ? 408  VAL A CG1 1 
ATOM   3164 C CG2 . VAL A 1 408 ? 19.606  60.466 49.368 1.00 40.07  ? 408  VAL A CG2 1 
ATOM   3165 N N   . ASN A 1 409 ? 19.874  56.696 49.786 1.00 35.11  ? 409  ASN A N   1 
ATOM   3166 C CA  . ASN A 1 409 ? 20.925  55.882 49.203 1.00 35.11  ? 409  ASN A CA  1 
ATOM   3167 C C   . ASN A 1 409 ? 20.341  54.875 48.234 1.00 35.11  ? 409  ASN A C   1 
ATOM   3168 O O   . ASN A 1 409 ? 20.871  54.701 47.149 1.00 35.11  ? 409  ASN A O   1 
ATOM   3169 C CB  . ASN A 1 409 ? 21.741  55.186 50.282 1.00 38.77  ? 409  ASN A CB  1 
ATOM   3170 C CG  . ASN A 1 409 ? 22.884  56.051 50.772 1.00 38.77  ? 409  ASN A CG  1 
ATOM   3171 O OD1 . ASN A 1 409 ? 23.702  56.518 49.974 1.00 38.77  ? 409  ASN A OD1 1 
ATOM   3172 N ND2 . ASN A 1 409 ? 22.944  56.280 52.081 1.00 38.77  ? 409  ASN A ND2 1 
ATOM   3173 N N   . LYS A 1 410 ? 19.246  54.218 48.600 1.00 37.85  ? 410  LYS A N   1 
ATOM   3174 C CA  . LYS A 1 410 ? 18.623  53.258 47.686 1.00 37.85  ? 410  LYS A CA  1 
ATOM   3175 C C   . LYS A 1 410 ? 18.109  53.967 46.421 1.00 37.85  ? 410  LYS A C   1 
ATOM   3176 O O   . LYS A 1 410 ? 18.265  53.475 45.307 1.00 37.85  ? 410  LYS A O   1 
ATOM   3177 C CB  . LYS A 1 410 ? 17.454  52.553 48.370 1.00 51.03  ? 410  LYS A CB  1 
ATOM   3178 C CG  . LYS A 1 410 ? 17.844  51.617 49.473 1.00 51.03  ? 410  LYS A CG  1 
ATOM   3179 C CD  . LYS A 1 410 ? 18.595  50.443 48.928 1.00 51.03  ? 410  LYS A CD  1 
ATOM   3180 C CE  . LYS A 1 410 ? 18.920  49.479 50.043 1.00 51.03  ? 410  LYS A CE  1 
ATOM   3181 N NZ  . LYS A 1 410 ? 19.676  48.301 49.533 1.00 51.03  ? 410  LYS A NZ  1 
ATOM   3182 N N   . TYR A 1 411 ? 17.501  55.131 46.614 1.00 34.63  ? 411  TYR A N   1 
ATOM   3183 C CA  . TYR A 1 411 ? 16.948  55.909 45.522 1.00 34.63  ? 411  TYR A CA  1 
ATOM   3184 C C   . TYR A 1 411 ? 17.995  56.386 44.543 1.00 34.63  ? 411  TYR A C   1 
ATOM   3185 O O   . TYR A 1 411 ? 17.926  56.103 43.350 1.00 34.63  ? 411  TYR A O   1 
ATOM   3186 C CB  . TYR A 1 411 ? 16.217  57.140 46.051 1.00 35.79  ? 411  TYR A CB  1 
ATOM   3187 C CG  . TYR A 1 411 ? 15.431  57.841 44.976 1.00 35.79  ? 411  TYR A CG  1 
ATOM   3188 C CD1 . TYR A 1 411 ? 14.122  57.453 44.692 1.00 35.79  ? 411  TYR A CD1 1 
ATOM   3189 C CD2 . TYR A 1 411 ? 16.015  58.837 44.193 1.00 35.79  ? 411  TYR A CD2 1 
ATOM   3190 C CE1 . TYR A 1 411 ? 13.408  58.030 43.655 1.00 35.79  ? 411  TYR A CE1 1 
ATOM   3191 C CE2 . TYR A 1 411 ? 15.311  59.426 43.144 1.00 35.79  ? 411  TYR A CE2 1 
ATOM   3192 C CZ  . TYR A 1 411 ? 14.004  59.015 42.880 1.00 35.79  ? 411  TYR A CZ  1 
ATOM   3193 O OH  . TYR A 1 411 ? 13.288  59.572 41.845 1.00 35.79  ? 411  TYR A OH  1 
ATOM   3194 N N   . THR A 1 412 ? 18.955  57.139 45.056 1.00 35.54  ? 412  THR A N   1 
ATOM   3195 C CA  . THR A 1 412 ? 20.009  57.690 44.228 1.00 35.54  ? 412  THR A CA  1 
ATOM   3196 C C   . THR A 1 412 ? 20.589  56.707 43.214 1.00 35.54  ? 412  THR A C   1 
ATOM   3197 O O   . THR A 1 412 ? 21.113  57.111 42.178 1.00 35.54  ? 412  THR A O   1 
ATOM   3198 C CB  . THR A 1 412 ? 21.107  58.280 45.120 1.00 29.53  ? 412  THR A CB  1 
ATOM   3199 O OG1 . THR A 1 412 ? 20.625  59.509 45.676 1.00 29.53  ? 412  THR A OG1 1 
ATOM   3200 C CG2 . THR A 1 412 ? 22.372  58.545 44.339 1.00 29.53  ? 412  THR A CG2 1 
ATOM   3201 N N   . LYS A 1 413 ? 20.465  55.416 43.497 1.00 44.08  ? 413  LYS A N   1 
ATOM   3202 C CA  . LYS A 1 413 ? 20.974  54.400 42.588 1.00 44.08  ? 413  LYS A CA  1 
ATOM   3203 C C   . LYS A 1 413 ? 20.190  54.290 41.269 1.00 44.08  ? 413  LYS A C   1 
ATOM   3204 O O   . LYS A 1 413 ? 20.737  53.830 40.277 1.00 44.08  ? 413  LYS A O   1 
ATOM   3205 C CB  . LYS A 1 413 ? 21.003  53.036 43.276 1.00 62.87  ? 413  LYS A CB  1 
ATOM   3206 C CG  . LYS A 1 413 ? 21.582  51.950 42.386 1.00 62.87  ? 413  LYS A CG  1 
ATOM   3207 C CD  . LYS A 1 413 ? 21.530  50.563 43.018 1.00 62.87  ? 413  LYS A CD  1 
ATOM   3208 C CE  . LYS A 1 413 ? 22.025  49.531 42.016 1.00 62.87  ? 413  LYS A CE  1 
ATOM   3209 N NZ  . LYS A 1 413 ? 21.405  49.780 40.675 1.00 62.87  ? 413  LYS A NZ  1 
ATOM   3210 N N   . PHE A 1 414 ? 18.917  54.693 41.257 1.00 41.67  ? 414  PHE A N   1 
ATOM   3211 C CA  . PHE A 1 414 ? 18.104  54.646 40.033 1.00 41.67  ? 414  PHE A CA  1 
ATOM   3212 C C   . PHE A 1 414 ? 17.466  55.998 39.686 1.00 41.67  ? 414  PHE A C   1 
ATOM   3213 O O   . PHE A 1 414 ? 16.759  56.115 38.685 1.00 41.67  ? 414  PHE A O   1 
ATOM   3214 C CB  . PHE A 1 414 ? 16.962  53.651 40.150 1.00 34.16  ? 414  PHE A CB  1 
ATOM   3215 C CG  . PHE A 1 414 ? 17.368  52.291 40.574 1.00 34.16  ? 414  PHE A CG  1 
ATOM   3216 C CD1 . PHE A 1 414 ? 17.767  52.049 41.877 1.00 34.16  ? 414  PHE A CD1 1 
ATOM   3217 C CD2 . PHE A 1 414 ? 17.246  51.221 39.697 1.00 34.16  ? 414  PHE A CD2 1 
ATOM   3218 C CE1 . PHE A 1 414 ? 18.027  50.758 42.307 1.00 34.16  ? 414  PHE A CE1 1 
ATOM   3219 C CE2 . PHE A 1 414 ? 17.504  49.925 40.113 1.00 34.16  ? 414  PHE A CE2 1 
ATOM   3220 C CZ  . PHE A 1 414 ? 17.893  49.693 41.424 1.00 34.16  ? 414  PHE A CZ  1 
ATOM   3221 N N   . GLY A 1 415 ? 17.697  57.010 40.510 1.00 31.24  ? 415  GLY A N   1 
ATOM   3222 C CA  . GLY A 1 415 ? 17.104  58.309 40.249 1.00 31.24  ? 415  GLY A CA  1 
ATOM   3223 C C   . GLY A 1 415 ? 17.877  59.108 39.233 1.00 31.24  ? 415  GLY A C   1 
ATOM   3224 O O   . GLY A 1 415 ? 18.926  58.670 38.769 1.00 31.24  ? 415  GLY A O   1 
ATOM   3225 N N   . ASN A 1 416 ? 17.361  60.286 38.897 1.00 29.94  ? 416  ASN A N   1 
ATOM   3226 C CA  . ASN A 1 416 ? 18.003  61.156 37.925 1.00 29.94  ? 416  ASN A CA  1 
ATOM   3227 C C   . ASN A 1 416 ? 18.453  62.462 38.580 1.00 29.94  ? 416  ASN A C   1 
ATOM   3228 O O   . ASN A 1 416 ? 18.525  63.497 37.925 1.00 29.94  ? 416  ASN A O   1 
ATOM   3229 C CB  . ASN A 1 416 ? 17.037  61.419 36.762 1.00 39.78  ? 416  ASN A CB  1 
ATOM   3230 C CG  . ASN A 1 416 ? 17.645  62.279 35.648 1.00 39.78  ? 416  ASN A CG  1 
ATOM   3231 O OD1 . ASN A 1 416 ? 17.116  63.353 35.340 1.00 39.78  ? 416  ASN A OD1 1 
ATOM   3232 N ND2 . ASN A 1 416 ? 18.740  61.808 35.031 1.00 39.78  ? 416  ASN A ND2 1 
ATOM   3233 N N   . GLY A 1 417 ? 18.766  62.402 39.876 1.00 33.48  ? 417  GLY A N   1 
ATOM   3234 C CA  . GLY A 1 417 ? 19.227  63.583 40.598 1.00 33.48  ? 417  GLY A CA  1 
ATOM   3235 C C   . GLY A 1 417 ? 18.785  63.656 42.046 1.00 33.48  ? 417  GLY A C   1 
ATOM   3236 O O   . GLY A 1 417 ? 17.606  63.569 42.343 1.00 33.48  ? 417  GLY A O   1 
ATOM   3237 N N   . THR A 1 418 ? 19.729  63.828 42.956 1.00 27.58  ? 418  THR A N   1 
ATOM   3238 C CA  . THR A 1 418 ? 19.386  63.905 44.367 1.00 27.58  ? 418  THR A CA  1 
ATOM   3239 C C   . THR A 1 418 ? 20.089  65.090 45.022 1.00 27.58  ? 418  THR A C   1 
ATOM   3240 O O   . THR A 1 418 ? 21.282  65.310 44.811 1.00 27.58  ? 418  THR A O   1 
ATOM   3241 C CB  . THR A 1 418 ? 19.795  62.603 45.120 1.00 29.02  ? 418  THR A CB  1 
ATOM   3242 O OG1 . THR A 1 418 ? 19.091  61.476 44.581 1.00 29.02  ? 418  THR A OG1 1 
ATOM   3243 C CG2 . THR A 1 418 ? 19.487  62.721 46.602 1.00 29.02  ? 418  THR A CG2 1 
ATOM   3244 N N   . TYR A 1 419 ? 19.341  65.854 45.812 1.00 31.75  ? 419  TYR A N   1 
ATOM   3245 C CA  . TYR A 1 419 ? 19.887  67.009 46.520 1.00 31.75  ? 419  TYR A CA  1 
ATOM   3246 C C   . TYR A 1 419 ? 19.528  66.881 47.994 1.00 31.75  ? 419  TYR A C   1 
ATOM   3247 O O   . TYR A 1 419 ? 18.357  66.900 48.354 1.00 31.75  ? 419  TYR A O   1 
ATOM   3248 C CB  . TYR A 1 419 ? 19.321  68.295 45.933 1.00 29.69  ? 419  TYR A CB  1 
ATOM   3249 C CG  . TYR A 1 419 ? 19.756  68.532 44.505 1.00 29.69  ? 419  TYR A CG  1 
ATOM   3250 C CD1 . TYR A 1 419 ? 20.950  69.185 44.217 1.00 29.69  ? 419  TYR A CD1 1 
ATOM   3251 C CD2 . TYR A 1 419 ? 18.982  68.080 43.441 1.00 29.69  ? 419  TYR A CD2 1 
ATOM   3252 C CE1 . TYR A 1 419 ? 21.357  69.381 42.914 1.00 29.69  ? 419  TYR A CE1 1 
ATOM   3253 C CE2 . TYR A 1 419 ? 19.381  68.268 42.140 1.00 29.69  ? 419  TYR A CE2 1 
ATOM   3254 C CZ  . TYR A 1 419 ? 20.569  68.920 41.876 1.00 29.69  ? 419  TYR A CZ  1 
ATOM   3255 O OH  . TYR A 1 419 ? 20.959  69.106 40.567 1.00 29.69  ? 419  TYR A OH  1 
ATOM   3256 N N   . LEU A 1 420 ? 20.544  66.765 48.843 1.00 27.41  ? 420  LEU A N   1 
ATOM   3257 C CA  . LEU A 1 420 ? 20.331  66.565 50.264 1.00 27.41  ? 420  LEU A CA  1 
ATOM   3258 C C   . LEU A 1 420 ? 20.772  67.732 51.148 1.00 27.41  ? 420  LEU A C   1 
ATOM   3259 O O   . LEU A 1 420 ? 21.844  68.293 50.959 1.00 27.41  ? 420  LEU A O   1 
ATOM   3260 C CB  . LEU A 1 420 ? 21.050  65.277 50.668 1.00 19.79  ? 420  LEU A CB  1 
ATOM   3261 C CG  . LEU A 1 420 ? 20.920  64.703 52.070 1.00 19.79  ? 420  LEU A CG  1 
ATOM   3262 C CD1 . LEU A 1 420 ? 19.472  64.551 52.397 1.00 19.79  ? 420  LEU A CD1 1 
ATOM   3263 C CD2 . LEU A 1 420 ? 21.607  63.363 52.140 1.00 19.79  ? 420  LEU A CD2 1 
ATOM   3264 N N   . TYR A 1 421 ? 19.938  68.094 52.119 1.00 33.15  ? 421  TYR A N   1 
ATOM   3265 C CA  . TYR A 1 421 ? 20.252  69.198 53.026 1.00 33.15  ? 421  TYR A CA  1 
ATOM   3266 C C   . TYR A 1 421 ? 20.184  68.769 54.485 1.00 33.15  ? 421  TYR A C   1 
ATOM   3267 O O   . TYR A 1 421 ? 19.699  67.686 54.806 1.00 33.15  ? 421  TYR A O   1 
ATOM   3268 C CB  . TYR A 1 421 ? 19.289  70.382 52.797 1.00 34.97  ? 421  TYR A CB  1 
ATOM   3269 C CG  . TYR A 1 421 ? 17.872  70.187 53.321 1.00 34.97  ? 421  TYR A CG  1 
ATOM   3270 C CD1 . TYR A 1 421 ? 17.577  70.354 54.677 1.00 34.97  ? 421  TYR A CD1 1 
ATOM   3271 C CD2 . TYR A 1 421 ? 16.835  69.810 52.466 1.00 34.97  ? 421  TYR A CD2 1 
ATOM   3272 C CE1 . TYR A 1 421 ? 16.287  70.145 55.164 1.00 34.97  ? 421  TYR A CE1 1 
ATOM   3273 C CE2 . TYR A 1 421 ? 15.542  69.598 52.941 1.00 34.97  ? 421  TYR A CE2 1 
ATOM   3274 C CZ  . TYR A 1 421 ? 15.272  69.766 54.292 1.00 34.97  ? 421  TYR A CZ  1 
ATOM   3275 O OH  . TYR A 1 421 ? 13.997  69.546 54.772 1.00 34.97  ? 421  TYR A OH  1 
ATOM   3276 N N   . PHE A 1 422 ? 20.670  69.634 55.364 1.00 29.49  ? 422  PHE A N   1 
ATOM   3277 C CA  . PHE A 1 422 ? 20.660  69.373 56.798 1.00 29.49  ? 422  PHE A CA  1 
ATOM   3278 C C   . PHE A 1 422 ? 20.341  70.719 57.442 1.00 29.49  ? 422  PHE A C   1 
ATOM   3279 O O   . PHE A 1 422 ? 21.196  71.584 57.509 1.00 29.49  ? 422  PHE A O   1 
ATOM   3280 C CB  . PHE A 1 422 ? 22.039  68.870 57.240 1.00 26.17  ? 422  PHE A CB  1 
ATOM   3281 C CG  . PHE A 1 422 ? 22.108  68.444 58.683 1.00 26.17  ? 422  PHE A CG  1 
ATOM   3282 C CD1 . PHE A 1 422 ? 21.419  67.319 59.127 1.00 26.17  ? 422  PHE A CD1 1 
ATOM   3283 C CD2 . PHE A 1 422 ? 22.864  69.167 59.601 1.00 26.17  ? 422  PHE A CD2 1 
ATOM   3284 C CE1 . PHE A 1 422 ? 21.485  66.924 60.466 1.00 26.17  ? 422  PHE A CE1 1 
ATOM   3285 C CE2 . PHE A 1 422 ? 22.930  68.776 60.936 1.00 26.17  ? 422  PHE A CE2 1 
ATOM   3286 C CZ  . PHE A 1 422 ? 22.240  67.654 61.368 1.00 26.17  ? 422  PHE A CZ  1 
ATOM   3287 N N   . PHE A 1 423 ? 19.107  70.909 57.889 1.00 30.59  ? 423  PHE A N   1 
ATOM   3288 C CA  . PHE A 1 423 ? 18.716  72.176 58.497 1.00 30.59  ? 423  PHE A CA  1 
ATOM   3289 C C   . PHE A 1 423 ? 19.152  72.218 59.957 1.00 30.59  ? 423  PHE A C   1 
ATOM   3290 O O   . PHE A 1 423 ? 18.656  71.472 60.791 1.00 30.59  ? 423  PHE A O   1 
ATOM   3291 C CB  . PHE A 1 423 ? 17.201  72.353 58.398 1.00 28.41  ? 423  PHE A CB  1 
ATOM   3292 C CG  . PHE A 1 423 ? 16.723  73.719 58.765 1.00 28.41  ? 423  PHE A CG  1 
ATOM   3293 C CD1 . PHE A 1 423 ? 16.840  74.769 57.873 1.00 28.41  ? 423  PHE A CD1 1 
ATOM   3294 C CD2 . PHE A 1 423 ? 16.153  73.956 60.009 1.00 28.41  ? 423  PHE A CD2 1 
ATOM   3295 C CE1 . PHE A 1 423 ? 16.392  76.044 58.212 1.00 28.41  ? 423  PHE A CE1 1 
ATOM   3296 C CE2 . PHE A 1 423 ? 15.703  75.223 60.362 1.00 28.41  ? 423  PHE A CE2 1 
ATOM   3297 C CZ  . PHE A 1 423 ? 15.823  76.270 59.460 1.00 28.41  ? 423  PHE A CZ  1 
ATOM   3298 N N   . ASN A 1 424 ? 20.087  73.095 60.277 1.00 39.13  ? 424  ASN A N   1 
ATOM   3299 C CA  . ASN A 1 424 ? 20.548  73.171 61.647 1.00 39.13  ? 424  ASN A CA  1 
ATOM   3300 C C   . ASN A 1 424 ? 20.606  74.595 62.158 1.00 39.13  ? 424  ASN A C   1 
ATOM   3301 O O   . ASN A 1 424 ? 21.619  75.015 62.697 1.00 39.13  ? 424  ASN A O   1 
ATOM   3302 C CB  . ASN A 1 424 ? 21.916  72.491 61.787 1.00 31.82  ? 424  ASN A CB  1 
ATOM   3303 C CG  . ASN A 1 424 ? 22.999  73.170 60.977 1.00 31.82  ? 424  ASN A CG  1 
ATOM   3304 O OD1 . ASN A 1 424 ? 22.737  73.745 59.925 1.00 31.82  ? 424  ASN A OD1 1 
ATOM   3305 N ND2 . ASN A 1 424 ? 24.228  73.088 61.456 1.00 31.82  ? 424  ASN A ND2 1 
ATOM   3306 N N   . HIS A 1 425 ? 19.516  75.338 61.969 1.00 42.79  ? 425  HIS A N   1 
ATOM   3307 C CA  . HIS A 1 425 ? 19.424  76.710 62.461 1.00 42.79  ? 425  HIS A CA  1 
ATOM   3308 C C   . HIS A 1 425 ? 18.214  76.853 63.370 1.00 42.79  ? 425  HIS A C   1 
ATOM   3309 O O   . HIS A 1 425 ? 17.085  76.607 62.947 1.00 42.79  ? 425  HIS A O   1 
ATOM   3310 C CB  . HIS A 1 425 ? 19.265  77.726 61.323 1.00 48.44  ? 425  HIS A CB  1 
ATOM   3311 C CG  . HIS A 1 425 ? 19.016  79.127 61.808 1.00 48.44  ? 425  HIS A CG  1 
ATOM   3312 N ND1 . HIS A 1 425 ? 19.975  79.870 62.468 1.00 48.44  ? 425  HIS A ND1 1 
ATOM   3313 C CD2 . HIS A 1 425 ? 17.891  79.880 61.821 1.00 48.44  ? 425  HIS A CD2 1 
ATOM   3314 C CE1 . HIS A 1 425 ? 19.449  81.012 62.873 1.00 48.44  ? 425  HIS A CE1 1 
ATOM   3315 N NE2 . HIS A 1 425 ? 18.185  81.044 62.495 1.00 48.44  ? 425  HIS A NE2 1 
ATOM   3316 N N   . ARG A 1 426 ? 18.433  77.248 64.617 1.00 37.22  ? 426  ARG A N   1 
ATOM   3317 C CA  . ARG A 1 426 ? 17.303  77.447 65.520 1.00 37.22  ? 426  ARG A CA  1 
ATOM   3318 C C   . ARG A 1 426 ? 16.804  78.892 65.350 1.00 37.22  ? 426  ARG A C   1 
ATOM   3319 O O   . ARG A 1 426 ? 17.557  79.845 65.560 1.00 37.22  ? 426  ARG A O   1 
ATOM   3320 C CB  . ARG A 1 426 ? 17.720  77.188 66.978 1.00 42.12  ? 426  ARG A CB  1 
ATOM   3321 C CG  . ARG A 1 426 ? 16.581  77.304 67.998 1.00 42.12  ? 426  ARG A CG  1 
ATOM   3322 C CD  . ARG A 1 426 ? 17.087  77.014 69.395 1.00 42.12  ? 426  ARG A CD  1 
ATOM   3323 N NE  . ARG A 1 426 ? 16.226  77.571 70.436 1.00 42.12  ? 426  ARG A NE  1 
ATOM   3324 C CZ  . ARG A 1 426 ? 15.219  76.927 71.029 1.00 42.12  ? 426  ARG A CZ  1 
ATOM   3325 N NH1 . ARG A 1 426 ? 14.916  75.672 70.694 1.00 42.12  ? 426  ARG A NH1 1 
ATOM   3326 N NH2 . ARG A 1 426 ? 14.513  77.544 71.973 1.00 42.12  ? 426  ARG A NH2 1 
ATOM   3327 N N   . ALA A 1 427 ? 15.546  79.049 64.946 1.00 51.65  ? 427  ALA A N   1 
ATOM   3328 C CA  . ALA A 1 427 ? 14.980  80.385 64.759 1.00 51.65  ? 427  ALA A CA  1 
ATOM   3329 C C   . ALA A 1 427 ? 15.134  81.171 66.059 1.00 51.65  ? 427  ALA A C   1 
ATOM   3330 O O   . ALA A 1 427 ? 15.055  80.594 67.141 1.00 51.65  ? 427  ALA A O   1 
ATOM   3331 C CB  . ALA A 1 427 ? 13.508  80.287 64.368 1.00 45.73  ? 427  ALA A CB  1 
ATOM   3332 N N   . SER A 1 428 ? 15.346  82.481 65.960 1.00 50.85  ? 428  SER A N   1 
ATOM   3333 C CA  . SER A 1 428 ? 15.539  83.307 67.154 1.00 50.85  ? 428  SER A CA  1 
ATOM   3334 C C   . SER A 1 428 ? 14.278  83.550 67.986 1.00 50.85  ? 428  SER A C   1 
ATOM   3335 O O   . SER A 1 428 ? 14.371  83.811 69.194 1.00 50.85  ? 428  SER A O   1 
ATOM   3336 C CB  . SER A 1 428 ? 16.154  84.658 66.771 1.00 50.62  ? 428  SER A CB  1 
ATOM   3337 O OG  . SER A 1 428 ? 15.284  85.393 65.919 1.00 50.62  ? 428  SER A OG  1 
ATOM   3338 N N   . ASN A 1 429 ? 13.105  83.469 67.356 1.00 49.97  ? 429  ASN A N   1 
ATOM   3339 C CA  . ASN A 1 429 ? 11.854  83.702 68.077 1.00 49.97  ? 429  ASN A CA  1 
ATOM   3340 C C   . ASN A 1 429 ? 11.137  82.454 68.602 1.00 49.97  ? 429  ASN A C   1 
ATOM   3341 O O   . ASN A 1 429 ? 9.966   82.538 68.985 1.00 49.97  ? 429  ASN A O   1 
ATOM   3342 C CB  . ASN A 1 429 ? 10.880  84.503 67.207 1.00 59.09  ? 429  ASN A CB  1 
ATOM   3343 C CG  . ASN A 1 429 ? 10.744  83.945 65.797 1.00 59.09  ? 429  ASN A CG  1 
ATOM   3344 O OD1 . ASN A 1 429 ? 10.867  82.735 65.569 1.00 59.09  ? 429  ASN A OD1 1 
ATOM   3345 N ND2 . ASN A 1 429 ? 10.467  84.831 64.838 1.00 59.09  ? 429  ASN A ND2 1 
ATOM   3346 N N   . LEU A 1 430 ? 11.821  81.310 68.635 1.00 39.67  ? 430  LEU A N   1 
ATOM   3347 C CA  . LEU A 1 430 ? 11.197  80.075 69.108 1.00 39.67  ? 430  LEU A CA  1 
ATOM   3348 C C   . LEU A 1 430 ? 10.776  80.172 70.565 1.00 39.67  ? 430  LEU A C   1 
ATOM   3349 O O   . LEU A 1 430 ? 11.503  80.703 71.403 1.00 39.67  ? 430  LEU A O   1 
ATOM   3350 C CB  . LEU A 1 430 ? 12.146  78.891 68.938 1.00 52.39  ? 430  LEU A CB  1 
ATOM   3351 C CG  . LEU A 1 430 ? 11.953  77.949 67.746 1.00 52.39  ? 430  LEU A CG  1 
ATOM   3352 C CD1 . LEU A 1 430 ? 13.012  76.857 67.806 1.00 52.39  ? 430  LEU A CD1 1 
ATOM   3353 C CD2 . LEU A 1 430 ? 10.579  77.317 67.781 1.00 52.39  ? 430  LEU A CD2 1 
ATOM   3354 N N   . VAL A 1 431 ? 9.601   79.642 70.867 1.00 37.15  ? 431  VAL A N   1 
ATOM   3355 C CA  . VAL A 1 431 ? 9.083   79.677 72.227 1.00 37.15  ? 431  VAL A CA  1 
ATOM   3356 C C   . VAL A 1 431 ? 9.410   78.430 73.062 1.00 37.15  ? 431  VAL A C   1 
ATOM   3357 O O   . VAL A 1 431 ? 9.165   78.398 74.264 1.00 37.15  ? 431  VAL A O   1 
ATOM   3358 C CB  . VAL A 1 431 ? 7.553   79.882 72.208 1.00 48.92  ? 431  VAL A CB  1 
ATOM   3359 C CG1 . VAL A 1 431 ? 7.230   81.253 71.675 1.00 48.92  ? 431  VAL A CG1 1 
ATOM   3360 C CG2 . VAL A 1 431 ? 6.894   78.825 71.336 1.00 48.92  ? 431  VAL A CG2 1 
ATOM   3361 N N   . TRP A 1 432 ? 9.960   77.404 72.427 1.00 45.54  ? 432  TRP A N   1 
ATOM   3362 C CA  . TRP A 1 432 ? 10.309  76.180 73.138 1.00 45.54  ? 432  TRP A CA  1 
ATOM   3363 C C   . TRP A 1 432 ? 11.663  76.311 73.840 1.00 45.54  ? 432  TRP A C   1 
ATOM   3364 O O   . TRP A 1 432 ? 12.485  77.145 73.479 1.00 45.54  ? 432  TRP A O   1 
ATOM   3365 C CB  . TRP A 1 432 ? 10.337  74.997 72.170 1.00 36.25  ? 432  TRP A CB  1 
ATOM   3366 C CG  . TRP A 1 432 ? 9.024   74.725 71.499 1.00 36.25  ? 432  TRP A CG  1 
ATOM   3367 C CD1 . TRP A 1 432 ? 8.651   75.089 70.237 1.00 36.25  ? 432  TRP A CD1 1 
ATOM   3368 C CD2 . TRP A 1 432 ? 7.929   73.985 72.042 1.00 36.25  ? 432  TRP A CD2 1 
ATOM   3369 N NE1 . TRP A 1 432 ? 7.393   74.613 69.954 1.00 36.25  ? 432  TRP A NE1 1 
ATOM   3370 C CE2 . TRP A 1 432 ? 6.926   73.929 71.045 1.00 36.25  ? 432  TRP A CE2 1 
ATOM   3371 C CE3 . TRP A 1 432 ? 7.696   73.361 73.273 1.00 36.25  ? 432  TRP A CE3 1 
ATOM   3372 C CZ2 . TRP A 1 432 ? 5.711   73.269 71.241 1.00 36.25  ? 432  TRP A CZ2 1 
ATOM   3373 C CZ3 . TRP A 1 432 ? 6.490   72.706 73.471 1.00 36.25  ? 432  TRP A CZ3 1 
ATOM   3374 C CH2 . TRP A 1 432 ? 5.511   72.663 72.457 1.00 36.25  ? 432  TRP A CH2 1 
ATOM   3375 N N   . PRO A 1 433 ? 11.914  75.481 74.857 1.00 35.31  ? 433  PRO A N   1 
ATOM   3376 C CA  . PRO A 1 433 ? 13.199  75.593 75.544 1.00 35.31  ? 433  PRO A CA  1 
ATOM   3377 C C   . PRO A 1 433 ? 14.390  75.362 74.629 1.00 35.31  ? 433  PRO A C   1 
ATOM   3378 O O   . PRO A 1 433 ? 14.241  74.842 73.524 1.00 35.31  ? 433  PRO A O   1 
ATOM   3379 C CB  . PRO A 1 433 ? 13.084  74.560 76.661 1.00 34.97  ? 433  PRO A CB  1 
ATOM   3380 C CG  . PRO A 1 433 ? 12.140  73.552 76.100 1.00 34.97  ? 433  PRO A CG  1 
ATOM   3381 C CD  . PRO A 1 433 ? 11.101  74.390 75.421 1.00 34.97  ? 433  PRO A CD  1 
ATOM   3382 N N   . GLU A 1 434 ? 15.569  75.764 75.099 1.00 44.48  ? 434  GLU A N   1 
ATOM   3383 C CA  . GLU A 1 434 ? 16.805  75.623 74.337 1.00 44.48  ? 434  GLU A CA  1 
ATOM   3384 C C   . GLU A 1 434 ? 17.220  74.174 74.140 1.00 44.48  ? 434  GLU A C   1 
ATOM   3385 O O   . GLU A 1 434 ? 17.669  73.812 73.056 1.00 44.48  ? 434  GLU A O   1 
ATOM   3386 C CB  . GLU A 1 434 ? 17.956  76.365 75.022 1.00 80.92  ? 434  GLU A CB  1 
ATOM   3387 C CG  . GLU A 1 434 ? 17.792  77.871 75.111 1.00 80.92  ? 434  GLU A CG  1 
ATOM   3388 C CD  . GLU A 1 434 ? 17.739  78.543 73.747 1.00 80.92  ? 434  GLU A CD  1 
ATOM   3389 O OE1 . GLU A 1 434 ? 18.800  78.676 73.081 1.00 80.92  ? 434  GLU A OE1 1 
ATOM   3390 O OE2 . GLU A 1 434 ? 16.621  78.936 73.333 1.00 80.92  ? 434  GLU A OE2 1 
ATOM   3391 N N   . TRP A 1 435 ? 17.073  73.341 75.174 1.00 44.07  ? 435  TRP A N   1 
ATOM   3392 C CA  . TRP A 1 435 ? 17.487  71.942 75.065 1.00 44.07  ? 435  TRP A CA  1 
ATOM   3393 C C   . TRP A 1 435 ? 16.802  71.196 73.930 1.00 44.07  ? 435  TRP A C   1 
ATOM   3394 O O   . TRP A 1 435 ? 17.203  70.088 73.573 1.00 44.07  ? 435  TRP A O   1 
ATOM   3395 C CB  . TRP A 1 435 ? 17.271  71.190 76.386 1.00 33.65  ? 435  TRP A CB  1 
ATOM   3396 C CG  . TRP A 1 435 ? 15.849  70.981 76.767 1.00 33.65  ? 435  TRP A CG  1 
ATOM   3397 C CD1 . TRP A 1 435 ? 15.122  71.723 77.644 1.00 33.65  ? 435  TRP A CD1 1 
ATOM   3398 C CD2 . TRP A 1 435 ? 14.974  69.951 76.291 1.00 33.65  ? 435  TRP A CD2 1 
ATOM   3399 N NE1 . TRP A 1 435 ? 13.842  71.220 77.751 1.00 33.65  ? 435  TRP A NE1 1 
ATOM   3400 C CE2 . TRP A 1 435 ? 13.727  70.133 76.929 1.00 33.65  ? 435  TRP A CE2 1 
ATOM   3401 C CE3 . TRP A 1 435 ? 15.122  68.892 75.386 1.00 33.65  ? 435  TRP A CE3 1 
ATOM   3402 C CZ2 . TRP A 1 435 ? 12.637  69.298 76.691 1.00 33.65  ? 435  TRP A CZ2 1 
ATOM   3403 C CZ3 . TRP A 1 435 ? 14.037  68.063 75.147 1.00 33.65  ? 435  TRP A CZ3 1 
ATOM   3404 C CH2 . TRP A 1 435 ? 12.810  68.271 75.798 1.00 33.65  ? 435  TRP A CH2 1 
ATOM   3405 N N   . MET A 1 436 ? 15.769  71.796 73.356 1.00 39.48  ? 436  MET A N   1 
ATOM   3406 C CA  . MET A 1 436 ? 15.075  71.142 72.266 1.00 39.48  ? 436  MET A CA  1 
ATOM   3407 C C   . MET A 1 436 ? 15.776  71.405 70.938 1.00 39.48  ? 436  MET A C   1 
ATOM   3408 O O   . MET A 1 436 ? 15.629  70.630 70.005 1.00 39.48  ? 436  MET A O   1 
ATOM   3409 C CB  . MET A 1 436 ? 13.613  71.591 72.224 1.00 42.34  ? 436  MET A CB  1 
ATOM   3410 C CG  . MET A 1 436 ? 12.823  71.162 73.453 1.00 42.34  ? 436  MET A CG  1 
ATOM   3411 S SD  . MET A 1 436 ? 11.035  71.403 73.304 1.00 42.34  ? 436  MET A SD  1 
ATOM   3412 C CE  . MET A 1 436 ? 10.615  70.078 72.201 1.00 42.34  ? 436  MET A CE  1 
ATOM   3413 N N   . GLY A 1 437 ? 16.532  72.498 70.855 1.00 31.90  ? 437  GLY A N   1 
ATOM   3414 C CA  . GLY A 1 437 ? 17.281  72.826 69.645 1.00 31.90  ? 437  GLY A CA  1 
ATOM   3415 C C   . GLY A 1 437 ? 16.532  73.135 68.364 1.00 31.90  ? 437  GLY A C   1 
ATOM   3416 O O   . GLY A 1 437 ? 15.535  73.845 68.381 1.00 31.90  ? 437  GLY A O   1 
ATOM   3417 N N   . VAL A 1 438 ? 17.038  72.626 67.244 1.00 31.46  ? 438  VAL A N   1 
ATOM   3418 C CA  . VAL A 1 438 ? 16.392  72.830 65.949 1.00 31.46  ? 438  VAL A CA  1 
ATOM   3419 C C   . VAL A 1 438 ? 15.253  71.810 65.846 1.00 31.46  ? 438  VAL A C   1 
ATOM   3420 O O   . VAL A 1 438 ? 15.396  70.741 65.247 1.00 31.46  ? 438  VAL A O   1 
ATOM   3421 C CB  . VAL A 1 438 ? 17.371  72.607 64.795 1.00 25.18  ? 438  VAL A CB  1 
ATOM   3422 C CG1 . VAL A 1 438 ? 16.765  73.103 63.505 1.00 25.18  ? 438  VAL A CG1 1 
ATOM   3423 C CG2 . VAL A 1 438 ? 18.661  73.315 65.071 1.00 25.18  ? 438  VAL A CG2 1 
ATOM   3424 N N   . ILE A 1 439 ? 14.125  72.165 66.452 1.00 39.89  ? 439  ILE A N   1 
ATOM   3425 C CA  . ILE A 1 439 ? 12.927  71.333 66.527 1.00 39.89  ? 439  ILE A CA  1 
ATOM   3426 C C   . ILE A 1 439 ? 12.298  70.831 65.233 1.00 39.89  ? 439  ILE A C   1 
ATOM   3427 O O   . ILE A 1 439 ? 12.310  71.504 64.204 1.00 39.89  ? 439  ILE A O   1 
ATOM   3428 C CB  . ILE A 1 439 ? 11.839  72.069 67.306 1.00 41.33  ? 439  ILE A CB  1 
ATOM   3429 C CG1 . ILE A 1 439 ? 12.380  72.450 68.675 1.00 41.33  ? 439  ILE A CG1 1 
ATOM   3430 C CG2 . ILE A 1 439 ? 10.599  71.205 67.437 1.00 41.33  ? 439  ILE A CG2 1 
ATOM   3431 C CD1 . ILE A 1 439 ? 11.405  73.249 69.491 1.00 41.33  ? 439  ILE A CD1 1 
ATOM   3432 N N   . HIS A 1 440 ? 11.728  69.633 65.329 1.00 40.76  ? 440  HIS A N   1 
ATOM   3433 C CA  . HIS A 1 440 ? 11.036  68.963 64.238 1.00 40.76  ? 440  HIS A CA  1 
ATOM   3434 C C   . HIS A 1 440 ? 9.991   69.912 63.643 1.00 40.76  ? 440  HIS A C   1 
ATOM   3435 O O   . HIS A 1 440 ? 9.276   70.587 64.375 1.00 40.76  ? 440  HIS A O   1 
ATOM   3436 C CB  . HIS A 1 440 ? 10.359  67.709 64.804 1.00 52.72  ? 440  HIS A CB  1 
ATOM   3437 C CG  . HIS A 1 440 ? 9.668   66.862 63.781 1.00 52.72  ? 440  HIS A CG  1 
ATOM   3438 N ND1 . HIS A 1 440 ? 10.338  66.241 62.749 1.00 52.72  ? 440  HIS A ND1 1 
ATOM   3439 C CD2 . HIS A 1 440 ? 8.367   66.499 63.659 1.00 52.72  ? 440  HIS A CD2 1 
ATOM   3440 C CE1 . HIS A 1 440 ? 9.482   65.529 62.034 1.00 52.72  ? 440  HIS A CE1 1 
ATOM   3441 N NE2 . HIS A 1 440 ? 8.279   65.669 62.566 1.00 52.72  ? 440  HIS A NE2 1 
ATOM   3442 N N   . GLY A 1 441 ? 9.921   69.979 62.318 1.00 42.60  ? 441  GLY A N   1 
ATOM   3443 C CA  . GLY A 1 441 ? 8.937   70.836 61.673 1.00 42.60  ? 441  GLY A CA  1 
ATOM   3444 C C   . GLY A 1 441 ? 9.158   72.348 61.629 1.00 42.60  ? 441  GLY A C   1 
ATOM   3445 O O   . GLY A 1 441 ? 8.503   73.055 60.860 1.00 42.60  ? 441  GLY A O   1 
ATOM   3446 N N   . TYR A 1 442 ? 10.074  72.868 62.432 1.00 51.82  ? 442  TYR A N   1 
ATOM   3447 C CA  . TYR A 1 442 ? 10.301  74.302 62.417 1.00 51.82  ? 442  TYR A CA  1 
ATOM   3448 C C   . TYR A 1 442 ? 11.115  74.858 61.241 1.00 51.82  ? 442  TYR A C   1 
ATOM   3449 O O   . TYR A 1 442 ? 11.540  76.020 61.260 1.00 51.82  ? 442  TYR A O   1 
ATOM   3450 C CB  . TYR A 1 442 ? 10.887  74.738 63.759 1.00 38.56  ? 442  TYR A CB  1 
ATOM   3451 C CG  . TYR A 1 442 ? 9.803   74.836 64.794 1.00 38.56  ? 442  TYR A CG  1 
ATOM   3452 C CD1 . TYR A 1 442 ? 9.301   73.701 65.415 1.00 38.56  ? 442  TYR A CD1 1 
ATOM   3453 C CD2 . TYR A 1 442 ? 9.209   76.060 65.082 1.00 38.56  ? 442  TYR A CD2 1 
ATOM   3454 C CE1 . TYR A 1 442 ? 8.228   73.783 66.296 1.00 38.56  ? 442  TYR A CE1 1 
ATOM   3455 C CE2 . TYR A 1 442 ? 8.142   76.153 65.952 1.00 38.56  ? 442  TYR A CE2 1 
ATOM   3456 C CZ  . TYR A 1 442 ? 7.655   75.016 66.556 1.00 38.56  ? 442  TYR A CZ  1 
ATOM   3457 O OH  . TYR A 1 442 ? 6.592   75.119 67.421 1.00 38.56  ? 442  TYR A OH  1 
ATOM   3458 N N   . GLU A 1 443 ? 11.323  74.034 60.216 1.00 37.74  ? 443  GLU A N   1 
ATOM   3459 C CA  . GLU A 1 443 ? 12.031  74.490 59.023 1.00 37.74  ? 443  GLU A CA  1 
ATOM   3460 C C   . GLU A 1 443 ? 10.957  74.939 58.049 1.00 37.74  ? 443  GLU A C   1 
ATOM   3461 O O   . GLU A 1 443 ? 11.242  75.570 57.039 1.00 37.74  ? 443  GLU A O   1 
ATOM   3462 C CB  . GLU A 1 443 ? 12.826  73.362 58.360 1.00 60.00  ? 443  GLU A CB  1 
ATOM   3463 C CG  . GLU A 1 443 ? 11.982  72.348 57.548 1.00 60.00  ? 443  GLU A CG  1 
ATOM   3464 C CD  . GLU A 1 443 ? 11.040  71.498 58.416 1.00 60.00  ? 443  GLU A CD  1 
ATOM   3465 O OE1 . GLU A 1 443 ? 11.407  71.192 59.574 1.00 60.00  ? 443  GLU A OE1 1 
ATOM   3466 O OE2 . GLU A 1 443 ? 9.944   71.120 57.939 1.00 60.00  ? 443  GLU A OE2 1 
ATOM   3467 N N   . ILE A 1 444 ? 9.716   74.583 58.358 1.00 37.73  ? 444  ILE A N   1 
ATOM   3468 C CA  . ILE A 1 444 ? 8.591   74.925 57.516 1.00 37.73  ? 444  ILE A CA  1 
ATOM   3469 C C   . ILE A 1 444 ? 8.431   76.428 57.374 1.00 37.73  ? 444  ILE A C   1 
ATOM   3470 O O   . ILE A 1 444 ? 8.230   76.916 56.269 1.00 37.73  ? 444  ILE A O   1 
ATOM   3471 C CB  . ILE A 1 444 ? 7.286   74.338 58.077 1.00 41.83  ? 444  ILE A CB  1 
ATOM   3472 C CG1 . ILE A 1 444 ? 7.302   72.818 57.949 1.00 41.83  ? 444  ILE A CG1 1 
ATOM   3473 C CG2 . ILE A 1 444 ? 6.093   74.909 57.329 1.00 41.83  ? 444  ILE A CG2 1 
ATOM   3474 C CD1 . ILE A 1 444 ? 6.132   72.141 58.632 1.00 41.83  ? 444  ILE A CD1 1 
ATOM   3475 N N   . GLU A 1 445 ? 8.515   77.163 58.480 1.00 47.00  ? 445  GLU A N   1 
ATOM   3476 C CA  . GLU A 1 445 ? 8.361   78.614 58.426 1.00 47.00  ? 445  GLU A CA  1 
ATOM   3477 C C   . GLU A 1 445 ? 9.281   79.287 57.419 1.00 47.00  ? 445  GLU A C   1 
ATOM   3478 O O   . GLU A 1 445 ? 8.916   80.304 56.830 1.00 47.00  ? 445  GLU A O   1 
ATOM   3479 C CB  . GLU A 1 445 ? 8.563   79.231 59.808 1.00 67.42  ? 445  GLU A CB  1 
ATOM   3480 C CG  . GLU A 1 445 ? 9.702   78.641 60.626 1.00 67.42  ? 445  GLU A CG  1 
ATOM   3481 C CD  . GLU A 1 445 ? 9.508   78.884 62.135 1.00 67.42  ? 445  GLU A CD  1 
ATOM   3482 O OE1 . GLU A 1 445 ? 8.528   78.337 62.705 1.00 67.42  ? 445  GLU A OE1 1 
ATOM   3483 O OE2 . GLU A 1 445 ? 10.321  79.624 62.751 1.00 67.42  ? 445  GLU A OE2 1 
ATOM   3484 N N   . PHE A 1 446 ? 10.468  78.725 57.211 1.00 38.39  ? 446  PHE A N   1 
ATOM   3485 C CA  . PHE A 1 446 ? 11.397  79.297 56.253 1.00 38.39  ? 446  PHE A CA  1 
ATOM   3486 C C   . PHE A 1 446 ? 10.984  78.933 54.836 1.00 38.39  ? 446  PHE A C   1 
ATOM   3487 O O   . PHE A 1 446 ? 11.176  79.712 53.906 1.00 38.39  ? 446  PHE A O   1 
ATOM   3488 C CB  . PHE A 1 446 ? 12.815  78.815 56.524 1.00 29.09  ? 446  PHE A CB  1 
ATOM   3489 C CG  . PHE A 1 446 ? 13.391  79.328 57.812 1.00 29.09  ? 446  PHE A CG  1 
ATOM   3490 C CD1 . PHE A 1 446 ? 13.040  78.752 59.027 1.00 29.09  ? 446  PHE A CD1 1 
ATOM   3491 C CD2 . PHE A 1 446 ? 14.291  80.388 57.812 1.00 29.09  ? 446  PHE A CD2 1 
ATOM   3492 C CE1 . PHE A 1 446 ? 13.577  79.221 60.214 1.00 29.09  ? 446  PHE A CE1 1 
ATOM   3493 C CE2 . PHE A 1 446 ? 14.830  80.858 58.994 1.00 29.09  ? 446  PHE A CE2 1 
ATOM   3494 C CZ  . PHE A 1 446 ? 14.472  80.273 60.198 1.00 29.09  ? 446  PHE A CZ  1 
ATOM   3495 N N   . VAL A 1 447 ? 10.408  77.750 54.664 1.00 34.20  ? 447  VAL A N   1 
ATOM   3496 C CA  . VAL A 1 447 ? 9.970   77.324 53.349 1.00 34.20  ? 447  VAL A CA  1 
ATOM   3497 C C   . VAL A 1 447 ? 8.813   78.188 52.871 1.00 34.20  ? 447  VAL A C   1 
ATOM   3498 O O   . VAL A 1 447 ? 8.766   78.568 51.699 1.00 34.20  ? 447  VAL A O   1 
ATOM   3499 C CB  . VAL A 1 447 ? 9.545   75.853 53.366 1.00 32.63  ? 447  VAL A CB  1 
ATOM   3500 C CG1 . VAL A 1 447 ? 8.811   75.500 52.081 1.00 32.63  ? 447  VAL A CG1 1 
ATOM   3501 C CG2 . VAL A 1 447 ? 10.774  74.975 53.545 1.00 32.63  ? 447  VAL A CG2 1 
ATOM   3502 N N   . PHE A 1 448 ? 7.886   78.501 53.776 1.00 41.42  ? 448  PHE A N   1 
ATOM   3503 C CA  . PHE A 1 448 ? 6.739   79.339 53.434 1.00 41.42  ? 448  PHE A CA  1 
ATOM   3504 C C   . PHE A 1 448 ? 7.035   80.833 53.559 1.00 41.42  ? 448  PHE A C   1 
ATOM   3505 O O   . PHE A 1 448 ? 6.157   81.676 53.369 1.00 41.42  ? 448  PHE A O   1 
ATOM   3506 C CB  . PHE A 1 448 ? 5.525   78.951 54.269 1.00 39.11  ? 448  PHE A CB  1 
ATOM   3507 C CG  . PHE A 1 448 ? 4.861   77.703 53.792 1.00 39.11  ? 448  PHE A CG  1 
ATOM   3508 C CD1 . PHE A 1 448 ? 5.499   76.478 53.899 1.00 39.11  ? 448  PHE A CD1 1 
ATOM   3509 C CD2 . PHE A 1 448 ? 3.619   77.754 53.169 1.00 39.11  ? 448  PHE A CD2 1 
ATOM   3510 C CE1 . PHE A 1 448 ? 4.908   75.314 53.380 1.00 39.11  ? 448  PHE A CE1 1 
ATOM   3511 C CE2 . PHE A 1 448 ? 3.019   76.598 52.648 1.00 39.11  ? 448  PHE A CE2 1 
ATOM   3512 C CZ  . PHE A 1 448 ? 3.665   75.380 52.752 1.00 39.11  ? 448  PHE A CZ  1 
ATOM   3513 N N   . GLY A 1 449 ? 8.290   81.144 53.873 1.00 47.44  ? 449  GLY A N   1 
ATOM   3514 C CA  . GLY A 1 449 ? 8.742   82.519 53.969 1.00 47.44  ? 449  GLY A CA  1 
ATOM   3515 C C   . GLY A 1 449 ? 8.182   83.441 55.030 1.00 47.44  ? 449  GLY A C   1 
ATOM   3516 O O   . GLY A 1 449 ? 8.169   84.647 54.816 1.00 47.44  ? 449  GLY A O   1 
ATOM   3517 N N   . LEU A 1 450 ? 7.743   82.905 56.166 1.00 44.17  ? 450  LEU A N   1 
ATOM   3518 C CA  . LEU A 1 450 ? 7.205   83.741 57.242 1.00 44.17  ? 450  LEU A CA  1 
ATOM   3519 C C   . LEU A 1 450 ? 8.207   84.797 57.738 1.00 44.17  ? 450  LEU A C   1 
ATOM   3520 O O   . LEU A 1 450 ? 7.807   85.843 58.243 1.00 44.17  ? 450  LEU A O   1 
ATOM   3521 C CB  . LEU A 1 450 ? 6.754   82.877 58.435 1.00 40.90  ? 450  LEU A CB  1 
ATOM   3522 C CG  . LEU A 1 450 ? 5.453   82.061 58.417 1.00 40.90  ? 450  LEU A CG  1 
ATOM   3523 C CD1 . LEU A 1 450 ? 4.273   82.989 58.325 1.00 40.90  ? 450  LEU A CD1 1 
ATOM   3524 C CD2 . LEU A 1 450 ? 5.446   81.091 57.253 1.00 40.90  ? 450  LEU A CD2 1 
ATOM   3525 N N   . PRO A 1 451 ? 9.523   84.531 57.623 1.00 39.54  ? 451  PRO A N   1 
ATOM   3526 C CA  . PRO A 1 451 ? 10.502  85.517 58.083 1.00 39.54  ? 451  PRO A CA  1 
ATOM   3527 C C   . PRO A 1 451 ? 10.373  86.866 57.384 1.00 39.54  ? 451  PRO A C   1 
ATOM   3528 O O   . PRO A 1 451 ? 10.748  87.889 57.947 1.00 39.54  ? 451  PRO A O   1 
ATOM   3529 C CB  . PRO A 1 451 ? 11.832  84.846 57.768 1.00 41.00  ? 451  PRO A CB  1 
ATOM   3530 C CG  . PRO A 1 451 ? 11.530  83.426 57.978 1.00 41.00  ? 451  PRO A CG  1 
ATOM   3531 C CD  . PRO A 1 451 ? 10.204  83.273 57.275 1.00 41.00  ? 451  PRO A CD  1 
ATOM   3532 N N   . LEU A 1 452 ? 9.850   86.858 56.160 1.00 47.25  ? 452  LEU A N   1 
ATOM   3533 C CA  . LEU A 1 452 ? 9.680   88.079 55.379 1.00 47.25  ? 452  LEU A CA  1 
ATOM   3534 C C   . LEU A 1 452 ? 8.702   89.069 55.997 1.00 47.25  ? 452  LEU A C   1 
ATOM   3535 O O   . LEU A 1 452 ? 8.819   90.275 55.781 1.00 47.25  ? 452  LEU A O   1 
ATOM   3536 C CB  . LEU A 1 452 ? 9.220   87.748 53.963 1.00 41.96  ? 452  LEU A CB  1 
ATOM   3537 C CG  . LEU A 1 452 ? 10.028  86.673 53.239 1.00 41.96  ? 452  LEU A CG  1 
ATOM   3538 C CD1 . LEU A 1 452 ? 9.735   86.758 51.754 1.00 41.96  ? 452  LEU A CD1 1 
ATOM   3539 C CD2 . LEU A 1 452 ? 11.515  86.877 53.471 1.00 41.96  ? 452  LEU A CD2 1 
ATOM   3540 N N   . VAL A 1 453 ? 7.728   88.588 56.755 1.00 37.27  ? 453  VAL A N   1 
ATOM   3541 C CA  . VAL A 1 453 ? 6.804   89.525 57.361 1.00 37.27  ? 453  VAL A CA  1 
ATOM   3542 C C   . VAL A 1 453 ? 7.380   90.030 58.696 1.00 37.27  ? 453  VAL A C   1 
ATOM   3543 O O   . VAL A 1 453 ? 7.476   89.300 59.690 1.00 37.27  ? 453  VAL A O   1 
ATOM   3544 C CB  . VAL A 1 453 ? 5.372   88.906 57.501 1.00 42.55  ? 453  VAL A CB  1 
ATOM   3545 C CG1 . VAL A 1 453 ? 5.409   87.433 57.180 1.00 42.55  ? 453  VAL A CG1 1 
ATOM   3546 C CG2 . VAL A 1 453 ? 4.804   89.150 58.884 1.00 42.55  ? 453  VAL A CG2 1 
ATOM   3547 N N   . LYS A 1 454 ? 7.786   91.298 58.676 1.00 47.89  ? 454  LYS A N   1 
ATOM   3548 C CA  . LYS A 1 454 ? 8.393   91.994 59.815 1.00 47.89  ? 454  LYS A CA  1 
ATOM   3549 C C   . LYS A 1 454 ? 7.783   91.685 61.188 1.00 47.89  ? 454  LYS A C   1 
ATOM   3550 O O   . LYS A 1 454 ? 8.454   91.206 62.106 1.00 47.89  ? 454  LYS A O   1 
ATOM   3551 C CB  . LYS A 1 454 ? 8.308   93.503 59.569 1.00 81.69  ? 454  LYS A CB  1 
ATOM   3552 C CG  . LYS A 1 454 ? 8.563   93.919 58.119 1.00 81.69  ? 454  LYS A CG  1 
ATOM   3553 C CD  . LYS A 1 454 ? 10.028  93.719 57.722 1.00 81.69  ? 454  LYS A CD  1 
ATOM   3554 C CE  . LYS A 1 454 ? 10.325  94.302 56.333 1.00 81.69  ? 454  LYS A CE  1 
ATOM   3555 N NZ  . LYS A 1 454 ? 11.776  94.201 55.985 1.00 81.69  ? 454  LYS A NZ  1 
ATOM   3556 N N   . GLU A 1 455 ? 6.504   91.998 61.311 1.00 49.99  ? 455  GLU A N   1 
ATOM   3557 C CA  . GLU A 1 455 ? 5.736   91.809 62.531 1.00 49.99  ? 455  GLU A CA  1 
ATOM   3558 C C   . GLU A 1 455 ? 5.884   90.450 63.225 1.00 49.99  ? 455  GLU A C   1 
ATOM   3559 O O   . GLU A 1 455 ? 5.515   90.318 64.391 1.00 49.99  ? 455  GLU A O   1 
ATOM   3560 C CB  . GLU A 1 455 ? 4.256   92.097 62.238 1.00 97.51  ? 455  GLU A CB  1 
ATOM   3561 C CG  . GLU A 1 455 ? 3.820   91.728 60.798 1.00 97.51  ? 455  GLU A CG  1 
ATOM   3562 C CD  . GLU A 1 455 ? 4.360   92.681 59.689 1.00 97.51  ? 455  GLU A CD  1 
ATOM   3563 O OE1 . GLU A 1 455 ? 5.424   93.336 59.879 1.00 97.51  ? 455  GLU A OE1 1 
ATOM   3564 O OE2 . GLU A 1 455 ? 3.712   92.755 58.606 1.00 97.51  ? 455  GLU A OE2 1 
ATOM   3565 N N   . LEU A 1 456 ? 6.414   89.442 62.532 1.00 61.66  ? 456  LEU A N   1 
ATOM   3566 C CA  . LEU A 1 456 ? 6.597   88.135 63.163 1.00 61.66  ? 456  LEU A CA  1 
ATOM   3567 C C   . LEU A 1 456 ? 7.905   88.075 63.967 1.00 61.66  ? 456  LEU A C   1 
ATOM   3568 O O   . LEU A 1 456 ? 8.163   87.113 64.705 1.00 61.66  ? 456  LEU A O   1 
ATOM   3569 C CB  . LEU A 1 456 ? 6.551   87.025 62.120 1.00 42.07  ? 456  LEU A CB  1 
ATOM   3570 C CG  . LEU A 1 456 ? 5.151   86.823 61.537 1.00 42.07  ? 456  LEU A CG  1 
ATOM   3571 C CD1 . LEU A 1 456 ? 5.198   85.770 60.431 1.00 42.07  ? 456  LEU A CD1 1 
ATOM   3572 C CD2 . LEU A 1 456 ? 4.196   86.418 62.641 1.00 42.07  ? 456  LEU A CD2 1 
ATOM   3573 N N   . ASN A 1 457 ? 8.730   89.109 63.813 1.00 61.56  ? 457  ASN A N   1 
ATOM   3574 C CA  . ASN A 1 457 ? 9.980   89.233 64.565 1.00 61.56  ? 457  ASN A CA  1 
ATOM   3575 C C   . ASN A 1 457 ? 11.166  88.320 64.261 1.00 61.56  ? 457  ASN A C   1 
ATOM   3576 O O   . ASN A 1 457 ? 11.774  87.776 65.184 1.00 61.56  ? 457  ASN A O   1 
ATOM   3577 C CB  . ASN A 1 457 ? 9.689   89.152 66.082 1.00 64.80  ? 457  ASN A CB  1 
ATOM   3578 C CG  . ASN A 1 457 ? 8.788   90.286 66.576 1.00 64.80  ? 457  ASN A CG  1 
ATOM   3579 O OD1 . ASN A 1 457 ? 8.806   91.400 66.040 1.00 64.80  ? 457  ASN A OD1 1 
ATOM   3580 N ND2 . ASN A 1 457 ? 8.010   90.007 67.619 1.00 64.80  ? 457  ASN A ND2 1 
ATOM   3581 N N   . TYR A 1 458 ? 11.515  88.146 62.994 1.00 45.01  ? 458  TYR A N   1 
ATOM   3582 C CA  . TYR A 1 458 ? 12.680  87.327 62.675 1.00 45.01  ? 458  TYR A CA  1 
ATOM   3583 C C   . TYR A 1 458 ? 13.861  88.273 62.434 1.00 45.01  ? 458  TYR A C   1 
ATOM   3584 O O   . TYR A 1 458 ? 13.670  89.455 62.187 1.00 45.01  ? 458  TYR A O   1 
ATOM   3585 C CB  . TYR A 1 458 ? 12.429  86.478 61.432 1.00 39.75  ? 458  TYR A CB  1 
ATOM   3586 C CG  . TYR A 1 458 ? 11.514  85.293 61.653 1.00 39.75  ? 458  TYR A CG  1 
ATOM   3587 C CD1 . TYR A 1 458 ? 10.127  85.404 61.481 1.00 39.75  ? 458  TYR A CD1 1 
ATOM   3588 C CD2 . TYR A 1 458 ? 12.038  84.055 62.019 1.00 39.75  ? 458  TYR A CD2 1 
ATOM   3589 C CE1 . TYR A 1 458 ? 9.283   84.307 61.667 1.00 39.75  ? 458  TYR A CE1 1 
ATOM   3590 C CE2 . TYR A 1 458 ? 11.210  82.953 62.215 1.00 39.75  ? 458  TYR A CE2 1 
ATOM   3591 C CZ  . TYR A 1 458 ? 9.834   83.080 62.035 1.00 39.75  ? 458  TYR A CZ  1 
ATOM   3592 O OH  . TYR A 1 458 ? 9.028   81.974 62.220 1.00 39.75  ? 458  TYR A OH  1 
ATOM   3593 N N   . THR A 1 459 ? 15.083  87.770 62.502 1.00 30.98  ? 459  THR A N   1 
ATOM   3594 C CA  . THR A 1 459 ? 16.230  88.639 62.286 1.00 30.98  ? 459  THR A CA  1 
ATOM   3595 C C   . THR A 1 459 ? 16.501  88.829 60.806 1.00 30.98  ? 459  THR A C   1 
ATOM   3596 O O   . THR A 1 459 ? 15.953  88.118 59.966 1.00 30.98  ? 459  THR A O   1 
ATOM   3597 C CB  . THR A 1 459 ? 17.491  88.081 62.962 1.00 37.12  ? 459  THR A CB  1 
ATOM   3598 O OG1 . THR A 1 459 ? 17.974  86.946 62.234 1.00 37.12  ? 459  THR A OG1 1 
ATOM   3599 C CG2 . THR A 1 459 ? 17.173  87.666 64.383 1.00 37.12  ? 459  THR A CG2 1 
ATOM   3600 N N   . ALA A 1 460 ? 17.357  89.795 60.491 1.00 45.48  ? 460  ALA A N   1 
ATOM   3601 C CA  . ALA A 1 460 ? 17.689  90.097 59.104 1.00 45.48  ? 460  ALA A CA  1 
ATOM   3602 C C   . ALA A 1 460 ? 18.309  88.895 58.418 1.00 45.48  ? 460  ALA A C   1 
ATOM   3603 O O   . ALA A 1 460 ? 17.970  88.589 57.276 1.00 45.48  ? 460  ALA A O   1 
ATOM   3604 C CB  . ALA A 1 460 ? 18.637  91.282 59.034 1.00 40.81  ? 460  ALA A CB  1 
ATOM   3605 N N   . GLU A 1 461 ? 19.215  88.206 59.104 1.00 47.44  ? 461  GLU A N   1 
ATOM   3606 C CA  . GLU A 1 461 ? 19.844  87.043 58.493 1.00 47.44  ? 461  GLU A CA  1 
ATOM   3607 C C   . GLU A 1 461 ? 18.865  85.878 58.335 1.00 47.44  ? 461  GLU A C   1 
ATOM   3608 O O   . GLU A 1 461 ? 19.015  85.056 57.424 1.00 47.44  ? 461  GLU A O   1 
ATOM   3609 C CB  . GLU A 1 461 ? 21.077  86.609 59.282 1.00 88.85  ? 461  GLU A CB  1 
ATOM   3610 C CG  . GLU A 1 461 ? 21.012  86.896 60.765 1.00 88.85  ? 461  GLU A CG  1 
ATOM   3611 C CD  . GLU A 1 461 ? 21.308  88.354 61.107 1.00 88.85  ? 461  GLU A CD  1 
ATOM   3612 O OE1 . GLU A 1 461 ? 22.321  88.898 60.590 1.00 88.85  ? 461  GLU A OE1 1 
ATOM   3613 O OE2 . GLU A 1 461 ? 20.534  88.947 61.904 1.00 88.85  ? 461  GLU A OE2 1 
ATOM   3614 N N   . GLU A 1 462 ? 17.859  85.811 59.206 1.00 57.77  ? 462  GLU A N   1 
ATOM   3615 C CA  . GLU A 1 462 ? 16.860  84.755 59.093 1.00 57.77  ? 462  GLU A CA  1 
ATOM   3616 C C   . GLU A 1 462 ? 16.009  84.982 57.828 1.00 57.77  ? 462  GLU A C   1 
ATOM   3617 O O   . GLU A 1 462 ? 15.753  84.040 57.074 1.00 57.77  ? 462  GLU A O   1 
ATOM   3618 C CB  . GLU A 1 462 ? 15.972  84.706 60.339 1.00 51.20  ? 462  GLU A CB  1 
ATOM   3619 C CG  . GLU A 1 462 ? 16.739  84.342 61.593 1.00 51.20  ? 462  GLU A CG  1 
ATOM   3620 C CD  . GLU A 1 462 ? 15.851  84.140 62.815 1.00 51.20  ? 462  GLU A CD  1 
ATOM   3621 O OE1 . GLU A 1 462 ? 14.922  84.958 63.033 1.00 51.20  ? 462  GLU A OE1 1 
ATOM   3622 O OE2 . GLU A 1 462 ? 16.098  83.165 63.566 1.00 51.20  ? 462  GLU A OE2 1 
ATOM   3623 N N   . GLU A 1 463 ? 15.585  86.221 57.585 1.00 47.70  ? 463  GLU A N   1 
ATOM   3624 C CA  . GLU A 1 463 ? 14.798  86.515 56.388 1.00 47.70  ? 463  GLU A CA  1 
ATOM   3625 C C   . GLU A 1 463 ? 15.619  86.182 55.148 1.00 47.70  ? 463  GLU A C   1 
ATOM   3626 O O   . GLU A 1 463 ? 15.080  85.777 54.119 1.00 47.70  ? 463  GLU A O   1 
ATOM   3627 C CB  . GLU A 1 463 ? 14.389  87.995 56.339 1.00 71.14  ? 463  GLU A CB  1 
ATOM   3628 C CG  . GLU A 1 463 ? 14.682  88.685 54.999 1.00 71.14  ? 463  GLU A CG  1 
ATOM   3629 C CD  . GLU A 1 463 ? 13.821  89.927 54.751 1.00 71.14  ? 463  GLU A CD  1 
ATOM   3630 O OE1 . GLU A 1 463 ? 13.848  90.865 55.591 1.00 71.14  ? 463  GLU A OE1 1 
ATOM   3631 O OE2 . GLU A 1 463 ? 13.116  89.963 53.703 1.00 71.14  ? 463  GLU A OE2 1 
ATOM   3632 N N   . ALA A 1 464 ? 16.929  86.365 55.249 1.00 42.59  ? 464  ALA A N   1 
ATOM   3633 C CA  . ALA A 1 464 ? 17.800  86.075 54.123 1.00 42.59  ? 464  ALA A CA  1 
ATOM   3634 C C   . ALA A 1 464 ? 17.772  84.580 53.863 1.00 42.59  ? 464  ALA A C   1 
ATOM   3635 O O   . ALA A 1 464 ? 17.640  84.139 52.723 1.00 42.59  ? 464  ALA A O   1 
ATOM   3636 C CB  . ALA A 1 464 ? 19.212  86.529 54.430 1.00 48.41  ? 464  ALA A CB  1 
ATOM   3637 N N   . LEU A 1 465 ? 17.894  83.809 54.938 1.00 38.15  ? 465  LEU A N   1 
ATOM   3638 C CA  . LEU A 1 465 ? 17.888  82.358 54.853 1.00 38.15  ? 465  LEU A CA  1 
ATOM   3639 C C   . LEU A 1 465 ? 16.596  81.880 54.228 1.00 38.15  ? 465  LEU A C   1 
ATOM   3640 O O   . LEU A 1 465 ? 16.587  80.940 53.437 1.00 38.15  ? 465  LEU A O   1 
ATOM   3641 C CB  . LEU A 1 465 ? 18.019  81.745 56.242 1.00 36.25  ? 465  LEU A CB  1 
ATOM   3642 C CG  . LEU A 1 465 ? 17.937  80.222 56.273 1.00 36.25  ? 465  LEU A CG  1 
ATOM   3643 C CD1 . LEU A 1 465 ? 19.140  79.626 55.592 1.00 36.25  ? 465  LEU A CD1 1 
ATOM   3644 C CD2 . LEU A 1 465 ? 17.884  79.756 57.702 1.00 36.25  ? 465  LEU A CD2 1 
ATOM   3645 N N   . SER A 1 466 ? 15.500  82.533 54.590 1.00 30.49  ? 466  SER A N   1 
ATOM   3646 C CA  . SER A 1 466 ? 14.203  82.163 54.071 1.00 30.49  ? 466  SER A CA  1 
ATOM   3647 C C   . SER A 1 466 ? 14.115  82.386 52.565 1.00 30.49  ? 466  SER A C   1 
ATOM   3648 O O   . SER A 1 466 ? 13.506  81.593 51.856 1.00 30.49  ? 466  SER A O   1 
ATOM   3649 C CB  . SER A 1 466 ? 13.116  82.956 54.791 1.00 45.06  ? 466  SER A CB  1 
ATOM   3650 O OG  . SER A 1 466 ? 11.824  82.577 54.346 1.00 45.06  ? 466  SER A OG  1 
ATOM   3651 N N   . ARG A 1 467 ? 14.714  83.459 52.063 1.00 37.53  ? 467  ARG A N   1 
ATOM   3652 C CA  . ARG A 1 467 ? 14.659  83.707 50.630 1.00 37.53  ? 467  ARG A CA  1 
ATOM   3653 C C   . ARG A 1 467 ? 15.527  82.723 49.870 1.00 37.53  ? 467  ARG A C   1 
ATOM   3654 O O   . ARG A 1 467 ? 15.140  82.266 48.801 1.00 37.53  ? 467  ARG A O   1 
ATOM   3655 C CB  . ARG A 1 467 ? 15.059  85.144 50.304 1.00 37.01  ? 467  ARG A CB  1 
ATOM   3656 C CG  . ARG A 1 467 ? 13.959  86.149 50.603 1.00 37.01  ? 467  ARG A CG  1 
ATOM   3657 C CD  . ARG A 1 467 ? 14.375  87.578 50.304 1.00 37.01  ? 467  ARG A CD  1 
ATOM   3658 N NE  . ARG A 1 467 ? 13.326  88.522 50.683 1.00 37.01  ? 467  ARG A NE  1 
ATOM   3659 C CZ  . ARG A 1 467 ? 12.158  88.643 50.056 1.00 37.01  ? 467  ARG A CZ  1 
ATOM   3660 N NH1 . ARG A 1 467 ? 11.880  87.882 48.999 1.00 37.01  ? 467  ARG A NH1 1 
ATOM   3661 N NH2 . ARG A 1 467 ? 11.256  89.510 50.503 1.00 37.01  ? 467  ARG A NH2 1 
ATOM   3662 N N   . ARG A 1 468 ? 16.693  82.384 50.413 1.00 39.14  ? 468  ARG A N   1 
ATOM   3663 C CA  . ARG A 1 468 ? 17.558  81.409 49.751 1.00 39.14  ? 468  ARG A CA  1 
ATOM   3664 C C   . ARG A 1 468 ? 16.793  80.106 49.585 1.00 39.14  ? 468  ARG A C   1 
ATOM   3665 O O   . ARG A 1 468 ? 16.763  79.524 48.502 1.00 39.14  ? 468  ARG A O   1 
ATOM   3666 C CB  . ARG A 1 468 ? 18.786  81.098 50.583 1.00 43.98  ? 468  ARG A CB  1 
ATOM   3667 C CG  . ARG A 1 468 ? 19.890  82.079 50.517 1.00 43.98  ? 468  ARG A CG  1 
ATOM   3668 C CD  . ARG A 1 468 ? 20.931  81.665 51.527 1.00 43.98  ? 468  ARG A CD  1 
ATOM   3669 N NE  . ARG A 1 468 ? 21.408  80.306 51.290 1.00 43.98  ? 468  ARG A NE  1 
ATOM   3670 C CZ  . ARG A 1 468 ? 21.955  79.541 52.231 1.00 43.98  ? 468  ARG A CZ  1 
ATOM   3671 N NH1 . ARG A 1 468 ? 22.077  80.008 53.471 1.00 43.98  ? 468  ARG A NH1 1 
ATOM   3672 N NH2 . ARG A 1 468 ? 22.401  78.323 51.932 1.00 43.98  ? 468  ARG A NH2 1 
ATOM   3673 N N   . ILE A 1 469 ? 16.184  79.652 50.677 1.00 33.27  ? 469  ILE A N   1 
ATOM   3674 C CA  . ILE A 1 469 ? 15.431  78.411 50.676 1.00 33.27  ? 469  ILE A CA  1 
ATOM   3675 C C   . ILE A 1 469 ? 14.233  78.433 49.734 1.00 33.27  ? 469  ILE A C   1 
ATOM   3676 O O   . ILE A 1 469 ? 14.036  77.483 48.987 1.00 33.27  ? 469  ILE A O   1 
ATOM   3677 C CB  . ILE A 1 469 ? 14.997  78.029 52.112 1.00 23.43  ? 469  ILE A CB  1 
ATOM   3678 C CG1 . ILE A 1 469 ? 16.230  77.597 52.909 1.00 23.43  ? 469  ILE A CG1 1 
ATOM   3679 C CG2 . ILE A 1 469 ? 13.987  76.906 52.086 1.00 23.43  ? 469  ILE A CG2 1 
ATOM   3680 C CD1 . ILE A 1 469 ? 15.943  77.191 54.325 1.00 23.43  ? 469  ILE A CD1 1 
ATOM   3681 N N   . MET A 1 470 ? 13.439  79.503 49.741 1.00 38.85  ? 470  MET A N   1 
ATOM   3682 C CA  . MET A 1 470 ? 12.284  79.561 48.833 1.00 38.85  ? 470  MET A CA  1 
ATOM   3683 C C   . MET A 1 470 ? 12.763  79.515 47.378 1.00 38.85  ? 470  MET A C   1 
ATOM   3684 O O   . MET A 1 470 ? 12.077  79.001 46.491 1.00 38.85  ? 470  MET A O   1 
ATOM   3685 C CB  . MET A 1 470 ? 11.459  80.841 49.042 1.00 42.13  ? 470  MET A CB  1 
ATOM   3686 C CG  . MET A 1 470 ? 10.886  81.015 50.425 1.00 42.13  ? 470  MET A CG  1 
ATOM   3687 S SD  . MET A 1 470 ? 9.577   82.252 50.467 1.00 42.13  ? 470  MET A SD  1 
ATOM   3688 C CE  . MET A 1 470 ? 10.488  83.739 50.097 1.00 42.13  ? 470  MET A CE  1 
ATOM   3689 N N   . HIS A 1 471 ? 13.951  80.057 47.139 1.00 47.18  ? 471  HIS A N   1 
ATOM   3690 C CA  . HIS A 1 471 ? 14.490  80.071 45.796 1.00 47.18  ? 471  HIS A CA  1 
ATOM   3691 C C   . HIS A 1 471 ? 15.054  78.699 45.454 1.00 47.18  ? 471  HIS A C   1 
ATOM   3692 O O   . HIS A 1 471 ? 15.122  78.327 44.284 1.00 47.18  ? 471  HIS A O   1 
ATOM   3693 C CB  . HIS A 1 471 ? 15.574  81.138 45.658 1.00 49.72  ? 471  HIS A CB  1 
ATOM   3694 C CG  . HIS A 1 471 ? 15.898  81.468 44.238 1.00 49.72  ? 471  HIS A CG  1 
ATOM   3695 N ND1 . HIS A 1 471 ? 15.010  82.118 43.407 1.00 49.72  ? 471  HIS A ND1 1 
ATOM   3696 C CD2 . HIS A 1 471 ? 16.993  81.201 43.486 1.00 49.72  ? 471  HIS A CD2 1 
ATOM   3697 C CE1 . HIS A 1 471 ? 15.544  82.238 42.202 1.00 49.72  ? 471  HIS A CE1 1 
ATOM   3698 N NE2 . HIS A 1 471 ? 16.747  81.690 42.223 1.00 49.72  ? 471  HIS A NE2 1 
ATOM   3699 N N   . TYR A 1 472 ? 15.464  77.946 46.468 1.00 34.94  ? 472  TYR A N   1 
ATOM   3700 C CA  . TYR A 1 472 ? 15.994  76.613 46.215 1.00 34.94  ? 472  TYR A CA  1 
ATOM   3701 C C   . TYR A 1 472 ? 14.825  75.698 45.866 1.00 34.94  ? 472  TYR A C   1 
ATOM   3702 O O   . TYR A 1 472 ? 14.842  75.000 44.857 1.00 34.94  ? 472  TYR A O   1 
ATOM   3703 C CB  . TYR A 1 472 ? 16.706  76.049 47.447 1.00 38.24  ? 472  TYR A CB  1 
ATOM   3704 C CG  . TYR A 1 472 ? 18.112  76.546 47.699 1.00 38.24  ? 472  TYR A CG  1 
ATOM   3705 C CD1 . TYR A 1 472 ? 19.023  76.683 46.657 1.00 38.24  ? 472  TYR A CD1 1 
ATOM   3706 C CD2 . TYR A 1 472 ? 18.557  76.795 49.001 1.00 38.24  ? 472  TYR A CD2 1 
ATOM   3707 C CE1 . TYR A 1 472 ? 20.350  77.053 46.900 1.00 38.24  ? 472  TYR A CE1 1 
ATOM   3708 C CE2 . TYR A 1 472 ? 19.880  77.163 49.257 1.00 38.24  ? 472  TYR A CE2 1 
ATOM   3709 C CZ  . TYR A 1 472 ? 20.770  77.287 48.199 1.00 38.24  ? 472  TYR A CZ  1 
ATOM   3710 O OH  . TYR A 1 472 ? 22.078  77.629 48.440 1.00 38.24  ? 472  TYR A OH  1 
ATOM   3711 N N   . TRP A 1 473 ? 13.808  75.707 46.715 1.00 32.11  ? 473  TRP A N   1 
ATOM   3712 C CA  . TRP A 1 473 ? 12.643  74.876 46.496 1.00 32.11  ? 473  TRP A CA  1 
ATOM   3713 C C   . TRP A 1 473 ? 11.951  75.247 45.188 1.00 32.11  ? 473  TRP A C   1 
ATOM   3714 O O   . TRP A 1 473 ? 11.602  74.379 44.395 1.00 32.11  ? 473  TRP A O   1 
ATOM   3715 C CB  . TRP A 1 473 ? 11.655  75.028 47.656 1.00 31.02  ? 473  TRP A CB  1 
ATOM   3716 C CG  . TRP A 1 473 ? 11.845  74.096 48.845 1.00 31.02  ? 473  TRP A CG  1 
ATOM   3717 C CD1 . TRP A 1 473 ? 10.853  73.483 49.551 1.00 31.02  ? 473  TRP A CD1 1 
ATOM   3718 C CD2 . TRP A 1 473 ? 13.070  73.753 49.510 1.00 31.02  ? 473  TRP A CD2 1 
ATOM   3719 N NE1 . TRP A 1 473 ? 11.373  72.788 50.611 1.00 31.02  ? 473  TRP A NE1 1 
ATOM   3720 C CE2 . TRP A 1 473 ? 12.734  72.934 50.613 1.00 31.02  ? 473  TRP A CE2 1 
ATOM   3721 C CE3 . TRP A 1 473 ? 14.419  74.056 49.288 1.00 31.02  ? 473  TRP A CE3 1 
ATOM   3722 C CZ2 . TRP A 1 473 ? 13.695  72.419 51.491 1.00 31.02  ? 473  TRP A CZ2 1 
ATOM   3723 C CZ3 . TRP A 1 473 ? 15.373  73.541 50.166 1.00 31.02  ? 473  TRP A CZ3 1 
ATOM   3724 C CH2 . TRP A 1 473 ? 15.004  72.733 51.249 1.00 31.02  ? 473  TRP A CH2 1 
ATOM   3725 N N   . ALA A 1 474 ? 11.756  76.540 44.963 1.00 28.72  ? 474  ALA A N   1 
ATOM   3726 C CA  . ALA A 1 474 ? 11.089  77.009 43.755 1.00 28.72  ? 474  ALA A CA  1 
ATOM   3727 C C   . ALA A 1 474 ? 11.889  76.739 42.495 1.00 28.72  ? 474  ALA A C   1 
ATOM   3728 O O   . ALA A 1 474 ? 11.321  76.358 41.483 1.00 28.72  ? 474  ALA A O   1 
ATOM   3729 C CB  . ALA A 1 474 ? 10.787  78.488 43.868 1.00 12.35  ? 474  ALA A CB  1 
ATOM   3730 N N   . THR A 1 475 ? 13.203  76.937 42.549 1.00 36.39  ? 475  THR A N   1 
ATOM   3731 C CA  . THR A 1 475 ? 14.044  76.691 41.383 1.00 36.39  ? 475  THR A CA  1 
ATOM   3732 C C   . THR A 1 475 ? 14.072  75.208 41.057 1.00 36.39  ? 475  THR A C   1 
ATOM   3733 O O   . THR A 1 475 ? 14.057  74.823 39.886 1.00 36.39  ? 475  THR A O   1 
ATOM   3734 C CB  . THR A 1 475 ? 15.480  77.128 41.611 1.00 43.01  ? 475  THR A CB  1 
ATOM   3735 O OG1 . THR A 1 475 ? 15.503  78.516 41.944 1.00 43.01  ? 475  THR A OG1 1 
ATOM   3736 C CG2 . THR A 1 475 ? 16.307  76.891 40.355 1.00 43.01  ? 475  THR A CG2 1 
ATOM   3737 N N   . PHE A 1 476 ? 14.135  74.384 42.097 1.00 35.34  ? 476  PHE A N   1 
ATOM   3738 C CA  . PHE A 1 476 ? 14.145  72.945 41.926 1.00 35.34  ? 476  PHE A CA  1 
ATOM   3739 C C   . PHE A 1 476 ? 12.818  72.484 41.349 1.00 35.34  ? 476  PHE A C   1 
ATOM   3740 O O   . PHE A 1 476 ? 12.788  71.653 40.452 1.00 35.34  ? 476  PHE A O   1 
ATOM   3741 C CB  . PHE A 1 476 ? 14.371  72.242 43.263 1.00 28.63  ? 476  PHE A CB  1 
ATOM   3742 C CG  . PHE A 1 476 ? 14.264  70.750 43.180 1.00 28.63  ? 476  PHE A CG  1 
ATOM   3743 C CD1 . PHE A 1 476 ? 15.286  69.999 42.623 1.00 28.63  ? 476  PHE A CD1 1 
ATOM   3744 C CD2 . PHE A 1 476 ? 13.122  70.101 43.625 1.00 28.63  ? 476  PHE A CD2 1 
ATOM   3745 C CE1 . PHE A 1 476 ? 15.175  68.627 42.508 1.00 28.63  ? 476  PHE A CE1 1 
ATOM   3746 C CE2 . PHE A 1 476 ? 12.996  68.732 43.516 1.00 28.63  ? 476  PHE A CE2 1 
ATOM   3747 C CZ  . PHE A 1 476 ? 14.028  67.989 42.955 1.00 28.63  ? 476  PHE A CZ  1 
ATOM   3748 N N   . ALA A 1 477 ? 11.719  73.015 41.870 1.00 34.52  ? 477  ALA A N   1 
ATOM   3749 C CA  . ALA A 1 477 ? 10.407  72.631 41.384 1.00 34.52  ? 477  ALA A CA  1 
ATOM   3750 C C   . ALA A 1 477 ? 10.285  72.880 39.882 1.00 34.52  ? 477  ALA A C   1 
ATOM   3751 O O   . ALA A 1 477 ? 9.661   72.085 39.165 1.00 34.52  ? 477  ALA A O   1 
ATOM   3752 C CB  . ALA A 1 477 ? 9.336   73.398 42.127 1.00 18.71  ? 477  ALA A CB  1 
ATOM   3753 N N   . LYS A 1 478 ? 10.886  73.978 39.411 1.00 35.78  ? 478  LYS A N   1 
ATOM   3754 C CA  . LYS A 1 478 ? 10.837  74.355 37.998 1.00 35.78  ? 478  LYS A CA  1 
ATOM   3755 C C   . LYS A 1 478 ? 11.804  73.591 37.123 1.00 35.78  ? 478  LYS A C   1 
ATOM   3756 O O   . LYS A 1 478 ? 11.431  73.098 36.067 1.00 35.78  ? 478  LYS A O   1 
ATOM   3757 C CB  . LYS A 1 478 ? 11.158  75.839 37.806 1.00 61.16  ? 478  LYS A CB  1 
ATOM   3758 C CG  . LYS A 1 478 ? 10.183  76.807 38.436 1.00 61.16  ? 478  LYS A CG  1 
ATOM   3759 C CD  . LYS A 1 478 ? 10.806  78.209 38.579 1.00 61.16  ? 478  LYS A CD  1 
ATOM   3760 C CE  . LYS A 1 478 ? 9.991   79.113 39.533 1.00 61.16  ? 478  LYS A CE  1 
ATOM   3761 N NZ  . LYS A 1 478 ? 10.826  80.203 40.155 1.00 61.16  ? 478  LYS A NZ  1 
ATOM   3762 N N   . THR A 1 479 ? 13.050  73.494 37.566 1.00 33.31  ? 479  THR A N   1 
ATOM   3763 C CA  . THR A 1 479 ? 14.091  72.861 36.770 1.00 33.31  ? 479  THR A CA  1 
ATOM   3764 C C   . THR A 1 479 ? 14.645  71.506 37.193 1.00 33.31  ? 479  THR A C   1 
ATOM   3765 O O   . THR A 1 479 ? 15.285  70.840 36.397 1.00 33.31  ? 479  THR A O   1 
ATOM   3766 C CB  . THR A 1 479 ? 15.279  73.839 36.616 1.00 43.99  ? 479  THR A CB  1 
ATOM   3767 O OG1 . THR A 1 479 ? 16.090  73.829 37.807 1.00 43.99  ? 479  THR A OG1 1 
ATOM   3768 C CG2 . THR A 1 479 ? 14.756  75.251 36.413 1.00 43.99  ? 479  THR A CG2 1 
ATOM   3769 N N   . GLY A 1 480 ? 14.422  71.092 38.430 1.00 33.99  ? 480  GLY A N   1 
ATOM   3770 C CA  . GLY A 1 480 ? 14.967  69.814 38.861 1.00 33.99  ? 480  GLY A CA  1 
ATOM   3771 C C   . GLY A 1 480 ? 16.388  69.965 39.382 1.00 33.99  ? 480  GLY A C   1 
ATOM   3772 O O   . GLY A 1 480 ? 17.140  69.001 39.489 1.00 33.99  ? 480  GLY A O   1 
ATOM   3773 N N   . ASN A 1 481 ? 16.746  71.205 39.698 1.00 52.74  ? 481  ASN A N   1 
ATOM   3774 C CA  . ASN A 1 481 ? 18.056  71.573 40.222 1.00 52.74  ? 481  ASN A CA  1 
ATOM   3775 C C   . ASN A 1 481 ? 17.821  72.838 41.059 1.00 52.74  ? 481  ASN A C   1 
ATOM   3776 O O   . ASN A 1 481 ? 17.281  73.828 40.556 1.00 52.74  ? 481  ASN A O   1 
ATOM   3777 C CB  . ASN A 1 481 ? 18.999  71.888 39.070 1.00 40.57  ? 481  ASN A CB  1 
ATOM   3778 C CG  . ASN A 1 481 ? 20.391  72.235 39.533 1.00 40.57  ? 481  ASN A CG  1 
ATOM   3779 O OD1 . ASN A 1 481 ? 20.582  72.847 40.586 1.00 40.57  ? 481  ASN A OD1 1 
ATOM   3780 N ND2 . ASN A 1 481 ? 21.378  71.868 38.732 1.00 40.57  ? 481  ASN A ND2 1 
ATOM   3781 N N   . PRO A 1 482 ? 18.215  72.819 42.344 1.00 38.61  ? 482  PRO A N   1 
ATOM   3782 C CA  . PRO A 1 482 ? 18.039  73.962 43.243 1.00 38.61  ? 482  PRO A CA  1 
ATOM   3783 C C   . PRO A 1 482 ? 18.869  75.201 42.897 1.00 38.61  ? 482  PRO A C   1 
ATOM   3784 O O   . PRO A 1 482 ? 18.576  76.316 43.358 1.00 38.61  ? 482  PRO A O   1 
ATOM   3785 C CB  . PRO A 1 482 ? 18.412  73.375 44.599 1.00 31.02  ? 482  PRO A CB  1 
ATOM   3786 C CG  . PRO A 1 482 ? 19.457  72.403 44.249 1.00 31.02  ? 482  PRO A CG  1 
ATOM   3787 C CD  . PRO A 1 482 ? 18.856  71.707 43.059 1.00 31.02  ? 482  PRO A CD  1 
ATOM   3788 N N   . ASN A 1 483 ? 19.888  74.997 42.068 1.00 40.09  ? 483  ASN A N   1 
ATOM   3789 C CA  . ASN A 1 483 ? 20.792  76.066 41.671 1.00 40.09  ? 483  ASN A CA  1 
ATOM   3790 C C   . ASN A 1 483 ? 20.461  76.813 40.397 1.00 40.09  ? 483  ASN A C   1 
ATOM   3791 O O   . ASN A 1 483 ? 19.928  76.257 39.436 1.00 40.09  ? 483  ASN A O   1 
ATOM   3792 C CB  . ASN A 1 483 ? 22.194  75.505 41.553 1.00 45.67  ? 483  ASN A CB  1 
ATOM   3793 C CG  . ASN A 1 483 ? 22.619  74.799 42.801 1.00 45.67  ? 483  ASN A CG  1 
ATOM   3794 O OD1 . ASN A 1 483 ? 22.806  75.426 43.852 1.00 45.67  ? 483  ASN A OD1 1 
ATOM   3795 N ND2 . ASN A 1 483 ? 22.752  73.481 42.714 1.00 45.67  ? 483  ASN A ND2 1 
ATOM   3796 N N   . GLU A 1 484 ? 20.808  78.091 40.407 1.00 60.09  ? 484  GLU A N   1 
ATOM   3797 C CA  . GLU A 1 484 ? 20.599  78.969 39.268 1.00 60.09  ? 484  GLU A CA  1 
ATOM   3798 C C   . GLU A 1 484 ? 21.625  78.667 38.169 1.00 60.09  ? 484  GLU A C   1 
ATOM   3799 O O   . GLU A 1 484 ? 22.826  78.595 38.437 1.00 60.09  ? 484  GLU A O   1 
ATOM   3800 C CB  . GLU A 1 484 ? 20.723  80.412 39.740 1.00 83.50  ? 484  GLU A CB  1 
ATOM   3801 C CG  . GLU A 1 484 ? 19.511  80.861 40.506 1.00 83.50  ? 484  GLU A CG  1 
ATOM   3802 C CD  . GLU A 1 484 ? 18.383  81.207 39.563 1.00 83.50  ? 484  GLU A CD  1 
ATOM   3803 O OE1 . GLU A 1 484 ? 18.280  80.541 38.494 1.00 83.50  ? 484  GLU A OE1 1 
ATOM   3804 O OE2 . GLU A 1 484 ? 17.606  82.141 39.887 1.00 83.50  ? 484  GLU A OE2 1 
ATOM   3805 N N   . PRO A 1 485 ? 21.160  78.515 36.913 0.75 68.13  ? 485  PRO A N   1 
ATOM   3806 C CA  . PRO A 1 485 ? 22.006  78.211 35.750 0.75 68.13  ? 485  PRO A CA  1 
ATOM   3807 C C   . PRO A 1 485 ? 23.412  78.793 35.811 0.75 68.13  ? 485  PRO A C   1 
ATOM   3808 O O   . PRO A 1 485 ? 24.381  78.080 36.074 0.75 68.13  ? 485  PRO A O   1 
ATOM   3809 C CB  . PRO A 1 485 ? 21.208  78.785 34.585 0.75 64.22  ? 485  PRO A CB  1 
ATOM   3810 C CG  . PRO A 1 485 ? 19.788  78.556 35.017 0.75 64.22  ? 485  PRO A CG  1 
ATOM   3811 C CD  . PRO A 1 485 ? 19.826  78.979 36.479 0.75 64.22  ? 485  PRO A CD  1 
ATOM   3812 N N   . HIS A 1 486 ? 23.513  80.096 35.586 0.75 61.59  ? 486  HIS A N   1 
ATOM   3813 C CA  . HIS A 1 486 ? 24.807  80.760 35.589 0.75 61.59  ? 486  HIS A CA  1 
ATOM   3814 C C   . HIS A 1 486 ? 25.020  81.693 36.784 0.75 61.59  ? 486  HIS A C   1 
ATOM   3815 O O   . HIS A 1 486 ? 25.739  82.689 36.675 0.75 61.59  ? 486  HIS A O   1 
ATOM   3816 C CB  . HIS A 1 486 ? 24.967  81.543 34.285 0.75 69.09  ? 486  HIS A CB  1 
ATOM   3817 C CG  . HIS A 1 486 ? 24.614  80.754 33.061 0.75 69.09  ? 486  HIS A CG  1 
ATOM   3818 N ND1 . HIS A 1 486 ? 25.320  79.637 32.663 0.75 69.09  ? 486  HIS A ND1 1 
ATOM   3819 C CD2 . HIS A 1 486 ? 23.624  80.916 32.150 0.75 69.09  ? 486  HIS A CD2 1 
ATOM   3820 C CE1 . HIS A 1 486 ? 24.780  79.147 31.561 0.75 69.09  ? 486  HIS A CE1 1 
ATOM   3821 N NE2 . HIS A 1 486 ? 23.750  79.904 31.229 0.75 69.09  ? 486  HIS A NE2 1 
ATOM   3822 N N   . SER A 1 487 ? 24.406  81.376 37.919 0.75 46.20  ? 487  SER A N   1 
ATOM   3823 C CA  . SER A 1 487 ? 24.549  82.194 39.123 0.75 46.20  ? 487  SER A CA  1 
ATOM   3824 C C   . SER A 1 487 ? 26.006  82.300 39.569 0.75 46.20  ? 487  SER A C   1 
ATOM   3825 O O   . SER A 1 487 ? 26.874  81.613 39.044 0.75 46.20  ? 487  SER A O   1 
ATOM   3826 C CB  . SER A 1 487 ? 23.719  81.594 40.259 0.75 50.08  ? 487  SER A CB  1 
ATOM   3827 O OG  . SER A 1 487 ? 24.168  82.046 41.524 0.75 50.08  ? 487  SER A OG  1 
ATOM   3828 N N   . GLN A 1 488 ? 26.267  83.169 40.539 0.75 41.84  ? 488  GLN A N   1 
ATOM   3829 C CA  . GLN A 1 488 ? 27.614  83.344 41.070 0.75 41.84  ? 488  GLN A CA  1 
ATOM   3830 C C   . GLN A 1 488 ? 27.638  82.882 42.525 0.75 41.84  ? 488  GLN A C   1 
ATOM   3831 O O   . GLN A 1 488 ? 28.685  82.898 43.176 0.75 41.84  ? 488  GLN A O   1 
ATOM   3832 C CB  . GLN A 1 488 ? 28.033  84.814 41.007 0.75 57.29  ? 488  GLN A CB  1 
ATOM   3833 C CG  . GLN A 1 488 ? 28.157  85.394 39.608 0.75 57.29  ? 488  GLN A CG  1 
ATOM   3834 C CD  . GLN A 1 488 ? 29.173  84.658 38.749 0.75 57.29  ? 488  GLN A CD  1 
ATOM   3835 O OE1 . GLN A 1 488 ? 30.318  84.444 39.154 0.75 57.29  ? 488  GLN A OE1 1 
ATOM   3836 N NE2 . GLN A 1 488 ? 28.758  84.276 37.549 0.75 57.29  ? 488  GLN A NE2 1 
ATOM   3837 N N   . GLU A 1 489 ? 26.472  82.481 43.029 0.75 46.10  ? 489  GLU A N   1 
ATOM   3838 C CA  . GLU A 1 489 ? 26.341  82.011 44.412 0.75 46.10  ? 489  GLU A CA  1 
ATOM   3839 C C   . GLU A 1 489 ? 26.984  80.638 44.560 0.75 46.10  ? 489  GLU A C   1 
ATOM   3840 O O   . GLU A 1 489 ? 27.415  80.045 43.570 0.75 46.10  ? 489  GLU A O   1 
ATOM   3841 C CB  . GLU A 1 489 ? 24.863  81.906 44.802 0.75 79.46  ? 489  GLU A CB  1 
ATOM   3842 C CG  . GLU A 1 489 ? 24.063  83.184 44.650 0.75 79.46  ? 489  GLU A CG  1 
ATOM   3843 C CD  . GLU A 1 489 ? 24.541  84.288 45.575 0.75 79.46  ? 489  GLU A CD  1 
ATOM   3844 O OE1 . GLU A 1 489 ? 24.536  84.086 46.815 0.75 79.46  ? 489  GLU A OE1 1 
ATOM   3845 O OE2 . GLU A 1 489 ? 24.922  85.364 45.059 0.75 79.46  ? 489  GLU A OE2 1 
ATOM   3846 N N   . SER A 1 490 ? 27.043  80.138 45.794 1.00 60.15  ? 490  SER A N   1 
ATOM   3847 C CA  . SER A 1 490 ? 27.619  78.811 46.069 1.00 60.15  ? 490  SER A CA  1 
ATOM   3848 C C   . SER A 1 490 ? 26.703  77.701 45.543 1.00 60.15  ? 490  SER A C   1 
ATOM   3849 O O   . SER A 1 490 ? 25.475  77.746 45.744 1.00 60.15  ? 490  SER A O   1 
ATOM   3850 C CB  . SER A 1 490 ? 27.815  78.601 47.576 1.00 65.11  ? 490  SER A CB  1 
ATOM   3851 O OG  . SER A 1 490 ? 28.780  79.489 48.108 1.00 65.11  ? 490  SER A OG  1 
ATOM   3852 N N   . LYS A 1 491 ? 27.295  76.705 44.886 1.00 44.44  ? 491  LYS A N   1 
ATOM   3853 C CA  . LYS A 1 491 ? 26.519  75.599 44.346 1.00 44.44  ? 491  LYS A CA  1 
ATOM   3854 C C   . LYS A 1 491 ? 26.226  74.481 45.351 1.00 44.44  ? 491  LYS A C   1 
ATOM   3855 O O   . LYS A 1 491 ? 27.109  74.054 46.105 1.00 44.44  ? 491  LYS A O   1 
ATOM   3856 C CB  . LYS A 1 491 ? 27.223  75.009 43.126 1.00 62.53  ? 491  LYS A CB  1 
ATOM   3857 C CG  . LYS A 1 491 ? 27.363  75.991 41.976 1.00 62.53  ? 491  LYS A CG  1 
ATOM   3858 C CD  . LYS A 1 491 ? 26.018  76.565 41.567 1.00 62.53  ? 491  LYS A CD  1 
ATOM   3859 C CE  . LYS A 1 491 ? 26.165  77.631 40.485 1.00 62.53  ? 491  LYS A CE  1 
ATOM   3860 N NZ  . LYS A 1 491 ? 24.828  78.170 40.082 1.00 62.53  ? 491  LYS A NZ  1 
ATOM   3861 N N   . TRP A 1 492 ? 24.969  74.030 45.343 1.00 32.49  ? 492  TRP A N   1 
ATOM   3862 C CA  . TRP A 1 492 ? 24.460  72.946 46.187 1.00 32.49  ? 492  TRP A CA  1 
ATOM   3863 C C   . TRP A 1 492 ? 24.829  71.686 45.420 1.00 32.49  ? 492  TRP A C   1 
ATOM   3864 O O   . TRP A 1 492 ? 24.091  71.264 44.543 1.00 32.49  ? 492  TRP A O   1 
ATOM   3865 C CB  . TRP A 1 492 ? 22.931  73.054 46.279 1.00 32.22  ? 492  TRP A CB  1 
ATOM   3866 C CG  . TRP A 1 492 ? 22.238  72.051 47.165 1.00 32.22  ? 492  TRP A CG  1 
ATOM   3867 C CD1 . TRP A 1 492 ? 22.693  70.818 47.527 1.00 32.22  ? 492  TRP A CD1 1 
ATOM   3868 C CD2 . TRP A 1 492 ? 20.949  72.195 47.776 1.00 32.22  ? 492  TRP A CD2 1 
ATOM   3869 N NE1 . TRP A 1 492 ? 21.771  70.187 48.327 1.00 32.22  ? 492  TRP A NE1 1 
ATOM   3870 C CE2 . TRP A 1 492 ? 20.690  71.011 48.493 1.00 32.22  ? 492  TRP A CE2 1 
ATOM   3871 C CE3 . TRP A 1 492 ? 19.989  73.210 47.787 1.00 32.22  ? 492  TRP A CE3 1 
ATOM   3872 C CZ2 . TRP A 1 492 ? 19.508  70.814 49.214 1.00 32.22  ? 492  TRP A CZ2 1 
ATOM   3873 C CZ3 . TRP A 1 492 ? 18.817  73.011 48.505 1.00 32.22  ? 492  TRP A CZ3 1 
ATOM   3874 C CH2 . TRP A 1 492 ? 18.589  71.822 49.207 1.00 32.22  ? 492  TRP A CH2 1 
ATOM   3875 N N   . PRO A 1 493 ? 25.968  71.066 45.740 1.00 27.44  ? 493  PRO A N   1 
ATOM   3876 C CA  . PRO A 1 493 ? 26.359  69.859 45.018 1.00 27.44  ? 493  PRO A CA  1 
ATOM   3877 C C   . PRO A 1 493 ? 25.314  68.751 44.994 1.00 27.44  ? 493  PRO A C   1 
ATOM   3878 O O   . PRO A 1 493 ? 24.501  68.619 45.906 1.00 27.44  ? 493  PRO A O   1 
ATOM   3879 C CB  . PRO A 1 493 ? 27.642  69.443 45.722 1.00 28.10  ? 493  PRO A CB  1 
ATOM   3880 C CG  . PRO A 1 493 ? 27.399  69.859 47.096 1.00 28.10  ? 493  PRO A CG  1 
ATOM   3881 C CD  . PRO A 1 493 ? 26.812  71.242 46.927 1.00 28.10  ? 493  PRO A CD  1 
ATOM   3882 N N   . LEU A 1 494 ? 25.354  67.968 43.923 1.00 34.46  ? 494  LEU A N   1 
ATOM   3883 C CA  . LEU A 1 494 ? 24.460  66.843 43.691 1.00 34.46  ? 494  LEU A CA  1 
ATOM   3884 C C   . LEU A 1 494 ? 24.899  65.694 44.607 1.00 34.46  ? 494  LEU A C   1 
ATOM   3885 O O   . LEU A 1 494 ? 26.081  65.561 44.913 1.00 34.46  ? 494  LEU A O   1 
ATOM   3886 C CB  . LEU A 1 494 ? 24.589  66.431 42.227 1.00 19.53  ? 494  LEU A CB  1 
ATOM   3887 C CG  . LEU A 1 494 ? 23.553  65.602 41.486 1.00 19.53  ? 494  LEU A CG  1 
ATOM   3888 C CD1 . LEU A 1 494 ? 22.226  66.304 41.483 1.00 19.53  ? 494  LEU A CD1 1 
ATOM   3889 C CD2 . LEU A 1 494 ? 24.018  65.405 40.067 1.00 19.53  ? 494  LEU A CD2 1 
ATOM   3890 N N   . PHE A 1 495 ? 23.955  64.881 45.062 1.00 36.95  ? 495  PHE A N   1 
ATOM   3891 C CA  . PHE A 1 495 ? 24.295  63.756 45.923 1.00 36.95  ? 495  PHE A CA  1 
ATOM   3892 C C   . PHE A 1 495 ? 24.504  62.534 45.037 1.00 36.95  ? 495  PHE A C   1 
ATOM   3893 O O   . PHE A 1 495 ? 23.635  62.184 44.242 1.00 36.95  ? 495  PHE A O   1 
ATOM   3894 C CB  . PHE A 1 495 ? 23.176  63.513 46.945 1.00 20.81  ? 495  PHE A CB  1 
ATOM   3895 C CG  . PHE A 1 495 ? 23.344  62.256 47.766 1.00 20.81  ? 495  PHE A CG  1 
ATOM   3896 C CD1 . PHE A 1 495 ? 22.961  61.014 47.264 1.00 20.81  ? 495  PHE A CD1 1 
ATOM   3897 C CD2 . PHE A 1 495 ? 23.859  62.314 49.056 1.00 20.81  ? 495  PHE A CD2 1 
ATOM   3898 C CE1 . PHE A 1 495 ? 23.085  59.859 48.031 1.00 20.81  ? 495  PHE A CE1 1 
ATOM   3899 C CE2 . PHE A 1 495 ? 23.985  61.161 49.822 1.00 20.81  ? 495  PHE A CE2 1 
ATOM   3900 C CZ  . PHE A 1 495 ? 23.595  59.935 49.305 1.00 20.81  ? 495  PHE A CZ  1 
ATOM   3901 N N   . THR A 1 496 ? 25.661  61.892 45.168 1.00 42.15  ? 496  THR A N   1 
ATOM   3902 C CA  . THR A 1 496 ? 25.992  60.719 44.362 1.00 42.15  ? 496  THR A CA  1 
ATOM   3903 C C   . THR A 1 496 ? 26.405  59.539 45.223 1.00 42.15  ? 496  THR A C   1 
ATOM   3904 O O   . THR A 1 496 ? 27.061  59.712 46.247 1.00 42.15  ? 496  THR A O   1 
ATOM   3905 C CB  . THR A 1 496 ? 27.149  61.015 43.426 1.00 37.91  ? 496  THR A CB  1 
ATOM   3906 O OG1 . THR A 1 496 ? 28.365  61.090 44.187 1.00 37.91  ? 496  THR A OG1 1 
ATOM   3907 C CG2 . THR A 1 496 ? 26.914  62.326 42.720 1.00 37.91  ? 496  THR A CG2 1 
ATOM   3908 N N   . THR A 1 497 ? 26.047  58.336 44.783 1.00 52.98  ? 497  THR A N   1 
ATOM   3909 C CA  . THR A 1 497 ? 26.376  57.134 45.528 1.00 52.98  ? 497  THR A CA  1 
ATOM   3910 C C   . THR A 1 497 ? 27.814  57.195 46.005 1.00 52.98  ? 497  THR A C   1 
ATOM   3911 O O   . THR A 1 497 ? 28.128  56.757 47.118 1.00 52.98  ? 497  THR A O   1 
ATOM   3912 C CB  . THR A 1 497 ? 26.233  55.860 44.678 1.00 48.44  ? 497  THR A CB  1 
ATOM   3913 O OG1 . THR A 1 497 ? 24.913  55.778 44.135 1.00 48.44  ? 497  THR A OG1 1 
ATOM   3914 C CG2 . THR A 1 497 ? 26.480  54.628 45.541 1.00 48.44  ? 497  THR A CG2 1 
ATOM   3915 N N   . LYS A 1 498 ? 28.684  57.754 45.173 1.00 38.39  ? 498  LYS A N   1 
ATOM   3916 C CA  . LYS A 1 498 ? 30.087  57.828 45.529 1.00 38.39  ? 498  LYS A CA  1 
ATOM   3917 C C   . LYS A 1 498 ? 30.449  58.902 46.558 1.00 38.39  ? 498  LYS A C   1 
ATOM   3918 O O   . LYS A 1 498 ? 30.883  58.575 47.661 1.00 38.39  ? 498  LYS A O   1 
ATOM   3919 C CB  . LYS A 1 498 ? 30.918  58.007 44.262 1.00 66.09  ? 498  LYS A CB  1 
ATOM   3920 C CG  . LYS A 1 498 ? 32.436  57.952 44.489 1.00 66.09  ? 498  LYS A CG  1 
ATOM   3921 C CD  . LYS A 1 498 ? 33.172  58.034 43.154 1.00 66.09  ? 498  LYS A CD  1 
ATOM   3922 C CE  . LYS A 1 498 ? 34.682  58.169 43.317 1.00 66.09  ? 498  LYS A CE  1 
ATOM   3923 N NZ  . LYS A 1 498 ? 35.348  58.146 41.964 1.00 66.09  ? 498  LYS A NZ  1 
ATOM   3924 N N   . GLU A 1 499 ? 30.267  60.174 46.205 1.00 31.04  ? 499  GLU A N   1 
ATOM   3925 C CA  . GLU A 1 499 ? 30.614  61.285 47.104 1.00 31.04  ? 499  GLU A CA  1 
ATOM   3926 C C   . GLU A 1 499 ? 29.702  61.446 48.312 1.00 31.04  ? 499  GLU A C   1 
ATOM   3927 O O   . GLU A 1 499 ? 30.167  61.713 49.412 1.00 31.04  ? 499  GLU A O   1 
ATOM   3928 C CB  . GLU A 1 499 ? 30.609  62.611 46.339 1.00 92.04  ? 499  GLU A CB  1 
ATOM   3929 C CG  . GLU A 1 499 ? 31.265  62.562 44.971 1.00 92.04  ? 499  GLU A CG  1 
ATOM   3930 C CD  . GLU A 1 499 ? 32.582  61.821 45.009 1.00 92.04  ? 499  GLU A CD  1 
ATOM   3931 O OE1 . GLU A 1 499 ? 33.360  62.052 45.972 1.00 92.04  ? 499  GLU A OE1 1 
ATOM   3932 O OE2 . GLU A 1 499 ? 32.832  61.012 44.076 1.00 92.04  ? 499  GLU A OE2 1 
ATOM   3933 N N   . GLN A 1 500 ? 28.399  61.325 48.087 1.00 39.59  ? 500  GLN A N   1 
ATOM   3934 C CA  . GLN A 1 500 ? 27.423  61.461 49.157 1.00 39.59  ? 500  GLN A CA  1 
ATOM   3935 C C   . GLN A 1 500 ? 27.493  62.839 49.797 1.00 39.59  ? 500  GLN A C   1 
ATOM   3936 O O   . GLN A 1 500 ? 27.480  62.979 51.011 1.00 39.59  ? 500  GLN A O   1 
ATOM   3937 C CB  . GLN A 1 500 ? 27.662  60.372 50.195 1.00 45.22  ? 500  GLN A CB  1 
ATOM   3938 C CG  . GLN A 1 500 ? 27.130  59.025 49.748 1.00 45.22  ? 500  GLN A CG  1 
ATOM   3939 C CD  . GLN A 1 500 ? 27.638  57.888 50.601 1.00 45.22  ? 500  GLN A CD  1 
ATOM   3940 O OE1 . GLN A 1 500 ? 28.721  57.351 50.351 1.00 45.22  ? 500  GLN A OE1 1 
ATOM   3941 N NE2 . GLN A 1 500 ? 26.869  57.519 51.626 1.00 45.22  ? 500  GLN A NE2 1 
ATOM   3942 N N   . LYS A 1 501 ? 27.553  63.864 48.964 1.00 37.06  ? 501  LYS A N   1 
ATOM   3943 C CA  . LYS A 1 501 ? 27.653  65.219 49.464 1.00 37.06  ? 501  LYS A CA  1 
ATOM   3944 C C   . LYS A 1 501 ? 26.328  65.796 49.867 1.00 37.06  ? 501  LYS A C   1 
ATOM   3945 O O   . LYS A 1 501 ? 25.283  65.391 49.378 1.00 37.06  ? 501  LYS A O   1 
ATOM   3946 C CB  . LYS A 1 501 ? 28.278  66.132 48.406 1.00 43.06  ? 501  LYS A CB  1 
ATOM   3947 C CG  . LYS A 1 501 ? 29.672  65.714 47.990 1.00 43.06  ? 501  LYS A CG  1 
ATOM   3948 C CD  . LYS A 1 501 ? 30.275  66.720 47.040 1.00 43.06  ? 501  LYS A CD  1 
ATOM   3949 C CE  . LYS A 1 501 ? 31.655  66.286 46.611 1.00 43.06  ? 501  LYS A CE  1 
ATOM   3950 N NZ  . LYS A 1 501 ? 32.321  67.354 45.829 1.00 43.06  ? 501  LYS A NZ  1 
ATOM   3951 N N   . PHE A 1 502 ? 26.379  66.755 50.771 1.00 36.75  ? 502  PHE A N   1 
ATOM   3952 C CA  . PHE A 1 502 ? 25.182  67.427 51.209 1.00 36.75  ? 502  PHE A CA  1 
ATOM   3953 C C   . PHE A 1 502 ? 25.579  68.773 51.797 1.00 36.75  ? 502  PHE A C   1 
ATOM   3954 O O   . PHE A 1 502 ? 26.760  69.037 52.020 1.00 36.75  ? 502  PHE A O   1 
ATOM   3955 C CB  . PHE A 1 502 ? 24.423  66.574 52.221 1.00 29.98  ? 502  PHE A CB  1 
ATOM   3956 C CG  . PHE A 1 502 ? 24.972  66.627 53.615 1.00 29.98  ? 502  PHE A CG  1 
ATOM   3957 C CD1 . PHE A 1 502 ? 25.954  65.742 54.023 1.00 29.98  ? 502  PHE A CD1 1 
ATOM   3958 C CD2 . PHE A 1 502 ? 24.435  67.513 54.547 1.00 29.98  ? 502  PHE A CD2 1 
ATOM   3959 C CE1 . PHE A 1 502 ? 26.385  65.731 55.347 1.00 29.98  ? 502  PHE A CE1 1 
ATOM   3960 C CE2 . PHE A 1 502 ? 24.860  67.506 55.860 1.00 29.98  ? 502  PHE A CE2 1 
ATOM   3961 C CZ  . PHE A 1 502 ? 25.833  66.613 56.264 1.00 29.98  ? 502  PHE A CZ  1 
ATOM   3962 N N   . ILE A 1 503 ? 24.597  69.628 52.049 1.00 40.00  ? 503  ILE A N   1 
ATOM   3963 C CA  . ILE A 1 503 ? 24.896  70.939 52.580 1.00 40.00  ? 503  ILE A CA  1 
ATOM   3964 C C   . ILE A 1 503 ? 24.105  71.246 53.836 1.00 40.00  ? 503  ILE A C   1 
ATOM   3965 O O   . ILE A 1 503 ? 23.059  70.651 54.078 1.00 40.00  ? 503  ILE A O   1 
ATOM   3966 C CB  . ILE A 1 503 ? 24.557  72.023 51.561 1.00 35.89  ? 503  ILE A CB  1 
ATOM   3967 C CG1 . ILE A 1 503 ? 23.048  72.039 51.327 1.00 35.89  ? 503  ILE A CG1 1 
ATOM   3968 C CG2 . ILE A 1 503 ? 25.279  71.761 50.257 1.00 35.89  ? 503  ILE A CG2 1 
ATOM   3969 C CD1 . ILE A 1 503 ? 22.519  73.395 50.914 1.00 35.89  ? 503  ILE A CD1 1 
ATOM   3970 N N   . ASP A 1 504 ? 24.620  72.171 54.642 1.00 52.03  ? 504  ASP A N   1 
ATOM   3971 C CA  . ASP A 1 504 ? 23.927  72.602 55.845 1.00 52.03  ? 504  ASP A CA  1 
ATOM   3972 C C   . ASP A 1 504 ? 23.071  73.763 55.373 1.00 52.03  ? 504  ASP A C   1 
ATOM   3973 O O   . ASP A 1 504 ? 23.406  74.417 54.384 1.00 52.03  ? 504  ASP A O   1 
ATOM   3974 C CB  . ASP A 1 504 ? 24.904  73.104 56.903 1.00 91.77  ? 504  ASP A CB  1 
ATOM   3975 C CG  . ASP A 1 504 ? 25.611  71.976 57.631 1.00 91.77  ? 504  ASP A CG  1 
ATOM   3976 O OD1 . ASP A 1 504 ? 24.921  71.016 58.044 1.00 91.77  ? 504  ASP A OD1 1 
ATOM   3977 O OD2 . ASP A 1 504 ? 26.851  72.051 57.810 1.00 91.77  ? 504  ASP A OD2 1 
ATOM   3978 N N   . LEU A 1 505 ? 21.972  74.027 56.064 1.00 42.42  ? 505  LEU A N   1 
ATOM   3979 C CA  . LEU A 1 505 ? 21.103  75.117 55.672 1.00 42.42  ? 505  LEU A CA  1 
ATOM   3980 C C   . LEU A 1 505 ? 20.895  76.025 56.878 1.00 42.42  ? 505  LEU A C   1 
ATOM   3981 O O   . LEU A 1 505 ? 19.990  75.813 57.680 1.00 42.42  ? 505  LEU A O   1 
ATOM   3982 C CB  . LEU A 1 505 ? 19.776  74.552 55.171 1.00 20.13  ? 505  LEU A CB  1 
ATOM   3983 C CG  . LEU A 1 505 ? 19.196  75.132 53.883 1.00 20.13  ? 505  LEU A CG  1 
ATOM   3984 C CD1 . LEU A 1 505 ? 20.238  75.163 52.787 1.00 20.13  ? 505  LEU A CD1 1 
ATOM   3985 C CD2 . LEU A 1 505 ? 18.022  74.291 53.470 1.00 20.13  ? 505  LEU A CD2 1 
ATOM   3986 N N   . ASN A 1 506 ? 21.753  77.030 57.009 1.00 49.28  ? 506  ASN A N   1 
ATOM   3987 C CA  . ASN A 1 506 ? 21.683  77.972 58.119 1.00 49.28  ? 506  ASN A CA  1 
ATOM   3988 C C   . ASN A 1 506 ? 22.175  79.335 57.653 1.00 49.28  ? 506  ASN A C   1 
ATOM   3989 O O   . ASN A 1 506 ? 22.638  79.477 56.524 1.00 49.28  ? 506  ASN A O   1 
ATOM   3990 C CB  . ASN A 1 506 ? 22.564  77.489 59.255 1.00 38.94  ? 506  ASN A CB  1 
ATOM   3991 C CG  . ASN A 1 506 ? 23.983  77.273 58.811 1.00 38.94  ? 506  ASN A CG  1 
ATOM   3992 O OD1 . ASN A 1 506 ? 24.593  78.157 58.214 1.00 38.94  ? 506  ASN A OD1 1 
ATOM   3993 N ND2 . ASN A 1 506 ? 24.521  76.094 59.092 1.00 38.94  ? 506  ASN A ND2 1 
ATOM   3994 N N   . THR A 1 507 ? 22.102  80.332 58.527 1.00 45.42  ? 507  THR A N   1 
ATOM   3995 C CA  . THR A 1 507 ? 22.532  81.676 58.169 1.00 45.42  ? 507  THR A CA  1 
ATOM   3996 C C   . THR A 1 507 ? 24.051  81.829 58.010 1.00 45.42  ? 507  THR A C   1 
ATOM   3997 O O   . THR A 1 507 ? 24.578  82.921 58.154 1.00 45.42  ? 507  THR A O   1 
ATOM   3998 C CB  . THR A 1 507 ? 22.013  82.704 59.200 1.00 32.15  ? 507  THR A CB  1 
ATOM   3999 O OG1 . THR A 1 507 ? 22.543  82.407 60.493 1.00 32.15  ? 507  THR A OG1 1 
ATOM   4000 C CG2 . THR A 1 507 ? 20.505  82.642 59.286 1.00 32.15  ? 507  THR A CG2 1 
ATOM   4001 N N   . GLU A 1 508 ? 24.755  80.747 57.691 1.00 51.77  ? 508  GLU A N   1 
ATOM   4002 C CA  . GLU A 1 508 ? 26.213  80.814 57.513 1.00 51.77  ? 508  GLU A CA  1 
ATOM   4003 C C   . GLU A 1 508 ? 26.662  80.392 56.113 1.00 51.77  ? 508  GLU A C   1 
ATOM   4004 O O   . GLU A 1 508 ? 25.964  79.647 55.428 1.00 51.77  ? 508  GLU A O   1 
ATOM   4005 C CB  . GLU A 1 508 ? 26.921  79.929 58.542 1.00 90.11  ? 508  GLU A CB  1 
ATOM   4006 C CG  . GLU A 1 508 ? 26.730  80.367 59.981 1.00 90.11  ? 508  GLU A CG  1 
ATOM   4007 C CD  . GLU A 1 508 ? 27.281  79.351 60.980 1.00 90.11  ? 508  GLU A CD  1 
ATOM   4008 O OE1 . GLU A 1 508 ? 28.522  79.150 61.026 1.00 90.11  ? 508  GLU A OE1 1 
ATOM   4009 O OE2 . GLU A 1 508 ? 26.465  78.747 61.718 1.00 90.11  ? 508  GLU A OE2 1 
ATOM   4010 N N   . PRO A 1 509 ? 27.851  80.854 55.681 1.00 53.72  ? 509  PRO A N   1 
ATOM   4011 C CA  . PRO A 1 509 ? 28.405  80.531 54.360 1.00 53.72  ? 509  PRO A CA  1 
ATOM   4012 C C   . PRO A 1 509 ? 28.299  79.040 54.051 1.00 53.72  ? 509  PRO A C   1 
ATOM   4013 O O   . PRO A 1 509 ? 28.967  78.212 54.676 1.00 53.72  ? 509  PRO A O   1 
ATOM   4014 C CB  . PRO A 1 509 ? 29.850  80.997 54.472 1.00 43.56  ? 509  PRO A CB  1 
ATOM   4015 C CG  . PRO A 1 509 ? 29.738  82.172 55.384 1.00 43.56  ? 509  PRO A CG  1 
ATOM   4016 C CD  . PRO A 1 509 ? 28.805  81.666 56.458 1.00 43.56  ? 509  PRO A CD  1 
ATOM   4017 N N   . MET A 1 510 ? 27.453  78.707 53.084 1.00 61.01  ? 510  MET A N   1 
ATOM   4018 C CA  . MET A 1 510 ? 27.238  77.321 52.700 1.00 61.01  ? 510  MET A CA  1 
ATOM   4019 C C   . MET A 1 510 ? 28.491  76.472 52.824 1.00 61.01  ? 510  MET A C   1 
ATOM   4020 O O   . MET A 1 510 ? 29.565  76.867 52.365 1.00 61.01  ? 510  MET A O   1 
ATOM   4021 C CB  . MET A 1 510 ? 26.715  77.241 51.260 1.00 91.17  ? 510  MET A CB  1 
ATOM   4022 C CG  . MET A 1 510 ? 26.586  75.810 50.725 1.00 91.17  ? 510  MET A CG  1 
ATOM   4023 S SD  . MET A 1 510 ? 25.908  75.699 49.019 1.00 91.17  ? 510  MET A SD  1 
ATOM   4024 C CE  . MET A 1 510 ? 24.084  75.908 49.421 1.00 91.17  ? 510  MET A CE  1 
ATOM   4025 N N   . LYS A 1 511 ? 28.337  75.314 53.466 1.00 50.72  ? 511  LYS A N   1 
ATOM   4026 C CA  . LYS A 1 511 ? 29.417  74.347 53.638 1.00 50.72  ? 511  LYS A CA  1 
ATOM   4027 C C   . LYS A 1 511 ? 28.915  72.989 53.157 1.00 50.72  ? 511  LYS A C   1 
ATOM   4028 O O   . LYS A 1 511 ? 27.804  72.569 53.486 1.00 50.72  ? 511  LYS A O   1 
ATOM   4029 C CB  . LYS A 1 511 ? 29.823  74.220 55.103 1.00 66.35  ? 511  LYS A CB  1 
ATOM   4030 C CG  . LYS A 1 511 ? 30.399  75.475 55.718 1.00 66.35  ? 511  LYS A CG  1 
ATOM   4031 C CD  . LYS A 1 511 ? 30.770  75.216 57.183 1.00 66.35  ? 511  LYS A CD  1 
ATOM   4032 C CE  . LYS A 1 511 ? 31.277  76.471 57.891 1.00 66.35  ? 511  LYS A CE  1 
ATOM   4033 N NZ  . LYS A 1 511 ? 31.521  76.230 59.353 1.00 66.35  ? 511  LYS A NZ  1 
ATOM   4034 N N   . VAL A 1 512 ? 29.731  72.309 52.368 1.00 41.52  ? 512  VAL A N   1 
ATOM   4035 C CA  . VAL A 1 512 ? 29.378  70.993 51.873 1.00 41.52  ? 512  VAL A CA  1 
ATOM   4036 C C   . VAL A 1 512 ? 30.023  69.985 52.814 1.00 41.52  ? 512  VAL A C   1 
ATOM   4037 O O   . VAL A 1 512 ? 31.045  70.269 53.425 1.00 41.52  ? 512  VAL A O   1 
ATOM   4038 C CB  . VAL A 1 512 ? 29.910  70.776 50.444 1.00 36.56  ? 512  VAL A CB  1 
ATOM   4039 C CG1 . VAL A 1 512 ? 29.620  69.357 49.986 1.00 36.56  ? 512  VAL A CG1 1 
ATOM   4040 C CG2 . VAL A 1 512 ? 29.263  71.766 49.502 1.00 36.56  ? 512  VAL A CG2 1 
ATOM   4041 N N   . HIS A 1 513 ? 29.419  68.812 52.939 1.00 42.38  ? 513  HIS A N   1 
ATOM   4042 C CA  . HIS A 1 513 ? 29.952  67.774 53.808 1.00 42.38  ? 513  HIS A CA  1 
ATOM   4043 C C   . HIS A 1 513 ? 29.774  66.422 53.145 1.00 42.38  ? 513  HIS A C   1 
ATOM   4044 O O   . HIS A 1 513 ? 29.504  66.343 51.946 1.00 42.38  ? 513  HIS A O   1 
ATOM   4045 C CB  . HIS A 1 513 ? 29.199  67.760 55.124 1.00 54.43  ? 513  HIS A CB  1 
ATOM   4046 C CG  . HIS A 1 513 ? 29.303  69.031 55.896 1.00 54.43  ? 513  HIS A CG  1 
ATOM   4047 N ND1 . HIS A 1 513 ? 30.409  69.351 56.652 1.00 54.43  ? 513  HIS A ND1 1 
ATOM   4048 C CD2 . HIS A 1 513 ? 28.424  70.047 56.059 1.00 54.43  ? 513  HIS A CD2 1 
ATOM   4049 C CE1 . HIS A 1 513 ? 30.204  70.509 57.254 1.00 54.43  ? 513  HIS A CE1 1 
ATOM   4050 N NE2 . HIS A 1 513 ? 29.008  70.952 56.910 1.00 54.43  ? 513  HIS A NE2 1 
ATOM   4051 N N   . GLN A 1 514 ? 29.906  65.356 53.931 1.00 36.29  ? 514  GLN A N   1 
ATOM   4052 C CA  . GLN A 1 514 ? 29.740  64.021 53.393 1.00 36.29  ? 514  GLN A CA  1 
ATOM   4053 C C   . GLN A 1 514 ? 29.256  63.022 54.407 1.00 36.29  ? 514  GLN A C   1 
ATOM   4054 O O   . GLN A 1 514 ? 29.491  63.159 55.599 1.00 36.29  ? 514  GLN A O   1 
ATOM   4055 C CB  . GLN A 1 514 ? 31.039  63.527 52.791 1.00 54.85  ? 514  GLN A CB  1 
ATOM   4056 C CG  . GLN A 1 514 ? 31.367  64.180 51.482 1.00 54.85  ? 514  GLN A CG  1 
ATOM   4057 C CD  . GLN A 1 514 ? 32.646  63.646 50.899 1.00 54.85  ? 514  GLN A CD  1 
ATOM   4058 O OE1 . GLN A 1 514 ? 33.721  63.817 51.476 1.00 54.85  ? 514  GLN A OE1 1 
ATOM   4059 N NE2 . GLN A 1 514 ? 32.541  62.981 49.750 1.00 54.85  ? 514  GLN A NE2 1 
ATOM   4060 N N   . ARG A 1 515 ? 28.559  62.015 53.902 1.00 40.30  ? 515  ARG A N   1 
ATOM   4061 C CA  . ARG A 1 515 ? 28.023  60.943 54.713 1.00 40.30  ? 515  ARG A CA  1 
ATOM   4062 C C   . ARG A 1 515 ? 27.301  61.410 55.964 1.00 40.30  ? 515  ARG A C   1 
ATOM   4063 O O   . ARG A 1 515 ? 27.794  61.227 57.067 1.00 40.30  ? 515  ARG A O   1 
ATOM   4064 C CB  . ARG A 1 515 ? 29.155  59.994 55.068 1.00 57.70  ? 515  ARG A CB  1 
ATOM   4065 C CG  . ARG A 1 515 ? 29.889  59.521 53.831 1.00 57.70  ? 515  ARG A CG  1 
ATOM   4066 C CD  . ARG A 1 515 ? 30.846  58.387 54.122 1.00 57.70  ? 515  ARG A CD  1 
ATOM   4067 N NE  . ARG A 1 515 ? 31.414  57.846 52.892 1.00 57.70  ? 515  ARG A NE  1 
ATOM   4068 C CZ  . ARG A 1 515 ? 31.881  56.603 52.768 1.00 57.70  ? 515  ARG A CZ  1 
ATOM   4069 N NH1 . ARG A 1 515 ? 31.841  55.765 53.805 1.00 57.70  ? 515  ARG A NH1 1 
ATOM   4070 N NH2 . ARG A 1 515 ? 32.399  56.199 51.609 1.00 57.70  ? 515  ARG A NH2 1 
ATOM   4071 N N   . LEU A 1 516 ? 26.126  62.005 55.786 1.00 36.72  ? 516  LEU A N   1 
ATOM   4072 C CA  . LEU A 1 516 ? 25.337  62.484 56.918 1.00 36.72  ? 516  LEU A CA  1 
ATOM   4073 C C   . LEU A 1 516 ? 25.120  61.350 57.912 1.00 36.72  ? 516  LEU A C   1 
ATOM   4074 O O   . LEU A 1 516 ? 24.561  60.312 57.570 1.00 36.72  ? 516  LEU A O   1 
ATOM   4075 C CB  . LEU A 1 516 ? 23.994  63.033 56.422 1.00 29.71  ? 516  LEU A CB  1 
ATOM   4076 C CG  . LEU A 1 516 ? 23.002  63.673 57.398 1.00 29.71  ? 516  LEU A CG  1 
ATOM   4077 C CD1 . LEU A 1 516 ? 23.727  64.413 58.499 1.00 29.71  ? 516  LEU A CD1 1 
ATOM   4078 C CD2 . LEU A 1 516 ? 22.102  64.613 56.634 1.00 29.71  ? 516  LEU A CD2 1 
ATOM   4079 N N   . ARG A 1 517 ? 25.589  61.564 59.137 1.00 38.21  ? 517  ARG A N   1 
ATOM   4080 C CA  . ARG A 1 517 ? 25.504  60.599 60.238 1.00 38.21  ? 517  ARG A CA  1 
ATOM   4081 C C   . ARG A 1 517 ? 25.657  59.128 59.863 1.00 38.21  ? 517  ARG A C   1 
ATOM   4082 O O   . ARG A 1 517 ? 24.800  58.320 60.198 1.00 38.21  ? 517  ARG A O   1 
ATOM   4083 C CB  . ARG A 1 517 ? 24.198  60.804 61.027 1.00 42.82  ? 517  ARG A CB  1 
ATOM   4084 C CG  . ARG A 1 517 ? 24.135  62.157 61.739 1.00 42.82  ? 517  ARG A CG  1 
ATOM   4085 C CD  . ARG A 1 517 ? 22.875  62.359 62.569 1.00 42.82  ? 517  ARG A CD  1 
ATOM   4086 N NE  . ARG A 1 517 ? 22.904  61.632 63.835 1.00 42.82  ? 517  ARG A NE  1 
ATOM   4087 C CZ  . ARG A 1 517 ? 23.809  61.835 64.787 1.00 42.82  ? 517  ARG A CZ  1 
ATOM   4088 N NH1 . ARG A 1 517 ? 24.749  62.747 64.598 1.00 42.82  ? 517  ARG A NH1 1 
ATOM   4089 N NH2 . ARG A 1 517 ? 23.780  61.137 65.920 1.00 42.82  ? 517  ARG A NH2 1 
ATOM   4090 N N   . VAL A 1 518 ? 26.754  58.778 59.191 1.00 42.43  ? 518  VAL A N   1 
ATOM   4091 C CA  . VAL A 1 518 ? 27.005  57.384 58.775 1.00 42.43  ? 518  VAL A CA  1 
ATOM   4092 C C   . VAL A 1 518 ? 27.270  56.391 59.898 1.00 42.43  ? 518  VAL A C   1 
ATOM   4093 O O   . VAL A 1 518 ? 26.835  55.248 59.827 1.00 42.43  ? 518  VAL A O   1 
ATOM   4094 C CB  . VAL A 1 518 ? 28.198  57.271 57.815 1.00 35.84  ? 518  VAL A CB  1 
ATOM   4095 C CG1 . VAL A 1 518 ? 27.727  57.419 56.394 1.00 35.84  ? 518  VAL A CG1 1 
ATOM   4096 C CG2 . VAL A 1 518 ? 29.234  58.334 58.148 1.00 35.84  ? 518  VAL A CG2 1 
ATOM   4097 N N   . GLN A 1 519 ? 27.998  56.821 60.923 1.00 40.78  ? 519  GLN A N   1 
ATOM   4098 C CA  . GLN A 1 519 ? 28.320  55.951 62.045 1.00 40.78  ? 519  GLN A CA  1 
ATOM   4099 C C   . GLN A 1 519 ? 27.069  55.320 62.624 1.00 40.78  ? 519  GLN A C   1 
ATOM   4100 O O   . GLN A 1 519 ? 27.006  54.108 62.814 1.00 40.78  ? 519  GLN A O   1 
ATOM   4101 C CB  . GLN A 1 519 ? 29.016  56.743 63.139 1.00 44.08  ? 519  GLN A CB  1 
ATOM   4102 C CG  . GLN A 1 519 ? 29.980  55.908 63.921 1.00 44.08  ? 519  GLN A CG  1 
ATOM   4103 C CD  . GLN A 1 519 ? 30.948  55.199 63.001 1.00 44.08  ? 519  GLN A CD  1 
ATOM   4104 O OE1 . GLN A 1 519 ? 31.607  55.829 62.169 1.00 44.08  ? 519  GLN A OE1 1 
ATOM   4105 N NE2 . GLN A 1 519 ? 31.036  53.879 63.139 1.00 44.08  ? 519  GLN A NE2 1 
ATOM   4106 N N   . MET A 1 520 ? 26.079  56.163 62.907 1.00 38.91  ? 520  MET A N   1 
ATOM   4107 C CA  . MET A 1 520 ? 24.817  55.726 63.481 1.00 38.91  ? 520  MET A CA  1 
ATOM   4108 C C   . MET A 1 520 ? 23.903  55.130 62.425 1.00 38.91  ? 520  MET A C   1 
ATOM   4109 O O   . MET A 1 520 ? 23.223  54.148 62.671 1.00 38.91  ? 520  MET A O   1 
ATOM   4110 C CB  . MET A 1 520 ? 24.115  56.907 64.152 1.00 55.47  ? 520  MET A CB  1 
ATOM   4111 C CG  . MET A 1 520 ? 24.911  57.574 65.263 1.00 55.47  ? 520  MET A CG  1 
ATOM   4112 S SD  . MET A 1 520 ? 25.095  56.564 66.777 1.00 55.47  ? 520  MET A SD  1 
ATOM   4113 C CE  . MET A 1 520 ? 26.779  55.938 66.614 1.00 55.47  ? 520  MET A CE  1 
ATOM   4114 N N   . CYS A 1 521 ? 23.879  55.722 61.242 1.00 32.54  ? 521  CYS A N   1 
ATOM   4115 C CA  . CYS A 1 521 ? 23.017  55.213 60.189 1.00 32.54  ? 521  CYS A CA  1 
ATOM   4116 C C   . CYS A 1 521 ? 23.354  53.756 59.875 1.00 32.54  ? 521  CYS A C   1 
ATOM   4117 O O   . CYS A 1 521 ? 22.479  52.986 59.522 1.00 32.54  ? 521  CYS A O   1 
ATOM   4118 C CB  . CYS A 1 521 ? 23.126  56.094 58.933 1.00 21.31  ? 521  CYS A CB  1 
ATOM   4119 N N   . VAL A 1 522 ? 24.613  53.364 60.018 1.00 36.74  ? 522  VAL A N   1 
ATOM   4120 C CA  . VAL A 1 522 ? 24.982  51.975 59.752 1.00 36.74  ? 522  VAL A CA  1 
ATOM   4121 C C   . VAL A 1 522 ? 24.480  51.078 60.885 1.00 36.74  ? 522  VAL A C   1 
ATOM   4122 O O   . VAL A 1 522 ? 24.129  49.919 60.660 1.00 36.74  ? 522  VAL A O   1 
ATOM   4123 C CB  . VAL A 1 522 ? 26.521  51.793 59.601 1.00 26.98  ? 522  VAL A CB  1 
ATOM   4124 C CG1 . VAL A 1 522 ? 26.871  50.315 59.521 1.00 26.98  ? 522  VAL A CG1 1 
ATOM   4125 C CG2 . VAL A 1 522 ? 27.008  52.489 58.345 1.00 26.98  ? 522  VAL A CG2 1 
ATOM   4126 N N   . PHE A 1 523 ? 24.454  51.619 62.101 1.00 30.51  ? 523  PHE A N   1 
ATOM   4127 C CA  . PHE A 1 523 ? 23.973  50.888 63.270 1.00 30.51  ? 523  PHE A CA  1 
ATOM   4128 C C   . PHE A 1 523 ? 22.471  50.659 63.193 1.00 30.51  ? 523  PHE A C   1 
ATOM   4129 O O   . PHE A 1 523 ? 21.971  49.609 63.564 1.00 30.51  ? 523  PHE A O   1 
ATOM   4130 C CB  . PHE A 1 523 ? 24.265  51.668 64.548 1.00 26.65  ? 523  PHE A CB  1 
ATOM   4131 C CG  . PHE A 1 523 ? 23.561  51.129 65.755 1.00 26.65  ? 523  PHE A CG  1 
ATOM   4132 C CD1 . PHE A 1 523 ? 24.027  49.999 66.399 1.00 26.65  ? 523  PHE A CD1 1 
ATOM   4133 C CD2 . PHE A 1 523 ? 22.411  51.737 66.228 1.00 26.65  ? 523  PHE A CD2 1 
ATOM   4134 C CE1 . PHE A 1 523 ? 23.359  49.481 67.496 1.00 26.65  ? 523  PHE A CE1 1 
ATOM   4135 C CE2 . PHE A 1 523 ? 21.733  51.231 67.321 1.00 26.65  ? 523  PHE A CE2 1 
ATOM   4136 C CZ  . PHE A 1 523 ? 22.209  50.097 67.960 1.00 26.65  ? 523  PHE A CZ  1 
ATOM   4137 N N   . TRP A 1 524 ? 21.750  51.660 62.716 1.00 30.63  ? 524  TRP A N   1 
ATOM   4138 C CA  . TRP A 1 524 ? 20.313  51.555 62.621 1.00 30.63  ? 524  TRP A CA  1 
ATOM   4139 C C   . TRP A 1 524 ? 19.817  50.873 61.360 1.00 30.63  ? 524  TRP A C   1 
ATOM   4140 O O   . TRP A 1 524 ? 18.711  50.367 61.336 1.00 30.63  ? 524  TRP A O   1 
ATOM   4141 C CB  . TRP A 1 524 ? 19.679  52.940 62.739 1.00 28.33  ? 524  TRP A CB  1 
ATOM   4142 C CG  . TRP A 1 524 ? 19.800  53.544 64.100 1.00 28.33  ? 524  TRP A CG  1 
ATOM   4143 C CD1 . TRP A 1 524 ? 20.613  54.577 64.471 1.00 28.33  ? 524  TRP A CD1 1 
ATOM   4144 C CD2 . TRP A 1 524 ? 19.101  53.139 65.281 1.00 28.33  ? 524  TRP A CD2 1 
ATOM   4145 N NE1 . TRP A 1 524 ? 20.467  54.839 65.812 1.00 28.33  ? 524  TRP A NE1 1 
ATOM   4146 C CE2 . TRP A 1 524 ? 19.544  53.968 66.334 1.00 28.33  ? 524  TRP A CE2 1 
ATOM   4147 C CE3 . TRP A 1 524 ? 18.147  52.155 65.553 1.00 28.33  ? 524  TRP A CE3 1 
ATOM   4148 C CZ2 . TRP A 1 524 ? 19.056  53.845 67.639 1.00 28.33  ? 524  TRP A CZ2 1 
ATOM   4149 C CZ3 . TRP A 1 524 ? 17.665  52.038 66.850 1.00 28.33  ? 524  TRP A CZ3 1 
ATOM   4150 C CH2 . TRP A 1 524 ? 18.121  52.876 67.874 1.00 28.33  ? 524  TRP A CH2 1 
ATOM   4151 N N   . ASN A 1 525 ? 20.617  50.835 60.308 1.00 30.79  ? 525  ASN A N   1 
ATOM   4152 C CA  . ASN A 1 525 ? 20.134  50.193 59.101 1.00 30.79  ? 525  ASN A CA  1 
ATOM   4153 C C   . ASN A 1 525 ? 20.686  48.801 58.863 1.00 30.79  ? 525  ASN A C   1 
ATOM   4154 O O   . ASN A 1 525 ? 19.981  47.945 58.352 1.00 30.79  ? 525  ASN A O   1 
ATOM   4155 C CB  . ASN A 1 525 ? 20.389  51.078 57.879 1.00 35.16  ? 525  ASN A CB  1 
ATOM   4156 C CG  . ASN A 1 525 ? 19.666  52.418 57.966 1.00 35.16  ? 525  ASN A CG  1 
ATOM   4157 O OD1 . ASN A 1 525 ? 18.495  52.482 58.353 1.00 35.16  ? 525  ASN A OD1 1 
ATOM   4158 N ND2 . ASN A 1 525 ? 20.358  53.495 57.600 1.00 35.16  ? 525  ASN A ND2 1 
ATOM   4159 N N   . GLN A 1 526 ? 21.932  48.551 59.243 1.00 43.59  ? 526  GLN A N   1 
ATOM   4160 C CA  . GLN A 1 526 ? 22.513  47.235 59.021 1.00 43.59  ? 526  GLN A CA  1 
ATOM   4161 C C   . GLN A 1 526 ? 22.633  46.355 60.259 1.00 43.59  ? 526  GLN A C   1 
ATOM   4162 O O   . GLN A 1 526 ? 22.016  45.299 60.316 1.00 43.59  ? 526  GLN A O   1 
ATOM   4163 C CB  . GLN A 1 526 ? 23.882  47.371 58.369 1.00 67.07  ? 526  GLN A CB  1 
ATOM   4164 C CG  . GLN A 1 526 ? 23.871  48.174 57.078 1.00 67.07  ? 526  GLN A CG  1 
ATOM   4165 C CD  . GLN A 1 526 ? 25.263  48.283 56.434 1.00 67.07  ? 526  GLN A CD  1 
ATOM   4166 O OE1 . GLN A 1 526 ? 25.524  49.204 55.648 1.00 67.07  ? 526  GLN A OE1 1 
ATOM   4167 N NE2 . GLN A 1 526 ? 26.158  47.335 56.759 1.00 67.07  ? 526  GLN A NE2 1 
ATOM   4168 N N   . PHE A 1 527 ? 23.415  46.788 61.248 1.00 35.48  ? 527  PHE A N   1 
ATOM   4169 C CA  . PHE A 1 527 ? 23.633  45.995 62.457 1.00 35.48  ? 527  PHE A CA  1 
ATOM   4170 C C   . PHE A 1 527 ? 22.413  45.636 63.302 1.00 35.48  ? 527  PHE A C   1 
ATOM   4171 O O   . PHE A 1 527 ? 22.088  44.458 63.437 1.00 35.48  ? 527  PHE A O   1 
ATOM   4172 C CB  . PHE A 1 527 ? 24.669  46.669 63.361 1.00 24.23  ? 527  PHE A CB  1 
ATOM   4173 C CG  . PHE A 1 527 ? 24.977  45.884 64.612 1.00 24.23  ? 527  PHE A CG  1 
ATOM   4174 C CD1 . PHE A 1 527 ? 25.606  44.651 64.537 1.00 24.23  ? 527  PHE A CD1 1 
ATOM   4175 C CD2 . PHE A 1 527 ? 24.594  46.358 65.858 1.00 24.23  ? 527  PHE A CD2 1 
ATOM   4176 C CE1 . PHE A 1 527 ? 25.843  43.907 65.678 1.00 24.23  ? 527  PHE A CE1 1 
ATOM   4177 C CE2 . PHE A 1 527 ? 24.830  45.618 67.005 1.00 24.23  ? 527  PHE A CE2 1 
ATOM   4178 C CZ  . PHE A 1 527 ? 25.453  44.392 66.916 1.00 24.23  ? 527  PHE A CZ  1 
ATOM   4179 N N   . LEU A 1 528 ? 21.750  46.637 63.882 1.00 43.51  ? 528  LEU A N   1 
ATOM   4180 C CA  . LEU A 1 528 ? 20.587  46.394 64.743 1.00 43.51  ? 528  LEU A CA  1 
ATOM   4181 C C   . LEU A 1 528 ? 19.513  45.530 64.087 1.00 43.51  ? 528  LEU A C   1 
ATOM   4182 O O   . LEU A 1 528 ? 19.077  44.544 64.673 1.00 43.51  ? 528  LEU A O   1 
ATOM   4183 C CB  . LEU A 1 528 ? 19.972  47.716 65.224 1.00 25.25  ? 528  LEU A CB  1 
ATOM   4184 C CG  . LEU A 1 528 ? 19.033  47.572 66.429 1.00 25.25  ? 528  LEU A CG  1 
ATOM   4185 C CD1 . LEU A 1 528 ? 19.822  47.052 67.615 1.00 25.25  ? 528  LEU A CD1 1 
ATOM   4186 C CD2 . LEU A 1 528 ? 18.390  48.900 66.767 1.00 25.25  ? 528  LEU A CD2 1 
ATOM   4187 N N   . PRO A 1 529 ? 19.060  45.890 62.872 1.00 42.36  ? 529  PRO A N   1 
ATOM   4188 C CA  . PRO A 1 529 ? 18.036  45.083 62.206 1.00 42.36  ? 529  PRO A CA  1 
ATOM   4189 C C   . PRO A 1 529 ? 18.421  43.608 62.265 1.00 42.36  ? 529  PRO A C   1 
ATOM   4190 O O   . PRO A 1 529 ? 17.648  42.769 62.731 1.00 42.36  ? 529  PRO A O   1 
ATOM   4191 C CB  . PRO A 1 529 ? 18.057  45.625 60.792 1.00 32.88  ? 529  PRO A CB  1 
ATOM   4192 C CG  . PRO A 1 529 ? 18.329  47.058 61.015 1.00 32.88  ? 529  PRO A CG  1 
ATOM   4193 C CD  . PRO A 1 529 ? 19.439  47.035 62.028 1.00 32.88  ? 529  PRO A CD  1 
ATOM   4194 N N   . LYS A 1 530 ? 19.635  43.318 61.799 1.00 46.31  ? 530  LYS A N   1 
ATOM   4195 C CA  . LYS A 1 530 ? 20.215  41.974 61.785 1.00 46.31  ? 530  LYS A CA  1 
ATOM   4196 C C   . LYS A 1 530 ? 20.269  41.337 63.180 1.00 46.31  ? 530  LYS A C   1 
ATOM   4197 O O   . LYS A 1 530 ? 19.911  40.180 63.353 1.00 46.31  ? 530  LYS A O   1 
ATOM   4198 C CB  . LYS A 1 530 ? 21.621  42.056 61.182 1.00 63.02  ? 530  LYS A CB  1 
ATOM   4199 C CG  . LYS A 1 530 ? 22.504  40.842 61.379 1.00 63.02  ? 530  LYS A CG  1 
ATOM   4200 C CD  . LYS A 1 530 ? 23.726  40.931 60.461 1.00 63.02  ? 530  LYS A CD  1 
ATOM   4201 C CE  . LYS A 1 530 ? 24.601  39.685 60.565 1.00 63.02  ? 530  LYS A CE  1 
ATOM   4202 N NZ  . LYS A 1 530 ? 25.468  39.524 59.351 1.00 63.02  ? 530  LYS A NZ  1 
ATOM   4203 N N   . LEU A 1 531 ? 20.716  42.098 64.171 1.00 39.33  ? 531  LEU A N   1 
ATOM   4204 C CA  . LEU A 1 531 ? 20.798  41.610 65.545 1.00 39.33  ? 531  LEU A CA  1 
ATOM   4205 C C   . LEU A 1 531 ? 19.432  41.095 66.021 1.00 39.33  ? 531  LEU A C   1 
ATOM   4206 O O   . LEU A 1 531 ? 19.311  39.971 66.499 1.00 39.33  ? 531  LEU A O   1 
ATOM   4207 C CB  . LEU A 1 531 ? 21.282  42.740 66.456 1.00 35.98  ? 531  LEU A CB  1 
ATOM   4208 C CG  . LEU A 1 531 ? 21.775  42.388 67.856 1.00 35.98  ? 531  LEU A CG  1 
ATOM   4209 C CD1 . LEU A 1 531 ? 22.137  43.674 68.573 1.00 35.98  ? 531  LEU A CD1 1 
ATOM   4210 C CD2 . LEU A 1 531 ? 20.712  41.632 68.630 1.00 35.98  ? 531  LEU A CD2 1 
ATOM   4211 N N   . LEU A 1 532 ? 18.408  41.930 65.894 1.00 50.63  ? 532  LEU A N   1 
ATOM   4212 C CA  . LEU A 1 532 ? 17.051  41.554 66.292 1.00 50.63  ? 532  LEU A CA  1 
ATOM   4213 C C   . LEU A 1 532 ? 16.546  40.326 65.515 1.00 50.63  ? 532  LEU A C   1 
ATOM   4214 O O   . LEU A 1 532 ? 15.709  39.568 66.015 1.00 50.63  ? 532  LEU A O   1 
ATOM   4215 C CB  . LEU A 1 532 ? 16.083  42.720 66.063 1.00 36.40  ? 532  LEU A CB  1 
ATOM   4216 C CG  . LEU A 1 532 ? 16.224  43.918 66.996 1.00 36.40  ? 532  LEU A CG  1 
ATOM   4217 C CD1 . LEU A 1 532 ? 15.469  45.106 66.427 1.00 36.40  ? 532  LEU A CD1 1 
ATOM   4218 C CD2 . LEU A 1 532 ? 15.718  43.539 68.381 1.00 36.40  ? 532  LEU A CD2 1 
ATOM   4219 N N   . ASN A 1 533 ? 17.042  40.130 64.297 1.00 53.43  ? 533  ASN A N   1 
ATOM   4220 C CA  . ASN A 1 533 ? 16.609  38.984 63.514 1.00 53.43  ? 533  ASN A CA  1 
ATOM   4221 C C   . ASN A 1 533 ? 17.221  37.697 64.067 1.00 53.43  ? 533  ASN A C   1 
ATOM   4222 O O   . ASN A 1 533 ? 16.531  36.697 64.270 1.00 53.43  ? 533  ASN A O   1 
ATOM   4223 C CB  . ASN A 1 533 ? 17.020  39.133 62.054 1.00 45.17  ? 533  ASN A CB  1 
ATOM   4224 C CG  . ASN A 1 533 ? 16.244  38.214 61.149 1.00 45.17  ? 533  ASN A CG  1 
ATOM   4225 O OD1 . ASN A 1 533 ? 16.646  37.953 60.020 1.00 45.17  ? 533  ASN A OD1 1 
ATOM   4226 N ND2 . ASN A 1 533 ? 15.110  37.728 61.634 1.00 45.17  ? 533  ASN A ND2 1 
ATOM   4227 N N   . ALA A 1 534 ? 18.525  37.722 64.308 1.00 60.51  ? 534  ALA A N   1 
ATOM   4228 C CA  . ALA A 1 534 ? 19.210  36.552 64.826 1.00 60.51  ? 534  ALA A CA  1 
ATOM   4229 C C   . ALA A 1 534 ? 18.773  36.222 66.252 1.00 60.51  ? 534  ALA A C   1 
ATOM   4230 O O   . ALA A 1 534 ? 18.788  35.056 66.647 1.00 60.51  ? 534  ALA A O   1 
ATOM   4231 C CB  . ALA A 1 534 ? 20.714  36.770 64.775 1.00 43.02  ? 534  ALA A CB  1 
ATOM   4232 N N   . THR A 1 535 ? 18.383  37.237 67.022 1.00 76.27  ? 535  THR A N   1 
ATOM   4233 C CA  . THR A 1 535 ? 17.957  37.011 68.405 1.00 76.27  ? 535  THR A CA  1 
ATOM   4234 C C   . THR A 1 535 ? 16.453  37.215 68.586 1.00 76.27  ? 535  THR A C   1 
ATOM   4235 O O   . THR A 1 535 ? 15.732  37.183 67.568 1.00 76.27  ? 535  THR A O   1 
ATOM   4236 C CB  . THR A 1 535 ? 18.711  37.940 69.397 1.00 83.31  ? 535  THR A CB  1 
ATOM   4237 O OG1 . THR A 1 535 ? 18.237  39.286 69.262 1.00 83.31  ? 535  THR A OG1 1 
ATOM   4238 C CG2 . THR A 1 535 ? 20.216  37.911 69.117 1.00 83.31  ? 535  THR A CG2 1 
HETATM 4239 O O   . HOH B 2 .   ? 1.396   90.076 54.949 1.00 16.27  ? 1001 HOH A O   1 
HETATM 4240 O O   . HOH B 2 .   ? 20.234  62.554 32.944 1.00 34.04  ? 1002 HOH A O   1 
HETATM 4241 O O   . HOH B 2 .   ? -18.970 84.983 51.036 1.00 40.88  ? 1003 HOH A O   1 
HETATM 4242 O O   . HOH B 2 .   ? 4.239   80.792 51.610 1.00 56.04  ? 1004 HOH A O   1 
HETATM 4243 O O   . HOH B 2 .   ? -14.131 77.654 27.474 1.00 33.03  ? 1005 HOH A O   1 
HETATM 4244 O O   . HOH B 2 .   ? -0.768  63.537 59.173 1.00 42.29  ? 1006 HOH A O   1 
HETATM 4245 O O   . HOH B 2 .   ? 21.117  82.984 54.237 1.00 34.11  ? 1007 HOH A O   1 
HETATM 4246 O O   . HOH B 2 .   ? 24.853  73.477 39.297 1.00 27.95  ? 1008 HOH A O   1 
HETATM 4247 O O   . HOH B 2 .   ? -7.032  50.745 49.643 1.00 44.76  ? 1009 HOH A O   1 
HETATM 4248 O O   . HOH B 2 .   ? -10.805 47.613 76.007 1.00 25.38  ? 1010 HOH A O   1 
HETATM 4249 O O   . HOH B 2 .   ? 3.898   69.480 57.718 1.00 39.73  ? 1011 HOH A O   1 
HETATM 4250 O O   . HOH B 2 .   ? 27.833  63.740 45.864 1.00 32.07  ? 1012 HOH A O   1 
HETATM 4251 O O   . HOH B 2 .   ? 4.195   68.559 61.771 1.00 32.23  ? 1013 HOH A O   1 
HETATM 4252 O O   . HOH B 2 .   ? 7.455   52.385 56.699 1.00 41.57  ? 1014 HOH A O   1 
HETATM 4253 O O   . HOH B 2 .   ? 7.117   71.438 39.353 1.00 78.94  ? 1015 HOH A O   1 
HETATM 4254 O O   . HOH B 2 .   ? 2.050   63.058 70.660 1.00 35.96  ? 1016 HOH A O   1 
HETATM 4255 O O   . HOH B 2 .   ? -4.633  71.090 34.398 1.00 40.76  ? 1017 HOH A O   1 
HETATM 4256 O O   . HOH B 2 .   ? -15.130 66.207 52.243 1.00 60.98  ? 1018 HOH A O   1 
HETATM 4257 O O   . HOH B 2 .   ? -5.866  83.365 54.717 1.00 42.24  ? 1019 HOH A O   1 
HETATM 4258 O O   . HOH B 2 .   ? 23.782  77.690 54.275 1.00 41.24  ? 1020 HOH A O   1 
HETATM 4259 O O   . HOH B 2 .   ? 6.943   79.332 67.858 1.00 52.20  ? 1021 HOH A O   1 
HETATM 4260 O O   . HOH B 2 .   ? 23.210  52.245 81.587 1.00 47.71  ? 1022 HOH A O   1 
HETATM 4261 O O   . HOH B 2 .   ? 16.717  89.355 52.870 1.00 36.65  ? 1023 HOH A O   1 
HETATM 4262 O O   . HOH B 2 .   ? 21.077  62.338 36.424 1.00 35.50  ? 1024 HOH A O   1 
HETATM 4263 O O   . HOH B 2 .   ? 3.719   44.427 66.044 1.00 32.63  ? 1025 HOH A O   1 
HETATM 4264 O O   . HOH B 2 .   ? 0.015   70.070 60.561 1.00 41.57  ? 1026 HOH A O   1 
HETATM 4265 O O   . HOH B 2 .   ? 9.053   81.232 37.396 1.00 46.83  ? 1027 HOH A O   1 
HETATM 4266 O O   . HOH B 2 .   ? 19.112  60.221 41.972 1.00 33.27  ? 1028 HOH A O   1 
HETATM 4267 O O   . HOH B 2 .   ? 8.786   50.086 37.403 1.00 40.25  ? 1029 HOH A O   1 
HETATM 4268 O O   . HOH B 2 .   ? 10.941  56.036 68.970 1.00 51.40  ? 1030 HOH A O   1 
HETATM 4269 O O   . HOH B 2 .   ? -10.309 62.802 59.727 1.00 49.68  ? 1031 HOH A O   1 
HETATM 4270 O O   . HOH B 2 .   ? -22.329 50.860 57.041 1.00 52.87  ? 1032 HOH A O   1 
HETATM 4271 O O   . HOH B 2 .   ? -13.651 58.097 56.915 1.00 34.05  ? 1033 HOH A O   1 
HETATM 4272 O O   . HOH B 2 .   ? 18.426  50.525 45.345 1.00 45.63  ? 1034 HOH A O   1 
HETATM 4273 O O   . HOH B 2 .   ? -10.851 66.387 68.911 1.00 46.70  ? 1035 HOH A O   1 
HETATM 4274 O O   . HOH B 2 .   ? -17.847 63.953 67.583 1.00 30.56  ? 1036 HOH A O   1 
HETATM 4275 O O   . HOH B 2 .   ? 3.788   47.589 66.123 1.00 30.80  ? 1037 HOH A O   1 
HETATM 4276 O O   . HOH B 2 .   ? -8.103  80.039 32.270 1.00 44.07  ? 1038 HOH A O   1 
HETATM 4277 O O   . HOH B 2 .   ? 3.279   64.985 65.501 1.00 36.52  ? 1039 HOH A O   1 
HETATM 4278 O O   . HOH B 2 .   ? 22.869  79.634 61.583 1.00 60.98  ? 1040 HOH A O   1 
HETATM 4279 O O   . HOH B 2 .   ? -0.605  61.346 72.884 1.00 42.56  ? 1041 HOH A O   1 
HETATM 4280 O O   . HOH B 2 .   ? -7.491  68.624 57.804 1.00 53.48  ? 1042 HOH A O   1 
HETATM 4281 O O   . HOH B 2 .   ? -14.683 47.632 78.588 1.00 42.30  ? 1043 HOH A O   1 
HETATM 4282 O O   . HOH B 2 .   ? -6.287  46.527 51.464 1.00 62.58  ? 1044 HOH A O   1 
HETATM 4283 O O   . HOH B 2 .   ? 4.143   66.907 36.329 1.00 47.14  ? 1045 HOH A O   1 
HETATM 4284 O O   . HOH B 2 .   ? -18.430 72.715 51.409 1.00 38.52  ? 1046 HOH A O   1 
HETATM 4285 O O   . HOH B 2 .   ? -3.170  76.325 64.580 1.00 40.50  ? 1047 HOH A O   1 
HETATM 4286 O O   . HOH B 2 .   ? 6.619   90.833 69.927 1.00 49.94  ? 1048 HOH A O   1 
HETATM 4287 O O   . HOH B 2 .   ? 5.596   63.845 63.833 1.00 55.06  ? 1049 HOH A O   1 
HETATM 4288 O O   . HOH B 2 .   ? 19.626  67.780 38.673 1.00 38.47  ? 1050 HOH A O   1 
HETATM 4289 O O   . HOH B 2 .   ? -9.365  70.421 54.998 1.00 53.12  ? 1051 HOH A O   1 
HETATM 4290 O O   . HOH B 2 .   ? 4.090   65.361 62.349 1.00 87.71  ? 1052 HOH A O   1 
HETATM 4291 O O   . HOH B 2 .   ? -1.942  57.938 63.164 1.00 56.91  ? 1053 HOH A O   1 
HETATM 4292 O O   . HOH B 2 .   ? 25.043  66.942 84.806 1.00 40.11  ? 1054 HOH A O   1 
HETATM 4293 O O   . HOH B 2 .   ? 22.555  53.512 54.741 1.00 46.86  ? 1055 HOH A O   1 
HETATM 4294 O O   . HOH B 2 .   ? 19.649  58.481 33.670 1.00 38.77  ? 1056 HOH A O   1 
HETATM 4295 O O   . HOH B 2 .   ? -2.673  68.963 67.276 1.00 43.06  ? 1057 HOH A O   1 
HETATM 4296 O O   . HOH B 2 .   ? 20.578  84.674 62.930 1.00 49.64  ? 1058 HOH A O   1 
HETATM 4297 O O   . HOH B 2 .   ? 6.091   81.563 64.697 1.00 42.40  ? 1059 HOH A O   1 
HETATM 4298 O O   . HOH B 2 .   ? 3.568   46.287 61.241 1.00 42.15  ? 1060 HOH A O   1 
HETATM 4299 O O   . HOH B 2 .   ? 22.276  72.738 76.842 1.00 32.98  ? 1061 HOH A O   1 
HETATM 4300 O O   . HOH B 2 .   ? 12.057  56.369 85.038 1.00 57.88  ? 1062 HOH A O   1 
HETATM 4301 O O   . HOH B 2 .   ? -0.182  77.736 62.290 1.00 50.05  ? 1063 HOH A O   1 
HETATM 4302 O O   . HOH B 2 .   ? 2.507   40.490 59.688 1.00 41.91  ? 1064 HOH A O   1 
HETATM 4303 O O   . HOH B 2 .   ? 23.603  79.321 46.814 1.00 41.93  ? 1065 HOH A O   1 
HETATM 4304 O O   . HOH B 2 .   ? -1.467  72.088 73.556 1.00 41.01  ? 1066 HOH A O   1 
HETATM 4305 O O   . HOH B 2 .   ? -8.828  64.821 31.157 1.00 40.56  ? 1067 HOH A O   1 
HETATM 4306 O O   . HOH B 2 .   ? 25.140  58.562 55.282 1.00 46.46  ? 1068 HOH A O   1 
HETATM 4307 O O   . HOH B 2 .   ? 33.520  68.780 48.075 1.00 49.07  ? 1069 HOH A O   1 
HETATM 4308 O O   . HOH B 2 .   ? 15.768  52.610 61.614 1.00 43.27  ? 1070 HOH A O   1 
HETATM 4309 O O   . HOH B 2 .   ? -7.065  61.585 65.051 1.00 35.42  ? 1071 HOH A O   1 
HETATM 4310 O O   . HOH B 2 .   ? 16.219  58.963 88.154 1.00 61.86  ? 1072 HOH A O   1 
HETATM 4311 O O   . HOH B 2 .   ? 24.420  76.211 63.440 1.00 40.71  ? 1073 HOH A O   1 
HETATM 4312 O O   . HOH B 2 .   ? 19.246  64.684 86.683 1.00 30.35  ? 1074 HOH A O   1 
HETATM 4313 O O   . HOH B 2 .   ? 30.181  63.000 74.675 1.00 41.27  ? 1075 HOH A O   1 
HETATM 4314 O O   . HOH B 2 .   ? 31.667  62.306 56.900 1.00 74.89  ? 1076 HOH A O   1 
HETATM 4315 O O   . HOH B 2 .   ? -15.074 60.772 48.910 1.00 54.61  ? 1077 HOH A O   1 
HETATM 4316 O O   . HOH B 2 .   ? 12.536  80.070 75.951 1.00 46.02  ? 1078 HOH A O   1 
HETATM 4317 O O   . HOH B 2 .   ? 18.486  91.325 62.619 1.00 35.13  ? 1079 HOH A O   1 
HETATM 4318 O O   . HOH B 2 .   ? -5.641  44.733 57.810 1.00 54.14  ? 1080 HOH A O   1 
HETATM 4319 O O   . HOH B 2 .   ? -2.373  75.913 52.931 1.00 85.60  ? 1081 HOH A O   1 
HETATM 4320 O O   . HOH B 2 .   ? 7.696   49.586 59.608 1.00 35.65  ? 1082 HOH A O   1 
HETATM 4321 O O   . HOH B 2 .   ? -3.893  52.326 56.525 1.00 40.25  ? 1083 HOH A O   1 
HETATM 4322 O O   . HOH B 2 .   ? 15.677  79.158 36.707 1.00 41.94  ? 1084 HOH A O   1 
HETATM 4323 O O   . HOH B 2 .   ? -6.466  84.155 38.853 1.00 43.32  ? 1085 HOH A O   1 
HETATM 4324 O O   . HOH B 2 .   ? -1.935  51.055 73.708 1.00 41.13  ? 1086 HOH A O   1 
HETATM 4325 O O   . HOH B 2 .   ? 23.874  70.460 40.283 1.00 37.93  ? 1087 HOH A O   1 
HETATM 4326 O O   . HOH B 2 .   ? -4.538  85.913 39.413 1.00 50.16  ? 1088 HOH A O   1 
HETATM 4327 O O   . HOH B 2 .   ? 30.245  77.091 45.266 1.00 42.66  ? 1089 HOH A O   1 
HETATM 4328 O O   . HOH B 2 .   ? 2.120   81.358 73.864 1.00 50.84  ? 1090 HOH A O   1 
HETATM 4329 O O   . HOH B 2 .   ? -8.780  52.907 44.848 1.00 41.83  ? 1091 HOH A O   1 
HETATM 4330 O O   . HOH B 2 .   ? 10.155  52.613 79.902 1.00 48.75  ? 1092 HOH A O   1 
HETATM 4331 O O   . HOH B 2 .   ? -22.399 79.868 46.535 1.00 45.49  ? 1093 HOH A O   1 
HETATM 4332 O O   . HOH B 2 .   ? 19.010  75.253 71.239 1.00 47.04  ? 1094 HOH A O   1 
HETATM 4333 O O   . HOH B 2 .   ? -17.291 68.575 49.207 1.00 58.61  ? 1095 HOH A O   1 
HETATM 4334 O O   . HOH B 2 .   ? -0.313  66.554 37.857 1.00 80.89  ? 1096 HOH A O   1 
HETATM 4335 O O   . HOH B 2 .   ? -21.633 46.349 67.224 1.00 55.02  ? 1097 HOH A O   1 
HETATM 4336 O O   . HOH B 2 .   ? 28.218  65.660 43.189 1.00 34.27  ? 1098 HOH A O   1 
HETATM 4337 O O   . HOH B 2 .   ? -24.592 56.654 60.267 1.00 45.92  ? 1099 HOH A O   1 
HETATM 4338 O O   . HOH B 2 .   ? 11.429  84.129 72.557 1.00 45.73  ? 1100 HOH A O   1 
HETATM 4339 O O   . HOH B 2 .   ? -5.278  40.314 57.472 1.00 50.67  ? 1101 HOH A O   1 
HETATM 4340 O O   . HOH B 2 .   ? -13.109 39.947 63.084 1.00 52.88  ? 1102 HOH A O   1 
HETATM 4341 O O   . HOH B 2 .   ? 3.035   54.262 63.803 1.00 41.60  ? 1103 HOH A O   1 
HETATM 4342 O O   . HOH B 2 .   ? -5.164  60.515 75.145 1.00 45.91  ? 1104 HOH A O   1 
HETATM 4343 O O   . HOH B 2 .   ? -15.696 87.294 33.468 1.00 52.68  ? 1105 HOH A O   1 
HETATM 4344 O O   . HOH B 2 .   ? 14.690  36.721 58.530 1.00 54.70  ? 1106 HOH A O   1 
HETATM 4345 O O   . HOH B 2 .   ? 20.259  70.332 35.743 1.00 40.55  ? 1107 HOH A O   1 
HETATM 4346 O O   . HOH B 2 .   ? -4.656  47.407 76.379 1.00 44.90  ? 1108 HOH A O   1 
HETATM 4347 O O   . HOH B 2 .   ? 0.994   66.765 31.825 1.00 55.60  ? 1109 HOH A O   1 
HETATM 4348 O O   . HOH B 2 .   ? 24.901  58.954 40.580 1.00 49.90  ? 1110 HOH A O   1 
HETATM 4349 O O   . HOH B 2 .   ? 21.124  47.024 51.630 1.00 37.77  ? 1111 HOH A O   1 
HETATM 4350 O O   . HOH B 2 .   ? 12.484  65.586 34.377 1.00 63.44  ? 1112 HOH A O   1 
HETATM 4351 O O   . HOH B 2 .   ? 12.275  48.185 74.032 1.00 77.29  ? 1113 HOH A O   1 
HETATM 4352 O O   . HOH B 2 .   ? 22.636  51.614 45.723 1.00 47.34  ? 1114 HOH A O   1 
HETATM 4353 O O   . HOH B 2 .   ? 13.342  87.256 46.637 1.00 45.09  ? 1115 HOH A O   1 
HETATM 4354 O O   . HOH B 2 .   ? 18.621  67.466 73.577 1.00 55.76  ? 1116 HOH A O   1 
HETATM 4355 O O   . HOH B 2 .   ? 16.913  57.616 36.336 1.00 36.48  ? 1117 HOH A O   1 
HETATM 4356 O O   . HOH B 2 .   ? 9.183   62.460 61.410 1.00 75.12  ? 1118 HOH A O   1 
HETATM 4357 O O   . HOH B 2 .   ? -7.924  73.046 67.664 1.00 46.09  ? 1119 HOH A O   1 
HETATM 4358 O O   . HOH B 2 .   ? 15.624  80.525 69.971 1.00 40.41  ? 1120 HOH A O   1 
HETATM 4359 O O   . HOH B 2 .   ? -23.991 38.633 68.726 1.00 52.25  ? 1121 HOH A O   1 
HETATM 4360 O O   . HOH B 2 .   ? -4.221  70.653 62.776 1.00 39.39  ? 1122 HOH A O   1 
HETATM 4361 O O   . HOH B 2 .   ? 15.625  77.311 77.918 1.00 40.21  ? 1123 HOH A O   1 
HETATM 4362 O O   . HOH B 2 .   ? 34.578  65.476 45.626 1.00 60.08  ? 1124 HOH A O   1 
HETATM 4363 O O   . HOH B 2 .   ? 4.690   50.721 62.404 1.00 47.16  ? 1125 HOH A O   1 
HETATM 4364 O O   . HOH B 2 .   ? -12.090 67.464 37.286 1.00 37.06  ? 1126 HOH A O   1 
HETATM 4365 O O   . HOH B 2 .   ? -6.122  58.290 40.025 1.00 44.00  ? 1127 HOH A O   1 
HETATM 4366 O O   . HOH B 2 .   ? 11.920  67.769 67.772 1.00 71.66  ? 1128 HOH A O   1 
HETATM 4367 O O   . HOH B 2 .   ? 33.890  63.755 84.217 1.00 44.31  ? 1129 HOH A O   1 
HETATM 4368 O O   . HOH B 2 .   ? -20.442 77.276 47.660 1.00 42.70  ? 1130 HOH A O   1 
HETATM 4369 O O   . HOH B 2 .   ? -16.082 72.310 54.534 1.00 56.95  ? 1131 HOH A O   1 
HETATM 4370 O O   . HOH B 2 .   ? -12.612 42.935 76.603 1.00 50.73  ? 1132 HOH A O   1 
HETATM 4371 O O   . HOH B 2 .   ? -9.299  57.877 65.203 1.00 61.86  ? 1133 HOH A O   1 
HETATM 4372 O O   . HOH B 2 .   ? 21.570  58.975 39.048 1.00 58.82  ? 1134 HOH A O   1 
HETATM 4373 O O   . HOH B 2 .   ? 12.279  50.804 60.127 1.00 51.60  ? 1135 HOH A O   1 
HETATM 4374 O O   . HOH B 2 .   ? 9.421   56.298 36.416 1.00 43.24  ? 1136 HOH A O   1 
HETATM 4375 O O   . HOH B 2 .   ? -3.740  50.823 59.827 1.00 65.37  ? 1137 HOH A O   1 
HETATM 4376 O O   . HOH B 2 .   ? 2.126   53.843 73.666 1.00 59.89  ? 1138 HOH A O   1 
HETATM 4377 O O   . HOH B 2 .   ? -10.082 52.031 55.026 1.00 39.14  ? 1139 HOH A O   1 
HETATM 4378 O O   . HOH B 2 .   ? 20.624  63.304 65.264 1.00 41.26  ? 1140 HOH A O   1 
HETATM 4379 O O   . HOH B 2 .   ? 14.605  76.569 81.461 1.00 61.15  ? 1141 HOH A O   1 
HETATM 4380 O O   . HOH B 2 .   ? -18.296 75.484 31.703 1.00 50.99  ? 1142 HOH A O   1 
HETATM 4381 O O   . HOH B 2 .   ? 13.709  69.191 57.517 1.00 39.67  ? 1143 HOH A O   1 
HETATM 4382 O O   . HOH B 2 .   ? -6.128  49.568 61.029 1.00 51.46  ? 1144 HOH A O   1 
HETATM 4383 O O   . HOH B 2 .   ? -21.871 70.873 47.819 1.00 49.98  ? 1145 HOH A O   1 
HETATM 4384 O O   . HOH B 2 .   ? -21.158 47.529 57.964 1.00 58.40  ? 1146 HOH A O   1 
HETATM 4385 O O   . HOH B 2 .   ? 4.655   92.640 54.536 1.00 79.62  ? 1147 HOH A O   1 
HETATM 4386 O O   . HOH B 2 .   ? -12.506 72.567 66.093 1.00 46.21  ? 1148 HOH A O   1 
HETATM 4387 O O   . HOH B 2 .   ? -2.278  98.205 48.806 1.00 57.43  ? 1149 HOH A O   1 
HETATM 4388 O O   . HOH B 2 .   ? 7.630   78.868 34.211 1.00 44.45  ? 1150 HOH A O   1 
HETATM 4389 O O   . HOH B 2 .   ? 6.900   65.800 80.263 1.00 53.46  ? 1151 HOH A O   1 
HETATM 4390 O O   . HOH B 2 .   ? 23.219  67.511 48.276 1.00 44.70  ? 1152 HOH A O   1 
HETATM 4391 O O   . HOH B 2 .   ? 7.251   49.163 67.176 1.00 46.43  ? 1153 HOH A O   1 
HETATM 4392 O O   . HOH B 2 .   ? 0.573   40.574 57.674 1.00 48.78  ? 1154 HOH A O   1 
HETATM 4393 O O   . HOH B 2 .   ? 1.328   43.068 55.587 1.00 56.92  ? 1155 HOH A O   1 
HETATM 4394 O O   . HOH B 2 .   ? 28.955  75.954 39.142 1.00 44.63  ? 1156 HOH A O   1 
HETATM 4395 O O   . HOH B 2 .   ? 31.749  59.237 50.342 1.00 55.80  ? 1157 HOH A O   1 
HETATM 4396 O O   . HOH B 2 .   ? 3.524   51.814 64.996 1.00 50.03  ? 1158 HOH A O   1 
HETATM 4397 O O   . HOH B 2 .   ? 22.455  84.221 48.588 1.00 62.04  ? 1159 HOH A O   1 
HETATM 4398 O O   . HOH B 2 .   ? -26.632 61.899 71.759 1.00 53.17  ? 1160 HOH A O   1 
HETATM 4399 O O   . HOH B 2 .   ? 10.958  43.745 54.077 1.00 48.32  ? 1161 HOH A O   1 
HETATM 4400 O O   . HOH B 2 .   ? -27.054 50.808 52.433 1.00 60.35  ? 1162 HOH A O   1 
HETATM 4401 O O   . HOH B 2 .   ? 3.587   66.179 69.912 1.00 46.49  ? 1163 HOH A O   1 
HETATM 4402 O O   . HOH B 2 .   ? 22.347  60.400 86.657 1.00 53.78  ? 1164 HOH A O   1 
HETATM 4403 O O   . HOH B 2 .   ? -21.619 80.458 49.817 1.00 47.82  ? 1165 HOH A O   1 
HETATM 4404 O O   . HOH B 2 .   ? -10.712 81.683 55.730 1.00 45.08  ? 1166 HOH A O   1 
HETATM 4405 O O   . HOH B 2 .   ? 30.171  52.797 66.121 1.00 54.40  ? 1167 HOH A O   1 
HETATM 4406 O O   . HOH B 2 .   ? -19.285 74.544 58.499 1.00 44.94  ? 1168 HOH A O   1 
HETATM 4407 O O   . HOH B 2 .   ? 30.493  64.373 42.790 1.00 76.41  ? 1169 HOH A O   1 
HETATM 4408 O O   . HOH B 2 .   ? 7.124   47.019 54.017 1.00 36.83  ? 1170 HOH A O   1 
HETATM 4409 O O   . HOH B 2 .   ? 8.013   54.596 81.028 1.00 49.11  ? 1171 HOH A O   1 
HETATM 4410 O O   . HOH B 2 .   ? -13.061 82.477 61.360 1.00 52.22  ? 1172 HOH A O   1 
HETATM 4411 O O   . HOH B 2 .   ? 15.294  64.439 31.998 1.00 53.48  ? 1173 HOH A O   1 
HETATM 4412 O O   . HOH B 2 .   ? -19.567 85.412 42.202 1.00 55.82  ? 1174 HOH A O   1 
HETATM 4413 O O   . HOH B 2 .   ? -15.570 74.995 51.063 1.00 52.96  ? 1175 HOH A O   1 
HETATM 4414 O O   . HOH B 2 .   ? -1.503  70.162 52.798 1.00 50.58  ? 1176 HOH A O   1 
HETATM 4415 O O   . HOH B 2 .   ? 1.093   83.966 58.360 1.00 52.87  ? 1177 HOH A O   1 
HETATM 4416 O O   . HOH B 2 .   ? 18.498  45.198 51.069 1.00 45.31  ? 1178 HOH A O   1 
HETATM 4417 O O   . HOH B 2 .   ? 0.063   42.461 65.028 1.00 40.89  ? 1179 HOH A O   1 
HETATM 4418 O O   . HOH B 2 .   ? 11.933  60.175 86.434 1.00 55.77  ? 1180 HOH A O   1 
HETATM 4419 O O   . HOH B 2 .   ? -11.487 70.586 69.818 1.00 58.83  ? 1181 HOH A O   1 
HETATM 4420 O O   . HOH B 2 .   ? 20.952  79.370 31.109 1.00 60.52  ? 1182 HOH A O   1 
HETATM 4421 O O   . HOH B 2 .   ? 14.063  39.731 76.044 1.00 45.75  ? 1183 HOH A O   1 
HETATM 4422 O O   . HOH B 2 .   ? 28.705  54.206 52.007 1.00 48.18  ? 1184 HOH A O   1 
HETATM 4423 O O   . HOH B 2 .   ? -22.819 49.444 53.389 1.00 53.49  ? 1185 HOH A O   1 
HETATM 4424 O O   . HOH B 2 .   ? 22.614  87.028 47.851 1.00 52.39  ? 1186 HOH A O   1 
HETATM 4425 O O   . HOH B 2 .   ? 6.064   74.925 30.568 1.00 47.17  ? 1187 HOH A O   1 
HETATM 4426 O O   . HOH B 2 .   ? 25.104  44.747 55.642 1.00 56.23  ? 1188 HOH A O   1 
HETATM 4427 O O   . HOH B 2 .   ? -0.331  41.298 51.549 1.00 56.90  ? 1189 HOH A O   1 
HETATM 4428 O O   . HOH B 2 .   ? 23.250  69.341 36.931 1.00 54.50  ? 1190 HOH A O   1 
HETATM 4429 O O   . HOH B 2 .   ? 25.236  60.785 69.260 1.00 48.23  ? 1191 HOH A O   1 
HETATM 4430 O O   . HOH B 2 .   ? 14.380  51.430 56.722 1.00 61.30  ? 1192 HOH A O   1 
HETATM 4431 O O   . HOH B 2 .   ? -18.249 45.278 76.297 1.00 47.42  ? 1193 HOH A O   1 
HETATM 4432 O O   . HOH B 2 .   ? 25.326  55.443 86.826 1.00 41.86  ? 1194 HOH A O   1 
HETATM 4433 O O   . HOH B 2 .   ? 27.293  64.658 62.494 1.00 53.83  ? 1195 HOH A O   1 
HETATM 4434 O O   . HOH B 2 .   ? -4.732  80.880 32.227 1.00 50.12  ? 1196 HOH A O   1 
HETATM 4435 O O   . HOH B 2 .   ? 0.529   65.705 69.654 1.00 45.05  ? 1197 HOH A O   1 
HETATM 4436 O O   . HOH B 2 .   ? 25.353  85.191 49.299 1.00 57.51  ? 1198 HOH A O   1 
HETATM 4437 O O   . HOH B 2 .   ? -12.403 64.130 56.337 1.00 62.26  ? 1199 HOH A O   1 
HETATM 4438 O O   . HOH B 2 .   ? -14.719 47.674 45.693 1.00 51.15  ? 1200 HOH A O   1 
HETATM 4439 O O   . HOH B 2 .   ? -22.169 59.432 62.526 1.00 50.33  ? 1201 HOH A O   1 
HETATM 4440 O O   . HOH B 2 .   ? 20.200  81.865 65.673 1.00 81.49  ? 1202 HOH A O   1 
HETATM 4441 O O   . HOH B 2 .   ? 29.090  59.539 61.712 1.00 50.00  ? 1203 HOH A O   1 
HETATM 4442 O O   . HOH B 2 .   ? -13.666 51.267 49.839 1.00 58.99  ? 1204 HOH A O   1 
HETATM 4443 O O   . HOH B 2 .   ? -7.434  69.379 29.376 1.00 46.00  ? 1205 HOH A O   1 
HETATM 4444 O O   . HOH B 2 .   ? -13.036 65.049 41.694 1.00 42.08  ? 1206 HOH A O   1 
HETATM 4445 O O   . HOH B 2 .   ? 3.460   82.252 32.646 1.00 41.60  ? 1207 HOH A O   1 
HETATM 4446 O O   . HOH B 2 .   ? 25.300  36.747 58.955 1.00 56.73  ? 1208 HOH A O   1 
HETATM 4447 O O   . HOH B 2 .   ? -11.920 90.154 46.906 1.00 46.18  ? 1209 HOH A O   1 
HETATM 4448 O O   . HOH B 2 .   ? -13.342 78.618 57.446 1.00 82.39  ? 1210 HOH A O   1 
HETATM 4449 O O   . HOH B 2 .   ? 17.741  39.169 74.801 1.00 38.89  ? 1211 HOH A O   1 
HETATM 4450 O O   . HOH B 2 .   ? -24.162 80.913 42.079 1.00 45.79  ? 1212 HOH A O   1 
HETATM 4451 O O   . HOH B 2 .   ? -2.997  57.163 65.518 1.00 69.06  ? 1213 HOH A O   1 
HETATM 4452 O O   . HOH B 2 .   ? 22.371  73.821 65.847 1.00 43.95  ? 1214 HOH A O   1 
HETATM 4453 O O   . HOH B 2 .   ? -14.827 87.420 49.945 1.00 52.79  ? 1215 HOH A O   1 
HETATM 4454 O O   . HOH B 2 .   ? 3.678   50.724 70.001 1.00 53.07  ? 1216 HOH A O   1 
HETATM 4455 O O   . HOH B 2 .   ? 24.115  71.242 69.222 1.00 54.11  ? 1217 HOH A O   1 
HETATM 4456 O O   . HOH B 2 .   ? 9.804   57.662 86.501 1.00 52.53  ? 1218 HOH A O   1 
HETATM 4457 O O   . HOH B 2 .   ? 8.986   45.342 43.706 1.00 51.05  ? 1219 HOH A O   1 
HETATM 4458 O O   . HOH B 2 .   ? 0.622   75.177 51.433 1.00 85.45  ? 1220 HOH A O   1 
HETATM 4459 O O   . HOH B 2 .   ? -4.048  40.129 63.860 1.00 49.59  ? 1221 HOH A O   1 
HETATM 4460 O O   . HOH B 2 .   ? -0.731  79.426 77.943 1.00 57.09  ? 1222 HOH A O   1 
HETATM 4461 O O   . HOH B 2 .   ? -22.378 81.035 36.473 1.00 48.61  ? 1223 HOH A O   1 
HETATM 4462 O O   . HOH B 2 .   ? 4.602   46.424 40.522 1.00 41.61  ? 1224 HOH A O   1 
HETATM 4463 O O   . HOH B 2 .   ? -0.453  74.744 31.339 1.00 58.90  ? 1225 HOH A O   1 
HETATM 4464 O O   . HOH B 2 .   ? -4.980  51.544 44.892 1.00 56.71  ? 1226 HOH A O   1 
HETATM 4465 O O   . HOH B 2 .   ? 18.869  65.873 36.635 1.00 48.89  ? 1227 HOH A O   1 
HETATM 4466 O O   . HOH B 2 .   ? 13.204  48.742 37.175 1.00 43.27  ? 1228 HOH A O   1 
HETATM 4467 O O   . HOH B 2 .   ? 12.735  39.285 62.121 1.00 46.34  ? 1229 HOH A O   1 
HETATM 4468 O O   . HOH B 2 .   ? 13.248  40.416 79.104 1.00 51.90  ? 1230 HOH A O   1 
HETATM 4469 O O   . HOH B 2 .   ? -6.711  40.453 49.024 1.00 60.89  ? 1231 HOH A O   1 
HETATM 4470 O O   . HOH B 2 .   ? 18.834  85.711 50.699 1.00 48.24  ? 1232 HOH A O   1 
HETATM 4471 O O   . HOH B 2 .   ? 2.156   83.663 60.876 1.00 60.13  ? 1233 HOH A O   1 
HETATM 4472 O O   . HOH B 2 .   ? -3.806  51.634 41.567 1.00 52.54  ? 1234 HOH A O   1 
HETATM 4473 O O   . HOH B 2 .   ? 12.450  37.344 67.898 1.00 58.45  ? 1235 HOH A O   1 
HETATM 4474 O O   . HOH B 2 .   ? -6.274  67.007 31.963 1.00 51.43  ? 1236 HOH A O   1 
HETATM 4475 O O   . HOH B 2 .   ? -0.202  57.007 38.333 1.00 55.51  ? 1237 HOH A O   1 
HETATM 4476 O O   . HOH B 2 .   ? -1.210  51.616 43.233 1.00 53.91  ? 1238 HOH A O   1 
HETATM 4477 O O   . HOH B 2 .   ? -2.825  67.582 32.244 1.00 48.37  ? 1239 HOH A O   1 
HETATM 4478 O O   . HOH B 2 .   ? 4.883   60.273 70.308 1.00 53.13  ? 1240 HOH A O   1 
HETATM 4479 O O   . HOH B 2 .   ? 9.209   89.048 48.539 1.00 73.11  ? 1241 HOH A O   1 
HETATM 4480 O O   . HOH B 2 .   ? 21.501  84.384 56.659 1.00 57.03  ? 1242 HOH A O   1 
HETATM 4481 O O   . HOH B 2 .   ? 14.925  42.959 48.228 1.00 54.73  ? 1243 HOH A O   1 
HETATM 4482 O O   . HOH B 2 .   ? -8.190  72.085 52.637 1.00 61.04  ? 1244 HOH A O   1 
HETATM 4483 O O   . HOH B 2 .   ? 9.846   88.886 60.939 1.00 80.69  ? 1245 HOH A O   1 
HETATM 4484 O O   . HOH B 2 .   ? 7.985   45.976 76.799 1.00 68.60  ? 1246 HOH A O   1 
HETATM 4485 O O   . HOH B 2 .   ? 24.170  72.635 82.917 1.00 62.52  ? 1247 HOH A O   1 
HETATM 4486 O O   . HOH B 2 .   ? 5.327   87.990 68.149 1.00 53.85  ? 1248 HOH A O   1 
HETATM 4487 O O   . HOH B 2 .   ? 5.777   57.947 36.296 1.00 59.42  ? 1249 HOH A O   1 
HETATM 4488 O O   . HOH B 2 .   ? -12.680 39.365 65.968 1.00 61.03  ? 1250 HOH A O   1 
HETATM 4489 O O   . HOH B 2 .   ? 30.409  74.760 47.566 1.00 50.06  ? 1251 HOH A O   1 
HETATM 4490 O O   . HOH B 2 .   ? 27.440  63.542 59.813 1.00 46.50  ? 1252 HOH A O   1 
HETATM 4491 O O   . HOH B 2 .   ? 17.008  50.981 84.442 1.00 54.59  ? 1253 HOH A O   1 
HETATM 4492 O O   . HOH B 2 .   ? -1.664  83.991 57.771 1.00 60.42  ? 1254 HOH A O   1 
HETATM 4493 O O   . HOH B 2 .   ? -9.755  84.807 54.034 1.00 57.63  ? 1255 HOH A O   1 
HETATM 4494 O O   . HOH B 2 .   ? 23.000  56.374 39.436 1.00 48.05  ? 1256 HOH A O   1 
HETATM 4495 O O   . HOH B 2 .   ? 12.789  66.692 30.254 1.00 48.59  ? 1257 HOH A O   1 
HETATM 4496 O O   . HOH B 2 .   ? -26.514 60.985 46.243 1.00 61.71  ? 1258 HOH A O   1 
HETATM 4497 O O   . HOH B 2 .   ? 10.989  83.342 38.037 1.00 58.67  ? 1259 HOH A O   1 
HETATM 4498 O O   . HOH B 2 .   ? 10.571  43.732 71.311 1.00 60.96  ? 1260 HOH A O   1 
HETATM 4499 O O   . HOH B 2 .   ? 16.890  52.012 35.657 1.00 65.50  ? 1261 HOH A O   1 
HETATM 4500 O O   . HOH B 2 .   ? 17.155  50.424 78.603 1.00 61.46  ? 1262 HOH A O   1 
HETATM 4501 O O   . HOH B 2 .   ? -24.325 78.615 35.959 1.00 46.44  ? 1263 HOH A O   1 
HETATM 4502 O O   . HOH B 2 .   ? -20.199 57.682 59.583 1.00 55.60  ? 1264 HOH A O   1 
HETATM 4503 O O   . HOH B 2 .   ? 16.612  74.573 77.594 1.00 51.99  ? 1265 HOH A O   1 
HETATM 4504 O O   . HOH B 2 .   ? 20.992  81.761 35.736 1.00 58.80  ? 1266 HOH A O   1 
HETATM 4505 O O   . HOH B 2 .   ? 6.828   93.213 47.980 1.00 56.28  ? 1267 HOH A O   1 
HETATM 4506 O O   . HOH B 2 .   ? -24.750 64.786 39.671 1.00 69.17  ? 1268 HOH A O   1 
HETATM 4507 O O   . HOH B 2 .   ? 21.052  72.942 79.347 1.00 45.25  ? 1269 HOH A O   1 
HETATM 4508 O O   . HOH B 2 .   ? -4.604  55.745 38.510 1.00 46.97  ? 1270 HOH A O   1 
HETATM 4509 O O   . HOH B 2 .   ? -18.342 75.091 55.896 1.00 50.37  ? 1271 HOH A O   1 
HETATM 4510 O O   . HOH B 2 .   ? 34.353  54.597 42.328 1.00 54.01  ? 1272 HOH A O   1 
HETATM 4511 O O   . HOH B 2 .   ? -0.615  64.969 72.979 1.00 52.94  ? 1273 HOH A O   1 
HETATM 4512 O O   . HOH B 2 .   ? 13.101  59.319 79.780 1.00 69.63  ? 1274 HOH A O   1 
HETATM 4513 O O   . HOH B 2 .   ? -1.347  79.810 67.072 1.00 49.38  ? 1275 HOH A O   1 
HETATM 4514 O O   . HOH B 2 .   ? -21.152 83.350 34.438 1.00 53.59  ? 1276 HOH A O   1 
HETATM 4515 O O   . HOH B 2 .   ? -11.419 43.486 44.843 1.00 49.60  ? 1277 HOH A O   1 
HETATM 4516 O O   . HOH B 2 .   ? -13.933 43.727 42.959 1.00 47.82  ? 1278 HOH A O   1 
HETATM 4517 O O   . HOH B 2 .   ? -18.940 67.454 61.274 1.00 57.89  ? 1279 HOH A O   1 
HETATM 4518 O O   . HOH B 2 .   ? -14.741 65.992 67.610 1.00 50.39  ? 1280 HOH A O   1 
HETATM 4519 O O   . HOH B 2 .   ? 7.025   71.598 31.226 1.00 80.01  ? 1281 HOH A O   1 
HETATM 4520 O O   . HOH B 2 .   ? -15.085 77.685 61.426 1.00 44.27  ? 1282 HOH A O   1 
HETATM 4521 O O   . HOH B 2 .   ? 4.044   56.378 70.650 1.00 41.64  ? 1283 HOH A O   1 
HETATM 4522 O O   . HOH B 2 .   ? -28.089 50.412 59.380 1.00 52.61  ? 1284 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS ALA A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS ALA A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS ALA A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS ALA A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS ALA A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 488 GLN GLN A . n 
A 1 489 GLU 489 489 489 GLU GLU A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS ALA A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   1001 1001 HOH HOH A . 
B 2 HOH 2   1002 1002 HOH HOH A . 
B 2 HOH 3   1003 1003 HOH HOH A . 
B 2 HOH 4   1004 1004 HOH HOH A . 
B 2 HOH 5   1005 1005 HOH HOH A . 
B 2 HOH 6   1006 1006 HOH HOH A . 
B 2 HOH 7   1007 1007 HOH HOH A . 
B 2 HOH 8   1008 1008 HOH HOH A . 
B 2 HOH 9   1009 1009 HOH HOH A . 
B 2 HOH 10  1010 1010 HOH HOH A . 
B 2 HOH 11  1011 1011 HOH HOH A . 
B 2 HOH 12  1012 1012 HOH HOH A . 
B 2 HOH 13  1013 1013 HOH HOH A . 
B 2 HOH 14  1014 1014 HOH HOH A . 
B 2 HOH 15  1015 1015 HOH HOH A . 
B 2 HOH 16  1016 1016 HOH HOH A . 
B 2 HOH 17  1017 1017 HOH HOH A . 
B 2 HOH 18  1018 1018 HOH HOH A . 
B 2 HOH 19  1019 1019 HOH HOH A . 
B 2 HOH 20  1020 1020 HOH HOH A . 
B 2 HOH 21  1021 1021 HOH HOH A . 
B 2 HOH 22  1022 1022 HOH HOH A . 
B 2 HOH 23  1023 1023 HOH HOH A . 
B 2 HOH 24  1024 1024 HOH HOH A . 
B 2 HOH 25  1025 1025 HOH HOH A . 
B 2 HOH 26  1026 1026 HOH HOH A . 
B 2 HOH 27  1027 1027 HOH HOH A . 
B 2 HOH 28  1028 1028 HOH HOH A . 
B 2 HOH 29  1029 1029 HOH HOH A . 
B 2 HOH 30  1030 1030 HOH HOH A . 
B 2 HOH 31  1031 1031 HOH HOH A . 
B 2 HOH 32  1032 1032 HOH HOH A . 
B 2 HOH 33  1033 1033 HOH HOH A . 
B 2 HOH 34  1034 1034 HOH HOH A . 
B 2 HOH 35  1035 1035 HOH HOH A . 
B 2 HOH 36  1036 1036 HOH HOH A . 
B 2 HOH 37  1037 1037 HOH HOH A . 
B 2 HOH 38  1038 1038 HOH HOH A . 
B 2 HOH 39  1039 1039 HOH HOH A . 
B 2 HOH 40  1040 1040 HOH HOH A . 
B 2 HOH 41  1041 1041 HOH HOH A . 
B 2 HOH 42  1042 1042 HOH HOH A . 
B 2 HOH 43  1043 1043 HOH HOH A . 
B 2 HOH 44  1044 1044 HOH HOH A . 
B 2 HOH 45  1045 1045 HOH HOH A . 
B 2 HOH 46  1046 1046 HOH HOH A . 
B 2 HOH 47  1047 1047 HOH HOH A . 
B 2 HOH 48  1048 1048 HOH HOH A . 
B 2 HOH 49  1049 1049 HOH HOH A . 
B 2 HOH 50  1050 1050 HOH HOH A . 
B 2 HOH 51  1051 1051 HOH HOH A . 
B 2 HOH 52  1052 1052 HOH HOH A . 
B 2 HOH 53  1053 1053 HOH HOH A . 
B 2 HOH 54  1054 1054 HOH HOH A . 
B 2 HOH 55  1055 1055 HOH HOH A . 
B 2 HOH 56  1056 1056 HOH HOH A . 
B 2 HOH 57  1057 1057 HOH HOH A . 
B 2 HOH 58  1058 1058 HOH HOH A . 
B 2 HOH 59  1059 1059 HOH HOH A . 
B 2 HOH 60  1060 1060 HOH HOH A . 
B 2 HOH 61  1061 1061 HOH HOH A . 
B 2 HOH 62  1062 1062 HOH HOH A . 
B 2 HOH 63  1063 1063 HOH HOH A . 
B 2 HOH 64  1064 1064 HOH HOH A . 
B 2 HOH 65  1065 1065 HOH HOH A . 
B 2 HOH 66  1066 1066 HOH HOH A . 
B 2 HOH 67  1067 1067 HOH HOH A . 
B 2 HOH 68  1068 1068 HOH HOH A . 
B 2 HOH 69  1069 1069 HOH HOH A . 
B 2 HOH 70  1070 1070 HOH HOH A . 
B 2 HOH 71  1071 1071 HOH HOH A . 
B 2 HOH 72  1072 1072 HOH HOH A . 
B 2 HOH 73  1073 1073 HOH HOH A . 
B 2 HOH 74  1074 1074 HOH HOH A . 
B 2 HOH 75  1075 1075 HOH HOH A . 
B 2 HOH 76  1076 1076 HOH HOH A . 
B 2 HOH 77  1077 1077 HOH HOH A . 
B 2 HOH 78  1078 1078 HOH HOH A . 
B 2 HOH 79  1079 1079 HOH HOH A . 
B 2 HOH 80  1080 1080 HOH HOH A . 
B 2 HOH 81  1081 1081 HOH HOH A . 
B 2 HOH 82  1082 1082 HOH HOH A . 
B 2 HOH 83  1083 1083 HOH HOH A . 
B 2 HOH 84  1084 1084 HOH HOH A . 
B 2 HOH 85  1085 1085 HOH HOH A . 
B 2 HOH 86  1086 1086 HOH HOH A . 
B 2 HOH 87  1087 1087 HOH HOH A . 
B 2 HOH 88  1088 1088 HOH HOH A . 
B 2 HOH 89  1089 1089 HOH HOH A . 
B 2 HOH 90  1090 1090 HOH HOH A . 
B 2 HOH 91  1091 1091 HOH HOH A . 
B 2 HOH 92  1092 1092 HOH HOH A . 
B 2 HOH 93  1093 1093 HOH HOH A . 
B 2 HOH 94  1094 1094 HOH HOH A . 
B 2 HOH 95  1095 1095 HOH HOH A . 
B 2 HOH 96  1096 1096 HOH HOH A . 
B 2 HOH 97  1097 1097 HOH HOH A . 
B 2 HOH 98  1098 1098 HOH HOH A . 
B 2 HOH 99  1099 1099 HOH HOH A . 
B 2 HOH 100 1100 1100 HOH HOH A . 
B 2 HOH 101 1101 1101 HOH HOH A . 
B 2 HOH 102 1102 1102 HOH HOH A . 
B 2 HOH 103 1103 1103 HOH HOH A . 
B 2 HOH 104 1104 1104 HOH HOH A . 
B 2 HOH 105 1105 1105 HOH HOH A . 
B 2 HOH 106 1106 1106 HOH HOH A . 
B 2 HOH 107 1107 1107 HOH HOH A . 
B 2 HOH 108 1108 1108 HOH HOH A . 
B 2 HOH 109 1109 1109 HOH HOH A . 
B 2 HOH 110 1110 1110 HOH HOH A . 
B 2 HOH 111 1111 1111 HOH HOH A . 
B 2 HOH 112 1112 1112 HOH HOH A . 
B 2 HOH 113 1113 1113 HOH HOH A . 
B 2 HOH 114 1114 1114 HOH HOH A . 
B 2 HOH 115 1115 1115 HOH HOH A . 
B 2 HOH 116 1116 1116 HOH HOH A . 
B 2 HOH 117 1117 1117 HOH HOH A . 
B 2 HOH 118 1118 1118 HOH HOH A . 
B 2 HOH 119 1119 1119 HOH HOH A . 
B 2 HOH 120 1120 1120 HOH HOH A . 
B 2 HOH 121 1121 1121 HOH HOH A . 
B 2 HOH 122 1122 1122 HOH HOH A . 
B 2 HOH 123 1123 1123 HOH HOH A . 
B 2 HOH 124 1124 1124 HOH HOH A . 
B 2 HOH 125 1125 1125 HOH HOH A . 
B 2 HOH 126 1126 1126 HOH HOH A . 
B 2 HOH 127 1127 1127 HOH HOH A . 
B 2 HOH 128 1128 1128 HOH HOH A . 
B 2 HOH 129 1129 1129 HOH HOH A . 
B 2 HOH 130 1130 1130 HOH HOH A . 
B 2 HOH 131 1131 1131 HOH HOH A . 
B 2 HOH 132 1132 1132 HOH HOH A . 
B 2 HOH 133 1133 1133 HOH HOH A . 
B 2 HOH 134 1134 1134 HOH HOH A . 
B 2 HOH 135 1135 1135 HOH HOH A . 
B 2 HOH 136 1136 1136 HOH HOH A . 
B 2 HOH 137 1137 1137 HOH HOH A . 
B 2 HOH 138 1138 1138 HOH HOH A . 
B 2 HOH 139 1139 1139 HOH HOH A . 
B 2 HOH 140 1140 1140 HOH HOH A . 
B 2 HOH 141 1141 1141 HOH HOH A . 
B 2 HOH 142 1142 1142 HOH HOH A . 
B 2 HOH 143 1143 1143 HOH HOH A . 
B 2 HOH 144 1144 1144 HOH HOH A . 
B 2 HOH 145 1145 1145 HOH HOH A . 
B 2 HOH 146 1146 1146 HOH HOH A . 
B 2 HOH 147 1147 1147 HOH HOH A . 
B 2 HOH 148 1148 1148 HOH HOH A . 
B 2 HOH 149 1149 1149 HOH HOH A . 
B 2 HOH 150 1150 1150 HOH HOH A . 
B 2 HOH 151 1151 1151 HOH HOH A . 
B 2 HOH 152 1152 1152 HOH HOH A . 
B 2 HOH 153 1153 1153 HOH HOH A . 
B 2 HOH 154 1154 1154 HOH HOH A . 
B 2 HOH 155 1155 1155 HOH HOH A . 
B 2 HOH 156 1156 1156 HOH HOH A . 
B 2 HOH 157 1157 1157 HOH HOH A . 
B 2 HOH 158 1158 1158 HOH HOH A . 
B 2 HOH 159 1159 1159 HOH HOH A . 
B 2 HOH 160 1160 1160 HOH HOH A . 
B 2 HOH 161 1161 1161 HOH HOH A . 
B 2 HOH 162 1162 1162 HOH HOH A . 
B 2 HOH 163 1163 1163 HOH HOH A . 
B 2 HOH 164 1164 1164 HOH HOH A . 
B 2 HOH 165 1165 1165 HOH HOH A . 
B 2 HOH 166 1166 1166 HOH HOH A . 
B 2 HOH 167 1167 1167 HOH HOH A . 
B 2 HOH 168 1168 1168 HOH HOH A . 
B 2 HOH 169 1169 1169 HOH HOH A . 
B 2 HOH 170 1170 1170 HOH HOH A . 
B 2 HOH 171 1171 1171 HOH HOH A . 
B 2 HOH 172 1172 1172 HOH HOH A . 
B 2 HOH 173 1173 1173 HOH HOH A . 
B 2 HOH 174 1174 1174 HOH HOH A . 
B 2 HOH 175 1175 1175 HOH HOH A . 
B 2 HOH 176 1176 1176 HOH HOH A . 
B 2 HOH 177 1177 1177 HOH HOH A . 
B 2 HOH 178 1178 1178 HOH HOH A . 
B 2 HOH 179 1179 1179 HOH HOH A . 
B 2 HOH 180 1180 1180 HOH HOH A . 
B 2 HOH 181 1181 1181 HOH HOH A . 
B 2 HOH 182 1182 1182 HOH HOH A . 
B 2 HOH 183 1183 1183 HOH HOH A . 
B 2 HOH 184 1184 1184 HOH HOH A . 
B 2 HOH 185 1185 1185 HOH HOH A . 
B 2 HOH 186 1186 1186 HOH HOH A . 
B 2 HOH 187 1187 1187 HOH HOH A . 
B 2 HOH 188 1188 1188 HOH HOH A . 
B 2 HOH 189 1189 1189 HOH HOH A . 
B 2 HOH 190 1190 1190 HOH HOH A . 
B 2 HOH 191 1191 1191 HOH HOH A . 
B 2 HOH 192 1192 1192 HOH HOH A . 
B 2 HOH 193 1193 1193 HOH HOH A . 
B 2 HOH 194 1194 1194 HOH HOH A . 
B 2 HOH 195 1195 1195 HOH HOH A . 
B 2 HOH 196 1196 1196 HOH HOH A . 
B 2 HOH 197 1197 1197 HOH HOH A . 
B 2 HOH 198 1198 1198 HOH HOH A . 
B 2 HOH 199 1199 1199 HOH HOH A . 
B 2 HOH 200 1200 1200 HOH HOH A . 
B 2 HOH 201 1201 1201 HOH HOH A . 
B 2 HOH 202 1202 1202 HOH HOH A . 
B 2 HOH 203 1203 1203 HOH HOH A . 
B 2 HOH 204 1204 1204 HOH HOH A . 
B 2 HOH 205 1205 1205 HOH HOH A . 
B 2 HOH 206 1206 1206 HOH HOH A . 
B 2 HOH 207 1207 1207 HOH HOH A . 
B 2 HOH 208 1208 1208 HOH HOH A . 
B 2 HOH 209 1209 1209 HOH HOH A . 
B 2 HOH 210 1210 1210 HOH HOH A . 
B 2 HOH 211 1211 1211 HOH HOH A . 
B 2 HOH 212 1212 1212 HOH HOH A . 
B 2 HOH 213 1213 1213 HOH HOH A . 
B 2 HOH 214 1214 1214 HOH HOH A . 
B 2 HOH 215 1215 1215 HOH HOH A . 
B 2 HOH 216 1216 1216 HOH HOH A . 
B 2 HOH 217 1217 1217 HOH HOH A . 
B 2 HOH 218 1218 1218 HOH HOH A . 
B 2 HOH 219 1219 1219 HOH HOH A . 
B 2 HOH 220 1220 1220 HOH HOH A . 
B 2 HOH 221 1221 1221 HOH HOH A . 
B 2 HOH 222 1222 1222 HOH HOH A . 
B 2 HOH 223 1223 1223 HOH HOH A . 
B 2 HOH 224 1224 1224 HOH HOH A . 
B 2 HOH 225 1225 1225 HOH HOH A . 
B 2 HOH 226 1226 1226 HOH HOH A . 
B 2 HOH 227 1227 1227 HOH HOH A . 
B 2 HOH 228 1228 1228 HOH HOH A . 
B 2 HOH 229 1229 1229 HOH HOH A . 
B 2 HOH 230 1230 1230 HOH HOH A . 
B 2 HOH 231 1231 1231 HOH HOH A . 
B 2 HOH 232 1232 1232 HOH HOH A . 
B 2 HOH 233 1233 1233 HOH HOH A . 
B 2 HOH 234 1234 1234 HOH HOH A . 
B 2 HOH 235 1235 1235 HOH HOH A . 
B 2 HOH 236 1236 1236 HOH HOH A . 
B 2 HOH 237 1237 1237 HOH HOH A . 
B 2 HOH 238 1238 1238 HOH HOH A . 
B 2 HOH 239 1239 1239 HOH HOH A . 
B 2 HOH 240 1240 1240 HOH HOH A . 
B 2 HOH 241 1241 1241 HOH HOH A . 
B 2 HOH 242 1242 1242 HOH HOH A . 
B 2 HOH 243 1243 1243 HOH HOH A . 
B 2 HOH 244 1244 1244 HOH HOH A . 
B 2 HOH 245 1245 1245 HOH HOH A . 
B 2 HOH 246 1246 1246 HOH HOH A . 
B 2 HOH 247 1247 1247 HOH HOH A . 
B 2 HOH 248 1248 1248 HOH HOH A . 
B 2 HOH 249 1249 1249 HOH HOH A . 
B 2 HOH 250 1250 1250 HOH HOH A . 
B 2 HOH 251 1251 1251 HOH HOH A . 
B 2 HOH 252 1252 1252 HOH HOH A . 
B 2 HOH 253 1253 1253 HOH HOH A . 
B 2 HOH 254 1254 1254 HOH HOH A . 
B 2 HOH 255 1255 1255 HOH HOH A . 
B 2 HOH 256 1256 1256 HOH HOH A . 
B 2 HOH 257 1257 1257 HOH HOH A . 
B 2 HOH 258 1258 1258 HOH HOH A . 
B 2 HOH 259 1259 1259 HOH HOH A . 
B 2 HOH 260 1260 1260 HOH HOH A . 
B 2 HOH 261 1261 1261 HOH HOH A . 
B 2 HOH 262 1262 1262 HOH HOH A . 
B 2 HOH 263 1263 1263 HOH HOH A . 
B 2 HOH 264 1264 1264 HOH HOH A . 
B 2 HOH 265 1265 1265 HOH HOH A . 
B 2 HOH 266 1266 1266 HOH HOH A . 
B 2 HOH 267 1267 1267 HOH HOH A . 
B 2 HOH 268 1268 1268 HOH HOH A . 
B 2 HOH 269 1269 1269 HOH HOH A . 
B 2 HOH 270 1270 1270 HOH HOH A . 
B 2 HOH 271 1271 1271 HOH HOH A . 
B 2 HOH 272 1272 1272 HOH HOH A . 
B 2 HOH 273 1273 1273 HOH HOH A . 
B 2 HOH 274 1274 1274 HOH HOH A . 
B 2 HOH 275 1275 1275 HOH HOH A . 
B 2 HOH 276 1276 1276 HOH HOH A . 
B 2 HOH 277 1277 1277 HOH HOH A . 
B 2 HOH 278 1278 1278 HOH HOH A . 
B 2 HOH 279 1279 1279 HOH HOH A . 
B 2 HOH 280 1280 1280 HOH HOH A . 
B 2 HOH 281 1281 1281 HOH HOH A . 
B 2 HOH 282 1282 1282 HOH HOH A . 
B 2 HOH 283 1283 1283 HOH HOH A . 
B 2 HOH 284 1284 1284 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 138.0730000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-01-28 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       0.5 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
SOLVE     phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 25  ? ? -167.78 -169.03 
2  1 PRO A 39  ? ? -72.96  43.07   
3  1 PHE A 45  ? ? 66.29   -6.90   
4  1 ALA A 60  ? ? -116.37 57.18   
5  1 MET A 83  ? ? -66.64  1.52    
6  1 LEU A 95  ? ? -67.22  81.96   
7  1 PRO A 102 ? ? -58.85  170.48  
8  1 SER A 108 ? ? -152.68 70.27   
9  1 PHE A 155 ? ? -140.50 11.32   
10 1 LEU A 158 ? ? -117.29 79.18   
11 1 ALA A 164 ? ? -159.96 66.81   
12 1 SER A 200 ? ? 62.98   -120.71 
13 1 SER A 291 ? ? -55.89  -72.25  
14 1 THR A 303 ? ? -126.63 -151.88 
15 1 THR A 317 ? ? -152.77 -147.72 
16 1 SER A 329 ? ? -22.17  -51.03  
17 1 VAL A 360 ? ? -118.33 69.10   
18 1 HIS A 362 ? ? -95.34  30.42   
19 1 ASP A 380 ? ? -148.49 38.35   
20 1 VAL A 400 ? ? -129.76 -54.55  
21 1 GLU A 455 ? ? -46.80  -16.16  
22 1 ASN A 457 ? ? 71.28   46.81   
23 1 PRO A 485 ? ? -32.15  -75.09  
24 1 SER A 487 ? ? -59.31  170.91  
25 1 THR A 507 ? ? -70.67  25.54   
26 1 MET A 510 ? ? -33.97  131.45  
27 1 ARG A 515 ? ? 47.08   71.19   
28 1 ARG A 517 ? ? 36.03   54.92   
29 1 GLN A 526 ? ? -104.84 -62.42  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A CYS 67  ? SG ? A CYS 67  SG 
2 1 Y 1 A CYS 94  ? SG ? A CYS 94  SG 
3 1 Y 1 A CYS 254 ? SG ? A CYS 254 SG 
4 1 Y 1 A CYS 265 ? SG ? A CYS 265 SG 
5 1 Y 1 A CYS 402 ? SG ? A CYS 402 SG 
6 1 Y 1 A CYS 521 ? SG ? A CYS 521 SG 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 1   ? A ASP 1   
2 1 Y 1 A ASP 2   ? A ASP 2   
3 1 Y 1 A HIS 3   ? A HIS 3   
4 1 Y 1 A ALA 536 ? A ALA 536 
5 1 Y 1 A CYS 537 ? A CYS 537 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#