data_1QL1
# 
_entry.id   1QL1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QL1         
PDBE  EBI-2971     
WWPDB D_1290002971 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1QL2 unspecified .                                                                                   
PDB 2IFM unspecified .                                                                                   
PDB 2IFN unspecified .                                                                                   
PDB 3IFM unspecified .                                                                                   
PDB 4IFM unspecified .                                                                                   
PDB 1PFI unspecified 'PDB ENTRIES 1IFI THROUGH 1IFP ARE ALL RELATED INOVIRUS FIBER DIFFRACTION STUDIES.' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QL1 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   1999-08-20 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Welsh, L.C.'   1 
'Symmons, M.F.' 2 
'Marvin, D.A.'  3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The Molecular Structure and Structural Transition of the Alpha-Helical Capsid in Filamentous Bacteriophage Pf1' 
'Acta Crystallogr.,Sect.D' 56 137 ? 2000 ABCRE6 DK 0907-4449 0766 ? 10666593 10.1107/S0907444999015334      
1       
;Pf1 Filamentous Bacteriophage: Refinement of a Molecular Model by Simulated Annealing Using 3.3 Angstroms Resolution X-Ray Fibre Diffraction Data
;
'Acta Crystallogr.,Sect.D' 51 792 ? 1995 ABCRE6 DK 0907-4449 0766 ? 15299811 10.1107/S0907444995003027      
2       
;Two Forms of Pf1 Inovirus: X-Ray Diffraction Studies on a Structural Phase Transition and a Calculated Libration Normal Mode of the Asymmetric Unit
;
'Phase Transitions'        39 45  ? 1992 PHTRDP US 0141-1594 1101 ? ?        ?                              
3       'Model-Building Studies of Inovirus: Genetic Variations on a Geometric Theme' Int.J.Biol.Macromol.       12 125 ? 1990 
IJBMDR UK 0141-8130 0708 ? 2078529  '10.1016/0141-8130(90)90064-H' 
4       'Dynamics of Telescoping Inovirus: A Mechanism for Assembly at Membrane Adhesions' Int.J.Biol.Macromol.       11 159 ? 
1989 IJBMDR UK 0141-8130 0708 ? 2489076  '10.1016/0141-8130(89)90061-5' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Welsh, L.C.'   1  
primary 'Symmons, M.F.' 2  
primary 'Marvin, D.A.'  3  
1       'Gonzalez, A.'  4  
1       'Nave, C.'      5  
1       'Marvin, D.A.'  6  
2       'Marvin, D.A.'  7  
2       'Nave, C.'      8  
2       'Bansal, M.'    9  
2       'Hale, R.D.'    10 
2       'Salje, E.K.H.' 11 
3       'Marvin, D.A.'  12 
4       'Marvin, D.A.'  13 
# 
_cell.entry_id           1QL1 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QL1 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'PF1 BACTERIOPHAGE COAT PROTEIN B' 
_entity.formula_weight             4612.393 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    'MAJOR COAT PROTEIN ASSEMBLY IN THE HIGHER-TEMPERATURE SYMMETRY' 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PF1 INOVIRUS' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA 
_entity_poly.pdbx_seq_one_letter_code_can   GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  VAL n 
1 3  ILE n 
1 4  ASP n 
1 5  THR n 
1 6  SER n 
1 7  ALA n 
1 8  VAL n 
1 9  GLU n 
1 10 SER n 
1 11 ALA n 
1 12 ILE n 
1 13 THR n 
1 14 ASP n 
1 15 GLY n 
1 16 GLN n 
1 17 GLY n 
1 18 ASP n 
1 19 MET n 
1 20 LYS n 
1 21 ALA n 
1 22 ILE n 
1 23 GLY n 
1 24 GLY n 
1 25 TYR n 
1 26 ILE n 
1 27 VAL n 
1 28 GLY n 
1 29 ALA n 
1 30 LEU n 
1 31 VAL n 
1 32 ILE n 
1 33 LEU n 
1 34 ALA n 
1 35 VAL n 
1 36 ALA n 
1 37 GLY n 
1 38 LEU n 
1 39 ILE n 
1 40 TYR n 
1 41 SER n 
1 42 MET n 
1 43 LEU n 
1 44 ARG n 
1 45 LYS n 
1 46 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'PSEUDOMONAS PHAGE PF1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10871 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'PSEUDOMONAS AERUGINOSA' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     287 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'GROWN IN PSEUDOMONAS AERUGINOSA' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    COAB_BPPF1 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P03621 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1QL1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 46 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P03621 
_struct_ref_seq.db_align_beg                  37 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  82 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       46 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QL1 
_exptl.method            'FIBER DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 8.00' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           283.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GE(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.488 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX7.2' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX7.2 
_diffrn_source.pdbx_wavelength             1.488 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1QL1 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            3.100 
_reflns.number_obs                   816 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
# 
_refine.pdbx_refine_id                           'FIBER DIFFRACTION' 
_refine.entry_id                                 1QL1 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     2448 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50. 
_refine.ls_d_res_high                            3.1 
_refine.ls_percent_reflns_obs                    100 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.30 
_refine.ls_R_factor_R_free                       0.38 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               'A POSTERIORI' 
_refine.details                                  
;THE MODEL WAS DERIVED FROM PDB ENTRY 2IFN, REFERENCE 1. THIS MODEL WAS REFINED AGAINST NEW FIBER DIFFRACTION DATA. THE TEMPERATURE FACTORS OF ENTRY 4IFM WERE USED WITHOUT FURTHER REFINEMENT.
;
_refine.pdbx_starting_model                      2IFN 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'FIBER DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        322 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               322 
_refine_hist.d_res_high                       3.1 
_refine_hist.d_res_low                        50. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
o_bond_d                0.018 ? ? ? 'FIBER DIFFRACTION' ? 
o_bond_d_na             ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_bond_d_prot           ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_angle_d               ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_angle_d_na            ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_angle_d_prot          ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_angle_deg             1.8   ? ? ? 'FIBER DIFFRACTION' ? 
o_angle_deg_na          ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_angle_deg_prot        ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_dihedral_angle_d      18    ? ? ? 'FIBER DIFFRACTION' ? 
o_dihedral_angle_d_na   ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_dihedral_angle_d_prot ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_improper_angle_d      1.7   ? ? ? 'FIBER DIFFRACTION' ? 
o_improper_angle_d_na   ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_improper_angle_d_prot ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_mcbond_it             ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_mcangle_it            ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_scbond_it             ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_scangle_it            ?     ? ? ? 'FIBER DIFFRACTION' ? 
# 
_struct.entry_id                  1QL1 
_struct.title                     'INOVIRUS (FILAMENTOUS BACTERIOPHAGE) STRAIN PF1 MAJOR COAT PROTEIN ASSEMBLY' 
_struct.pdbx_descriptor           'PF1 BACTERIOPHAGE COAT PROTEIN B' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QL1 
_struct_keywords.pdbx_keywords   VIRUS 
_struct_keywords.text            'VIRUS, VIRUS COAT PROTEIN, HELICAL VIRUS COAT PROTEIN, SSDNA VIRUSES, INOVIRUS, HELICAL VIRUS' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       SER 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        6 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       LYS 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        45 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        SER 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         6 
_struct_conf.end_auth_comp_id        LYS 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         45 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   40 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1QL1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QL1 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1   N N   . GLY A 1 1  ? 5.797   -27.208 46.281  1.00 167.00 ? 1  GLY A N   1 
ATOM 2   C CA  . GLY A 1 1  ? 4.859   -26.220 45.761  1.00 167.00 ? 1  GLY A CA  1 
ATOM 3   C C   . GLY A 1 1  ? 5.172   -26.022 44.300  1.00 167.00 ? 1  GLY A C   1 
ATOM 4   O O   . GLY A 1 1  ? 6.246   -26.395 43.834  1.00 167.00 ? 1  GLY A O   1 
ATOM 5   N N   . VAL A 1 2  ? 4.210   -25.451 43.582  1.00 44.81  ? 2  VAL A N   1 
ATOM 6   C CA  . VAL A 1 2  ? 4.279   -25.232 42.151  1.00 44.81  ? 2  VAL A CA  1 
ATOM 7   C C   . VAL A 1 2  ? 2.921   -24.572 41.881  1.00 44.81  ? 2  VAL A C   1 
ATOM 8   O O   . VAL A 1 2  ? 2.310   -24.035 42.801  1.00 44.81  ? 2  VAL A O   1 
ATOM 9   C CB  . VAL A 1 2  ? 4.520   -26.576 41.366  1.00 56.25  ? 2  VAL A CB  1 
ATOM 10  C CG1 . VAL A 1 2  ? 3.345   -27.514 41.502  1.00 56.25  ? 2  VAL A CG1 1 
ATOM 11  C CG2 . VAL A 1 2  ? 4.847   -26.314 39.913  1.00 56.25  ? 2  VAL A CG2 1 
ATOM 12  N N   . ILE A 1 3  ? 2.407   -24.693 40.667  1.00 48.49  ? 3  ILE A N   1 
ATOM 13  C CA  . ILE A 1 3  ? 1.127   -24.120 40.306  1.00 48.49  ? 3  ILE A CA  1 
ATOM 14  C C   . ILE A 1 3  ? 0.655   -24.998 39.185  1.00 48.49  ? 3  ILE A C   1 
ATOM 15  O O   . ILE A 1 3  ? 1.384   -25.314 38.234  1.00 48.49  ? 3  ILE A O   1 
ATOM 16  C CB  . ILE A 1 3  ? 1.164   -22.640 39.838  1.00 47.58  ? 3  ILE A CB  1 
ATOM 17  C CG1 . ILE A 1 3  ? 1.097   -21.683 41.038  1.00 47.58  ? 3  ILE A CG1 1 
ATOM 18  C CG2 . ILE A 1 3  ? -0.039  -22.351 38.963  1.00 47.58  ? 3  ILE A CG2 1 
ATOM 19  C CD1 . ILE A 1 3  ? -0.276  -21.647 41.738  1.00 47.58  ? 3  ILE A CD1 1 
ATOM 20  N N   . ASP A 1 4  ? -0.496  -25.582 39.475  1.00 82.76  ? 4  ASP A N   1 
ATOM 21  C CA  . ASP A 1 4  ? -1.068  -26.619 38.673  1.00 82.76  ? 4  ASP A CA  1 
ATOM 22  C C   . ASP A 1 4  ? -1.762  -26.011 37.459  1.00 82.76  ? 4  ASP A C   1 
ATOM 23  O O   . ASP A 1 4  ? -2.966  -25.777 37.470  1.00 82.76  ? 4  ASP A O   1 
ATOM 24  C CB  . ASP A 1 4  ? -2.059  -27.387 39.542  1.00 115.07 ? 4  ASP A CB  1 
ATOM 25  C CG  . ASP A 1 4  ? -1.465  -27.778 40.901  1.00 115.07 ? 4  ASP A CG  1 
ATOM 26  O OD1 . ASP A 1 4  ? -0.502  -28.584 40.925  1.00 115.07 ? 4  ASP A OD1 1 
ATOM 27  O OD2 . ASP A 1 4  ? -1.922  -27.232 41.933  1.00 115.07 ? 4  ASP A OD2 1 
ATOM 28  N N   . THR A 1 5  ? -0.984  -25.736 36.419  1.00 2.00   ? 5  THR A N   1 
ATOM 29  C CA  . THR A 1 5  ? -1.547  -25.251 35.163  1.00 2.00   ? 5  THR A CA  1 
ATOM 30  C C   . THR A 1 5  ? -1.620  -26.471 34.247  1.00 2.00   ? 5  THR A C   1 
ATOM 31  O O   . THR A 1 5  ? -1.150  -26.471 33.087  1.00 2.00   ? 5  THR A O   1 
ATOM 32  C CB  . THR A 1 5  ? -0.677  -24.129 34.547  1.00 21.98  ? 5  THR A CB  1 
ATOM 33  O OG1 . THR A 1 5  ? -0.558  -23.043 35.483  1.00 21.98  ? 5  THR A OG1 1 
ATOM 34  C CG2 . THR A 1 5  ? -1.315  -23.607 33.255  1.00 21.98  ? 5  THR A CG2 1 
ATOM 35  N N   . SER A 1 6  ? -2.257  -27.507 34.804  1.00 36.97  ? 6  SER A N   1 
ATOM 36  C CA  . SER A 1 6  ? -2.295  -28.808 34.176  1.00 36.97  ? 6  SER A CA  1 
ATOM 37  C C   . SER A 1 6  ? -3.279  -28.764 33.008  1.00 36.97  ? 6  SER A C   1 
ATOM 38  O O   . SER A 1 6  ? -2.880  -28.847 31.850  1.00 36.97  ? 6  SER A O   1 
ATOM 39  C CB  . SER A 1 6  ? -2.749  -29.837 35.214  1.00 69.79  ? 6  SER A CB  1 
ATOM 40  O OG  . SER A 1 6  ? -1.991  -29.699 36.401  1.00 69.79  ? 6  SER A OG  1 
ATOM 41  N N   . ALA A 1 7  ? -4.538  -28.448 33.329  1.00 8.00   ? 7  ALA A N   1 
ATOM 42  C CA  . ALA A 1 7  ? -5.595  -28.356 32.339  1.00 8.00   ? 7  ALA A CA  1 
ATOM 43  C C   . ALA A 1 7  ? -5.444  -27.053 31.562  1.00 8.00   ? 7  ALA A C   1 
ATOM 44  O O   . ALA A 1 7  ? -5.750  -26.978 30.374  1.00 8.00   ? 7  ALA A O   1 
ATOM 45  C CB  . ALA A 1 7  ? -6.950  -28.420 33.029  1.00 23.09  ? 7  ALA A CB  1 
ATOM 46  N N   . VAL A 1 8  ? -4.902  -26.039 32.226  1.00 23.96  ? 8  VAL A N   1 
ATOM 47  C CA  . VAL A 1 8  ? -4.743  -24.757 31.586  1.00 23.96  ? 8  VAL A CA  1 
ATOM 48  C C   . VAL A 1 8  ? -3.682  -24.798 30.471  1.00 23.96  ? 8  VAL A C   1 
ATOM 49  O O   . VAL A 1 8  ? -3.765  -24.052 29.496  1.00 23.96  ? 8  VAL A O   1 
ATOM 50  C CB  . VAL A 1 8  ? -4.592  -23.659 32.634  1.00 2.00   ? 8  VAL A CB  1 
ATOM 51  C CG1 . VAL A 1 8  ? -4.427  -22.336 32.010  1.00 2.00   ? 8  VAL A CG1 1 
ATOM 52  C CG2 . VAL A 1 8  ? -5.879  -23.597 33.439  1.00 2.00   ? 8  VAL A CG2 1 
ATOM 53  N N   . GLU A 1 9  ? -2.774  -25.774 30.534  1.00 16.67  ? 9  GLU A N   1 
ATOM 54  C CA  . GLU A 1 9  ? -1.858  -25.972 29.417  1.00 16.67  ? 9  GLU A CA  1 
ATOM 55  C C   . GLU A 1 9  ? -2.660  -26.390 28.200  1.00 16.67  ? 9  GLU A C   1 
ATOM 56  O O   . GLU A 1 9  ? -2.735  -25.666 27.214  1.00 16.67  ? 9  GLU A O   1 
ATOM 57  C CB  . GLU A 1 9  ? -0.862  -27.088 29.734  1.00 57.08  ? 9  GLU A CB  1 
ATOM 58  C CG  . GLU A 1 9  ? 0.313   -26.651 30.550  1.00 57.08  ? 9  GLU A CG  1 
ATOM 59  C CD  . GLU A 1 9  ? 0.925   -27.775 31.345  1.00 57.08  ? 9  GLU A CD  1 
ATOM 60  O OE1 . GLU A 1 9  ? 0.680   -28.955 31.008  1.00 57.08  ? 9  GLU A OE1 1 
ATOM 61  O OE2 . GLU A 1 9  ? 1.634   -27.467 32.326  1.00 57.08  ? 9  GLU A OE2 1 
ATOM 62  N N   . SER A 1 10 ? -3.358  -27.513 28.327  1.00 2.00   ? 10 SER A N   1 
ATOM 63  C CA  . SER A 1 10 ? -4.132  -28.024 27.207  1.00 2.00   ? 10 SER A CA  1 
ATOM 64  C C   . SER A 1 10 ? -5.290  -27.086 26.850  1.00 2.00   ? 10 SER A C   1 
ATOM 65  O O   . SER A 1 10 ? -5.748  -27.027 25.695  1.00 2.00   ? 10 SER A O   1 
ATOM 66  C CB  . SER A 1 10 ? -4.637  -29.437 27.493  1.00 33.45  ? 10 SER A CB  1 
ATOM 67  O OG  . SER A 1 10 ? -5.207  -29.502 28.780  1.00 33.45  ? 10 SER A OG  1 
ATOM 68  N N   . ALA A 1 11 ? -5.707  -26.291 27.832  1.00 2.00   ? 11 ALA A N   1 
ATOM 69  C CA  . ALA A 1 11 ? -6.718  -25.309 27.553  1.00 2.00   ? 11 ALA A CA  1 
ATOM 70  C C   . ALA A 1 11 ? -6.289  -24.389 26.392  1.00 2.00   ? 11 ALA A C   1 
ATOM 71  O O   . ALA A 1 11 ? -7.109  -23.990 25.556  1.00 2.00   ? 11 ALA A O   1 
ATOM 72  C CB  . ALA A 1 11 ? -7.018  -24.506 28.785  1.00 60.89  ? 11 ALA A CB  1 
ATOM 73  N N   . ILE A 1 12 ? -4.989  -24.100 26.308  1.00 20.10  ? 12 ILE A N   1 
ATOM 74  C CA  . ILE A 1 12 ? -4.490  -23.186 25.283  1.00 20.10  ? 12 ILE A CA  1 
ATOM 75  C C   . ILE A 1 12 ? -4.963  -23.693 23.916  1.00 20.10  ? 12 ILE A C   1 
ATOM 76  O O   . ILE A 1 12 ? -5.429  -22.935 23.046  1.00 20.10  ? 12 ILE A O   1 
ATOM 77  C CB  . ILE A 1 12 ? -2.933  -23.106 25.287  1.00 2.00   ? 12 ILE A CB  1 
ATOM 78  C CG1 . ILE A 1 12 ? -2.408  -22.814 26.694  1.00 2.00   ? 12 ILE A CG1 1 
ATOM 79  C CG2 . ILE A 1 12 ? -2.452  -21.977 24.364  1.00 2.00   ? 12 ILE A CG2 1 
ATOM 80  C CD1 . ILE A 1 12 ? -1.778  -21.416 26.863  1.00 2.00   ? 12 ILE A CD1 1 
ATOM 81  N N   . THR A 1 13 ? -4.897  -25.010 23.766  1.00 2.00   ? 13 THR A N   1 
ATOM 82  C CA  . THR A 1 13 ? -5.226  -25.646 22.503  1.00 2.00   ? 13 THR A CA  1 
ATOM 83  C C   . THR A 1 13 ? -6.707  -25.475 22.143  1.00 2.00   ? 13 THR A C   1 
ATOM 84  O O   . THR A 1 13 ? -7.050  -25.341 20.970  1.00 2.00   ? 13 THR A O   1 
ATOM 85  C CB  . THR A 1 13 ? -4.831  -27.112 22.565  1.00 34.92  ? 13 THR A CB  1 
ATOM 86  O OG1 . THR A 1 13 ? -3.491  -27.196 23.068  1.00 34.92  ? 13 THR A OG1 1 
ATOM 87  C CG2 . THR A 1 13 ? -4.856  -27.721 21.177  1.00 34.92  ? 13 THR A CG2 1 
ATOM 88  N N   . ASP A 1 14 ? -7.571  -25.401 23.165  1.00 2.00   ? 14 ASP A N   1 
ATOM 89  C CA  . ASP A 1 14 ? -9.008  -25.208 22.964  1.00 2.00   ? 14 ASP A CA  1 
ATOM 90  C C   . ASP A 1 14 ? -9.276  -23.987 22.096  1.00 2.00   ? 14 ASP A C   1 
ATOM 91  O O   . ASP A 1 14 ? -10.028 -24.043 21.128  1.00 2.00   ? 14 ASP A O   1 
ATOM 92  C CB  . ASP A 1 14 ? -9.720  -25.001 24.297  1.00 78.30  ? 14 ASP A CB  1 
ATOM 93  C CG  . ASP A 1 14 ? -9.397  -26.077 25.310  1.00 78.30  ? 14 ASP A CG  1 
ATOM 94  O OD1 . ASP A 1 14 ? -8.674  -27.047 24.990  1.00 78.30  ? 14 ASP A OD1 1 
ATOM 95  O OD2 . ASP A 1 14 ? -9.877  -25.924 26.452  1.00 78.30  ? 14 ASP A OD2 1 
ATOM 96  N N   . GLY A 1 15 ? -8.664  -22.871 22.480  1.00 16.94  ? 15 GLY A N   1 
ATOM 97  C CA  . GLY A 1 15 ? -8.784  -21.672 21.687  1.00 16.94  ? 15 GLY A CA  1 
ATOM 98  C C   . GLY A 1 15 ? -8.088  -21.832 20.344  1.00 16.94  ? 15 GLY A C   1 
ATOM 99  O O   . GLY A 1 15 ? -8.605  -21.403 19.307  1.00 16.94  ? 15 GLY A O   1 
ATOM 100 N N   . GLN A 1 16 ? -6.921  -22.474 20.342  1.00 2.00   ? 16 GLN A N   1 
ATOM 101 C CA  . GLN A 1 16 ? -6.168  -22.619 19.111  1.00 2.00   ? 16 GLN A CA  1 
ATOM 102 C C   . GLN A 1 16 ? -7.012  -23.100 17.958  1.00 2.00   ? 16 GLN A C   1 
ATOM 103 O O   . GLN A 1 16 ? -6.893  -22.601 16.834  1.00 2.00   ? 16 GLN A O   1 
ATOM 104 C CB  . GLN A 1 16 ? -5.074  -23.664 19.268  1.00 14.70  ? 16 GLN A CB  1 
ATOM 105 C CG  . GLN A 1 16 ? -3.929  -23.269 20.090  1.00 14.70  ? 16 GLN A CG  1 
ATOM 106 C CD  . GLN A 1 16 ? -2.848  -24.299 19.978  1.00 14.70  ? 16 GLN A CD  1 
ATOM 107 O OE1 . GLN A 1 16 ? -2.565  -25.037 20.926  1.00 14.70  ? 16 GLN A OE1 1 
ATOM 108 N NE2 . GLN A 1 16 ? -2.283  -24.415 18.784  1.00 14.70  ? 16 GLN A NE2 1 
ATOM 109 N N   . GLY A 1 17 ? -7.830  -24.113 18.226  1.00 9.87   ? 17 GLY A N   1 
ATOM 110 C CA  . GLY A 1 17 ? -8.588  -24.704 17.145  1.00 9.87   ? 17 GLY A CA  1 
ATOM 111 C C   . GLY A 1 17 ? -9.351  -23.582 16.489  1.00 9.87   ? 17 GLY A C   1 
ATOM 112 O O   . GLY A 1 17 ? -9.342  -23.428 15.269  1.00 9.87   ? 17 GLY A O   1 
ATOM 113 N N   . ASP A 1 18 ? -9.909  -22.727 17.344  1.00 2.04   ? 18 ASP A N   1 
ATOM 114 C CA  . ASP A 1 18 ? -10.679 -21.585 16.914  1.00 2.04   ? 18 ASP A CA  1 
ATOM 115 C C   . ASP A 1 18 ? -9.787  -20.706 16.017  1.00 2.04   ? 18 ASP A C   1 
ATOM 116 O O   . ASP A 1 18 ? -10.226 -20.204 14.969  1.00 2.04   ? 18 ASP A O   1 
ATOM 117 C CB  . ASP A 1 18 ? -11.122 -20.802 18.143  1.00 54.44  ? 18 ASP A CB  1 
ATOM 118 C CG  . ASP A 1 18 ? -11.750 -21.690 19.208  1.00 54.44  ? 18 ASP A CG  1 
ATOM 119 O OD1 . ASP A 1 18 ? -12.082 -22.857 18.904  1.00 54.44  ? 18 ASP A OD1 1 
ATOM 120 O OD2 . ASP A 1 18 ? -11.882 -21.229 20.366  1.00 54.44  ? 18 ASP A OD2 1 
ATOM 121 N N   . MET A 1 19 ? -8.529  -20.531 16.444  1.00 2.00   ? 19 MET A N   1 
ATOM 122 C CA  . MET A 1 19 ? -7.573  -19.726 15.686  1.00 2.00   ? 19 MET A CA  1 
ATOM 123 C C   . MET A 1 19 ? -7.381  -20.287 14.260  1.00 2.00   ? 19 MET A C   1 
ATOM 124 O O   . MET A 1 19 ? -7.395  -19.528 13.288  1.00 2.00   ? 19 MET A O   1 
ATOM 125 C CB  . MET A 1 19 ? -6.225  -19.569 16.447  1.00 2.00   ? 19 MET A CB  1 
ATOM 126 C CG  . MET A 1 19 ? -6.319  -18.803 17.837  1.00 2.00   ? 19 MET A CG  1 
ATOM 127 S SD  . MET A 1 19 ? -5.065  -17.425 18.292  1.00 2.00   ? 19 MET A SD  1 
ATOM 128 C CE  . MET A 1 19 ? -5.303  -16.275 16.676  1.00 2.00   ? 19 MET A CE  1 
ATOM 129 N N   . LYS A 1 20 ? -7.287  -21.614 14.117  1.00 2.00   ? 20 LYS A N   1 
ATOM 130 C CA  . LYS A 1 20 ? -7.119  -22.210 12.786  1.00 2.00   ? 20 LYS A CA  1 
ATOM 131 C C   . LYS A 1 20 ? -8.434  -22.167 12.017  1.00 2.00   ? 20 LYS A C   1 
ATOM 132 O O   . LYS A 1 20 ? -8.471  -21.964 10.817  1.00 2.00   ? 20 LYS A O   1 
ATOM 133 C CB  . LYS A 1 20 ? -6.676  -23.671 12.897  1.00 12.10  ? 20 LYS A CB  1 
ATOM 134 C CG  . LYS A 1 20 ? -5.353  -23.885 13.601  1.00 12.10  ? 20 LYS A CG  1 
ATOM 135 C CD  . LYS A 1 20 ? -5.033  -25.369 13.699  1.00 12.10  ? 20 LYS A CD  1 
ATOM 136 C CE  . LYS A 1 20 ? -5.797  -26.004 14.842  1.00 12.10  ? 20 LYS A CE  1 
ATOM 137 N NZ  . LYS A 1 20 ? -5.451  -25.338 16.140  1.00 12.10  ? 20 LYS A NZ  1 
ATOM 138 N N   . ALA A 1 21 ? -9.521  -22.339 12.757  1.00 2.00   ? 21 ALA A N   1 
ATOM 139 C CA  . ALA A 1 21 ? -10.855 -22.375 12.194  1.00 2.00   ? 21 ALA A CA  1 
ATOM 140 C C   . ALA A 1 21 ? -11.305 -21.079 11.520  1.00 2.00   ? 21 ALA A C   1 
ATOM 141 O O   . ALA A 1 21 ? -11.720 -21.096 10.371  1.00 2.00   ? 21 ALA A O   1 
ATOM 142 C CB  . ALA A 1 21 ? -11.848 -22.782 13.251  1.00 43.28  ? 21 ALA A CB  1 
ATOM 143 N N   . ILE A 1 22 ? -11.237 -19.951 12.224  1.00 29.18  ? 22 ILE A N   1 
ATOM 144 C CA  . ILE A 1 22 ? -11.689 -18.699 11.622  1.00 29.18  ? 22 ILE A CA  1 
ATOM 145 C C   . ILE A 1 22 ? -10.980 -18.393 10.307  1.00 29.18  ? 22 ILE A C   1 
ATOM 146 O O   . ILE A 1 22 ? -11.614 -17.975 9.330   1.00 29.18  ? 22 ILE A O   1 
ATOM 147 C CB  . ILE A 1 22 ? -11.519 -17.483 12.543  1.00 2.00   ? 22 ILE A CB  1 
ATOM 148 C CG1 . ILE A 1 22 ? -12.287 -17.701 13.868  1.00 2.00   ? 22 ILE A CG1 1 
ATOM 149 C CG2 . ILE A 1 22 ? -12.011 -16.230 11.811  1.00 2.00   ? 22 ILE A CG2 1 
ATOM 150 C CD1 . ILE A 1 22 ? -12.364 -16.453 14.814  1.00 2.00   ? 22 ILE A CD1 1 
ATOM 151 N N   . GLY A 1 23 ? -9.670  -18.623 10.269  1.00 2.00   ? 23 GLY A N   1 
ATOM 152 C CA  . GLY A 1 23 ? -8.922  -18.326 9.059   1.00 2.00   ? 23 GLY A CA  1 
ATOM 153 C C   . GLY A 1 23 ? -9.507  -18.879 7.760   1.00 2.00   ? 23 GLY A C   1 
ATOM 154 O O   . GLY A 1 23 ? -9.667  -18.150 6.781   1.00 2.00   ? 23 GLY A O   1 
ATOM 155 N N   . GLY A 1 24 ? -9.876  -20.158 7.764   1.00 10.41  ? 24 GLY A N   1 
ATOM 156 C CA  . GLY A 1 24 ? -10.400 -20.771 6.564   1.00 10.41  ? 24 GLY A CA  1 
ATOM 157 C C   . GLY A 1 24 ? -11.508 -19.964 5.919   1.00 10.41  ? 24 GLY A C   1 
ATOM 158 O O   . GLY A 1 24 ? -11.573 -19.831 4.687   1.00 10.41  ? 24 GLY A O   1 
ATOM 159 N N   . TYR A 1 25 ? -12.364 -19.390 6.758   1.00 33.94  ? 25 TYR A N   1 
ATOM 160 C CA  . TYR A 1 25 ? -13.555 -18.737 6.246   1.00 33.94  ? 25 TYR A CA  1 
ATOM 161 C C   . TYR A 1 25 ? -13.163 -17.395 5.641   1.00 33.94  ? 25 TYR A C   1 
ATOM 162 O O   . TYR A 1 25 ? -13.676 -17.007 4.592   1.00 33.94  ? 25 TYR A O   1 
ATOM 163 C CB  . TYR A 1 25 ? -14.536 -18.504 7.376   1.00 112.90 ? 25 TYR A CB  1 
ATOM 164 C CG  . TYR A 1 25 ? -14.617 -19.672 8.302   1.00 112.90 ? 25 TYR A CG  1 
ATOM 165 C CD1 . TYR A 1 25 ? -14.776 -20.972 7.829   1.00 112.90 ? 25 TYR A CD1 1 
ATOM 166 C CD2 . TYR A 1 25 ? -14.546 -19.459 9.673   1.00 112.90 ? 25 TYR A CD2 1 
ATOM 167 C CE1 . TYR A 1 25 ? -14.835 -22.034 8.718   1.00 112.90 ? 25 TYR A CE1 1 
ATOM 168 C CE2 . TYR A 1 25 ? -14.610 -20.487 10.561  1.00 112.90 ? 25 TYR A CE2 1 
ATOM 169 C CZ  . TYR A 1 25 ? -14.748 -21.780 10.087  1.00 112.90 ? 25 TYR A CZ  1 
ATOM 170 O OH  . TYR A 1 25 ? -14.797 -22.801 10.995  1.00 112.90 ? 25 TYR A OH  1 
ATOM 171 N N   . ILE A 1 26 ? -12.248 -16.687 6.308   1.00 12.73  ? 26 ILE A N   1 
ATOM 172 C CA  . ILE A 1 26 ? -11.861 -15.378 5.809   1.00 12.73  ? 26 ILE A CA  1 
ATOM 173 C C   . ILE A 1 26 ? -11.115 -15.635 4.510   1.00 12.73  ? 26 ILE A C   1 
ATOM 174 O O   . ILE A 1 26 ? -11.391 -15.026 3.478   1.00 12.73  ? 26 ILE A O   1 
ATOM 175 C CB  . ILE A 1 26 ? -10.897 -14.632 6.748   1.00 33.82  ? 26 ILE A CB  1 
ATOM 176 C CG1 . ILE A 1 26 ? -11.395 -14.674 8.184   1.00 33.82  ? 26 ILE A CG1 1 
ATOM 177 C CG2 . ILE A 1 26 ? -10.879 -13.145 6.394   1.00 33.82  ? 26 ILE A CG2 1 
ATOM 178 C CD1 . ILE A 1 26 ? -10.359 -14.218 9.178   1.00 33.82  ? 26 ILE A CD1 1 
ATOM 179 N N   . VAL A 1 27 ? -10.177 -16.577 4.572   1.00 2.00   ? 27 VAL A N   1 
ATOM 180 C CA  . VAL A 1 27 ? -9.353  -16.913 3.428   1.00 2.00   ? 27 VAL A CA  1 
ATOM 181 C C   . VAL A 1 27 ? -10.212 -17.413 2.256   1.00 2.00   ? 27 VAL A C   1 
ATOM 182 O O   . VAL A 1 27 ? -9.905  -17.160 1.093   1.00 2.00   ? 27 VAL A O   1 
ATOM 183 C CB  . VAL A 1 27 ? -8.249  -17.902 3.848   1.00 35.23  ? 27 VAL A CB  1 
ATOM 184 C CG1 . VAL A 1 27 ? -7.483  -18.379 2.646   1.00 35.23  ? 27 VAL A CG1 1 
ATOM 185 C CG2 . VAL A 1 27 ? -7.290  -17.205 4.822   1.00 35.23  ? 27 VAL A CG2 1 
ATOM 186 N N   . GLY A 1 28 ? -11.337 -18.044 2.590   1.00 12.44  ? 28 GLY A N   1 
ATOM 187 C CA  . GLY A 1 28 ? -12.321 -18.413 1.583   1.00 12.44  ? 28 GLY A CA  1 
ATOM 188 C C   . GLY A 1 28 ? -12.986 -17.188 0.941   1.00 12.44  ? 28 GLY A C   1 
ATOM 189 O O   . GLY A 1 28 ? -13.372 -17.214 -0.218  1.00 12.44  ? 28 GLY A O   1 
ATOM 190 N N   . ALA A 1 29 ? -13.136 -16.099 1.690   1.00 2.00   ? 29 ALA A N   1 
ATOM 191 C CA  . ALA A 1 29 ? -13.673 -14.875 1.120   1.00 2.00   ? 29 ALA A CA  1 
ATOM 192 C C   . ALA A 1 29 ? -12.555 -14.170 0.366   1.00 2.00   ? 29 ALA A C   1 
ATOM 193 O O   . ALA A 1 29 ? -12.737 -13.715 -0.771  1.00 2.00   ? 29 ALA A O   1 
ATOM 194 C CB  . ALA A 1 29 ? -14.197 -13.974 2.192   1.00 13.97  ? 29 ALA A CB  1 
ATOM 195 N N   . LEU A 1 30 ? -11.353 -14.183 0.942   1.00 2.00   ? 30 LEU A N   1 
ATOM 196 C CA  . LEU A 1 30 ? -10.213 -13.611 0.238   1.00 2.00   ? 30 LEU A CA  1 
ATOM 197 C C   . LEU A 1 30 ? -10.126 -14.082 -1.231  1.00 2.00   ? 30 LEU A C   1 
ATOM 198 O O   . LEU A 1 30 ? -9.997  -13.277 -2.161  1.00 2.00   ? 30 LEU A O   1 
ATOM 199 C CB  . LEU A 1 30 ? -8.918  -13.968 0.966   1.00 4.55   ? 30 LEU A CB  1 
ATOM 200 C CG  . LEU A 1 30 ? -8.602  -13.038 2.139   1.00 4.55   ? 30 LEU A CG  1 
ATOM 201 C CD1 . LEU A 1 30 ? -9.786  -12.136 2.515   1.00 4.55   ? 30 LEU A CD1 1 
ATOM 202 C CD2 . LEU A 1 30 ? -8.100  -13.857 3.336   1.00 4.55   ? 30 LEU A CD2 1 
ATOM 203 N N   . VAL A 1 31 ? -10.316 -15.381 -1.415  1.00 16.04  ? 31 VAL A N   1 
ATOM 204 C CA  . VAL A 1 31 ? -10.275 -15.997 -2.716  1.00 16.04  ? 31 VAL A CA  1 
ATOM 205 C C   . VAL A 1 31 ? -11.127 -15.295 -3.805  1.00 16.04  ? 31 VAL A C   1 
ATOM 206 O O   . VAL A 1 31 ? -10.711 -15.249 -4.972  1.00 16.04  ? 31 VAL A O   1 
ATOM 207 C CB  . VAL A 1 31 ? -10.549 -17.521 -2.555  1.00 31.11  ? 31 VAL A CB  1 
ATOM 208 C CG1 . VAL A 1 31 ? -11.071 -18.123 -3.804  1.00 31.11  ? 31 VAL A CG1 1 
ATOM 209 C CG2 . VAL A 1 31 ? -9.256  -18.227 -2.193  1.00 31.11  ? 31 VAL A CG2 1 
ATOM 210 N N   . ILE A 1 32 ? -12.249 -14.659 -3.433  1.00 2.00   ? 32 ILE A N   1 
ATOM 211 C CA  . ILE A 1 32 ? -13.046 -13.936 -4.445  1.00 2.00   ? 32 ILE A CA  1 
ATOM 212 C C   . ILE A 1 32 ? -12.211 -12.838 -5.111  1.00 2.00   ? 32 ILE A C   1 
ATOM 213 O O   . ILE A 1 32 ? -12.255 -12.624 -6.323  1.00 2.00   ? 32 ILE A O   1 
ATOM 214 C CB  . ILE A 1 32 ? -14.316 -13.262 -3.863  1.00 2.00   ? 32 ILE A CB  1 
ATOM 215 C CG1 . ILE A 1 32 ? -15.358 -14.338 -3.529  1.00 2.00   ? 32 ILE A CG1 1 
ATOM 216 C CG2 . ILE A 1 32 ? -14.913 -12.275 -4.874  1.00 2.00   ? 32 ILE A CG2 1 
ATOM 217 C CD1 . ILE A 1 32 ? -16.563 -13.835 -2.700  1.00 2.00   ? 32 ILE A CD1 1 
ATOM 218 N N   . LEU A 1 33 ? -11.428 -12.160 -4.296  1.00 24.23  ? 33 LEU A N   1 
ATOM 219 C CA  . LEU A 1 33 ? -10.644 -11.053 -4.764  1.00 24.23  ? 33 LEU A CA  1 
ATOM 220 C C   . LEU A 1 33 ? -9.631  -11.560 -5.805  1.00 24.23  ? 33 LEU A C   1 
ATOM 221 O O   . LEU A 1 33 ? -9.291  -10.833 -6.724  1.00 24.23  ? 33 LEU A O   1 
ATOM 222 C CB  . LEU A 1 33 ? -9.954  -10.373 -3.562  1.00 2.00   ? 33 LEU A CB  1 
ATOM 223 C CG  . LEU A 1 33 ? -10.799 -9.831  -2.388  1.00 2.00   ? 33 LEU A CG  1 
ATOM 224 C CD1 . LEU A 1 33 ? -11.469 -8.490  -2.700  1.00 2.00   ? 33 LEU A CD1 1 
ATOM 225 C CD2 . LEU A 1 33 ? -11.836 -10.847 -1.948  1.00 2.00   ? 33 LEU A CD2 1 
ATOM 226 N N   . ALA A 1 34 ? -9.218  -12.823 -5.703  1.00 8.24   ? 34 ALA A N   1 
ATOM 227 C CA  . ALA A 1 34 ? -8.238  -13.391 -6.621  1.00 8.24   ? 34 ALA A CA  1 
ATOM 228 C C   . ALA A 1 34 ? -8.907  -13.829 -7.919  1.00 8.24   ? 34 ALA A C   1 
ATOM 229 O O   . ALA A 1 34 ? -8.275  -14.026 -8.951  1.00 8.24   ? 34 ALA A O   1 
ATOM 230 C CB  . ALA A 1 34 ? -7.556  -14.580 -5.969  1.00 48.97  ? 34 ALA A CB  1 
ATOM 231 N N   . VAL A 1 35 ? -10.202 -14.072 -7.820  1.00 2.00   ? 35 VAL A N   1 
ATOM 232 C CA  . VAL A 1 35 ? -10.991 -14.470 -8.966  1.00 2.00   ? 35 VAL A CA  1 
ATOM 233 C C   . VAL A 1 35 ? -11.439 -13.205 -9.689  1.00 2.00   ? 35 VAL A C   1 
ATOM 234 O O   . VAL A 1 35 ? -11.037 -12.914 -10.807 1.00 2.00   ? 35 VAL A O   1 
ATOM 235 C CB  . VAL A 1 35 ? -12.216 -15.272 -8.472  1.00 81.48  ? 35 VAL A CB  1 
ATOM 236 C CG1 . VAL A 1 35 ? -13.157 -15.574 -9.600  1.00 81.48  ? 35 VAL A CG1 1 
ATOM 237 C CG2 . VAL A 1 35 ? -11.754 -16.576 -7.826  1.00 81.48  ? 35 VAL A CG2 1 
ATOM 238 N N   . ALA A 1 36 ? -12.171 -12.384 -8.948  1.00 2.00   ? 36 ALA A N   1 
ATOM 239 C CA  . ALA A 1 36 ? -12.745 -11.167 -9.464  1.00 2.00   ? 36 ALA A CA  1 
ATOM 240 C C   . ALA A 1 36 ? -11.682 -10.251 -10.029 1.00 2.00   ? 36 ALA A C   1 
ATOM 241 O O   . ALA A 1 36 ? -11.878 -9.658  -11.069 1.00 2.00   ? 36 ALA A O   1 
ATOM 242 C CB  . ALA A 1 36 ? -13.512 -10.475 -8.388  1.00 25.65  ? 36 ALA A CB  1 
ATOM 243 N N   . GLY A 1 37 ? -10.532 -10.185 -9.374  1.00 2.00   ? 37 GLY A N   1 
ATOM 244 C CA  . GLY A 1 37 ? -9.475  -9.327  -9.864  1.00 2.00   ? 37 GLY A CA  1 
ATOM 245 C C   . GLY A 1 37 ? -8.965  -9.820  -11.208 1.00 2.00   ? 37 GLY A C   1 
ATOM 246 O O   . GLY A 1 37 ? -8.642  -9.038  -12.110 1.00 2.00   ? 37 GLY A O   1 
ATOM 247 N N   . LEU A 1 38 ? -8.915  -11.141 -11.368 1.00 2.00   ? 38 LEU A N   1 
ATOM 248 C CA  . LEU A 1 38 ? -8.408  -11.674 -12.612 1.00 2.00   ? 38 LEU A CA  1 
ATOM 249 C C   . LEU A 1 38 ? -9.549  -11.603 -13.586 1.00 2.00   ? 38 LEU A C   1 
ATOM 250 O O   . LEU A 1 38 ? -9.321  -11.441 -14.757 1.00 2.00   ? 38 LEU A O   1 
ATOM 251 C CB  . LEU A 1 38 ? -7.873  -13.091 -12.450 1.00 2.00   ? 38 LEU A CB  1 
ATOM 252 C CG  . LEU A 1 38 ? -6.789  -13.221 -11.365 1.00 2.00   ? 38 LEU A CG  1 
ATOM 253 C CD1 . LEU A 1 38 ? -6.478  -14.683 -11.113 1.00 2.00   ? 38 LEU A CD1 1 
ATOM 254 C CD2 . LEU A 1 38 ? -5.528  -12.466 -11.748 1.00 2.00   ? 38 LEU A CD2 1 
ATOM 255 N N   . ILE A 1 39 ? -10.786 -11.644 -13.106 1.00 2.00   ? 39 ILE A N   1 
ATOM 256 C CA  . ILE A 1 39 ? -11.928 -11.436 -13.996 1.00 2.00   ? 39 ILE A CA  1 
ATOM 257 C C   . ILE A 1 39 ? -11.990 -9.989  -14.533 1.00 2.00   ? 39 ILE A C   1 
ATOM 258 O O   . ILE A 1 39 ? -12.253 -9.747  -15.730 1.00 2.00   ? 39 ILE A O   1 
ATOM 259 C CB  . ILE A 1 39 ? -13.242 -11.780 -13.280 1.00 37.76  ? 39 ILE A CB  1 
ATOM 260 C CG1 . ILE A 1 39 ? -13.307 -13.287 -13.031 1.00 37.76  ? 39 ILE A CG1 1 
ATOM 261 C CG2 . ILE A 1 39 ? -14.434 -11.338 -14.112 1.00 37.76  ? 39 ILE A CG2 1 
ATOM 262 C CD1 . ILE A 1 39 ? -14.446 -13.694 -12.132 1.00 37.76  ? 39 ILE A CD1 1 
ATOM 263 N N   . TYR A 1 40 ? -11.703 -9.050  -13.617 1.00 2.00   ? 40 TYR A N   1 
ATOM 264 C CA  . TYR A 1 40 ? -11.634 -7.584  -13.795 1.00 2.00   ? 40 TYR A CA  1 
ATOM 265 C C   . TYR A 1 40 ? -10.589 -7.305  -14.935 1.00 2.00   ? 40 TYR A C   1 
ATOM 266 O O   . TYR A 1 40 ? -10.794 -6.499  -15.871 1.00 2.00   ? 40 TYR A O   1 
ATOM 267 C CB  . TYR A 1 40 ? -11.266 -7.065  -12.377 1.00 82.81  ? 40 TYR A CB  1 
ATOM 268 C CG  . TYR A 1 40 ? -10.777 -5.640  -12.085 1.00 82.81  ? 40 TYR A CG  1 
ATOM 269 C CD1 . TYR A 1 40 ? -11.669 -4.597  -11.776 1.00 82.81  ? 40 TYR A CD1 1 
ATOM 270 C CD2 . TYR A 1 40 ? -9.405  -5.356  -12.029 1.00 82.81  ? 40 TYR A CD2 1 
ATOM 271 C CE1 . TYR A 1 40 ? -11.193 -3.289  -11.420 1.00 82.81  ? 40 TYR A CE1 1 
ATOM 272 C CE2 . TYR A 1 40 ? -8.916  -4.067  -11.682 1.00 82.81  ? 40 TYR A CE2 1 
ATOM 273 C CZ  . TYR A 1 40 ? -9.806  -3.042  -11.380 1.00 82.81  ? 40 TYR A CZ  1 
ATOM 274 O OH  . TYR A 1 40 ? -9.275  -1.819  -10.985 1.00 82.81  ? 40 TYR A OH  1 
ATOM 275 N N   . SER A 1 41 ? -9.506  -8.079  -14.898 1.00 9.32   ? 41 SER A N   1 
ATOM 276 C CA  . SER A 1 41 ? -8.461  -7.973  -15.926 1.00 9.32   ? 41 SER A CA  1 
ATOM 277 C C   . SER A 1 41 ? -8.853  -8.803  -17.160 1.00 9.32   ? 41 SER A C   1 
ATOM 278 O O   . SER A 1 41 ? -8.649  -8.396  -18.297 1.00 9.32   ? 41 SER A O   1 
ATOM 279 C CB  . SER A 1 41 ? -7.103  -8.422  -15.344 1.00 37.53  ? 41 SER A CB  1 
ATOM 280 O OG  . SER A 1 41 ? -6.797  -7.706  -14.140 1.00 37.53  ? 41 SER A OG  1 
ATOM 281 N N   . MET A 1 42 ? -9.467  -9.951  -16.908 1.00 17.56  ? 42 MET A N   1 
ATOM 282 C CA  . MET A 1 42 ? -9.879  -10.835 -17.970 1.00 17.56  ? 42 MET A CA  1 
ATOM 283 C C   . MET A 1 42 ? -10.669 -10.074 -19.047 1.00 17.56  ? 42 MET A C   1 
ATOM 284 O O   . MET A 1 42 ? -10.259 -10.003 -20.193 1.00 17.56  ? 42 MET A O   1 
ATOM 285 C CB  . MET A 1 42 ? -10.740 -11.947 -17.367 1.00 16.84  ? 42 MET A CB  1 
ATOM 286 C CG  . MET A 1 42 ? -11.270 -12.979 -18.346 1.00 16.84  ? 42 MET A CG  1 
ATOM 287 S SD  . MET A 1 42 ? -9.876  -13.846 -19.131 1.00 16.84  ? 42 MET A SD  1 
ATOM 288 C CE  . MET A 1 42 ? -10.711 -14.856 -20.301 1.00 16.84  ? 42 MET A CE  1 
ATOM 289 N N   . LEU A 1 43 ? -11.740 -9.413  -18.625 1.00 2.00   ? 43 LEU A N   1 
ATOM 290 C CA  . LEU A 1 43 ? -12.593 -8.664  -19.529 1.00 2.00   ? 43 LEU A CA  1 
ATOM 291 C C   . LEU A 1 43 ? -11.953 -7.486  -20.241 1.00 2.00   ? 43 LEU A C   1 
ATOM 292 O O   . LEU A 1 43 ? -12.593 -6.914  -21.100 1.00 2.00   ? 43 LEU A O   1 
ATOM 293 C CB  . LEU A 1 43 ? -13.825 -8.147  -18.801 1.00 2.00   ? 43 LEU A CB  1 
ATOM 294 C CG  . LEU A 1 43 ? -14.982 -9.095  -18.536 1.00 2.00   ? 43 LEU A CG  1 
ATOM 295 C CD1 . LEU A 1 43 ? -15.981 -8.401  -17.577 1.00 2.00   ? 43 LEU A CD1 1 
ATOM 296 C CD2 . LEU A 1 43 ? -15.604 -9.419  -19.891 1.00 2.00   ? 43 LEU A CD2 1 
ATOM 297 N N   . ARG A 1 44 ? -10.836 -6.955  -19.744 1.00 54.89  ? 44 ARG A N   1 
ATOM 298 C CA  . ARG A 1 44 ? -10.095 -5.981  -20.547 1.00 54.89  ? 44 ARG A CA  1 
ATOM 299 C C   . ARG A 1 44 ? -9.086  -6.662  -21.501 1.00 54.89  ? 44 ARG A C   1 
ATOM 300 O O   . ARG A 1 44 ? -9.000  -6.353  -22.700 1.00 54.89  ? 44 ARG A O   1 
ATOM 301 C CB  . ARG A 1 44 ? -9.458  -4.861  -19.696 1.00 160.79 ? 44 ARG A CB  1 
ATOM 302 C CG  . ARG A 1 44 ? -8.482  -5.289  -18.621 1.00 160.79 ? 44 ARG A CG  1 
ATOM 303 C CD  . ARG A 1 44 ? -7.992  -4.075  -17.815 1.00 160.79 ? 44 ARG A CD  1 
ATOM 304 N NE  . ARG A 1 44 ? -9.101  -3.390  -17.128 1.00 160.79 ? 44 ARG A NE  1 
ATOM 305 C CZ  . ARG A 1 44 ? -9.306  -3.389  -15.811 1.00 160.79 ? 44 ARG A CZ  1 
ATOM 306 N NH1 . ARG A 1 44 ? -8.471  -4.028  -15.013 1.00 160.79 ? 44 ARG A NH1 1 
ATOM 307 N NH2 . ARG A 1 44 ? -10.386 -2.815  -15.305 1.00 160.79 ? 44 ARG A NH2 1 
ATOM 308 N N   . LYS A 1 45 ? -8.321  -7.590  -20.925 1.00 30.32  ? 45 LYS A N   1 
ATOM 309 C CA  . LYS A 1 45 ? -7.242  -8.301  -21.585 1.00 30.32  ? 45 LYS A CA  1 
ATOM 310 C C   . LYS A 1 45 ? -7.688  -9.328  -22.651 1.00 30.32  ? 45 LYS A C   1 
ATOM 311 O O   . LYS A 1 45 ? -7.141  -9.337  -23.743 1.00 30.32  ? 45 LYS A O   1 
ATOM 312 C CB  . LYS A 1 45 ? -6.434  -8.996  -20.476 1.00 27.85  ? 45 LYS A CB  1 
ATOM 313 C CG  . LYS A 1 45 ? -5.203  -9.759  -20.887 1.00 27.85  ? 45 LYS A CG  1 
ATOM 314 C CD  . LYS A 1 45 ? -4.078  -8.801  -21.250 1.00 27.85  ? 45 LYS A CD  1 
ATOM 315 C CE  . LYS A 1 45 ? -2.802  -9.554  -21.643 1.00 27.85  ? 45 LYS A CE  1 
ATOM 316 N NZ  . LYS A 1 45 ? -1.699  -8.659  -22.143 1.00 27.85  ? 45 LYS A NZ  1 
ATOM 317 N N   . ALA A 1 46 ? -8.576  -10.252 -22.271 1.00 74.74  ? 46 ALA A N   1 
ATOM 318 C CA  . ALA A 1 46 ? -9.064  -11.319 -23.139 1.00 74.74  ? 46 ALA A CA  1 
ATOM 319 C C   . ALA A 1 46 ? -10.237 -10.961 -24.060 1.00 74.74  ? 46 ALA A C   1 
ATOM 320 O O   . ALA A 1 46 ? -10.804 -9.861  -23.902 1.00 74.74  ? 46 ALA A O   1 
ATOM 321 C CB  . ALA A 1 46 ? -9.403  -12.525 -22.297 1.00 74.75  ? 46 ALA A CB  1 
ATOM 322 O OXT . ALA A 1 46 ? -10.584 -11.793 -24.932 1.00 74.75  ? 46 ALA A OXT 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  1  1  GLY GLY A . n 
A 1 2  VAL 2  2  2  VAL VAL A . n 
A 1 3  ILE 3  3  3  ILE ILE A . n 
A 1 4  ASP 4  4  4  ASP ASP A . n 
A 1 5  THR 5  5  5  THR THR A . n 
A 1 6  SER 6  6  6  SER SER A . n 
A 1 7  ALA 7  7  7  ALA ALA A . n 
A 1 8  VAL 8  8  8  VAL VAL A . n 
A 1 9  GLU 9  9  9  GLU GLU A . n 
A 1 10 SER 10 10 10 SER SER A . n 
A 1 11 ALA 11 11 11 ALA ALA A . n 
A 1 12 ILE 12 12 12 ILE ILE A . n 
A 1 13 THR 13 13 13 THR THR A . n 
A 1 14 ASP 14 14 14 ASP ASP A . n 
A 1 15 GLY 15 15 15 GLY GLY A . n 
A 1 16 GLN 16 16 16 GLN GLN A . n 
A 1 17 GLY 17 17 17 GLY GLY A . n 
A 1 18 ASP 18 18 18 ASP ASP A . n 
A 1 19 MET 19 19 19 MET MET A . n 
A 1 20 LYS 20 20 20 LYS LYS A . n 
A 1 21 ALA 21 21 21 ALA ALA A . n 
A 1 22 ILE 22 22 22 ILE ILE A . n 
A 1 23 GLY 23 23 23 GLY GLY A . n 
A 1 24 GLY 24 24 24 GLY GLY A . n 
A 1 25 TYR 25 25 25 TYR TYR A . n 
A 1 26 ILE 26 26 26 ILE ILE A . n 
A 1 27 VAL 27 27 27 VAL VAL A . n 
A 1 28 GLY 28 28 28 GLY GLY A . n 
A 1 29 ALA 29 29 29 ALA ALA A . n 
A 1 30 LEU 30 30 30 LEU LEU A . n 
A 1 31 VAL 31 31 31 VAL VAL A . n 
A 1 32 ILE 32 32 32 ILE ILE A . n 
A 1 33 LEU 33 33 33 LEU LEU A . n 
A 1 34 ALA 34 34 34 ALA ALA A . n 
A 1 35 VAL 35 35 35 VAL VAL A . n 
A 1 36 ALA 36 36 36 ALA ALA A . n 
A 1 37 GLY 37 37 37 GLY GLY A . n 
A 1 38 LEU 38 38 38 LEU LEU A . n 
A 1 39 ILE 39 39 39 ILE ILE A . n 
A 1 40 TYR 40 40 40 TYR TYR A . n 
A 1 41 SER 41 41 41 SER SER A . n 
A 1 42 MET 42 42 42 MET MET A . n 
A 1 43 LEU 43 43 43 LEU LEU A . n 
A 1 44 ARG 44 44 44 ARG ARG A . n 
A 1 45 LYS 45 45 45 LYS LYS A . n 
A 1 46 ALA 46 46 46 ALA ALA A . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 'representative helical assembly'            ? helical   35 
2 'helical asymmetric unit'                    ? monomeric 1  
3 'helical asymmetric unit, std helical frame' ? monomeric 1  
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 '(1-35)' A 
2 1        A 
3 H        A 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
H  'transform to helical frame' ? ? 1.00000000  0.00000000  0.00000000 0.00000 0.00000000  1.00000000  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 0.00000   
1  'helical symmetry operation' ? ? 0.59707926  0.80218225  0.00000000 0.00000 -0.80218225 0.59707926  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -49.30000 
2  'helical symmetry operation' ? ? 0.97306633  -0.23052529 0.00000000 0.00000 0.23052529  0.97306633  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -46.40000 
3  'helical symmetry operation' ? ? 0.17373412  -0.98479260 0.00000000 0.00000 0.98479260  0.17373412  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -43.50000 
4  'helical symmetry operation' ? ? -0.83544305 -0.54957703 0.00000000 0.00000 0.54957703  -0.83544305 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -40.60000 
5  'helical symmetry operation' ? ? -0.83552937 0.54944579  0.00000000 0.00000 -0.54944579 -0.83552937 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -37.70000 
6  'helical symmetry operation' ? ? 0.17357942  0.98481987  0.00000000 0.00000 -0.98481987 0.17357942  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -34.80000 
7  'helical symmetry operation' ? ? 0.97303011  0.23067814  0.00000000 0.00000 -0.23067814 0.97303011  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -31.90000 
8  'helical symmetry operation' ? ? 0.59720526  -0.80208845 0.00000000 0.00000 0.80208845  0.59720526  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -29.00000 
9  'helical symmetry operation' ? ? -0.49995465 -0.86605158 0.00000000 0.00000 0.86605158  -0.49995465 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -26.10000 
10 'helical symmetry operation' ? ? -0.99324376 0.11604669  0.00000000 0.00000 -0.11604669 -0.99324376 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -23.20000 
11 'helical symmetry operation' ? ? -0.28684225 0.95797783  0.00000000 0.00000 -0.95797783 -0.28684225 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -20.30000 
12 'helical symmetry operation' ? ? 0.76602201  0.64281435  0.00000000 0.00000 -0.64281435 0.76602201  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -17.40000 
13 'helical symmetry operation' ? ? 0.89364569  -0.44877319 0.00000000 0.00000 0.44877319  0.89364569  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -14.50000 
14 'helical symmetry operation' ? ? -0.05812160 -0.99830951 0.00000000 0.00000 0.99830951  -0.05812160 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -11.60000 
15 'helical symmetry operation' ? ? -0.93968665 -0.34203654 0.00000000 0.00000 0.34203654  -0.93968665 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -8.70000  
16 'helical symmetry operation' ? ? -0.68625010 0.72736566  0.00000000 0.00000 -0.72736566 -0.68625010 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -5.80000  
17 'helical symmetry operation' ? ? 0.39607442  0.91821841  0.00000000 0.00000 -0.91821841 0.39607442  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -2.90000  
18 'helical symmetry operation' ? ? 1.00000000  0.00000000  0.00000000 0.00000 0.00000000  1.00000000  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -0.00000  
19 'helical symmetry operation' ? ? 0.39607442  -0.91821841 0.00000000 0.00000 0.91821841  0.39607442  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 2.90000   
20 'helical symmetry operation' ? ? -0.68625010 -0.72736566 0.00000000 0.00000 0.72736566  -0.68625010 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 5.80000   
21 'helical symmetry operation' ? ? -0.93968665 0.34203654  0.00000000 0.00000 -0.34203654 -0.93968665 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 8.70000   
22 'helical symmetry operation' ? ? -0.05812160 0.99830951  0.00000000 0.00000 -0.99830951 -0.05812160 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 11.60000  
23 'helical symmetry operation' ? ? 0.89364569  0.44877319  0.00000000 0.00000 -0.44877319 0.89364569  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 14.50000  
24 'helical symmetry operation' ? ? 0.76602201  -0.64281435 0.00000000 0.00000 0.64281435  0.76602201  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 17.40000  
25 'helical symmetry operation' ? ? -0.28684225 -0.95797783 0.00000000 0.00000 0.95797783  -0.28684225 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 20.30000  
26 'helical symmetry operation' ? ? -0.99324376 -0.11604669 0.00000000 0.00000 0.11604669  -0.99324376 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 23.20000  
27 'helical symmetry operation' ? ? -0.49995465 0.86605158  0.00000000 0.00000 -0.86605158 -0.49995465 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 26.10000  
28 'helical symmetry operation' ? ? 0.59720526  0.80208845  0.00000000 0.00000 -0.80208845 0.59720526  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 29.00000  
29 'helical symmetry operation' ? ? 0.97303011  -0.23067814 0.00000000 0.00000 0.23067814  0.97303011  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 31.90000  
30 'helical symmetry operation' ? ? 0.17357942  -0.98481987 0.00000000 0.00000 0.98481987  0.17357942  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 34.80000  
31 'helical symmetry operation' ? ? -0.83552937 -0.54944579 0.00000000 0.00000 0.54944579  -0.83552937 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 37.70000  
32 'helical symmetry operation' ? ? -0.83544305 0.54957703  0.00000000 0.00000 -0.54957703 -0.83544305 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 40.60000  
33 'helical symmetry operation' ? ? 0.17373412  0.98479260  0.00000000 0.00000 -0.98479260 0.17373412  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 43.50000  
34 'helical symmetry operation' ? ? 0.97306633  0.23052529  0.00000000 0.00000 -0.23052529 0.97306633  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 46.40000  
35 'helical symmetry operation' ? ? 0.59707926  -0.80218225 0.00000000 0.00000 0.80218225  0.59707926  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 49.30000  
# 
_pdbx_helical_symmetry.entry_id                  1QL1 
_pdbx_helical_symmetry.number_of_operations      35 
_pdbx_helical_symmetry.rotation_per_n_subunits   66.667000 
_pdbx_helical_symmetry.rise_per_n_subunits       2.900000 
_pdbx_helical_symmetry.n_subunits_divisor        1 
_pdbx_helical_symmetry.dyad_axis                 no 
_pdbx_helical_symmetry.circular_symmetry         1 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-02-07 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
FXPLOR        refinement       .          ? 1 
CCP13         'data reduction' '(LSQINT)' ? 2 
CCP13-FDSCALE 'data scaling'   .          ? 3 
# 
_pdbx_database_remark.id     285 
_pdbx_database_remark.text   
;  THE ANALOGUE OF THE CRYSTALLOGRAPHIC SPACE GROUP FOR                
  HELICAL STRUCTURES IS THE LINE GROUP (A.KLUG, F.H.C.CRICK,          
  H.W.WYCKOFF, ACTA CRYSTALLOG. V.11, 199, 1958).  THE                
  LINE GROUP OF PF1 IS S.  THE UNIT CELL DIMENSIONS ARE THE           
  HELIX PARAMETERS (UNIT TWIST TAU, UNIT HEIGHT P).                   
                                                                      
  THE INDEXING OF UNITS ALONG THE BASIC HELIX IS ILLUSTRATED          
  IN REFERENCE 4.  TO GENERATE COORDINATES X(K), Y(K), Z(K)           
  OF UNIT K FROM THE GIVEN COORDINATES X(0), Y(0), Z(0) OF            
  UNIT 0 IN A UNIT CELL WITH HELIX PARAMETERS                         
         (TAU, P) = (66.667, 2.90),                                   
  APPLY THE MATRIX AND VECTOR:                                        
                                                                      
     |    COS(TAU*K)   -SIN(TAU*K)   0 |    |   0         |           
     |    SIN(TAU*K)   COS(TAU*K)    0 | +  |   0         |           
     |    0            0             1 |    |   P*K       |           
                                                                      
  THE NEIGHBORS IN CONTACT WITH UNIT 0 ARE UNITS                      
         K = +/-1, +/-5, +/-6, +/-11 AND +/-17.                       
  THESE SYMMETRY-RELATED COPIES ARE USED TO DETERMINE INTERCHAIN      
  NON-BONDED CONTACTS DURING THE REFINEMENT.                          
                                                                      
  [ THE LOWER-TEMPERATURE FORM OF PF1 HAS HELIX PARAMETERS,           
     TAU = 65.915 DEGREES,                                            
      P = 3.05 ANGSTROMS. ]                                           

;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 VAL A 2 ? ? 179.47 -154.26 
2 1 THR A 5 ? ? -99.58 52.66   
#