data_1QLS
# 
_entry.id   1QLS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.305 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QLS         
PDBE  EBI-2868     
WWPDB D_1290002868 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1A4P unspecified 'P11 (S100A10), LIGAND OF ANNEXIN II CALPACTIN LIGHT CHAIN'                         
PDB 1BT6 unspecified 'P11 (S100A10), LIGAND OF ANNEXIN II IN COMPLEX WITH ANNEXIN II N-TERMINUS (HUMAN)' 
PDB 1BO9 unspecified 'NMR SOLUTION STRUCTURE OF DOMAIN 1 OF HUMAN ANNIXIN I'                             
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QLS 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   1999-09-15 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rety, S.'          1 
'Sopkova, J.'       2 
'Renouard, M.'      3 
'Osterloh, D.'      4 
'Gerke, V.'         5 
'Russo-Marie, F.'   6 
'Lewit-Bentley, A.' 7 
# 
_citation.id                        primary 
_citation.title                     
'Structural Basis of the Ca2+ Dependent Association between S100C (S100A11) and its Target, the N-Terminal Part of Annexin I' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            8 
_citation.page_first                175 
_citation.page_last                 ? 
_citation.year                      2000 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10673436 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(00)00093-9' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rety, S.'          1 ? 
primary 'Osterloh, D.'      2 ? 
primary 'Arie, J.P.'        3 ? 
primary 'Tabaries, S.'      4 ? 
primary 'Seeman, J.'        5 ? 
primary 'Russo-Marie, F.'   6 ? 
primary 'Gerke, V.'         7 ? 
primary 'Lewit-Bentley, A.' 8 ? 
# 
_cell.entry_id           1QLS 
_cell.length_a           77.510 
_cell.length_b           77.510 
_cell.length_c           111.610 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QLS 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'S100C PROTEIN' 11194.829 1  ? ? ?          ?                            
2 polymer     syn 'ANNEXIN I'     1278.541  1  ? ? N-TERMINAL 'N-ACETYLATED ON N-TERMINUS' 
3 non-polymer syn 'CALCIUM ION'   40.078    2  ? ? ?          ?                            
4 water       nat water           18.015    23 ? ? ?          ?                            
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        CALGIZZARIN 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MAKRPTETERCIESLIAIFQKHAGRDGNNTKISKTEFLIFMNTELAAFTQNQKDPGVLDRMMKKLDLDSDGQLDFQEFLN
LIGGLAIACHDSFIKSTQK
;
;MAKRPTETERCIESLIAIFQKHAGRDGNNTKISKTEFLIFMNTELAAFTQNQKDPGVLDRMMKKLDLDSDGQLDFQEFLN
LIGGLAIACHDSFIKSTQK
;
A ? 
2 'polypeptide(L)' no yes '(ACE)AMVSAFLKQAW'                                                                                     
XAMVSAFLKQAW                                                                                           D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ALA n 
1 3  LYS n 
1 4  ARG n 
1 5  PRO n 
1 6  THR n 
1 7  GLU n 
1 8  THR n 
1 9  GLU n 
1 10 ARG n 
1 11 CYS n 
1 12 ILE n 
1 13 GLU n 
1 14 SER n 
1 15 LEU n 
1 16 ILE n 
1 17 ALA n 
1 18 ILE n 
1 19 PHE n 
1 20 GLN n 
1 21 LYS n 
1 22 HIS n 
1 23 ALA n 
1 24 GLY n 
1 25 ARG n 
1 26 ASP n 
1 27 GLY n 
1 28 ASN n 
1 29 ASN n 
1 30 THR n 
1 31 LYS n 
1 32 ILE n 
1 33 SER n 
1 34 LYS n 
1 35 THR n 
1 36 GLU n 
1 37 PHE n 
1 38 LEU n 
1 39 ILE n 
1 40 PHE n 
1 41 MET n 
1 42 ASN n 
1 43 THR n 
1 44 GLU n 
1 45 LEU n 
1 46 ALA n 
1 47 ALA n 
1 48 PHE n 
1 49 THR n 
1 50 GLN n 
1 51 ASN n 
1 52 GLN n 
1 53 LYS n 
1 54 ASP n 
1 55 PRO n 
1 56 GLY n 
1 57 VAL n 
1 58 LEU n 
1 59 ASP n 
1 60 ARG n 
1 61 MET n 
1 62 MET n 
1 63 LYS n 
1 64 LYS n 
1 65 LEU n 
1 66 ASP n 
1 67 LEU n 
1 68 ASP n 
1 69 SER n 
1 70 ASP n 
1 71 GLY n 
1 72 GLN n 
1 73 LEU n 
1 74 ASP n 
1 75 PHE n 
1 76 GLN n 
1 77 GLU n 
1 78 PHE n 
1 79 LEU n 
1 80 ASN n 
1 81 LEU n 
1 82 ILE n 
1 83 GLY n 
1 84 GLY n 
1 85 LEU n 
1 86 ALA n 
1 87 ILE n 
1 88 ALA n 
1 89 CYS n 
1 90 HIS n 
1 91 ASP n 
1 92 SER n 
1 93 PHE n 
1 94 ILE n 
1 95 LYS n 
1 96 SER n 
1 97 THR n 
1 98 GLN n 
1 99 LYS n 
2 1  ACE n 
2 2  ALA n 
2 3  MET n 
2 4  VAL n 
2 5  SER n 
2 6  ALA n 
2 7  PHE n 
2 8  LEU n 
2 9  LYS n 
2 10 GLN n 
2 11 ALA n 
2 12 TRP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               PIG 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'SUS SCROFA' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9823 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET23A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'HOMO SAPIENS' 
_pdbx_entity_src_syn.organism_common_name   HUMAN 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP S111_PIG   1 ? ? P31950 ? 
2 UNP ANX1_HUMAN 2 ? ? P04083 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1QLS A 1 ? 99 ? P31950 1 ? 99 ? 1 99 
2 2 1QLS D 2 ? 12 ? P04083 1 ? 11 ? 1 11 
# 
_struct_ref_seq_dif.align_id                     2 
_struct_ref_seq_dif.pdbx_pdb_id_code             1QLS 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           D 
_struct_ref_seq_dif.seq_num                      6 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P04083 
_struct_ref_seq_dif.db_mon_id                    GLU 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          5 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            5 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'  ? 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QLS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.9 
_exptl_crystal.density_percent_sol   68.2 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;20 MG/ML PROTEIN WERE CRYSTALLIZED BY VAPOR DIFFUSION AGAINST 10% PEG 4000, 20% PEG 4000, 10% 2-PROPANOL, 100MM HEPES, PH=8.5, pH 8.50
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           280.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1998-07-02 
_diffrn_detector.details                'FOCUSSING MONOCHROMATOR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GE(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.37 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'LURE BEAMLINE D41A' 
_diffrn_source.pdbx_synchrotron_site       LURE 
_diffrn_source.pdbx_synchrotron_beamline   D41A 
_diffrn_source.pdbx_wavelength             1.37 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1QLS 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             69.000 
_reflns.d_resolution_high            2.300 
_reflns.number_obs                   9310 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.08000 
_reflns.pdbx_Rsym_value              0.08000 
_reflns.pdbx_netI_over_sigmaI        20.1000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.600 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1QLS 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     9333 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20. 
_refine.ls_d_res_high                            2.3 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.214 
_refine.ls_R_factor_R_free                       0.268 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  930 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               200.109 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1BT6 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.217 
_refine.pdbx_overall_ESU_R_Free                  0.207 
_refine.overall_SU_ML                            0.1216 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             4.869 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        840 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             23 
_refine_hist.number_atoms_total               865 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        20. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.017 0.020 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.035 0.030 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.054 0.05  ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         2.417 2.0   ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        3.357 3.0   ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         4.480 3.0   ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        6.602 4.0   ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       0.009 0.02  ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      0.203 0.15  ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       0.206 0.300 ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       0.350 0.300 ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       0.189 0.3   ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        2.1   15.0  ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     23.0  15.0  ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    21.8  20.0  ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       0.    15.0  ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1QLS 
_struct.title                     'S100C (S100A11),OR CALGIZZARIN, IN COMPLEX WITH ANNEXIN I N-TERMINUS' 
_struct.pdbx_descriptor           'S100C PROTEIN, ANNEXIN I' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QLS 
_struct_keywords.pdbx_keywords   'METAL-BINDING PROTEIN/INHIBITOR' 
_struct_keywords.text            
;METAL-BINDING PROTEIN/INHIBITOR, S100 FAMILY, EF-HAND PROTEIN, COMPLEX (LIGAND-ANNEXIN), LIGAND OF ANNEXIN II, CALCIUM/PHOSPHOLIPID BINDING PROTEIN, METAL-BINDING PROTEIN-INHIBITOR complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;BIOLOGICAL_UNIT: DIMERTHE DIMER IS COVALENT IN               
  THE CRYSTAL, LINKED BY ADISULPHIDE AT CYS11.                        
 UNDER REDUCING CONDITIONS, THOUGHTHE DISULPHIDE WOULD                
  BE REDUCED, THE DIMER SHOULD REMAININTACT.FOR                       
 THE HOMO-ASSEMBLY DESCRIBED BY REMARK 350THE                         
 DIFFERENCE IN ACCESSIBLE SURFACE AREA PERCHAIN                       
 BETWEEN THE ISOLATED CHAIN AND THAT FOR
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1  THR A 6  ? GLY A 24 ? THR A 6  GLY A 24 1 ? 19 
HELX_P HELX_P2 2  SER A 33 ? THR A 43 ? SER A 33 THR A 43 1 ? 11 
HELX_P HELX_P3 3  ALA A 46 ? ASN A 51 ? ALA A 46 ASN A 51 1 ? 6  
HELX_P HELX_P4 4  GLY A 56 ? LEU A 65 ? GLY A 56 LEU A 65 1 ? 10 
HELX_P HELX_P5 5  PHE A 75 ? THR A 97 ? PHE A 75 THR A 97 1 ? 23 
HELX_P HELX_P6 1D MET B 3  ? GLN B 10 ? MET D 2  GLN D 9  1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ?    ? A CYS 11 SG ? ? ? 1_555 A CYS 11 SG  ? ? A CYS 11  A CYS 11   8_676 ? ? ? ? ? ? ? 1.923 ? 
metalc1  metalc ?    ? C CA  .  CA ? ? ? 1_555 A ALA 23 O   ? ? A CA  101 A ALA 23   1_555 ? ? ? ? ? ? ? 2.481 ? 
metalc2  metalc ?    ? C CA  .  CA ? ? ? 1_555 A GLU 36 OE2 ? ? A CA  101 A GLU 36   1_555 ? ? ? ? ? ? ? 2.819 ? 
metalc3  metalc ?    ? C CA  .  CA ? ? ? 1_555 A ASP 26 OD1 ? ? A CA  101 A ASP 26   1_555 ? ? ? ? ? ? ? 2.544 ? 
metalc4  metalc ?    ? C CA  .  CA ? ? ? 1_555 E HOH .  O   ? ? A CA  101 A HOH 2017 1_555 ? ? ? ? ? ? ? 2.490 ? 
metalc5  metalc ?    ? C CA  .  CA ? ? ? 1_555 A LYS 31 O   ? ? A CA  101 A LYS 31   1_555 ? ? ? ? ? ? ? 2.557 ? 
metalc6  metalc ?    ? C CA  .  CA ? ? ? 1_555 A GLU 36 OE1 ? ? A CA  101 A GLU 36   1_555 ? ? ? ? ? ? ? 2.628 ? 
metalc7  metalc ?    ? C CA  .  CA ? ? ? 1_555 A ASN 28 O   ? ? A CA  101 A ASN 28   1_555 ? ? ? ? ? ? ? 2.685 ? 
metalc8  metalc ?    ? D CA  .  CA ? ? ? 1_555 A GLN 72 O   ? ? A CA  102 A GLN 72   1_555 ? ? ? ? ? ? ? 2.625 ? 
metalc9  metalc ?    ? D CA  .  CA ? ? ? 1_555 A GLU 77 OE1 ? ? A CA  102 A GLU 77   1_555 ? ? ? ? ? ? ? 2.735 ? 
metalc10 metalc ?    ? D CA  .  CA ? ? ? 1_555 A GLU 77 OE2 ? ? A CA  102 A GLU 77   1_555 ? ? ? ? ? ? ? 2.793 ? 
metalc11 metalc ?    ? D CA  .  CA ? ? ? 1_555 E HOH .  O   ? ? A CA  102 A HOH 2013 1_555 ? ? ? ? ? ? ? 2.703 ? 
metalc12 metalc ?    ? D CA  .  CA ? ? ? 1_555 A ASP 66 OD1 ? ? A CA  102 A ASP 66   1_555 ? ? ? ? ? ? ? 2.559 ? 
metalc13 metalc ?    ? D CA  .  CA ? ? ? 1_555 A ASP 68 OD1 ? ? A CA  102 A ASP 68   1_555 ? ? ? ? ? ? ? 2.601 ? 
metalc14 metalc ?    ? D CA  .  CA ? ? ? 1_555 A ASP 70 OD1 ? ? A CA  102 A ASP 70   1_555 ? ? ? ? ? ? ? 2.641 ? 
covale1  covale both ? B ACE 1  C  ? ? ? 1_555 B ALA 2  N   ? ? D ACE 0   D ALA 1    1_555 ? ? ? ? ? ? ? 1.334 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
covale ? ? 
# 
_struct_sheet.id               S1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     S1 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1 1 LYS A 31 ? SER A 33 ? LYS A 31 SER A 33 
S1 2 GLN A 72 ? ASP A 74 ? GLN A 72 ASP A 74 
# 
_pdbx_struct_sheet_hbond.sheet_id                S1 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   LEU 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    73 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    LEU 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     73 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    32 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     32 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 101' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 102' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ALA A 23 ? ALA A 23   . ? 1_555 ? 
2  AC1 6 ASP A 26 ? ASP A 26   . ? 1_555 ? 
3  AC1 6 ASN A 28 ? ASN A 28   . ? 1_555 ? 
4  AC1 6 LYS A 31 ? LYS A 31   . ? 1_555 ? 
5  AC1 6 GLU A 36 ? GLU A 36   . ? 1_555 ? 
6  AC1 6 HOH E .  ? HOH A 2017 . ? 1_555 ? 
7  AC2 6 ASP A 66 ? ASP A 66   . ? 1_555 ? 
8  AC2 6 ASP A 68 ? ASP A 68   . ? 1_555 ? 
9  AC2 6 ASP A 70 ? ASP A 70   . ? 1_555 ? 
10 AC2 6 GLN A 72 ? GLN A 72   . ? 1_555 ? 
11 AC2 6 GLU A 77 ? GLU A 77   . ? 1_555 ? 
12 AC2 6 HOH E .  ? HOH A 2013 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QLS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QLS 
_atom_sites.fract_transf_matrix[1][1]   0.012901 
_atom_sites.fract_transf_matrix[1][2]   0.007449 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014897 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008960 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . PRO A 1 5  ? -13.405 71.471 65.891 1.00 52.35  ? 5    PRO A N   1 
ATOM   2   C  CA  . PRO A 1 5  ? -12.039 71.411 65.295 1.00 50.37  ? 5    PRO A CA  1 
ATOM   3   C  C   . PRO A 1 5  ? -11.889 72.242 64.028 1.00 45.18  ? 5    PRO A C   1 
ATOM   4   O  O   . PRO A 1 5  ? -12.766 72.309 63.176 1.00 44.21  ? 5    PRO A O   1 
ATOM   5   C  CB  . PRO A 1 5  ? -11.874 69.925 64.944 1.00 52.81  ? 5    PRO A CB  1 
ATOM   6   C  CG  . PRO A 1 5  ? -13.257 69.390 64.822 1.00 54.29  ? 5    PRO A CG  1 
ATOM   7   C  CD  . PRO A 1 5  ? -14.236 70.477 65.147 1.00 53.54  ? 5    PRO A CD  1 
ATOM   8   N  N   . THR A 1 6  ? -10.735 72.888 63.924 1.00 42.32  ? 6    THR A N   1 
ATOM   9   C  CA  . THR A 1 6  ? -10.503 73.688 62.683 1.00 39.40  ? 6    THR A CA  1 
ATOM   10  C  C   . THR A 1 6  ? -10.209 72.775 61.524 1.00 37.69  ? 6    THR A C   1 
ATOM   11  O  O   . THR A 1 6  ? -10.000 71.560 61.687 1.00 34.93  ? 6    THR A O   1 
ATOM   12  C  CB  . THR A 1 6  ? -9.333  74.638 62.929 1.00 40.11  ? 6    THR A CB  1 
ATOM   13  O  OG1 . THR A 1 6  ? -8.144  73.926 63.301 1.00 35.65  ? 6    THR A OG1 1 
ATOM   14  C  CG2 . THR A 1 6  ? -9.732  75.551 64.130 1.00 36.21  ? 6    THR A CG2 1 
ATOM   15  N  N   . GLU A 1 7  ? -10.130 73.361 60.316 1.00 38.51  ? 7    GLU A N   1 
ATOM   16  C  CA  . GLU A 1 7  ? -9.773  72.516 59.175 1.00 37.89  ? 7    GLU A CA  1 
ATOM   17  C  C   . GLU A 1 7  ? -8.333  71.998 59.384 1.00 35.65  ? 7    GLU A C   1 
ATOM   18  O  O   . GLU A 1 7  ? -8.061  70.866 58.999 1.00 33.94  ? 7    GLU A O   1 
ATOM   19  C  CB  . GLU A 1 7  ? -9.840  73.230 57.852 1.00 46.40  ? 7    GLU A CB  1 
ATOM   20  C  CG  . GLU A 1 7  ? -11.052 72.961 56.995 1.00 57.06  ? 7    GLU A CG  1 
ATOM   21  C  CD  . GLU A 1 7  ? -11.338 71.476 56.797 1.00 63.90  ? 7    GLU A CD  1 
ATOM   22  O  OE1 . GLU A 1 7  ? -10.629 70.780 56.032 1.00 62.35  ? 7    GLU A OE1 1 
ATOM   23  O  OE2 . GLU A 1 7  ? -12.325 71.055 57.462 1.00 67.94  ? 7    GLU A OE2 1 
ATOM   24  N  N   . THR A 1 8  ? -7.445  72.805 59.968 1.00 31.94  ? 8    THR A N   1 
ATOM   25  C  CA  . THR A 1 8  ? -6.097  72.293 60.130 1.00 33.38  ? 8    THR A CA  1 
ATOM   26  C  C   . THR A 1 8  ? -6.074  71.160 61.126 1.00 34.17  ? 8    THR A C   1 
ATOM   27  O  O   . THR A 1 8  ? -5.405  70.154 60.911 1.00 32.83  ? 8    THR A O   1 
ATOM   28  C  CB  . THR A 1 8  ? -4.956  73.256 60.146 1.00 30.67  ? 8    THR A CB  1 
ATOM   29  O  OG1 . THR A 1 8  ? -3.990  73.213 61.156 1.00 39.82  ? 8    THR A OG1 1 
ATOM   30  C  CG2 . THR A 1 8  ? -5.265  74.632 59.775 1.00 22.71  ? 8    THR A CG2 1 
ATOM   31  N  N   . GLU A 1 9  ? -6.842  71.298 62.212 1.00 34.65  ? 9    GLU A N   1 
ATOM   32  C  CA  . GLU A 1 9  ? -6.896  70.243 63.194 1.00 36.52  ? 9    GLU A CA  1 
ATOM   33  C  C   . GLU A 1 9  ? -7.483  68.942 62.594 1.00 34.11  ? 9    GLU A C   1 
ATOM   34  O  O   . GLU A 1 9  ? -7.049  67.843 62.839 1.00 31.69  ? 9    GLU A O   1 
ATOM   35  C  CB  . GLU A 1 9  ? -7.794  70.653 64.378 1.00 37.78  ? 9    GLU A CB  1 
ATOM   36  C  CG  . GLU A 1 9  ? -7.068  71.517 65.395 1.00 37.60  ? 9    GLU A CG  1 
ATOM   37  C  CD  . GLU A 1 9  ? -8.097  72.164 66.351 1.00 39.00  ? 9    GLU A CD  1 
ATOM   38  O  OE1 . GLU A 1 9  ? -9.279  72.383 66.004 1.00 36.67  ? 9    GLU A OE1 1 
ATOM   39  O  OE2 . GLU A 1 9  ? -7.610  72.420 67.442 1.00 40.95  ? 9    GLU A OE2 1 
ATOM   40  N  N   . ARG A 1 10 ? -8.522  69.105 61.806 1.00 33.00  ? 10   ARG A N   1 
ATOM   41  C  CA  . ARG A 1 10 ? -9.185  67.981 61.215 1.00 36.61  ? 10   ARG A CA  1 
ATOM   42  C  C   . ARG A 1 10 ? -8.253  67.248 60.242 1.00 36.86  ? 10   ARG A C   1 
ATOM   43  O  O   . ARG A 1 10 ? -8.276  66.030 60.231 1.00 35.47  ? 10   ARG A O   1 
ATOM   44  C  CB  . ARG A 1 10 ? -10.452 68.474 60.502 1.00 40.42  ? 10   ARG A CB  1 
ATOM   45  C  CG  . ARG A 1 10 ? -11.518 67.379 60.528 1.00 51.98  ? 10   ARG A CG  1 
ATOM   46  C  CD  . ARG A 1 10 ? -12.525 67.607 59.385 1.00 61.96  ? 10   ARG A CD  1 
ATOM   47  N  NE  . ARG A 1 10 ? -11.783 68.249 58.306 1.00 70.81  ? 10   ARG A NE  1 
ATOM   48  C  CZ  . ARG A 1 10 ? -11.131 67.597 57.356 1.00 75.68  ? 10   ARG A CZ  1 
ATOM   49  N  NH1 . ARG A 1 10 ? -11.137 66.272 57.306 1.00 76.55  ? 10   ARG A NH1 1 
ATOM   50  N  NH2 . ARG A 1 10 ? -10.473 68.332 56.461 1.00 79.38  ? 10   ARG A NH2 1 
ATOM   51  N  N   . CYS A 1 11 ? -7.486  68.015 59.453 1.00 33.61  ? 11   CYS A N   1 
ATOM   52  C  CA  . CYS A 1 11 ? -6.567  67.428 58.523 1.00 34.07  ? 11   CYS A CA  1 
ATOM   53  C  C   . CYS A 1 11 ? -5.418  66.750 59.236 1.00 32.34  ? 11   CYS A C   1 
ATOM   54  O  O   . CYS A 1 11 ? -5.003  65.691 58.785 1.00 32.05  ? 11   CYS A O   1 
ATOM   55  C  CB  . CYS A 1 11 ? -6.245  68.323 57.321 1.00 38.37  ? 11   CYS A CB  1 
ATOM   56  S  SG  . CYS A 1 11 ? -7.600  68.049 56.073 1.00 44.47  ? 11   CYS A SG  1 
ATOM   57  N  N   . ILE A 1 12 ? -4.933  67.274 60.363 1.00 30.46  ? 12   ILE A N   1 
ATOM   58  C  CA  . ILE A 1 12 ? -3.880  66.602 61.096 1.00 31.77  ? 12   ILE A CA  1 
ATOM   59  C  C   . ILE A 1 12 ? -4.446  65.262 61.595 1.00 33.32  ? 12   ILE A C   1 
ATOM   60  O  O   . ILE A 1 12 ? -3.826  64.212 61.562 1.00 31.62  ? 12   ILE A O   1 
ATOM   61  C  CB  . ILE A 1 12 ? -3.428  67.440 62.291 1.00 33.06  ? 12   ILE A CB  1 
ATOM   62  C  CG1 . ILE A 1 12 ? -2.542  68.569 61.734 1.00 35.26  ? 12   ILE A CG1 1 
ATOM   63  C  CG2 . ILE A 1 12 ? -2.699  66.622 63.346 1.00 27.81  ? 12   ILE A CG2 1 
ATOM   64  C  CD1 . ILE A 1 12 ? -2.245  69.672 62.714 1.00 28.92  ? 12   ILE A CD1 1 
ATOM   65  N  N   . GLU A 1 13 ? -5.691  65.307 62.067 1.00 32.78  ? 13   GLU A N   1 
ATOM   66  C  CA  . GLU A 1 13 ? -6.287  64.082 62.565 1.00 37.72  ? 13   GLU A CA  1 
ATOM   67  C  C   . GLU A 1 13 ? -6.551  63.029 61.479 1.00 35.20  ? 13   GLU A C   1 
ATOM   68  O  O   . GLU A 1 13 ? -6.337  61.843 61.734 1.00 32.63  ? 13   GLU A O   1 
ATOM   69  C  CB  . GLU A 1 13 ? -7.573  64.407 63.284 1.00 40.58  ? 13   GLU A CB  1 
ATOM   70  C  CG  . GLU A 1 13 ? -8.172  63.148 63.930 1.00 55.56  ? 13   GLU A CG  1 
ATOM   71  C  CD  . GLU A 1 13 ? -9.213  63.714 64.905 1.00 64.23  ? 13   GLU A CD  1 
ATOM   72  O  OE1 . GLU A 1 13 ? -8.725  64.329 65.903 1.00 68.29  ? 13   GLU A OE1 1 
ATOM   73  O  OE2 . GLU A 1 13 ? -10.408 63.548 64.608 1.00 65.76  ? 13   GLU A OE2 1 
ATOM   74  N  N   . SER A 1 14 ? -7.034  63.466 60.315 1.00 33.10  ? 14   SER A N   1 
ATOM   75  C  CA  . SER A 1 14 ? -7.216  62.570 59.200 1.00 35.12  ? 14   SER A CA  1 
ATOM   76  C  C   . SER A 1 14 ? -5.861  61.943 58.795 1.00 33.50  ? 14   SER A C   1 
ATOM   77  O  O   . SER A 1 14 ? -5.864  60.751 58.524 1.00 34.35  ? 14   SER A O   1 
ATOM   78  C  CB  . SER A 1 14 ? -7.681  63.263 57.903 1.00 37.73  ? 14   SER A CB  1 
ATOM   79  O  OG  . SER A 1 14 ? -9.049  63.496 58.007 1.00 42.97  ? 14   SER A OG  1 
ATOM   80  N  N   . LEU A 1 15 ? -4.788  62.759 58.776 1.00 31.56  ? 15   LEU A N   1 
ATOM   81  C  CA  . LEU A 1 15 ? -3.495  62.177 58.391 1.00 31.39  ? 15   LEU A CA  1 
ATOM   82  C  C   . LEU A 1 15 ? -3.161  60.967 59.247 1.00 32.39  ? 15   LEU A C   1 
ATOM   83  O  O   . LEU A 1 15 ? -2.813  59.873 58.747 1.00 32.88  ? 15   LEU A O   1 
ATOM   84  C  CB  . LEU A 1 15 ? -2.408  63.242 58.341 1.00 28.98  ? 15   LEU A CB  1 
ATOM   85  C  CG  . LEU A 1 15 ? -2.547  64.170 57.110 1.00 36.86  ? 15   LEU A CG  1 
ATOM   86  C  CD1 . LEU A 1 15 ? -1.326  65.038 56.929 1.00 37.71  ? 15   LEU A CD1 1 
ATOM   87  C  CD2 . LEU A 1 15 ? -2.781  63.365 55.834 1.00 35.48  ? 15   LEU A CD2 1 
ATOM   88  N  N   . ILE A 1 16 ? -3.320  61.151 60.562 1.00 29.56  ? 16   ILE A N   1 
ATOM   89  C  CA  . ILE A 1 16 ? -3.076  60.130 61.530 1.00 29.87  ? 16   ILE A CA  1 
ATOM   90  C  C   . ILE A 1 16 ? -4.012  58.953 61.302 1.00 32.49  ? 16   ILE A C   1 
ATOM   91  O  O   . ILE A 1 16 ? -3.524  57.834 61.302 1.00 32.73  ? 16   ILE A O   1 
ATOM   92  C  CB  . ILE A 1 16 ? -3.276  60.665 62.962 1.00 33.68  ? 16   ILE A CB  1 
ATOM   93  C  CG1 . ILE A 1 16 ? -2.086  61.623 63.264 1.00 33.20  ? 16   ILE A CG1 1 
ATOM   94  C  CG2 . ILE A 1 16 ? -3.320  59.570 64.005 1.00 30.58  ? 16   ILE A CG2 1 
ATOM   95  C  CD1 . ILE A 1 16 ? -2.341  62.426 64.517 1.00 39.33  ? 16   ILE A CD1 1 
ATOM   96  N  N   . ALA A 1 17 ? -5.317  59.186 61.098 1.00 31.16  ? 17   ALA A N   1 
ATOM   97  C  CA  . ALA A 1 17 ? -6.238  58.110 60.892 1.00 30.16  ? 17   ALA A CA  1 
ATOM   98  C  C   . ALA A 1 17 ? -5.924  57.344 59.606 1.00 29.19  ? 17   ALA A C   1 
ATOM   99  O  O   . ALA A 1 17 ? -6.053  56.143 59.569 1.00 29.63  ? 17   ALA A O   1 
ATOM   100 C  CB  . ALA A 1 17 ? -7.710  58.603 60.778 1.00 25.60  ? 17   ALA A CB  1 
ATOM   101 N  N   . ILE A 1 18 ? -5.588  58.065 58.537 1.00 28.34  ? 18   ILE A N   1 
ATOM   102 C  CA  . ILE A 1 18 ? -5.317  57.358 57.277 1.00 27.30  ? 18   ILE A CA  1 
ATOM   103 C  C   . ILE A 1 18 ? -4.104  56.474 57.444 1.00 26.33  ? 18   ILE A C   1 
ATOM   104 O  O   . ILE A 1 18 ? -4.108  55.311 57.042 1.00 27.47  ? 18   ILE A O   1 
ATOM   105 C  CB  . ILE A 1 18 ? -5.089  58.424 56.196 1.00 29.58  ? 18   ILE A CB  1 
ATOM   106 C  CG1 . ILE A 1 18 ? -6.471  59.076 55.912 1.00 33.15  ? 18   ILE A CG1 1 
ATOM   107 C  CG2 . ILE A 1 18 ? -4.416  57.851 54.997 1.00 27.81  ? 18   ILE A CG2 1 
ATOM   108 C  CD1 . ILE A 1 18 ? -6.231  60.480 55.340 1.00 40.47  ? 18   ILE A CD1 1 
ATOM   109 N  N   . PHE A 1 19 ? -3.052  57.032 58.071 1.00 26.52  ? 19   PHE A N   1 
ATOM   110 C  CA  . PHE A 1 19 ? -1.867  56.184 58.265 1.00 26.92  ? 19   PHE A CA  1 
ATOM   111 C  C   . PHE A 1 19 ? -2.217  54.924 59.038 1.00 26.32  ? 19   PHE A C   1 
ATOM   112 O  O   . PHE A 1 19 ? -1.872  53.801 58.659 1.00 26.68  ? 19   PHE A O   1 
ATOM   113 C  CB  . PHE A 1 19 ? -0.792  56.918 59.018 1.00 22.40  ? 19   PHE A CB  1 
ATOM   114 C  CG  . PHE A 1 19 ? 0.404   56.086 59.314 1.00 23.86  ? 19   PHE A CG  1 
ATOM   115 C  CD1 . PHE A 1 19 ? 1.376   55.912 58.331 1.00 19.13  ? 19   PHE A CD1 1 
ATOM   116 C  CD2 . PHE A 1 19 ? 0.576   55.468 60.570 1.00 19.25  ? 19   PHE A CD2 1 
ATOM   117 C  CE1 . PHE A 1 19 ? 2.494   55.156 58.546 1.00 22.94  ? 19   PHE A CE1 1 
ATOM   118 C  CE2 . PHE A 1 19 ? 1.695   54.712 60.795 1.00 24.39  ? 19   PHE A CE2 1 
ATOM   119 C  CZ  . PHE A 1 19 ? 2.670   54.537 59.806 1.00 24.88  ? 19   PHE A CZ  1 
ATOM   120 N  N   . GLN A 1 20 ? -2.931  55.085 60.120 1.00 27.77  ? 20   GLN A N   1 
ATOM   121 C  CA  . GLN A 1 20 ? -3.287  54.002 61.028 1.00 30.88  ? 20   GLN A CA  1 
ATOM   122 C  C   . GLN A 1 20 ? -4.173  52.946 60.439 1.00 30.44  ? 20   GLN A C   1 
ATOM   123 O  O   . GLN A 1 20 ? -3.978  51.721 60.588 1.00 27.83  ? 20   GLN A O   1 
ATOM   124 C  CB  . GLN A 1 20 ? -3.817  54.621 62.348 1.00 33.65  ? 20   GLN A CB  1 
ATOM   125 C  CG  A GLN A 1 20 ? -2.904  54.222 63.514 0.50 39.31  ? 20   GLN A CG  1 
ATOM   126 C  CG  B GLN A 1 20 ? -2.903  54.371 63.519 0.50 44.21  ? 20   GLN A CG  1 
ATOM   127 C  CD  A GLN A 1 20 ? -1.490  54.701 63.561 0.50 37.74  ? 20   GLN A CD  1 
ATOM   128 C  CD  B GLN A 1 20 ? -3.176  53.179 64.401 0.50 46.21  ? 20   GLN A CD  1 
ATOM   129 O  OE1 A GLN A 1 20 ? -1.162  55.855 63.223 0.50 41.47  ? 20   GLN A OE1 1 
ATOM   130 O  OE1 B GLN A 1 20 ? -4.311  52.766 64.696 0.50 49.25  ? 20   GLN A OE1 1 
ATOM   131 N  NE2 A GLN A 1 20 ? -0.538  53.893 63.986 0.50 31.64  ? 20   GLN A NE2 1 
ATOM   132 N  NE2 B GLN A 1 20 ? -2.078  52.591 64.867 0.50 46.73  ? 20   GLN A NE2 1 
ATOM   133 N  N   . LYS A 1 21 ? -5.129  53.364 59.633 1.00 30.73  ? 21   LYS A N   1 
ATOM   134 C  CA  . LYS A 1 21 ? -5.975  52.445 58.904 1.00 33.88  ? 21   LYS A CA  1 
ATOM   135 C  C   . LYS A 1 21 ? -5.144  51.607 57.903 1.00 34.18  ? 21   LYS A C   1 
ATOM   136 O  O   . LYS A 1 21 ? -5.370  50.387 57.784 1.00 35.90  ? 21   LYS A O   1 
ATOM   137 C  CB  . LYS A 1 21 ? -6.965  53.215 58.026 1.00 39.21  ? 21   LYS A CB  1 
ATOM   138 C  CG  . LYS A 1 21 ? -7.875  52.232 57.264 1.00 45.38  ? 21   LYS A CG  1 
ATOM   139 C  CD  . LYS A 1 21 ? -8.856  53.059 56.455 1.00 54.66  ? 21   LYS A CD  1 
ATOM   140 C  CE  . LYS A 1 21 ? -9.493  52.295 55.296 1.00 59.62  ? 21   LYS A CE  1 
ATOM   141 N  NZ  . LYS A 1 21 ? -10.103 53.282 54.329 1.00 64.21  ? 21   LYS A NZ  1 
ATOM   142 N  N   . HIS A 1 22 ? -4.232  52.259 57.190 1.00 30.33  ? 22   HIS A N   1 
ATOM   143 C  CA  . HIS A 1 22 ? -3.440  51.499 56.212 1.00 29.10  ? 22   HIS A CA  1 
ATOM   144 C  C   . HIS A 1 22 ? -2.303  50.758 56.865 1.00 28.72  ? 22   HIS A C   1 
ATOM   145 O  O   . HIS A 1 22 ? -1.908  49.677 56.422 1.00 28.07  ? 22   HIS A O   1 
ATOM   146 C  CB  . HIS A 1 22 ? -2.909  52.411 55.081 1.00 29.74  ? 22   HIS A CB  1 
ATOM   147 C  CG  . HIS A 1 22 ? -4.130  52.780 54.242 1.00 30.72  ? 22   HIS A CG  1 
ATOM   148 N  ND1 . HIS A 1 22 ? -4.893  53.914 54.537 1.00 28.92  ? 22   HIS A ND1 1 
ATOM   149 C  CD2 . HIS A 1 22 ? -4.697  52.172 53.186 1.00 26.73  ? 22   HIS A CD2 1 
ATOM   150 C  CE1 . HIS A 1 22 ? -5.893  53.992 53.678 1.00 28.57  ? 22   HIS A CE1 1 
ATOM   151 N  NE2 . HIS A 1 22 ? -5.787  52.954 52.846 1.00 29.35  ? 22   HIS A NE2 1 
ATOM   152 N  N   . ALA A 1 23 ? -1.777  51.330 57.988 1.00 26.35  ? 23   ALA A N   1 
ATOM   153 C  CA  . ALA A 1 23 ? -0.694  50.591 58.628 1.00 25.93  ? 23   ALA A CA  1 
ATOM   154 C  C   . ALA A 1 23 ? -1.281  49.458 59.443 1.00 26.59  ? 23   ALA A C   1 
ATOM   155 O  O   . ALA A 1 23 ? -0.526  48.540 59.727 1.00 23.94  ? 23   ALA A O   1 
ATOM   156 C  CB  . ALA A 1 23 ? 0.112   51.445 59.601 1.00 29.17  ? 23   ALA A CB  1 
ATOM   157 N  N   . GLY A 1 24 ? -2.509  49.407 59.875 1.00 30.46  ? 24   GLY A N   1 
ATOM   158 C  CA  . GLY A 1 24 ? -2.988  48.326 60.709 1.00 29.51  ? 24   GLY A CA  1 
ATOM   159 C  C   . GLY A 1 24 ? -3.557  47.143 60.012 1.00 33.87  ? 24   GLY A C   1 
ATOM   160 O  O   . GLY A 1 24 ? -4.287  46.431 60.690 1.00 35.15  ? 24   GLY A O   1 
ATOM   161 N  N   . ARG A 1 25 ? -3.182  46.807 58.760 1.00 34.05  ? 25   ARG A N   1 
ATOM   162 C  CA  . ARG A 1 25 ? -3.746  45.623 58.159 1.00 32.82  ? 25   ARG A CA  1 
ATOM   163 C  C   . ARG A 1 25 ? -2.938  44.404 58.633 1.00 32.79  ? 25   ARG A C   1 
ATOM   164 O  O   . ARG A 1 25 ? -3.525  43.338 58.718 1.00 35.24  ? 25   ARG A O   1 
ATOM   165 C  CB  . ARG A 1 25 ? -3.648  45.593 56.622 1.00 41.33  ? 25   ARG A CB  1 
ATOM   166 C  CG  . ARG A 1 25 ? -4.055  46.770 55.825 1.00 47.86  ? 25   ARG A CG  1 
ATOM   167 C  CD  . ARG A 1 25 ? -5.469  47.272 56.127 1.00 56.58  ? 25   ARG A CD  1 
ATOM   168 N  NE  . ARG A 1 25 ? -5.763  48.327 55.124 1.00 65.84  ? 25   ARG A NE  1 
ATOM   169 C  CZ  . ARG A 1 25 ? -6.495  48.191 54.033 1.00 65.22  ? 25   ARG A CZ  1 
ATOM   170 N  NH1 . ARG A 1 25 ? -7.089  47.052 53.698 1.00 64.62  ? 25   ARG A NH1 1 
ATOM   171 N  NH2 . ARG A 1 25 ? -6.633  49.245 53.249 1.00 67.95  ? 25   ARG A NH2 1 
ATOM   172 N  N   . ASP A 1 26 ? -1.631  44.517 58.821 1.00 28.27  ? 26   ASP A N   1 
ATOM   173 C  CA  . ASP A 1 26 ? -0.914  43.335 59.267 1.00 27.83  ? 26   ASP A CA  1 
ATOM   174 C  C   . ASP A 1 26 ? -0.724  43.469 60.811 1.00 31.94  ? 26   ASP A C   1 
ATOM   175 O  O   . ASP A 1 26 ? -1.459  44.235 61.460 1.00 30.54  ? 26   ASP A O   1 
ATOM   176 C  CB  . ASP A 1 26 ? 0.357   43.115 58.494 1.00 21.98  ? 26   ASP A CB  1 
ATOM   177 C  CG  . ASP A 1 26 ? 1.382   44.192 58.634 1.00 27.73  ? 26   ASP A CG  1 
ATOM   178 O  OD1 . ASP A 1 26 ? 1.076   45.055 59.508 1.00 26.54  ? 26   ASP A OD1 1 
ATOM   179 O  OD2 . ASP A 1 26 ? 2.473   44.352 58.062 1.00 28.31  ? 26   ASP A OD2 1 
ATOM   180 N  N   . GLY A 1 27 ? 0.243   42.764 61.417 1.00 30.42  ? 27   GLY A N   1 
ATOM   181 C  CA  . GLY A 1 27 ? 0.384   42.861 62.875 1.00 31.31  ? 27   GLY A CA  1 
ATOM   182 C  C   . GLY A 1 27 ? 1.186   44.002 63.426 1.00 31.81  ? 27   GLY A C   1 
ATOM   183 O  O   . GLY A 1 27 ? 1.490   44.029 64.619 1.00 32.68  ? 27   GLY A O   1 
ATOM   184 N  N   . ASN A 1 28 ? 1.638   44.921 62.554 1.00 27.74  ? 28   ASN A N   1 
ATOM   185 C  CA  . ASN A 1 28 ? 2.415   46.046 63.021 1.00 28.75  ? 28   ASN A CA  1 
ATOM   186 C  C   . ASN A 1 28 ? 1.726   47.334 62.724 1.00 29.12  ? 28   ASN A C   1 
ATOM   187 O  O   . ASN A 1 28 ? 1.993   47.892 61.682 1.00 24.55  ? 28   ASN A O   1 
ATOM   188 C  CB  . ASN A 1 28 ? 3.818   45.987 62.420 1.00 25.78  ? 28   ASN A CB  1 
ATOM   189 C  CG  . ASN A 1 28 ? 4.735   47.067 62.889 1.00 23.17  ? 28   ASN A CG  1 
ATOM   190 O  OD1 . ASN A 1 28 ? 4.373   47.991 63.625 1.00 25.39  ? 28   ASN A OD1 1 
ATOM   191 N  ND2 . ASN A 1 28 ? 5.991   46.959 62.476 1.00 25.44  ? 28   ASN A ND2 1 
ATOM   192 N  N   . ASN A 1 29 ? 0.927   48.001 63.540 1.00 30.82  ? 29   ASN A N   1 
ATOM   193 C  CA  . ASN A 1 29 ? 0.332   49.261 63.047 1.00 22.72  ? 29   ASN A CA  1 
ATOM   194 C  C   . ASN A 1 29 ? 1.187   50.443 63.156 1.00 23.04  ? 29   ASN A C   1 
ATOM   195 O  O   . ASN A 1 29 ? 0.623   51.565 63.105 1.00 23.98  ? 29   ASN A O   1 
ATOM   196 C  CB  . ASN A 1 29 ? -0.991  49.482 63.778 1.00 27.40  ? 29   ASN A CB  1 
ATOM   197 C  CG  . ASN A 1 29 ? -0.709  49.626 65.299 1.00 33.91  ? 29   ASN A CG  1 
ATOM   198 O  OD1 . ASN A 1 29 ? -1.713  49.635 66.018 1.00 42.19  ? 29   ASN A OD1 1 
ATOM   199 N  ND2 . ASN A 1 29 ? 0.485   49.697 65.792 1.00 23.58  ? 29   ASN A ND2 1 
ATOM   200 N  N   . THR A 1 30 ? 2.502   50.365 63.271 1.00 20.36  ? 30   THR A N   1 
ATOM   201 C  CA  . THR A 1 30 ? 3.283   51.580 63.316 1.00 22.62  ? 30   THR A CA  1 
ATOM   202 C  C   . THR A 1 30 ? 4.102   51.666 62.038 1.00 24.45  ? 30   THR A C   1 
ATOM   203 O  O   . THR A 1 30 ? 4.871   52.617 61.840 1.00 24.46  ? 30   THR A O   1 
ATOM   204 C  CB  . THR A 1 30 ? 4.287   51.600 64.531 1.00 27.65  ? 30   THR A CB  1 
ATOM   205 O  OG1 . THR A 1 30 ? 5.264   50.593 64.255 1.00 26.26  ? 30   THR A OG1 1 
ATOM   206 C  CG2 . THR A 1 30 ? 3.576   51.265 65.847 1.00 22.48  ? 30   THR A CG2 1 
ATOM   207 N  N   . LYS A 1 31 ? 3.898   50.680 61.137 1.00 22.82  ? 31   LYS A N   1 
ATOM   208 C  CA  . LYS A 1 31 ? 4.730   50.742 59.894 1.00 24.63  ? 31   LYS A CA  1 
ATOM   209 C  C   . LYS A 1 31 ? 3.923   50.451 58.651 1.00 24.92  ? 31   LYS A C   1 
ATOM   210 O  O   . LYS A 1 31 ? 2.983   49.640 58.747 1.00 20.50  ? 31   LYS A O   1 
ATOM   211 C  CB  . LYS A 1 31 ? 5.879   49.694 60.057 1.00 21.85  ? 31   LYS A CB  1 
ATOM   212 C  CG  . LYS A 1 31 ? 7.124   50.503 60.559 1.00 27.65  ? 31   LYS A CG  1 
ATOM   213 C  CD  . LYS A 1 31 ? 8.284   49.547 60.677 1.00 41.87  ? 31   LYS A CD  1 
ATOM   214 C  CE  . LYS A 1 31 ? 9.439   50.212 61.481 1.00 42.25  ? 31   LYS A CE  1 
ATOM   215 N  NZ  . LYS A 1 31 ? 8.951   51.529 61.956 1.00 46.88  ? 31   LYS A NZ  1 
ATOM   216 N  N   . ILE A 1 32 ? 4.050   51.120 57.511 1.00 24.37  ? 32   ILE A N   1 
ATOM   217 C  CA  . ILE A 1 32 ? 3.207   50.664 56.366 1.00 19.83  ? 32   ILE A CA  1 
ATOM   218 C  C   . ILE A 1 32 ? 4.067   49.713 55.602 1.00 19.93  ? 32   ILE A C   1 
ATOM   219 O  O   . ILE A 1 32 ? 5.216   50.111 55.197 1.00 18.53  ? 32   ILE A O   1 
ATOM   220 C  CB  . ILE A 1 32 ? 2.791   51.918 55.553 1.00 27.33  ? 32   ILE A CB  1 
ATOM   221 C  CG1 . ILE A 1 32 ? 1.517   52.492 56.181 1.00 20.93  ? 32   ILE A CG1 1 
ATOM   222 C  CG2 . ILE A 1 32 ? 2.438   51.527 54.083 1.00 21.66  ? 32   ILE A CG2 1 
ATOM   223 C  CD1 . ILE A 1 32 ? 1.050   53.803 55.576 1.00 29.25  ? 32   ILE A CD1 1 
ATOM   224 N  N   . SER A 1 33 ? 3.708   48.412 55.451 1.00 17.57  ? 33   SER A N   1 
ATOM   225 C  CA  . SER A 1 33 ? 4.677   47.625 54.620 1.00 21.85  ? 33   SER A CA  1 
ATOM   226 C  C   . SER A 1 33 ? 4.458   47.910 53.085 1.00 23.10  ? 33   SER A C   1 
ATOM   227 O  O   . SER A 1 33 ? 3.577   48.691 52.671 1.00 21.72  ? 33   SER A O   1 
ATOM   228 C  CB  . SER A 1 33 ? 4.325   46.140 54.839 1.00 23.26  ? 33   SER A CB  1 
ATOM   229 O  OG  . SER A 1 33 ? 3.025   45.934 54.257 1.00 25.41  ? 33   SER A OG  1 
ATOM   230 N  N   . LYS A 1 34 ? 5.228   47.288 52.226 1.00 24.52  ? 34   LYS A N   1 
ATOM   231 C  CA  . LYS A 1 34 ? 5.151   47.402 50.765 1.00 27.50  ? 34   LYS A CA  1 
ATOM   232 C  C   . LYS A 1 34 ? 3.759   47.011 50.275 1.00 25.23  ? 34   LYS A C   1 
ATOM   233 O  O   . LYS A 1 34 ? 3.103   47.756 49.586 1.00 25.45  ? 34   LYS A O   1 
ATOM   234 C  CB  . LYS A 1 34 ? 6.146   46.448 50.114 1.00 33.95  ? 34   LYS A CB  1 
ATOM   235 C  CG  . LYS A 1 34 ? 5.943   46.344 48.600 1.00 48.43  ? 34   LYS A CG  1 
ATOM   236 C  CD  . LYS A 1 34 ? 7.013   47.152 47.861 1.00 54.85  ? 34   LYS A CD  1 
ATOM   237 C  CE  . LYS A 1 34 ? 7.962   46.178 47.147 1.00 61.87  ? 34   LYS A CE  1 
ATOM   238 N  NZ  . LYS A 1 34 ? 8.919   46.917 46.257 1.00 63.82  ? 34   LYS A NZ  1 
ATOM   239 N  N   . THR A 1 35 ? 3.204   45.917 50.835 1.00 22.36  ? 35   THR A N   1 
ATOM   240 C  CA  . THR A 1 35 ? 1.871   45.534 50.453 1.00 25.38  ? 35   THR A CA  1 
ATOM   241 C  C   . THR A 1 35 ? 0.818   46.564 50.808 1.00 26.95  ? 35   THR A C   1 
ATOM   242 O  O   . THR A 1 35 ? -0.142  46.923 50.063 1.00 29.18  ? 35   THR A O   1 
ATOM   243 C  CB  . THR A 1 35 ? 1.525   44.146 51.074 1.00 25.94  ? 35   THR A CB  1 
ATOM   244 O  OG1 . THR A 1 35 ? 2.408   43.207 50.499 1.00 28.83  ? 35   THR A OG1 1 
ATOM   245 C  CG2 . THR A 1 35 ? 0.117   43.704 50.698 1.00 27.92  ? 35   THR A CG2 1 
ATOM   246 N  N   . GLU A 1 36 ? 0.927   47.103 52.003 1.00 22.89  ? 36   GLU A N   1 
ATOM   247 C  CA  . GLU A 1 36 ? 0.013   48.101 52.470 1.00 23.23  ? 36   GLU A CA  1 
ATOM   248 C  C   . GLU A 1 36 ? 0.218   49.413 51.720 1.00 17.98  ? 36   GLU A C   1 
ATOM   249 O  O   . GLU A 1 36 ? -0.771  50.105 51.627 1.00 19.76  ? 36   GLU A O   1 
ATOM   250 C  CB  . GLU A 1 36 ? 0.274   48.446 53.984 1.00 18.80  ? 36   GLU A CB  1 
ATOM   251 C  CG  . GLU A 1 36 ? -0.310  47.335 54.832 1.00 23.83  ? 36   GLU A CG  1 
ATOM   252 C  CD  . GLU A 1 36 ? 0.311   47.317 56.254 1.00 24.47  ? 36   GLU A CD  1 
ATOM   253 O  OE1 . GLU A 1 36 ? 1.373   47.929 56.472 1.00 20.68  ? 36   GLU A OE1 1 
ATOM   254 O  OE2 . GLU A 1 36 ? -0.258  46.663 57.124 1.00 22.56  ? 36   GLU A OE2 1 
ATOM   255 N  N   . PHE A 1 37 ? 1.422   49.702 51.309 1.00 16.51  ? 37   PHE A N   1 
ATOM   256 C  CA  . PHE A 1 37 ? 1.649   50.957 50.571 1.00 21.87  ? 37   PHE A CA  1 
ATOM   257 C  C   . PHE A 1 37 ? 0.955   50.780 49.155 1.00 25.57  ? 37   PHE A C   1 
ATOM   258 O  O   . PHE A 1 37 ? 0.281   51.679 48.686 1.00 24.51  ? 37   PHE A O   1 
ATOM   259 C  CB  . PHE A 1 37 ? 3.169   51.056 50.424 1.00 23.02  ? 37   PHE A CB  1 
ATOM   260 C  CG  . PHE A 1 37 ? 3.658   52.127 49.498 1.00 26.91  ? 37   PHE A CG  1 
ATOM   261 C  CD1 . PHE A 1 37 ? 3.425   53.458 49.797 1.00 27.75  ? 37   PHE A CD1 1 
ATOM   262 C  CD2 . PHE A 1 37 ? 4.282   51.800 48.295 1.00 30.43  ? 37   PHE A CD2 1 
ATOM   263 C  CE1 . PHE A 1 37 ? 3.826   54.491 48.975 1.00 26.69  ? 37   PHE A CE1 1 
ATOM   264 C  CE2 . PHE A 1 37 ? 4.709   52.847 47.451 1.00 30.26  ? 37   PHE A CE2 1 
ATOM   265 C  CZ  . PHE A 1 37 ? 4.486   54.161 47.786 1.00 28.97  ? 37   PHE A CZ  1 
ATOM   266 N  N   . LEU A 1 38 ? 1.085   49.593 48.584 1.00 26.47  ? 38   LEU A N   1 
ATOM   267 C  CA  . LEU A 1 38 ? 0.464   49.205 47.306 1.00 30.30  ? 38   LEU A CA  1 
ATOM   268 C  C   . LEU A 1 38 ? -1.034  49.448 47.371 1.00 27.54  ? 38   LEU A C   1 
ATOM   269 O  O   . LEU A 1 38 ? -1.627  50.082 46.504 1.00 29.03  ? 38   LEU A O   1 
ATOM   270 C  CB  . LEU A 1 38 ? 0.727   47.723 47.033 1.00 33.90  ? 38   LEU A CB  1 
ATOM   271 C  CG  . LEU A 1 38 ? 1.538   47.416 45.785 1.00 51.78  ? 38   LEU A CG  1 
ATOM   272 C  CD1 . LEU A 1 38 ? 2.569   46.320 45.942 1.00 46.74  ? 38   LEU A CD1 1 
ATOM   273 C  CD2 . LEU A 1 38 ? 0.500   47.092 44.672 1.00 51.16  ? 38   LEU A CD2 1 
ATOM   274 N  N   . ILE A 1 39 ? -1.661  49.018 48.463 1.00 26.46  ? 39   ILE A N   1 
ATOM   275 C  CA  . ILE A 1 39 ? -3.091  49.210 48.639 1.00 25.80  ? 39   ILE A CA  1 
ATOM   276 C  C   . ILE A 1 39 ? -3.456  50.655 48.865 1.00 27.31  ? 39   ILE A C   1 
ATOM   277 O  O   . ILE A 1 39 ? -4.464  51.129 48.327 1.00 28.28  ? 39   ILE A O   1 
ATOM   278 C  CB  . ILE A 1 39 ? -3.589  48.389 49.853 1.00 25.14  ? 39   ILE A CB  1 
ATOM   279 C  CG1 . ILE A 1 39 ? -3.193  46.931 49.665 1.00 30.15  ? 39   ILE A CG1 1 
ATOM   280 C  CG2 . ILE A 1 39 ? -5.075  48.665 50.044 1.00 28.47  ? 39   ILE A CG2 1 
ATOM   281 C  CD1 . ILE A 1 39 ? -3.651  45.977 50.766 1.00 26.64  ? 39   ILE A CD1 1 
ATOM   282 N  N   . PHE A 1 40 ? -2.645  51.362 49.686 1.00 26.01  ? 40   PHE A N   1 
ATOM   283 C  CA  . PHE A 1 40 ? -2.928  52.764 49.950 1.00 25.44  ? 40   PHE A CA  1 
ATOM   284 C  C   . PHE A 1 40 ? -2.873  53.559 48.590 1.00 26.28  ? 40   PHE A C   1 
ATOM   285 O  O   . PHE A 1 40 ? -3.773  54.299 48.322 1.00 24.92  ? 40   PHE A O   1 
ATOM   286 C  CB  . PHE A 1 40 ? -1.813  53.340 50.850 1.00 20.20  ? 40   PHE A CB  1 
ATOM   287 C  CG  . PHE A 1 40 ? -1.818  54.844 50.940 1.00 19.21  ? 40   PHE A CG  1 
ATOM   288 C  CD1 . PHE A 1 40 ? -2.802  55.507 51.627 1.00 20.57  ? 40   PHE A CD1 1 
ATOM   289 C  CD2 . PHE A 1 40 ? -0.794  55.545 50.351 1.00 20.61  ? 40   PHE A CD2 1 
ATOM   290 C  CE1 . PHE A 1 40 ? -2.798  56.893 51.690 1.00 22.38  ? 40   PHE A CE1 1 
ATOM   291 C  CE2 . PHE A 1 40 ? -0.780  56.919 50.436 1.00 22.98  ? 40   PHE A CE2 1 
ATOM   292 C  CZ  . PHE A 1 40 ? -1.769  57.600 51.085 1.00 18.47  ? 40   PHE A CZ  1 
ATOM   293 N  N   . MET A 1 41 ? -1.817  53.388 47.835 1.00 24.92  ? 41   MET A N   1 
ATOM   294 C  CA  . MET A 1 41 ? -1.560  54.020 46.573 1.00 30.61  ? 41   MET A CA  1 
ATOM   295 C  C   . MET A 1 41 ? -2.668  53.652 45.554 1.00 33.52  ? 41   MET A C   1 
ATOM   296 O  O   . MET A 1 41 ? -3.163  54.541 44.868 1.00 34.44  ? 41   MET A O   1 
ATOM   297 C  CB  . MET A 1 41 ? -0.202  53.625 46.009 1.00 26.27  ? 41   MET A CB  1 
ATOM   298 C  CG  . MET A 1 41 ? 1.018   54.215 46.725 1.00 31.05  ? 41   MET A CG  1 
ATOM   299 S  SD  . MET A 1 41 ? 0.808   56.012 46.954 1.00 34.74  ? 41   MET A SD  1 
ATOM   300 C  CE  . MET A 1 41 ? 1.384   56.531 45.289 1.00 34.24  ? 41   MET A CE  1 
ATOM   301 N  N   . ASN A 1 42 ? -3.198  52.436 45.578 1.00 33.31  ? 42   ASN A N   1 
ATOM   302 C  CA  . ASN A 1 42 ? -4.277  52.140 44.626 1.00 36.74  ? 42   ASN A CA  1 
ATOM   303 C  C   . ASN A 1 42 ? -5.642  52.491 45.148 1.00 38.00  ? 42   ASN A C   1 
ATOM   304 O  O   . ASN A 1 42 ? -6.635  52.130 44.507 1.00 39.22  ? 42   ASN A O   1 
ATOM   305 C  CB  . ASN A 1 42 ? -4.247  50.639 44.293 1.00 33.34  ? 42   ASN A CB  1 
ATOM   306 C  CG  . ASN A 1 42 ? -3.112  50.376 43.334 1.00 37.58  ? 42   ASN A CG  1 
ATOM   307 O  OD1 . ASN A 1 42 ? -3.380  50.581 42.159 1.00 41.84  ? 42   ASN A OD1 1 
ATOM   308 N  ND2 . ASN A 1 42 ? -1.912  49.959 43.737 1.00 36.07  ? 42   ASN A ND2 1 
ATOM   309 N  N   . THR A 1 43 ? -5.793  53.100 46.324 1.00 36.80  ? 43   THR A N   1 
ATOM   310 C  CA  . THR A 1 43 ? -7.122  53.397 46.790 1.00 39.07  ? 43   THR A CA  1 
ATOM   311 C  C   . THR A 1 43 ? -7.227  54.846 47.283 1.00 41.52  ? 43   THR A C   1 
ATOM   312 O  O   . THR A 1 43 ? -8.304  55.404 47.082 1.00 46.84  ? 43   THR A O   1 
ATOM   313 C  CB  . THR A 1 43 ? -7.566  52.484 47.951 1.00 42.41  ? 43   THR A CB  1 
ATOM   314 O  OG1 . THR A 1 43 ? -6.537  52.555 48.929 1.00 42.90  ? 43   THR A OG1 1 
ATOM   315 C  CG2 . THR A 1 43 ? -7.790  51.034 47.561 1.00 44.82  ? 43   THR A CG2 1 
ATOM   316 N  N   . GLU A 1 44 ? -6.243  55.431 47.956 1.00 38.25  ? 44   GLU A N   1 
ATOM   317 C  CA  . GLU A 1 44 ? -6.367  56.796 48.453 1.00 36.67  ? 44   GLU A CA  1 
ATOM   318 C  C   . GLU A 1 44 ? -5.799  57.704 47.338 1.00 34.05  ? 44   GLU A C   1 
ATOM   319 O  O   . GLU A 1 44 ? -6.282  58.800 47.182 1.00 34.37  ? 44   GLU A O   1 
ATOM   320 C  CB  . GLU A 1 44 ? -5.521  57.052 49.736 1.00 33.96  ? 44   GLU A CB  1 
ATOM   321 C  CG  . GLU A 1 44 ? -6.241  56.473 50.991 1.00 31.83  ? 44   GLU A CG  1 
ATOM   322 C  CD  . GLU A 1 44 ? -7.518  57.225 51.234 1.00 35.85  ? 44   GLU A CD  1 
ATOM   323 O  OE1 . GLU A 1 44 ? -7.509  58.464 51.244 1.00 36.27  ? 44   GLU A OE1 1 
ATOM   324 O  OE2 . GLU A 1 44 ? -8.604  56.648 51.428 1.00 39.75  ? 44   GLU A OE2 1 
ATOM   325 N  N   . LEU A 1 45 ? -4.773  57.197 46.666 1.00 28.20  ? 45   LEU A N   1 
ATOM   326 C  CA  . LEU A 1 45 ? -4.154  57.919 45.612 1.00 31.37  ? 45   LEU A CA  1 
ATOM   327 C  C   . LEU A 1 45 ? -4.358  57.268 44.232 1.00 33.02  ? 45   LEU A C   1 
ATOM   328 O  O   . LEU A 1 45 ? -3.460  57.298 43.411 1.00 29.99  ? 45   LEU A O   1 
ATOM   329 C  CB  . LEU A 1 45 ? -2.670  58.121 45.927 1.00 31.46  ? 45   LEU A CB  1 
ATOM   330 C  CG  . LEU A 1 45 ? -2.421  59.077 47.149 1.00 35.61  ? 45   LEU A CG  1 
ATOM   331 C  CD1 . LEU A 1 45 ? -0.941  59.263 47.389 1.00 33.56  ? 45   LEU A CD1 1 
ATOM   332 C  CD2 . LEU A 1 45 ? -3.129  60.405 46.888 1.00 37.22  ? 45   LEU A CD2 1 
ATOM   333 N  N   . ALA A 1 46 ? -5.467  56.577 44.029 1.00 35.80  ? 46   ALA A N   1 
ATOM   334 C  CA  . ALA A 1 46 ? -5.792  55.875 42.784 1.00 42.48  ? 46   ALA A CA  1 
ATOM   335 C  C   . ALA A 1 46 ? -5.575  56.733 41.536 1.00 45.67  ? 46   ALA A C   1 
ATOM   336 O  O   . ALA A 1 46 ? -4.945  56.293 40.567 1.00 46.91  ? 46   ALA A O   1 
ATOM   337 C  CB  . ALA A 1 46 ? -7.263  55.400 42.826 1.00 37.62  ? 46   ALA A CB  1 
ATOM   338 N  N   . ALA A 1 47 ? -6.026  57.979 41.568 1.00 47.33  ? 47   ALA A N   1 
ATOM   339 C  CA  . ALA A 1 47 ? -5.938  58.922 40.485 1.00 50.83  ? 47   ALA A CA  1 
ATOM   340 C  C   . ALA A 1 47 ? -4.535  59.187 40.022 1.00 53.12  ? 47   ALA A C   1 
ATOM   341 O  O   . ALA A 1 47 ? -4.234  59.293 38.818 1.00 53.04  ? 47   ALA A O   1 
ATOM   342 C  CB  . ALA A 1 47 ? -6.730  60.176 40.822 1.00 53.68  ? 47   ALA A CB  1 
ATOM   343 N  N   . PHE A 1 48 ? -3.585  59.259 40.936 1.00 53.87  ? 48   PHE A N   1 
ATOM   344 C  CA  . PHE A 1 48 ? -2.193  59.475 40.529 1.00 54.07  ? 48   PHE A CA  1 
ATOM   345 C  C   . PHE A 1 48 ? -1.605  58.142 40.132 1.00 56.70  ? 48   PHE A C   1 
ATOM   346 O  O   . PHE A 1 48 ? -0.696  58.041 39.300 1.00 56.10  ? 48   PHE A O   1 
ATOM   347 C  CB  . PHE A 1 48 ? -1.463  60.063 41.736 1.00 57.60  ? 48   PHE A CB  1 
ATOM   348 C  CG  . PHE A 1 48 ? 0.001   59.797 41.830 1.00 60.61  ? 48   PHE A CG  1 
ATOM   349 C  CD1 . PHE A 1 48 ? 0.514   58.557 42.155 1.00 58.42  ? 48   PHE A CD1 1 
ATOM   350 C  CD2 . PHE A 1 48 ? 0.893   60.849 41.584 1.00 61.83  ? 48   PHE A CD2 1 
ATOM   351 C  CE1 . PHE A 1 48 ? 1.869   58.335 42.229 1.00 61.72  ? 48   PHE A CE1 1 
ATOM   352 C  CE2 . PHE A 1 48 ? 2.253   60.631 41.663 1.00 61.53  ? 48   PHE A CE2 1 
ATOM   353 C  CZ  . PHE A 1 48 ? 2.744   59.379 41.986 1.00 62.69  ? 48   PHE A CZ  1 
ATOM   354 N  N   . THR A 1 49 ? -2.074  57.079 40.800 1.00 58.39  ? 49   THR A N   1 
ATOM   355 C  CA  . THR A 1 49 ? -1.499  55.763 40.540 1.00 63.46  ? 49   THR A CA  1 
ATOM   356 C  C   . THR A 1 49 ? -1.903  55.172 39.196 1.00 67.39  ? 49   THR A C   1 
ATOM   357 O  O   . THR A 1 49 ? -1.056  54.686 38.446 1.00 65.32  ? 49   THR A O   1 
ATOM   358 C  CB  . THR A 1 49 ? -1.822  54.713 41.636 1.00 60.06  ? 49   THR A CB  1 
ATOM   359 O  OG1 . THR A 1 49 ? -1.429  55.182 42.927 1.00 59.49  ? 49   THR A OG1 1 
ATOM   360 C  CG2 . THR A 1 49 ? -1.068  53.429 41.339 1.00 54.82  ? 49   THR A CG2 1 
ATOM   361 N  N   . GLN A 1 50 ? -3.202  55.193 38.917 1.00 73.91  ? 50   GLN A N   1 
ATOM   362 C  CA  . GLN A 1 50 ? -3.740  54.654 37.682 1.00 80.95  ? 50   GLN A CA  1 
ATOM   363 C  C   . GLN A 1 50 ? -3.098  55.281 36.458 1.00 84.02  ? 50   GLN A C   1 
ATOM   364 O  O   . GLN A 1 50 ? -2.841  54.553 35.496 1.00 85.33  ? 50   GLN A O   1 
ATOM   365 C  CB  . GLN A 1 50 ? -5.258  54.831 37.599 1.00 85.89  ? 50   GLN A CB  1 
ATOM   366 C  CG  . GLN A 1 50 ? -6.003  53.926 38.572 1.00 92.72  ? 50   GLN A CG  1 
ATOM   367 C  CD  . GLN A 1 50 ? -7.502  54.105 38.509 1.00 96.32  ? 50   GLN A CD  1 
ATOM   368 O  OE1 . GLN A 1 50 ? -8.065  54.264 37.420 1.00 99.40  ? 50   GLN A OE1 1 
ATOM   369 N  NE2 . GLN A 1 50 ? -8.169  54.081 39.659 1.00 97.84  ? 50   GLN A NE2 1 
ATOM   370 N  N   . ASN A 1 51 ? -2.845  56.580 36.487 1.00 87.88  ? 51   ASN A N   1 
ATOM   371 C  CA  . ASN A 1 51 ? -2.170  57.203 35.327 1.00 92.16  ? 51   ASN A CA  1 
ATOM   372 C  C   . ASN A 1 51 ? -0.933  56.386 34.981 1.00 93.75  ? 51   ASN A C   1 
ATOM   373 O  O   . ASN A 1 51 ? -0.888  55.745 33.922 1.00 94.70  ? 51   ASN A O   1 
ATOM   374 C  CB  . ASN A 1 51 ? -1.930  58.658 35.616 1.00 95.59  ? 51   ASN A CB  1 
ATOM   375 C  CG  . ASN A 1 51 ? -0.542  59.186 35.408 1.00 97.94  ? 51   ASN A CG  1 
ATOM   376 O  OD1 . ASN A 1 51 ? -0.141  59.570 34.306 1.00 99.97  ? 51   ASN A OD1 1 
ATOM   377 N  ND2 . ASN A 1 51 ? 0.221   59.208 36.496 1.00 99.34  ? 51   ASN A ND2 1 
ATOM   378 N  N   . GLN A 1 52 ? 0.070   56.374 35.843 1.00 94.80  ? 52   GLN A N   1 
ATOM   379 C  CA  . GLN A 1 52 ? 1.300   55.606 35.608 1.00 95.87  ? 52   GLN A CA  1 
ATOM   380 C  C   . GLN A 1 52 ? 0.958   54.162 35.279 1.00 95.84  ? 52   GLN A C   1 
ATOM   381 O  O   . GLN A 1 52 ? 0.045   53.593 35.900 1.00 96.96  ? 52   GLN A O   1 
ATOM   382 C  CB  . GLN A 1 52 ? 2.184   55.802 36.854 1.00 96.09  ? 52   GLN A CB  1 
ATOM   383 C  CG  . GLN A 1 52 ? 2.709   57.228 36.924 1.00 98.87  ? 52   GLN A CG  1 
ATOM   384 C  CD  . GLN A 1 52 ? 2.602   57.939 38.238 1.00 100.68 ? 52   GLN A CD  1 
ATOM   385 O  OE1 . GLN A 1 52 ? 1.719   58.757 38.525 1.00 101.19 ? 52   GLN A OE1 1 
ATOM   386 N  NE2 . GLN A 1 52 ? 3.540   57.659 39.149 1.00 103.04 ? 52   GLN A NE2 1 
ATOM   387 N  N   . LYS A 1 53 ? 1.581   53.543 34.274 1.00 94.63  ? 53   LYS A N   1 
ATOM   388 C  CA  . LYS A 1 53 ? 1.267   52.174 33.867 1.00 92.61  ? 53   LYS A CA  1 
ATOM   389 C  C   . LYS A 1 53 ? 2.441   51.226 34.076 1.00 90.53  ? 53   LYS A C   1 
ATOM   390 O  O   . LYS A 1 53 ? 2.356   50.016 33.854 1.00 89.53  ? 53   LYS A O   1 
ATOM   391 C  CB  . LYS A 1 53 ? 0.855   52.111 32.394 1.00 95.86  ? 53   LYS A CB  1 
ATOM   392 C  CG  . LYS A 1 53 ? -0.322  51.213 32.065 1.00 96.73  ? 53   LYS A CG  1 
ATOM   393 C  CD  . LYS A 1 53 ? 0.078   49.772 31.832 1.00 97.43  ? 53   LYS A CD  1 
ATOM   394 C  CE  . LYS A 1 53 ? 1.140   49.612 30.765 1.00 98.19  ? 53   LYS A CE  1 
ATOM   395 N  NZ  . LYS A 1 53 ? 2.288   48.774 31.227 1.00 97.84  ? 53   LYS A NZ  1 
ATOM   396 N  N   . ASP A 1 54 ? 3.554   51.822 34.498 1.00 88.48  ? 54   ASP A N   1 
ATOM   397 C  CA  . ASP A 1 54 ? 4.764   51.032 34.772 1.00 85.60  ? 54   ASP A CA  1 
ATOM   398 C  C   . ASP A 1 54 ? 4.696   50.713 36.265 1.00 83.39  ? 54   ASP A C   1 
ATOM   399 O  O   . ASP A 1 54 ? 4.681   51.594 37.115 1.00 81.93  ? 54   ASP A O   1 
ATOM   400 C  CB  . ASP A 1 54 ? 6.002   51.800 34.371 1.00 87.44  ? 54   ASP A CB  1 
ATOM   401 C  CG  . ASP A 1 54 ? 7.287   51.326 35.010 1.00 89.26  ? 54   ASP A CG  1 
ATOM   402 O  OD1 . ASP A 1 54 ? 7.480   50.101 35.154 1.00 89.99  ? 54   ASP A OD1 1 
ATOM   403 O  OD2 . ASP A 1 54 ? 8.118   52.190 35.378 1.00 89.99  ? 54   ASP A OD2 1 
ATOM   404 N  N   . PRO A 1 55 ? 4.569   49.433 36.578 1.00 82.06  ? 55   PRO A N   1 
ATOM   405 C  CA  . PRO A 1 55 ? 4.441   48.957 37.943 1.00 79.63  ? 55   PRO A CA  1 
ATOM   406 C  C   . PRO A 1 55 ? 5.711   49.063 38.759 1.00 75.73  ? 55   PRO A C   1 
ATOM   407 O  O   . PRO A 1 55 ? 5.686   48.900 39.983 1.00 77.68  ? 55   PRO A O   1 
ATOM   408 C  CB  . PRO A 1 55 ? 4.054   47.484 37.779 1.00 81.79  ? 55   PRO A CB  1 
ATOM   409 C  CG  . PRO A 1 55 ? 4.572   47.081 36.440 1.00 81.92  ? 55   PRO A CG  1 
ATOM   410 C  CD  . PRO A 1 55 ? 4.532   48.323 35.588 1.00 82.45  ? 55   PRO A CD  1 
ATOM   411 N  N   . GLY A 1 56 ? 6.847   49.355 38.126 1.00 69.59  ? 56   GLY A N   1 
ATOM   412 C  CA  . GLY A 1 56 ? 8.101   49.522 38.835 1.00 62.00  ? 56   GLY A CA  1 
ATOM   413 C  C   . GLY A 1 56 ? 8.120   50.915 39.508 1.00 55.79  ? 56   GLY A C   1 
ATOM   414 O  O   . GLY A 1 56 ? 8.965   51.138 40.359 1.00 55.23  ? 56   GLY A O   1 
ATOM   415 N  N   . VAL A 1 57 ? 7.234   51.817 39.133 1.00 49.78  ? 57   VAL A N   1 
ATOM   416 C  CA  . VAL A 1 57 ? 7.187   53.136 39.707 1.00 47.45  ? 57   VAL A CA  1 
ATOM   417 C  C   . VAL A 1 57 ? 6.984   53.098 41.226 1.00 46.31  ? 57   VAL A C   1 
ATOM   418 O  O   . VAL A 1 57 ? 7.818   53.618 41.960 1.00 46.83  ? 57   VAL A O   1 
ATOM   419 C  CB  . VAL A 1 57 ? 6.163   54.040 39.026 1.00 45.81  ? 57   VAL A CB  1 
ATOM   420 C  CG1 . VAL A 1 57 ? 4.729   53.639 39.345 1.00 48.56  ? 57   VAL A CG1 1 
ATOM   421 C  CG2 . VAL A 1 57 ? 6.382   55.491 39.433 1.00 45.94  ? 57   VAL A CG2 1 
ATOM   422 N  N   . LEU A 1 58 ? 5.985   52.402 41.740 1.00 44.90  ? 58   LEU A N   1 
ATOM   423 C  CA  . LEU A 1 58 ? 5.744   52.278 43.163 1.00 45.57  ? 58   LEU A CA  1 
ATOM   424 C  C   . LEU A 1 58 ? 6.919   51.669 43.880 1.00 44.62  ? 58   LEU A C   1 
ATOM   425 O  O   . LEU A 1 58 ? 7.245   52.068 44.987 1.00 43.31  ? 58   LEU A O   1 
ATOM   426 C  CB  . LEU A 1 58 ? 4.442   51.542 43.479 1.00 41.28  ? 58   LEU A CB  1 
ATOM   427 C  CG  . LEU A 1 58 ? 3.233   52.170 42.801 1.00 43.49  ? 58   LEU A CG  1 
ATOM   428 C  CD1 . LEU A 1 58 ? 1.952   51.477 43.247 1.00 45.17  ? 58   LEU A CD1 1 
ATOM   429 C  CD2 . LEU A 1 58 ? 3.136   53.673 43.005 1.00 42.67  ? 58   LEU A CD2 1 
ATOM   430 N  N   . ASP A 1 59 ? 7.596   50.716 43.239 1.00 46.25  ? 59   ASP A N   1 
ATOM   431 C  CA  . ASP A 1 59 ? 8.745   50.115 43.904 1.00 47.75  ? 59   ASP A CA  1 
ATOM   432 C  C   . ASP A 1 59 ? 9.814   51.204 44.030 1.00 47.62  ? 59   ASP A C   1 
ATOM   433 O  O   . ASP A 1 59 ? 10.544  51.187 45.001 1.00 47.34  ? 59   ASP A O   1 
ATOM   434 C  CB  . ASP A 1 59 ? 9.375   48.959 43.191 1.00 53.48  ? 59   ASP A CB  1 
ATOM   435 C  CG  . ASP A 1 59 ? 8.433   47.803 42.922 1.00 59.40  ? 59   ASP A CG  1 
ATOM   436 O  OD1 . ASP A 1 59 ? 7.763   47.819 41.862 1.00 62.18  ? 59   ASP A OD1 1 
ATOM   437 O  OD2 . ASP A 1 59 ? 8.434   46.910 43.776 1.00 61.92  ? 59   ASP A OD2 1 
ATOM   438 N  N   . ARG A 1 60 ? 9.857   52.069 43.016 1.00 46.47  ? 60   ARG A N   1 
ATOM   439 C  CA  . ARG A 1 60 ? 10.887  53.117 43.077 1.00 47.74  ? 60   ARG A CA  1 
ATOM   440 C  C   . ARG A 1 60 ? 10.443  54.183 44.054 1.00 42.92  ? 60   ARG A C   1 
ATOM   441 O  O   . ARG A 1 60 ? 11.285  54.775 44.689 1.00 41.76  ? 60   ARG A O   1 
ATOM   442 C  CB  . ARG A 1 60 ? 11.189  53.720 41.681 1.00 52.51  ? 60   ARG A CB  1 
ATOM   443 C  CG  . ARG A 1 60 ? 12.104  52.788 40.878 1.00 58.62  ? 60   ARG A CG  1 
ATOM   444 C  CD  . ARG A 1 60 ? 12.667  53.377 39.588 1.00 60.54  ? 60   ARG A CD  1 
ATOM   445 N  NE  . ARG A 1 60 ? 11.671  53.598 38.577 1.00 62.49  ? 60   ARG A NE  1 
ATOM   446 C  CZ  . ARG A 1 60 ? 11.007  52.774 37.796 1.00 64.02  ? 60   ARG A CZ  1 
ATOM   447 N  NH1 . ARG A 1 60 ? 11.151  51.458 37.776 1.00 62.98  ? 60   ARG A NH1 1 
ATOM   448 N  NH2 . ARG A 1 60 ? 10.109  53.307 36.957 1.00 66.86  ? 60   ARG A NH2 1 
ATOM   449 N  N   . MET A 1 61 ? 9.149   54.442 44.190 1.00 41.31  ? 61   MET A N   1 
ATOM   450 C  CA  . MET A 1 61 ? 8.742   55.466 45.161 1.00 42.21  ? 61   MET A CA  1 
ATOM   451 C  C   . MET A 1 61 ? 9.032   54.958 46.606 1.00 38.99  ? 61   MET A C   1 
ATOM   452 O  O   . MET A 1 61 ? 9.567   55.656 47.451 1.00 37.88  ? 61   MET A O   1 
ATOM   453 C  CB  . MET A 1 61 ? 7.279   55.802 45.018 1.00 44.26  ? 61   MET A CB  1 
ATOM   454 C  CG  . MET A 1 61 ? 6.863   56.482 43.737 1.00 52.49  ? 61   MET A CG  1 
ATOM   455 S  SD  . MET A 1 61 ? 5.178   57.138 43.830 1.00 56.79  ? 61   MET A SD  1 
ATOM   456 C  CE  . MET A 1 61 ? 5.104   57.706 45.485 1.00 46.05  ? 61   MET A CE  1 
ATOM   457 N  N   . MET A 1 62 ? 8.734   53.706 46.826 1.00 37.61  ? 62   MET A N   1 
ATOM   458 C  CA  . MET A 1 62 ? 8.916   53.071 48.123 1.00 40.69  ? 62   MET A CA  1 
ATOM   459 C  C   . MET A 1 62 ? 10.361  53.182 48.571 1.00 40.52  ? 62   MET A C   1 
ATOM   460 O  O   . MET A 1 62 ? 10.610  53.625 49.706 1.00 38.96  ? 62   MET A O   1 
ATOM   461 C  CB  . MET A 1 62 ? 8.390   51.642 48.088 1.00 39.33  ? 62   MET A CB  1 
ATOM   462 C  CG  . MET A 1 62 ? 8.615   50.899 49.413 1.00 43.67  ? 62   MET A CG  1 
ATOM   463 S  SD  . MET A 1 62 ? 7.114   50.981 50.408 1.00 41.98  ? 62   MET A SD  1 
ATOM   464 C  CE  . MET A 1 62 ? 7.727   50.259 51.952 1.00 46.25  ? 62   MET A CE  1 
ATOM   465 N  N   . LYS A 1 63 ? 11.297  52.831 47.690 1.00 40.89  ? 63   LYS A N   1 
ATOM   466 C  CA  . LYS A 1 63 ? 12.697  52.896 48.021 1.00 44.53  ? 63   LYS A CA  1 
ATOM   467 C  C   . LYS A 1 63 ? 13.137  54.322 48.347 1.00 42.02  ? 63   LYS A C   1 
ATOM   468 O  O   . LYS A 1 63 ? 13.820  54.533 49.351 1.00 41.16  ? 63   LYS A O   1 
ATOM   469 C  CB  . LYS A 1 63 ? 13.624  52.268 46.980 1.00 51.54  ? 63   LYS A CB  1 
ATOM   470 C  CG  . LYS A 1 63 ? 13.798  50.761 47.203 1.00 59.80  ? 63   LYS A CG  1 
ATOM   471 C  CD  . LYS A 1 63 ? 14.247  50.397 48.604 1.00 63.08  ? 63   LYS A CD  1 
ATOM   472 C  CE  . LYS A 1 63 ? 13.048  50.030 49.518 1.00 64.76  ? 63   LYS A CE  1 
ATOM   473 N  NZ  . LYS A 1 63 ? 13.439  50.207 50.960 1.00 56.69  ? 63   LYS A NZ  1 
ATOM   474 N  N   . LYS A 1 64 ? 12.661  55.254 47.573 1.00 39.73  ? 64   LYS A N   1 
ATOM   475 C  CA  . LYS A 1 64 ? 12.937  56.650 47.774 1.00 41.99  ? 64   LYS A CA  1 
ATOM   476 C  C   . LYS A 1 64 ? 12.340  57.155 49.089 1.00 40.56  ? 64   LYS A C   1 
ATOM   477 O  O   . LYS A 1 64 ? 12.915  58.037 49.706 1.00 39.96  ? 64   LYS A O   1 
ATOM   478 C  CB  . LYS A 1 64 ? 12.413  57.475 46.588 1.00 48.64  ? 64   LYS A CB  1 
ATOM   479 C  CG  . LYS A 1 64 ? 12.768  58.956 46.677 1.00 57.90  ? 64   LYS A CG  1 
ATOM   480 C  CD  . LYS A 1 64 ? 13.647  59.412 45.519 1.00 65.74  ? 64   LYS A CD  1 
ATOM   481 C  CE  . LYS A 1 64 ? 14.647  60.476 45.977 1.00 71.92  ? 64   LYS A CE  1 
ATOM   482 N  NZ  . LYS A 1 64 ? 14.258  61.858 45.535 1.00 75.22  ? 64   LYS A NZ  1 
ATOM   483 N  N   . LEU A 1 65 ? 11.172  56.672 49.518 1.00 37.50  ? 65   LEU A N   1 
ATOM   484 C  CA  . LEU A 1 65 ? 10.580  57.183 50.741 1.00 35.63  ? 65   LEU A CA  1 
ATOM   485 C  C   . LEU A 1 65 ? 11.113  56.502 51.995 1.00 35.57  ? 65   LEU A C   1 
ATOM   486 O  O   . LEU A 1 65 ? 11.025  57.056 53.084 1.00 35.91  ? 65   LEU A O   1 
ATOM   487 C  CB  . LEU A 1 65 ? 9.062   56.945 50.710 1.00 33.11  ? 65   LEU A CB  1 
ATOM   488 C  CG  . LEU A 1 65 ? 8.340   57.783 49.635 1.00 32.63  ? 65   LEU A CG  1 
ATOM   489 C  CD1 . LEU A 1 65 ? 6.957   57.159 49.419 1.00 32.32  ? 65   LEU A CD1 1 
ATOM   490 C  CD2 . LEU A 1 65 ? 8.263   59.244 50.057 1.00 28.66  ? 65   LEU A CD2 1 
ATOM   491 N  N   . ASP A 1 66 ? 11.635  55.295 51.819 1.00 35.58  ? 66   ASP A N   1 
ATOM   492 C  CA  . ASP A 1 66 ? 12.132  54.480 52.904 1.00 36.18  ? 66   ASP A CA  1 
ATOM   493 C  C   . ASP A 1 66 ? 13.487  55.000 53.347 1.00 37.67  ? 66   ASP A C   1 
ATOM   494 O  O   . ASP A 1 66 ? 14.494  54.350 53.089 1.00 39.25  ? 66   ASP A O   1 
ATOM   495 C  CB  . ASP A 1 66 ? 12.143  53.011 52.459 1.00 34.64  ? 66   ASP A CB  1 
ATOM   496 C  CG  . ASP A 1 66 ? 12.609  52.049 53.485 1.00 36.17  ? 66   ASP A CG  1 
ATOM   497 O  OD1 . ASP A 1 66 ? 12.783  52.565 54.598 1.00 35.71  ? 66   ASP A OD1 1 
ATOM   498 O  OD2 . ASP A 1 66 ? 12.880  50.834 53.438 1.00 38.83  ? 66   ASP A OD2 1 
ATOM   499 N  N   . LEU A 1 67 ? 13.526  56.144 54.028 1.00 37.62  ? 67   LEU A N   1 
ATOM   500 C  CA  . LEU A 1 67 ? 14.790  56.688 54.436 1.00 41.37  ? 67   LEU A CA  1 
ATOM   501 C  C   . LEU A 1 67 ? 15.627  55.840 55.353 1.00 41.38  ? 67   LEU A C   1 
ATOM   502 O  O   . LEU A 1 67 ? 16.848  55.989 55.213 1.00 44.21  ? 67   LEU A O   1 
ATOM   503 C  CB  . LEU A 1 67 ? 14.671  58.082 55.052 1.00 42.53  ? 67   LEU A CB  1 
ATOM   504 C  CG  . LEU A 1 67 ? 13.791  59.044 54.258 1.00 45.16  ? 67   LEU A CG  1 
ATOM   505 C  CD1 . LEU A 1 67 ? 13.509  60.260 55.131 1.00 44.46  ? 67   LEU A CD1 1 
ATOM   506 C  CD2 . LEU A 1 67 ? 14.520  59.413 52.964 1.00 44.50  ? 67   LEU A CD2 1 
ATOM   507 N  N   . ASP A 1 68 ? 15.135  55.009 56.246 1.00 40.80  ? 68   ASP A N   1 
ATOM   508 C  CA  . ASP A 1 68 ? 16.110  54.269 57.075 1.00 42.20  ? 68   ASP A CA  1 
ATOM   509 C  C   . ASP A 1 68 ? 16.300  52.877 56.506 1.00 42.80  ? 68   ASP A C   1 
ATOM   510 O  O   . ASP A 1 68 ? 16.881  51.966 57.039 1.00 44.05  ? 68   ASP A O   1 
ATOM   511 C  CB  . ASP A 1 68 ? 15.723  54.320 58.538 1.00 38.45  ? 68   ASP A CB  1 
ATOM   512 C  CG  . ASP A 1 68 ? 14.333  53.730 58.720 1.00 40.83  ? 68   ASP A CG  1 
ATOM   513 O  OD1 . ASP A 1 68 ? 13.852  53.265 57.689 1.00 40.60  ? 68   ASP A OD1 1 
ATOM   514 O  OD2 . ASP A 1 68 ? 13.713  53.693 59.774 1.00 43.15  ? 68   ASP A OD2 1 
ATOM   515 N  N   . SER A 1 69 ? 15.753  52.662 55.334 1.00 43.01  ? 69   SER A N   1 
ATOM   516 C  CA  . SER A 1 69 ? 15.844  51.456 54.581 1.00 46.65  ? 69   SER A CA  1 
ATOM   517 C  C   . SER A 1 69 ? 15.599  50.143 55.261 1.00 45.07  ? 69   SER A C   1 
ATOM   518 O  O   . SER A 1 69 ? 16.238  49.113 54.991 1.00 46.28  ? 69   SER A O   1 
ATOM   519 C  CB  . SER A 1 69 ? 17.151  51.512 53.721 1.00 51.44  ? 69   SER A CB  1 
ATOM   520 O  OG  . SER A 1 69 ? 18.212  50.936 54.420 1.00 58.68  ? 69   SER A OG  1 
ATOM   521 N  N   . ASP A 1 70 ? 14.575  50.077 56.117 1.00 42.42  ? 70   ASP A N   1 
ATOM   522 C  CA  . ASP A 1 70 ? 14.076  48.917 56.794 1.00 37.45  ? 70   ASP A CA  1 
ATOM   523 C  C   . ASP A 1 70 ? 12.980  48.257 55.960 1.00 33.79  ? 70   ASP A C   1 
ATOM   524 O  O   . ASP A 1 70 ? 12.400  47.273 56.397 1.00 36.02  ? 70   ASP A O   1 
ATOM   525 C  CB  . ASP A 1 70 ? 13.520  49.173 58.204 1.00 38.92  ? 70   ASP A CB  1 
ATOM   526 C  CG  . ASP A 1 70 ? 12.239  49.945 58.308 1.00 41.46  ? 70   ASP A CG  1 
ATOM   527 O  OD1 . ASP A 1 70 ? 11.747  50.437 57.270 1.00 38.22  ? 70   ASP A OD1 1 
ATOM   528 O  OD2 . ASP A 1 70 ? 11.626  50.123 59.390 1.00 42.17  ? 70   ASP A OD2 1 
ATOM   529 N  N   . GLY A 1 71 ? 12.626  48.759 54.793 1.00 34.08  ? 71   GLY A N   1 
ATOM   530 C  CA  . GLY A 1 71 ? 11.615  48.171 53.902 1.00 29.64  ? 71   GLY A CA  1 
ATOM   531 C  C   . GLY A 1 71 ? 10.184  48.546 54.224 1.00 32.04  ? 71   GLY A C   1 
ATOM   532 O  O   . GLY A 1 71 ? 9.232   47.931 53.650 1.00 30.07  ? 71   GLY A O   1 
ATOM   533 N  N   . GLN A 1 72 ? 9.925   49.497 55.170 1.00 27.63  ? 72   GLN A N   1 
ATOM   534 C  CA  . GLN A 1 72 ? 8.505   49.781 55.519 1.00 26.68  ? 72   GLN A CA  1 
ATOM   535 C  C   . GLN A 1 72 ? 8.300   51.262 55.630 1.00 25.73  ? 72   GLN A C   1 
ATOM   536 O  O   . GLN A 1 72 ? 9.346   51.889 55.625 1.00 24.05  ? 72   GLN A O   1 
ATOM   537 C  CB  . GLN A 1 72 ? 8.192   49.123 56.882 1.00 27.28  ? 72   GLN A CB  1 
ATOM   538 C  CG  . GLN A 1 72 ? 8.165   47.585 56.732 1.00 26.38  ? 72   GLN A CG  1 
ATOM   539 C  CD  . GLN A 1 72 ? 7.261   46.949 57.727 1.00 29.20  ? 72   GLN A CD  1 
ATOM   540 O  OE1 . GLN A 1 72 ? 6.039   47.067 57.581 1.00 29.87  ? 72   GLN A OE1 1 
ATOM   541 N  NE2 . GLN A 1 72 ? 7.824   46.275 58.741 1.00 28.33  ? 72   GLN A NE2 1 
ATOM   542 N  N   . LEU A 1 73 ? 7.183   51.930 55.683 1.00 23.63  ? 73   LEU A N   1 
ATOM   543 C  CA  . LEU A 1 73 ? 7.214   53.377 55.812 1.00 22.56  ? 73   LEU A CA  1 
ATOM   544 C  C   . LEU A 1 73 ? 6.724   53.644 57.262 1.00 24.18  ? 73   LEU A C   1 
ATOM   545 O  O   . LEU A 1 73 ? 5.694   53.073 57.648 1.00 21.76  ? 73   LEU A O   1 
ATOM   546 C  CB  . LEU A 1 73 ? 6.238   54.105 54.857 1.00 22.63  ? 73   LEU A CB  1 
ATOM   547 C  CG  . LEU A 1 73 ? 6.514   53.856 53.341 1.00 27.45  ? 73   LEU A CG  1 
ATOM   548 C  CD1 . LEU A 1 73 ? 5.568   54.636 52.429 1.00 25.33  ? 73   LEU A CD1 1 
ATOM   549 C  CD2 . LEU A 1 73 ? 7.934   54.213 52.975 1.00 25.41  ? 73   LEU A CD2 1 
ATOM   550 N  N   . ASP A 1 74 ? 7.453   54.490 58.003 1.00 20.61  ? 74   ASP A N   1 
ATOM   551 C  CA  . ASP A 1 74 ? 6.839   54.818 59.337 1.00 23.54  ? 74   ASP A CA  1 
ATOM   552 C  C   . ASP A 1 74 ? 6.035   56.072 59.126 1.00 22.58  ? 74   ASP A C   1 
ATOM   553 O  O   . ASP A 1 74 ? 6.015   56.594 57.975 1.00 22.65  ? 74   ASP A O   1 
ATOM   554 C  CB  . ASP A 1 74 ? 7.901   54.965 60.397 1.00 23.53  ? 74   ASP A CB  1 
ATOM   555 C  CG  . ASP A 1 74 ? 8.852   56.117 60.113 1.00 27.15  ? 74   ASP A CG  1 
ATOM   556 O  OD1 . ASP A 1 74 ? 8.673   57.021 59.274 1.00 32.17  ? 74   ASP A OD1 1 
ATOM   557 O  OD2 . ASP A 1 74 ? 9.886   56.151 60.786 1.00 40.87  ? 74   ASP A OD2 1 
ATOM   558 N  N   . PHE A 1 75 ? 5.389   56.641 60.130 1.00 24.14  ? 75   PHE A N   1 
ATOM   559 C  CA  . PHE A 1 75 ? 4.581   57.838 59.944 1.00 24.95  ? 75   PHE A CA  1 
ATOM   560 C  C   . PHE A 1 75 ? 5.240   59.030 59.297 1.00 25.25  ? 75   PHE A C   1 
ATOM   561 O  O   . PHE A 1 75 ? 4.712   59.787 58.493 1.00 21.04  ? 75   PHE A O   1 
ATOM   562 C  CB  . PHE A 1 75 ? 3.894   58.234 61.221 1.00 25.57  ? 75   PHE A CB  1 
ATOM   563 C  CG  . PHE A 1 75 ? 2.841   59.284 61.122 1.00 28.77  ? 75   PHE A CG  1 
ATOM   564 C  CD1 . PHE A 1 75 ? 1.731   59.082 60.278 1.00 30.03  ? 75   PHE A CD1 1 
ATOM   565 C  CD2 . PHE A 1 75 ? 2.921   60.469 61.835 1.00 28.77  ? 75   PHE A CD2 1 
ATOM   566 C  CE1 . PHE A 1 75 ? 0.729   60.039 60.173 1.00 27.59  ? 75   PHE A CE1 1 
ATOM   567 C  CE2 . PHE A 1 75 ? 1.903   61.424 61.724 1.00 26.48  ? 75   PHE A CE2 1 
ATOM   568 C  CZ  . PHE A 1 75 ? 0.814   61.207 60.896 1.00 24.71  ? 75   PHE A CZ  1 
ATOM   569 N  N   . GLN A 1 76 ? 6.456   59.306 59.728 1.00 25.58  ? 76   GLN A N   1 
ATOM   570 C  CA  . GLN A 1 76 ? 7.178   60.430 59.204 1.00 28.04  ? 76   GLN A CA  1 
ATOM   571 C  C   . GLN A 1 76 ? 7.497   60.240 57.723 1.00 25.75  ? 76   GLN A C   1 
ATOM   572 O  O   . GLN A 1 76 ? 7.435   61.190 56.985 1.00 27.89  ? 76   GLN A O   1 
ATOM   573 C  CB  . GLN A 1 76 ? 8.498   60.543 60.028 1.00 28.21  ? 76   GLN A CB  1 
ATOM   574 C  CG  . GLN A 1 76 ? 9.510   61.348 59.269 1.00 43.43  ? 76   GLN A CG  1 
ATOM   575 C  CD  . GLN A 1 76 ? 10.196  62.378 60.138 1.00 56.08  ? 76   GLN A CD  1 
ATOM   576 O  OE1 . GLN A 1 76 ? 10.204  63.572 59.802 1.00 61.18  ? 76   GLN A OE1 1 
ATOM   577 N  NE2 . GLN A 1 76 ? 10.747  61.864 61.245 1.00 57.25  ? 76   GLN A NE2 1 
ATOM   578 N  N   . GLU A 1 77 ? 7.906   59.080 57.296 1.00 26.02  ? 77   GLU A N   1 
ATOM   579 C  CA  . GLU A 1 77 ? 8.203   58.771 55.901 1.00 26.13  ? 77   GLU A CA  1 
ATOM   580 C  C   . GLU A 1 77 ? 6.923   58.885 55.093 1.00 26.64  ? 77   GLU A C   1 
ATOM   581 O  O   . GLU A 1 77 ? 6.981   59.412 53.988 1.00 30.19  ? 77   GLU A O   1 
ATOM   582 C  CB  . GLU A 1 77 ? 8.774   57.375 55.722 1.00 20.29  ? 77   GLU A CB  1 
ATOM   583 C  CG  . GLU A 1 77 ? 10.249  57.431 56.218 1.00 21.21  ? 77   GLU A CG  1 
ATOM   584 C  CD  . GLU A 1 77 ? 10.671  56.014 56.501 1.00 28.92  ? 77   GLU A CD  1 
ATOM   585 O  OE1 . GLU A 1 77 ? 9.768   55.165 56.695 1.00 26.82  ? 77   GLU A OE1 1 
ATOM   586 O  OE2 . GLU A 1 77 ? 11.882  55.756 56.517 1.00 33.00  ? 77   GLU A OE2 1 
ATOM   587 N  N   . PHE A 1 78 ? 5.843   58.427 55.696 1.00 23.04  ? 78   PHE A N   1 
ATOM   588 C  CA  . PHE A 1 78 ? 4.560   58.591 54.986 1.00 26.16  ? 78   PHE A CA  1 
ATOM   589 C  C   . PHE A 1 78 ? 4.233   60.065 54.857 1.00 26.53  ? 78   PHE A C   1 
ATOM   590 O  O   . PHE A 1 78 ? 3.734   60.520 53.824 1.00 27.82  ? 78   PHE A O   1 
ATOM   591 C  CB  . PHE A 1 78 ? 3.507   57.805 55.702 1.00 19.58  ? 78   PHE A CB  1 
ATOM   592 C  CG  . PHE A 1 78 ? 2.095   58.125 55.466 1.00 27.12  ? 78   PHE A CG  1 
ATOM   593 C  CD1 . PHE A 1 78 ? 1.443   59.061 56.235 1.00 28.22  ? 78   PHE A CD1 1 
ATOM   594 C  CD2 . PHE A 1 78 ? 1.399   57.470 54.433 1.00 31.25  ? 78   PHE A CD2 1 
ATOM   595 C  CE1 . PHE A 1 78 ? 0.106   59.353 55.996 1.00 32.73  ? 78   PHE A CE1 1 
ATOM   596 C  CE2 . PHE A 1 78 ? 0.069   57.756 54.191 1.00 30.98  ? 78   PHE A CE2 1 
ATOM   597 C  CZ  . PHE A 1 78 ? -0.565  58.701 54.984 1.00 33.32  ? 78   PHE A CZ  1 
ATOM   598 N  N   . LEU A 1 79 ? 4.502   60.895 55.853 1.00 25.86  ? 79   LEU A N   1 
ATOM   599 C  CA  . LEU A 1 79 ? 4.246   62.322 55.745 1.00 26.81  ? 79   LEU A CA  1 
ATOM   600 C  C   . LEU A 1 79 ? 5.087   62.970 54.642 1.00 25.03  ? 79   LEU A C   1 
ATOM   601 O  O   . LEU A 1 79 ? 4.579   63.894 54.030 1.00 27.16  ? 79   LEU A O   1 
ATOM   602 C  CB  . LEU A 1 79 ? 4.348   63.087 57.039 1.00 28.41  ? 79   LEU A CB  1 
ATOM   603 C  CG  . LEU A 1 79 ? 3.271   62.781 58.121 1.00 34.51  ? 79   LEU A CG  1 
ATOM   604 C  CD1 . LEU A 1 79 ? 3.720   63.459 59.398 1.00 31.71  ? 79   LEU A CD1 1 
ATOM   605 C  CD2 . LEU A 1 79 ? 1.901   63.225 57.659 1.00 32.07  ? 79   LEU A CD2 1 
ATOM   606 N  N   . ASN A 1 80 ? 6.301   62.576 54.356 1.00 25.48  ? 80   ASN A N   1 
ATOM   607 C  CA  . ASN A 1 80 ? 7.136   63.111 53.301 1.00 28.54  ? 80   ASN A CA  1 
ATOM   608 C  C   . ASN A 1 80 ? 6.454   62.799 51.941 1.00 31.02  ? 80   ASN A C   1 
ATOM   609 O  O   . ASN A 1 80 ? 6.490   63.650 51.056 1.00 33.33  ? 80   ASN A O   1 
ATOM   610 C  CB  . ASN A 1 80 ? 8.506   62.405 53.321 1.00 32.27  ? 80   ASN A CB  1 
ATOM   611 C  CG  . ASN A 1 80 ? 9.344   62.877 54.506 1.00 33.47  ? 80   ASN A CG  1 
ATOM   612 O  OD1 . ASN A 1 80 ? 9.103   63.962 55.025 1.00 37.91  ? 80   ASN A OD1 1 
ATOM   613 N  ND2 . ASN A 1 80 ? 10.303  62.079 54.921 1.00 32.85  ? 80   ASN A ND2 1 
ATOM   614 N  N   . LEU A 1 81 ? 5.709   61.700 51.818 1.00 28.87  ? 81   LEU A N   1 
ATOM   615 C  CA  . LEU A 1 81 ? 4.938   61.409 50.614 1.00 31.92  ? 81   LEU A CA  1 
ATOM   616 C  C   . LEU A 1 81 ? 3.795   62.414 50.505 1.00 31.01  ? 81   LEU A C   1 
ATOM   617 O  O   . LEU A 1 81 ? 3.604   63.033 49.484 1.00 30.39  ? 81   LEU A O   1 
ATOM   618 C  CB  . LEU A 1 81 ? 4.386   59.990 50.555 1.00 31.67  ? 81   LEU A CB  1 
ATOM   619 C  CG  . LEU A 1 81 ? 3.295   59.660 49.525 1.00 36.65  ? 81   LEU A CG  1 
ATOM   620 C  CD1 . LEU A 1 81 ? 3.920   59.544 48.130 1.00 34.97  ? 81   LEU A CD1 1 
ATOM   621 C  CD2 . LEU A 1 81 ? 2.610   58.351 49.865 1.00 37.96  ? 81   LEU A CD2 1 
ATOM   622 N  N   . ILE A 1 82 ? 3.026   62.592 51.577 1.00 30.06  ? 82   ILE A N   1 
ATOM   623 C  CA  . ILE A 1 82 ? 1.925   63.536 51.549 1.00 27.01  ? 82   ILE A CA  1 
ATOM   624 C  C   . ILE A 1 82 ? 2.439   64.930 51.217 1.00 27.50  ? 82   ILE A C   1 
ATOM   625 O  O   . ILE A 1 82 ? 1.912   65.599 50.306 1.00 28.71  ? 82   ILE A O   1 
ATOM   626 C  CB  . ILE A 1 82 ? 1.096   63.479 52.819 1.00 32.04  ? 82   ILE A CB  1 
ATOM   627 C  CG1 . ILE A 1 82 ? 0.696   62.027 53.197 1.00 31.64  ? 82   ILE A CG1 1 
ATOM   628 C  CG2 . ILE A 1 82 ? -0.213  64.261 52.638 1.00 31.36  ? 82   ILE A CG2 1 
ATOM   629 C  CD1 . ILE A 1 82 ? -0.180  61.427 52.064 1.00 30.88  ? 82   ILE A CD1 1 
ATOM   630 N  N   . GLY A 1 83 ? 3.493   65.372 51.833 1.00 23.08  ? 83   GLY A N   1 
ATOM   631 C  CA  . GLY A 1 83 ? 4.088   66.656 51.654 1.00 27.40  ? 83   GLY A CA  1 
ATOM   632 C  C   . GLY A 1 83 ? 4.657   66.842 50.209 1.00 28.24  ? 83   GLY A C   1 
ATOM   633 O  O   . GLY A 1 83 ? 4.416   67.876 49.626 1.00 27.03  ? 83   GLY A O   1 
ATOM   634 N  N   . GLY A 1 84 ? 5.376   65.875 49.685 1.00 27.88  ? 84   GLY A N   1 
ATOM   635 C  CA  . GLY A 1 84 ? 5.922   65.948 48.343 1.00 29.12  ? 84   GLY A CA  1 
ATOM   636 C  C   . GLY A 1 84 ? 4.800   66.165 47.316 1.00 29.15  ? 84   GLY A C   1 
ATOM   637 O  O   . GLY A 1 84 ? 4.936   67.019 46.452 1.00 32.88  ? 84   GLY A O   1 
ATOM   638 N  N   . LEU A 1 85 ? 3.690   65.479 47.443 1.00 27.62  ? 85   LEU A N   1 
ATOM   639 C  CA  . LEU A 1 85 ? 2.531   65.652 46.605 1.00 30.38  ? 85   LEU A CA  1 
ATOM   640 C  C   . LEU A 1 85 ? 1.840   67.001 46.796 1.00 30.77  ? 85   LEU A C   1 
ATOM   641 O  O   . LEU A 1 85 ? 1.379   67.618 45.828 1.00 31.40  ? 85   LEU A O   1 
ATOM   642 C  CB  . LEU A 1 85 ? 1.484   64.565 46.883 1.00 28.14  ? 85   LEU A CB  1 
ATOM   643 C  CG  . LEU A 1 85 ? 1.926   63.127 46.577 1.00 38.53  ? 85   LEU A CG  1 
ATOM   644 C  CD1 . LEU A 1 85 ? 0.728   62.180 46.706 1.00 38.74  ? 85   LEU A CD1 1 
ATOM   645 C  CD2 . LEU A 1 85 ? 2.545   62.969 45.205 1.00 40.38  ? 85   LEU A CD2 1 
ATOM   646 N  N   . ALA A 1 86 ? 1.697   67.471 48.050 1.00 28.12  ? 86   ALA A N   1 
ATOM   647 C  CA  . ALA A 1 86 ? 1.039   68.746 48.260 1.00 26.64  ? 86   ALA A CA  1 
ATOM   648 C  C   . ALA A 1 86 ? 1.984   69.816 47.685 1.00 23.82  ? 86   ALA A C   1 
ATOM   649 O  O   . ALA A 1 86 ? 1.517   70.769 47.106 1.00 26.12  ? 86   ALA A O   1 
ATOM   650 C  CB  . ALA A 1 86 ? 0.784   68.993 49.763 1.00 25.42  ? 86   ALA A CB  1 
ATOM   651 N  N   . ILE A 1 87 ? 3.277   69.711 47.808 1.00 24.19  ? 87   ILE A N   1 
ATOM   652 C  CA  . ILE A 1 87 ? 4.175   70.715 47.267 1.00 28.75  ? 87   ILE A CA  1 
ATOM   653 C  C   . ILE A 1 87 ? 4.079   70.751 45.730 1.00 32.26  ? 87   ILE A C   1 
ATOM   654 O  O   . ILE A 1 87 ? 3.874   71.815 45.153 1.00 32.07  ? 87   ILE A O   1 
ATOM   655 C  CB  . ILE A 1 87 ? 5.596   70.525 47.755 1.00 30.49  ? 87   ILE A CB  1 
ATOM   656 C  CG1 . ILE A 1 87 ? 5.757   70.905 49.231 1.00 34.87  ? 87   ILE A CG1 1 
ATOM   657 C  CG2 . ILE A 1 87 ? 6.589   71.375 46.937 1.00 31.98  ? 87   ILE A CG2 1 
ATOM   658 C  CD1 . ILE A 1 87 ? 7.020   70.371 49.873 1.00 33.66  ? 87   ILE A CD1 1 
ATOM   659 N  N   . ALA A 1 88 ? 4.128   69.618 45.036 1.00 31.63  ? 88   ALA A N   1 
ATOM   660 C  CA  . ALA A 1 88 ? 3.987   69.640 43.580 1.00 33.95  ? 88   ALA A CA  1 
ATOM   661 C  C   . ALA A 1 88 ? 2.655   70.235 43.208 1.00 35.63  ? 88   ALA A C   1 
ATOM   662 O  O   . ALA A 1 88 ? 2.509   71.050 42.296 1.00 37.62  ? 88   ALA A O   1 
ATOM   663 C  CB  . ALA A 1 88 ? 4.173   68.236 43.014 1.00 31.78  ? 88   ALA A CB  1 
ATOM   664 N  N   . CYS A 1 89 ? 1.575   69.898 43.915 1.00 35.75  ? 89   CYS A N   1 
ATOM   665 C  CA  . CYS A 1 89 ? 0.291   70.449 43.578 1.00 35.02  ? 89   CYS A CA  1 
ATOM   666 C  C   . CYS A 1 89 ? 0.190   71.957 43.785 1.00 37.48  ? 89   CYS A C   1 
ATOM   667 O  O   . CYS A 1 89 ? -0.503  72.684 43.070 1.00 36.97  ? 89   CYS A O   1 
ATOM   668 C  CB  . CYS A 1 89 ? -0.741  69.794 44.474 1.00 37.23  ? 89   CYS A CB  1 
ATOM   669 S  SG  A CYS A 1 89 ? -1.332  68.157 44.067 0.50 40.54  ? 89   CYS A SG  1 
ATOM   670 S  SG  B CYS A 1 89 ? -2.391  70.104 43.910 0.50 41.61  ? 89   CYS A SG  1 
ATOM   671 N  N   . HIS A 1 90 ? 0.869   72.443 44.841 1.00 34.51  ? 90   HIS A N   1 
ATOM   672 C  CA  . HIS A 1 90 ? 0.818   73.870 45.135 1.00 33.16  ? 90   HIS A CA  1 
ATOM   673 C  C   . HIS A 1 90 ? 1.670   74.600 44.068 1.00 33.23  ? 90   HIS A C   1 
ATOM   674 O  O   . HIS A 1 90 ? 1.298   75.673 43.663 1.00 29.00  ? 90   HIS A O   1 
ATOM   675 C  CB  . HIS A 1 90 ? 1.349   74.124 46.534 1.00 28.35  ? 90   HIS A CB  1 
ATOM   676 C  CG  . HIS A 1 90 ? 1.414   75.567 46.870 1.00 25.04  ? 90   HIS A CG  1 
ATOM   677 N  ND1 . HIS A 1 90 ? 2.614   76.237 46.928 1.00 26.46  ? 90   HIS A ND1 1 
ATOM   678 C  CD2 . HIS A 1 90 ? 0.436   76.460 47.136 1.00 23.84  ? 90   HIS A CD2 1 
ATOM   679 C  CE1 . HIS A 1 90 ? 2.398   77.491 47.235 1.00 24.90  ? 90   HIS A CE1 1 
ATOM   680 N  NE2 . HIS A 1 90 ? 1.083   77.637 47.368 1.00 28.33  ? 90   HIS A NE2 1 
ATOM   681 N  N   . ASP A 1 91 ? 2.769   74.032 43.649 1.00 34.46  ? 91   ASP A N   1 
ATOM   682 C  CA  . ASP A 1 91 ? 3.620   74.582 42.618 1.00 40.89  ? 91   ASP A CA  1 
ATOM   683 C  C   . ASP A 1 91 ? 2.800   74.704 41.296 1.00 40.29  ? 91   ASP A C   1 
ATOM   684 O  O   . ASP A 1 91 ? 2.865   75.768 40.693 1.00 38.95  ? 91   ASP A O   1 
ATOM   685 C  CB  . ASP A 1 91 ? 4.826   73.705 42.300 1.00 50.53  ? 91   ASP A CB  1 
ATOM   686 C  CG  . ASP A 1 91 ? 6.003   74.014 43.188 1.00 60.27  ? 91   ASP A CG  1 
ATOM   687 O  OD1 . ASP A 1 91 ? 5.842   74.635 44.248 1.00 63.95  ? 91   ASP A OD1 1 
ATOM   688 O  OD2 . ASP A 1 91 ? 7.156   73.639 42.842 1.00 71.39  ? 91   ASP A OD2 1 
ATOM   689 N  N   . SER A 1 92 ? 2.020   73.709 40.931 1.00 38.90  ? 92   SER A N   1 
ATOM   690 C  CA  . SER A 1 92 ? 1.173   73.774 39.767 1.00 40.04  ? 92   SER A CA  1 
ATOM   691 C  C   . SER A 1 92 ? 0.078   74.813 39.938 1.00 39.26  ? 92   SER A C   1 
ATOM   692 O  O   . SER A 1 92 ? -0.285  75.449 38.962 1.00 38.31  ? 92   SER A O   1 
ATOM   693 C  CB  . SER A 1 92 ? 0.363   72.445 39.500 1.00 41.29  ? 92   SER A CB  1 
ATOM   694 O  OG  . SER A 1 92 ? 1.322   71.492 39.133 1.00 48.13  ? 92   SER A OG  1 
ATOM   695 N  N   . PHE A 1 93 ? -0.455  74.953 41.169 1.00 37.85  ? 93   PHE A N   1 
ATOM   696 C  CA  . PHE A 1 93 ? -1.500  75.976 41.295 1.00 38.84  ? 93   PHE A CA  1 
ATOM   697 C  C   . PHE A 1 93 ? -0.825  77.364 41.107 1.00 37.72  ? 93   PHE A C   1 
ATOM   698 O  O   . PHE A 1 93 ? -1.455  78.237 40.524 1.00 38.34  ? 93   PHE A O   1 
ATOM   699 C  CB  . PHE A 1 93 ? -2.280  75.848 42.578 1.00 42.51  ? 93   PHE A CB  1 
ATOM   700 C  CG  . PHE A 1 93 ? -2.934  77.117 43.058 1.00 48.81  ? 93   PHE A CG  1 
ATOM   701 C  CD1 . PHE A 1 93 ? -2.218  78.016 43.857 1.00 51.17  ? 93   PHE A CD1 1 
ATOM   702 C  CD2 . PHE A 1 93 ? -4.239  77.415 42.722 1.00 50.97  ? 93   PHE A CD2 1 
ATOM   703 C  CE1 . PHE A 1 93 ? -2.788  79.185 44.304 1.00 53.82  ? 93   PHE A CE1 1 
ATOM   704 C  CE2 . PHE A 1 93 ? -4.827  78.582 43.164 1.00 53.77  ? 93   PHE A CE2 1 
ATOM   705 C  CZ  . PHE A 1 93 ? -4.102  79.469 43.953 1.00 56.38  ? 93   PHE A CZ  1 
ATOM   706 N  N   . ILE A 1 94 ? 0.392   77.597 41.565 1.00 37.01  ? 94   ILE A N   1 
ATOM   707 C  CA  . ILE A 1 94 ? 1.035   78.902 41.397 1.00 40.45  ? 94   ILE A CA  1 
ATOM   708 C  C   . ILE A 1 94 ? 1.320   79.161 39.891 1.00 38.45  ? 94   ILE A C   1 
ATOM   709 O  O   . ILE A 1 94 ? 1.034   80.219 39.339 1.00 36.09  ? 94   ILE A O   1 
ATOM   710 C  CB  . ILE A 1 94 ? 2.346   79.024 42.173 1.00 39.68  ? 94   ILE A CB  1 
ATOM   711 C  CG1 . ILE A 1 94 ? 2.172   79.013 43.703 1.00 41.61  ? 94   ILE A CG1 1 
ATOM   712 C  CG2 . ILE A 1 94 ? 3.113   80.287 41.758 1.00 37.80  ? 94   ILE A CG2 1 
ATOM   713 C  CD1 . ILE A 1 94 ? 1.185   80.012 44.264 1.00 44.23  ? 94   ILE A CD1 1 
ATOM   714 N  N   . LYS A 1 95 ? 1.889   78.186 39.240 1.00 40.02  ? 95   LYS A N   1 
ATOM   715 C  CA  . LYS A 1 95 ? 2.261   78.151 37.834 1.00 44.59  ? 95   LYS A CA  1 
ATOM   716 C  C   . LYS A 1 95 ? 1.065   78.484 36.942 1.00 45.14  ? 95   LYS A C   1 
ATOM   717 O  O   . LYS A 1 95 ? 1.149   79.259 36.012 1.00 48.08  ? 95   LYS A O   1 
ATOM   718 C  CB  . LYS A 1 95 ? 2.801   76.802 37.412 1.00 50.07  ? 95   LYS A CB  1 
ATOM   719 C  CG  . LYS A 1 95 ? 4.280   76.726 37.116 1.00 60.34  ? 95   LYS A CG  1 
ATOM   720 C  CD  . LYS A 1 95 ? 5.196   77.005 38.282 1.00 65.50  ? 95   LYS A CD  1 
ATOM   721 C  CE  . LYS A 1 95 ? 6.510   76.234 38.178 1.00 68.48  ? 95   LYS A CE  1 
ATOM   722 N  NZ  . LYS A 1 95 ? 7.500   76.710 39.204 1.00 68.98  ? 95   LYS A NZ  1 
ATOM   723 N  N   . SER A 1 96 ? -0.094  77.986 37.289 1.00 46.03  ? 96   SER A N   1 
ATOM   724 C  CA  . SER A 1 96 ? -1.335  78.162 36.601 1.00 46.08  ? 96   SER A CA  1 
ATOM   725 C  C   . SER A 1 96 ? -1.975  79.498 36.877 1.00 46.41  ? 96   SER A C   1 
ATOM   726 O  O   . SER A 1 96 ? -2.703  80.033 36.033 1.00 44.29  ? 96   SER A O   1 
ATOM   727 C  CB  . SER A 1 96 ? -2.277  76.999 36.996 1.00 48.79  ? 96   SER A CB  1 
ATOM   728 O  OG  . SER A 1 96 ? -3.345  77.507 37.800 1.00 55.67  ? 96   SER A OG  1 
ATOM   729 N  N   . THR A 1 97 ? -1.730  80.059 38.074 1.00 44.76  ? 97   THR A N   1 
ATOM   730 C  CA  . THR A 1 97 ? -2.381  81.353 38.314 1.00 41.36  ? 97   THR A CA  1 
ATOM   731 C  C   . THR A 1 97 ? -1.429  82.517 38.170 1.00 40.01  ? 97   THR A C   1 
ATOM   732 O  O   . THR A 1 97 ? -1.878  83.653 38.037 1.00 42.22  ? 97   THR A O   1 
ATOM   733 C  CB  . THR A 1 97 ? -3.060  81.347 39.700 1.00 42.62  ? 97   THR A CB  1 
ATOM   734 O  OG1 . THR A 1 97 ? -2.049  81.051 40.680 1.00 41.27  ? 97   THR A OG1 1 
ATOM   735 C  CG2 . THR A 1 97 ? -4.170  80.322 39.770 1.00 41.48  ? 97   THR A CG2 1 
ATOM   736 N  N   . GLN A 1 98 ? -0.126  82.364 38.253 1.00 38.69  ? 98   GLN A N   1 
ATOM   737 C  CA  . GLN A 1 98 ? 0.796   83.539 38.098 1.00 37.71  ? 98   GLN A CA  1 
ATOM   738 C  C   . GLN A 1 98 ? 1.547   83.228 36.806 1.00 38.66  ? 98   GLN A C   1 
ATOM   739 O  O   . GLN A 1 98 ? 2.741   82.956 36.791 1.00 40.98  ? 98   GLN A O   1 
ATOM   740 C  CB  . GLN A 1 98 ? 1.758   83.614 39.290 1.00 36.96  ? 98   GLN A CB  1 
ATOM   741 C  CG  . GLN A 1 98 ? 1.004   83.890 40.568 1.00 30.60  ? 98   GLN A CG  1 
ATOM   742 C  CD  . GLN A 1 98 ? 1.767   83.898 41.865 1.00 32.47  ? 98   GLN A CD  1 
ATOM   743 O  OE1 . GLN A 1 98 ? 2.995   83.878 42.000 1.00 32.59  ? 98   GLN A OE1 1 
ATOM   744 N  NE2 . GLN A 1 98 ? 0.920   83.918 42.912 1.00 29.01  ? 98   GLN A NE2 1 
ATOM   745 N  N   . LYS A 1 99 ? 0.770   83.226 35.732 1.00 38.71  ? 99   LYS A N   1 
ATOM   746 C  CA  . LYS A 1 99 ? 1.313   82.891 34.436 1.00 44.06  ? 99   LYS A CA  1 
ATOM   747 C  C   . LYS A 1 99 ? 1.448   84.017 33.424 1.00 41.68  ? 99   LYS A C   1 
ATOM   748 O  O   . LYS A 1 99 ? 2.129   83.620 32.434 1.00 45.91  ? 99   LYS A O   1 
ATOM   749 C  CB  . LYS A 1 99 ? 0.406   81.800 33.769 1.00 42.96  ? 99   LYS A CB  1 
ATOM   750 C  CG  . LYS A 1 99 ? -1.017  82.372 33.674 1.00 49.67  ? 99   LYS A CG  1 
ATOM   751 C  CD  . LYS A 1 99 ? -1.937  81.309 33.057 1.00 59.62  ? 99   LYS A CD  1 
ATOM   752 C  CE  . LYS A 1 99 ? -3.387  81.823 33.097 1.00 64.91  ? 99   LYS A CE  1 
ATOM   753 N  NZ  . LYS A 1 99 ? -3.541  82.962 32.126 1.00 67.49  ? 99   LYS A NZ  1 
ATOM   754 O  OXT . LYS A 1 99 ? 0.934   85.110 33.556 1.00 33.42  ? 99   LYS A OXT 1 
HETATM 755 C  C   . ACE B 2 1  ? -9.689  66.848 45.203 0.50 52.39  ? 0    ACE D C   1 
HETATM 756 O  O   . ACE B 2 1  ? -8.664  66.154 45.054 0.50 52.95  ? 0    ACE D O   1 
HETATM 757 C  CH3 . ACE B 2 1  ? -10.041 67.555 46.472 0.50 48.96  ? 0    ACE D CH3 1 
ATOM   758 N  N   . ALA B 2 2  ? -10.588 67.031 44.235 0.50 53.20  ? 1    ALA D N   1 
ATOM   759 C  CA  . ALA B 2 2  ? -10.914 68.284 43.625 0.50 52.17  ? 1    ALA D CA  1 
ATOM   760 C  C   . ALA B 2 2  ? -9.809  68.672 42.632 0.50 51.90  ? 1    ALA D C   1 
ATOM   761 O  O   . ALA B 2 2  ? -9.585  67.983 41.607 0.50 51.52  ? 1    ALA D O   1 
ATOM   762 C  CB  . ALA B 2 2  ? -11.224 69.440 44.547 0.50 53.43  ? 1    ALA D CB  1 
ATOM   763 N  N   . MET B 2 3  ? -9.124  69.775 42.909 0.50 51.38  ? 2    MET D N   1 
ATOM   764 C  CA  . MET B 2 3  ? -8.058  70.237 42.023 0.50 49.90  ? 2    MET D CA  1 
ATOM   765 C  C   . MET B 2 3  ? -6.872  69.279 42.128 0.50 47.75  ? 2    MET D C   1 
ATOM   766 O  O   . MET B 2 3  ? -6.135  69.012 41.177 0.50 46.67  ? 2    MET D O   1 
ATOM   767 C  CB  . MET B 2 3  ? -7.650  71.659 42.364 0.50 53.93  ? 2    MET D CB  1 
ATOM   768 C  CG  . MET B 2 3  ? -6.617  71.864 43.443 0.50 59.60  ? 2    MET D CG  1 
ATOM   769 S  SD  . MET B 2 3  ? -4.909  71.581 42.923 0.50 62.96  ? 2    MET D SD  1 
ATOM   770 C  CE  . MET B 2 3  ? -4.800  72.670 41.505 0.50 63.80  ? 2    MET D CE  1 
ATOM   771 N  N   . VAL B 2 4  ? -6.699  68.756 43.342 0.50 44.92  ? 3    VAL D N   1 
ATOM   772 C  CA  . VAL B 2 4  ? -5.596  67.823 43.575 0.50 43.62  ? 3    VAL D CA  1 
ATOM   773 C  C   . VAL B 2 4  ? -5.714  66.568 42.737 0.50 42.84  ? 3    VAL D C   1 
ATOM   774 O  O   . VAL B 2 4  ? -4.749  66.211 42.056 0.50 40.36  ? 3    VAL D O   1 
ATOM   775 C  CB  . VAL B 2 4  ? -5.480  67.506 45.084 0.50 42.05  ? 3    VAL D CB  1 
ATOM   776 C  CG1 . VAL B 2 4  ? -4.562  66.317 45.332 0.50 39.66  ? 3    VAL D CG1 1 
ATOM   777 C  CG2 . VAL B 2 4  ? -5.000  68.772 45.760 0.50 39.53  ? 3    VAL D CG2 1 
ATOM   778 N  N   . SER B 2 5  ? -6.871  65.903 42.789 0.50 43.86  ? 4    SER D N   1 
ATOM   779 C  CA  . SER B 2 5  ? -7.085  64.700 42.005 0.50 46.49  ? 4    SER D CA  1 
ATOM   780 C  C   . SER B 2 5  ? -6.756  64.886 40.525 0.50 47.71  ? 4    SER D C   1 
ATOM   781 O  O   . SER B 2 5  ? -6.226  63.979 39.872 0.50 47.89  ? 4    SER D O   1 
ATOM   782 C  CB  . SER B 2 5  ? -8.549  64.241 42.105 0.50 48.19  ? 4    SER D CB  1 
ATOM   783 O  OG  . SER B 2 5  ? -8.648  62.855 41.781 0.50 47.50  ? 4    SER D OG  1 
ATOM   784 N  N   . ALA B 2 6  ? -7.083  66.058 39.981 0.50 48.42  ? 5    ALA D N   1 
ATOM   785 C  CA  . ALA B 2 6  ? -6.795  66.303 38.565 0.50 49.40  ? 5    ALA D CA  1 
ATOM   786 C  C   . ALA B 2 6  ? -5.294  66.507 38.416 0.50 50.83  ? 5    ALA D C   1 
ATOM   787 O  O   . ALA B 2 6  ? -4.657  66.010 37.488 0.50 51.03  ? 5    ALA D O   1 
ATOM   788 C  CB  . ALA B 2 6  ? -7.525  67.538 38.061 0.50 49.79  ? 5    ALA D CB  1 
ATOM   789 N  N   . PHE B 2 7  ? -4.747  67.262 39.384 0.50 51.27  ? 6    PHE D N   1 
ATOM   790 C  CA  . PHE B 2 7  ? -3.310  67.507 39.288 0.50 53.53  ? 6    PHE D CA  1 
ATOM   791 C  C   . PHE B 2 7  ? -2.571  66.174 39.261 0.50 55.93  ? 6    PHE D C   1 
ATOM   792 O  O   . PHE B 2 7  ? -1.739  65.937 38.387 0.50 56.73  ? 6    PHE D O   1 
ATOM   793 C  CB  . PHE B 2 7  ? -2.766  68.428 40.391 0.50 51.02  ? 6    PHE D CB  1 
ATOM   794 C  CG  . PHE B 2 7  ? -1.281  68.211 40.575 0.50 50.70  ? 6    PHE D CG  1 
ATOM   795 C  CD1 . PHE B 2 7  ? -0.366  68.903 39.803 0.50 50.44  ? 6    PHE D CD1 1 
ATOM   796 C  CD2 . PHE B 2 7  ? -0.818  67.297 41.507 0.50 49.71  ? 6    PHE D CD2 1 
ATOM   797 C  CE1 . PHE B 2 7  ? 0.993   68.692 39.970 0.50 48.10  ? 6    PHE D CE1 1 
ATOM   798 C  CE2 . PHE B 2 7  ? 0.532   67.087 41.669 0.50 50.85  ? 6    PHE D CE2 1 
ATOM   799 C  CZ  . PHE B 2 7  ? 1.437   67.790 40.893 0.50 48.92  ? 6    PHE D CZ  1 
ATOM   800 N  N   . LEU B 2 8  ? -2.857  65.338 40.253 0.50 59.13  ? 7    LEU D N   1 
ATOM   801 C  CA  . LEU B 2 8  ? -2.211  64.036 40.382 0.50 61.83  ? 7    LEU D CA  1 
ATOM   802 C  C   . LEU B 2 8  ? -2.253  63.256 39.073 0.50 64.35  ? 7    LEU D C   1 
ATOM   803 O  O   . LEU B 2 8  ? -1.327  62.530 38.719 0.50 63.12  ? 7    LEU D O   1 
ATOM   804 C  CB  . LEU B 2 8  ? -2.844  63.248 41.532 0.50 60.55  ? 7    LEU D CB  1 
ATOM   805 C  CG  . LEU B 2 8  ? -2.636  63.799 42.946 0.50 60.44  ? 7    LEU D CG  1 
ATOM   806 C  CD1 . LEU B 2 8  ? -3.331  62.944 43.995 0.50 57.44  ? 7    LEU D CD1 1 
ATOM   807 C  CD2 . LEU B 2 8  ? -1.153  63.933 43.267 0.50 60.22  ? 7    LEU D CD2 1 
ATOM   808 N  N   . LYS B 2 9  ? -3.357  63.425 38.353 0.50 67.84  ? 8    LYS D N   1 
ATOM   809 C  CA  . LYS B 2 9  ? -3.559  62.760 37.074 0.50 72.05  ? 8    LYS D CA  1 
ATOM   810 C  C   . LYS B 2 9  ? -2.591  63.290 36.016 0.50 75.67  ? 8    LYS D C   1 
ATOM   811 O  O   . LYS B 2 9  ? -2.064  62.531 35.209 0.50 75.32  ? 8    LYS D O   1 
ATOM   812 C  CB  . LYS B 2 9  ? -5.000  62.955 36.600 0.50 69.66  ? 8    LYS D CB  1 
ATOM   813 C  CG  . LYS B 2 9  ? -5.976  61.884 37.034 0.50 67.00  ? 8    LYS D CG  1 
ATOM   814 C  CD  . LYS B 2 9  ? -7.419  62.327 36.825 0.50 66.56  ? 8    LYS D CD  1 
ATOM   815 C  CE  . LYS B 2 9  ? -8.265  62.053 38.057 0.50 66.00  ? 8    LYS D CE  1 
ATOM   816 N  NZ  . LYS B 2 9  ? -9.686  62.453 37.848 0.50 67.13  ? 8    LYS D NZ  1 
ATOM   817 N  N   . GLN B 2 10 ? -2.367  64.596 36.037 0.50 80.18  ? 9    GLN D N   1 
ATOM   818 C  CA  . GLN B 2 10 ? -1.485  65.273 35.103 0.50 84.52  ? 9    GLN D CA  1 
ATOM   819 C  C   . GLN B 2 10 ? -0.015  65.123 35.475 0.50 87.94  ? 9    GLN D C   1 
ATOM   820 O  O   . GLN B 2 10 ? 0.818   64.824 34.613 0.50 89.14  ? 9    GLN D O   1 
ATOM   821 C  CB  . GLN B 2 10 ? -1.834  66.769 35.038 0.50 83.78  ? 9    GLN D CB  1 
ATOM   822 C  CG  . GLN B 2 10 ? -3.283  67.073 34.729 0.50 82.67  ? 9    GLN D CG  1 
ATOM   823 C  CD  . GLN B 2 10 ? -3.794  68.356 35.350 0.50 83.12  ? 9    GLN D CD  1 
ATOM   824 O  OE1 . GLN B 2 10 ? -3.099  69.047 36.107 0.50 82.15  ? 9    GLN D OE1 1 
ATOM   825 N  NE2 . GLN B 2 10 ? -5.045  68.696 35.031 0.50 81.59  ? 9    GLN D NE2 1 
ATOM   826 N  N   . ALA B 2 11 ? 0.317   65.330 36.745 0.50 91.20  ? 10   ALA D N   1 
ATOM   827 C  CA  . ALA B 2 11 ? 1.699   65.218 37.193 0.50 94.36  ? 10   ALA D CA  1 
ATOM   828 C  C   . ALA B 2 11 ? 2.090   63.785 37.547 0.50 96.12  ? 10   ALA D C   1 
ATOM   829 O  O   . ALA B 2 11 ? 1.586   63.198 38.496 0.50 96.30  ? 10   ALA D O   1 
ATOM   830 C  CB  . ALA B 2 11 ? 1.951   66.141 38.379 0.50 94.92  ? 10   ALA D CB  1 
ATOM   831 N  N   . TRP B 2 12 ? 3.013   63.239 36.781 0.50 98.09  ? 11   TRP D N   1 
ATOM   832 C  CA  . TRP B 2 12 ? 3.564   61.899 36.905 0.50 99.79  ? 11   TRP D CA  1 
ATOM   833 C  C   . TRP B 2 12 ? 2.886   60.993 35.880 0.50 100.68 ? 11   TRP D C   1 
ATOM   834 O  O   . TRP B 2 12 ? 1.697   61.258 35.577 0.50 101.15 ? 11   TRP D O   1 
ATOM   835 C  CB  . TRP B 2 12 ? 3.561   61.375 38.303 0.50 101.51 ? 11   TRP D CB  1 
ATOM   836 C  CG  . TRP B 2 12 ? 4.832   60.842 38.882 0.50 102.64 ? 11   TRP D CG  1 
ATOM   837 C  CD1 . TRP B 2 12 ? 5.274   61.037 40.164 0.50 102.91 ? 11   TRP D CD1 1 
ATOM   838 C  CD2 . TRP B 2 12 ? 5.828   60.036 38.247 0.50 103.37 ? 11   TRP D CD2 1 
ATOM   839 N  NE1 . TRP B 2 12 ? 6.474   60.407 40.361 0.50 103.16 ? 11   TRP D NE1 1 
ATOM   840 C  CE2 . TRP B 2 12 ? 6.838   59.784 39.198 0.50 103.74 ? 11   TRP D CE2 1 
ATOM   841 C  CE3 . TRP B 2 12 ? 5.968   59.501 36.964 0.50 103.59 ? 11   TRP D CE3 1 
ATOM   842 C  CZ2 . TRP B 2 12 ? 7.970   59.021 38.908 0.50 104.33 ? 11   TRP D CZ2 1 
ATOM   843 C  CZ3 . TRP B 2 12 ? 7.090   58.746 36.678 0.50 104.21 ? 11   TRP D CZ3 1 
ATOM   844 C  CH2 . TRP B 2 12 ? 8.079   58.512 37.644 0.50 104.17 ? 11   TRP D CH2 1 
ATOM   845 O  OXT . TRP B 2 12 ? 3.516   60.051 35.361 0.50 101.43 ? 11   TRP D OXT 1 
HETATM 846 CA CA  . CA  C 3 .  ? 1.622   47.497 59.052 1.00 26.66  ? 101  CA  A CA  1 
HETATM 847 CA CA  . CA  D 3 .  ? 11.446  53.006 56.735 1.00 35.09  ? 102  CA  A CA  1 
HETATM 848 O  O   . HOH E 4 .  ? -3.137  49.385 53.577 1.00 40.48  ? 2001 HOH A O   1 
HETATM 849 O  O   . HOH E 4 .  ? 11.375  61.331 50.684 1.00 55.77  ? 2002 HOH A O   1 
HETATM 850 O  O   . HOH E 4 .  ? 0.104   42.662 66.426 1.00 33.98  ? 2003 HOH A O   1 
HETATM 851 O  O   . HOH E 4 .  ? 2.274   40.568 60.469 1.00 50.44  ? 2004 HOH A O   1 
HETATM 852 O  O   . HOH E 4 .  ? 8.274   48.425 63.689 1.00 44.33  ? 2005 HOH A O   1 
HETATM 853 O  O   . HOH E 4 .  ? 5.195   55.237 62.562 1.00 30.93  ? 2006 HOH A O   1 
HETATM 854 O  O   . HOH E 4 .  ? 1.898   43.755 55.355 1.00 30.89  ? 2007 HOH A O   1 
HETATM 855 O  O   . HOH E 4 .  ? 10.776  48.741 46.545 1.00 59.28  ? 2008 HOH A O   1 
HETATM 856 O  O   . HOH E 4 .  ? -0.627  43.609 55.296 1.00 52.49  ? 2009 HOH A O   1 
HETATM 857 O  O   . HOH E 4 .  ? -10.779 57.913 51.469 1.00 42.10  ? 2010 HOH A O   1 
HETATM 858 O  O   . HOH E 4 .  ? 2.616   48.098 41.307 1.00 58.51  ? 2011 HOH A O   1 
HETATM 859 O  O   . HOH E 4 .  ? 10.029  59.607 53.353 1.00 39.73  ? 2012 HOH A O   1 
HETATM 860 O  O   . HOH E 4 .  ? 10.520  52.657 59.250 1.00 38.71  ? 2013 HOH A O   1 
HETATM 861 O  O   . HOH E 4 .  ? 10.902  45.738 58.297 1.00 50.12  ? 2014 HOH A O   1 
HETATM 862 O  O   . HOH E 4 .  ? 7.564   45.756 53.384 1.00 28.98  ? 2015 HOH A O   1 
HETATM 863 O  O   . HOH E 4 .  ? 9.900   46.727 50.866 1.00 53.15  ? 2016 HOH A O   1 
HETATM 864 O  O   . HOH E 4 .  ? 3.862   46.498 58.621 1.00 27.34  ? 2017 HOH A O   1 
HETATM 865 O  O   . HOH E 4 .  ? 7.452   58.373 62.716 1.00 40.83  ? 2018 HOH A O   1 
HETATM 866 O  O   . HOH E 4 .  ? 11.788  62.940 57.274 1.00 52.74  ? 2019 HOH A O   1 
HETATM 867 O  O   . HOH E 4 .  ? 7.537   67.633 45.640 1.00 43.16  ? 2020 HOH A O   1 
HETATM 868 O  O   . HOH E 4 .  ? -1.936  82.715 42.789 1.00 45.93  ? 2021 HOH A O   1 
HETATM 869 O  O   . HOH E 4 .  ? 4.426   81.135 37.322 1.00 49.03  ? 2022 HOH A O   1 
HETATM 870 O  O   . HOH E 4 .  ? 3.868   81.566 32.304 1.00 47.44  ? 2023 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  ?  ?   ?   A . n 
A 1 2  ALA 2  2  ?  ?   ?   A . n 
A 1 3  LYS 3  3  ?  ?   ?   A . n 
A 1 4  ARG 4  4  ?  ?   ?   A . n 
A 1 5  PRO 5  5  5  PRO PRO A . n 
A 1 6  THR 6  6  6  THR THR A . n 
A 1 7  GLU 7  7  7  GLU GLU A . n 
A 1 8  THR 8  8  8  THR THR A . n 
A 1 9  GLU 9  9  9  GLU GLU A . n 
A 1 10 ARG 10 10 10 ARG ARG A . n 
A 1 11 CYS 11 11 11 CYS CYS A . n 
A 1 12 ILE 12 12 12 ILE ILE A . n 
A 1 13 GLU 13 13 13 GLU GLU A . n 
A 1 14 SER 14 14 14 SER SER A . n 
A 1 15 LEU 15 15 15 LEU LEU A . n 
A 1 16 ILE 16 16 16 ILE ILE A . n 
A 1 17 ALA 17 17 17 ALA ALA A . n 
A 1 18 ILE 18 18 18 ILE ILE A . n 
A 1 19 PHE 19 19 19 PHE PHE A . n 
A 1 20 GLN 20 20 20 GLN GLN A . n 
A 1 21 LYS 21 21 21 LYS LYS A . n 
A 1 22 HIS 22 22 22 HIS HIS A . n 
A 1 23 ALA 23 23 23 ALA ALA A . n 
A 1 24 GLY 24 24 24 GLY GLY A . n 
A 1 25 ARG 25 25 25 ARG ARG A . n 
A 1 26 ASP 26 26 26 ASP ASP A . n 
A 1 27 GLY 27 27 27 GLY GLY A . n 
A 1 28 ASN 28 28 28 ASN ASN A . n 
A 1 29 ASN 29 29 29 ASN ASN A . n 
A 1 30 THR 30 30 30 THR THR A . n 
A 1 31 LYS 31 31 31 LYS LYS A . n 
A 1 32 ILE 32 32 32 ILE ILE A . n 
A 1 33 SER 33 33 33 SER SER A . n 
A 1 34 LYS 34 34 34 LYS LYS A . n 
A 1 35 THR 35 35 35 THR THR A . n 
A 1 36 GLU 36 36 36 GLU GLU A . n 
A 1 37 PHE 37 37 37 PHE PHE A . n 
A 1 38 LEU 38 38 38 LEU LEU A . n 
A 1 39 ILE 39 39 39 ILE ILE A . n 
A 1 40 PHE 40 40 40 PHE PHE A . n 
A 1 41 MET 41 41 41 MET MET A . n 
A 1 42 ASN 42 42 42 ASN ASN A . n 
A 1 43 THR 43 43 43 THR THR A . n 
A 1 44 GLU 44 44 44 GLU GLU A . n 
A 1 45 LEU 45 45 45 LEU LEU A . n 
A 1 46 ALA 46 46 46 ALA ALA A . n 
A 1 47 ALA 47 47 47 ALA ALA A . n 
A 1 48 PHE 48 48 48 PHE PHE A . n 
A 1 49 THR 49 49 49 THR THR A . n 
A 1 50 GLN 50 50 50 GLN GLN A . n 
A 1 51 ASN 51 51 51 ASN ASN A . n 
A 1 52 GLN 52 52 52 GLN GLN A . n 
A 1 53 LYS 53 53 53 LYS LYS A . n 
A 1 54 ASP 54 54 54 ASP ASP A . n 
A 1 55 PRO 55 55 55 PRO PRO A . n 
A 1 56 GLY 56 56 56 GLY GLY A . n 
A 1 57 VAL 57 57 57 VAL VAL A . n 
A 1 58 LEU 58 58 58 LEU LEU A . n 
A 1 59 ASP 59 59 59 ASP ASP A . n 
A 1 60 ARG 60 60 60 ARG ARG A . n 
A 1 61 MET 61 61 61 MET MET A . n 
A 1 62 MET 62 62 62 MET MET A . n 
A 1 63 LYS 63 63 63 LYS LYS A . n 
A 1 64 LYS 64 64 64 LYS LYS A . n 
A 1 65 LEU 65 65 65 LEU LEU A . n 
A 1 66 ASP 66 66 66 ASP ASP A . n 
A 1 67 LEU 67 67 67 LEU LEU A . n 
A 1 68 ASP 68 68 68 ASP ASP A . n 
A 1 69 SER 69 69 69 SER SER A . n 
A 1 70 ASP 70 70 70 ASP ASP A . n 
A 1 71 GLY 71 71 71 GLY GLY A . n 
A 1 72 GLN 72 72 72 GLN GLN A . n 
A 1 73 LEU 73 73 73 LEU LEU A . n 
A 1 74 ASP 74 74 74 ASP ASP A . n 
A 1 75 PHE 75 75 75 PHE PHE A . n 
A 1 76 GLN 76 76 76 GLN GLN A . n 
A 1 77 GLU 77 77 77 GLU GLU A . n 
A 1 78 PHE 78 78 78 PHE PHE A . n 
A 1 79 LEU 79 79 79 LEU LEU A . n 
A 1 80 ASN 80 80 80 ASN ASN A . n 
A 1 81 LEU 81 81 81 LEU LEU A . n 
A 1 82 ILE 82 82 82 ILE ILE A . n 
A 1 83 GLY 83 83 83 GLY GLY A . n 
A 1 84 GLY 84 84 84 GLY GLY A . n 
A 1 85 LEU 85 85 85 LEU LEU A . n 
A 1 86 ALA 86 86 86 ALA ALA A . n 
A 1 87 ILE 87 87 87 ILE ILE A . n 
A 1 88 ALA 88 88 88 ALA ALA A . n 
A 1 89 CYS 89 89 89 CYS CYS A . n 
A 1 90 HIS 90 90 90 HIS HIS A . n 
A 1 91 ASP 91 91 91 ASP ASP A . n 
A 1 92 SER 92 92 92 SER SER A . n 
A 1 93 PHE 93 93 93 PHE PHE A . n 
A 1 94 ILE 94 94 94 ILE ILE A . n 
A 1 95 LYS 95 95 95 LYS LYS A . n 
A 1 96 SER 96 96 96 SER SER A . n 
A 1 97 THR 97 97 97 THR THR A . n 
A 1 98 GLN 98 98 98 GLN GLN A . n 
A 1 99 LYS 99 99 99 LYS LYS A . n 
B 2 1  ACE 1  0  0  ACE ACE D . n 
B 2 2  ALA 2  1  1  ALA ALA D . n 
B 2 3  MET 3  2  2  MET MET D . n 
B 2 4  VAL 4  3  3  VAL VAL D . n 
B 2 5  SER 5  4  4  SER SER D . n 
B 2 6  ALA 6  5  5  ALA ALA D . n 
B 2 7  PHE 7  6  6  PHE PHE D . n 
B 2 8  LEU 8  7  7  LEU LEU D . n 
B 2 9  LYS 9  8  8  LYS LYS D . n 
B 2 10 GLN 10 9  9  GLN GLN D . n 
B 2 11 ALA 11 10 10 ALA ALA D . n 
B 2 12 TRP 12 11 11 TRP TRP D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 CA  1  101  101  CA  CA  A . 
D 3 CA  1  102  102  CA  CA  A . 
E 4 HOH 1  2001 2001 HOH HOH A . 
E 4 HOH 2  2002 2002 HOH HOH A . 
E 4 HOH 3  2003 2003 HOH HOH A . 
E 4 HOH 4  2004 2004 HOH HOH A . 
E 4 HOH 5  2005 2005 HOH HOH A . 
E 4 HOH 6  2006 2006 HOH HOH A . 
E 4 HOH 7  2007 2007 HOH HOH A . 
E 4 HOH 8  2008 2008 HOH HOH A . 
E 4 HOH 9  2009 2009 HOH HOH A . 
E 4 HOH 10 2010 2010 HOH HOH A . 
E 4 HOH 11 2011 2011 HOH HOH A . 
E 4 HOH 12 2012 2012 HOH HOH A . 
E 4 HOH 13 2013 2013 HOH HOH A . 
E 4 HOH 14 2014 2014 HOH HOH A . 
E 4 HOH 15 2015 2015 HOH HOH A . 
E 4 HOH 16 2016 2016 HOH HOH A . 
E 4 HOH 17 2017 2017 HOH HOH A . 
E 4 HOH 18 2018 2018 HOH HOH A . 
E 4 HOH 19 2019 2019 HOH HOH A . 
E 4 HOH 20 2020 2020 HOH HOH A . 
E 4 HOH 21 2021 2021 HOH HOH A . 
E 4 HOH 22 2022 2022 HOH HOH A . 
E 4 HOH 23 2023 2023 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5820  ? 
1 MORE         -59.1 ? 
1 'SSA (A^2)'  12460 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z           1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 8_676 x-y+1,-y+2,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 
-1.0000000000 0.0000000000 134.2512580947 0.0000000000 0.0000000000 -1.0000000000 111.6100000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A ALA 23 ? A ALA 23   ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE2 ? A GLU 36 ? A GLU 36   ? 1_555 74.5  ? 
2  O   ? A ALA 23 ? A ALA 23   ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD1 ? A ASP 26 ? A ASP 26   ? 1_555 99.7  ? 
3  OE2 ? A GLU 36 ? A GLU 36   ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD1 ? A ASP 26 ? A ASP 26   ? 1_555 72.3  ? 
4  O   ? A ALA 23 ? A ALA 23   ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O   ? E HOH .  ? A HOH 2017 ? 1_555 173.9 ? 
5  OE2 ? A GLU 36 ? A GLU 36   ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O   ? E HOH .  ? A HOH 2017 ? 1_555 111.3 ? 
6  OD1 ? A ASP 26 ? A ASP 26   ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O   ? E HOH .  ? A HOH 2017 ? 1_555 80.7  ? 
7  O   ? A ALA 23 ? A ALA 23   ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O   ? A LYS 31 ? A LYS 31   ? 1_555 98.1  ? 
8  OE2 ? A GLU 36 ? A GLU 36   ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O   ? A LYS 31 ? A LYS 31   ? 1_555 121.4 ? 
9  OD1 ? A ASP 26 ? A ASP 26   ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O   ? A LYS 31 ? A LYS 31   ? 1_555 160.1 ? 
10 O   ? E HOH .  ? A HOH 2017 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O   ? A LYS 31 ? A LYS 31   ? 1_555 80.6  ? 
11 O   ? A ALA 23 ? A ALA 23   ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 36 ? A GLU 36   ? 1_555 96.7  ? 
12 OE2 ? A GLU 36 ? A GLU 36   ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 36 ? A GLU 36   ? 1_555 46.7  ? 
13 OD1 ? A ASP 26 ? A ASP 26   ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 36 ? A GLU 36   ? 1_555 108.3 ? 
14 O   ? E HOH .  ? A HOH 2017 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 36 ? A GLU 36   ? 1_555 88.9  ? 
15 O   ? A LYS 31 ? A LYS 31   ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 36 ? A GLU 36   ? 1_555 78.2  ? 
16 O   ? A ALA 23 ? A ALA 23   ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O   ? A ASN 28 ? A ASN 28   ? 1_555 78.0  ? 
17 OE2 ? A GLU 36 ? A GLU 36   ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O   ? A ASN 28 ? A ASN 28   ? 1_555 143.7 ? 
18 OD1 ? A ASP 26 ? A ASP 26   ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O   ? A ASN 28 ? A ASN 28   ? 1_555 89.7  ? 
19 O   ? E HOH .  ? A HOH 2017 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O   ? A ASN 28 ? A ASN 28   ? 1_555 96.0  ? 
20 O   ? A LYS 31 ? A LYS 31   ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O   ? A ASN 28 ? A ASN 28   ? 1_555 85.4  ? 
21 OE1 ? A GLU 36 ? A GLU 36   ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O   ? A ASN 28 ? A ASN 28   ? 1_555 161.9 ? 
22 O   ? A GLN 72 ? A GLN 72   ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OE1 ? A GLU 77 ? A GLU 77   ? 1_555 80.7  ? 
23 O   ? A GLN 72 ? A GLN 72   ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OE2 ? A GLU 77 ? A GLU 77   ? 1_555 120.7 ? 
24 OE1 ? A GLU 77 ? A GLU 77   ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OE2 ? A GLU 77 ? A GLU 77   ? 1_555 46.9  ? 
25 O   ? A GLN 72 ? A GLN 72   ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O   ? E HOH .  ? A HOH 2013 ? 1_555 93.7  ? 
26 OE1 ? A GLU 77 ? A GLU 77   ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O   ? E HOH .  ? A HOH 2013 ? 1_555 84.6  ? 
27 OE2 ? A GLU 77 ? A GLU 77   ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O   ? E HOH .  ? A HOH 2013 ? 1_555 104.7 ? 
28 O   ? A GLN 72 ? A GLN 72   ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 66 ? A ASP 66   ? 1_555 89.5  ? 
29 OE1 ? A GLU 77 ? A GLU 77   ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 66 ? A ASP 66   ? 1_555 116.4 ? 
30 OE2 ? A GLU 77 ? A GLU 77   ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 66 ? A ASP 66   ? 1_555 91.3  ? 
31 O   ? E HOH .  ? A HOH 2013 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 66 ? A ASP 66   ? 1_555 159.0 ? 
32 O   ? A GLN 72 ? A GLN 72   ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 68 ? A ASP 68   ? 1_555 159.6 ? 
33 OE1 ? A GLU 77 ? A GLU 77   ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 68 ? A ASP 68   ? 1_555 119.6 ? 
34 OE2 ? A GLU 77 ? A GLU 77   ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 68 ? A ASP 68   ? 1_555 77.7  ? 
35 O   ? E HOH .  ? A HOH 2013 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 68 ? A ASP 68   ? 1_555 89.3  ? 
36 OD1 ? A ASP 66 ? A ASP 66   ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 68 ? A ASP 68   ? 1_555 80.8  ? 
37 O   ? A GLN 72 ? A GLN 72   ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 70 ? A ASP 70   ? 1_555 76.3  ? 
38 OE1 ? A GLU 77 ? A GLU 77   ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 70 ? A ASP 70   ? 1_555 147.2 ? 
39 OE2 ? A GLU 77 ? A GLU 77   ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 70 ? A ASP 70   ? 1_555 162.9 ? 
40 O   ? E HOH .  ? A HOH 2013 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 70 ? A ASP 70   ? 1_555 74.0  ? 
41 OD1 ? A ASP 66 ? A ASP 66   ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 70 ? A ASP 70   ? 1_555 86.7  ? 
42 OD1 ? A ASP 68 ? A ASP 68   ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 70 ? A ASP 70   ? 1_555 85.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-02-25 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-03-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Derived calculations'      
5 4 'Structure model' 'Experimental preparation'  
6 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' exptl_crystal_grow   
2 4 'Structure model' pdbx_database_proc   
3 4 'Structure model' pdbx_database_status 
4 4 'Structure model' struct_conn          
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_exptl_crystal_grow.method'                  
2 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       . ? 1 
DENZO     'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
AMoRE     phasing          . ? 4 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
650 
;
HELIX
DETERMINATION METHOD: AUTHOR PROVIDED.
;
700 
;
SHEET
DETERMINATION METHOD: AUTHOR PROVIDED.
;
# 
_pdbx_entry_details.entry_id             1QLS 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'SYNTHETIC ANNEXIN I N-TERMINAL SEQUENCE' 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH2 A ARG 10 ? ? 116.98 120.30 -3.32 0.50 N 
2 1 CB A ASP 26 ? ? CG A ASP 26 ? ? OD2 A ASP 26 ? ? 130.73 118.30 12.43 0.90 N 
3 1 CD A ARG 60 ? ? NE A ARG 60 ? ? CZ  A ARG 60 ? ? 132.20 123.60 8.60  1.40 N 
4 1 NE A ARG 60 ? ? CZ A ARG 60 ? ? NH1 A ARG 60 ? ? 125.22 120.30 4.92  0.50 N 
5 1 CB A ASP 66 ? ? CG A ASP 66 ? ? OD2 A ASP 66 ? ? 132.50 118.30 14.20 0.90 N 
6 1 CB A ASP 68 ? ? CG A ASP 68 ? ? OD2 A ASP 68 ? ? 125.31 118.30 7.01  0.90 N 
7 1 CB A ASP 74 ? ? CG A ASP 74 ? ? OD1 A ASP 74 ? ? 125.83 118.30 7.53  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 26 ? ? -98.96  -159.03 
2 1 THR A 43 ? ? -132.16 -38.37  
3 1 GLN A 98 ? ? -114.01 65.59   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1 ? A MET 1 
2 1 Y 1 A ALA 2 ? A ALA 2 
3 1 Y 1 A LYS 3 ? A LYS 3 
4 1 Y 1 A ARG 4 ? A ARG 4 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'CALCIUM ION' CA  
4 water         HOH 
#