data_1QN5
# 
_entry.id   1QN5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.338 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QN5         
PDBE  EBI-4263     
WWPDB D_1290004263 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1QN3 unspecified 
;CRYSTAL STRUCTURE OF THE C(-25) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QN4 unspecified 
;CRYSTAL STRUCTURE OF THE T(-24) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QN6 unspecified 
;CRYSTAL STRUCTURE OF THE T(-26) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QN7 unspecified 
;CRYSTAL STRUCTURE OF THE T(-27) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QN8 unspecified 
;CRYSTAL STRUCTURE OF THE T(-28) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QN9 unspecified 
;CRYSTAL STRUCTURE OF THE C(-29) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QNA unspecified 
;CRYSTAL STRUCTURE OF THE T(-30) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QNB unspecified 
;CRYSTAL STRUCTURE OF THE T(-25) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QNC unspecified 
;CRYSTAL STRUCTURE OF THE A(-31) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QNE unspecified 
'CRYSTAL STRUCTURE OF THE ADENOVIRUS MAJOR LATE PROMOTER TATA BOX BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2).' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QN5 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   1999-10-14 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Patikoglou, G.A.' 1 ?                   
'Kim, J.L.'        2 ?                   
'Sun, L.'          3 ?                   
'Yang, S.-H.'      4 ?                   
'Kodadek, T.'      5 ?                   
'Burley, S.K.'     6 0000-0002-2487-9713 
# 
_citation.id                        primary 
_citation.title                     
'TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution' 
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_volume            13 
_citation.page_first                3217 
_citation.page_last                 ? 
_citation.year                      1999 
_citation.journal_id_ASTM           GEDEEP 
_citation.country                   US 
_citation.journal_id_ISSN           0890-9369 
_citation.journal_id_CSD            2056 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10617571 
_citation.pdbx_database_id_DOI      10.1101/GAD.13.24.3217 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Patikoglou, G.A.' 1 ?                   
primary 'Kim, J.L.'        2 ?                   
primary 'Sun, L.'          3 ?                   
primary 'Yang, S.-H.'      4 ?                   
primary 'Kodadek, T.'      5 ?                   
primary 'Burley, S.K.'     6 0000-0002-2487-9713 
# 
_cell.entry_id           1QN5 
_cell.length_a           41.800 
_cell.length_b           146.700 
_cell.length_c           57.400 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.50 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QN5 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'TRANSCRIPTION INITIATION FACTOR TFIID-1'                  22400.354 2   ? ? ? ? 
2 polymer syn 
;DNA (5'-D(*GP*CP*TP*AP*TP*AP*AP*GP*AP*GP*GP*GP*CP*A)-3')
;
4353.854  2   ? ? ? ? 
3 polymer syn 
;DNA (5'-D(*TP*GP*CP*CP*CP*TP*CP*TP*TP*AP*TP*AP*GP*C)-3')
;
4206.740  2   ? ? ? ? 
4 water   nat water                                                      18.015    501 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TATA-BOX FACTOR 1, TATA SEQUENCE-BINDING PROTEIN 1, TBP1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MTDQGLEGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMV
CTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKI
VLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKIQQ
;
;MTDQGLEGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMV
CTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKI
VLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKIQQ
;
A,B ? 
2 polydeoxyribonucleotide no no '(DG)(DC)(DT)(DA)(DT)(DA)(DA)(DG)(DA)(DG)(DG)(DG)(DC)(DA)' GCTATAAGAGGGCA C,E ? 
3 polydeoxyribonucleotide no no '(DT)(DG)(DC)(DC)(DC)(DT)(DC)(DT)(DT)(DA)(DT)(DA)(DG)(DC)' TGCCCTCTTATAGC D,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   ASP n 
1 4   GLN n 
1 5   GLY n 
1 6   LEU n 
1 7   GLU n 
1 8   GLY n 
1 9   SER n 
1 10  ASN n 
1 11  PRO n 
1 12  VAL n 
1 13  ASP n 
1 14  LEU n 
1 15  SER n 
1 16  LYS n 
1 17  HIS n 
1 18  PRO n 
1 19  SER n 
1 20  GLY n 
1 21  ILE n 
1 22  VAL n 
1 23  PRO n 
1 24  THR n 
1 25  LEU n 
1 26  GLN n 
1 27  ASN n 
1 28  ILE n 
1 29  VAL n 
1 30  SER n 
1 31  THR n 
1 32  VAL n 
1 33  ASN n 
1 34  LEU n 
1 35  ASP n 
1 36  CYS n 
1 37  LYS n 
1 38  LEU n 
1 39  ASP n 
1 40  LEU n 
1 41  LYS n 
1 42  ALA n 
1 43  ILE n 
1 44  ALA n 
1 45  LEU n 
1 46  GLN n 
1 47  ALA n 
1 48  ARG n 
1 49  ASN n 
1 50  ALA n 
1 51  GLU n 
1 52  TYR n 
1 53  ASN n 
1 54  PRO n 
1 55  LYS n 
1 56  ARG n 
1 57  PHE n 
1 58  ALA n 
1 59  ALA n 
1 60  VAL n 
1 61  ILE n 
1 62  MET n 
1 63  ARG n 
1 64  ILE n 
1 65  ARG n 
1 66  GLU n 
1 67  PRO n 
1 68  LYS n 
1 69  THR n 
1 70  THR n 
1 71  ALA n 
1 72  LEU n 
1 73  ILE n 
1 74  PHE n 
1 75  ALA n 
1 76  SER n 
1 77  GLY n 
1 78  LYS n 
1 79  MET n 
1 80  VAL n 
1 81  CYS n 
1 82  THR n 
1 83  GLY n 
1 84  ALA n 
1 85  LYS n 
1 86  SER n 
1 87  GLU n 
1 88  ASP n 
1 89  PHE n 
1 90  SER n 
1 91  LYS n 
1 92  MET n 
1 93  ALA n 
1 94  ALA n 
1 95  ARG n 
1 96  LYS n 
1 97  TYR n 
1 98  ALA n 
1 99  ARG n 
1 100 ILE n 
1 101 VAL n 
1 102 GLN n 
1 103 LYS n 
1 104 LEU n 
1 105 GLY n 
1 106 PHE n 
1 107 PRO n 
1 108 ALA n 
1 109 LYS n 
1 110 PHE n 
1 111 LYS n 
1 112 ASP n 
1 113 PHE n 
1 114 LYS n 
1 115 ILE n 
1 116 GLN n 
1 117 ASN n 
1 118 ILE n 
1 119 VAL n 
1 120 GLY n 
1 121 SER n 
1 122 CYS n 
1 123 ASP n 
1 124 VAL n 
1 125 LYS n 
1 126 PHE n 
1 127 PRO n 
1 128 ILE n 
1 129 ARG n 
1 130 LEU n 
1 131 GLU n 
1 132 GLY n 
1 133 LEU n 
1 134 ALA n 
1 135 TYR n 
1 136 SER n 
1 137 HIS n 
1 138 ALA n 
1 139 ALA n 
1 140 PHE n 
1 141 SER n 
1 142 SER n 
1 143 TYR n 
1 144 GLU n 
1 145 PRO n 
1 146 GLU n 
1 147 LEU n 
1 148 PHE n 
1 149 PRO n 
1 150 GLY n 
1 151 LEU n 
1 152 ILE n 
1 153 TYR n 
1 154 ARG n 
1 155 MET n 
1 156 LYS n 
1 157 VAL n 
1 158 PRO n 
1 159 LYS n 
1 160 ILE n 
1 161 VAL n 
1 162 LEU n 
1 163 LEU n 
1 164 ILE n 
1 165 PHE n 
1 166 VAL n 
1 167 SER n 
1 168 GLY n 
1 169 LYS n 
1 170 ILE n 
1 171 VAL n 
1 172 ILE n 
1 173 THR n 
1 174 GLY n 
1 175 ALA n 
1 176 LYS n 
1 177 MET n 
1 178 ARG n 
1 179 ASP n 
1 180 GLU n 
1 181 THR n 
1 182 TYR n 
1 183 LYS n 
1 184 ALA n 
1 185 PHE n 
1 186 GLU n 
1 187 ASN n 
1 188 ILE n 
1 189 TYR n 
1 190 PRO n 
1 191 VAL n 
1 192 LEU n 
1 193 SER n 
1 194 GLU n 
1 195 PHE n 
1 196 ARG n 
1 197 LYS n 
1 198 ILE n 
1 199 GLN n 
1 200 GLN n 
2 1   DG  n 
2 2   DC  n 
2 3   DT  n 
2 4   DA  n 
2 5   DT  n 
2 6   DA  n 
2 7   DA  n 
2 8   DG  n 
2 9   DA  n 
2 10  DG  n 
2 11  DG  n 
2 12  DG  n 
2 13  DC  n 
2 14  DA  n 
3 1   DT  n 
3 2   DG  n 
3 3   DC  n 
3 4   DC  n 
3 5   DC  n 
3 6   DT  n 
3 7   DC  n 
3 8   DT  n 
3 9   DT  n 
3 10  DA  n 
3 11  DT  n 
3 12  DA  n 
3 13  DG  n 
3 14  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'MOUSE-EAR CRESS' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'ARABIDOPSIS THALIANA' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     3702 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP TF21_ARATH 1 ? ? P28147 ? 
2 PDB 1QN5       2 ? ? 1QN5   ? 
3 PDB 1QN5       3 ? ? 1QN5   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1QN5 A 1 ? 200 ? P28147 1   ? 200 ? 1   200 
2 1 1QN5 B 1 ? 200 ? P28147 1   ? 200 ? 1   200 
3 2 1QN5 C 1 ? 14  ? 1QN5   201 ? 214 ? 201 214 
4 3 1QN5 D 1 ? 14  ? 1QN5   215 ? 228 ? 215 228 
5 2 1QN5 E 1 ? 14  ? 1QN5   201 ? 214 ? 201 214 
6 3 1QN5 F 1 ? 14  ? 1QN5   215 ? 228 ? 215 228 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1QN5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.84 
_exptl_crystal.density_percent_sol   56.72 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 6.00' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.92 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             0.92 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1QN5 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             15.000 
_reflns.d_resolution_high            1.930 
_reflns.number_obs                   51549 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.05000 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.300 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1QN5 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     48078 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6 
_refine.ls_d_res_high                            1.93 
_refine.ls_percent_reflns_obs                    98.7 
_refine.ls_R_factor_obs                          .196 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       .196 
_refine.ls_R_factor_R_free                       .252 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  4358 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2915 
_refine_hist.pdbx_number_atoms_nucleic_acid   1134 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             501 
_refine_hist.number_atoms_total               4550 
_refine_hist.d_res_high                       1.93 
_refine_hist.d_res_low                        6 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                .008 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.4  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?    ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.999990 
_struct_ncs_oper.matrix[1][2]   0.001720 
_struct_ncs_oper.matrix[1][3]   -0.002890 
_struct_ncs_oper.matrix[2][1]   0.001760 
_struct_ncs_oper.matrix[2][2]   -0.999890 
_struct_ncs_oper.matrix[2][3]   0.014620 
_struct_ncs_oper.matrix[3][1]   -0.002870 
_struct_ncs_oper.matrix[3][2]   -0.014630 
_struct_ncs_oper.matrix[3][3]   -0.999890 
_struct_ncs_oper.vector[1]      8.99841 
_struct_ncs_oper.vector[2]      -88.32040 
_struct_ncs_oper.vector[3]      217.52924 
# 
_struct.entry_id                  1QN5 
_struct.title                     
;Crystal structure of the G(-26) Adenovirus major late promoter TATA box variant bound to wild-type TBP (Arabidopsis thaliana TBP isoform 2). TATA element recognition by the TATA box-binding protein has been conserved throughout evolution.
;
_struct.pdbx_descriptor           'TRANSCRIPTION INITIATION FACTOR TFIID-1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QN5 
_struct_keywords.pdbx_keywords   'TATA BOX-BINDING PROTEIN (TBP)' 
_struct_keywords.text            
'TATA BOX-BINDING PROTEIN (TBP), ADENOVIRUS MAJOR LATE PROMOTER (ADMLP) TATA BOX, TBP-TATA ELEMENT COMPLEX, G(-26) TATA BOX VARIANT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 39  ? ALA A 47  ? ASP A 39  ALA A 47  1 ? 9  
HELX_P HELX_P2 2 SER A 86  ? LEU A 104 ? SER A 86  LEU A 104 1 ? 19 
HELX_P HELX_P3 3 ARG A 129 ? HIS A 137 ? ARG A 129 HIS A 137 1 ? 9  
HELX_P HELX_P4 4 MET A 177 ? PHE A 195 ? MET A 177 PHE A 195 1 ? 19 
HELX_P HELX_P5 5 ASP B 39  ? ALA B 47  ? ASP B 39  ALA B 47  1 ? 9  
HELX_P HELX_P6 6 SER B 86  ? LEU B 104 ? SER B 86  LEU B 104 1 ? 19 
HELX_P HELX_P7 7 ARG B 129 ? HIS B 137 ? ARG B 129 HIS B 137 1 ? 9  
HELX_P HELX_P8 8 MET B 177 ? SER B 193 ? MET B 177 SER B 193 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1  hydrog ? ? C DG 1  N1 ? ? ? 1_555 D DC 14 N3 ? ? C DG 201 D DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog2  hydrog ? ? C DG 1  N2 ? ? ? 1_555 D DC 14 O2 ? ? C DG 201 D DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog3  hydrog ? ? C DG 1  O6 ? ? ? 1_555 D DC 14 N4 ? ? C DG 201 D DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog4  hydrog ? ? C DC 2  N3 ? ? ? 1_555 D DG 13 N1 ? ? C DC 202 D DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog5  hydrog ? ? C DC 2  N4 ? ? ? 1_555 D DG 13 O6 ? ? C DC 202 D DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog6  hydrog ? ? C DC 2  O2 ? ? ? 1_555 D DG 13 N2 ? ? C DC 202 D DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog7  hydrog ? ? C DT 3  N3 ? ? ? 1_555 D DA 12 N1 ? ? C DT 203 D DA 226 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog8  hydrog ? ? C DT 3  O4 ? ? ? 1_555 D DA 12 N6 ? ? C DT 203 D DA 226 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog9  hydrog ? ? C DA 4  N1 ? ? ? 1_555 D DT 11 N3 ? ? C DA 204 D DT 225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog10 hydrog ? ? C DA 4  N6 ? ? ? 1_555 D DT 11 O4 ? ? C DA 204 D DT 225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog11 hydrog ? ? C DT 5  N3 ? ? ? 1_555 D DA 10 N1 ? ? C DT 205 D DA 224 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog12 hydrog ? ? C DT 5  O4 ? ? ? 1_555 D DA 10 N6 ? ? C DT 205 D DA 224 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog13 hydrog ? ? C DA 6  N1 ? ? ? 1_555 D DT 9  N3 ? ? C DA 206 D DT 223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog14 hydrog ? ? C DA 6  N6 ? ? ? 1_555 D DT 9  O4 ? ? C DA 206 D DT 223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog15 hydrog ? ? C DA 7  N1 ? ? ? 1_555 D DT 8  N3 ? ? C DA 207 D DT 222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog16 hydrog ? ? C DA 7  N6 ? ? ? 1_555 D DT 8  O4 ? ? C DA 207 D DT 222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog17 hydrog ? ? C DG 8  N1 ? ? ? 1_555 D DC 7  N3 ? ? C DG 208 D DC 221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog18 hydrog ? ? C DG 8  N2 ? ? ? 1_555 D DC 7  O2 ? ? C DG 208 D DC 221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog19 hydrog ? ? C DG 8  O6 ? ? ? 1_555 D DC 7  N4 ? ? C DG 208 D DC 221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog20 hydrog ? ? C DA 9  N1 ? ? ? 1_555 D DT 6  N3 ? ? C DA 209 D DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog21 hydrog ? ? C DA 9  N6 ? ? ? 1_555 D DT 6  O4 ? ? C DA 209 D DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog22 hydrog ? ? C DG 10 O6 ? ? ? 1_555 D DC 5  N4 ? ? C DG 210 D DC 219 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? ? 
hydrog23 hydrog ? ? C DG 11 N1 ? ? ? 1_555 D DC 4  N3 ? ? C DG 211 D DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog24 hydrog ? ? C DG 11 N2 ? ? ? 1_555 D DC 4  O2 ? ? C DG 211 D DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog25 hydrog ? ? C DG 11 O6 ? ? ? 1_555 D DC 4  N4 ? ? C DG 211 D DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog26 hydrog ? ? C DG 12 N1 ? ? ? 1_555 D DC 3  N3 ? ? C DG 212 D DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog27 hydrog ? ? C DG 12 N2 ? ? ? 1_555 D DC 3  O2 ? ? C DG 212 D DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog28 hydrog ? ? C DG 12 O6 ? ? ? 1_555 D DC 3  N4 ? ? C DG 212 D DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog29 hydrog ? ? C DC 13 N3 ? ? ? 1_555 D DG 2  N1 ? ? C DC 213 D DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog30 hydrog ? ? C DC 13 N4 ? ? ? 1_555 D DG 2  O6 ? ? C DC 213 D DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog31 hydrog ? ? C DC 13 O2 ? ? ? 1_555 D DG 2  N2 ? ? C DC 213 D DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog32 hydrog ? ? C DA 14 N1 ? ? ? 1_555 D DT 1  N3 ? ? C DA 214 D DT 215 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog33 hydrog ? ? C DA 14 N6 ? ? ? 1_555 D DT 1  O4 ? ? C DA 214 D DT 215 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog34 hydrog ? ? E DG 1  N1 ? ? ? 1_555 F DC 14 N3 ? ? E DG 201 F DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog35 hydrog ? ? E DG 1  N2 ? ? ? 1_555 F DC 14 O2 ? ? E DG 201 F DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog36 hydrog ? ? E DG 1  O6 ? ? ? 1_555 F DC 14 N4 ? ? E DG 201 F DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog37 hydrog ? ? E DC 2  N3 ? ? ? 1_555 F DG 13 N1 ? ? E DC 202 F DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog38 hydrog ? ? E DC 2  N4 ? ? ? 1_555 F DG 13 O6 ? ? E DC 202 F DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog39 hydrog ? ? E DC 2  O2 ? ? ? 1_555 F DG 13 N2 ? ? E DC 202 F DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog40 hydrog ? ? E DT 3  N3 ? ? ? 1_555 F DA 12 N1 ? ? E DT 203 F DA 226 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog41 hydrog ? ? E DT 3  O4 ? ? ? 1_555 F DA 12 N6 ? ? E DT 203 F DA 226 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog42 hydrog ? ? E DA 4  N1 ? ? ? 1_555 F DT 11 N3 ? ? E DA 204 F DT 225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog43 hydrog ? ? E DA 4  N6 ? ? ? 1_555 F DT 11 O4 ? ? E DA 204 F DT 225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog44 hydrog ? ? E DT 5  N3 ? ? ? 1_555 F DA 10 N1 ? ? E DT 205 F DA 224 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog45 hydrog ? ? E DT 5  O4 ? ? ? 1_555 F DA 10 N6 ? ? E DT 205 F DA 224 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog46 hydrog ? ? E DA 6  N1 ? ? ? 1_555 F DT 9  N3 ? ? E DA 206 F DT 223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog47 hydrog ? ? E DA 6  N6 ? ? ? 1_555 F DT 9  O4 ? ? E DA 206 F DT 223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog48 hydrog ? ? E DA 7  N1 ? ? ? 1_555 F DT 8  N3 ? ? E DA 207 F DT 222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog49 hydrog ? ? E DA 7  N6 ? ? ? 1_555 F DT 8  O4 ? ? E DA 207 F DT 222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog50 hydrog ? ? E DG 8  N1 ? ? ? 1_555 F DC 7  N3 ? ? E DG 208 F DC 221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog51 hydrog ? ? E DG 8  N2 ? ? ? 1_555 F DC 7  O2 ? ? E DG 208 F DC 221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog52 hydrog ? ? E DG 8  O6 ? ? ? 1_555 F DC 7  N4 ? ? E DG 208 F DC 221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog53 hydrog ? ? E DA 9  N1 ? ? ? 1_555 F DT 6  N3 ? ? E DA 209 F DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog54 hydrog ? ? E DA 9  N6 ? ? ? 1_555 F DT 6  O4 ? ? E DA 209 F DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog55 hydrog ? ? E DG 10 O6 ? ? ? 1_555 F DC 4  N4 ? ? E DG 210 F DC 218 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? ? 
hydrog56 hydrog ? ? E DG 10 O6 ? ? ? 1_555 F DC 5  N4 ? ? E DG 210 F DC 219 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? ? 
hydrog57 hydrog ? ? E DG 11 N1 ? ? ? 1_555 F DC 4  N3 ? ? E DG 211 F DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog58 hydrog ? ? E DG 11 N2 ? ? ? 1_555 F DC 4  O2 ? ? E DG 211 F DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog59 hydrog ? ? E DG 11 O6 ? ? ? 1_555 F DC 4  N4 ? ? E DG 211 F DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog60 hydrog ? ? E DG 12 N1 ? ? ? 1_555 F DC 3  N3 ? ? E DG 212 F DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog61 hydrog ? ? E DG 12 N2 ? ? ? 1_555 F DC 3  O2 ? ? E DG 212 F DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog62 hydrog ? ? E DG 12 O6 ? ? ? 1_555 F DC 3  N4 ? ? E DG 212 F DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog63 hydrog ? ? E DC 13 N3 ? ? ? 1_555 F DG 2  N1 ? ? E DC 213 F DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog64 hydrog ? ? E DC 13 N4 ? ? ? 1_555 F DG 2  O6 ? ? E DC 213 F DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog65 hydrog ? ? E DC 13 O2 ? ? ? 1_555 F DG 2  N2 ? ? E DC 213 F DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog66 hydrog ? ? E DA 14 N1 ? ? ? 1_555 F DT 1  N3 ? ? E DA 214 F DT 215 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog67 hydrog ? ? E DA 14 N6 ? ? ? 1_555 F DT 1  O4 ? ? E DA 214 F DT 215 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 66  A . ? GLU 66  A PRO 67  A ? PRO 67  A 1 -0.61 
2 VAL 157 A . ? VAL 157 A PRO 158 A ? PRO 158 A 1 -0.44 
3 GLU 66  B . ? GLU 66  B PRO 67  B ? PRO 67  B 1 -0.58 
4 VAL 157 B . ? VAL 157 B PRO 158 B ? PRO 158 B 1 -0.51 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 4 ? 
D ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 30  ? ASN A 33  ? SER A 30  ASN A 33  
A 2 LYS A 78  ? THR A 82  ? LYS A 78  THR A 82  
A 3 THR A 69  ? PHE A 74  ? THR A 69  PHE A 74  
A 4 ALA A 59  ? ILE A 64  ? ALA A 59  ILE A 64  
A 5 ALA A 50  ? TYR A 52  ? ALA A 50  TYR A 52  
B 1 LEU A 151 ? MET A 155 ? LEU A 151 MET A 155 
B 2 ILE A 160 ? ILE A 164 ? ILE A 160 ILE A 164 
B 3 LYS A 169 ? ALA A 175 ? LYS A 169 ALA A 175 
B 4 ASN A 117 ? ASP A 123 ? ASN A 117 ASP A 123 
B 5 THR A 24  ? VAL A 29  ? THR A 24  VAL A 29  
C 1 SER B 30  ? ASN B 33  ? SER B 30  ASN B 33  
C 2 LYS B 78  ? THR B 82  ? LYS B 78  THR B 82  
C 3 THR B 69  ? ILE B 73  ? THR B 69  ILE B 73  
C 4 VAL B 60  ? ILE B 64  ? VAL B 60  ILE B 64  
D 1 LEU B 151 ? MET B 155 ? LEU B 151 MET B 155 
D 2 ILE B 160 ? ILE B 164 ? ILE B 160 ILE B 164 
D 3 LYS B 169 ? ALA B 175 ? LYS B 169 ALA B 175 
D 4 ASN B 117 ? ASP B 123 ? ASN B 117 ASP B 123 
D 5 THR B 24  ? VAL B 29  ? THR B 24  VAL B 29  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER A 30  ? O SER A 30  N CYS A 81  ? N CYS A 81  
A 2 3 O VAL A 80  ? O VAL A 80  N LEU A 72  ? N LEU A 72  
A 3 4 O THR A 69  ? O THR A 69  N ILE A 64  ? N ILE A 64  
A 4 5 O ILE A 61  ? O ILE A 61  N GLU A 51  ? N GLU A 51  
B 1 2 O LEU A 151 ? O LEU A 151 N ILE A 164 ? N ILE A 164 
B 2 3 O VAL A 161 ? O VAL A 161 N THR A 173 ? N THR A 173 
B 3 4 O ILE A 170 ? O ILE A 170 N CYS A 122 ? N CYS A 122 
B 4 5 O ASN A 117 ? O ASN A 117 N VAL A 29  ? N VAL A 29  
C 1 2 O SER B 30  ? O SER B 30  N CYS B 81  ? N CYS B 81  
C 2 3 O VAL B 80  ? O VAL B 80  N LEU B 72  ? N LEU B 72  
C 3 4 O THR B 69  ? O THR B 69  N ILE B 64  ? N ILE B 64  
D 1 2 O LEU B 151 ? O LEU B 151 N ILE B 164 ? N ILE B 164 
D 2 3 O VAL B 161 ? O VAL B 161 N THR B 173 ? N THR B 173 
D 3 4 O ILE B 170 ? O ILE B 170 N CYS B 122 ? N CYS B 122 
D 4 5 O ASN B 117 ? O ASN B 117 N VAL B 29  ? N VAL B 29  
# 
_database_PDB_matrix.entry_id          1QN5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QN5 
_atom_sites.fract_transf_matrix[1][1]   0.023923 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000209 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006817 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017422 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . LYS A 1 16  ? 28.668  86.381  40.098 1.00 43.71 ? 16   LYS A N     1 
ATOM   2    C CA    . LYS A 1 16  ? 28.442  84.899  40.111 1.00 42.75 ? 16   LYS A CA    1 
ATOM   3    C C     . LYS A 1 16  ? 27.176  84.589  40.908 1.00 41.19 ? 16   LYS A C     1 
ATOM   4    O O     . LYS A 1 16  ? 26.417  83.676  40.566 1.00 42.14 ? 16   LYS A O     1 
ATOM   5    C CB    . LYS A 1 16  ? 29.648  84.191  40.745 1.00 44.58 ? 16   LYS A CB    1 
ATOM   6    C CG    . LYS A 1 16  ? 29.952  82.790  40.200 1.00 46.71 ? 16   LYS A CG    1 
ATOM   7    C CD    . LYS A 1 16  ? 28.840  81.776  40.488 1.00 47.67 ? 16   LYS A CD    1 
ATOM   8    C CE    . LYS A 1 16  ? 29.336  80.345  40.300 1.00 48.64 ? 16   LYS A CE    1 
ATOM   9    N NZ    . LYS A 1 16  ? 30.452  80.009  41.256 1.00 49.56 ? 16   LYS A NZ    1 
ATOM   10   N N     . HIS A 1 17  ? 26.966  85.338  41.988 1.00 38.82 ? 17   HIS A N     1 
ATOM   11   C CA    . HIS A 1 17  ? 25.782  85.161  42.837 1.00 36.72 ? 17   HIS A CA    1 
ATOM   12   C C     . HIS A 1 17  ? 25.154  86.520  43.102 1.00 34.50 ? 17   HIS A C     1 
ATOM   13   O O     . HIS A 1 17  ? 25.190  87.019  44.223 1.00 34.16 ? 17   HIS A O     1 
ATOM   14   C CB    . HIS A 1 17  ? 26.145  84.481  44.167 1.00 35.77 ? 17   HIS A CB    1 
ATOM   15   C CG    . HIS A 1 17  ? 26.743  83.117  44.002 1.00 35.49 ? 17   HIS A CG    1 
ATOM   16   N ND1   . HIS A 1 17  ? 26.012  82.031  43.579 1.00 34.32 ? 17   HIS A ND1   1 
ATOM   17   C CD2   . HIS A 1 17  ? 28.013  82.674  44.167 1.00 35.17 ? 17   HIS A CD2   1 
ATOM   18   C CE1   . HIS A 1 17  ? 26.801  80.978  43.487 1.00 35.22 ? 17   HIS A CE1   1 
ATOM   19   N NE2   . HIS A 1 17  ? 28.021  81.342  43.839 1.00 35.71 ? 17   HIS A NE2   1 
ATOM   20   N N     . PRO A 1 18  ? 24.533  87.115  42.073 1.00 34.17 ? 18   PRO A N     1 
ATOM   21   C CA    . PRO A 1 18  ? 23.869  88.426  42.114 1.00 33.87 ? 18   PRO A CA    1 
ATOM   22   C C     . PRO A 1 18  ? 22.905  88.611  43.274 1.00 33.64 ? 18   PRO A C     1 
ATOM   23   O O     . PRO A 1 18  ? 22.745  89.720  43.791 1.00 34.68 ? 18   PRO A O     1 
ATOM   24   C CB    . PRO A 1 18  ? 23.140  88.475  40.776 1.00 34.88 ? 18   PRO A CB    1 
ATOM   25   C CG    . PRO A 1 18  ? 24.045  87.693  39.882 1.00 35.14 ? 18   PRO A CG    1 
ATOM   26   C CD    . PRO A 1 18  ? 24.391  86.503  40.740 1.00 34.12 ? 18   PRO A CD    1 
ATOM   27   N N     . SER A 1 19  ? 22.238  87.530  43.659 1.00 33.02 ? 19   SER A N     1 
ATOM   28   C CA    . SER A 1 19  ? 21.286  87.560  44.762 1.00 32.34 ? 19   SER A CA    1 
ATOM   29   C C     . SER A 1 19  ? 22.009  87.777  46.082 1.00 32.63 ? 19   SER A C     1 
ATOM   30   O O     . SER A 1 19  ? 21.410  88.233  47.064 1.00 33.50 ? 19   SER A O     1 
ATOM   31   C CB    . SER A 1 19  ? 20.516  86.231  44.820 1.00 32.63 ? 19   SER A CB    1 
ATOM   32   O OG    . SER A 1 19  ? 21.398  85.118  44.947 1.00 29.37 ? 19   SER A OG    1 
ATOM   33   N N     . GLY A 1 20  ? 23.292  87.421  46.102 1.00 32.10 ? 20   GLY A N     1 
ATOM   34   C CA    . GLY A 1 20  ? 24.098  87.539  47.303 1.00 31.48 ? 20   GLY A CA    1 
ATOM   35   C C     . GLY A 1 20  ? 23.869  86.331  48.193 1.00 31.37 ? 20   GLY A C     1 
ATOM   36   O O     . GLY A 1 20  ? 24.295  86.300  49.350 1.00 32.14 ? 20   GLY A O     1 
ATOM   37   N N     . ILE A 1 21  ? 23.166  85.336  47.656 1.00 30.58 ? 21   ILE A N     1 
ATOM   38   C CA    . ILE A 1 21  ? 22.859  84.117  48.397 1.00 28.55 ? 21   ILE A CA    1 
ATOM   39   C C     . ILE A 1 21  ? 23.462  82.943  47.640 1.00 27.08 ? 21   ILE A C     1 
ATOM   40   O O     . ILE A 1 21  ? 23.325  82.852  46.416 1.00 26.99 ? 21   ILE A O     1 
ATOM   41   C CB    . ILE A 1 21  ? 21.321  83.895  48.523 1.00 29.33 ? 21   ILE A CB    1 
ATOM   42   C CG1   . ILE A 1 21  ? 20.674  85.061  49.290 1.00 29.31 ? 21   ILE A CG1   1 
ATOM   43   C CG2   . ILE A 1 21  ? 21.032  82.557  49.212 1.00 28.93 ? 21   ILE A CG2   1 
ATOM   44   C CD1   . ILE A 1 21  ? 19.153  84.989  49.407 1.00 27.72 ? 21   ILE A CD1   1 
ATOM   45   N N     . VAL A 1 22  ? 24.171  82.076  48.355 1.00 25.07 ? 22   VAL A N     1 
ATOM   46   C CA    . VAL A 1 22  ? 24.778  80.907  47.733 1.00 23.34 ? 22   VAL A CA    1 
ATOM   47   C C     . VAL A 1 22  ? 24.176  79.629  48.296 1.00 21.42 ? 22   VAL A C     1 
ATOM   48   O O     . VAL A 1 22  ? 24.354  79.325  49.473 1.00 21.36 ? 22   VAL A O     1 
ATOM   49   C CB    . VAL A 1 22  ? 26.304  80.835  47.971 1.00 24.65 ? 22   VAL A CB    1 
ATOM   50   C CG1   . VAL A 1 22  ? 26.902  79.677  47.169 1.00 22.77 ? 22   VAL A CG1   1 
ATOM   51   C CG2   . VAL A 1 22  ? 26.975  82.163  47.596 1.00 26.06 ? 22   VAL A CG2   1 
ATOM   52   N N     . PRO A 1 23  ? 23.412  78.889  47.474 1.00 20.31 ? 23   PRO A N     1 
ATOM   53   C CA    . PRO A 1 23  ? 22.808  77.635  47.933 1.00 19.20 ? 23   PRO A CA    1 
ATOM   54   C C     . PRO A 1 23  ? 23.873  76.750  48.611 1.00 19.40 ? 23   PRO A C     1 
ATOM   55   O O     . PRO A 1 23  ? 25.011  76.663  48.147 1.00 19.70 ? 23   PRO A O     1 
ATOM   56   C CB    . PRO A 1 23  ? 22.343  76.994  46.628 1.00 17.92 ? 23   PRO A CB    1 
ATOM   57   C CG    . PRO A 1 23  ? 21.973  78.169  45.790 1.00 17.35 ? 23   PRO A CG    1 
ATOM   58   C CD    . PRO A 1 23  ? 23.038  79.187  46.077 1.00 17.92 ? 23   PRO A CD    1 
ATOM   59   N N     . THR A 1 24  ? 23.507  76.141  49.731 1.00 19.64 ? 24   THR A N     1 
ATOM   60   C CA    . THR A 1 24  ? 24.388  75.246  50.482 1.00 18.75 ? 24   THR A CA    1 
ATOM   61   C C     . THR A 1 24  ? 24.220  73.830  49.926 1.00 17.58 ? 24   THR A C     1 
ATOM   62   O O     . THR A 1 24  ? 23.098  73.342  49.808 1.00 17.87 ? 24   THR A O     1 
ATOM   63   C CB    . THR A 1 24  ? 23.967  75.231  51.962 1.00 19.80 ? 24   THR A CB    1 
ATOM   64   O OG1   . THR A 1 24  ? 23.993  76.568  52.476 1.00 21.68 ? 24   THR A OG1   1 
ATOM   65   C CG2   . THR A 1 24  ? 24.897  74.359  52.784 1.00 21.75 ? 24   THR A CG2   1 
ATOM   66   N N     . LEU A 1 25  ? 25.304  73.174  49.540 1.00 16.92 ? 25   LEU A N     1 
ATOM   67   C CA    . LEU A 1 25  ? 25.172  71.811  49.027 1.00 17.78 ? 25   LEU A CA    1 
ATOM   68   C C     . LEU A 1 25  ? 24.887  70.898  50.221 1.00 18.64 ? 25   LEU A C     1 
ATOM   69   O O     . LEU A 1 25  ? 25.578  70.973  51.241 1.00 20.20 ? 25   LEU A O     1 
ATOM   70   C CB    . LEU A 1 25  ? 26.433  71.379  48.268 1.00 17.20 ? 25   LEU A CB    1 
ATOM   71   C CG    . LEU A 1 25  ? 26.834  72.270  47.083 1.00 15.95 ? 25   LEU A CG    1 
ATOM   72   C CD1   . LEU A 1 25  ? 27.932  71.588  46.281 1.00 14.90 ? 25   LEU A CD1   1 
ATOM   73   C CD2   . LEU A 1 25  ? 25.603  72.563  46.192 1.00 14.68 ? 25   LEU A CD2   1 
ATOM   74   N N     . GLN A 1 26  ? 23.869  70.051  50.096 1.00 18.60 ? 26   GLN A N     1 
ATOM   75   C CA    . GLN A 1 26  ? 23.442  69.180  51.194 1.00 19.14 ? 26   GLN A CA    1 
ATOM   76   C C     . GLN A 1 26  ? 23.608  67.679  51.003 1.00 18.93 ? 26   GLN A C     1 
ATOM   77   O O     . GLN A 1 26  ? 23.730  66.934  51.972 1.00 19.12 ? 26   GLN A O     1 
ATOM   78   C CB    . GLN A 1 26  ? 21.963  69.457  51.502 1.00 19.40 ? 26   GLN A CB    1 
ATOM   79   C CG    . GLN A 1 26  ? 21.622  70.914  51.788 1.00 18.26 ? 26   GLN A CG    1 
ATOM   80   C CD    . GLN A 1 26  ? 22.053  71.381  53.172 1.00 20.52 ? 26   GLN A CD    1 
ATOM   81   O OE1   . GLN A 1 26  ? 22.682  70.646  53.937 1.00 20.98 ? 26   GLN A OE1   1 
ATOM   82   N NE2   . GLN A 1 26  ? 21.683  72.606  53.512 1.00 21.27 ? 26   GLN A NE2   1 
ATOM   83   N N     . ASN A 1 27  ? 23.563  67.228  49.760 1.00 19.15 ? 27   ASN A N     1 
ATOM   84   C CA    . ASN A 1 27  ? 23.669  65.807  49.469 1.00 19.12 ? 27   ASN A CA    1 
ATOM   85   C C     . ASN A 1 27  ? 24.206  65.623  48.053 1.00 19.54 ? 27   ASN A C     1 
ATOM   86   O O     . ASN A 1 27  ? 23.786  66.326  47.127 1.00 20.80 ? 27   ASN A O     1 
ATOM   87   C CB    . ASN A 1 27  ? 22.274  65.171  49.593 1.00 17.59 ? 27   ASN A CB    1 
ATOM   88   C CG    . ASN A 1 27  ? 22.278  63.667  49.366 1.00 16.93 ? 27   ASN A CG    1 
ATOM   89   O OD1   . ASN A 1 27  ? 23.219  62.971  49.732 1.00 16.48 ? 27   ASN A OD1   1 
ATOM   90   N ND2   . ASN A 1 27  ? 21.203  63.159  48.781 1.00 16.02 ? 27   ASN A ND2   1 
ATOM   91   N N     . ILE A 1 28  ? 25.155  64.708  47.895 1.00 18.27 ? 28   ILE A N     1 
ATOM   92   C CA    . ILE A 1 28  ? 25.734  64.420  46.595 1.00 17.42 ? 28   ILE A CA    1 
ATOM   93   C C     . ILE A 1 28  ? 25.589  62.917  46.404 1.00 17.50 ? 28   ILE A C     1 
ATOM   94   O O     . ILE A 1 28  ? 25.790  62.151  47.346 1.00 18.30 ? 28   ILE A O     1 
ATOM   95   C CB    . ILE A 1 28  ? 27.258  64.776  46.543 1.00 17.33 ? 28   ILE A CB    1 
ATOM   96   C CG1   . ILE A 1 28  ? 27.506  66.217  46.977 1.00 16.62 ? 28   ILE A CG1   1 
ATOM   97   C CG2   . ILE A 1 28  ? 27.812  64.561  45.146 1.00 17.55 ? 28   ILE A CG2   1 
ATOM   98   C CD1   . ILE A 1 28  ? 26.985  67.234  46.052 1.00 17.75 ? 28   ILE A CD1   1 
ATOM   99   N N     . VAL A 1 29  ? 25.182  62.509  45.204 1.00 17.77 ? 29   VAL A N     1 
ATOM   100  C CA    . VAL A 1 29  ? 25.033  61.106  44.842 1.00 17.71 ? 29   VAL A CA    1 
ATOM   101  C C     . VAL A 1 29  ? 26.017  60.874  43.701 1.00 18.84 ? 29   VAL A C     1 
ATOM   102  O O     . VAL A 1 29  ? 25.971  61.575  42.692 1.00 19.03 ? 29   VAL A O     1 
ATOM   103  C CB    . VAL A 1 29  ? 23.604  60.785  44.334 1.00 16.84 ? 29   VAL A CB    1 
ATOM   104  C CG1   . VAL A 1 29  ? 23.526  59.363  43.790 1.00 17.96 ? 29   VAL A CG1   1 
ATOM   105  C CG2   . VAL A 1 29  ? 22.597  60.955  45.455 1.00 17.98 ? 29   VAL A CG2   1 
ATOM   106  N N     . SER A 1 30  ? 26.918  59.913  43.869 1.00 19.07 ? 30   SER A N     1 
ATOM   107  C CA    . SER A 1 30  ? 27.899  59.599  42.838 1.00 19.92 ? 30   SER A CA    1 
ATOM   108  C C     . SER A 1 30  ? 27.919  58.090  42.607 1.00 21.29 ? 30   SER A C     1 
ATOM   109  O O     . SER A 1 30  ? 27.372  57.324  43.409 1.00 20.72 ? 30   SER A O     1 
ATOM   110  C CB    . SER A 1 30  ? 29.287  60.086  43.264 1.00 19.50 ? 30   SER A CB    1 
ATOM   111  O OG    . SER A 1 30  ? 29.730  59.427  44.442 1.00 19.68 ? 30   SER A OG    1 
ATOM   112  N N     . THR A 1 31  ? 28.485  57.675  41.478 1.00 21.57 ? 31   THR A N     1 
ATOM   113  C CA    . THR A 1 31  ? 28.608  56.264  41.141 1.00 21.11 ? 31   THR A CA    1 
ATOM   114  C C     . THR A 1 31  ? 30.022  56.037  40.633 1.00 21.60 ? 31   THR A C     1 
ATOM   115  O O     . THR A 1 31  ? 30.679  56.970  40.158 1.00 20.80 ? 31   THR A O     1 
ATOM   116  C CB    . THR A 1 31  ? 27.604  55.810  40.025 1.00 20.92 ? 31   THR A CB    1 
ATOM   117  O OG1   . THR A 1 31  ? 27.756  56.625  38.856 1.00 23.16 ? 31   THR A OG1   1 
ATOM   118  C CG2   . THR A 1 31  ? 26.172  55.893  40.504 1.00 18.48 ? 31   THR A CG2   1 
ATOM   119  N N     . VAL A 1 32  ? 30.509  54.813  40.807 1.00 22.95 ? 32   VAL A N     1 
ATOM   120  C CA    . VAL A 1 32  ? 31.829  54.418  40.334 1.00 22.83 ? 32   VAL A CA    1 
ATOM   121  C C     . VAL A 1 32  ? 31.781  52.928  40.010 1.00 24.14 ? 32   VAL A C     1 
ATOM   122  O O     . VAL A 1 32  ? 30.943  52.178  40.537 1.00 22.78 ? 32   VAL A O     1 
ATOM   123  C CB    . VAL A 1 32  ? 32.958  54.723  41.351 1.00 23.46 ? 32   VAL A CB    1 
ATOM   124  C CG1   . VAL A 1 32  ? 32.860  53.811  42.556 1.00 25.23 ? 32   VAL A CG1   1 
ATOM   125  C CG2   . VAL A 1 32  ? 34.328  54.579  40.684 1.00 22.84 ? 32   VAL A CG2   1 
ATOM   126  N N     . ASN A 1 33  ? 32.652  52.526  39.092 1.00 25.39 ? 33   ASN A N     1 
ATOM   127  C CA    . ASN A 1 33  ? 32.749  51.148  38.637 1.00 26.76 ? 33   ASN A CA    1 
ATOM   128  C C     . ASN A 1 33  ? 34.014  50.541  39.222 1.00 27.04 ? 33   ASN A C     1 
ATOM   129  O O     . ASN A 1 33  ? 35.117  50.944  38.869 1.00 27.21 ? 33   ASN A O     1 
ATOM   130  C CB    . ASN A 1 33  ? 32.808  51.121  37.107 1.00 27.33 ? 33   ASN A CB    1 
ATOM   131  C CG    . ASN A 1 33  ? 32.814  49.720  36.547 1.00 29.79 ? 33   ASN A CG    1 
ATOM   132  O OD1   . ASN A 1 33  ? 32.684  48.740  37.279 1.00 30.33 ? 33   ASN A OD1   1 
ATOM   133  N ND2   . ASN A 1 33  ? 32.959  49.615  35.232 1.00 31.18 ? 33   ASN A ND2   1 
ATOM   134  N N     . LEU A 1 34  ? 33.855  49.609  40.155 1.00 28.16 ? 34   LEU A N     1 
ATOM   135  C CA    . LEU A 1 34  ? 35.006  48.963  40.777 1.00 29.37 ? 34   LEU A CA    1 
ATOM   136  C C     . LEU A 1 34  ? 35.694  48.041  39.766 1.00 30.94 ? 34   LEU A C     1 
ATOM   137  O O     . LEU A 1 34  ? 36.824  47.587  39.983 1.00 30.66 ? 34   LEU A O     1 
ATOM   138  C CB    . LEU A 1 34  ? 34.593  48.214  42.052 1.00 27.19 ? 34   LEU A CB    1 
ATOM   139  C CG    . LEU A 1 34  ? 33.975  49.121  43.120 1.00 26.03 ? 34   LEU A CG    1 
ATOM   140  C CD1   . LEU A 1 34  ? 33.702  48.330  44.382 1.00 27.31 ? 34   LEU A CD1   1 
ATOM   141  C CD2   . LEU A 1 34  ? 34.888  50.308  43.410 1.00 24.79 ? 34   LEU A CD2   1 
ATOM   142  N N     . ASP A 1 35  ? 34.985  47.755  38.676 1.00 31.93 ? 35   ASP A N     1 
ATOM   143  C CA    . ASP A 1 35  ? 35.500  46.945  37.586 1.00 34.65 ? 35   ASP A CA    1 
ATOM   144  C C     . ASP A 1 35  ? 35.966  45.526  37.948 1.00 35.63 ? 35   ASP A C     1 
ATOM   145  O O     . ASP A 1 35  ? 37.076  45.117  37.593 1.00 35.92 ? 35   ASP A O     1 
ATOM   146  C CB    . ASP A 1 35  ? 36.625  47.718  36.886 1.00 35.94 ? 35   ASP A CB    1 
ATOM   147  C CG    . ASP A 1 35  ? 36.799  47.330  35.426 1.00 37.01 ? 35   ASP A CG    1 
ATOM   148  O OD1   . ASP A 1 35  ? 35.939  46.613  34.864 1.00 38.07 ? 35   ASP A OD1   1 
ATOM   149  O OD2   . ASP A 1 35  ? 37.803  47.770  34.833 1.00 38.77 ? 35   ASP A OD2   1 
ATOM   150  N N     . CYS A 1 36  ? 35.106  44.788  38.648 1.00 36.28 ? 36   CYS A N     1 
ATOM   151  C CA    . CYS A 1 36  ? 35.364  43.405  39.048 1.00 36.69 ? 36   CYS A CA    1 
ATOM   152  C C     . CYS A 1 36  ? 34.129  42.927  39.782 1.00 36.60 ? 36   CYS A C     1 
ATOM   153  O O     . CYS A 1 36  ? 33.497  43.706  40.490 1.00 37.15 ? 36   CYS A O     1 
ATOM   154  C CB    . CYS A 1 36  ? 36.593  43.288  39.958 1.00 37.34 ? 36   CYS A CB    1 
ATOM   155  S SG    . CYS A 1 36  ? 36.427  43.922  41.641 1.00 38.84 ? 36   CYS A SG    1 
ATOM   156  N N     . LYS A 1 37  ? 33.729  41.680  39.548 1.00 37.00 ? 37   LYS A N     1 
ATOM   157  C CA    . LYS A 1 37  ? 32.550  41.141  40.217 1.00 36.18 ? 37   LYS A CA    1 
ATOM   158  C C     . LYS A 1 37  ? 32.824  41.019  41.704 1.00 34.43 ? 37   LYS A C     1 
ATOM   159  O O     . LYS A 1 37  ? 33.960  40.759  42.114 1.00 34.85 ? 37   LYS A O     1 
ATOM   160  C CB    . LYS A 1 37  ? 32.133  39.792  39.629 1.00 37.98 ? 37   LYS A CB    1 
ATOM   161  C CG    . LYS A 1 37  ? 31.297  39.921  38.364 1.00 41.04 ? 37   LYS A CG    1 
ATOM   162  C CD    . LYS A 1 37  ? 30.116  38.920  38.340 1.00 44.00 ? 37   LYS A CD    1 
ATOM   163  C CE    . LYS A 1 37  ? 28.955  39.298  39.293 1.00 41.93 ? 37   LYS A CE    1 
ATOM   164  N NZ    . LYS A 1 37  ? 29.249  39.024  40.733 1.00 42.75 ? 37   LYS A NZ    1 
ATOM   165  N N     . LEU A 1 38  ? 31.786  41.210  42.509 1.00 31.94 ? 38   LEU A N     1 
ATOM   166  C CA    . LEU A 1 38  ? 31.926  41.161  43.952 1.00 29.33 ? 38   LEU A CA    1 
ATOM   167  C C     . LEU A 1 38  ? 31.040  40.087  44.525 1.00 29.06 ? 38   LEU A C     1 
ATOM   168  O O     . LEU A 1 38  ? 29.993  39.777  43.966 1.00 29.65 ? 38   LEU A O     1 
ATOM   169  C CB    . LEU A 1 38  ? 31.560  42.519  44.561 1.00 26.59 ? 38   LEU A CB    1 
ATOM   170  C CG    . LEU A 1 38  ? 32.395  43.718  44.112 1.00 23.94 ? 38   LEU A CG    1 
ATOM   171  C CD1   . LEU A 1 38  ? 31.891  44.973  44.804 1.00 23.04 ? 38   LEU A CD1   1 
ATOM   172  C CD2   . LEU A 1 38  ? 33.866  43.491  44.423 1.00 23.05 ? 38   LEU A CD2   1 
ATOM   173  N N     . ASP A 1 39  ? 31.496  39.488  45.619 1.00 29.41 ? 39   ASP A N     1 
ATOM   174  C CA    . ASP A 1 39  ? 30.758  38.437  46.312 1.00 28.99 ? 39   ASP A CA    1 
ATOM   175  C C     . ASP A 1 39  ? 30.148  39.175  47.479 1.00 27.84 ? 39   ASP A C     1 
ATOM   176  O O     . ASP A 1 39  ? 30.837  39.451  48.459 1.00 27.06 ? 39   ASP A O     1 
ATOM   177  C CB    . ASP A 1 39  ? 31.737  37.370  46.818 1.00 30.35 ? 39   ASP A CB    1 
ATOM   178  C CG    . ASP A 1 39  ? 31.049  36.210  47.519 1.00 32.20 ? 39   ASP A CG    1 
ATOM   179  O OD1   . ASP A 1 39  ? 29.921  36.368  48.036 1.00 31.78 ? 39   ASP A OD1   1 
ATOM   180  O OD2   . ASP A 1 39  ? 31.665  35.124  47.573 1.00 34.59 ? 39   ASP A OD2   1 
ATOM   181  N N     . LEU A 1 40  ? 28.858  39.472  47.389 1.00 27.70 ? 40   LEU A N     1 
ATOM   182  C CA    . LEU A 1 40  ? 28.194  40.231  48.445 1.00 29.04 ? 40   LEU A CA    1 
ATOM   183  C C     . LEU A 1 40  ? 28.084  39.556  49.820 1.00 30.09 ? 40   LEU A C     1 
ATOM   184  O O     . LEU A 1 40  ? 28.146  40.233  50.846 1.00 29.56 ? 40   LEU A O     1 
ATOM   185  C CB    . LEU A 1 40  ? 26.851  40.797  47.954 1.00 27.38 ? 40   LEU A CB    1 
ATOM   186  C CG    . LEU A 1 40  ? 26.925  41.718  46.717 1.00 25.11 ? 40   LEU A CG    1 
ATOM   187  C CD1   . LEU A 1 40  ? 25.578  42.417  46.496 1.00 23.02 ? 40   LEU A CD1   1 
ATOM   188  C CD2   . LEU A 1 40  ? 28.042  42.752  46.873 1.00 22.58 ? 40   LEU A CD2   1 
ATOM   189  N N     . LYS A 1 41  ? 27.945  38.233  49.855 1.00 31.52 ? 41   LYS A N     1 
ATOM   190  C CA    . LYS A 1 41  ? 27.887  37.531  51.137 1.00 31.52 ? 41   LYS A CA    1 
ATOM   191  C C     . LYS A 1 41  ? 29.243  37.575  51.814 1.00 30.63 ? 41   LYS A C     1 
ATOM   192  O O     . LYS A 1 41  ? 29.335  37.761  53.023 1.00 31.93 ? 41   LYS A O     1 
ATOM   193  C CB    . LYS A 1 41  ? 27.472  36.072  50.970 1.00 32.93 ? 41   LYS A CB    1 
ATOM   194  C CG    . LYS A 1 41  ? 25.984  35.858  50.932 1.00 36.87 ? 41   LYS A CG    1 
ATOM   195  C CD    . LYS A 1 41  ? 25.252  36.758  51.944 1.00 40.75 ? 41   LYS A CD    1 
ATOM   196  C CE    . LYS A 1 41  ? 25.715  36.596  53.392 1.00 41.07 ? 41   LYS A CE    1 
ATOM   197  N NZ    . LYS A 1 41  ? 24.952  37.543  54.262 1.00 41.93 ? 41   LYS A NZ    1 
ATOM   198  N N     . ALA A 1 42  ? 30.301  37.389  51.034 1.00 30.19 ? 42   ALA A N     1 
ATOM   199  C CA    . ALA A 1 42  ? 31.651  37.420  51.584 1.00 29.27 ? 42   ALA A CA    1 
ATOM   200  C C     . ALA A 1 42  ? 31.922  38.787  52.180 1.00 28.38 ? 42   ALA A C     1 
ATOM   201  O O     . ALA A 1 42  ? 32.514  38.890  53.255 1.00 28.47 ? 42   ALA A O     1 
ATOM   202  C CB    . ALA A 1 42  ? 32.679  37.103  50.514 1.00 29.02 ? 42   ALA A CB    1 
ATOM   203  N N     . ILE A 1 43  ? 31.447  39.829  51.502 1.00 27.39 ? 43   ILE A N     1 
ATOM   204  C CA    . ILE A 1 43  ? 31.641  41.199  51.969 1.00 27.87 ? 43   ILE A CA    1 
ATOM   205  C C     . ILE A 1 43  ? 30.852  41.497  53.253 1.00 28.15 ? 43   ILE A C     1 
ATOM   206  O O     . ILE A 1 43  ? 31.395  42.052  54.219 1.00 28.90 ? 43   ILE A O     1 
ATOM   207  C CB    . ILE A 1 43  ? 31.291  42.235  50.853 1.00 26.90 ? 43   ILE A CB    1 
ATOM   208  C CG1   . ILE A 1 43  ? 32.284  42.093  49.690 1.00 24.89 ? 43   ILE A CG1   1 
ATOM   209  C CG2   . ILE A 1 43  ? 31.326  43.662  51.414 1.00 25.59 ? 43   ILE A CG2   1 
ATOM   210  C CD1   . ILE A 1 43  ? 32.008  42.998  48.526 1.00 22.73 ? 43   ILE A CD1   1 
ATOM   211  N N     . ALA A 1 44  ? 29.589  41.090  53.270 1.00 28.81 ? 44   ALA A N     1 
ATOM   212  C CA    . ALA A 1 44  ? 28.715  41.304  54.416 1.00 29.68 ? 44   ALA A CA    1 
ATOM   213  C C     . ALA A 1 44  ? 29.198  40.515  55.621 1.00 30.35 ? 44   ALA A C     1 
ATOM   214  O O     . ALA A 1 44  ? 28.919  40.878  56.760 1.00 31.05 ? 44   ALA A O     1 
ATOM   215  C CB    . ALA A 1 44  ? 27.287  40.903  54.066 1.00 28.36 ? 44   ALA A CB    1 
ATOM   216  N N     . LEU A 1 45  ? 29.892  39.414  55.363 1.00 32.15 ? 45   LEU A N     1 
ATOM   217  C CA    . LEU A 1 45  ? 30.412  38.578  56.427 1.00 33.14 ? 45   LEU A CA    1 
ATOM   218  C C     . LEU A 1 45  ? 31.727  39.097  56.987 1.00 33.82 ? 45   LEU A C     1 
ATOM   219  O O     . LEU A 1 45  ? 31.911  39.146  58.205 1.00 33.48 ? 45   LEU A O     1 
ATOM   220  C CB    . LEU A 1 45  ? 30.588  37.145  55.934 1.00 34.79 ? 45   LEU A CB    1 
ATOM   221  C CG    . LEU A 1 45  ? 29.302  36.391  55.588 1.00 36.70 ? 45   LEU A CG    1 
ATOM   222  C CD1   . LEU A 1 45  ? 29.631  34.923  55.356 1.00 36.92 ? 45   LEU A CD1   1 
ATOM   223  C CD2   . LEU A 1 45  ? 28.280  36.535  56.717 1.00 38.40 ? 45   LEU A CD2   1 
ATOM   224  N N     . GLN A 1 46  ? 32.633  39.494  56.098 1.00 34.89 ? 46   GLN A N     1 
ATOM   225  C CA    . GLN A 1 46  ? 33.944  39.992  56.493 1.00 36.52 ? 46   GLN A CA    1 
ATOM   226  C C     . GLN A 1 46  ? 33.943  41.409  57.053 1.00 37.98 ? 46   GLN A C     1 
ATOM   227  O O     . GLN A 1 46  ? 34.597  41.683  58.064 1.00 37.69 ? 46   GLN A O     1 
ATOM   228  C CB    . GLN A 1 46  ? 34.909  39.905  55.320 1.00 36.44 ? 46   GLN A CB    1 
ATOM   229  C CG    . GLN A 1 46  ? 35.219  38.488  54.889 1.00 39.63 ? 46   GLN A CG    1 
ATOM   230  C CD    . GLN A 1 46  ? 36.024  38.437  53.596 1.00 41.36 ? 46   GLN A CD    1 
ATOM   231  O OE1   . GLN A 1 46  ? 35.708  37.668  52.687 1.00 43.29 ? 46   GLN A OE1   1 
ATOM   232  N NE2   . GLN A 1 46  ? 37.073  39.245  53.513 1.00 42.33 ? 46   GLN A NE2   1 
ATOM   233  N N     . ALA A 1 47  ? 33.234  42.315  56.387 1.00 39.80 ? 47   ALA A N     1 
ATOM   234  C CA    . ALA A 1 47  ? 33.168  43.701  56.836 1.00 42.53 ? 47   ALA A CA    1 
ATOM   235  C C     . ALA A 1 47  ? 31.984  43.908  57.783 1.00 44.73 ? 47   ALA A C     1 
ATOM   236  O O     . ALA A 1 47  ? 30.828  43.772  57.369 1.00 46.46 ? 47   ALA A O     1 
ATOM   237  C CB    . ALA A 1 47  ? 33.055  44.634  55.636 1.00 40.83 ? 47   ALA A CB    1 
ATOM   238  N N     . ARG A 1 48  ? 32.269  44.259  59.040 1.00 46.44 ? 48   ARG A N     1 
ATOM   239  C CA    . ARG A 1 48  ? 31.218  44.492  60.047 1.00 47.32 ? 48   ARG A CA    1 
ATOM   240  C C     . ARG A 1 48  ? 30.391  45.723  59.708 1.00 47.36 ? 48   ARG A C     1 
ATOM   241  O O     . ARG A 1 48  ? 29.238  45.870  60.115 1.00 47.24 ? 48   ARG A O     1 
ATOM   242  C CB    . ARG A 1 48  ? 31.827  44.693  61.429 1.00 47.84 ? 48   ARG A CB    1 
ATOM   243  C CG    . ARG A 1 48  ? 30.802  44.571  62.521 1.00 48.53 ? 48   ARG A CG    1 
ATOM   244  C CD    . ARG A 1 48  ? 30.253  43.162  62.512 1.00 50.85 ? 48   ARG A CD    1 
ATOM   245  N NE    . ARG A 1 48  ? 31.156  42.199  63.146 1.00 52.45 ? 48   ARG A NE    1 
ATOM   246  C CZ    . ARG A 1 48  ? 31.035  40.877  63.036 1.00 53.49 ? 48   ARG A CZ    1 
ATOM   247  N NH1   . ARG A 1 48  ? 30.057  40.351  62.303 1.00 52.44 ? 48   ARG A NH1   1 
ATOM   248  N NH2   . ARG A 1 48  ? 31.861  40.076  63.697 1.00 53.45 ? 48   ARG A NH2   1 
ATOM   249  N N     . ASN A 1 49  ? 31.040  46.624  58.988 1.00 47.92 ? 49   ASN A N     1 
ATOM   250  C CA    . ASN A 1 49  ? 30.471  47.880  58.528 1.00 47.35 ? 49   ASN A CA    1 
ATOM   251  C C     . ASN A 1 49  ? 29.261  47.678  57.601 1.00 45.98 ? 49   ASN A C     1 
ATOM   252  O O     . ASN A 1 49  ? 28.392  48.546  57.517 1.00 46.03 ? 49   ASN A O     1 
ATOM   253  C CB    . ASN A 1 49  ? 31.592  48.620  57.786 1.00 49.75 ? 49   ASN A CB    1 
ATOM   254  C CG    . ASN A 1 49  ? 31.151  49.937  57.176 1.00 51.98 ? 49   ASN A CG    1 
ATOM   255  O OD1   . ASN A 1 49  ? 29.993  50.360  57.303 1.00 53.93 ? 49   ASN A OD1   1 
ATOM   256  N ND2   . ASN A 1 49  ? 32.087  50.597  56.492 1.00 51.72 ? 49   ASN A ND2   1 
ATOM   257  N N     . ALA A 1 50  ? 29.184  46.508  56.968 1.00 44.16 ? 50   ALA A N     1 
ATOM   258  C CA    . ALA A 1 50  ? 28.133  46.192  56.000 1.00 42.58 ? 50   ALA A CA    1 
ATOM   259  C C     . ALA A 1 50  ? 26.826  45.541  56.472 1.00 41.77 ? 50   ALA A C     1 
ATOM   260  O O     . ALA A 1 50  ? 26.753  44.950  57.548 1.00 43.40 ? 50   ALA A O     1 
ATOM   261  C CB    . ALA A 1 50  ? 28.734  45.363  54.887 1.00 41.70 ? 50   ALA A CB    1 
ATOM   262  N N     . GLU A 1 51  ? 25.798  45.658  55.634 1.00 39.96 ? 51   GLU A N     1 
ATOM   263  C CA    . GLU A 1 51  ? 24.479  45.075  55.874 1.00 38.66 ? 51   GLU A CA    1 
ATOM   264  C C     . GLU A 1 51  ? 24.074  44.508  54.528 1.00 35.86 ? 51   GLU A C     1 
ATOM   265  O O     . GLU A 1 51  ? 24.190  45.194  53.522 1.00 34.52 ? 51   GLU A O     1 
ATOM   266  C CB    . GLU A 1 51  ? 23.447  46.139  56.222 1.00 41.06 ? 51   GLU A CB    1 
ATOM   267  C CG    . GLU A 1 51  ? 23.768  47.045  57.380 1.00 45.41 ? 51   GLU A CG    1 
ATOM   268  C CD    . GLU A 1 51  ? 22.764  48.181  57.469 1.00 48.25 ? 51   GLU A CD    1 
ATOM   269  O OE1   . GLU A 1 51  ? 21.612  47.999  56.993 1.00 48.78 ? 51   GLU A OE1   1 
ATOM   270  O OE2   . GLU A 1 51  ? 23.130  49.257  57.996 1.00 50.13 ? 51   GLU A OE2   1 
ATOM   271  N N     . TYR A 1 52  ? 23.553  43.293  54.502 1.00 34.23 ? 52   TYR A N     1 
ATOM   272  C CA    . TYR A 1 52  ? 23.152  42.687  53.240 1.00 33.38 ? 52   TYR A CA    1 
ATOM   273  C C     . TYR A 1 52  ? 21.832  41.954  53.412 1.00 34.43 ? 52   TYR A C     1 
ATOM   274  O O     . TYR A 1 52  ? 21.712  41.037  54.221 1.00 34.73 ? 52   TYR A O     1 
ATOM   275  C CB    . TYR A 1 52  ? 24.241  41.741  52.742 1.00 31.99 ? 52   TYR A CB    1 
ATOM   276  C CG    . TYR A 1 52  ? 23.971  41.116  51.392 1.00 31.47 ? 52   TYR A CG    1 
ATOM   277  C CD1   . TYR A 1 52  ? 23.370  41.846  50.367 1.00 31.53 ? 52   TYR A CD1   1 
ATOM   278  C CD2   . TYR A 1 52  ? 24.351  39.798  51.125 1.00 31.39 ? 52   TYR A CD2   1 
ATOM   279  C CE1   . TYR A 1 52  ? 23.157  41.277  49.105 1.00 31.54 ? 52   TYR A CE1   1 
ATOM   280  C CE2   . TYR A 1 52  ? 24.147  39.223  49.872 1.00 30.24 ? 52   TYR A CE2   1 
ATOM   281  C CZ    . TYR A 1 52  ? 23.552  39.969  48.869 1.00 31.53 ? 52   TYR A CZ    1 
ATOM   282  O OH    . TYR A 1 52  ? 23.367  39.415  47.623 1.00 32.88 ? 52   TYR A OH    1 
ATOM   283  N N     . ASN A 1 53  ? 20.838  42.374  52.641 1.00 35.41 ? 53   ASN A N     1 
ATOM   284  C CA    . ASN A 1 53  ? 19.509  41.792  52.700 1.00 36.19 ? 53   ASN A CA    1 
ATOM   285  C C     . ASN A 1 53  ? 19.002  41.591  51.274 1.00 35.18 ? 53   ASN A C     1 
ATOM   286  O O     . ASN A 1 53  ? 18.170  42.360  50.798 1.00 35.27 ? 53   ASN A O     1 
ATOM   287  C CB    . ASN A 1 53  ? 18.584  42.754  53.442 1.00 39.06 ? 53   ASN A CB    1 
ATOM   288  C CG    . ASN A 1 53  ? 19.299  43.505  54.556 1.00 43.10 ? 53   ASN A CG    1 
ATOM   289  O OD1   . ASN A 1 53  ? 19.495  42.976  55.659 1.00 44.79 ? 53   ASN A OD1   1 
ATOM   290  N ND2   . ASN A 1 53  ? 19.732  44.729  54.261 1.00 42.90 ? 53   ASN A ND2   1 
ATOM   291  N N     . PRO A 1 54  ? 19.463  40.525  50.590 1.00 34.68 ? 54   PRO A N     1 
ATOM   292  C CA    . PRO A 1 54  ? 19.100  40.163  49.211 1.00 34.28 ? 54   PRO A CA    1 
ATOM   293  C C     . PRO A 1 54  ? 17.611  40.224  48.881 1.00 34.74 ? 54   PRO A C     1 
ATOM   294  O O     . PRO A 1 54  ? 17.233  40.678  47.805 1.00 35.02 ? 54   PRO A O     1 
ATOM   295  C CB    . PRO A 1 54  ? 19.618  38.734  49.086 1.00 34.26 ? 54   PRO A CB    1 
ATOM   296  C CG    . PRO A 1 54  ? 20.802  38.729  49.950 1.00 34.32 ? 54   PRO A CG    1 
ATOM   297  C CD    . PRO A 1 54  ? 20.358  39.508  51.170 1.00 34.73 ? 54   PRO A CD    1 
ATOM   298  N N     . LYS A 1 55  ? 16.768  39.737  49.787 1.00 34.57 ? 55   LYS A N     1 
ATOM   299  C CA    . LYS A 1 55  ? 15.324  39.746  49.563 1.00 35.42 ? 55   LYS A CA    1 
ATOM   300  C C     . LYS A 1 55  ? 14.702  41.137  49.617 1.00 34.59 ? 55   LYS A C     1 
ATOM   301  O O     . LYS A 1 55  ? 13.551  41.323  49.234 1.00 34.96 ? 55   LYS A O     1 
ATOM   302  C CB    . LYS A 1 55  ? 14.612  38.795  50.538 1.00 36.92 ? 55   LYS A CB    1 
ATOM   303  C CG    . LYS A 1 55  ? 15.001  38.962  52.004 1.00 40.30 ? 55   LYS A CG    1 
ATOM   304  C CD    . LYS A 1 55  ? 14.382  40.204  52.643 1.00 42.21 ? 55   LYS A CD    1 
ATOM   305  C CE    . LYS A 1 55  ? 15.026  40.516  53.997 1.00 43.97 ? 55   LYS A CE    1 
ATOM   306  N NZ    . LYS A 1 55  ? 16.505  40.749  53.879 1.00 42.54 ? 55   LYS A NZ    1 
ATOM   307  N N     . ARG A 1 56  ? 15.445  42.107  50.128 1.00 33.60 ? 56   ARG A N     1 
ATOM   308  C CA    . ARG A 1 56  ? 14.938  43.463  50.207 1.00 33.59 ? 56   ARG A CA    1 
ATOM   309  C C     . ARG A 1 56  ? 15.581  44.328  49.134 1.00 32.06 ? 56   ARG A C     1 
ATOM   310  O O     . ARG A 1 56  ? 14.888  45.060  48.424 1.00 32.05 ? 56   ARG A O     1 
ATOM   311  C CB    . ARG A 1 56  ? 15.194  44.062  51.594 1.00 36.25 ? 56   ARG A CB    1 
ATOM   312  C CG    . ARG A 1 56  ? 13.939  44.197  52.462 1.00 41.06 ? 56   ARG A CG    1 
ATOM   313  C CD    . ARG A 1 56  ? 13.013  45.331  51.980 1.00 45.47 ? 56   ARG A CD    1 
ATOM   314  N NE    . ARG A 1 56  ? 11.741  44.858  51.429 1.00 47.53 ? 56   ARG A NE    1 
ATOM   315  C CZ    . ARG A 1 56  ? 11.452  44.816  50.127 1.00 49.08 ? 56   ARG A CZ    1 
ATOM   316  N NH1   . ARG A 1 56  ? 12.339  45.219  49.226 1.00 49.08 ? 56   ARG A NH1   1 
ATOM   317  N NH2   . ARG A 1 56  ? 10.273  44.362  49.719 1.00 50.12 ? 56   ARG A NH2   1 
ATOM   318  N N     . PHE A 1 57  ? 16.895  44.202  48.975 1.00 29.37 ? 57   PHE A N     1 
ATOM   319  C CA    . PHE A 1 57  ? 17.615  45.002  47.994 1.00 27.58 ? 57   PHE A CA    1 
ATOM   320  C C     . PHE A 1 57  ? 18.908  44.311  47.587 1.00 27.53 ? 57   PHE A C     1 
ATOM   321  O O     . PHE A 1 57  ? 19.647  43.785  48.423 1.00 27.86 ? 57   PHE A O     1 
ATOM   322  C CB    . PHE A 1 57  ? 17.896  46.402  48.561 1.00 26.05 ? 57   PHE A CB    1 
ATOM   323  C CG    . PHE A 1 57  ? 18.335  47.401  47.529 1.00 24.97 ? 57   PHE A CG    1 
ATOM   324  C CD1   . PHE A 1 57  ? 17.546  47.657  46.410 1.00 23.21 ? 57   PHE A CD1   1 
ATOM   325  C CD2   . PHE A 1 57  ? 19.552  48.060  47.658 1.00 24.25 ? 57   PHE A CD2   1 
ATOM   326  C CE1   . PHE A 1 57  ? 17.963  48.545  45.433 1.00 23.82 ? 57   PHE A CE1   1 
ATOM   327  C CE2   . PHE A 1 57  ? 19.985  48.953  46.687 1.00 23.14 ? 57   PHE A CE2   1 
ATOM   328  C CZ    . PHE A 1 57  ? 19.191  49.197  45.570 1.00 24.27 ? 57   PHE A CZ    1 
ATOM   329  N N     . ALA A 1 58  ? 19.198  44.356  46.294 1.00 27.25 ? 58   ALA A N     1 
ATOM   330  C CA    . ALA A 1 58  ? 20.378  43.714  45.735 1.00 27.12 ? 58   ALA A CA    1 
ATOM   331  C C     . ALA A 1 58  ? 21.727  44.299  46.123 1.00 27.09 ? 58   ALA A C     1 
ATOM   332  O O     . ALA A 1 58  ? 22.728  43.948  45.513 1.00 29.33 ? 58   ALA A O     1 
ATOM   333  C CB    . ALA A 1 58  ? 20.261  43.676  44.213 1.00 26.47 ? 58   ALA A CB    1 
ATOM   334  N N     . ALA A 1 59  ? 21.799  45.139  47.145 1.00 25.65 ? 59   ALA A N     1 
ATOM   335  C CA    . ALA A 1 59  ? 23.090  45.726  47.471 1.00 24.75 ? 59   ALA A CA    1 
ATOM   336  C C     . ALA A 1 59  ? 23.569  45.555  48.898 1.00 24.81 ? 59   ALA A C     1 
ATOM   337  O O     . ALA A 1 59  ? 22.773  45.322  49.808 1.00 25.74 ? 59   ALA A O     1 
ATOM   338  C CB    . ALA A 1 59  ? 23.066  47.200  47.142 1.00 23.60 ? 59   ALA A CB    1 
ATOM   339  N N     . VAL A 1 60  ? 24.884  45.636  49.072 1.00 22.90 ? 60   VAL A N     1 
ATOM   340  C CA    . VAL A 1 60  ? 25.481  45.603  50.396 1.00 22.01 ? 60   VAL A CA    1 
ATOM   341  C C     . VAL A 1 60  ? 25.494  47.087  50.771 1.00 21.54 ? 60   VAL A C     1 
ATOM   342  O O     . VAL A 1 60  ? 25.891  47.928  49.968 1.00 21.00 ? 60   VAL A O     1 
ATOM   343  C CB    . VAL A 1 60  ? 26.923  45.066  50.369 1.00 21.30 ? 60   VAL A CB    1 
ATOM   344  C CG1   . VAL A 1 60  ? 27.689  45.523  51.601 1.00 21.02 ? 60   VAL A CG1   1 
ATOM   345  C CG2   . VAL A 1 60  ? 26.908  43.550  50.314 1.00 21.68 ? 60   VAL A CG2   1 
ATOM   346  N N     . ILE A 1 61  ? 24.954  47.410  51.936 1.00 21.76 ? 61   ILE A N     1 
ATOM   347  C CA    . ILE A 1 61  ? 24.905  48.781  52.410 1.00 22.20 ? 61   ILE A CA    1 
ATOM   348  C C     . ILE A 1 61  ? 26.019  48.924  53.429 1.00 21.95 ? 61   ILE A C     1 
ATOM   349  O O     . ILE A 1 61  ? 26.100  48.159  54.383 1.00 21.87 ? 61   ILE A O     1 
ATOM   350  C CB    . ILE A 1 61  ? 23.524  49.086  53.011 1.00 22.38 ? 61   ILE A CB    1 
ATOM   351  C CG1   . ILE A 1 61  ? 22.470  48.931  51.913 1.00 23.94 ? 61   ILE A CG1   1 
ATOM   352  C CG2   . ILE A 1 61  ? 23.475  50.500  53.570 1.00 23.31 ? 61   ILE A CG2   1 
ATOM   353  C CD1   . ILE A 1 61  ? 21.090  48.666  52.416 1.00 25.38 ? 61   ILE A CD1   1 
ATOM   354  N N     . MET A 1 62  ? 26.901  49.883  53.188 1.00 23.23 ? 62   MET A N     1 
ATOM   355  C CA    . MET A 1 62  ? 28.060  50.126  54.038 1.00 23.99 ? 62   MET A CA    1 
ATOM   356  C C     . MET A 1 62  ? 28.158  51.621  54.349 1.00 23.84 ? 62   MET A C     1 
ATOM   357  O O     . MET A 1 62  ? 27.784  52.444  53.520 1.00 23.68 ? 62   MET A O     1 
ATOM   358  C CB    . MET A 1 62  ? 29.294  49.673  53.270 1.00 24.15 ? 62   MET A CB    1 
ATOM   359  C CG    . MET A 1 62  ? 30.522  49.511  54.087 1.00 26.71 ? 62   MET A CG    1 
ATOM   360  S SD    . MET A 1 62  ? 31.845  48.936  53.039 1.00 30.31 ? 62   MET A SD    1 
ATOM   361  C CE    . MET A 1 62  ? 31.406  47.221  52.923 1.00 28.44 ? 62   MET A CE    1 
ATOM   362  N N     . ARG A 1 63  ? 28.684  51.984  55.515 1.00 22.66 ? 63   ARG A N     1 
ATOM   363  C CA    . ARG A 1 63  ? 28.788  53.400  55.874 1.00 23.17 ? 63   ARG A CA    1 
ATOM   364  C C     . ARG A 1 63  ? 30.117  53.761  56.531 1.00 23.95 ? 63   ARG A C     1 
ATOM   365  O O     . ARG A 1 63  ? 30.745  52.910  57.157 1.00 25.54 ? 63   ARG A O     1 
ATOM   366  C CB    . ARG A 1 63  ? 27.653  53.794  56.841 1.00 20.90 ? 63   ARG A CB    1 
ATOM   367  C CG    . ARG A 1 63  ? 26.230  53.642  56.298 1.00 20.17 ? 63   ARG A CG    1 
ATOM   368  C CD    . ARG A 1 63  ? 25.184  54.121  57.291 1.00 16.97 ? 63   ARG A CD    1 
ATOM   369  N NE    . ARG A 1 63  ? 23.843  54.114  56.715 1.00 17.89 ? 63   ARG A NE    1 
ATOM   370  C CZ    . ARG A 1 63  ? 23.037  53.052  56.661 1.00 18.72 ? 63   ARG A CZ    1 
ATOM   371  N NH1   . ARG A 1 63  ? 23.413  51.885  57.157 1.00 20.65 ? 63   ARG A NH1   1 
ATOM   372  N NH2   . ARG A 1 63  ? 21.863  53.143  56.057 1.00 17.95 ? 63   ARG A NH2   1 
ATOM   373  N N     . ILE A 1 64  ? 30.561  55.004  56.359 1.00 23.29 ? 64   ILE A N     1 
ATOM   374  C CA    . ILE A 1 64  ? 31.781  55.496  57.004 1.00 23.39 ? 64   ILE A CA    1 
ATOM   375  C C     . ILE A 1 64  ? 31.456  56.828  57.687 1.00 24.46 ? 64   ILE A C     1 
ATOM   376  O O     . ILE A 1 64  ? 30.487  57.510  57.321 1.00 24.49 ? 64   ILE A O     1 
ATOM   377  C CB    . ILE A 1 64  ? 32.973  55.679  56.031 1.00 23.47 ? 64   ILE A CB    1 
ATOM   378  C CG1   . ILE A 1 64  ? 32.655  56.738  54.971 1.00 23.69 ? 64   ILE A CG1   1 
ATOM   379  C CG2   . ILE A 1 64  ? 33.369  54.328  55.421 1.00 23.70 ? 64   ILE A CG2   1 
ATOM   380  C CD1   . ILE A 1 64  ? 33.826  57.078  54.072 1.00 23.54 ? 64   ILE A CD1   1 
ATOM   381  N N     . ARG A 1 65  ? 32.243  57.180  58.699 1.00 24.84 ? 65   ARG A N     1 
ATOM   382  C CA    . ARG A 1 65  ? 32.028  58.415  59.453 1.00 25.02 ? 65   ARG A CA    1 
ATOM   383  C C     . ARG A 1 65  ? 32.524  59.694  58.782 1.00 24.85 ? 65   ARG A C     1 
ATOM   384  O O     . ARG A 1 65  ? 31.910  60.749  58.943 1.00 24.15 ? 65   ARG A O     1 
ATOM   385  C CB    . ARG A 1 65  ? 32.672  58.321  60.844 1.00 25.55 ? 65   ARG A CB    1 
ATOM   386  C CG    . ARG A 1 65  ? 31.869  57.561  61.875 1.00 25.00 ? 65   ARG A CG    1 
ATOM   387  C CD    . ARG A 1 65  ? 32.593  57.580  63.214 1.00 24.66 ? 65   ARG A CD    1 
ATOM   388  N NE    . ARG A 1 65  ? 32.425  58.840  63.935 1.00 25.48 ? 65   ARG A NE    1 
ATOM   389  C CZ    . ARG A 1 65  ? 33.220  59.257  64.918 1.00 24.99 ? 65   ARG A CZ    1 
ATOM   390  N NH1   . ARG A 1 65  ? 34.256  58.521  65.304 1.00 25.68 ? 65   ARG A NH1   1 
ATOM   391  N NH2   . ARG A 1 65  ? 32.966  60.403  65.532 1.00 24.51 ? 65   ARG A NH2   1 
ATOM   392  N N     . GLU A 1 66  ? 33.649  59.614  58.076 1.00 24.48 ? 66   GLU A N     1 
ATOM   393  C CA    . GLU A 1 66  ? 34.217  60.787  57.428 1.00 25.59 ? 66   GLU A CA    1 
ATOM   394  C C     . GLU A 1 66  ? 34.807  60.450  56.073 1.00 24.05 ? 66   GLU A C     1 
ATOM   395  O O     . GLU A 1 66  ? 35.681  59.593  55.981 1.00 24.43 ? 66   GLU A O     1 
ATOM   396  C CB    . GLU A 1 66  ? 35.322  61.389  58.298 1.00 28.64 ? 66   GLU A CB    1 
ATOM   397  C CG    . GLU A 1 66  ? 34.882  61.876  59.682 1.00 35.29 ? 66   GLU A CG    1 
ATOM   398  C CD    . GLU A 1 66  ? 34.110  63.199  59.664 1.00 38.90 ? 66   GLU A CD    1 
ATOM   399  O OE1   . GLU A 1 66  ? 34.027  63.843  58.593 1.00 41.32 ? 66   GLU A OE1   1 
ATOM   400  O OE2   . GLU A 1 66  ? 33.597  63.604  60.737 1.00 40.81 ? 66   GLU A OE2   1 
ATOM   401  N N     . PRO A 1 67  ? 34.251  61.023  54.991 1.00 22.54 ? 67   PRO A N     1 
ATOM   402  C CA    . PRO A 1 67  ? 33.108  61.941  55.015 1.00 21.52 ? 67   PRO A CA    1 
ATOM   403  C C     . PRO A 1 67  ? 31.881  61.085  55.307 1.00 20.47 ? 67   PRO A C     1 
ATOM   404  O O     . PRO A 1 67  ? 31.797  59.961  54.828 1.00 20.07 ? 67   PRO A O     1 
ATOM   405  C CB    . PRO A 1 67  ? 33.073  62.481  53.579 1.00 20.17 ? 67   PRO A CB    1 
ATOM   406  C CG    . PRO A 1 67  ? 34.499  62.371  53.131 1.00 21.52 ? 67   PRO A CG    1 
ATOM   407  C CD    . PRO A 1 67  ? 34.872  61.011  53.656 1.00 22.51 ? 67   PRO A CD    1 
ATOM   408  N N     . LYS A 1 68  ? 30.962  61.587  56.122 1.00 20.69 ? 68   LYS A N     1 
ATOM   409  C CA    . LYS A 1 68  ? 29.769  60.822  56.479 1.00 21.31 ? 68   LYS A CA    1 
ATOM   410  C C     . LYS A 1 68  ? 28.955  60.498  55.240 1.00 20.74 ? 68   LYS A C     1 
ATOM   411  O O     . LYS A 1 68  ? 28.274  61.371  54.691 1.00 20.96 ? 68   LYS A O     1 
ATOM   412  C CB    . LYS A 1 68  ? 28.911  61.585  57.481 1.00 22.34 ? 68   LYS A CB    1 
ATOM   413  C CG    . LYS A 1 68  ? 27.725  60.765  57.947 1.00 25.34 ? 68   LYS A CG    1 
ATOM   414  C CD    . LYS A 1 68  ? 26.823  61.555  58.849 1.00 27.33 ? 68   LYS A CD    1 
ATOM   415  C CE    . LYS A 1 68  ? 25.557  60.792  59.139 1.00 28.31 ? 68   LYS A CE    1 
ATOM   416  N NZ    . LYS A 1 68  ? 24.657  61.595  60.017 1.00 31.15 ? 68   LYS A NZ    1 
ATOM   417  N N     . THR A 1 69  ? 28.999  59.232  54.831 1.00 19.89 ? 69   THR A N     1 
ATOM   418  C CA    . THR A 1 69  ? 28.308  58.772  53.633 1.00 19.02 ? 69   THR A CA    1 
ATOM   419  C C     . THR A 1 69  ? 27.800  57.337  53.782 1.00 18.80 ? 69   THR A C     1 
ATOM   420  O O     . THR A 1 69  ? 28.181  56.632  54.720 1.00 19.39 ? 69   THR A O     1 
ATOM   421  C CB    . THR A 1 69  ? 29.268  58.795  52.416 1.00 17.71 ? 69   THR A CB    1 
ATOM   422  O OG1   . THR A 1 69  ? 30.417  57.999  52.711 1.00 19.58 ? 69   THR A OG1   1 
ATOM   423  C CG2   . THR A 1 69  ? 29.718  60.215  52.082 1.00 17.26 ? 69   THR A CG2   1 
ATOM   424  N N     . THR A 1 70  ? 26.963  56.918  52.835 1.00 17.41 ? 70   THR A N     1 
ATOM   425  C CA    . THR A 1 70  ? 26.412  55.570  52.784 1.00 17.12 ? 70   THR A CA    1 
ATOM   426  C C     . THR A 1 70  ? 26.600  55.061  51.352 1.00 17.60 ? 70   THR A C     1 
ATOM   427  O O     . THR A 1 70  ? 26.261  55.745  50.397 1.00 16.55 ? 70   THR A O     1 
ATOM   428  C CB    . THR A 1 70  ? 24.907  55.552  53.134 1.00 18.29 ? 70   THR A CB    1 
ATOM   429  O OG1   . THR A 1 70  ? 24.725  55.957  54.494 1.00 18.59 ? 70   THR A OG1   1 
ATOM   430  C CG2   . THR A 1 70  ? 24.313  54.158  52.955 1.00 18.30 ? 70   THR A CG2   1 
ATOM   431  N N     . ALA A 1 71  ? 27.179  53.875  51.213 1.00 17.88 ? 71   ALA A N     1 
ATOM   432  C CA    . ALA A 1 71  ? 27.410  53.270  49.909 1.00 17.48 ? 71   ALA A CA    1 
ATOM   433  C C     . ALA A 1 71  ? 26.495  52.072  49.693 1.00 17.77 ? 71   ALA A C     1 
ATOM   434  O O     . ALA A 1 71  ? 26.096  51.398  50.647 1.00 17.76 ? 71   ALA A O     1 
ATOM   435  C CB    . ALA A 1 71  ? 28.866  52.833  49.780 1.00 16.68 ? 71   ALA A CB    1 
ATOM   436  N N     . LEU A 1 72  ? 26.108  51.861  48.440 1.00 17.97 ? 72   LEU A N     1 
ATOM   437  C CA    . LEU A 1 72  ? 25.281  50.725  48.045 1.00 18.43 ? 72   LEU A CA    1 
ATOM   438  C C     . LEU A 1 72  ? 26.229  50.006  47.098 1.00 18.64 ? 72   LEU A C     1 
ATOM   439  O O     . LEU A 1 72  ? 26.644  50.566  46.085 1.00 18.51 ? 72   LEU A O     1 
ATOM   440  C CB    . LEU A 1 72  ? 24.021  51.187  47.304 1.00 19.14 ? 72   LEU A CB    1 
ATOM   441  C CG    . LEU A 1 72  ? 23.143  52.267  47.948 1.00 20.02 ? 72   LEU A CG    1 
ATOM   442  C CD1   . LEU A 1 72  ? 21.940  52.521  47.070 1.00 19.73 ? 72   LEU A CD1   1 
ATOM   443  C CD2   . LEU A 1 72  ? 22.689  51.856  49.340 1.00 20.78 ? 72   LEU A CD2   1 
ATOM   444  N N     . ILE A 1 73  ? 26.648  48.809  47.484 1.00 18.93 ? 73   ILE A N     1 
ATOM   445  C CA    . ILE A 1 73  ? 27.611  48.022  46.712 1.00 19.00 ? 73   ILE A CA    1 
ATOM   446  C C     . ILE A 1 73  ? 26.943  46.821  46.049 1.00 19.14 ? 73   ILE A C     1 
ATOM   447  O O     . ILE A 1 73  ? 26.310  45.998  46.714 1.00 19.25 ? 73   ILE A O     1 
ATOM   448  C CB    . ILE A 1 73  ? 28.787  47.591  47.623 1.00 18.46 ? 73   ILE A CB    1 
ATOM   449  C CG1   . ILE A 1 73  ? 29.474  48.842  48.178 1.00 16.58 ? 73   ILE A CG1   1 
ATOM   450  C CG2   . ILE A 1 73  ? 29.786  46.720  46.853 1.00 19.82 ? 73   ILE A CG2   1 
ATOM   451  C CD1   . ILE A 1 73  ? 30.318  48.598  49.399 1.00 15.20 ? 73   ILE A CD1   1 
ATOM   452  N N     . PHE A 1 74  ? 27.100  46.727  44.733 1.00 19.72 ? 74   PHE A N     1 
ATOM   453  C CA    . PHE A 1 74  ? 26.475  45.665  43.962 1.00 20.15 ? 74   PHE A CA    1 
ATOM   454  C C     . PHE A 1 74  ? 27.451  44.601  43.455 1.00 21.24 ? 74   PHE A C     1 
ATOM   455  O O     . PHE A 1 74  ? 28.641  44.869  43.260 1.00 21.91 ? 74   PHE A O     1 
ATOM   456  C CB    . PHE A 1 74  ? 25.677  46.284  42.804 1.00 18.80 ? 74   PHE A CB    1 
ATOM   457  C CG    . PHE A 1 74  ? 24.666  47.309  43.250 1.00 16.96 ? 74   PHE A CG    1 
ATOM   458  C CD1   . PHE A 1 74  ? 25.051  48.619  43.500 1.00 16.49 ? 74   PHE A CD1   1 
ATOM   459  C CD2   . PHE A 1 74  ? 23.342  46.950  43.471 1.00 17.80 ? 74   PHE A CD2   1 
ATOM   460  C CE1   . PHE A 1 74  ? 24.142  49.560  43.968 1.00 15.12 ? 74   PHE A CE1   1 
ATOM   461  C CE2   . PHE A 1 74  ? 22.412  47.893  43.943 1.00 17.75 ? 74   PHE A CE2   1 
ATOM   462  C CZ    . PHE A 1 74  ? 22.822  49.199  44.192 1.00 15.46 ? 74   PHE A CZ    1 
ATOM   463  N N     . ALA A 1 75  ? 26.925  43.398  43.233 1.00 22.33 ? 75   ALA A N     1 
ATOM   464  C CA    . ALA A 1 75  ? 27.702  42.250  42.759 1.00 22.35 ? 75   ALA A CA    1 
ATOM   465  C C     . ALA A 1 75  ? 28.436  42.546  41.452 1.00 23.68 ? 75   ALA A C     1 
ATOM   466  O O     . ALA A 1 75  ? 29.511  42.006  41.185 1.00 23.21 ? 75   ALA A O     1 
ATOM   467  C CB    . ALA A 1 75  ? 26.779  41.049  42.590 1.00 21.72 ? 75   ALA A CB    1 
ATOM   468  N N     . SER A 1 76  ? 27.842  43.412  40.641 1.00 24.30 ? 76   SER A N     1 
ATOM   469  C CA    . SER A 1 76  ? 28.410  43.802  39.361 1.00 24.48 ? 76   SER A CA    1 
ATOM   470  C C     . SER A 1 76  ? 29.708  44.596  39.503 1.00 24.81 ? 76   SER A C     1 
ATOM   471  O O     . SER A 1 76  ? 30.461  44.743  38.535 1.00 26.18 ? 76   SER A O     1 
ATOM   472  C CB    . SER A 1 76  ? 27.384  44.645  38.591 1.00 25.05 ? 76   SER A CB    1 
ATOM   473  O OG    . SER A 1 76  ? 27.075  45.851  39.280 1.00 23.94 ? 76   SER A OG    1 
ATOM   474  N N     . GLY A 1 77  ? 29.972  45.105  40.702 1.00 23.84 ? 77   GLY A N     1 
ATOM   475  C CA    . GLY A 1 77  ? 31.159  45.909  40.906 1.00 22.33 ? 77   GLY A CA    1 
ATOM   476  C C     . GLY A 1 77  ? 30.789  47.383  40.871 1.00 22.16 ? 77   GLY A C     1 
ATOM   477  O O     . GLY A 1 77  ? 31.629  48.247  41.099 1.00 22.41 ? 77   GLY A O     1 
ATOM   478  N N     . LYS A 1 78  ? 29.541  47.681  40.534 1.00 23.23 ? 78   LYS A N     1 
ATOM   479  C CA    . LYS A 1 78  ? 29.086  49.063  40.502 1.00 24.72 ? 78   LYS A CA    1 
ATOM   480  C C     . LYS A 1 78  ? 28.810  49.499  41.941 1.00 25.25 ? 78   LYS A C     1 
ATOM   481  O O     . LYS A 1 78  ? 28.436  48.672  42.791 1.00 24.75 ? 78   LYS A O     1 
ATOM   482  C CB    . LYS A 1 78  ? 27.808  49.197  39.673 1.00 26.74 ? 78   LYS A CB    1 
ATOM   483  C CG    . LYS A 1 78  ? 27.950  48.821  38.199 1.00 28.51 ? 78   LYS A CG    1 
ATOM   484  C CD    . LYS A 1 78  ? 29.008  49.651  37.513 1.00 30.72 ? 78   LYS A CD    1 
ATOM   485  C CE    . LYS A 1 78  ? 28.999  49.440  36.008 1.00 29.17 ? 78   LYS A CE    1 
ATOM   486  N NZ    . LYS A 1 78  ? 27.712  49.917  35.457 1.00 33.16 ? 78   LYS A NZ    1 
ATOM   487  N N     . MET A 1 79  ? 28.969  50.795  42.206 1.00 24.98 ? 79   MET A N     1 
ATOM   488  C CA    . MET A 1 79  ? 28.753  51.336  43.547 1.00 23.75 ? 79   MET A CA    1 
ATOM   489  C C     . MET A 1 79  ? 28.158  52.741  43.531 1.00 21.97 ? 79   MET A C     1 
ATOM   490  O O     . MET A 1 79  ? 28.563  53.580  42.728 1.00 21.12 ? 79   MET A O     1 
ATOM   491  C CB    . MET A 1 79  ? 30.083  51.345  44.315 1.00 24.66 ? 79   MET A CB    1 
ATOM   492  C CG    . MET A 1 79  ? 30.016  52.010  45.677 1.00 27.54 ? 79   MET A CG    1 
ATOM   493  S SD    . MET A 1 79  ? 31.491  51.757  46.683 1.00 30.41 ? 79   MET A SD    1 
ATOM   494  C CE    . MET A 1 79  ? 32.576  53.014  46.050 1.00 27.13 ? 79   MET A CE    1 
ATOM   495  N N     . VAL A 1 80  ? 27.170  52.967  44.397 1.00 20.03 ? 80   VAL A N     1 
ATOM   496  C CA    . VAL A 1 80  ? 26.519  54.265  44.537 1.00 18.73 ? 80   VAL A CA    1 
ATOM   497  C C     . VAL A 1 80  ? 26.969  54.834  45.885 1.00 18.63 ? 80   VAL A C     1 
ATOM   498  O O     . VAL A 1 80  ? 27.010  54.108  46.877 1.00 18.55 ? 80   VAL A O     1 
ATOM   499  C CB    . VAL A 1 80  ? 24.963  54.145  44.545 1.00 19.74 ? 80   VAL A CB    1 
ATOM   500  C CG1   . VAL A 1 80  ? 24.324  55.517  44.772 1.00 17.98 ? 80   VAL A CG1   1 
ATOM   501  C CG2   . VAL A 1 80  ? 24.458  53.553  43.244 1.00 17.10 ? 80   VAL A CG2   1 
ATOM   502  N N     . CYS A 1 81  ? 27.341  56.113  45.910 1.00 18.29 ? 81   CYS A N     1 
ATOM   503  C CA    . CYS A 1 81  ? 27.776  56.784  47.140 1.00 18.09 ? 81   CYS A CA    1 
ATOM   504  C C     . CYS A 1 81  ? 26.831  57.960  47.418 1.00 17.18 ? 81   CYS A C     1 
ATOM   505  O O     . CYS A 1 81  ? 26.612  58.805  46.544 1.00 17.89 ? 81   CYS A O     1 
ATOM   506  C CB    . CYS A 1 81  ? 29.222  57.279  47.007 1.00 19.63 ? 81   CYS A CB    1 
ATOM   507  S SG    . CYS A 1 81  ? 29.856  58.119  48.467 1.00 18.21 ? 81   CYS A SG    1 
ATOM   508  N N     . THR A 1 82  ? 26.258  57.999  48.616 1.00 14.21 ? 82   THR A N     1 
ATOM   509  C CA    . THR A 1 82  ? 25.316  59.047  48.971 1.00 14.69 ? 82   THR A CA    1 
ATOM   510  C C     . THR A 1 82  ? 25.666  59.732  50.277 1.00 12.71 ? 82   THR A C     1 
ATOM   511  O O     . THR A 1 82  ? 26.436  59.206  51.072 1.00 10.92 ? 82   THR A O     1 
ATOM   512  C CB    . THR A 1 82  ? 23.888  58.483  49.154 1.00 14.49 ? 82   THR A CB    1 
ATOM   513  O OG1   . THR A 1 82  ? 23.890  57.505  50.204 1.00 11.09 ? 82   THR A OG1   1 
ATOM   514  C CG2   . THR A 1 82  ? 23.372  57.851  47.860 1.00 14.82 ? 82   THR A CG2   1 
ATOM   515  N N     . GLY A 1 83  ? 25.096  60.916  50.486 1.00 14.32 ? 83   GLY A N     1 
ATOM   516  C CA    . GLY A 1 83  ? 25.290  61.639  51.734 1.00 14.89 ? 83   GLY A CA    1 
ATOM   517  C C     . GLY A 1 83  ? 26.360  62.699  51.866 1.00 15.45 ? 83   GLY A C     1 
ATOM   518  O O     . GLY A 1 83  ? 26.287  63.502  52.789 1.00 15.81 ? 83   GLY A O     1 
ATOM   519  N N     . ALA A 1 84  ? 27.349  62.709  50.973 1.00 16.32 ? 84   ALA A N     1 
ATOM   520  C CA    . ALA A 1 84  ? 28.422  63.695  51.044 1.00 17.76 ? 84   ALA A CA    1 
ATOM   521  C C     . ALA A 1 84  ? 27.913  65.120  50.859 1.00 17.81 ? 84   ALA A C     1 
ATOM   522  O O     . ALA A 1 84  ? 26.882  65.341  50.218 1.00 17.67 ? 84   ALA A O     1 
ATOM   523  C CB    . ALA A 1 84  ? 29.492  63.385  50.016 1.00 19.13 ? 84   ALA A CB    1 
ATOM   524  N N     . LYS A 1 85  ? 28.650  66.078  51.412 1.00 17.69 ? 85   LYS A N     1 
ATOM   525  C CA    . LYS A 1 85  ? 28.288  67.489  51.326 1.00 19.54 ? 85   LYS A CA    1 
ATOM   526  C C     . LYS A 1 85  ? 28.923  68.232  50.159 1.00 20.28 ? 85   LYS A C     1 
ATOM   527  O O     . LYS A 1 85  ? 28.649  69.419  49.953 1.00 20.37 ? 85   LYS A O     1 
ATOM   528  C CB    . LYS A 1 85  ? 28.613  68.214  52.628 1.00 20.97 ? 85   LYS A CB    1 
ATOM   529  C CG    . LYS A 1 85  ? 27.813  67.733  53.815 1.00 23.93 ? 85   LYS A CG    1 
ATOM   530  C CD    . LYS A 1 85  ? 26.316  67.838  53.561 1.00 25.68 ? 85   LYS A CD    1 
ATOM   531  C CE    . LYS A 1 85  ? 25.517  67.673  54.853 1.00 26.06 ? 85   LYS A CE    1 
ATOM   532  N NZ    . LYS A 1 85  ? 24.061  67.783  54.598 1.00 25.32 ? 85   LYS A NZ    1 
ATOM   533  N N     . SER A 1 86  ? 29.783  67.549  49.409 1.00 19.63 ? 86   SER A N     1 
ATOM   534  C CA    . SER A 1 86  ? 30.416  68.157  48.253 1.00 19.87 ? 86   SER A CA    1 
ATOM   535  C C     . SER A 1 86  ? 30.862  67.067  47.302 1.00 19.66 ? 86   SER A C     1 
ATOM   536  O O     . SER A 1 86  ? 30.949  65.900  47.686 1.00 20.27 ? 86   SER A O     1 
ATOM   537  C CB    . SER A 1 86  ? 31.615  69.011  48.666 1.00 19.90 ? 86   SER A CB    1 
ATOM   538  O OG    . SER A 1 86  ? 32.807  68.244  48.682 1.00 22.19 ? 86   SER A OG    1 
ATOM   539  N N     . GLU A 1 87  ? 31.189  67.469  46.077 1.00 20.92 ? 87   GLU A N     1 
ATOM   540  C CA    . GLU A 1 87  ? 31.639  66.563  45.019 1.00 19.97 ? 87   GLU A CA    1 
ATOM   541  C C     . GLU A 1 87  ? 32.957  65.900  45.398 1.00 20.12 ? 87   GLU A C     1 
ATOM   542  O O     . GLU A 1 87  ? 33.137  64.703  45.185 1.00 20.58 ? 87   GLU A O     1 
ATOM   543  C CB    . GLU A 1 87  ? 31.816  67.327  43.704 1.00 20.80 ? 87   GLU A CB    1 
ATOM   544  C CG    . GLU A 1 87  ? 30.564  68.027  43.198 1.00 20.49 ? 87   GLU A CG    1 
ATOM   545  C CD    . GLU A 1 87  ? 30.487  69.480  43.605 1.00 22.02 ? 87   GLU A CD    1 
ATOM   546  O OE1   . GLU A 1 87  ? 30.863  69.836  44.746 1.00 22.48 ? 87   GLU A OE1   1 
ATOM   547  O OE2   . GLU A 1 87  ? 30.039  70.282  42.767 1.00 23.90 ? 87   GLU A OE2   1 
ATOM   548  N N     . ASP A 1 88  ? 33.875  66.683  45.955 1.00 20.10 ? 88   ASP A N     1 
ATOM   549  C CA    . ASP A 1 88  ? 35.170  66.163  46.377 1.00 20.87 ? 88   ASP A CA    1 
ATOM   550  C C     . ASP A 1 88  ? 34.999  65.150  47.506 1.00 21.40 ? 88   ASP A C     1 
ATOM   551  O O     . ASP A 1 88  ? 35.645  64.102  47.507 1.00 21.15 ? 88   ASP A O     1 
ATOM   552  C CB    . ASP A 1 88  ? 36.091  67.297  46.848 1.00 21.68 ? 88   ASP A CB    1 
ATOM   553  C CG    . ASP A 1 88  ? 36.673  68.113  45.702 1.00 22.44 ? 88   ASP A CG    1 
ATOM   554  O OD1   . ASP A 1 88  ? 36.558  67.719  44.517 1.00 23.61 ? 88   ASP A OD1   1 
ATOM   555  O OD2   . ASP A 1 88  ? 37.265  69.162  46.000 1.00 21.23 ? 88   ASP A OD2   1 
ATOM   556  N N     . PHE A 1 89  ? 34.148  65.486  48.476 1.00 20.59 ? 89   PHE A N     1 
ATOM   557  C CA    . PHE A 1 89  ? 33.874  64.614  49.616 1.00 19.86 ? 89   PHE A CA    1 
ATOM   558  C C     . PHE A 1 89  ? 33.259  63.316  49.138 1.00 19.32 ? 89   PHE A C     1 
ATOM   559  O O     . PHE A 1 89  ? 33.587  62.252  49.646 1.00 19.35 ? 89   PHE A O     1 
ATOM   560  C CB    . PHE A 1 89  ? 32.936  65.294  50.627 1.00 20.16 ? 89   PHE A CB    1 
ATOM   561  C CG    . PHE A 1 89  ? 33.626  66.274  51.544 1.00 20.22 ? 89   PHE A CG    1 
ATOM   562  C CD1   . PHE A 1 89  ? 34.882  65.982  52.083 1.00 20.14 ? 89   PHE A CD1   1 
ATOM   563  C CD2   . PHE A 1 89  ? 33.023  67.489  51.863 1.00 19.20 ? 89   PHE A CD2   1 
ATOM   564  C CE1   . PHE A 1 89  ? 35.529  66.887  52.921 1.00 20.36 ? 89   PHE A CE1   1 
ATOM   565  C CE2   . PHE A 1 89  ? 33.659  68.402  52.699 1.00 20.45 ? 89   PHE A CE2   1 
ATOM   566  C CZ    . PHE A 1 89  ? 34.916  68.105  53.232 1.00 19.85 ? 89   PHE A CZ    1 
ATOM   567  N N     . SER A 1 90  ? 32.374  63.407  48.153 1.00 19.42 ? 90   SER A N     1 
ATOM   568  C CA    . SER A 1 90  ? 31.738  62.220  47.607 1.00 20.68 ? 90   SER A CA    1 
ATOM   569  C C     . SER A 1 90  ? 32.779  61.286  46.949 1.00 21.99 ? 90   SER A C     1 
ATOM   570  O O     . SER A 1 90  ? 32.784  60.078  47.211 1.00 22.26 ? 90   SER A O     1 
ATOM   571  C CB    . SER A 1 90  ? 30.654  62.625  46.612 1.00 18.47 ? 90   SER A CB    1 
ATOM   572  O OG    . SER A 1 90  ? 29.906  61.503  46.191 1.00 20.83 ? 90   SER A OG    1 
ATOM   573  N N     . LYS A 1 91  ? 33.673  61.844  46.129 1.00 22.44 ? 91   LYS A N     1 
ATOM   574  C CA    . LYS A 1 91  ? 34.713  61.053  45.458 1.00 24.16 ? 91   LYS A CA    1 
ATOM   575  C C     . LYS A 1 91  ? 35.684  60.457  46.479 1.00 24.34 ? 91   LYS A C     1 
ATOM   576  O O     . LYS A 1 91  ? 36.125  59.316  46.349 1.00 23.40 ? 91   LYS A O     1 
ATOM   577  C CB    . LYS A 1 91  ? 35.487  61.923  44.464 1.00 26.80 ? 91   LYS A CB    1 
ATOM   578  C CG    . LYS A 1 91  ? 36.503  61.155  43.625 1.00 30.32 ? 91   LYS A CG    1 
ATOM   579  C CD    . LYS A 1 91  ? 37.180  62.075  42.624 1.00 32.28 ? 91   LYS A CD    1 
ATOM   580  C CE    . LYS A 1 91  ? 37.833  61.277  41.496 1.00 35.13 ? 91   LYS A CE    1 
ATOM   581  N NZ    . LYS A 1 91  ? 38.216  62.144  40.325 1.00 35.52 ? 91   LYS A NZ    1 
ATOM   582  N N     . MET A 1 92  ? 36.003  61.253  47.490 1.00 24.69 ? 92   MET A N     1 
ATOM   583  C CA    . MET A 1 92  ? 36.892  60.866  48.570 1.00 26.00 ? 92   MET A CA    1 
ATOM   584  C C     . MET A 1 92  ? 36.280  59.695  49.336 1.00 25.44 ? 92   MET A C     1 
ATOM   585  O O     . MET A 1 92  ? 36.982  58.754  49.708 1.00 25.89 ? 92   MET A O     1 
ATOM   586  C CB    . MET A 1 92  ? 37.069  62.063  49.498 1.00 31.45 ? 92   MET A CB    1 
ATOM   587  C CG    . MET A 1 92  ? 38.254  62.015  50.447 1.00 38.62 ? 92   MET A CG    1 
ATOM   588  S SD    . MET A 1 92  ? 38.304  63.543  51.444 1.00 47.93 ? 92   MET A SD    1 
ATOM   589  C CE    . MET A 1 92  ? 37.634  64.787  50.255 1.00 41.40 ? 92   MET A CE    1 
ATOM   590  N N     . ALA A 1 93  ? 34.978  59.764  49.596 1.00 23.06 ? 93   ALA A N     1 
ATOM   591  C CA    . ALA A 1 93  ? 34.285  58.691  50.299 1.00 21.98 ? 93   ALA A CA    1 
ATOM   592  C C     . ALA A 1 93  ? 34.226  57.427  49.420 1.00 21.62 ? 93   ALA A C     1 
ATOM   593  O O     . ALA A 1 93  ? 34.424  56.308  49.903 1.00 21.04 ? 93   ALA A O     1 
ATOM   594  C CB    . ALA A 1 93  ? 32.884  59.142  50.682 1.00 20.59 ? 93   ALA A CB    1 
ATOM   595  N N     . ALA A 1 94  ? 33.963  57.612  48.129 1.00 21.63 ? 94   ALA A N     1 
ATOM   596  C CA    . ALA A 1 94  ? 33.896  56.498  47.179 1.00 22.15 ? 94   ALA A CA    1 
ATOM   597  C C     . ALA A 1 94  ? 35.224  55.732  47.154 1.00 23.26 ? 94   ALA A C     1 
ATOM   598  O O     . ALA A 1 94  ? 35.244  54.498  47.122 1.00 22.70 ? 94   ALA A O     1 
ATOM   599  C CB    . ALA A 1 94  ? 33.564  57.022  45.781 1.00 21.07 ? 94   ALA A CB    1 
ATOM   600  N N     . ARG A 1 95  ? 36.326  56.481  47.150 1.00 24.51 ? 95   ARG A N     1 
ATOM   601  C CA    . ARG A 1 95  ? 37.675  55.921  47.138 1.00 25.36 ? 95   ARG A CA    1 
ATOM   602  C C     . ARG A 1 95  ? 37.960  55.078  48.384 1.00 25.55 ? 95   ARG A C     1 
ATOM   603  O O     . ARG A 1 95  ? 38.583  54.015  48.299 1.00 26.01 ? 95   ARG A O     1 
ATOM   604  C CB    . ARG A 1 95  ? 38.694  57.050  46.985 1.00 27.31 ? 95   ARG A CB    1 
ATOM   605  C CG    . ARG A 1 95  ? 39.109  57.299  45.531 1.00 31.82 ? 95   ARG A CG    1 
ATOM   606  C CD    . ARG A 1 95  ? 39.416  58.766  45.224 1.00 35.08 ? 95   ARG A CD    1 
ATOM   607  N NE    . ARG A 1 95  ? 40.121  59.459  46.305 1.00 38.97 ? 95   ARG A NE    1 
ATOM   608  C CZ    . ARG A 1 95  ? 40.370  60.769  46.324 1.00 40.22 ? 95   ARG A CZ    1 
ATOM   609  N NH1   . ARG A 1 95  ? 39.988  61.548  45.315 1.00 41.03 ? 95   ARG A NH1   1 
ATOM   610  N NH2   . ARG A 1 95  ? 40.945  61.316  47.387 1.00 40.78 ? 95   ARG A NH2   1 
ATOM   611  N N     . LYS A 1 96  ? 37.472  55.533  49.533 1.00 26.21 ? 96   LYS A N     1 
ATOM   612  C CA    . LYS A 1 96  ? 37.653  54.807  50.787 1.00 26.28 ? 96   LYS A CA    1 
ATOM   613  C C     . LYS A 1 96  ? 36.902  53.479  50.723 1.00 26.65 ? 96   LYS A C     1 
ATOM   614  O O     . LYS A 1 96  ? 37.449  52.433  51.083 1.00 25.87 ? 96   LYS A O     1 
ATOM   615  C CB    . LYS A 1 96  ? 37.164  55.641  51.974 1.00 27.40 ? 96   LYS A CB    1 
ATOM   616  C CG    . LYS A 1 96  ? 37.912  56.947  52.129 1.00 30.14 ? 96   LYS A CG    1 
ATOM   617  C CD    . LYS A 1 96  ? 37.554  57.675  53.410 1.00 31.38 ? 96   LYS A CD    1 
ATOM   618  C CE    . LYS A 1 96  ? 38.355  58.967  53.497 1.00 32.84 ? 96   LYS A CE    1 
ATOM   619  N NZ    . LYS A 1 96  ? 38.535  59.422  54.905 1.00 36.28 ? 96   LYS A NZ    1 
ATOM   620  N N     . TYR A 1 97  ? 35.650  53.520  50.270 1.00 26.30 ? 97   TYR A N     1 
ATOM   621  C CA    . TYR A 1 97  ? 34.849  52.307  50.134 1.00 26.00 ? 97   TYR A CA    1 
ATOM   622  C C     . TYR A 1 97  ? 35.566  51.371  49.169 1.00 26.82 ? 97   TYR A C     1 
ATOM   623  O O     . TYR A 1 97  ? 35.620  50.169  49.406 1.00 28.16 ? 97   TYR A O     1 
ATOM   624  C CB    . TYR A 1 97  ? 33.450  52.622  49.595 1.00 24.15 ? 97   TYR A CB    1 
ATOM   625  C CG    . TYR A 1 97  ? 32.543  53.329  50.579 1.00 24.07 ? 97   TYR A CG    1 
ATOM   626  C CD1   . TYR A 1 97  ? 32.158  52.716  51.773 1.00 22.53 ? 97   TYR A CD1   1 
ATOM   627  C CD2   . TYR A 1 97  ? 32.046  54.606  50.306 1.00 23.14 ? 97   TYR A CD2   1 
ATOM   628  C CE1   . TYR A 1 97  ? 31.293  53.357  52.676 1.00 22.32 ? 97   TYR A CE1   1 
ATOM   629  C CE2   . TYR A 1 97  ? 31.181  55.256  51.202 1.00 22.15 ? 97   TYR A CE2   1 
ATOM   630  C CZ    . TYR A 1 97  ? 30.807  54.624  52.380 1.00 22.42 ? 97   TYR A CZ    1 
ATOM   631  O OH    . TYR A 1 97  ? 29.933  55.250  53.244 1.00 21.56 ? 97   TYR A OH    1 
ATOM   632  N N     . ALA A 1 98  ? 36.131  51.924  48.093 1.00 28.21 ? 98   ALA A N     1 
ATOM   633  C CA    . ALA A 1 98  ? 36.856  51.118  47.104 1.00 28.81 ? 98   ALA A CA    1 
ATOM   634  C C     . ALA A 1 98  ? 38.048  50.436  47.765 1.00 30.13 ? 98   ALA A C     1 
ATOM   635  O O     . ALA A 1 98  ? 38.349  49.282  47.461 1.00 31.57 ? 98   ALA A O     1 
ATOM   636  C CB    . ALA A 1 98  ? 37.320  51.970  45.934 1.00 27.19 ? 98   ALA A CB    1 
ATOM   637  N N     . ARG A 1 99  ? 38.699  51.136  48.693 1.00 30.44 ? 99   ARG A N     1 
ATOM   638  C CA    . ARG A 1 99  ? 39.847  50.587  49.411 1.00 31.25 ? 99   ARG A CA    1 
ATOM   639  C C     . ARG A 1 99  ? 39.408  49.495  50.404 1.00 31.00 ? 99   ARG A C     1 
ATOM   640  O O     . ARG A 1 99  ? 40.064  48.458  50.528 1.00 30.65 ? 99   ARG A O     1 
ATOM   641  C CB    . ARG A 1 99  ? 40.611  51.704  50.112 1.00 33.30 ? 99   ARG A CB    1 
ATOM   642  C CG    . ARG A 1 99  ? 41.895  51.256  50.773 1.00 39.39 ? 99   ARG A CG    1 
ATOM   643  C CD    . ARG A 1 99  ? 42.976  52.314  50.638 1.00 43.96 ? 99   ARG A CD    1 
ATOM   644  N NE    . ARG A 1 99  ? 43.320  52.556  49.235 1.00 48.03 ? 99   ARG A NE    1 
ATOM   645  C CZ    . ARG A 1 99  ? 44.564  52.664  48.769 1.00 49.36 ? 99   ARG A CZ    1 
ATOM   646  N NH1   . ARG A 1 99  ? 45.608  52.551  49.589 1.00 50.20 ? 99   ARG A NH1   1 
ATOM   647  N NH2   . ARG A 1 99  ? 44.765  52.903  47.480 1.00 50.50 ? 99   ARG A NH2   1 
ATOM   648  N N     . ILE A 1 100 ? 38.284  49.711  51.082 1.00 30.17 ? 100  ILE A N     1 
ATOM   649  C CA    . ILE A 1 100 ? 37.743  48.722  52.017 1.00 29.90 ? 100  ILE A CA    1 
ATOM   650  C C     . ILE A 1 100 ? 37.501  47.412  51.243 1.00 30.99 ? 100  ILE A C     1 
ATOM   651  O O     . ILE A 1 100 ? 37.796  46.312  51.736 1.00 30.31 ? 100  ILE A O     1 
ATOM   652  C CB    . ILE A 1 100 ? 36.383  49.190  52.614 1.00 28.67 ? 100  ILE A CB    1 
ATOM   653  C CG1   . ILE A 1 100 ? 36.580  50.400  53.521 1.00 28.06 ? 100  ILE A CG1   1 
ATOM   654  C CG2   . ILE A 1 100 ? 35.708  48.062  53.376 1.00 27.30 ? 100  ILE A CG2   1 
ATOM   655  C CD1   . ILE A 1 100 ? 35.259  51.051  53.983 1.00 27.82 ? 100  ILE A CD1   1 
ATOM   656  N N     . VAL A 1 101 ? 36.967  47.540  50.029 1.00 31.33 ? 101  VAL A N     1 
ATOM   657  C CA    . VAL A 1 101 ? 36.685  46.377  49.197 1.00 31.78 ? 101  VAL A CA    1 
ATOM   658  C C     . VAL A 1 101 ? 37.990  45.698  48.756 1.00 32.88 ? 101  VAL A C     1 
ATOM   659  O O     . VAL A 1 101 ? 38.103  44.465  48.804 1.00 32.00 ? 101  VAL A O     1 
ATOM   660  C CB    . VAL A 1 101 ? 35.787  46.753  47.984 1.00 30.80 ? 101  VAL A CB    1 
ATOM   661  C CG1   . VAL A 1 101 ? 35.637  45.567  47.027 1.00 29.17 ? 101  VAL A CG1   1 
ATOM   662  C CG2   . VAL A 1 101 ? 34.402  47.196  48.486 1.00 30.36 ? 101  VAL A CG2   1 
ATOM   663  N N     . GLN A 1 102 ? 38.981  46.506  48.377 1.00 33.58 ? 102  GLN A N     1 
ATOM   664  C CA    . GLN A 1 102 ? 40.279  45.987  47.954 1.00 35.15 ? 102  GLN A CA    1 
ATOM   665  C C     . GLN A 1 102 ? 40.843  45.152  49.084 1.00 36.00 ? 102  GLN A C     1 
ATOM   666  O O     . GLN A 1 102 ? 41.200  43.993  48.894 1.00 37.30 ? 102  GLN A O     1 
ATOM   667  C CB    . GLN A 1 102 ? 41.254  47.122  47.655 1.00 36.20 ? 102  GLN A CB    1 
ATOM   668  C CG    . GLN A 1 102 ? 41.035  47.840  46.349 1.00 39.36 ? 102  GLN A CG    1 
ATOM   669  C CD    . GLN A 1 102 ? 41.767  49.176  46.308 1.00 42.58 ? 102  GLN A CD    1 
ATOM   670  O OE1   . GLN A 1 102 ? 42.746  49.394  47.039 1.00 43.49 ? 102  GLN A OE1   1 
ATOM   671  N NE2   . GLN A 1 102 ? 41.283  50.088  45.468 1.00 43.76 ? 102  GLN A NE2   1 
ATOM   672  N N     . LYS A 1 103 ? 40.871  45.733  50.276 1.00 36.30 ? 103  LYS A N     1 
ATOM   673  C CA    . LYS A 1 103 ? 41.394  45.052  51.452 1.00 37.55 ? 103  LYS A CA    1 
ATOM   674  C C     . LYS A 1 103 ? 40.619  43.789  51.811 1.00 37.62 ? 103  LYS A C     1 
ATOM   675  O O     . LYS A 1 103 ? 41.123  42.923  52.524 1.00 38.75 ? 103  LYS A O     1 
ATOM   676  C CB    . LYS A 1 103 ? 41.421  46.004  52.642 1.00 38.17 ? 103  LYS A CB    1 
ATOM   677  C CG    . LYS A 1 103 ? 42.425  47.125  52.491 1.00 40.23 ? 103  LYS A CG    1 
ATOM   678  C CD    . LYS A 1 103 ? 42.418  48.003  53.719 1.00 43.36 ? 103  LYS A CD    1 
ATOM   679  C CE    . LYS A 1 103 ? 43.508  49.053  53.641 1.00 45.03 ? 103  LYS A CE    1 
ATOM   680  N NZ    . LYS A 1 103 ? 43.494  49.928  54.852 1.00 46.88 ? 103  LYS A NZ    1 
ATOM   681  N N     . LEU A 1 104 ? 39.396  43.680  51.310 1.00 36.58 ? 104  LEU A N     1 
ATOM   682  C CA    . LEU A 1 104 ? 38.574  42.522  51.588 1.00 35.59 ? 104  LEU A CA    1 
ATOM   683  C C     . LEU A 1 104 ? 38.910  41.393  50.616 1.00 36.33 ? 104  LEU A C     1 
ATOM   684  O O     . LEU A 1 104 ? 38.313  40.317  50.672 1.00 37.15 ? 104  LEU A O     1 
ATOM   685  C CB    . LEU A 1 104 ? 37.102  42.911  51.493 1.00 34.86 ? 104  LEU A CB    1 
ATOM   686  C CG    . LEU A 1 104 ? 36.193  42.596  52.680 1.00 33.99 ? 104  LEU A CG    1 
ATOM   687  C CD1   . LEU A 1 104 ? 36.932  42.740  53.990 1.00 31.82 ? 104  LEU A CD1   1 
ATOM   688  C CD2   . LEU A 1 104 ? 34.985  43.532  52.621 1.00 32.82 ? 104  LEU A CD2   1 
ATOM   689  N N     . GLY A 1 105 ? 39.834  41.657  49.698 1.00 35.99 ? 105  GLY A N     1 
ATOM   690  C CA    . GLY A 1 105 ? 40.250  40.638  48.752 1.00 35.93 ? 105  GLY A CA    1 
ATOM   691  C C     . GLY A 1 105 ? 39.684  40.666  47.346 1.00 36.10 ? 105  GLY A C     1 
ATOM   692  O O     . GLY A 1 105 ? 39.567  39.618  46.721 1.00 37.37 ? 105  GLY A O     1 
ATOM   693  N N     . PHE A 1 106 ? 39.332  41.841  46.838 1.00 35.85 ? 106  PHE A N     1 
ATOM   694  C CA    . PHE A 1 106 ? 38.797  41.955  45.484 1.00 34.26 ? 106  PHE A CA    1 
ATOM   695  C C     . PHE A 1 106 ? 39.644  42.958  44.720 1.00 35.01 ? 106  PHE A C     1 
ATOM   696  O O     . PHE A 1 106 ? 40.067  43.969  45.282 1.00 35.73 ? 106  PHE A O     1 
ATOM   697  C CB    . PHE A 1 106 ? 37.343  42.420  45.519 1.00 32.17 ? 106  PHE A CB    1 
ATOM   698  C CG    . PHE A 1 106 ? 36.420  41.466  46.223 1.00 30.57 ? 106  PHE A CG    1 
ATOM   699  C CD1   . PHE A 1 106 ? 36.214  41.561  47.594 1.00 29.97 ? 106  PHE A CD1   1 
ATOM   700  C CD2   . PHE A 1 106 ? 35.762  40.467  45.513 1.00 29.36 ? 106  PHE A CD2   1 
ATOM   701  C CE1   . PHE A 1 106 ? 35.365  40.674  48.252 1.00 28.88 ? 106  PHE A CE1   1 
ATOM   702  C CE2   . PHE A 1 106 ? 34.915  39.580  46.157 1.00 28.88 ? 106  PHE A CE2   1 
ATOM   703  C CZ    . PHE A 1 106 ? 34.716  39.684  47.535 1.00 29.42 ? 106  PHE A CZ    1 
ATOM   704  N N     . PRO A 1 107 ? 39.949  42.672  43.443 1.00 36.18 ? 107  PRO A N     1 
ATOM   705  C CA    . PRO A 1 107 ? 40.765  43.592  42.632 1.00 36.72 ? 107  PRO A CA    1 
ATOM   706  C C     . PRO A 1 107 ? 39.963  44.829  42.212 1.00 37.16 ? 107  PRO A C     1 
ATOM   707  O O     . PRO A 1 107 ? 39.720  45.047  41.023 1.00 37.69 ? 107  PRO A O     1 
ATOM   708  C CB    . PRO A 1 107 ? 41.156  42.728  41.427 1.00 36.17 ? 107  PRO A CB    1 
ATOM   709  C CG    . PRO A 1 107 ? 39.958  41.843  41.258 1.00 36.39 ? 107  PRO A CG    1 
ATOM   710  C CD    . PRO A 1 107 ? 39.625  41.446  42.690 1.00 36.02 ? 107  PRO A CD    1 
ATOM   711  N N     . ALA A 1 108 ? 39.572  45.635  43.196 1.00 36.77 ? 108  ALA A N     1 
ATOM   712  C CA    . ALA A 1 108 ? 38.777  46.831  42.949 1.00 36.41 ? 108  ALA A CA    1 
ATOM   713  C C     . ALA A 1 108 ? 39.568  47.997  42.365 1.00 36.21 ? 108  ALA A C     1 
ATOM   714  O O     . ALA A 1 108 ? 40.622  48.370  42.886 1.00 36.29 ? 108  ALA A O     1 
ATOM   715  C CB    . ALA A 1 108 ? 38.077  47.266  44.233 1.00 35.84 ? 108  ALA A CB    1 
ATOM   716  N N     . LYS A 1 109 ? 39.047  48.546  41.270 1.00 35.64 ? 109  LYS A N     1 
ATOM   717  C CA    . LYS A 1 109 ? 39.633  49.695  40.583 1.00 35.67 ? 109  LYS A CA    1 
ATOM   718  C C     . LYS A 1 109 ? 38.749  50.900  40.909 1.00 33.98 ? 109  LYS A C     1 
ATOM   719  O O     . LYS A 1 109 ? 38.050  50.891  41.926 1.00 33.81 ? 109  LYS A O     1 
ATOM   720  C CB    . LYS A 1 109 ? 39.677  49.443  39.071 1.00 37.23 ? 109  LYS A CB    1 
ATOM   721  C CG    . LYS A 1 109 ? 40.552  48.247  38.669 1.00 40.14 ? 109  LYS A CG    1 
ATOM   722  C CD    . LYS A 1 109 ? 42.004  48.444  39.129 1.00 42.67 ? 109  LYS A CD    1 
ATOM   723  C CE    . LYS A 1 109 ? 42.882  47.210  38.882 1.00 44.53 ? 109  LYS A CE    1 
ATOM   724  N NZ    . LYS A 1 109 ? 42.542  46.042  39.764 1.00 45.59 ? 109  LYS A NZ    1 
ATOM   725  N N     . PHE A 1 110 ? 38.760  51.922  40.059 1.00 32.39 ? 110  PHE A N     1 
ATOM   726  C CA    . PHE A 1 110 ? 37.955  53.127  40.289 1.00 30.98 ? 110  PHE A CA    1 
ATOM   727  C C     . PHE A 1 110 ? 37.646  53.718  38.933 1.00 30.39 ? 110  PHE A C     1 
ATOM   728  O O     . PHE A 1 110 ? 38.138  54.786  38.570 1.00 30.87 ? 110  PHE A O     1 
ATOM   729  C CB    . PHE A 1 110 ? 38.745  54.140  41.127 1.00 30.34 ? 110  PHE A CB    1 
ATOM   730  C CG    . PHE A 1 110 ? 37.879  55.089  41.915 1.00 29.46 ? 110  PHE A CG    1 
ATOM   731  C CD1   . PHE A 1 110 ? 37.221  54.656  43.060 1.00 27.90 ? 110  PHE A CD1   1 
ATOM   732  C CD2   . PHE A 1 110 ? 37.736  56.416  41.520 1.00 29.13 ? 110  PHE A CD2   1 
ATOM   733  C CE1   . PHE A 1 110 ? 36.439  55.526  43.796 1.00 28.72 ? 110  PHE A CE1   1 
ATOM   734  C CE2   . PHE A 1 110 ? 36.950  57.299  42.256 1.00 28.42 ? 110  PHE A CE2   1 
ATOM   735  C CZ    . PHE A 1 110 ? 36.303  56.855  43.393 1.00 28.35 ? 110  PHE A CZ    1 
ATOM   736  N N     . LYS A 1 111 ? 36.814  53.011  38.189 1.00 31.13 ? 111  LYS A N     1 
ATOM   737  C CA    . LYS A 1 111 ? 36.460  53.403  36.835 1.00 32.04 ? 111  LYS A CA    1 
ATOM   738  C C     . LYS A 1 111 ? 35.169  54.202  36.657 1.00 31.61 ? 111  LYS A C     1 
ATOM   739  O O     . LYS A 1 111 ? 34.140  53.915  37.266 1.00 31.23 ? 111  LYS A O     1 
ATOM   740  C CB    . LYS A 1 111 ? 36.429  52.145  35.962 1.00 32.77 ? 111  LYS A CB    1 
ATOM   741  C CG    . LYS A 1 111 ? 36.047  52.371  34.526 1.00 35.65 ? 111  LYS A CG    1 
ATOM   742  C CD    . LYS A 1 111 ? 36.061  51.067  33.742 1.00 39.02 ? 111  LYS A CD    1 
ATOM   743  C CE    . LYS A 1 111 ? 35.545  51.265  32.322 1.00 41.23 ? 111  LYS A CE    1 
ATOM   744  N NZ    . LYS A 1 111 ? 36.191  52.452  31.667 1.00 43.50 ? 111  LYS A NZ    1 
ATOM   745  N N     . ASP A 1 112 ? 35.250  55.228  35.826 1.00 31.23 ? 112  ASP A N     1 
ATOM   746  C CA    . ASP A 1 112 ? 34.103  56.058  35.506 1.00 31.10 ? 112  ASP A CA    1 
ATOM   747  C C     . ASP A 1 112 ? 33.390  56.741  36.680 1.00 29.10 ? 112  ASP A C     1 
ATOM   748  O O     . ASP A 1 112 ? 32.160  56.806  36.698 1.00 28.66 ? 112  ASP A O     1 
ATOM   749  C CB    . ASP A 1 112 ? 33.105  55.226  34.699 1.00 32.54 ? 112  ASP A CB    1 
ATOM   750  C CG    . ASP A 1 112 ? 33.756  54.526  33.520 1.00 34.52 ? 112  ASP A CG    1 
ATOM   751  O OD1   . ASP A 1 112 ? 34.514  55.193  32.781 1.00 34.83 ? 112  ASP A OD1   1 
ATOM   752  O OD2   . ASP A 1 112 ? 33.516  53.311  33.345 1.00 34.27 ? 112  ASP A OD2   1 
ATOM   753  N N     . PHE A 1 113 ? 34.147  57.250  37.647 1.00 27.16 ? 113  PHE A N     1 
ATOM   754  C CA    . PHE A 1 113 ? 33.541  57.951  38.772 1.00 26.42 ? 113  PHE A CA    1 
ATOM   755  C C     . PHE A 1 113 ? 32.694  59.075  38.182 1.00 26.31 ? 113  PHE A C     1 
ATOM   756  O O     . PHE A 1 113 ? 33.153  59.784  37.280 1.00 25.94 ? 113  PHE A O     1 
ATOM   757  C CB    . PHE A 1 113 ? 34.610  58.554  39.682 1.00 25.93 ? 113  PHE A CB    1 
ATOM   758  C CG    . PHE A 1 113 ? 34.049  59.455  40.744 1.00 26.53 ? 113  PHE A CG    1 
ATOM   759  C CD1   . PHE A 1 113 ? 33.460  58.920  41.886 1.00 26.05 ? 113  PHE A CD1   1 
ATOM   760  C CD2   . PHE A 1 113 ? 34.032  60.835  40.566 1.00 26.59 ? 113  PHE A CD2   1 
ATOM   761  C CE1   . PHE A 1 113 ? 32.854  59.741  42.829 1.00 25.68 ? 113  PHE A CE1   1 
ATOM   762  C CE2   . PHE A 1 113 ? 33.427  61.670  41.508 1.00 27.24 ? 113  PHE A CE2   1 
ATOM   763  C CZ    . PHE A 1 113 ? 32.836  61.121  42.638 1.00 26.20 ? 113  PHE A CZ    1 
ATOM   764  N N     . LYS A 1 114 ? 31.467  59.235  38.670 1.00 24.35 ? 114  LYS A N     1 
ATOM   765  C CA    . LYS A 1 114 ? 30.593  60.279  38.152 1.00 23.41 ? 114  LYS A CA    1 
ATOM   766  C C     . LYS A 1 114 ? 29.627  60.844  39.189 1.00 22.42 ? 114  LYS A C     1 
ATOM   767  O O     . LYS A 1 114 ? 29.052  60.091  39.970 1.00 21.58 ? 114  LYS A O     1 
ATOM   768  C CB    . LYS A 1 114 ? 29.786  59.740  36.971 1.00 24.00 ? 114  LYS A CB    1 
ATOM   769  C CG    . LYS A 1 114 ? 29.000  60.818  36.257 1.00 26.81 ? 114  LYS A CG    1 
ATOM   770  C CD    . LYS A 1 114 ? 28.021  60.229  35.288 1.00 30.22 ? 114  LYS A CD    1 
ATOM   771  C CE    . LYS A 1 114 ? 27.224  61.336  34.609 1.00 33.54 ? 114  LYS A CE    1 
ATOM   772  N NZ    . LYS A 1 114 ? 26.221  60.775  33.658 1.00 35.83 ? 114  LYS A NZ    1 
ATOM   773  N N     . ILE A 1 115 ? 29.474  62.167  39.205 1.00 21.93 ? 115  ILE A N     1 
ATOM   774  C CA    . ILE A 1 115 ? 28.536  62.853  40.105 1.00 20.40 ? 115  ILE A CA    1 
ATOM   775  C C     . ILE A 1 115 ? 27.187  62.753  39.400 1.00 21.13 ? 115  ILE A C     1 
ATOM   776  O O     . ILE A 1 115 ? 27.027  63.247  38.278 1.00 21.35 ? 115  ILE A O     1 
ATOM   777  C CB    . ILE A 1 115 ? 28.905  64.352  40.303 1.00 21.02 ? 115  ILE A CB    1 
ATOM   778  C CG1   . ILE A 1 115 ? 30.284  64.476  40.961 1.00 18.62 ? 115  ILE A CG1   1 
ATOM   779  C CG2   . ILE A 1 115 ? 27.822  65.078  41.134 1.00 18.45 ? 115  ILE A CG2   1 
ATOM   780  C CD1   . ILE A 1 115 ? 30.390  63.843  42.332 1.00 18.45 ? 115  ILE A CD1   1 
ATOM   781  N N     . GLN A 1 116 ? 26.237  62.080  40.043 1.00 19.96 ? 116  GLN A N     1 
ATOM   782  C CA    . GLN A 1 116 ? 24.916  61.856  39.470 1.00 19.38 ? 116  GLN A CA    1 
ATOM   783  C C     . GLN A 1 116 ? 23.810  62.828  39.883 1.00 18.62 ? 116  GLN A C     1 
ATOM   784  O O     . GLN A 1 116 ? 22.862  63.051  39.131 1.00 18.14 ? 116  GLN A O     1 
ATOM   785  C CB    . GLN A 1 116 ? 24.484  60.421  39.768 1.00 19.04 ? 116  GLN A CB    1 
ATOM   786  C CG    . GLN A 1 116 ? 25.424  59.369  39.220 1.00 19.81 ? 116  GLN A CG    1 
ATOM   787  C CD    . GLN A 1 116 ? 25.275  59.179  37.726 1.00 21.65 ? 116  GLN A CD    1 
ATOM   788  O OE1   . GLN A 1 116 ? 24.517  59.889  37.070 1.00 23.14 ? 116  GLN A OE1   1 
ATOM   789  N NE2   . GLN A 1 116 ? 25.987  58.209  37.182 1.00 22.09 ? 116  GLN A NE2   1 
ATOM   790  N N     . ASN A 1 117 ? 23.913  63.391  41.077 1.00 17.79 ? 117  ASN A N     1 
ATOM   791  C CA    . ASN A 1 117 ? 22.895  64.323  41.550 1.00 17.43 ? 117  ASN A CA    1 
ATOM   792  C C     . ASN A 1 117 ? 23.454  65.160  42.676 1.00 16.44 ? 117  ASN A C     1 
ATOM   793  O O     . ASN A 1 117 ? 24.237  64.679  43.494 1.00 15.68 ? 117  ASN A O     1 
ATOM   794  C CB    . ASN A 1 117 ? 21.652  63.552  42.038 1.00 18.14 ? 117  ASN A CB    1 
ATOM   795  C CG    . ASN A 1 117 ? 20.482  64.468  42.420 1.00 19.05 ? 117  ASN A CG    1 
ATOM   796  O OD1   . ASN A 1 117 ? 20.295  65.545  41.852 1.00 18.79 ? 117  ASN A OD1   1 
ATOM   797  N ND2   . ASN A 1 117 ? 19.675  64.018  43.372 1.00 17.32 ? 117  ASN A ND2   1 
ATOM   798  N N     . ILE A 1 118 ? 23.073  66.426  42.686 1.00 16.47 ? 118  ILE A N     1 
ATOM   799  C CA    . ILE A 1 118 ? 23.497  67.363  43.713 1.00 16.33 ? 118  ILE A CA    1 
ATOM   800  C C     . ILE A 1 118 ? 22.225  68.015  44.236 1.00 16.30 ? 118  ILE A C     1 
ATOM   801  O O     . ILE A 1 118 ? 21.372  68.438  43.456 1.00 16.08 ? 118  ILE A O     1 
ATOM   802  C CB    . ILE A 1 118 ? 24.421  68.455  43.130 1.00 16.09 ? 118  ILE A CB    1 
ATOM   803  C CG1   . ILE A 1 118 ? 25.676  67.815  42.524 1.00 17.57 ? 118  ILE A CG1   1 
ATOM   804  C CG2   . ILE A 1 118 ? 24.767  69.479  44.195 1.00 15.52 ? 118  ILE A CG2   1 
ATOM   805  C CD1   . ILE A 1 118 ? 26.585  68.781  41.822 1.00 17.15 ? 118  ILE A CD1   1 
ATOM   806  N N     . VAL A 1 119 ? 22.082  68.044  45.558 1.00 17.36 ? 119  VAL A N     1 
ATOM   807  C CA    . VAL A 1 119 ? 20.924  68.638  46.224 1.00 16.68 ? 119  VAL A CA    1 
ATOM   808  C C     . VAL A 1 119 ? 21.413  69.828  47.030 1.00 16.74 ? 119  VAL A C     1 
ATOM   809  O O     . VAL A 1 119 ? 22.329  69.698  47.838 1.00 18.50 ? 119  VAL A O     1 
ATOM   810  C CB    . VAL A 1 119 ? 20.263  67.640  47.207 1.00 15.07 ? 119  VAL A CB    1 
ATOM   811  C CG1   . VAL A 1 119 ? 18.993  68.239  47.783 1.00 16.30 ? 119  VAL A CG1   1 
ATOM   812  C CG2   . VAL A 1 119 ? 19.982  66.305  46.519 1.00 14.12 ? 119  VAL A CG2   1 
ATOM   813  N N     . GLY A 1 120 ? 20.811  70.985  46.823 1.00 16.08 ? 120  GLY A N     1 
ATOM   814  C CA    . GLY A 1 120 ? 21.231  72.154  47.567 1.00 17.15 ? 120  GLY A CA    1 
ATOM   815  C C     . GLY A 1 120 ? 20.027  72.821  48.193 1.00 18.31 ? 120  GLY A C     1 
ATOM   816  O O     . GLY A 1 120 ? 18.894  72.492  47.845 1.00 19.15 ? 120  GLY A O     1 
ATOM   817  N N     . SER A 1 121 ? 20.258  73.735  49.127 1.00 19.13 ? 121  SER A N     1 
ATOM   818  C CA    . SER A 1 121 ? 19.166  74.441  49.777 1.00 20.23 ? 121  SER A CA    1 
ATOM   819  C C     . SER A 1 121 ? 19.589  75.829  50.234 1.00 20.61 ? 121  SER A C     1 
ATOM   820  O O     . SER A 1 121 ? 20.767  76.083  50.495 1.00 20.45 ? 121  SER A O     1 
ATOM   821  C CB    . SER A 1 121 ? 18.616  73.637  50.967 1.00 19.44 ? 121  SER A CB    1 
ATOM   822  O OG    . SER A 1 121 ? 19.466  73.695  52.098 1.00 18.68 ? 121  SER A OG    1 
ATOM   823  N N     . CYS A 1 122 ? 18.632  76.744  50.280 1.00 21.67 ? 122  CYS A N     1 
ATOM   824  C CA    . CYS A 1 122 ? 18.915  78.092  50.738 1.00 23.50 ? 122  CYS A CA    1 
ATOM   825  C C     . CYS A 1 122 ? 17.675  78.743  51.322 1.00 22.50 ? 122  CYS A C     1 
ATOM   826  O O     . CYS A 1 122 ? 16.579  78.182  51.260 1.00 21.65 ? 122  CYS A O     1 
ATOM   827  C CB    . CYS A 1 122 ? 19.543  78.943  49.632 1.00 25.54 ? 122  CYS A CB    1 
ATOM   828  S SG    . CYS A 1 122 ? 18.681  78.869  48.102 1.00 29.13 ? 122  CYS A SG    1 
ATOM   829  N N     . ASP A 1 123 ? 17.856  79.934  51.873 1.00 21.71 ? 123  ASP A N     1 
ATOM   830  C CA    . ASP A 1 123 ? 16.788  80.657  52.532 1.00 22.02 ? 123  ASP A CA    1 
ATOM   831  C C     . ASP A 1 123 ? 16.786  82.091  52.029 1.00 22.81 ? 123  ASP A C     1 
ATOM   832  O O     . ASP A 1 123 ? 17.757  82.813  52.229 1.00 23.68 ? 123  ASP A O     1 
ATOM   833  C CB    . ASP A 1 123 ? 17.091  80.620  54.030 1.00 22.91 ? 123  ASP A CB    1 
ATOM   834  C CG    . ASP A 1 123 ? 16.018  81.248  54.882 1.00 24.02 ? 123  ASP A CG    1 
ATOM   835  O OD1   . ASP A 1 123 ? 14.988  81.732  54.359 1.00 24.57 ? 123  ASP A OD1   1 
ATOM   836  O OD2   . ASP A 1 123 ? 16.225  81.246  56.112 1.00 24.39 ? 123  ASP A OD2   1 
ATOM   837  N N     . VAL A 1 124 ? 15.705  82.510  51.375 1.00 23.06 ? 124  VAL A N     1 
ATOM   838  C CA    . VAL A 1 124 ? 15.636  83.884  50.867 1.00 24.06 ? 124  VAL A CA    1 
ATOM   839  C C     . VAL A 1 124 ? 15.202  84.878  51.944 1.00 25.24 ? 124  VAL A C     1 
ATOM   840  O O     . VAL A 1 124 ? 15.179  86.089  51.726 1.00 25.90 ? 124  VAL A O     1 
ATOM   841  C CB    . VAL A 1 124 ? 14.735  84.007  49.627 1.00 23.21 ? 124  VAL A CB    1 
ATOM   842  C CG1   . VAL A 1 124 ? 15.283  83.130  48.506 1.00 22.65 ? 124  VAL A CG1   1 
ATOM   843  C CG2   . VAL A 1 124 ? 13.286  83.657  49.971 1.00 22.25 ? 124  VAL A CG2   1 
ATOM   844  N N     . LYS A 1 125 ? 14.834  84.347  53.103 1.00 26.14 ? 125  LYS A N     1 
ATOM   845  C CA    . LYS A 1 125 ? 14.443  85.154  54.244 1.00 27.35 ? 125  LYS A CA    1 
ATOM   846  C C     . LYS A 1 125 ? 13.218  86.042  54.088 1.00 26.98 ? 125  LYS A C     1 
ATOM   847  O O     . LYS A 1 125 ? 13.164  87.139  54.638 1.00 27.66 ? 125  LYS A O     1 
ATOM   848  C CB    . LYS A 1 125 ? 15.640  85.965  54.751 1.00 29.89 ? 125  LYS A CB    1 
ATOM   849  C CG    . LYS A 1 125 ? 16.710  85.106  55.379 1.00 32.76 ? 125  LYS A CG    1 
ATOM   850  C CD    . LYS A 1 125 ? 18.033  85.321  54.690 1.00 37.62 ? 125  LYS A CD    1 
ATOM   851  C CE    . LYS A 1 125 ? 19.099  84.404  55.273 1.00 41.02 ? 125  LYS A CE    1 
ATOM   852  N NZ    . LYS A 1 125 ? 19.392  84.726  56.701 1.00 43.30 ? 125  LYS A NZ    1 
ATOM   853  N N     . PHE A 1 126 ? 12.264  85.586  53.286 1.00 25.55 ? 126  PHE A N     1 
ATOM   854  C CA    . PHE A 1 126 ? 10.992  86.274  53.108 1.00 23.15 ? 126  PHE A CA    1 
ATOM   855  C C     . PHE A 1 126 ? 9.982   85.230  52.668 1.00 22.56 ? 126  PHE A C     1 
ATOM   856  O O     . PHE A 1 126 ? 10.347  84.250  52.011 1.00 22.07 ? 126  PHE A O     1 
ATOM   857  C CB    . PHE A 1 126 ? 11.066  87.508  52.173 1.00 22.39 ? 126  PHE A CB    1 
ATOM   858  C CG    . PHE A 1 126 ? 11.519  87.227  50.764 1.00 20.63 ? 126  PHE A CG    1 
ATOM   859  C CD1   . PHE A 1 126 ? 10.634  86.726  49.815 1.00 19.79 ? 126  PHE A CD1   1 
ATOM   860  C CD2   . PHE A 1 126 ? 12.803  87.562  50.365 1.00 19.10 ? 126  PHE A CD2   1 
ATOM   861  C CE1   . PHE A 1 126 ? 11.021  86.570  48.489 1.00 19.37 ? 126  PHE A CE1   1 
ATOM   862  C CE2   . PHE A 1 126 ? 13.203  87.411  49.045 1.00 19.75 ? 126  PHE A CE2   1 
ATOM   863  C CZ    . PHE A 1 126 ? 12.311  86.916  48.102 1.00 20.22 ? 126  PHE A CZ    1 
ATOM   864  N N     . PRO A 1 127 ? 8.736   85.337  53.158 1.00 23.31 ? 127  PRO A N     1 
ATOM   865  C CA    . PRO A 1 127 ? 7.688   84.379  52.801 1.00 22.14 ? 127  PRO A CA    1 
ATOM   866  C C     . PRO A 1 127 ? 7.236   84.535  51.347 1.00 21.99 ? 127  PRO A C     1 
ATOM   867  O O     . PRO A 1 127 ? 7.320   85.624  50.768 1.00 22.32 ? 127  PRO A O     1 
ATOM   868  C CB    . PRO A 1 127 ? 6.593   84.691  53.813 1.00 21.86 ? 127  PRO A CB    1 
ATOM   869  C CG    . PRO A 1 127 ? 6.736   86.178  53.992 1.00 22.38 ? 127  PRO A CG    1 
ATOM   870  C CD    . PRO A 1 127 ? 8.224   86.361  54.091 1.00 22.42 ? 127  PRO A CD    1 
ATOM   871  N N     . ILE A 1 128 ? 6.744   83.443  50.770 1.00 21.95 ? 128  ILE A N     1 
ATOM   872  C CA    . ILE A 1 128 ? 6.322   83.409  49.373 1.00 21.61 ? 128  ILE A CA    1 
ATOM   873  C C     . ILE A 1 128 ? 4.838   83.095  49.239 1.00 21.88 ? 128  ILE A C     1 
ATOM   874  O O     . ILE A 1 128 ? 4.288   82.292  50.003 1.00 22.13 ? 128  ILE A O     1 
ATOM   875  C CB    . ILE A 1 128 ? 7.088   82.284  48.586 1.00 21.92 ? 128  ILE A CB    1 
ATOM   876  C CG1   . ILE A 1 128 ? 8.594   82.282  48.930 1.00 20.90 ? 128  ILE A CG1   1 
ATOM   877  C CG2   . ILE A 1 128 ? 6.845   82.399  47.074 1.00 20.02 ? 128  ILE A CG2   1 
ATOM   878  C CD1   . ILE A 1 128 ? 9.352   83.515  48.522 1.00 21.68 ? 128  ILE A CD1   1 
ATOM   879  N N     . ARG A 1 129 ? 4.195   83.749  48.274 1.00 22.18 ? 129  ARG A N     1 
ATOM   880  C CA    . ARG A 1 129 ? 2.787   83.521  47.953 1.00 21.84 ? 129  ARG A CA    1 
ATOM   881  C C     . ARG A 1 129 ? 2.811   82.405  46.912 1.00 21.71 ? 129  ARG A C     1 
ATOM   882  O O     . ARG A 1 129 ? 2.819   82.663  45.707 1.00 21.79 ? 129  ARG A O     1 
ATOM   883  C CB    . ARG A 1 129 ? 2.164   84.773  47.344 1.00 22.51 ? 129  ARG A CB    1 
ATOM   884  C CG    . ARG A 1 129 ? 1.853   85.859  48.346 1.00 24.29 ? 129  ARG A CG    1 
ATOM   885  C CD    . ARG A 1 129 ? 0.802   86.808  47.794 1.00 26.75 ? 129  ARG A CD    1 
ATOM   886  N NE    . ARG A 1 129 ? 1.291   87.533  46.628 1.00 28.03 ? 129  ARG A NE    1 
ATOM   887  C CZ    . ARG A 1 129 ? 0.862   87.350  45.382 1.00 30.73 ? 129  ARG A CZ    1 
ATOM   888  N NH1   . ARG A 1 129 ? -0.091  86.455  45.116 1.00 30.63 ? 129  ARG A NH1   1 
ATOM   889  N NH2   . ARG A 1 129 ? 1.380   88.076  44.394 1.00 30.77 ? 129  ARG A NH2   1 
ATOM   890  N N     . LEU A 1 130 ? 2.838   81.165  47.389 1.00 21.43 ? 130  LEU A N     1 
ATOM   891  C CA    . LEU A 1 130 ? 2.935   80.007  46.515 1.00 21.64 ? 130  LEU A CA    1 
ATOM   892  C C     . LEU A 1 130 ? 1.854   79.882  45.465 1.00 22.78 ? 130  LEU A C     1 
ATOM   893  O O     . LEU A 1 130 ? 2.164   79.651  44.296 1.00 22.23 ? 130  LEU A O     1 
ATOM   894  C CB    . LEU A 1 130 ? 3.069   78.714  47.334 1.00 20.89 ? 130  LEU A CB    1 
ATOM   895  C CG    . LEU A 1 130 ? 4.282   78.642  48.281 1.00 19.99 ? 130  LEU A CG    1 
ATOM   896  C CD1   . LEU A 1 130 ? 4.342   77.292  48.964 1.00 19.93 ? 130  LEU A CD1   1 
ATOM   897  C CD2   . LEU A 1 130 ? 5.573   78.877  47.517 1.00 18.73 ? 130  LEU A CD2   1 
ATOM   898  N N     . GLU A 1 131 ? 0.595   80.081  45.847 1.00 24.75 ? 131  GLU A N     1 
ATOM   899  C CA    . GLU A 1 131 ? -0.490  79.962  44.875 1.00 26.79 ? 131  GLU A CA    1 
ATOM   900  C C     . GLU A 1 131 ? -0.369  80.987  43.737 1.00 25.19 ? 131  GLU A C     1 
ATOM   901  O O     . GLU A 1 131 ? -0.643  80.674  42.575 1.00 25.24 ? 131  GLU A O     1 
ATOM   902  C CB    . GLU A 1 131 ? -1.859  80.030  45.565 1.00 30.21 ? 131  GLU A CB    1 
ATOM   903  C CG    . GLU A 1 131 ? -3.037  79.719  44.639 1.00 39.00 ? 131  GLU A CG    1 
ATOM   904  C CD    . GLU A 1 131 ? -2.807  78.468  43.780 1.00 44.48 ? 131  GLU A CD    1 
ATOM   905  O OE1   . GLU A 1 131 ? -2.856  77.337  44.331 1.00 47.12 ? 131  GLU A OE1   1 
ATOM   906  O OE2   . GLU A 1 131 ? -2.572  78.622  42.551 1.00 46.65 ? 131  GLU A OE2   1 
ATOM   907  N N     . GLY A 1 132 ? 0.051   82.203  44.071 1.00 23.83 ? 132  GLY A N     1 
ATOM   908  C CA    . GLY A 1 132 ? 0.231   83.221  43.051 1.00 22.11 ? 132  GLY A CA    1 
ATOM   909  C C     . GLY A 1 132 ? 1.393   82.866  42.136 1.00 21.99 ? 132  GLY A C     1 
ATOM   910  O O     . GLY A 1 132 ? 1.348   83.109  40.925 1.00 21.33 ? 132  GLY A O     1 
ATOM   911  N N     . LEU A 1 133 ? 2.455   82.303  42.705 1.00 21.47 ? 133  LEU A N     1 
ATOM   912  C CA    . LEU A 1 133 ? 3.596   81.909  41.891 1.00 23.17 ? 133  LEU A CA    1 
ATOM   913  C C     . LEU A 1 133 ? 3.188   80.755  40.976 1.00 23.99 ? 133  LEU A C     1 
ATOM   914  O O     . LEU A 1 133 ? 3.540   80.734  39.796 1.00 24.54 ? 133  LEU A O     1 
ATOM   915  C CB    . LEU A 1 133 ? 4.787   81.498  42.764 1.00 24.13 ? 133  LEU A CB    1 
ATOM   916  C CG    . LEU A 1 133 ? 6.153   81.411  42.068 1.00 24.62 ? 133  LEU A CG    1 
ATOM   917  C CD1   . LEU A 1 133 ? 7.269   81.434  43.109 1.00 25.44 ? 133  LEU A CD1   1 
ATOM   918  C CD2   . LEU A 1 133 ? 6.257   80.170  41.189 1.00 24.36 ? 133  LEU A CD2   1 
ATOM   919  N N     . ALA A 1 134 ? 2.445   79.799  41.522 1.00 25.03 ? 134  ALA A N     1 
ATOM   920  C CA    . ALA A 1 134 ? 1.990   78.649  40.749 1.00 25.96 ? 134  ALA A CA    1 
ATOM   921  C C     . ALA A 1 134 ? 1.132   79.095  39.558 1.00 27.00 ? 134  ALA A C     1 
ATOM   922  O O     . ALA A 1 134 ? 1.366   78.686  38.423 1.00 26.84 ? 134  ALA A O     1 
ATOM   923  C CB    . ALA A 1 134 ? 1.204   77.700  41.654 1.00 25.14 ? 134  ALA A CB    1 
ATOM   924  N N     . TYR A 1 135 ? 0.173   79.972  39.827 1.00 28.76 ? 135  TYR A N     1 
ATOM   925  C CA    . TYR A 1 135 ? -0.741  80.491  38.811 1.00 31.02 ? 135  TYR A CA    1 
ATOM   926  C C     . TYR A 1 135 ? -0.030  81.170  37.647 1.00 30.86 ? 135  TYR A C     1 
ATOM   927  O O     . TYR A 1 135 ? -0.339  80.913  36.480 1.00 31.29 ? 135  TYR A O     1 
ATOM   928  C CB    . TYR A 1 135 ? -1.712  81.471  39.462 1.00 34.06 ? 135  TYR A CB    1 
ATOM   929  C CG    . TYR A 1 135 ? -2.838  81.932  38.571 1.00 38.76 ? 135  TYR A CG    1 
ATOM   930  C CD1   . TYR A 1 135 ? -3.906  81.082  38.265 1.00 39.94 ? 135  TYR A CD1   1 
ATOM   931  C CD2   . TYR A 1 135 ? -2.855  83.226  38.053 1.00 39.99 ? 135  TYR A CD2   1 
ATOM   932  C CE1   . TYR A 1 135 ? -4.961  81.512  37.469 1.00 41.73 ? 135  TYR A CE1   1 
ATOM   933  C CE2   . TYR A 1 135 ? -3.908  83.668  37.253 1.00 41.70 ? 135  TYR A CE2   1 
ATOM   934  C CZ    . TYR A 1 135 ? -4.956  82.807  36.966 1.00 42.34 ? 135  TYR A CZ    1 
ATOM   935  O OH    . TYR A 1 135 ? -5.995  83.240  36.172 1.00 44.26 ? 135  TYR A OH    1 
ATOM   936  N N     . SER A 1 136 ? 0.930   82.030  37.957 1.00 30.12 ? 136  SER A N     1 
ATOM   937  C CA    . SER A 1 136 ? 1.664   82.739  36.918 1.00 29.41 ? 136  SER A CA    1 
ATOM   938  C C     . SER A 1 136 ? 2.675   81.865  36.172 1.00 29.36 ? 136  SER A C     1 
ATOM   939  O O     . SER A 1 136 ? 3.227   82.285  35.153 1.00 28.99 ? 136  SER A O     1 
ATOM   940  C CB    . SER A 1 136 ? 2.379   83.934  37.531 1.00 29.69 ? 136  SER A CB    1 
ATOM   941  O OG    . SER A 1 136 ? 3.263   83.503  38.548 1.00 30.04 ? 136  SER A OG    1 
ATOM   942  N N     . HIS A 1 137 ? 2.933   80.663  36.688 1.00 29.50 ? 137  HIS A N     1 
ATOM   943  C CA    . HIS A 1 137 ? 3.885   79.731  36.082 1.00 28.40 ? 137  HIS A CA    1 
ATOM   944  C C     . HIS A 1 137 ? 3.304   78.329  36.044 1.00 28.84 ? 137  HIS A C     1 
ATOM   945  O O     . HIS A 1 137 ? 4.001   77.359  36.344 1.00 30.19 ? 137  HIS A O     1 
ATOM   946  C CB    . HIS A 1 137 ? 5.182   79.701  36.896 1.00 28.02 ? 137  HIS A CB    1 
ATOM   947  C CG    . HIS A 1 137 ? 5.927   80.992  36.891 1.00 26.50 ? 137  HIS A CG    1 
ATOM   948  N ND1   . HIS A 1 137 ? 5.470   82.116  37.547 1.00 26.39 ? 137  HIS A ND1   1 
ATOM   949  C CD2   . HIS A 1 137 ? 7.069   81.359  36.264 1.00 25.94 ? 137  HIS A CD2   1 
ATOM   950  C CE1   . HIS A 1 137 ? 6.294   83.121  37.316 1.00 26.50 ? 137  HIS A CE1   1 
ATOM   951  N NE2   . HIS A 1 137 ? 7.271   82.687  36.542 1.00 26.77 ? 137  HIS A NE2   1 
ATOM   952  N N     . ALA A 1 138 ? 2.055   78.214  35.606 1.00 28.72 ? 138  ALA A N     1 
ATOM   953  C CA    . ALA A 1 138 ? 1.358   76.933  35.545 1.00 28.88 ? 138  ALA A CA    1 
ATOM   954  C C     . ALA A 1 138 ? 2.100   75.808  34.830 1.00 29.81 ? 138  ALA A C     1 
ATOM   955  O O     . ALA A 1 138 ? 2.010   74.642  35.226 1.00 31.06 ? 138  ALA A O     1 
ATOM   956  C CB    . ALA A 1 138 ? -0.004  77.126  34.923 1.00 29.31 ? 138  ALA A CB    1 
ATOM   957  N N     . ALA A 1 139 ? 2.827   76.149  33.772 1.00 30.17 ? 139  ALA A N     1 
ATOM   958  C CA    . ALA A 1 139 ? 3.567   75.154  33.000 1.00 30.08 ? 139  ALA A CA    1 
ATOM   959  C C     . ALA A 1 139 ? 4.801   74.592  33.707 1.00 29.92 ? 139  ALA A C     1 
ATOM   960  O O     . ALA A 1 139 ? 5.359   73.587  33.269 1.00 30.48 ? 139  ALA A O     1 
ATOM   961  C CB    . ALA A 1 139 ? 3.969   75.736  31.658 1.00 30.09 ? 139  ALA A CB    1 
ATOM   962  N N     . PHE A 1 140 ? 5.235   75.250  34.780 1.00 28.91 ? 140  PHE A N     1 
ATOM   963  C CA    . PHE A 1 140 ? 6.417   74.807  35.519 1.00 28.62 ? 140  PHE A CA    1 
ATOM   964  C C     . PHE A 1 140 ? 6.094   74.365  36.931 1.00 27.81 ? 140  PHE A C     1 
ATOM   965  O O     . PHE A 1 140 ? 6.881   73.655  37.557 1.00 27.11 ? 140  PHE A O     1 
ATOM   966  C CB    . PHE A 1 140 ? 7.437   75.944  35.638 1.00 28.42 ? 140  PHE A CB    1 
ATOM   967  C CG    . PHE A 1 140 ? 7.846   76.538  34.329 1.00 28.81 ? 140  PHE A CG    1 
ATOM   968  C CD1   . PHE A 1 140 ? 7.122   77.587  33.771 1.00 29.45 ? 140  PHE A CD1   1 
ATOM   969  C CD2   . PHE A 1 140 ? 8.957   76.057  33.653 1.00 28.45 ? 140  PHE A CD2   1 
ATOM   970  C CE1   . PHE A 1 140 ? 7.505   78.146  32.557 1.00 29.94 ? 140  PHE A CE1   1 
ATOM   971  C CE2   . PHE A 1 140 ? 9.346   76.609  32.444 1.00 29.58 ? 140  PHE A CE2   1 
ATOM   972  C CZ    . PHE A 1 140 ? 8.620   77.655  31.895 1.00 28.93 ? 140  PHE A CZ    1 
ATOM   973  N N     . SER A 1 141 ? 4.929   74.774  37.420 1.00 27.54 ? 141  SER A N     1 
ATOM   974  C CA    . SER A 1 141 ? 4.541   74.503  38.792 1.00 27.08 ? 141  SER A CA    1 
ATOM   975  C C     . SER A 1 141 ? 3.514   73.422  39.066 1.00 27.13 ? 141  SER A C     1 
ATOM   976  O O     . SER A 1 141 ? 2.630   73.150  38.253 1.00 27.80 ? 141  SER A O     1 
ATOM   977  C CB    . SER A 1 141 ? 4.032   75.800  39.429 1.00 26.21 ? 141  SER A CB    1 
ATOM   978  O OG    . SER A 1 141 ? 4.911   76.886  39.198 1.00 26.53 ? 141  SER A OG    1 
ATOM   979  N N     . SER A 1 142 ? 3.650   72.838  40.249 1.00 27.05 ? 142  SER A N     1 
ATOM   980  C CA    . SER A 1 142 ? 2.737   71.839  40.776 1.00 27.10 ? 142  SER A CA    1 
ATOM   981  C C     . SER A 1 142 ? 2.604   72.236  42.241 1.00 27.20 ? 142  SER A C     1 
ATOM   982  O O     . SER A 1 142 ? 3.567   72.146  42.997 1.00 26.37 ? 142  SER A O     1 
ATOM   983  C CB    . SER A 1 142 ? 3.314   70.429  40.696 1.00 26.84 ? 142  SER A CB    1 
ATOM   984  O OG    . SER A 1 142 ? 3.387   69.981  39.363 1.00 30.86 ? 142  SER A OG    1 
ATOM   985  N N     . TYR A 1 143 ? 1.450   72.772  42.611 1.00 27.07 ? 143  TYR A N     1 
ATOM   986  C CA    . TYR A 1 143 ? 1.212   73.176  43.979 1.00 26.82 ? 143  TYR A CA    1 
ATOM   987  C C     . TYR A 1 143 ? -0.115  72.607  44.484 1.00 28.46 ? 143  TYR A C     1 
ATOM   988  O O     . TYR A 1 143 ? -1.197  73.060  44.091 1.00 28.97 ? 143  TYR A O     1 
ATOM   989  C CB    . TYR A 1 143 ? 1.207   74.699  44.092 1.00 25.31 ? 143  TYR A CB    1 
ATOM   990  C CG    . TYR A 1 143 ? 1.038   75.201  45.510 1.00 23.55 ? 143  TYR A CG    1 
ATOM   991  C CD1   . TYR A 1 143 ? 1.770   74.642  46.564 1.00 21.92 ? 143  TYR A CD1   1 
ATOM   992  C CD2   . TYR A 1 143 ? 0.148   76.231  45.800 1.00 22.97 ? 143  TYR A CD2   1 
ATOM   993  C CE1   . TYR A 1 143 ? 1.615   75.100  47.862 1.00 20.00 ? 143  TYR A CE1   1 
ATOM   994  C CE2   . TYR A 1 143 ? -0.013  76.695  47.098 1.00 21.85 ? 143  TYR A CE2   1 
ATOM   995  C CZ    . TYR A 1 143 ? 0.722   76.125  48.119 1.00 20.54 ? 143  TYR A CZ    1 
ATOM   996  O OH    . TYR A 1 143 ? 0.549   76.583  49.394 1.00 20.84 ? 143  TYR A OH    1 
ATOM   997  N N     . GLU A 1 144 ? -0.020  71.584  45.324 1.00 27.93 ? 144  GLU A N     1 
ATOM   998  C CA    . GLU A 1 144 ? -1.185  70.954  45.916 1.00 27.47 ? 144  GLU A CA    1 
ATOM   999  C C     . GLU A 1 144 ? -0.833  70.826  47.393 1.00 27.21 ? 144  GLU A C     1 
ATOM   1000 O O     . GLU A 1 144 ? -0.417  69.758  47.858 1.00 28.41 ? 144  GLU A O     1 
ATOM   1001 C CB    . GLU A 1 144 ? -1.418  69.583  45.295 1.00 28.78 ? 144  GLU A CB    1 
ATOM   1002 C CG    . GLU A 1 144 ? -1.584  69.595  43.779 1.00 33.32 ? 144  GLU A CG    1 
ATOM   1003 C CD    . GLU A 1 144 ? -2.702  70.517  43.278 1.00 36.62 ? 144  GLU A CD    1 
ATOM   1004 O OE1   . GLU A 1 144 ? -3.771  70.615  43.923 1.00 37.03 ? 144  GLU A OE1   1 
ATOM   1005 O OE2   . GLU A 1 144 ? -2.512  71.144  42.212 1.00 39.56 ? 144  GLU A OE2   1 
ATOM   1006 N N     . PRO A 1 145 ? -0.992  71.922  48.156 1.00 25.37 ? 145  PRO A N     1 
ATOM   1007 C CA    . PRO A 1 145 ? -0.689  71.979  49.587 1.00 25.58 ? 145  PRO A CA    1 
ATOM   1008 C C     . PRO A 1 145 ? -1.258  70.849  50.451 1.00 26.98 ? 145  PRO A C     1 
ATOM   1009 O O     . PRO A 1 145 ? -0.630  70.425  51.426 1.00 27.34 ? 145  PRO A O     1 
ATOM   1010 C CB    . PRO A 1 145 ? -1.221  73.357  49.995 1.00 24.49 ? 145  PRO A CB    1 
ATOM   1011 C CG    . PRO A 1 145 ? -2.285  73.637  48.975 1.00 24.30 ? 145  PRO A CG    1 
ATOM   1012 C CD    . PRO A 1 145 ? -1.640  73.169  47.719 1.00 24.47 ? 145  PRO A CD    1 
ATOM   1013 N N     . GLU A 1 146 ? -2.422  70.337  50.084 1.00 27.45 ? 146  GLU A N     1 
ATOM   1014 C CA    . GLU A 1 146 ? -3.033  69.269  50.854 1.00 28.94 ? 146  GLU A CA    1 
ATOM   1015 C C     . GLU A 1 146 ? -2.247  67.978  50.705 1.00 29.40 ? 146  GLU A C     1 
ATOM   1016 O O     . GLU A 1 146 ? -2.317  67.098  51.560 1.00 30.11 ? 146  GLU A O     1 
ATOM   1017 C CB    . GLU A 1 146 ? -4.485  69.088  50.422 1.00 29.22 ? 146  GLU A CB    1 
ATOM   1018 C CG    . GLU A 1 146 ? -5.317  70.314  50.737 1.00 29.81 ? 146  GLU A CG    1 
ATOM   1019 C CD    . GLU A 1 146 ? -6.700  70.264  50.151 1.00 31.03 ? 146  GLU A CD    1 
ATOM   1020 O OE1   . GLU A 1 146 ? -6.907  69.520  49.172 1.00 30.83 ? 146  GLU A OE1   1 
ATOM   1021 O OE2   . GLU A 1 146 ? -7.582  70.986  50.666 1.00 32.71 ? 146  GLU A OE2   1 
ATOM   1022 N N     . LEU A 1 147 ? -1.499  67.882  49.614 1.00 30.04 ? 147  LEU A N     1 
ATOM   1023 C CA    . LEU A 1 147 ? -0.677  66.714  49.330 1.00 30.74 ? 147  LEU A CA    1 
ATOM   1024 C C     . LEU A 1 147 ? 0.741   66.942  49.875 1.00 30.13 ? 147  LEU A C     1 
ATOM   1025 O O     . LEU A 1 147 ? 1.240   66.159  50.689 1.00 30.43 ? 147  LEU A O     1 
ATOM   1026 C CB    . LEU A 1 147 ? -0.656  66.465  47.821 1.00 33.44 ? 147  LEU A CB    1 
ATOM   1027 C CG    . LEU A 1 147 ? -2.023  66.191  47.167 1.00 35.74 ? 147  LEU A CG    1 
ATOM   1028 C CD1   . LEU A 1 147 ? -1.925  66.253  45.651 1.00 36.66 ? 147  LEU A CD1   1 
ATOM   1029 C CD2   . LEU A 1 147 ? -2.546  64.828  47.596 1.00 37.29 ? 147  LEU A CD2   1 
ATOM   1030 N N     . PHE A 1 148 ? 1.370   68.034  49.446 1.00 27.61 ? 148  PHE A N     1 
ATOM   1031 C CA    . PHE A 1 148 ? 2.715   68.393  49.894 1.00 24.82 ? 148  PHE A CA    1 
ATOM   1032 C C     . PHE A 1 148 ? 2.682   69.915  50.001 1.00 23.42 ? 148  PHE A C     1 
ATOM   1033 O O     . PHE A 1 148 ? 2.217   70.593  49.089 1.00 23.60 ? 148  PHE A O     1 
ATOM   1034 C CB    . PHE A 1 148 ? 3.781   67.918  48.878 1.00 23.47 ? 148  PHE A CB    1 
ATOM   1035 C CG    . PHE A 1 148 ? 5.212   68.148  49.330 1.00 22.54 ? 148  PHE A CG    1 
ATOM   1036 C CD1   . PHE A 1 148 ? 5.718   67.502  50.461 1.00 21.49 ? 148  PHE A CD1   1 
ATOM   1037 C CD2   . PHE A 1 148 ? 6.033   69.060  48.660 1.00 21.07 ? 148  PHE A CD2   1 
ATOM   1038 C CE1   . PHE A 1 148 ? 7.018   67.772  50.921 1.00 20.84 ? 148  PHE A CE1   1 
ATOM   1039 C CE2   . PHE A 1 148 ? 7.327   69.336  49.112 1.00 18.56 ? 148  PHE A CE2   1 
ATOM   1040 C CZ    . PHE A 1 148 ? 7.820   68.696  50.242 1.00 19.01 ? 148  PHE A CZ    1 
ATOM   1041 N N     . PRO A 1 149 ? 3.148   70.468  51.130 1.00 23.47 ? 149  PRO A N     1 
ATOM   1042 C CA    . PRO A 1 149 ? 3.180   71.910  51.397 1.00 23.23 ? 149  PRO A CA    1 
ATOM   1043 C C     . PRO A 1 149 ? 4.101   72.772  50.508 1.00 22.55 ? 149  PRO A C     1 
ATOM   1044 O O     . PRO A 1 149 ? 3.954   73.990  50.465 1.00 22.63 ? 149  PRO A O     1 
ATOM   1045 C CB    . PRO A 1 149 ? 3.583   71.965  52.868 1.00 24.16 ? 149  PRO A CB    1 
ATOM   1046 C CG    . PRO A 1 149 ? 4.484   70.793  53.004 1.00 24.42 ? 149  PRO A CG    1 
ATOM   1047 C CD    . PRO A 1 149 ? 3.728   69.720  52.261 1.00 24.02 ? 149  PRO A CD    1 
ATOM   1048 N N     . GLY A 1 150 ? 5.062   72.155  49.832 1.00 21.71 ? 150  GLY A N     1 
ATOM   1049 C CA    . GLY A 1 150 ? 5.945   72.908  48.963 1.00 20.32 ? 150  GLY A CA    1 
ATOM   1050 C C     . GLY A 1 150 ? 5.493   72.886  47.516 1.00 20.05 ? 150  GLY A C     1 
ATOM   1051 O O     . GLY A 1 150 ? 4.822   71.960  47.078 1.00 18.83 ? 150  GLY A O     1 
ATOM   1052 N N     . LEU A 1 151 ? 5.831   73.932  46.776 1.00 19.79 ? 151  LEU A N     1 
ATOM   1053 C CA    . LEU A 1 151 ? 5.484   74.028  45.365 1.00 19.96 ? 151  LEU A CA    1 
ATOM   1054 C C     . LEU A 1 151 ? 6.615   73.370  44.578 1.00 20.18 ? 151  LEU A C     1 
ATOM   1055 O O     . LEU A 1 151 ? 7.793   73.615  44.849 1.00 20.63 ? 151  LEU A O     1 
ATOM   1056 C CB    . LEU A 1 151 ? 5.317   75.505  44.973 1.00 19.79 ? 151  LEU A CB    1 
ATOM   1057 C CG    . LEU A 1 151 ? 5.037   75.933  43.530 1.00 20.03 ? 151  LEU A CG    1 
ATOM   1058 C CD1   . LEU A 1 151 ? 4.507   77.351  43.537 1.00 19.73 ? 151  LEU A CD1   1 
ATOM   1059 C CD2   . LEU A 1 151 ? 6.292   75.857  42.672 1.00 21.30 ? 151  LEU A CD2   1 
ATOM   1060 N N     . ILE A 1 152 ? 6.251   72.488  43.653 1.00 20.23 ? 152  ILE A N     1 
ATOM   1061 C CA    . ILE A 1 152 ? 7.210   71.775  42.812 1.00 20.95 ? 152  ILE A CA    1 
ATOM   1062 C C     . ILE A 1 152 ? 7.422   72.585  41.536 1.00 20.12 ? 152  ILE A C     1 
ATOM   1063 O O     . ILE A 1 152 ? 6.510   72.712  40.721 1.00 20.37 ? 152  ILE A O     1 
ATOM   1064 C CB    . ILE A 1 152 ? 6.679   70.358  42.391 1.00 21.70 ? 152  ILE A CB    1 
ATOM   1065 C CG1   . ILE A 1 152 ? 6.044   69.615  43.582 1.00 22.10 ? 152  ILE A CG1   1 
ATOM   1066 C CG2   . ILE A 1 152 ? 7.802   69.543  41.754 1.00 20.94 ? 152  ILE A CG2   1 
ATOM   1067 C CD1   . ILE A 1 152 ? 6.935   69.463  44.789 1.00 22.82 ? 152  ILE A CD1   1 
ATOM   1068 N N     . TYR A 1 153 ? 8.620   73.129  41.361 1.00 20.56 ? 153  TYR A N     1 
ATOM   1069 C CA    . TYR A 1 153 ? 8.922   73.922  40.179 1.00 20.98 ? 153  TYR A CA    1 
ATOM   1070 C C     . TYR A 1 153 ? 9.944   73.197  39.328 1.00 21.31 ? 153  TYR A C     1 
ATOM   1071 O O     . TYR A 1 153 ? 11.106  73.025  39.719 1.00 20.85 ? 153  TYR A O     1 
ATOM   1072 C CB    . TYR A 1 153 ? 9.440   75.304  40.580 1.00 21.64 ? 153  TYR A CB    1 
ATOM   1073 C CG    . TYR A 1 153 ? 9.472   76.307  39.450 1.00 21.57 ? 153  TYR A CG    1 
ATOM   1074 C CD1   . TYR A 1 153 ? 10.487  76.280  38.486 1.00 21.71 ? 153  TYR A CD1   1 
ATOM   1075 C CD2   . TYR A 1 153 ? 8.504   77.305  39.361 1.00 21.57 ? 153  TYR A CD2   1 
ATOM   1076 C CE1   . TYR A 1 153 ? 10.537  77.231  37.455 1.00 22.16 ? 153  TYR A CE1   1 
ATOM   1077 C CE2   . TYR A 1 153 ? 8.544   78.258  38.340 1.00 22.80 ? 153  TYR A CE2   1 
ATOM   1078 C CZ    . TYR A 1 153 ? 9.561   78.216  37.395 1.00 22.50 ? 153  TYR A CZ    1 
ATOM   1079 O OH    . TYR A 1 153 ? 9.591   79.169  36.401 1.00 24.67 ? 153  TYR A OH    1 
ATOM   1080 N N     . ARG A 1 154 ? 9.499   72.752  38.164 1.00 22.72 ? 154  ARG A N     1 
ATOM   1081 C CA    . ARG A 1 154 ? 10.366  72.032  37.249 1.00 23.37 ? 154  ARG A CA    1 
ATOM   1082 C C     . ARG A 1 154 ? 10.932  72.994  36.226 1.00 23.71 ? 154  ARG A C     1 
ATOM   1083 O O     . ARG A 1 154 ? 10.295  73.290  35.217 1.00 23.97 ? 154  ARG A O     1 
ATOM   1084 C CB    . ARG A 1 154 ? 9.605   70.869  36.601 1.00 23.52 ? 154  ARG A CB    1 
ATOM   1085 C CG    . ARG A 1 154 ? 9.259   69.779  37.614 1.00 25.47 ? 154  ARG A CG    1 
ATOM   1086 C CD    . ARG A 1 154 ? 8.650   68.544  36.974 1.00 27.86 ? 154  ARG A CD    1 
ATOM   1087 N NE    . ARG A 1 154 ? 8.587   67.411  37.904 1.00 29.97 ? 154  ARG A NE    1 
ATOM   1088 C CZ    . ARG A 1 154 ? 7.624   67.228  38.807 1.00 31.80 ? 154  ARG A CZ    1 
ATOM   1089 N NH1   . ARG A 1 154 ? 6.634   68.111  38.917 1.00 33.43 ? 154  ARG A NH1   1 
ATOM   1090 N NH2   . ARG A 1 154 ? 7.625   66.140  39.578 1.00 30.24 ? 154  ARG A NH2   1 
ATOM   1091 N N     . MET A 1 155 ? 12.095  73.550  36.548 1.00 23.18 ? 155  MET A N     1 
ATOM   1092 C CA    . MET A 1 155 ? 12.767  74.500  35.675 1.00 25.19 ? 155  MET A CA    1 
ATOM   1093 C C     . MET A 1 155 ? 13.330  73.784  34.454 1.00 27.13 ? 155  MET A C     1 
ATOM   1094 O O     . MET A 1 155 ? 13.945  72.719  34.571 1.00 28.17 ? 155  MET A O     1 
ATOM   1095 C CB    . MET A 1 155 ? 13.882  75.220  36.430 1.00 23.62 ? 155  MET A CB    1 
ATOM   1096 C CG    . MET A 1 155 ? 14.454  76.391  35.670 1.00 22.63 ? 155  MET A CG    1 
ATOM   1097 S SD    . MET A 1 155 ? 15.568  77.338  36.660 1.00 22.77 ? 155  MET A SD    1 
ATOM   1098 C CE    . MET A 1 155 ? 14.404  78.237  37.660 1.00 21.66 ? 155  MET A CE    1 
ATOM   1099 N N     . LYS A 1 156 ? 13.124  74.366  33.282 1.00 27.80 ? 156  LYS A N     1 
ATOM   1100 C CA    . LYS A 1 156 ? 13.597  73.745  32.059 1.00 30.02 ? 156  LYS A CA    1 
ATOM   1101 C C     . LYS A 1 156 ? 15.043  74.083  31.704 1.00 29.22 ? 156  LYS A C     1 
ATOM   1102 O O     . LYS A 1 156 ? 15.768  73.234  31.182 1.00 28.88 ? 156  LYS A O     1 
ATOM   1103 C CB    . LYS A 1 156 ? 12.640  74.057  30.904 1.00 33.41 ? 156  LYS A CB    1 
ATOM   1104 C CG    . LYS A 1 156 ? 11.254  73.434  31.095 1.00 36.69 ? 156  LYS A CG    1 
ATOM   1105 C CD    . LYS A 1 156 ? 10.388  73.617  29.854 1.00 40.95 ? 156  LYS A CD    1 
ATOM   1106 C CE    . LYS A 1 156 ? 9.136   72.735  29.893 1.00 42.69 ? 156  LYS A CE    1 
ATOM   1107 N NZ    . LYS A 1 156 ? 8.116   73.204  30.874 1.00 44.32 ? 156  LYS A NZ    1 
ATOM   1108 N N     . VAL A 1 157 ? 15.467  75.308  32.003 1.00 28.34 ? 157  VAL A N     1 
ATOM   1109 C CA    . VAL A 1 157 ? 16.835  75.726  31.717 1.00 27.37 ? 157  VAL A CA    1 
ATOM   1110 C C     . VAL A 1 157 ? 17.440  76.442  32.922 1.00 25.95 ? 157  VAL A C     1 
ATOM   1111 O O     . VAL A 1 157 ? 17.051  77.566  33.252 1.00 26.31 ? 157  VAL A O     1 
ATOM   1112 C CB    . VAL A 1 157 ? 16.917  76.645  30.458 1.00 28.32 ? 157  VAL A CB    1 
ATOM   1113 C CG1   . VAL A 1 157 ? 18.347  77.127  30.235 1.00 27.52 ? 157  VAL A CG1   1 
ATOM   1114 C CG2   . VAL A 1 157 ? 16.441  75.895  29.228 1.00 28.61 ? 157  VAL A CG2   1 
ATOM   1115 N N     . PRO A 1 158 ? 18.319  75.751  33.667 1.00 24.53 ? 158  PRO A N     1 
ATOM   1116 C CA    . PRO A 1 158 ? 18.727  74.363  33.409 1.00 23.61 ? 158  PRO A CA    1 
ATOM   1117 C C     . PRO A 1 158 ? 17.628  73.396  33.868 1.00 23.24 ? 158  PRO A C     1 
ATOM   1118 O O     . PRO A 1 158 ? 16.672  73.813  34.536 1.00 23.10 ? 158  PRO A O     1 
ATOM   1119 C CB    . PRO A 1 158 ? 20.010  74.232  34.225 1.00 22.47 ? 158  PRO A CB    1 
ATOM   1120 C CG    . PRO A 1 158 ? 19.771  75.153  35.379 1.00 24.45 ? 158  PRO A CG    1 
ATOM   1121 C CD    . PRO A 1 158 ? 19.116  76.351  34.751 1.00 23.34 ? 158  PRO A CD    1 
ATOM   1122 N N     . LYS A 1 159 ? 17.717  72.129  33.470 1.00 22.87 ? 159  LYS A N     1 
ATOM   1123 C CA    . LYS A 1 159 ? 16.697  71.147  33.847 1.00 22.68 ? 159  LYS A CA    1 
ATOM   1124 C C     . LYS A 1 159 ? 16.876  70.815  35.325 1.00 22.81 ? 159  LYS A C     1 
ATOM   1125 O O     . LYS A 1 159 ? 17.595  69.879  35.682 1.00 22.60 ? 159  LYS A O     1 
ATOM   1126 C CB    . LYS A 1 159 ? 16.829  69.892  32.994 1.00 22.47 ? 159  LYS A CB    1 
ATOM   1127 C CG    . LYS A 1 159 ? 15.670  68.938  33.118 1.00 25.20 ? 159  LYS A CG    1 
ATOM   1128 C CD    . LYS A 1 159 ? 15.958  67.636  32.396 1.00 28.08 ? 159  LYS A CD    1 
ATOM   1129 C CE    . LYS A 1 159 ? 14.712  66.741  32.312 1.00 31.28 ? 159  LYS A CE    1 
ATOM   1130 N NZ    . LYS A 1 159 ? 14.263  66.159  33.629 1.00 31.62 ? 159  LYS A NZ    1 
ATOM   1131 N N     . ILE A 1 160 ? 16.206  71.585  36.177 1.00 21.96 ? 160  ILE A N     1 
ATOM   1132 C CA    . ILE A 1 160 ? 16.321  71.441  37.625 1.00 20.97 ? 160  ILE A CA    1 
ATOM   1133 C C     . ILE A 1 160 ? 14.959  71.551  38.316 1.00 20.64 ? 160  ILE A C     1 
ATOM   1134 O O     . ILE A 1 160 ? 14.079  72.302  37.869 1.00 21.01 ? 160  ILE A O     1 
ATOM   1135 C CB    . ILE A 1 160 ? 17.242  72.567  38.186 1.00 20.40 ? 160  ILE A CB    1 
ATOM   1136 C CG1   . ILE A 1 160 ? 18.686  72.371  37.726 1.00 20.26 ? 160  ILE A CG1   1 
ATOM   1137 C CG2   . ILE A 1 160 ? 17.151  72.651  39.692 1.00 20.30 ? 160  ILE A CG2   1 
ATOM   1138 C CD1   . ILE A 1 160 ? 19.379  71.196  38.364 1.00 20.02 ? 160  ILE A CD1   1 
ATOM   1139 N N     . VAL A 1 161 ? 14.800  70.822  39.419 1.00 19.66 ? 161  VAL A N     1 
ATOM   1140 C CA    . VAL A 1 161 ? 13.558  70.860  40.188 1.00 18.21 ? 161  VAL A CA    1 
ATOM   1141 C C     . VAL A 1 161 ? 13.774  71.609  41.508 1.00 17.57 ? 161  VAL A C     1 
ATOM   1142 O O     . VAL A 1 161 ? 14.699  71.311  42.264 1.00 17.44 ? 161  VAL A O     1 
ATOM   1143 C CB    . VAL A 1 161 ? 13.010  69.440  40.467 1.00 17.22 ? 161  VAL A CB    1 
ATOM   1144 C CG1   . VAL A 1 161 ? 11.711  69.525  41.256 1.00 18.60 ? 161  VAL A CG1   1 
ATOM   1145 C CG2   . VAL A 1 161 ? 12.774  68.711  39.163 1.00 17.19 ? 161  VAL A CG2   1 
ATOM   1146 N N     . LEU A 1 162 ? 12.951  72.622  41.751 1.00 16.83 ? 162  LEU A N     1 
ATOM   1147 C CA    . LEU A 1 162 ? 13.054  73.403  42.970 1.00 16.73 ? 162  LEU A CA    1 
ATOM   1148 C C     . LEU A 1 162 ? 11.801  73.198  43.797 1.00 16.57 ? 162  LEU A C     1 
ATOM   1149 O O     . LEU A 1 162 ? 10.708  73.078  43.258 1.00 17.74 ? 162  LEU A O     1 
ATOM   1150 C CB    . LEU A 1 162 ? 13.235  74.898  42.655 1.00 16.20 ? 162  LEU A CB    1 
ATOM   1151 C CG    . LEU A 1 162 ? 14.424  75.301  41.764 1.00 15.15 ? 162  LEU A CG    1 
ATOM   1152 C CD1   . LEU A 1 162 ? 14.007  75.287  40.311 1.00 15.01 ? 162  LEU A CD1   1 
ATOM   1153 C CD2   . LEU A 1 162 ? 14.921  76.691  42.129 1.00 15.10 ? 162  LEU A CD2   1 
ATOM   1154 N N     . LEU A 1 163 ? 11.973  73.053  45.100 1.00 17.16 ? 163  LEU A N     1 
ATOM   1155 C CA    . LEU A 1 163 ? 10.842  72.883  45.990 1.00 16.97 ? 163  LEU A CA    1 
ATOM   1156 C C     . LEU A 1 163 ? 10.836  74.193  46.742 1.00 16.15 ? 163  LEU A C     1 
ATOM   1157 O O     . LEU A 1 163 ? 11.791  74.522  47.431 1.00 16.73 ? 163  LEU A O     1 
ATOM   1158 C CB    . LEU A 1 163 ? 11.044  71.692  46.925 1.00 16.85 ? 163  LEU A CB    1 
ATOM   1159 C CG    . LEU A 1 163 ? 11.444  70.364  46.267 1.00 17.35 ? 163  LEU A CG    1 
ATOM   1160 C CD1   . LEU A 1 163 ? 11.477  69.285  47.334 1.00 20.06 ? 163  LEU A CD1   1 
ATOM   1161 C CD2   . LEU A 1 163 ? 10.483  69.978  45.164 1.00 18.48 ? 163  LEU A CD2   1 
ATOM   1162 N N     . ILE A 1 164 ? 9.764   74.953  46.559 1.00 16.83 ? 164  ILE A N     1 
ATOM   1163 C CA    . ILE A 1 164 ? 9.606   76.278  47.141 1.00 16.87 ? 164  ILE A CA    1 
ATOM   1164 C C     . ILE A 1 164 ? 8.550   76.286  48.246 1.00 17.94 ? 164  ILE A C     1 
ATOM   1165 O O     . ILE A 1 164 ? 7.393   75.912  48.021 1.00 17.37 ? 164  ILE A O     1 
ATOM   1166 C CB    . ILE A 1 164 ? 9.248   77.267  45.997 1.00 16.24 ? 164  ILE A CB    1 
ATOM   1167 C CG1   . ILE A 1 164 ? 10.340  77.181  44.915 1.00 16.25 ? 164  ILE A CG1   1 
ATOM   1168 C CG2   . ILE A 1 164 ? 9.097   78.695  46.520 1.00 15.86 ? 164  ILE A CG2   1 
ATOM   1169 C CD1   . ILE A 1 164 ? 9.952   77.740  43.569 1.00 16.70 ? 164  ILE A CD1   1 
ATOM   1170 N N     . PHE A 1 165 ? 8.944   76.720  49.439 1.00 17.87 ? 165  PHE A N     1 
ATOM   1171 C CA    . PHE A 1 165 ? 8.026   76.742  50.573 1.00 18.43 ? 165  PHE A CA    1 
ATOM   1172 C C     . PHE A 1 165 ? 7.597   78.138  50.977 1.00 19.23 ? 165  PHE A C     1 
ATOM   1173 O O     . PHE A 1 165 ? 8.251   79.117  50.629 1.00 19.39 ? 165  PHE A O     1 
ATOM   1174 C CB    . PHE A 1 165 ? 8.656   76.002  51.748 1.00 17.70 ? 165  PHE A CB    1 
ATOM   1175 C CG    . PHE A 1 165 ? 9.073   74.600  51.401 1.00 17.95 ? 165  PHE A CG    1 
ATOM   1176 C CD1   . PHE A 1 165 ? 10.311  74.358  50.806 1.00 16.67 ? 165  PHE A CD1   1 
ATOM   1177 C CD2   . PHE A 1 165 ? 8.183   73.533  51.573 1.00 18.10 ? 165  PHE A CD2   1 
ATOM   1178 C CE1   . PHE A 1 165 ? 10.654  73.084  50.375 1.00 15.97 ? 165  PHE A CE1   1 
ATOM   1179 C CE2   . PHE A 1 165 ? 8.516   72.248  51.145 1.00 17.48 ? 165  PHE A CE2   1 
ATOM   1180 C CZ    . PHE A 1 165 ? 9.759   72.029  50.541 1.00 17.80 ? 165  PHE A CZ    1 
ATOM   1181 N N     . VAL A 1 166 ? 6.499   78.228  51.719 1.00 20.07 ? 166  VAL A N     1 
ATOM   1182 C CA    . VAL A 1 166 ? 5.980   79.518  52.167 1.00 20.72 ? 166  VAL A CA    1 
ATOM   1183 C C     . VAL A 1 166 ? 7.002   80.306  52.983 1.00 21.03 ? 166  VAL A C     1 
ATOM   1184 O O     . VAL A 1 166 ? 7.056   81.534  52.908 1.00 21.75 ? 166  VAL A O     1 
ATOM   1185 C CB    . VAL A 1 166 ? 4.680   79.348  53.003 1.00 21.31 ? 166  VAL A CB    1 
ATOM   1186 C CG1   . VAL A 1 166 ? 4.172   80.700  53.477 1.00 21.03 ? 166  VAL A CG1   1 
ATOM   1187 C CG2   . VAL A 1 166 ? 3.612   78.672  52.166 1.00 21.57 ? 166  VAL A CG2   1 
ATOM   1188 N N     . SER A 1 167 ? 7.834   79.586  53.726 1.00 20.46 ? 167  SER A N     1 
ATOM   1189 C CA    . SER A 1 167 ? 8.860   80.184  54.571 1.00 20.59 ? 167  SER A CA    1 
ATOM   1190 C C     . SER A 1 167 ? 9.981   80.899  53.831 1.00 21.17 ? 167  SER A C     1 
ATOM   1191 O O     . SER A 1 167 ? 10.704  81.698  54.425 1.00 22.28 ? 167  SER A O     1 
ATOM   1192 C CB    . SER A 1 167 ? 9.489   79.093  55.434 1.00 20.33 ? 167  SER A CB    1 
ATOM   1193 O OG    . SER A 1 167 ? 10.060  78.092  54.608 1.00 18.66 ? 167  SER A OG    1 
ATOM   1194 N N     . GLY A 1 168 ? 10.151  80.597  52.550 1.00 21.95 ? 168  GLY A N     1 
ATOM   1195 C CA    . GLY A 1 168 ? 11.238  81.197  51.795 1.00 22.31 ? 168  GLY A CA    1 
ATOM   1196 C C     . GLY A 1 168 ? 12.408  80.224  51.705 1.00 22.00 ? 168  GLY A C     1 
ATOM   1197 O O     . GLY A 1 168 ? 13.472  80.557  51.181 1.00 21.64 ? 168  GLY A O     1 
ATOM   1198 N N     . LYS A 1 169 ? 12.233  79.050  52.308 1.00 22.73 ? 169  LYS A N     1 
ATOM   1199 C CA    . LYS A 1 169 ? 13.227  77.978  52.272 1.00 22.36 ? 169  LYS A CA    1 
ATOM   1200 C C     . LYS A 1 169 ? 13.070  77.328  50.890 1.00 21.19 ? 169  LYS A C     1 
ATOM   1201 O O     . LYS A 1 169 ? 11.946  77.147  50.399 1.00 19.76 ? 169  LYS A O     1 
ATOM   1202 C CB    . LYS A 1 169 ? 12.941  76.950  53.364 1.00 23.79 ? 169  LYS A CB    1 
ATOM   1203 C CG    . LYS A 1 169 ? 13.932  76.933  54.500 1.00 26.47 ? 169  LYS A CG    1 
ATOM   1204 C CD    . LYS A 1 169 ? 14.024  78.254  55.190 1.00 28.40 ? 169  LYS A CD    1 
ATOM   1205 C CE    . LYS A 1 169 ? 14.323  78.067  56.672 1.00 30.05 ? 169  LYS A CE    1 
ATOM   1206 N NZ    . LYS A 1 169 ? 15.558  77.270  56.932 1.00 33.11 ? 169  LYS A NZ    1 
ATOM   1207 N N     . ILE A 1 170 ? 14.196  76.987  50.273 1.00 20.52 ? 170  ILE A N     1 
ATOM   1208 C CA    . ILE A 1 170 ? 14.208  76.418  48.933 1.00 20.60 ? 170  ILE A CA    1 
ATOM   1209 C C     . ILE A 1 170 ? 15.153  75.215  48.828 1.00 20.16 ? 170  ILE A C     1 
ATOM   1210 O O     . ILE A 1 170 ? 16.299  75.269  49.275 1.00 21.02 ? 170  ILE A O     1 
ATOM   1211 C CB    . ILE A 1 170 ? 14.739  77.472  47.884 1.00 19.58 ? 170  ILE A CB    1 
ATOM   1212 C CG1   . ILE A 1 170 ? 14.163  78.876  48.135 1.00 19.23 ? 170  ILE A CG1   1 
ATOM   1213 C CG2   . ILE A 1 170 ? 14.479  76.993  46.469 1.00 18.61 ? 170  ILE A CG2   1 
ATOM   1214 C CD1   . ILE A 1 170 ? 12.663  79.016  47.942 1.00 17.99 ? 170  ILE A CD1   1 
ATOM   1215 N N     . VAL A 1 171 ? 14.677  74.150  48.201 1.00 19.47 ? 171  VAL A N     1 
ATOM   1216 C CA    . VAL A 1 171 ? 15.491  72.965  47.967 1.00 19.28 ? 171  VAL A CA    1 
ATOM   1217 C C     . VAL A 1 171 ? 15.632  72.938  46.444 1.00 19.52 ? 171  VAL A C     1 
ATOM   1218 O O     . VAL A 1 171 ? 14.655  73.183  45.726 1.00 19.12 ? 171  VAL A O     1 
ATOM   1219 C CB    . VAL A 1 171 ? 14.792  71.672  48.436 1.00 18.72 ? 171  VAL A CB    1 
ATOM   1220 C CG1   . VAL A 1 171 ? 15.614  70.445  48.037 1.00 17.77 ? 171  VAL A CG1   1 
ATOM   1221 C CG2   . VAL A 1 171 ? 14.593  71.701  49.937 1.00 18.78 ? 171  VAL A CG2   1 
ATOM   1222 N N     . ILE A 1 172 ? 16.847  72.678  45.960 1.00 19.27 ? 172  ILE A N     1 
ATOM   1223 C CA    . ILE A 1 172 ? 17.137  72.627  44.531 1.00 17.55 ? 172  ILE A CA    1 
ATOM   1224 C C     . ILE A 1 172 ? 17.804  71.279  44.273 1.00 17.99 ? 172  ILE A C     1 
ATOM   1225 O O     . ILE A 1 172 ? 18.862  70.983  44.834 1.00 18.20 ? 172  ILE A O     1 
ATOM   1226 C CB    . ILE A 1 172 ? 18.096  73.755  44.152 1.00 16.76 ? 172  ILE A CB    1 
ATOM   1227 C CG1   . ILE A 1 172 ? 17.571  75.076  44.700 1.00 17.49 ? 172  ILE A CG1   1 
ATOM   1228 C CG2   . ILE A 1 172 ? 18.231  73.853  42.651 1.00 15.54 ? 172  ILE A CG2   1 
ATOM   1229 C CD1   . ILE A 1 172 ? 18.584  76.163  44.713 1.00 19.25 ? 172  ILE A CD1   1 
ATOM   1230 N N     . THR A 1 173 ? 17.194  70.455  43.433 1.00 18.20 ? 173  THR A N     1 
ATOM   1231 C CA    . THR A 1 173 ? 17.747  69.137  43.156 1.00 18.14 ? 173  THR A CA    1 
ATOM   1232 C C     . THR A 1 173 ? 17.745  68.752  41.671 1.00 18.23 ? 173  THR A C     1 
ATOM   1233 O O     . THR A 1 173 ? 17.049  69.367  40.853 1.00 17.89 ? 173  THR A O     1 
ATOM   1234 C CB    . THR A 1 173 ? 17.005  68.055  43.973 1.00 17.59 ? 173  THR A CB    1 
ATOM   1235 O OG1   . THR A 1 173 ? 17.664  66.792  43.806 1.00 17.97 ? 173  THR A OG1   1 
ATOM   1236 C CG2   . THR A 1 173 ? 15.549  67.943  43.523 1.00 15.87 ? 173  THR A CG2   1 
ATOM   1237 N N     . GLY A 1 174 ? 18.551  67.743  41.340 1.00 17.99 ? 174  GLY A N     1 
ATOM   1238 C CA    . GLY A 1 174 ? 18.640  67.259  39.978 1.00 17.97 ? 174  GLY A CA    1 
ATOM   1239 C C     . GLY A 1 174 ? 19.897  67.660  39.237 1.00 18.17 ? 174  GLY A C     1 
ATOM   1240 O O     . GLY A 1 174 ? 20.138  67.178  38.133 1.00 19.71 ? 174  GLY A O     1 
ATOM   1241 N N     . ALA A 1 175 ? 20.721  68.510  39.833 1.00 19.02 ? 175  ALA A N     1 
ATOM   1242 C CA    . ALA A 1 175 ? 21.939  68.965  39.166 1.00 19.74 ? 175  ALA A CA    1 
ATOM   1243 C C     . ALA A 1 175 ? 23.078  67.956  39.169 1.00 21.08 ? 175  ALA A C     1 
ATOM   1244 O O     . ALA A 1 175 ? 23.264  67.214  40.135 1.00 21.38 ? 175  ALA A O     1 
ATOM   1245 C CB    . ALA A 1 175 ? 22.414  70.252  39.784 1.00 18.25 ? 175  ALA A CB    1 
ATOM   1246 N N     . LYS A 1 176 ? 23.799  67.891  38.055 1.00 22.61 ? 176  LYS A N     1 
ATOM   1247 C CA    . LYS A 1 176 ? 24.973  67.029  37.944 1.00 23.80 ? 176  LYS A CA    1 
ATOM   1248 C C     . LYS A 1 176 ? 26.233  67.897  38.022 1.00 24.22 ? 176  LYS A C     1 
ATOM   1249 O O     . LYS A 1 176 ? 27.348  67.380  38.076 1.00 23.40 ? 176  LYS A O     1 
ATOM   1250 C CB    . LYS A 1 176 ? 24.961  66.210  36.656 1.00 24.52 ? 176  LYS A CB    1 
ATOM   1251 C CG    . LYS A 1 176 ? 24.051  65.008  36.717 1.00 24.32 ? 176  LYS A CG    1 
ATOM   1252 C CD    . LYS A 1 176 ? 24.439  64.016  35.649 1.00 26.05 ? 176  LYS A CD    1 
ATOM   1253 C CE    . LYS A 1 176 ? 23.679  62.726  35.778 1.00 25.30 ? 176  LYS A CE    1 
ATOM   1254 N NZ    . LYS A 1 176 ? 22.249  62.941  35.545 1.00 27.50 ? 176  LYS A NZ    1 
ATOM   1255 N N     . MET A 1 177 ? 26.027  69.216  38.045 1.00 24.56 ? 177  MET A N     1 
ATOM   1256 C CA    . MET A 1 177 ? 27.091  70.213  38.153 1.00 26.79 ? 177  MET A CA    1 
ATOM   1257 C C     . MET A 1 177 ? 26.558  71.291  39.093 1.00 25.52 ? 177  MET A C     1 
ATOM   1258 O O     . MET A 1 177 ? 25.429  71.744  38.910 1.00 24.35 ? 177  MET A O     1 
ATOM   1259 C CB    . MET A 1 177 ? 27.371  70.842  36.787 1.00 30.30 ? 177  MET A CB    1 
ATOM   1260 C CG    . MET A 1 177 ? 27.921  69.874  35.743 1.00 35.46 ? 177  MET A CG    1 
ATOM   1261 S SD    . MET A 1 177 ? 29.607  69.369  36.129 1.00 41.17 ? 177  MET A SD    1 
ATOM   1262 C CE    . MET A 1 177 ? 30.515  70.771  35.369 1.00 40.61 ? 177  MET A CE    1 
ATOM   1263 N N     . ARG A 1 178 ? 27.365  71.721  40.065 1.00 25.33 ? 178  ARG A N     1 
ATOM   1264 C CA    . ARG A 1 178 ? 26.941  72.738  41.034 1.00 25.44 ? 178  ARG A CA    1 
ATOM   1265 C C     . ARG A 1 178 ? 26.507  74.073  40.438 1.00 26.30 ? 178  ARG A C     1 
ATOM   1266 O O     . ARG A 1 178 ? 25.651  74.767  41.004 1.00 24.15 ? 178  ARG A O     1 
ATOM   1267 C CB    . ARG A 1 178 ? 28.004  72.976  42.110 1.00 25.71 ? 178  ARG A CB    1 
ATOM   1268 C CG    . ARG A 1 178 ? 29.251  73.723  41.652 1.00 27.06 ? 178  ARG A CG    1 
ATOM   1269 C CD    . ARG A 1 178 ? 30.048  74.229  42.854 1.00 26.23 ? 178  ARG A CD    1 
ATOM   1270 N NE    . ARG A 1 178 ? 30.354  73.169  43.819 1.00 27.23 ? 178  ARG A NE    1 
ATOM   1271 C CZ    . ARG A 1 178 ? 30.915  73.374  45.008 1.00 27.08 ? 178  ARG A CZ    1 
ATOM   1272 N NH1   . ARG A 1 178 ? 31.237  74.600  45.387 1.00 28.45 ? 178  ARG A NH1   1 
ATOM   1273 N NH2   . ARG A 1 178 ? 31.136  72.356  45.830 1.00 26.55 ? 178  ARG A NH2   1 
ATOM   1274 N N     . ASP A 1 179 ? 27.092  74.448  39.305 1.00 27.33 ? 179  ASP A N     1 
ATOM   1275 C CA    . ASP A 1 179 ? 26.704  75.698  38.673 1.00 28.44 ? 179  ASP A CA    1 
ATOM   1276 C C     . ASP A 1 179 ? 25.255  75.671  38.204 1.00 26.59 ? 179  ASP A C     1 
ATOM   1277 O O     . ASP A 1 179 ? 24.655  76.720  38.024 1.00 26.04 ? 179  ASP A O     1 
ATOM   1278 C CB    . ASP A 1 179 ? 27.652  76.065  37.534 1.00 32.51 ? 179  ASP A CB    1 
ATOM   1279 C CG    . ASP A 1 179 ? 28.957  76.693  38.037 1.00 38.30 ? 179  ASP A CG    1 
ATOM   1280 O OD1   . ASP A 1 179 ? 29.023  77.107  39.227 1.00 39.56 ? 179  ASP A OD1   1 
ATOM   1281 O OD2   . ASP A 1 179 ? 29.921  76.780  37.232 1.00 41.39 ? 179  ASP A OD2   1 
ATOM   1282 N N     . GLU A 1 180 ? 24.689  74.475  38.034 1.00 26.03 ? 180  GLU A N     1 
ATOM   1283 C CA    . GLU A 1 180 ? 23.284  74.321  37.621 1.00 25.13 ? 180  GLU A CA    1 
ATOM   1284 C C     . GLU A 1 180 ? 22.389  74.612  38.823 1.00 24.08 ? 180  GLU A C     1 
ATOM   1285 O O     . GLU A 1 180 ? 21.270  75.101  38.673 1.00 22.70 ? 180  GLU A O     1 
ATOM   1286 C CB    . GLU A 1 180 ? 23.008  72.901  37.115 1.00 26.28 ? 180  GLU A CB    1 
ATOM   1287 C CG    . GLU A 1 180 ? 23.715  72.548  35.816 1.00 27.68 ? 180  GLU A CG    1 
ATOM   1288 C CD    . GLU A 1 180 ? 23.674  71.067  35.496 1.00 28.48 ? 180  GLU A CD    1 
ATOM   1289 O OE1   . GLU A 1 180 ? 23.343  70.265  36.388 1.00 28.07 ? 180  GLU A OE1   1 
ATOM   1290 O OE2   . GLU A 1 180 ? 23.985  70.694  34.346 1.00 31.82 ? 180  GLU A OE2   1 
ATOM   1291 N N     . THR A 1 181 ? 22.889  74.269  40.008 1.00 22.83 ? 181  THR A N     1 
ATOM   1292 C CA    . THR A 1 181 ? 22.190  74.508  41.262 1.00 21.44 ? 181  THR A CA    1 
ATOM   1293 C C     . THR A 1 181 ? 22.138  76.017  41.455 1.00 21.81 ? 181  THR A C     1 
ATOM   1294 O O     . THR A 1 181 ? 21.100  76.586  41.786 1.00 21.65 ? 181  THR A O     1 
ATOM   1295 C CB    . THR A 1 181 ? 22.990  73.923  42.460 1.00 20.74 ? 181  THR A CB    1 
ATOM   1296 O OG1   . THR A 1 181 ? 23.242  72.525  42.247 1.00 21.23 ? 181  THR A OG1   1 
ATOM   1297 C CG2   . THR A 1 181 ? 22.229  74.123  43.775 1.00 18.60 ? 181  THR A CG2   1 
ATOM   1298 N N     . TYR A 1 182 ? 23.289  76.652  41.257 1.00 22.60 ? 182  TYR A N     1 
ATOM   1299 C CA    . TYR A 1 182 ? 23.428  78.096  41.419 1.00 22.52 ? 182  TYR A CA    1 
ATOM   1300 C C     . TYR A 1 182 ? 22.601  78.858  40.400 1.00 23.27 ? 182  TYR A C     1 
ATOM   1301 O O     . TYR A 1 182 ? 21.831  79.753  40.755 1.00 23.36 ? 182  TYR A O     1 
ATOM   1302 C CB    . TYR A 1 182 ? 24.896  78.503  41.287 1.00 23.26 ? 182  TYR A CB    1 
ATOM   1303 C CG    . TYR A 1 182 ? 25.825  77.883  42.314 1.00 24.32 ? 182  TYR A CG    1 
ATOM   1304 C CD1   . TYR A 1 182 ? 25.351  77.457  43.560 1.00 24.49 ? 182  TYR A CD1   1 
ATOM   1305 C CD2   . TYR A 1 182 ? 27.180  77.725  42.038 1.00 25.09 ? 182  TYR A CD2   1 
ATOM   1306 C CE1   . TYR A 1 182 ? 26.208  76.888  44.509 1.00 24.91 ? 182  TYR A CE1   1 
ATOM   1307 C CE2   . TYR A 1 182 ? 28.046  77.159  42.974 1.00 26.32 ? 182  TYR A CE2   1 
ATOM   1308 C CZ    . TYR A 1 182 ? 27.558  76.744  44.206 1.00 25.90 ? 182  TYR A CZ    1 
ATOM   1309 O OH    . TYR A 1 182 ? 28.435  76.209  45.119 1.00 26.93 ? 182  TYR A OH    1 
ATOM   1310 N N     . LYS A 1 183 ? 22.735  78.478  39.136 1.00 23.33 ? 183  LYS A N     1 
ATOM   1311 C CA    . LYS A 1 183 ? 22.003  79.150  38.082 1.00 25.23 ? 183  LYS A CA    1 
ATOM   1312 C C     . LYS A 1 183 ? 20.499  78.987  38.250 1.00 24.88 ? 183  LYS A C     1 
ATOM   1313 O O     . LYS A 1 183 ? 19.752  79.948  38.071 1.00 26.00 ? 183  LYS A O     1 
ATOM   1314 C CB    . LYS A 1 183 ? 22.461  78.671  36.706 1.00 27.30 ? 183  LYS A CB    1 
ATOM   1315 C CG    . LYS A 1 183 ? 22.190  79.670  35.577 1.00 32.70 ? 183  LYS A CG    1 
ATOM   1316 C CD    . LYS A 1 183 ? 21.116  79.149  34.627 1.00 36.45 ? 183  LYS A CD    1 
ATOM   1317 C CE    . LYS A 1 183 ? 20.972  80.022  33.369 1.00 39.51 ? 183  LYS A CE    1 
ATOM   1318 N NZ    . LYS A 1 183 ? 19.935  79.481  32.425 1.00 38.17 ? 183  LYS A NZ    1 
ATOM   1319 N N     . ALA A 1 184 ? 20.053  77.792  38.626 1.00 23.45 ? 184  ALA A N     1 
ATOM   1320 C CA    . ALA A 1 184 ? 18.624  77.543  38.830 1.00 21.86 ? 184  ALA A CA    1 
ATOM   1321 C C     . ALA A 1 184 ? 18.087  78.460  39.917 1.00 20.61 ? 184  ALA A C     1 
ATOM   1322 O O     . ALA A 1 184 ? 16.992  79.002  39.789 1.00 20.84 ? 184  ALA A O     1 
ATOM   1323 C CB    . ALA A 1 184 ? 18.368  76.086  39.188 1.00 20.38 ? 184  ALA A CB    1 
ATOM   1324 N N     . PHE A 1 185 ? 18.873  78.660  40.968 1.00 19.74 ? 185  PHE A N     1 
ATOM   1325 C CA    . PHE A 1 185 ? 18.473  79.539  42.059 1.00 20.69 ? 185  PHE A CA    1 
ATOM   1326 C C     . PHE A 1 185 ? 18.422  80.997  41.613 1.00 22.27 ? 185  PHE A C     1 
ATOM   1327 O O     . PHE A 1 185 ? 17.513  81.750  41.999 1.00 22.35 ? 185  PHE A O     1 
ATOM   1328 C CB    . PHE A 1 185 ? 19.437  79.444  43.232 1.00 18.93 ? 185  PHE A CB    1 
ATOM   1329 C CG    . PHE A 1 185 ? 19.095  80.379  44.348 1.00 19.34 ? 185  PHE A CG    1 
ATOM   1330 C CD1   . PHE A 1 185 ? 17.917  80.206  45.074 1.00 18.92 ? 185  PHE A CD1   1 
ATOM   1331 C CD2   . PHE A 1 185 ? 19.907  81.469  44.637 1.00 18.12 ? 185  PHE A CD2   1 
ATOM   1332 C CE1   . PHE A 1 185 ? 17.554  81.107  46.066 1.00 18.58 ? 185  PHE A CE1   1 
ATOM   1333 C CE2   . PHE A 1 185 ? 19.549  82.375  45.627 1.00 18.92 ? 185  PHE A CE2   1 
ATOM   1334 C CZ    . PHE A 1 185 ? 18.366  82.193  46.344 1.00 18.38 ? 185  PHE A CZ    1 
ATOM   1335 N N     . GLU A 1 186 ? 19.433  81.405  40.848 1.00 22.11 ? 186  GLU A N     1 
ATOM   1336 C CA    . GLU A 1 186 ? 19.505  82.772  40.355 1.00 21.74 ? 186  GLU A CA    1 
ATOM   1337 C C     . GLU A 1 186 ? 18.344  83.081  39.417 1.00 20.03 ? 186  GLU A C     1 
ATOM   1338 O O     . GLU A 1 186 ? 17.820  84.193  39.417 1.00 20.42 ? 186  GLU A O     1 
ATOM   1339 C CB    . GLU A 1 186 ? 20.856  83.025  39.682 1.00 22.21 ? 186  GLU A CB    1 
ATOM   1340 C CG    . GLU A 1 186 ? 22.023  83.057  40.662 1.00 22.93 ? 186  GLU A CG    1 
ATOM   1341 C CD    . GLU A 1 186 ? 21.924  84.185  41.674 1.00 24.27 ? 186  GLU A CD    1 
ATOM   1342 O OE1   . GLU A 1 186 ? 21.527  85.313  41.294 1.00 27.34 ? 186  GLU A OE1   1 
ATOM   1343 O OE2   . GLU A 1 186 ? 22.263  83.953  42.852 1.00 24.85 ? 186  GLU A OE2   1 
ATOM   1344 N N     . ASN A 1 187 ? 17.933  82.091  38.637 1.00 19.99 ? 187  ASN A N     1 
ATOM   1345 C CA    . ASN A 1 187 ? 16.808  82.258  37.730 1.00 20.27 ? 187  ASN A CA    1 
ATOM   1346 C C     . ASN A 1 187 ? 15.508  82.442  38.509 1.00 20.87 ? 187  ASN A C     1 
ATOM   1347 O O     . ASN A 1 187 ? 14.685  83.299  38.178 1.00 20.81 ? 187  ASN A O     1 
ATOM   1348 C CB    . ASN A 1 187 ? 16.676  81.048  36.802 1.00 20.80 ? 187  ASN A CB    1 
ATOM   1349 C CG    . ASN A 1 187 ? 17.763  80.999  35.758 1.00 22.44 ? 187  ASN A CG    1 
ATOM   1350 O OD1   . ASN A 1 187 ? 18.573  81.914  35.654 1.00 24.99 ? 187  ASN A OD1   1 
ATOM   1351 N ND2   . ASN A 1 187 ? 17.803  79.923  34.989 1.00 22.36 ? 187  ASN A ND2   1 
ATOM   1352 N N     . ILE A 1 188 ? 15.334  81.652  39.564 1.00 20.59 ? 188  ILE A N     1 
ATOM   1353 C CA    . ILE A 1 188 ? 14.115  81.713  40.363 1.00 20.04 ? 188  ILE A CA    1 
ATOM   1354 C C     . ILE A 1 188 ? 14.024  82.900  41.330 1.00 20.92 ? 188  ILE A C     1 
ATOM   1355 O O     . ILE A 1 188 ? 12.923  83.390  41.608 1.00 20.80 ? 188  ILE A O     1 
ATOM   1356 C CB    . ILE A 1 188 ? 13.895  80.387  41.145 1.00 18.87 ? 188  ILE A CB    1 
ATOM   1357 C CG1   . ILE A 1 188 ? 12.401  80.148  41.377 1.00 17.88 ? 188  ILE A CG1   1 
ATOM   1358 C CG2   . ILE A 1 188 ? 14.639  80.420  42.475 1.00 17.53 ? 188  ILE A CG2   1 
ATOM   1359 C CD1   . ILE A 1 188 ? 11.608  79.933  40.114 1.00 16.95 ? 188  ILE A CD1   1 
ATOM   1360 N N     . TYR A 1 189 ? 15.172  83.382  41.810 1.00 20.63 ? 189  TYR A N     1 
ATOM   1361 C CA    . TYR A 1 189 ? 15.201  84.483  42.762 1.00 19.67 ? 189  TYR A CA    1 
ATOM   1362 C C     . TYR A 1 189 ? 14.281  85.667  42.431 1.00 20.74 ? 189  TYR A C     1 
ATOM   1363 O O     . TYR A 1 189 ? 13.479  86.075  43.275 1.00 20.52 ? 189  TYR A O     1 
ATOM   1364 C CB    . TYR A 1 189 ? 16.630  84.971  43.015 1.00 19.26 ? 189  TYR A CB    1 
ATOM   1365 C CG    . TYR A 1 189 ? 16.701  85.903  44.208 1.00 21.46 ? 189  TYR A CG    1 
ATOM   1366 C CD1   . TYR A 1 189 ? 16.566  85.399  45.499 1.00 20.97 ? 189  TYR A CD1   1 
ATOM   1367 C CD2   . TYR A 1 189 ? 16.824  87.289  44.049 1.00 20.26 ? 189  TYR A CD2   1 
ATOM   1368 C CE1   . TYR A 1 189 ? 16.544  86.230  46.605 1.00 22.37 ? 189  TYR A CE1   1 
ATOM   1369 C CE2   . TYR A 1 189 ? 16.804  88.141  45.160 1.00 21.86 ? 189  TYR A CE2   1 
ATOM   1370 C CZ    . TYR A 1 189 ? 16.662  87.597  46.439 1.00 22.95 ? 189  TYR A CZ    1 
ATOM   1371 O OH    . TYR A 1 189 ? 16.657  88.389  47.570 1.00 23.21 ? 189  TYR A OH    1 
ATOM   1372 N N     . PRO A 1 190 ? 14.365  86.219  41.205 1.00 20.34 ? 190  PRO A N     1 
ATOM   1373 C CA    . PRO A 1 190 ? 13.489  87.356  40.873 1.00 20.92 ? 190  PRO A CA    1 
ATOM   1374 C C     . PRO A 1 190 ? 12.002  87.010  40.898 1.00 20.38 ? 190  PRO A C     1 
ATOM   1375 O O     . PRO A 1 190 ? 11.157  87.872  41.194 1.00 19.66 ? 190  PRO A O     1 
ATOM   1376 C CB    . PRO A 1 190 ? 13.978  87.787  39.479 1.00 21.32 ? 190  PRO A CB    1 
ATOM   1377 C CG    . PRO A 1 190 ? 14.608  86.528  38.913 1.00 22.99 ? 190  PRO A CG    1 
ATOM   1378 C CD    . PRO A 1 190 ? 15.322  85.953  40.115 1.00 20.56 ? 190  PRO A CD    1 
ATOM   1379 N N     . VAL A 1 191 ? 11.691  85.742  40.623 1.00 20.39 ? 191  VAL A N     1 
ATOM   1380 C CA    . VAL A 1 191 ? 10.310  85.263  40.637 1.00 20.00 ? 191  VAL A CA    1 
ATOM   1381 C C     . VAL A 1 191 ? 9.831   85.181  42.080 1.00 19.36 ? 191  VAL A C     1 
ATOM   1382 O O     . VAL A 1 191 ? 8.708   85.572  42.396 1.00 20.76 ? 191  VAL A O     1 
ATOM   1383 C CB    . VAL A 1 191 ? 10.175  83.872  39.989 1.00 20.03 ? 191  VAL A CB    1 
ATOM   1384 C CG1   . VAL A 1 191 ? 8.720   83.411  40.017 1.00 19.31 ? 191  VAL A CG1   1 
ATOM   1385 C CG2   . VAL A 1 191 ? 10.704  83.904  38.572 1.00 20.08 ? 191  VAL A CG2   1 
ATOM   1386 N N     . LEU A 1 192 ? 10.686  84.678  42.959 1.00 18.27 ? 192  LEU A N     1 
ATOM   1387 C CA    . LEU A 1 192 ? 10.338  84.579  44.366 1.00 18.55 ? 192  LEU A CA    1 
ATOM   1388 C C     . LEU A 1 192 ? 10.048  85.974  44.916 1.00 19.64 ? 192  LEU A C     1 
ATOM   1389 O O     . LEU A 1 192 ? 9.118   86.159  45.702 1.00 18.90 ? 192  LEU A O     1 
ATOM   1390 C CB    . LEU A 1 192 ? 11.486  83.941  45.170 1.00 18.01 ? 192  LEU A CB    1 
ATOM   1391 C CG    . LEU A 1 192 ? 11.945  82.524  44.794 1.00 18.03 ? 192  LEU A CG    1 
ATOM   1392 C CD1   . LEU A 1 192 ? 13.036  82.069  45.750 1.00 16.65 ? 192  LEU A CD1   1 
ATOM   1393 C CD2   . LEU A 1 192 ? 10.774  81.565  44.821 1.00 15.37 ? 192  LEU A CD2   1 
ATOM   1394 N N     . SER A 1 193 ? 10.865  86.947  44.515 1.00 20.19 ? 193  SER A N     1 
ATOM   1395 C CA    . SER A 1 193 ? 10.716  88.334  44.967 1.00 20.74 ? 193  SER A CA    1 
ATOM   1396 C C     . SER A 1 193 ? 9.397   88.918  44.492 1.00 20.21 ? 193  SER A C     1 
ATOM   1397 O O     . SER A 1 193 ? 8.698   89.605  45.232 1.00 20.23 ? 193  SER A O     1 
ATOM   1398 C CB    . SER A 1 193 ? 11.861  89.192  44.424 1.00 20.97 ? 193  SER A CB    1 
ATOM   1399 O OG    . SER A 1 193 ? 13.100  88.800  44.978 1.00 22.79 ? 193  SER A OG    1 
ATOM   1400 N N     . GLU A 1 194 ? 9.075   88.643  43.239 1.00 21.00 ? 194  GLU A N     1 
ATOM   1401 C CA    . GLU A 1 194 ? 7.849   89.131  42.644 1.00 21.58 ? 194  GLU A CA    1 
ATOM   1402 C C     . GLU A 1 194 ? 6.654   88.629  43.431 1.00 22.15 ? 194  GLU A C     1 
ATOM   1403 O O     . GLU A 1 194 ? 5.648   89.324  43.554 1.00 21.71 ? 194  GLU A O     1 
ATOM   1404 C CB    . GLU A 1 194 ? 7.765   88.647  41.204 1.00 22.31 ? 194  GLU A CB    1 
ATOM   1405 C CG    . GLU A 1 194 ? 6.546   89.114  40.459 1.00 24.08 ? 194  GLU A CG    1 
ATOM   1406 C CD    . GLU A 1 194 ? 6.515   88.618  39.036 1.00 24.87 ? 194  GLU A CD    1 
ATOM   1407 O OE1   . GLU A 1 194 ? 7.399   87.832  38.630 1.00 26.51 ? 194  GLU A OE1   1 
ATOM   1408 O OE2   . GLU A 1 194 ? 5.590   89.012  38.310 1.00 28.20 ? 194  GLU A OE2   1 
ATOM   1409 N N     . PHE A 1 195 ? 6.782   87.424  43.979 1.00 21.64 ? 195  PHE A N     1 
ATOM   1410 C CA    . PHE A 1 195 ? 5.707   86.826  44.743 1.00 22.02 ? 195  PHE A CA    1 
ATOM   1411 C C     . PHE A 1 195 ? 5.936   86.774  46.236 1.00 22.30 ? 195  PHE A C     1 
ATOM   1412 O O     . PHE A 1 195 ? 5.470   85.860  46.898 1.00 23.11 ? 195  PHE A O     1 
ATOM   1413 C CB    . PHE A 1 195 ? 5.351   85.450  44.163 1.00 21.75 ? 195  PHE A CB    1 
ATOM   1414 C CG    . PHE A 1 195 ? 4.716   85.536  42.807 1.00 20.30 ? 195  PHE A CG    1 
ATOM   1415 C CD1   . PHE A 1 195 ? 3.369   85.879  42.683 1.00 21.21 ? 195  PHE A CD1   1 
ATOM   1416 C CD2   . PHE A 1 195 ? 5.485   85.406  41.653 1.00 20.45 ? 195  PHE A CD2   1 
ATOM   1417 C CE1   . PHE A 1 195 ? 2.800   86.101  41.426 1.00 20.90 ? 195  PHE A CE1   1 
ATOM   1418 C CE2   . PHE A 1 195 ? 4.931   85.623  40.396 1.00 19.90 ? 195  PHE A CE2   1 
ATOM   1419 C CZ    . PHE A 1 195 ? 3.588   85.975  40.282 1.00 19.94 ? 195  PHE A CZ    1 
ATOM   1420 N N     . ARG A 1 196 ? 6.632   87.775  46.767 1.00 23.14 ? 196  ARG A N     1 
ATOM   1421 C CA    . ARG A 1 196 ? 6.891   87.851  48.200 1.00 25.37 ? 196  ARG A CA    1 
ATOM   1422 C C     . ARG A 1 196 ? 5.564   88.087  48.899 1.00 26.74 ? 196  ARG A C     1 
ATOM   1423 O O     . ARG A 1 196 ? 4.720   88.848  48.408 1.00 26.66 ? 196  ARG A O     1 
ATOM   1424 C CB    . ARG A 1 196 ? 7.869   88.989  48.523 1.00 26.17 ? 196  ARG A CB    1 
ATOM   1425 C CG    . ARG A 1 196 ? 8.016   89.274  50.008 1.00 27.31 ? 196  ARG A CG    1 
ATOM   1426 C CD    . ARG A 1 196 ? 9.241   90.115  50.322 1.00 31.18 ? 196  ARG A CD    1 
ATOM   1427 N NE    . ARG A 1 196 ? 9.251   91.422  49.664 1.00 35.36 ? 196  ARG A NE    1 
ATOM   1428 C CZ    . ARG A 1 196 ? 8.678   92.525  50.151 1.00 36.86 ? 196  ARG A CZ    1 
ATOM   1429 N NH1   . ARG A 1 196 ? 8.026   92.494  51.311 1.00 36.48 ? 196  ARG A NH1   1 
ATOM   1430 N NH2   . ARG A 1 196 ? 8.794   93.679  49.493 1.00 36.90 ? 196  ARG A NH2   1 
ATOM   1431 N N     . LYS A 1 197 ? 5.370   87.419  50.027 1.00 27.24 ? 197  LYS A N     1 
ATOM   1432 C CA    . LYS A 1 197 ? 4.134   87.557  50.778 1.00 29.92 ? 197  LYS A CA    1 
ATOM   1433 C C     . LYS A 1 197 ? 4.233   88.745  51.725 1.00 30.87 ? 197  LYS A C     1 
ATOM   1434 O O     . LYS A 1 197 ? 5.096   88.778  52.606 1.00 30.26 ? 197  LYS A O     1 
ATOM   1435 C CB    . LYS A 1 197 ? 3.843   86.271  51.548 1.00 31.19 ? 197  LYS A CB    1 
ATOM   1436 C CG    . LYS A 1 197 ? 2.529   86.275  52.299 1.00 34.12 ? 197  LYS A CG    1 
ATOM   1437 C CD    . LYS A 1 197 ? 2.297   84.952  53.031 1.00 37.56 ? 197  LYS A CD    1 
ATOM   1438 C CE    . LYS A 1 197 ? 2.282   83.763  52.068 1.00 39.12 ? 197  LYS A CE    1 
ATOM   1439 N NZ    . LYS A 1 197 ? 1.761   82.518  52.718 1.00 41.83 ? 197  LYS A NZ    1 
ATOM   1440 N N     . ILE A 1 198 ? 3.380   89.742  51.496 1.00 33.06 ? 198  ILE A N     1 
ATOM   1441 C CA    . ILE A 1 198 ? 3.336   90.958  52.314 1.00 34.84 ? 198  ILE A CA    1 
ATOM   1442 C C     . ILE A 1 198 ? 2.277   90.788  53.402 1.00 35.54 ? 198  ILE A C     1 
ATOM   1443 O O     . ILE A 1 198 ? 2.615   91.104  54.563 1.00 37.61 ? 198  ILE A O     1 
ATOM   1444 C CB    . ILE A 1 198 ? 2.959   92.219  51.477 1.00 35.25 ? 198  ILE A CB    1 
ATOM   1445 C CG1   . ILE A 1 198 ? 3.741   92.276  50.158 1.00 35.49 ? 198  ILE A CG1   1 
ATOM   1446 C CG2   . ILE A 1 198 ? 3.259   93.480  52.278 1.00 34.81 ? 198  ILE A CG2   1 
ATOM   1447 C CD1   . ILE A 1 198 ? 5.224   92.486  50.315 1.00 35.09 ? 198  ILE A CD1   1 
ATOM   1448 N N     . VAL B 1 12  ? 22.137  92.795  36.694 1.00 34.94 ? 12   VAL B N     1 
ATOM   1449 C CA    . VAL B 1 12  ? 21.429  93.502  37.793 1.00 34.47 ? 12   VAL B CA    1 
ATOM   1450 C C     . VAL B 1 12  ? 21.838  92.951  39.157 1.00 35.82 ? 12   VAL B C     1 
ATOM   1451 O O     . VAL B 1 12  ? 21.954  91.733  39.359 1.00 35.79 ? 12   VAL B O     1 
ATOM   1452 C CB    . VAL B 1 12  ? 19.882  93.417  37.625 1.00 33.09 ? 12   VAL B CB    1 
ATOM   1453 C CG1   . VAL B 1 12  ? 19.169  93.984  38.846 1.00 30.85 ? 12   VAL B CG1   1 
ATOM   1454 C CG2   . VAL B 1 12  ? 19.456  94.194  36.400 1.00 31.73 ? 12   VAL B CG2   1 
ATOM   1455 N N     . ASP B 1 13  ? 22.095  93.864  40.084 1.00 37.02 ? 13   ASP B N     1 
ATOM   1456 C CA    . ASP B 1 13  ? 22.470  93.488  41.431 1.00 37.72 ? 13   ASP B CA    1 
ATOM   1457 C C     . ASP B 1 13  ? 21.197  93.136  42.178 1.00 37.63 ? 13   ASP B C     1 
ATOM   1458 O O     . ASP B 1 13  ? 20.509  94.022  42.706 1.00 36.80 ? 13   ASP B O     1 
ATOM   1459 C CB    . ASP B 1 13  ? 23.187  94.643  42.131 1.00 40.02 ? 13   ASP B CB    1 
ATOM   1460 C CG    . ASP B 1 13  ? 23.651  94.277  43.529 1.00 41.97 ? 13   ASP B CG    1 
ATOM   1461 O OD1   . ASP B 1 13  ? 23.862  93.070  43.789 1.00 44.06 ? 13   ASP B OD1   1 
ATOM   1462 O OD2   . ASP B 1 13  ? 23.800  95.195  44.368 1.00 44.07 ? 13   ASP B OD2   1 
ATOM   1463 N N     . LEU B 1 14  ? 20.883  91.842  42.201 1.00 37.92 ? 14   LEU B N     1 
ATOM   1464 C CA    . LEU B 1 14  ? 19.690  91.337  42.877 1.00 37.57 ? 14   LEU B CA    1 
ATOM   1465 C C     . LEU B 1 14  ? 19.740  91.562  44.384 1.00 37.82 ? 14   LEU B C     1 
ATOM   1466 O O     . LEU B 1 14  ? 18.709  91.533  45.053 1.00 38.09 ? 14   LEU B O     1 
ATOM   1467 C CB    . LEU B 1 14  ? 19.487  89.855  42.574 1.00 37.50 ? 14   LEU B CB    1 
ATOM   1468 C CG    . LEU B 1 14  ? 19.187  89.517  41.116 1.00 38.24 ? 14   LEU B CG    1 
ATOM   1469 C CD1   . LEU B 1 14  ? 19.227  88.000  40.929 1.00 39.16 ? 14   LEU B CD1   1 
ATOM   1470 C CD2   . LEU B 1 14  ? 17.828  90.076  40.720 1.00 37.93 ? 14   LEU B CD2   1 
ATOM   1471 N N     . SER B 1 15  ? 20.934  91.769  44.925 1.00 37.54 ? 15   SER B N     1 
ATOM   1472 C CA    . SER B 1 15  ? 21.054  92.026  46.347 1.00 37.50 ? 15   SER B CA    1 
ATOM   1473 C C     . SER B 1 15  ? 20.379  93.352  46.658 1.00 36.69 ? 15   SER B C     1 
ATOM   1474 O O     . SER B 1 15  ? 19.827  93.527  47.743 1.00 37.14 ? 15   SER B O     1 
ATOM   1475 C CB    . SER B 1 15  ? 22.520  92.075  46.761 1.00 38.77 ? 15   SER B CB    1 
ATOM   1476 O OG    . SER B 1 15  ? 23.188  90.885  46.362 1.00 42.03 ? 15   SER B OG    1 
ATOM   1477 N N     . LYS B 1 16  ? 20.421  94.292  45.713 1.00 35.73 ? 16   LYS B N     1 
ATOM   1478 C CA    . LYS B 1 16  ? 19.775  95.583  45.936 1.00 34.76 ? 16   LYS B CA    1 
ATOM   1479 C C     . LYS B 1 16  ? 18.510  95.781  45.092 1.00 32.21 ? 16   LYS B C     1 
ATOM   1480 O O     . LYS B 1 16  ? 17.749  96.729  45.300 1.00 31.84 ? 16   LYS B O     1 
ATOM   1481 C CB    . LYS B 1 16  ? 20.756  96.753  45.758 1.00 38.96 ? 16   LYS B CB    1 
ATOM   1482 C CG    . LYS B 1 16  ? 20.622  97.796  46.892 1.00 43.36 ? 16   LYS B CG    1 
ATOM   1483 C CD    . LYS B 1 16  ? 21.521  99.031  46.744 1.00 46.16 ? 16   LYS B CD    1 
ATOM   1484 C CE    . LYS B 1 16  ? 20.996  100.026 45.704 1.00 47.52 ? 16   LYS B CE    1 
ATOM   1485 N NZ    . LYS B 1 16  ? 21.346  99.655  44.297 1.00 49.43 ? 16   LYS B NZ    1 
ATOM   1486 N N     . HIS B 1 17  ? 18.288  94.891  44.133 1.00 29.42 ? 17   HIS B N     1 
ATOM   1487 C CA    . HIS B 1 17  ? 17.091  94.949  43.290 1.00 26.05 ? 17   HIS B CA    1 
ATOM   1488 C C     . HIS B 1 17  ? 16.588  93.512  43.145 1.00 23.47 ? 17   HIS B C     1 
ATOM   1489 O O     . HIS B 1 17  ? 16.688  92.913  42.070 1.00 21.85 ? 17   HIS B O     1 
ATOM   1490 C CB    . HIS B 1 17  ? 17.422  95.531  41.911 1.00 25.22 ? 17   HIS B CB    1 
ATOM   1491 C CG    . HIS B 1 17  ? 18.101  96.863  41.962 1.00 24.38 ? 17   HIS B CG    1 
ATOM   1492 N ND1   . HIS B 1 17  ? 17.410  98.045  42.101 1.00 23.96 ? 17   HIS B ND1   1 
ATOM   1493 C CD2   . HIS B 1 17  ? 19.408  97.201  41.870 1.00 25.01 ? 17   HIS B CD2   1 
ATOM   1494 C CE1   . HIS B 1 17  ? 18.258  99.056  42.086 1.00 23.72 ? 17   HIS B CE1   1 
ATOM   1495 N NE2   . HIS B 1 17  ? 19.478  98.571  41.947 1.00 25.02 ? 17   HIS B NE2   1 
ATOM   1496 N N     . PRO B 1 18  ? 16.045  92.941  44.235 1.00 22.23 ? 18   PRO B N     1 
ATOM   1497 C CA    . PRO B 1 18  ? 15.534  91.566  44.225 1.00 21.94 ? 18   PRO B CA    1 
ATOM   1498 C C     . PRO B 1 18  ? 14.534  91.243  43.124 1.00 22.77 ? 18   PRO B C     1 
ATOM   1499 O O     . PRO B 1 18  ? 14.471  90.105  42.654 1.00 22.15 ? 18   PRO B O     1 
ATOM   1500 C CB    . PRO B 1 18  ? 14.966  91.387  45.635 1.00 22.03 ? 18   PRO B CB    1 
ATOM   1501 C CG    . PRO B 1 18  ? 14.804  92.795  46.169 1.00 22.52 ? 18   PRO B CG    1 
ATOM   1502 C CD    . PRO B 1 18  ? 15.959  93.528  45.584 1.00 21.63 ? 18   PRO B CD    1 
ATOM   1503 N N     . SER B 1 19  ? 13.787  92.252  42.677 1.00 22.44 ? 19   SER B N     1 
ATOM   1504 C CA    . SER B 1 19  ? 12.818  92.074  41.596 1.00 22.23 ? 19   SER B CA    1 
ATOM   1505 C C     . SER B 1 19  ? 13.519  91.815  40.256 1.00 21.41 ? 19   SER B C     1 
ATOM   1506 O O     . SER B 1 19  ? 12.928  91.267  39.325 1.00 21.83 ? 19   SER B O     1 
ATOM   1507 C CB    . SER B 1 19  ? 11.955  93.325  41.459 1.00 21.11 ? 19   SER B CB    1 
ATOM   1508 O OG    . SER B 1 19  ? 12.744  94.429  41.059 1.00 21.01 ? 19   SER B OG    1 
ATOM   1509 N N     . GLY B 1 20  ? 14.771  92.245  40.155 1.00 21.63 ? 20   GLY B N     1 
ATOM   1510 C CA    . GLY B 1 20  ? 15.517  92.076  38.924 1.00 21.81 ? 20   GLY B CA    1 
ATOM   1511 C C     . GLY B 1 20  ? 15.261  93.230  37.965 1.00 22.11 ? 20   GLY B C     1 
ATOM   1512 O O     . GLY B 1 20  ? 15.741  93.214  36.828 1.00 22.78 ? 20   GLY B O     1 
ATOM   1513 N N     . ILE B 1 21  ? 14.526  94.240  38.427 1.00 20.34 ? 21   ILE B N     1 
ATOM   1514 C CA    . ILE B 1 21  ? 14.193  95.392  37.598 1.00 19.33 ? 21   ILE B CA    1 
ATOM   1515 C C     . ILE B 1 21  ? 14.745  96.645  38.238 1.00 18.68 ? 21   ILE B C     1 
ATOM   1516 O O     . ILE B 1 21  ? 14.531  96.876  39.423 1.00 18.48 ? 21   ILE B O     1 
ATOM   1517 C CB    . ILE B 1 21  ? 12.663  95.569  37.467 1.00 19.66 ? 21   ILE B CB    1 
ATOM   1518 C CG1   . ILE B 1 21  ? 12.015  94.278  36.957 1.00 18.94 ? 21   ILE B CG1   1 
ATOM   1519 C CG2   . ILE B 1 21  ? 12.343  96.728  36.521 1.00 19.52 ? 21   ILE B CG2   1 
ATOM   1520 C CD1   . ILE B 1 21  ? 10.530  94.197  37.237 1.00 17.55 ? 21   ILE B CD1   1 
ATOM   1521 N N     . VAL B 1 22  ? 15.431  97.467  37.450 1.00 18.73 ? 22   VAL B N     1 
ATOM   1522 C CA    . VAL B 1 22  ? 16.009  98.706  37.962 1.00 18.36 ? 22   VAL B CA    1 
ATOM   1523 C C     . VAL B 1 22  ? 15.373  99.944  37.330 1.00 17.26 ? 22   VAL B C     1 
ATOM   1524 O O     . VAL B 1 22  ? 15.455  100.141 36.119 1.00 17.57 ? 22   VAL B O     1 
ATOM   1525 C CB    . VAL B 1 22  ? 17.540  98.774  37.714 1.00 18.28 ? 22   VAL B CB    1 
ATOM   1526 C CG1   . VAL B 1 22  ? 18.132  99.985  38.424 1.00 18.70 ? 22   VAL B CG1   1 
ATOM   1527 C CG2   . VAL B 1 22  ? 18.214  97.491  38.180 1.00 18.39 ? 22   VAL B CG2   1 
ATOM   1528 N N     . PRO B 1 23  ? 14.683  100.763 38.140 1.00 17.09 ? 23   PRO B N     1 
ATOM   1529 C CA    . PRO B 1 23  ? 14.047  101.985 37.622 1.00 16.90 ? 23   PRO B CA    1 
ATOM   1530 C C     . PRO B 1 23  ? 15.097  102.879 36.949 1.00 16.96 ? 23   PRO B C     1 
ATOM   1531 O O     . PRO B 1 23  ? 16.241  102.965 37.400 1.00 18.01 ? 23   PRO B O     1 
ATOM   1532 C CB    . PRO B 1 23  ? 13.494  102.645 38.889 1.00 15.63 ? 23   PRO B CB    1 
ATOM   1533 C CG    . PRO B 1 23  ? 13.146  101.463 39.759 1.00 16.49 ? 23   PRO B CG    1 
ATOM   1534 C CD    . PRO B 1 23  ? 14.327  100.531 39.553 1.00 15.86 ? 23   PRO B CD    1 
ATOM   1535 N N     . THR B 1 24  ? 14.722  103.508 35.848 1.00 16.65 ? 24   THR B N     1 
ATOM   1536 C CA    . THR B 1 24  ? 15.628  104.384 35.140 1.00 16.24 ? 24   THR B CA    1 
ATOM   1537 C C     . THR B 1 24  ? 15.378  105.790 35.632 1.00 15.39 ? 24   THR B C     1 
ATOM   1538 O O     . THR B 1 24  ? 14.231  106.198 35.738 1.00 16.40 ? 24   THR B O     1 
ATOM   1539 C CB    . THR B 1 24  ? 15.338  104.329 33.652 1.00 17.57 ? 24   THR B CB    1 
ATOM   1540 O OG1   . THR B 1 24  ? 15.501  102.984 33.202 1.00 20.48 ? 24   THR B OG1   1 
ATOM   1541 C CG2   . THR B 1 24  ? 16.272  105.250 32.877 1.00 17.50 ? 24   THR B CG2   1 
ATOM   1542 N N     . LEU B 1 25  ? 16.437  106.514 35.975 1.00 15.37 ? 25   LEU B N     1 
ATOM   1543 C CA    . LEU B 1 25  ? 16.293  107.892 36.435 1.00 15.97 ? 25   LEU B CA    1 
ATOM   1544 C C     . LEU B 1 25  ? 16.033  108.758 35.212 1.00 16.93 ? 25   LEU B C     1 
ATOM   1545 O O     . LEU B 1 25  ? 16.777  108.700 34.220 1.00 18.09 ? 25   LEU B O     1 
ATOM   1546 C CB    . LEU B 1 25  ? 17.535  108.355 37.197 1.00 16.05 ? 25   LEU B CB    1 
ATOM   1547 C CG    . LEU B 1 25  ? 17.880  107.491 38.421 1.00 17.19 ? 25   LEU B CG    1 
ATOM   1548 C CD1   . LEU B 1 25  ? 19.059  108.103 39.159 1.00 15.52 ? 25   LEU B CD1   1 
ATOM   1549 C CD2   . LEU B 1 25  ? 16.661  107.337 39.363 1.00 15.84 ? 25   LEU B CD2   1 
ATOM   1550 N N     . GLN B 1 26  ? 14.968  109.550 35.285 1.00 16.60 ? 26   GLN B N     1 
ATOM   1551 C CA    . GLN B 1 26  ? 14.539  110.384 34.170 1.00 16.67 ? 26   GLN B CA    1 
ATOM   1552 C C     . GLN B 1 26  ? 14.723  111.879 34.314 1.00 16.65 ? 26   GLN B C     1 
ATOM   1553 O O     . GLN B 1 26  ? 14.841  112.581 33.317 1.00 16.57 ? 26   GLN B O     1 
ATOM   1554 C CB    . GLN B 1 26  ? 13.054  110.123 33.882 1.00 17.43 ? 26   GLN B CB    1 
ATOM   1555 C CG    . GLN B 1 26  ? 12.678  108.671 33.655 1.00 16.13 ? 26   GLN B CG    1 
ATOM   1556 C CD    . GLN B 1 26  ? 13.224  108.122 32.357 1.00 17.77 ? 26   GLN B CD    1 
ATOM   1557 O OE1   . GLN B 1 26  ? 13.930  108.809 31.621 1.00 18.47 ? 26   GLN B OE1   1 
ATOM   1558 N NE2   . GLN B 1 26  ? 12.882  106.881 32.058 1.00 19.64 ? 26   GLN B NE2   1 
ATOM   1559 N N     . ASN B 1 27  ? 14.693  112.377 35.543 1.00 17.25 ? 27   ASN B N     1 
ATOM   1560 C CA    . ASN B 1 27  ? 14.805  113.814 35.782 1.00 16.51 ? 27   ASN B CA    1 
ATOM   1561 C C     . ASN B 1 27  ? 15.339  114.026 37.185 1.00 15.92 ? 27   ASN B C     1 
ATOM   1562 O O     . ASN B 1 27  ? 14.970  113.301 38.112 1.00 15.72 ? 27   ASN B O     1 
ATOM   1563 C CB    . ASN B 1 27  ? 13.414  114.451 35.641 1.00 15.58 ? 27   ASN B CB    1 
ATOM   1564 C CG    . ASN B 1 27  ? 13.414  115.961 35.868 1.00 16.06 ? 27   ASN B CG    1 
ATOM   1565 O OD1   . ASN B 1 27  ? 14.367  116.657 35.527 1.00 16.62 ? 27   ASN B OD1   1 
ATOM   1566 N ND2   . ASN B 1 27  ? 12.316  116.475 36.412 1.00 14.13 ? 27   ASN B ND2   1 
ATOM   1567 N N     . ILE B 1 28  ? 16.230  114.996 37.332 1.00 15.65 ? 28   ILE B N     1 
ATOM   1568 C CA    . ILE B 1 28  ? 16.826  115.306 38.624 1.00 15.83 ? 28   ILE B CA    1 
ATOM   1569 C C     . ILE B 1 28  ? 16.697  116.808 38.832 1.00 16.56 ? 28   ILE B C     1 
ATOM   1570 O O     . ILE B 1 28  ? 16.983  117.582 37.917 1.00 16.62 ? 28   ILE B O     1 
ATOM   1571 C CB    . ILE B 1 28  ? 18.347  114.945 38.666 1.00 14.73 ? 28   ILE B CB    1 
ATOM   1572 C CG1   . ILE B 1 28  ? 18.595  113.476 38.288 1.00 14.97 ? 28   ILE B CG1   1 
ATOM   1573 C CG2   . ILE B 1 28  ? 18.926  115.274 40.026 1.00 14.62 ? 28   ILE B CG2   1 
ATOM   1574 C CD1   . ILE B 1 28  ? 18.131  112.436 39.283 1.00 11.52 ? 28   ILE B CD1   1 
ATOM   1575 N N     . VAL B 1 29  ? 16.200  117.211 40.001 1.00 15.95 ? 29   VAL B N     1 
ATOM   1576 C CA    . VAL B 1 29  ? 16.060  118.625 40.345 1.00 15.99 ? 29   VAL B CA    1 
ATOM   1577 C C     . VAL B 1 29  ? 17.049  118.873 41.482 1.00 16.77 ? 29   VAL B C     1 
ATOM   1578 O O     . VAL B 1 29  ? 17.053  118.128 42.464 1.00 17.10 ? 29   VAL B O     1 
ATOM   1579 C CB    . VAL B 1 29  ? 14.636  118.962 40.867 1.00 15.28 ? 29   VAL B CB    1 
ATOM   1580 C CG1   . VAL B 1 29  ? 14.548  120.428 41.271 1.00 15.33 ? 29   VAL B CG1   1 
ATOM   1581 C CG2   . VAL B 1 29  ? 13.597  118.645 39.824 1.00 14.25 ? 29   VAL B CG2   1 
ATOM   1582 N N     . SER B 1 30  ? 17.881  119.902 41.353 1.00 17.69 ? 30   SER B N     1 
ATOM   1583 C CA    . SER B 1 30  ? 18.858  120.231 42.388 1.00 17.86 ? 30   SER B CA    1 
ATOM   1584 C C     . SER B 1 30  ? 18.890  121.732 42.595 1.00 18.62 ? 30   SER B C     1 
ATOM   1585 O O     . SER B 1 30  ? 18.339  122.487 41.792 1.00 19.16 ? 30   SER B O     1 
ATOM   1586 C CB    . SER B 1 30  ? 20.248  119.738 41.987 1.00 16.84 ? 30   SER B CB    1 
ATOM   1587 O OG    . SER B 1 30  ? 20.714  120.391 40.815 1.00 17.46 ? 30   SER B OG    1 
ATOM   1588 N N     . THR B 1 31  ? 19.490  122.163 43.695 1.00 18.94 ? 31   THR B N     1 
ATOM   1589 C CA    . THR B 1 31  ? 19.613  123.587 43.983 1.00 20.40 ? 31   THR B CA    1 
ATOM   1590 C C     . THR B 1 31  ? 21.011  123.849 44.496 1.00 20.25 ? 31   THR B C     1 
ATOM   1591 O O     . THR B 1 31  ? 21.680  122.940 44.986 1.00 19.10 ? 31   THR B O     1 
ATOM   1592 C CB    . THR B 1 31  ? 18.627  124.077 45.089 1.00 19.64 ? 31   THR B CB    1 
ATOM   1593 O OG1   . THR B 1 31  ? 18.824  123.313 46.284 1.00 20.25 ? 31   THR B OG1   1 
ATOM   1594 C CG2   . THR B 1 31  ? 17.172  123.961 44.633 1.00 19.68 ? 31   THR B CG2   1 
ATOM   1595 N N     . VAL B 1 32  ? 21.464  125.082 44.328 1.00 21.59 ? 32   VAL B N     1 
ATOM   1596 C CA    . VAL B 1 32  ? 22.762  125.504 44.835 1.00 22.39 ? 32   VAL B CA    1 
ATOM   1597 C C     . VAL B 1 32  ? 22.678  126.992 45.154 1.00 24.19 ? 32   VAL B C     1 
ATOM   1598 O O     . VAL B 1 32  ? 21.789  127.709 44.661 1.00 23.08 ? 32   VAL B O     1 
ATOM   1599 C CB    . VAL B 1 32  ? 23.931  125.217 43.865 1.00 21.89 ? 32   VAL B CB    1 
ATOM   1600 C CG1   . VAL B 1 32  ? 23.837  126.087 42.623 1.00 22.29 ? 32   VAL B CG1   1 
ATOM   1601 C CG2   . VAL B 1 32  ? 25.266  125.429 44.581 1.00 20.00 ? 32   VAL B CG2   1 
ATOM   1602 N N     . ASN B 1 33  ? 23.567  127.438 46.032 1.00 25.49 ? 33   ASN B N     1 
ATOM   1603 C CA    . ASN B 1 33  ? 23.602  128.829 46.433 1.00 27.26 ? 33   ASN B CA    1 
ATOM   1604 C C     . ASN B 1 33  ? 24.868  129.449 45.856 1.00 27.46 ? 33   ASN B C     1 
ATOM   1605 O O     . ASN B 1 33  ? 25.974  129.119 46.276 1.00 27.89 ? 33   ASN B O     1 
ATOM   1606 C CB    . ASN B 1 33  ? 23.592  128.931 47.966 1.00 28.42 ? 33   ASN B CB    1 
ATOM   1607 C CG    . ASN B 1 33  ? 23.360  130.348 48.463 1.00 29.03 ? 33   ASN B CG    1 
ATOM   1608 O OD1   . ASN B 1 33  ? 23.512  131.322 47.729 1.00 29.55 ? 33   ASN B OD1   1 
ATOM   1609 N ND2   . ASN B 1 33  ? 22.960  130.464 49.711 1.00 29.95 ? 33   ASN B ND2   1 
ATOM   1610 N N     . LEU B 1 34  ? 24.708  130.297 44.846 1.00 27.84 ? 34   LEU B N     1 
ATOM   1611 C CA    . LEU B 1 34  ? 25.855  130.952 44.234 1.00 29.07 ? 34   LEU B CA    1 
ATOM   1612 C C     . LEU B 1 34  ? 26.486  131.906 45.248 1.00 30.78 ? 34   LEU B C     1 
ATOM   1613 O O     . LEU B 1 34  ? 27.613  132.366 45.073 1.00 31.71 ? 34   LEU B O     1 
ATOM   1614 C CB    . LEU B 1 34  ? 25.455  131.669 42.941 1.00 27.33 ? 34   LEU B CB    1 
ATOM   1615 C CG    . LEU B 1 34  ? 24.945  130.720 41.849 1.00 26.30 ? 34   LEU B CG    1 
ATOM   1616 C CD1   . LEU B 1 34  ? 24.628  131.490 40.577 1.00 26.73 ? 34   LEU B CD1   1 
ATOM   1617 C CD2   . LEU B 1 34  ? 25.962  129.634 41.582 1.00 24.63 ? 34   LEU B CD2   1 
ATOM   1618 N N     . ASP B 1 35  ? 25.736  132.213 46.299 1.00 32.09 ? 35   ASP B N     1 
ATOM   1619 C CA    . ASP B 1 35  ? 26.220  133.046 47.383 1.00 34.34 ? 35   ASP B CA    1 
ATOM   1620 C C     . ASP B 1 35  ? 26.697  134.442 46.995 1.00 35.04 ? 35   ASP B C     1 
ATOM   1621 O O     . ASP B 1 35  ? 27.802  134.863 47.375 1.00 34.66 ? 35   ASP B O     1 
ATOM   1622 C CB    . ASP B 1 35  ? 27.326  132.297 48.130 1.00 36.89 ? 35   ASP B CB    1 
ATOM   1623 C CG    . ASP B 1 35  ? 27.546  132.822 49.536 1.00 40.41 ? 35   ASP B CG    1 
ATOM   1624 O OD1   . ASP B 1 35  ? 26.547  133.055 50.267 1.00 44.17 ? 35   ASP B OD1   1 
ATOM   1625 O OD2   . ASP B 1 35  ? 28.724  132.979 49.919 1.00 41.64 ? 35   ASP B OD2   1 
ATOM   1626 N N     . CYS B 1 36  ? 25.866  135.145 46.225 1.00 34.91 ? 36   CYS B N     1 
ATOM   1627 C CA    . CYS B 1 36  ? 26.137  136.521 45.802 1.00 34.65 ? 36   CYS B CA    1 
ATOM   1628 C C     . CYS B 1 36  ? 24.887  137.031 45.116 1.00 34.20 ? 36   CYS B C     1 
ATOM   1629 O O     . CYS B 1 36  ? 24.177  136.258 44.477 1.00 34.49 ? 36   CYS B O     1 
ATOM   1630 C CB    . CYS B 1 36  ? 27.350  136.616 44.873 1.00 34.87 ? 36   CYS B CB    1 
ATOM   1631 S SG    . CYS B 1 36  ? 27.116  135.984 43.227 1.00 38.04 ? 36   CYS B SG    1 
ATOM   1632 N N     . LYS B 1 37  ? 24.560  138.300 45.330 1.00 33.64 ? 37   LYS B N     1 
ATOM   1633 C CA    . LYS B 1 37  ? 23.365  138.873 44.722 1.00 34.08 ? 37   LYS B CA    1 
ATOM   1634 C C     . LYS B 1 37  ? 23.575  138.941 43.216 1.00 32.70 ? 37   LYS B C     1 
ATOM   1635 O O     . LYS B 1 37  ? 24.702  139.139 42.745 1.00 32.01 ? 37   LYS B O     1 
ATOM   1636 C CB    . LYS B 1 37  ? 23.055  140.255 45.322 1.00 36.46 ? 37   LYS B CB    1 
ATOM   1637 C CG    . LYS B 1 37  ? 22.589  140.217 46.785 1.00 38.24 ? 37   LYS B CG    1 
ATOM   1638 C CD    . LYS B 1 37  ? 21.214  139.558 46.910 1.00 41.10 ? 37   LYS B CD    1 
ATOM   1639 C CE    . LYS B 1 37  ? 20.921  139.071 48.332 1.00 41.40 ? 37   LYS B CE    1 
ATOM   1640 N NZ    . LYS B 1 37  ? 21.687  137.836 48.693 1.00 42.43 ? 37   LYS B NZ    1 
ATOM   1641 N N     . LEU B 1 38  ? 22.503  138.738 42.458 1.00 31.05 ? 38   LEU B N     1 
ATOM   1642 C CA    . LEU B 1 38  ? 22.612  138.748 41.009 1.00 29.47 ? 38   LEU B CA    1 
ATOM   1643 C C     . LEU B 1 38  ? 21.743  139.796 40.356 1.00 29.31 ? 38   LEU B C     1 
ATOM   1644 O O     . LEU B 1 38  ? 20.612  140.026 40.773 1.00 30.00 ? 38   LEU B O     1 
ATOM   1645 C CB    . LEU B 1 38  ? 22.262  137.362 40.440 1.00 27.75 ? 38   LEU B CB    1 
ATOM   1646 C CG    . LEU B 1 38  ? 23.082  136.169 40.945 1.00 26.46 ? 38   LEU B CG    1 
ATOM   1647 C CD1   . LEU B 1 38  ? 22.629  134.882 40.257 1.00 25.23 ? 38   LEU B CD1   1 
ATOM   1648 C CD2   . LEU B 1 38  ? 24.565  136.416 40.722 1.00 26.40 ? 38   LEU B CD2   1 
ATOM   1649 N N     . ASP B 1 39  ? 22.292  140.455 39.344 1.00 30.60 ? 39   ASP B N     1 
ATOM   1650 C CA    . ASP B 1 39  ? 21.560  141.466 38.586 1.00 31.10 ? 39   ASP B CA    1 
ATOM   1651 C C     . ASP B 1 39  ? 20.947  140.701 37.410 1.00 30.80 ? 39   ASP B C     1 
ATOM   1652 O O     . ASP B 1 39  ? 21.616  140.459 36.400 1.00 30.91 ? 39   ASP B O     1 
ATOM   1653 C CB    . ASP B 1 39  ? 22.523  142.549 38.082 1.00 31.23 ? 39   ASP B CB    1 
ATOM   1654 C CG    . ASP B 1 39  ? 21.818  143.667 37.331 1.00 31.69 ? 39   ASP B CG    1 
ATOM   1655 O OD1   . ASP B 1 39  ? 20.645  143.505 36.936 1.00 32.11 ? 39   ASP B OD1   1 
ATOM   1656 O OD2   . ASP B 1 39  ? 22.452  144.719 37.113 1.00 33.62 ? 39   ASP B OD2   1 
ATOM   1657 N N     . LEU B 1 40  ? 19.678  140.325 37.548 1.00 30.31 ? 40   LEU B N     1 
ATOM   1658 C CA    . LEU B 1 40  ? 18.986  139.550 36.526 1.00 30.09 ? 40   LEU B CA    1 
ATOM   1659 C C     . LEU B 1 40  ? 18.838  140.214 35.157 1.00 31.78 ? 40   LEU B C     1 
ATOM   1660 O O     . LEU B 1 40  ? 19.067  139.565 34.128 1.00 31.73 ? 40   LEU B O     1 
ATOM   1661 C CB    . LEU B 1 40  ? 17.637  139.026 37.048 1.00 27.13 ? 40   LEU B CB    1 
ATOM   1662 C CG    . LEU B 1 40  ? 17.703  138.059 38.247 1.00 24.93 ? 40   LEU B CG    1 
ATOM   1663 C CD1   . LEU B 1 40  ? 16.341  137.424 38.451 1.00 24.72 ? 40   LEU B CD1   1 
ATOM   1664 C CD2   . LEU B 1 40  ? 18.751  136.972 38.042 1.00 22.39 ? 40   LEU B CD2   1 
ATOM   1665 N N     . LYS B 1 41  ? 18.471  141.492 35.126 1.00 33.51 ? 41   LYS B N     1 
ATOM   1666 C CA    . LYS B 1 41  ? 18.333  142.184 33.845 1.00 35.93 ? 41   LYS B CA    1 
ATOM   1667 C C     . LYS B 1 41  ? 19.703  142.144 33.144 1.00 35.29 ? 41   LYS B C     1 
ATOM   1668 O O     . LYS B 1 41  ? 19.803  141.853 31.950 1.00 36.45 ? 41   LYS B O     1 
ATOM   1669 C CB    . LYS B 1 41  ? 17.903  143.648 34.034 1.00 38.72 ? 41   LYS B CB    1 
ATOM   1670 C CG    . LYS B 1 41  ? 16.958  143.918 35.202 1.00 43.05 ? 41   LYS B CG    1 
ATOM   1671 C CD    . LYS B 1 41  ? 15.536  143.443 34.955 1.00 46.06 ? 41   LYS B CD    1 
ATOM   1672 C CE    . LYS B 1 41  ? 14.734  143.431 36.262 1.00 47.19 ? 41   LYS B CE    1 
ATOM   1673 N NZ    . LYS B 1 41  ? 13.329  142.948 36.076 1.00 47.83 ? 41   LYS B NZ    1 
ATOM   1674 N N     . ALA B 1 42  ? 20.762  142.405 33.900 1.00 34.62 ? 42   ALA B N     1 
ATOM   1675 C CA    . ALA B 1 42  ? 22.104  142.392 33.339 1.00 34.41 ? 42   ALA B CA    1 
ATOM   1676 C C     . ALA B 1 42  ? 22.406  141.019 32.762 1.00 35.48 ? 42   ALA B C     1 
ATOM   1677 O O     . ALA B 1 42  ? 22.908  140.910 31.637 1.00 36.72 ? 42   ALA B O     1 
ATOM   1678 C CB    . ALA B 1 42  ? 23.136  142.747 34.399 1.00 33.66 ? 42   ALA B CB    1 
ATOM   1679 N N     . ILE B 1 43  ? 22.089  139.971 33.521 1.00 34.28 ? 43   ILE B N     1 
ATOM   1680 C CA    . ILE B 1 43  ? 22.347  138.614 33.066 1.00 33.45 ? 43   ILE B CA    1 
ATOM   1681 C C     . ILE B 1 43  ? 21.606  138.300 31.768 1.00 33.07 ? 43   ILE B C     1 
ATOM   1682 O O     . ILE B 1 43  ? 22.202  137.803 30.808 1.00 31.78 ? 43   ILE B O     1 
ATOM   1683 C CB    . ILE B 1 43  ? 22.009  137.566 34.160 1.00 34.15 ? 43   ILE B CB    1 
ATOM   1684 C CG1   . ILE B 1 43  ? 23.004  137.693 35.327 1.00 33.37 ? 43   ILE B CG1   1 
ATOM   1685 C CG2   . ILE B 1 43  ? 22.051  136.152 33.570 1.00 33.12 ? 43   ILE B CG2   1 
ATOM   1686 C CD1   . ILE B 1 43  ? 22.767  136.715 36.470 1.00 31.71 ? 43   ILE B CD1   1 
ATOM   1687 N N     . ALA B 1 44  ? 20.329  138.647 31.713 1.00 32.64 ? 44   ALA B N     1 
ATOM   1688 C CA    . ALA B 1 44  ? 19.532  138.389 30.518 1.00 33.55 ? 44   ALA B CA    1 
ATOM   1689 C C     . ALA B 1 44  ? 20.072  139.121 29.274 1.00 34.34 ? 44   ALA B C     1 
ATOM   1690 O O     . ALA B 1 44  ? 19.936  138.631 28.148 1.00 33.92 ? 44   ALA B O     1 
ATOM   1691 C CB    . ALA B 1 44  ? 18.076  138.758 30.768 1.00 32.71 ? 44   ALA B CB    1 
ATOM   1692 N N     . LEU B 1 45  ? 20.691  140.281 29.477 1.00 34.72 ? 45   LEU B N     1 
ATOM   1693 C CA    . LEU B 1 45  ? 21.234  141.046 28.362 1.00 35.73 ? 45   LEU B CA    1 
ATOM   1694 C C     . LEU B 1 45  ? 22.633  140.611 27.953 1.00 36.13 ? 45   LEU B C     1 
ATOM   1695 O O     . LEU B 1 45  ? 23.028  140.779 26.797 1.00 36.59 ? 45   LEU B O     1 
ATOM   1696 C CB    . LEU B 1 45  ? 21.243  142.537 28.682 1.00 35.08 ? 45   LEU B CB    1 
ATOM   1697 C CG    . LEU B 1 45  ? 19.882  143.220 28.806 1.00 36.17 ? 45   LEU B CG    1 
ATOM   1698 C CD1   . LEU B 1 45  ? 20.090  144.648 29.299 1.00 36.55 ? 45   LEU B CD1   1 
ATOM   1699 C CD2   . LEU B 1 45  ? 19.134  143.204 27.472 1.00 35.24 ? 45   LEU B CD2   1 
ATOM   1700 N N     . GLN B 1 46  ? 23.382  140.044 28.888 1.00 36.97 ? 46   GLN B N     1 
ATOM   1701 C CA    . GLN B 1 46  ? 24.744  139.619 28.595 1.00 38.12 ? 46   GLN B CA    1 
ATOM   1702 C C     . GLN B 1 46  ? 24.912  138.151 28.238 1.00 38.00 ? 46   GLN B C     1 
ATOM   1703 O O     . GLN B 1 46  ? 25.805  137.798 27.470 1.00 38.13 ? 46   GLN B O     1 
ATOM   1704 C CB    . GLN B 1 46  ? 25.664  140.001 29.750 1.00 39.28 ? 46   GLN B CB    1 
ATOM   1705 C CG    . GLN B 1 46  ? 25.618  141.486 30.039 1.00 43.08 ? 46   GLN B CG    1 
ATOM   1706 C CD    . GLN B 1 46  ? 25.746  142.314 28.771 1.00 45.51 ? 46   GLN B CD    1 
ATOM   1707 O OE1   . GLN B 1 46  ? 24.884  143.148 28.459 1.00 47.58 ? 46   GLN B OE1   1 
ATOM   1708 N NE2   . GLN B 1 46  ? 26.810  142.069 28.017 1.00 46.85 ? 46   GLN B NE2   1 
ATOM   1709 N N     . ALA B 1 47  ? 24.059  137.298 28.788 1.00 38.42 ? 47   ALA B N     1 
ATOM   1710 C CA    . ALA B 1 47  ? 24.144  135.872 28.516 1.00 39.33 ? 47   ALA B CA    1 
ATOM   1711 C C     . ALA B 1 47  ? 23.537  135.594 27.161 1.00 41.11 ? 47   ALA B C     1 
ATOM   1712 O O     . ALA B 1 47  ? 22.664  136.332 26.707 1.00 42.09 ? 47   ALA B O     1 
ATOM   1713 C CB    . ALA B 1 47  ? 23.417  135.084 29.581 1.00 38.08 ? 47   ALA B CB    1 
ATOM   1714 N N     . ARG B 1 48  ? 24.003  134.537 26.508 1.00 42.36 ? 48   ARG B N     1 
ATOM   1715 C CA    . ARG B 1 48  ? 23.474  134.181 25.204 1.00 43.13 ? 48   ARG B CA    1 
ATOM   1716 C C     . ARG B 1 48  ? 22.227  133.323 25.393 1.00 42.98 ? 48   ARG B C     1 
ATOM   1717 O O     . ARG B 1 48  ? 22.262  132.258 26.030 1.00 42.98 ? 48   ARG B O     1 
ATOM   1718 C CB    . ARG B 1 48  ? 24.508  133.416 24.374 1.00 43.83 ? 48   ARG B CB    1 
ATOM   1719 C CG    . ARG B 1 48  ? 24.008  133.033 22.994 1.00 44.69 ? 48   ARG B CG    1 
ATOM   1720 C CD    . ARG B 1 48  ? 24.698  131.785 22.508 1.00 46.34 ? 48   ARG B CD    1 
ATOM   1721 N NE    . ARG B 1 48  ? 26.128  132.000 22.400 1.00 48.06 ? 48   ARG B NE    1 
ATOM   1722 C CZ    . ARG B 1 48  ? 26.677  132.804 21.500 1.00 50.48 ? 48   ARG B CZ    1 
ATOM   1723 N NH1   . ARG B 1 48  ? 25.899  133.450 20.638 1.00 51.82 ? 48   ARG B NH1   1 
ATOM   1724 N NH2   . ARG B 1 48  ? 27.995  132.984 21.476 1.00 51.08 ? 48   ARG B NH2   1 
ATOM   1725 N N     . ASN B 1 49  ? 21.117  133.834 24.886 1.00 42.44 ? 49   ASN B N     1 
ATOM   1726 C CA    . ASN B 1 49  ? 19.847  133.143 24.947 1.00 42.70 ? 49   ASN B CA    1 
ATOM   1727 C C     . ASN B 1 49  ? 19.467  132.818 26.383 1.00 42.22 ? 49   ASN B C     1 
ATOM   1728 O O     . ASN B 1 49  ? 19.562  131.675 26.829 1.00 42.54 ? 49   ASN B O     1 
ATOM   1729 C CB    . ASN B 1 49  ? 19.891  131.869 24.102 1.00 43.01 ? 49   ASN B CB    1 
ATOM   1730 C CG    . ASN B 1 49  ? 18.533  131.499 23.544 1.00 43.89 ? 49   ASN B CG    1 
ATOM   1731 O OD1   . ASN B 1 49  ? 17.565  132.245 23.704 1.00 45.21 ? 49   ASN B OD1   1 
ATOM   1732 N ND2   . ASN B 1 49  ? 18.452  130.350 22.882 1.00 43.84 ? 49   ASN B ND2   1 
ATOM   1733 N N     . ALA B 1 50  ? 19.120  133.855 27.124 1.00 40.55 ? 50   ALA B N     1 
ATOM   1734 C CA    . ALA B 1 50  ? 18.701  133.704 28.501 1.00 39.67 ? 50   ALA B CA    1 
ATOM   1735 C C     . ALA B 1 50  ? 17.326  134.337 28.497 1.00 39.36 ? 50   ALA B C     1 
ATOM   1736 O O     . ALA B 1 50  ? 17.124  135.367 27.851 1.00 39.90 ? 50   ALA B O     1 
ATOM   1737 C CB    . ALA B 1 50  ? 19.639  134.466 29.429 1.00 39.03 ? 50   ALA B CB    1 
ATOM   1738 N N     . GLU B 1 51  ? 16.360  133.668 29.114 1.00 39.36 ? 51   GLU B N     1 
ATOM   1739 C CA    . GLU B 1 51  ? 15.000  134.181 29.185 1.00 38.65 ? 51   GLU B CA    1 
ATOM   1740 C C     . GLU B 1 51  ? 14.808  134.892 30.508 1.00 36.84 ? 51   GLU B C     1 
ATOM   1741 O O     . GLU B 1 51  ? 15.423  134.535 31.511 1.00 35.27 ? 51   GLU B O     1 
ATOM   1742 C CB    . GLU B 1 51  ? 13.991  133.046 29.084 1.00 41.75 ? 51   GLU B CB    1 
ATOM   1743 C CG    . GLU B 1 51  ? 14.033  132.288 27.772 1.00 48.57 ? 51   GLU B CG    1 
ATOM   1744 C CD    . GLU B 1 51  ? 13.107  131.071 27.753 1.00 52.41 ? 51   GLU B CD    1 
ATOM   1745 O OE1   . GLU B 1 51  ? 12.389  130.832 28.761 1.00 53.97 ? 51   GLU B OE1   1 
ATOM   1746 O OE2   . GLU B 1 51  ? 13.104  130.351 26.723 1.00 54.46 ? 51   GLU B OE2   1 
ATOM   1747 N N     . TYR B 1 52  ? 13.964  135.913 30.505 1.00 35.62 ? 52   TYR B N     1 
ATOM   1748 C CA    . TYR B 1 52  ? 13.691  136.652 31.719 1.00 34.60 ? 52   TYR B CA    1 
ATOM   1749 C C     . TYR B 1 52  ? 12.479  137.555 31.601 1.00 34.40 ? 52   TYR B C     1 
ATOM   1750 O O     . TYR B 1 52  ? 12.539  138.623 30.997 1.00 36.00 ? 52   TYR B O     1 
ATOM   1751 C CB    . TYR B 1 52  ? 14.910  137.474 32.145 1.00 32.80 ? 52   TYR B CB    1 
ATOM   1752 C CG    . TYR B 1 52  ? 14.704  138.230 33.440 1.00 32.05 ? 52   TYR B CG    1 
ATOM   1753 C CD1   . TYR B 1 52  ? 14.072  137.626 34.534 1.00 30.65 ? 52   TYR B CD1   1 
ATOM   1754 C CD2   . TYR B 1 52  ? 15.123  139.556 33.568 1.00 32.12 ? 52   TYR B CD2   1 
ATOM   1755 C CE1   . TYR B 1 52  ? 13.860  138.327 35.721 1.00 31.53 ? 52   TYR B CE1   1 
ATOM   1756 C CE2   . TYR B 1 52  ? 14.919  140.265 34.748 1.00 32.16 ? 52   TYR B CE2   1 
ATOM   1757 C CZ    . TYR B 1 52  ? 14.289  139.648 35.820 1.00 32.36 ? 52   TYR B CZ    1 
ATOM   1758 O OH    . TYR B 1 52  ? 14.102  140.351 36.984 1.00 32.54 ? 52   TYR B OH    1 
ATOM   1759 N N     . ASN B 1 53  ? 11.366  137.112 32.158 1.00 34.26 ? 53   ASN B N     1 
ATOM   1760 C CA    . ASN B 1 53  ? 10.162  137.920 32.157 1.00 34.28 ? 53   ASN B CA    1 
ATOM   1761 C C     . ASN B 1 53  ? 9.711   137.994 33.614 1.00 33.59 ? 53   ASN B C     1 
ATOM   1762 O O     . ASN B 1 53  ? 8.907   137.183 34.078 1.00 31.98 ? 53   ASN B O     1 
ATOM   1763 C CB    . ASN B 1 53  ? 9.080   137.315 31.262 1.00 36.17 ? 53   ASN B CB    1 
ATOM   1764 C CG    . ASN B 1 53  ? 7.836   138.200 31.163 1.00 38.83 ? 53   ASN B CG    1 
ATOM   1765 O OD1   . ASN B 1 53  ? 6.774   137.740 30.742 1.00 41.27 ? 53   ASN B OD1   1 
ATOM   1766 N ND2   . ASN B 1 53  ? 7.962   139.473 31.543 1.00 38.36 ? 53   ASN B ND2   1 
ATOM   1767 N N     . PRO B 1 54  ? 10.234  138.985 34.357 1.00 33.49 ? 54   PRO B N     1 
ATOM   1768 C CA    . PRO B 1 54  ? 9.926   139.210 35.771 1.00 34.16 ? 54   PRO B CA    1 
ATOM   1769 C C     . PRO B 1 54  ? 8.436   139.330 36.083 1.00 34.32 ? 54   PRO B C     1 
ATOM   1770 O O     . PRO B 1 54  ? 8.012   139.099 37.215 1.00 34.98 ? 54   PRO B O     1 
ATOM   1771 C CB    . PRO B 1 54  ? 10.701  140.486 36.093 1.00 34.17 ? 54   PRO B CB    1 
ATOM   1772 C CG    . PRO B 1 54  ? 10.795  141.179 34.774 1.00 34.38 ? 54   PRO B CG    1 
ATOM   1773 C CD    . PRO B 1 54  ? 11.121  140.048 33.852 1.00 33.97 ? 54   PRO B CD    1 
ATOM   1774 N N     . LYS B 1 55  ? 7.637   139.681 35.086 1.00 34.10 ? 55   LYS B N     1 
ATOM   1775 C CA    . LYS B 1 55  ? 6.208   139.779 35.302 1.00 34.79 ? 55   LYS B CA    1 
ATOM   1776 C C     . LYS B 1 55  ? 5.611   138.372 35.327 1.00 34.92 ? 55   LYS B C     1 
ATOM   1777 O O     . LYS B 1 55  ? 4.575   138.128 35.948 1.00 36.00 ? 55   LYS B O     1 
ATOM   1778 C CB    . LYS B 1 55  ? 5.562   140.602 34.191 1.00 36.89 ? 55   LYS B CB    1 
ATOM   1779 C CG    . LYS B 1 55  ? 5.956   142.069 34.210 1.00 40.41 ? 55   LYS B CG    1 
ATOM   1780 C CD    . LYS B 1 55  ? 4.808   142.975 33.767 1.00 42.90 ? 55   LYS B CD    1 
ATOM   1781 C CE    . LYS B 1 55  ? 3.606   142.918 34.728 1.00 44.33 ? 55   LYS B CE    1 
ATOM   1782 N NZ    . LYS B 1 55  ? 2.792   141.652 34.650 1.00 45.51 ? 55   LYS B NZ    1 
ATOM   1783 N N     . ARG B 1 56  ? 6.298   137.449 34.667 1.00 33.90 ? 56   ARG B N     1 
ATOM   1784 C CA    . ARG B 1 56  ? 5.879   136.060 34.556 1.00 32.80 ? 56   ARG B CA    1 
ATOM   1785 C C     . ARG B 1 56  ? 6.443   135.232 35.707 1.00 30.86 ? 56   ARG B C     1 
ATOM   1786 O O     . ARG B 1 56  ? 5.704   134.535 36.398 1.00 29.98 ? 56   ARG B O     1 
ATOM   1787 C CB    . ARG B 1 56  ? 6.369   135.523 33.206 1.00 34.79 ? 56   ARG B CB    1 
ATOM   1788 C CG    . ARG B 1 56  ? 6.088   134.069 32.887 1.00 37.69 ? 56   ARG B CG    1 
ATOM   1789 C CD    . ARG B 1 56  ? 6.633   133.742 31.486 1.00 40.56 ? 56   ARG B CD    1 
ATOM   1790 N NE    . ARG B 1 56  ? 6.580   132.317 31.154 1.00 42.69 ? 56   ARG B NE    1 
ATOM   1791 C CZ    . ARG B 1 56  ? 5.466   131.649 30.856 1.00 43.07 ? 56   ARG B CZ    1 
ATOM   1792 N NH1   . ARG B 1 56  ? 4.290   132.267 30.842 1.00 43.50 ? 56   ARG B NH1   1 
ATOM   1793 N NH2   . ARG B 1 56  ? 5.528   130.351 30.589 1.00 42.54 ? 56   ARG B NH2   1 
ATOM   1794 N N     . PHE B 1 57  ? 7.748   135.341 35.926 1.00 28.88 ? 57   PHE B N     1 
ATOM   1795 C CA    . PHE B 1 57  ? 8.417   134.596 36.985 1.00 27.11 ? 57   PHE B CA    1 
ATOM   1796 C C     . PHE B 1 57  ? 9.669   135.371 37.384 1.00 27.02 ? 57   PHE B C     1 
ATOM   1797 O O     . PHE B 1 57  ? 10.302  136.026 36.554 1.00 27.33 ? 57   PHE B O     1 
ATOM   1798 C CB    . PHE B 1 57  ? 8.774   133.181 36.499 1.00 25.41 ? 57   PHE B CB    1 
ATOM   1799 C CG    . PHE B 1 57  ? 9.224   132.243 37.599 1.00 23.56 ? 57   PHE B CG    1 
ATOM   1800 C CD1   . PHE B 1 57  ? 8.371   131.920 38.657 1.00 22.27 ? 57   PHE B CD1   1 
ATOM   1801 C CD2   . PHE B 1 57  ? 10.493  131.667 37.563 1.00 22.09 ? 57   PHE B CD2   1 
ATOM   1802 C CE1   . PHE B 1 57  ? 8.777   131.036 39.664 1.00 21.81 ? 57   PHE B CE1   1 
ATOM   1803 C CE2   . PHE B 1 57  ? 10.906  130.785 38.563 1.00 21.62 ? 57   PHE B CE2   1 
ATOM   1804 C CZ    . PHE B 1 57  ? 10.047  130.470 39.615 1.00 21.39 ? 57   PHE B CZ    1 
ATOM   1805 N N     . ALA B 1 58  ? 10.028  135.289 38.658 1.00 26.96 ? 58   ALA B N     1 
ATOM   1806 C CA    . ALA B 1 58  ? 11.178  136.016 39.181 1.00 27.58 ? 58   ALA B CA    1 
ATOM   1807 C C     . ALA B 1 58  ? 12.547  135.373 38.972 1.00 27.68 ? 58   ALA B C     1 
ATOM   1808 O O     . ALA B 1 58  ? 13.341  135.314 39.901 1.00 31.32 ? 58   ALA B O     1 
ATOM   1809 C CB    . ALA B 1 58  ? 10.959  136.303 40.666 1.00 27.35 ? 58   ALA B CB    1 
ATOM   1810 N N     . ALA B 1 59  ? 12.854  134.907 37.773 1.00 27.26 ? 59   ALA B N     1 
ATOM   1811 C CA    . ALA B 1 59  ? 14.155  134.288 37.553 1.00 25.15 ? 59   ALA B CA    1 
ATOM   1812 C C     . ALA B 1 59  ? 14.548  134.284 36.098 1.00 24.58 ? 59   ALA B C     1 
ATOM   1813 O O     . ALA B 1 59  ? 13.693  134.416 35.212 1.00 23.67 ? 59   ALA B O     1 
ATOM   1814 C CB    . ALA B 1 59  ? 14.142  132.863 38.054 1.00 26.25 ? 59   ALA B CB    1 
ATOM   1815 N N     . VAL B 1 60  ? 15.846  134.137 35.858 1.00 22.89 ? 60   VAL B N     1 
ATOM   1816 C CA    . VAL B 1 60  ? 16.360  134.040 34.501 1.00 23.20 ? 60   VAL B CA    1 
ATOM   1817 C C     . VAL B 1 60  ? 16.367  132.547 34.167 1.00 22.52 ? 60   VAL B C     1 
ATOM   1818 O O     . VAL B 1 60  ? 16.782  131.728 34.996 1.00 21.57 ? 60   VAL B O     1 
ATOM   1819 C CB    . VAL B 1 60  ? 17.792  134.601 34.390 1.00 22.45 ? 60   VAL B CB    1 
ATOM   1820 C CG1   . VAL B 1 60  ? 18.413  134.211 33.054 1.00 21.41 ? 60   VAL B CG1   1 
ATOM   1821 C CG2   . VAL B 1 60  ? 17.768  136.115 34.518 1.00 22.97 ? 60   VAL B CG2   1 
ATOM   1822 N N     . ILE B 1 61  ? 15.805  132.198 33.011 1.00 22.44 ? 61   ILE B N     1 
ATOM   1823 C CA    . ILE B 1 61  ? 15.753  130.819 32.548 1.00 22.67 ? 61   ILE B CA    1 
ATOM   1824 C C     . ILE B 1 61  ? 16.941  130.693 31.614 1.00 23.29 ? 61   ILE B C     1 
ATOM   1825 O O     . ILE B 1 61  ? 17.102  131.503 30.699 1.00 23.07 ? 61   ILE B O     1 
ATOM   1826 C CB    . ILE B 1 61  ? 14.481  130.503 31.722 1.00 23.59 ? 61   ILE B CB    1 
ATOM   1827 C CG1   . ILE B 1 61  ? 13.215  131.038 32.398 1.00 25.26 ? 61   ILE B CG1   1 
ATOM   1828 C CG2   . ILE B 1 61  ? 14.365  129.008 31.486 1.00 23.13 ? 61   ILE B CG2   1 
ATOM   1829 C CD1   . ILE B 1 61  ? 12.962  130.541 33.778 1.00 25.63 ? 61   ILE B CD1   1 
ATOM   1830 N N     . MET B 1 62  ? 17.754  129.668 31.823 1.00 22.78 ? 62   MET B N     1 
ATOM   1831 C CA    . MET B 1 62  ? 18.929  129.463 31.007 1.00 22.84 ? 62   MET B CA    1 
ATOM   1832 C C     . MET B 1 62  ? 19.024  127.974 30.712 1.00 22.93 ? 62   MET B C     1 
ATOM   1833 O O     . MET B 1 62  ? 18.541  127.162 31.495 1.00 23.16 ? 62   MET B O     1 
ATOM   1834 C CB    . MET B 1 62  ? 20.146  129.933 31.800 1.00 25.15 ? 62   MET B CB    1 
ATOM   1835 C CG    . MET B 1 62  ? 21.305  130.372 30.960 1.00 28.79 ? 62   MET B CG    1 
ATOM   1836 S SD    . MET B 1 62  ? 22.655  130.898 32.004 1.00 33.48 ? 62   MET B SD    1 
ATOM   1837 C CE    . MET B 1 62  ? 22.328  132.673 32.110 1.00 31.43 ? 62   MET B CE    1 
ATOM   1838 N N     . ARG B 1 63  ? 19.648  127.605 29.599 1.00 23.02 ? 63   ARG B N     1 
ATOM   1839 C CA    . ARG B 1 63  ? 19.787  126.195 29.237 1.00 22.97 ? 63   ARG B CA    1 
ATOM   1840 C C     . ARG B 1 63  ? 21.142  125.871 28.624 1.00 23.64 ? 63   ARG B C     1 
ATOM   1841 O O     . ARG B 1 63  ? 21.786  126.743 28.037 1.00 24.41 ? 63   ARG B O     1 
ATOM   1842 C CB    . ARG B 1 63  ? 18.693  125.793 28.244 1.00 20.65 ? 63   ARG B CB    1 
ATOM   1843 C CG    . ARG B 1 63  ? 17.300  125.865 28.808 1.00 19.56 ? 63   ARG B CG    1 
ATOM   1844 C CD    . ARG B 1 63  ? 16.258  125.391 27.817 1.00 20.41 ? 63   ARG B CD    1 
ATOM   1845 N NE    . ARG B 1 63  ? 14.926  125.398 28.417 1.00 21.46 ? 63   ARG B NE    1 
ATOM   1846 C CZ    . ARG B 1 63  ? 14.084  126.425 28.375 1.00 21.40 ? 63   ARG B CZ    1 
ATOM   1847 N NH1   . ARG B 1 63  ? 14.416  127.547 27.747 1.00 21.79 ? 63   ARG B NH1   1 
ATOM   1848 N NH2   . ARG B 1 63  ? 12.927  126.347 29.012 1.00 20.33 ? 63   ARG B NH2   1 
ATOM   1849 N N     . ILE B 1 64  ? 21.598  124.635 28.819 1.00 23.45 ? 64   ILE B N     1 
ATOM   1850 C CA    . ILE B 1 64  ? 22.853  124.167 28.229 1.00 22.93 ? 64   ILE B CA    1 
ATOM   1851 C C     . ILE B 1 64  ? 22.554  122.810 27.593 1.00 23.07 ? 64   ILE B C     1 
ATOM   1852 O O     . ILE B 1 64  ? 21.592  122.140 27.992 1.00 23.03 ? 64   ILE B O     1 
ATOM   1853 C CB    . ILE B 1 64  ? 24.029  124.053 29.251 1.00 23.81 ? 64   ILE B CB    1 
ATOM   1854 C CG1   . ILE B 1 64  ? 23.737  123.017 30.334 1.00 23.03 ? 64   ILE B CG1   1 
ATOM   1855 C CG2   . ILE B 1 64  ? 24.372  125.427 29.856 1.00 24.66 ? 64   ILE B CG2   1 
ATOM   1856 C CD1   . ILE B 1 64  ? 24.911  122.806 31.269 1.00 21.26 ? 64   ILE B CD1   1 
ATOM   1857 N N     . ARG B 1 65  ? 23.327  122.438 26.573 1.00 22.48 ? 65   ARG B N     1 
ATOM   1858 C CA    . ARG B 1 65  ? 23.131  121.168 25.863 1.00 22.45 ? 65   ARG B CA    1 
ATOM   1859 C C     . ARG B 1 65  ? 23.685  119.934 26.564 1.00 22.88 ? 65   ARG B C     1 
ATOM   1860 O O     . ARG B 1 65  ? 23.122  118.848 26.432 1.00 23.21 ? 65   ARG B O     1 
ATOM   1861 C CB    . ARG B 1 65  ? 23.727  121.221 24.448 1.00 21.33 ? 65   ARG B CB    1 
ATOM   1862 C CG    . ARG B 1 65  ? 22.953  122.059 23.453 1.00 21.33 ? 65   ARG B CG    1 
ATOM   1863 C CD    . ARG B 1 65  ? 23.652  122.078 22.095 1.00 21.80 ? 65   ARG B CD    1 
ATOM   1864 N NE    . ARG B 1 65  ? 23.464  120.839 21.341 1.00 22.35 ? 65   ARG B NE    1 
ATOM   1865 C CZ    . ARG B 1 65  ? 24.240  120.438 20.333 1.00 21.48 ? 65   ARG B CZ    1 
ATOM   1866 N NH1   . ARG B 1 65  ? 25.275  121.171 19.945 1.00 19.53 ? 65   ARG B NH1   1 
ATOM   1867 N NH2   . ARG B 1 65  ? 23.958  119.311 19.693 1.00 22.69 ? 65   ARG B NH2   1 
ATOM   1868 N N     . GLU B 1 66  ? 24.803  120.079 27.267 1.00 22.77 ? 66   GLU B N     1 
ATOM   1869 C CA    . GLU B 1 66  ? 25.419  118.946 27.953 1.00 24.00 ? 66   GLU B CA    1 
ATOM   1870 C C     . GLU B 1 66  ? 25.950  119.308 29.329 1.00 22.85 ? 66   GLU B C     1 
ATOM   1871 O O     . GLU B 1 66  ? 26.785  120.211 29.450 1.00 23.24 ? 66   GLU B O     1 
ATOM   1872 C CB    . GLU B 1 66  ? 26.588  118.390 27.130 1.00 25.59 ? 66   GLU B CB    1 
ATOM   1873 C CG    . GLU B 1 66  ? 26.203  117.746 25.818 1.00 29.84 ? 66   GLU B CG    1 
ATOM   1874 C CD    . GLU B 1 66  ? 25.316  116.527 25.986 1.00 32.77 ? 66   GLU B CD    1 
ATOM   1875 O OE1   . GLU B 1 66  ? 25.401  115.854 27.043 1.00 33.55 ? 66   GLU B OE1   1 
ATOM   1876 O OE2   . GLU B 1 66  ? 24.529  116.245 25.047 1.00 35.00 ? 66   GLU B OE2   1 
ATOM   1877 N N     . PRO B 1 67  ? 25.381  118.710 30.393 1.00 21.90 ? 67   PRO B N     1 
ATOM   1878 C CA    . PRO B 1 67  ? 24.278  117.740 30.365 1.00 20.58 ? 67   PRO B CA    1 
ATOM   1879 C C     . PRO B 1 67  ? 23.030  118.545 30.046 1.00 20.53 ? 67   PRO B C     1 
ATOM   1880 O O     . PRO B 1 67  ? 22.868  119.648 30.571 1.00 21.26 ? 67   PRO B O     1 
ATOM   1881 C CB    . PRO B 1 67  ? 24.221  117.250 31.811 1.00 19.58 ? 67   PRO B CB    1 
ATOM   1882 C CG    . PRO B 1 67  ? 25.604  117.445 32.300 1.00 19.76 ? 67   PRO B CG    1 
ATOM   1883 C CD    . PRO B 1 67  ? 25.944  118.797 31.749 1.00 20.51 ? 67   PRO B CD    1 
ATOM   1884 N N     . LYS B 1 68  ? 22.172  118.038 29.170 1.00 19.44 ? 68   LYS B N     1 
ATOM   1885 C CA    . LYS B 1 68  ? 20.971  118.771 28.798 1.00 19.19 ? 68   LYS B CA    1 
ATOM   1886 C C     . LYS B 1 68  ? 20.144  119.113 30.041 1.00 20.49 ? 68   LYS B C     1 
ATOM   1887 O O     . LYS B 1 68  ? 19.552  118.227 30.676 1.00 20.65 ? 68   LYS B O     1 
ATOM   1888 C CB    . LYS B 1 68  ? 20.146  117.966 27.812 1.00 19.13 ? 68   LYS B CB    1 
ATOM   1889 C CG    . LYS B 1 68  ? 19.002  118.750 27.241 1.00 21.17 ? 68   LYS B CG    1 
ATOM   1890 C CD    . LYS B 1 68  ? 17.956  117.853 26.633 1.00 22.96 ? 68   LYS B CD    1 
ATOM   1891 C CE    . LYS B 1 68  ? 16.805  118.699 26.126 1.00 25.44 ? 68   LYS B CE    1 
ATOM   1892 N NZ    . LYS B 1 68  ? 15.682  117.865 25.617 1.00 29.09 ? 68   LYS B NZ    1 
ATOM   1893 N N     . THR B 1 69  ? 20.102  120.399 30.380 1.00 19.56 ? 69   THR B N     1 
ATOM   1894 C CA    . THR B 1 69  ? 19.389  120.871 31.562 1.00 18.50 ? 69   THR B CA    1 
ATOM   1895 C C     . THR B 1 69  ? 18.841  122.284 31.371 1.00 18.86 ? 69   THR B C     1 
ATOM   1896 O O     . THR B 1 69  ? 19.147  122.951 30.375 1.00 18.69 ? 69   THR B O     1 
ATOM   1897 C CB    . THR B 1 69  ? 20.346  120.937 32.772 1.00 16.61 ? 69   THR B CB    1 
ATOM   1898 O OG1   . THR B 1 69  ? 21.505  121.695 32.410 1.00 16.67 ? 69   THR B OG1   1 
ATOM   1899 C CG2   . THR B 1 69  ? 20.764  119.548 33.229 1.00 15.47 ? 69   THR B CG2   1 
ATOM   1900 N N     . THR B 1 70  ? 18.039  122.724 32.342 1.00 18.02 ? 70   THR B N     1 
ATOM   1901 C CA    . THR B 1 70  ? 17.461  124.067 32.373 1.00 17.52 ? 70   THR B CA    1 
ATOM   1902 C C     . THR B 1 70  ? 17.693  124.604 33.795 1.00 18.22 ? 70   THR B C     1 
ATOM   1903 O O     . THR B 1 70  ? 17.489  123.891 34.776 1.00 18.36 ? 70   THR B O     1 
ATOM   1904 C CB    . THR B 1 70  ? 15.941  124.055 32.063 1.00 16.37 ? 70   THR B CB    1 
ATOM   1905 O OG1   . THR B 1 70  ? 15.728  123.689 30.695 1.00 17.64 ? 70   THR B OG1   1 
ATOM   1906 C CG2   . THR B 1 70  ? 15.323  125.421 32.300 1.00 17.10 ? 70   THR B CG2   1 
ATOM   1907 N N     . ALA B 1 71  ? 18.183  125.830 33.910 1.00 18.52 ? 71   ALA B N     1 
ATOM   1908 C CA    . ALA B 1 71  ? 18.420  126.423 35.221 1.00 18.46 ? 71   ALA B CA    1 
ATOM   1909 C C     . ALA B 1 71  ? 17.491  127.603 35.434 1.00 18.58 ? 71   ALA B C     1 
ATOM   1910 O O     . ALA B 1 71  ? 17.103  128.283 34.476 1.00 18.83 ? 71   ALA B O     1 
ATOM   1911 C CB    . ALA B 1 71  ? 19.872  126.883 35.360 1.00 16.89 ? 71   ALA B CB    1 
ATOM   1912 N N     . LEU B 1 72  ? 17.099  127.804 36.685 1.00 18.41 ? 72   LEU B N     1 
ATOM   1913 C CA    . LEU B 1 72  ? 16.252  128.925 37.072 1.00 18.42 ? 72   LEU B CA    1 
ATOM   1914 C C     . LEU B 1 72  ? 17.164  129.690 38.027 1.00 18.53 ? 72   LEU B C     1 
ATOM   1915 O O     . LEU B 1 72  ? 17.524  129.186 39.086 1.00 17.21 ? 72   LEU B O     1 
ATOM   1916 C CB    . LEU B 1 72  ? 14.997  128.436 37.797 1.00 17.91 ? 72   LEU B CB    1 
ATOM   1917 C CG    . LEU B 1 72  ? 14.105  127.398 37.106 1.00 18.65 ? 72   LEU B CG    1 
ATOM   1918 C CD1   . LEU B 1 72  ? 12.985  126.994 38.035 1.00 19.39 ? 72   LEU B CD1   1 
ATOM   1919 C CD2   . LEU B 1 72  ? 13.530  127.948 35.831 1.00 18.18 ? 72   LEU B CD2   1 
ATOM   1920 N N     . ILE B 1 73  ? 17.612  130.863 37.596 1.00 19.38 ? 73   ILE B N     1 
ATOM   1921 C CA    . ILE B 1 73  ? 18.525  131.694 38.372 1.00 19.52 ? 73   ILE B CA    1 
ATOM   1922 C C     . ILE B 1 73  ? 17.797  132.873 39.021 1.00 20.71 ? 73   ILE B C     1 
ATOM   1923 O O     . ILE B 1 73  ? 17.131  133.659 38.337 1.00 20.31 ? 73   ILE B O     1 
ATOM   1924 C CB    . ILE B 1 73  ? 19.662  132.203 37.457 1.00 19.81 ? 73   ILE B CB    1 
ATOM   1925 C CG1   . ILE B 1 73  ? 20.354  131.009 36.794 1.00 19.04 ? 73   ILE B CG1   1 
ATOM   1926 C CG2   . ILE B 1 73  ? 20.657  133.032 38.251 1.00 20.19 ? 73   ILE B CG2   1 
ATOM   1927 C CD1   . ILE B 1 73  ? 21.435  131.374 35.817 1.00 20.30 ? 73   ILE B CD1   1 
ATOM   1928 N N     . PHE B 1 74  ? 17.951  133.013 40.336 1.00 20.97 ? 74   PHE B N     1 
ATOM   1929 C CA    . PHE B 1 74  ? 17.276  134.080 41.078 1.00 20.70 ? 74   PHE B CA    1 
ATOM   1930 C C     . PHE B 1 74  ? 18.197  135.212 41.544 1.00 20.77 ? 74   PHE B C     1 
ATOM   1931 O O     . PHE B 1 74  ? 19.395  135.013 41.745 1.00 19.67 ? 74   PHE B O     1 
ATOM   1932 C CB    . PHE B 1 74  ? 16.509  133.470 42.262 1.00 20.65 ? 74   PHE B CB    1 
ATOM   1933 C CG    . PHE B 1 74  ? 15.534  132.393 41.855 1.00 19.80 ? 74   PHE B CG    1 
ATOM   1934 C CD1   . PHE B 1 74  ? 15.950  131.072 41.725 1.00 20.32 ? 74   PHE B CD1   1 
ATOM   1935 C CD2   . PHE B 1 74  ? 14.220  132.711 41.537 1.00 19.66 ? 74   PHE B CD2   1 
ATOM   1936 C CE1   . PHE B 1 74  ? 15.071  130.076 41.273 1.00 19.12 ? 74   PHE B CE1   1 
ATOM   1937 C CE2   . PHE B 1 74  ? 13.330  131.726 41.086 1.00 20.29 ? 74   PHE B CE2   1 
ATOM   1938 C CZ    . PHE B 1 74  ? 13.764  130.402 40.953 1.00 19.45 ? 74   PHE B CZ    1 
ATOM   1939 N N     . ALA B 1 75  ? 17.620  136.397 41.723 1.00 21.25 ? 75   ALA B N     1 
ATOM   1940 C CA    . ALA B 1 75  ? 18.357  137.580 42.169 1.00 22.89 ? 75   ALA B CA    1 
ATOM   1941 C C     . ALA B 1 75  ? 19.094  137.372 43.495 1.00 24.39 ? 75   ALA B C     1 
ATOM   1942 O O     . ALA B 1 75  ? 20.101  138.046 43.776 1.00 25.21 ? 75   ALA B O     1 
ATOM   1943 C CB    . ALA B 1 75  ? 17.414  138.758 42.288 1.00 21.70 ? 75   ALA B CB    1 
ATOM   1944 N N     . SER B 1 76  ? 18.585  136.449 44.307 1.00 25.25 ? 76   SER B N     1 
ATOM   1945 C CA    . SER B 1 76  ? 19.170  136.136 45.607 1.00 25.65 ? 76   SER B CA    1 
ATOM   1946 C C     . SER B 1 76  ? 20.452  135.321 45.500 1.00 25.83 ? 76   SER B C     1 
ATOM   1947 O O     . SER B 1 76  ? 21.180  135.170 46.480 1.00 27.14 ? 76   SER B O     1 
ATOM   1948 C CB    . SER B 1 76  ? 18.160  135.357 46.450 1.00 25.39 ? 76   SER B CB    1 
ATOM   1949 O OG    . SER B 1 76  ? 17.834  134.116 45.841 1.00 24.94 ? 76   SER B OG    1 
ATOM   1950 N N     . GLY B 1 77  ? 20.714  134.777 44.318 1.00 25.13 ? 77   GLY B N     1 
ATOM   1951 C CA    . GLY B 1 77  ? 21.896  133.959 44.129 1.00 24.09 ? 77   GLY B CA    1 
ATOM   1952 C C     . GLY B 1 77  ? 21.555  132.480 44.169 1.00 22.98 ? 77   GLY B C     1 
ATOM   1953 O O     . GLY B 1 77  ? 22.402  131.631 43.928 1.00 22.42 ? 77   GLY B O     1 
ATOM   1954 N N     . LYS B 1 78  ? 20.321  132.162 44.529 1.00 23.74 ? 78   LYS B N     1 
ATOM   1955 C CA    . LYS B 1 78  ? 19.893  130.770 44.566 1.00 24.19 ? 78   LYS B CA    1 
ATOM   1956 C C     . LYS B 1 78  ? 19.644  130.307 43.126 1.00 23.76 ? 78   LYS B C     1 
ATOM   1957 O O     . LYS B 1 78  ? 19.218  131.097 42.272 1.00 23.09 ? 78   LYS B O     1 
ATOM   1958 C CB    . LYS B 1 78  ? 18.599  130.610 45.380 1.00 24.44 ? 78   LYS B CB    1 
ATOM   1959 C CG    . LYS B 1 78  ? 18.696  131.013 46.840 1.00 24.85 ? 78   LYS B CG    1 
ATOM   1960 C CD    . LYS B 1 78  ? 19.823  130.281 47.533 1.00 26.03 ? 78   LYS B CD    1 
ATOM   1961 C CE    . LYS B 1 78  ? 19.776  130.475 49.046 1.00 26.95 ? 78   LYS B CE    1 
ATOM   1962 N NZ    . LYS B 1 78  ? 18.623  129.774 49.670 1.00 27.89 ? 78   LYS B NZ    1 
ATOM   1963 N N     . MET B 1 79  ? 19.910  129.031 42.860 1.00 22.95 ? 79   MET B N     1 
ATOM   1964 C CA    . MET B 1 79  ? 19.696  128.466 41.535 1.00 22.33 ? 79   MET B CA    1 
ATOM   1965 C C     . MET B 1 79  ? 19.115  127.058 41.587 1.00 20.32 ? 79   MET B C     1 
ATOM   1966 O O     . MET B 1 79  ? 19.482  126.241 42.434 1.00 20.05 ? 79   MET B O     1 
ATOM   1967 C CB    . MET B 1 79  ? 21.001  128.460 40.740 1.00 22.68 ? 79   MET B CB    1 
ATOM   1968 C CG    . MET B 1 79  ? 20.944  127.633 39.475 1.00 22.28 ? 79   MET B CG    1 
ATOM   1969 S SD    . MET B 1 79  ? 22.439  127.821 38.510 1.00 26.34 ? 79   MET B SD    1 
ATOM   1970 C CE    . MET B 1 79  ? 23.511  126.604 39.247 1.00 23.62 ? 79   MET B CE    1 
ATOM   1971 N N     . VAL B 1 80  ? 18.166  126.805 40.697 1.00 18.36 ? 80   VAL B N     1 
ATOM   1972 C CA    . VAL B 1 80  ? 17.530  125.506 40.579 1.00 17.16 ? 80   VAL B CA    1 
ATOM   1973 C C     . VAL B 1 80  ? 17.986  124.930 39.246 1.00 16.93 ? 80   VAL B C     1 
ATOM   1974 O O     . VAL B 1 80  ? 18.006  125.638 38.235 1.00 17.50 ? 80   VAL B O     1 
ATOM   1975 C CB    . VAL B 1 80  ? 15.995  125.625 40.567 1.00 16.86 ? 80   VAL B CB    1 
ATOM   1976 C CG1   . VAL B 1 80  ? 15.355  124.248 40.328 1.00 14.91 ? 80   VAL B CG1   1 
ATOM   1977 C CG2   . VAL B 1 80  ? 15.506  126.232 41.884 1.00 17.56 ? 80   VAL B CG2   1 
ATOM   1978 N N     . CYS B 1 81  ? 18.380  123.661 39.251 1.00 16.41 ? 81   CYS B N     1 
ATOM   1979 C CA    . CYS B 1 81  ? 18.827  122.986 38.035 1.00 17.27 ? 81   CYS B CA    1 
ATOM   1980 C C     . CYS B 1 81  ? 17.889  121.807 37.772 1.00 14.77 ? 81   CYS B C     1 
ATOM   1981 O O     . CYS B 1 81  ? 17.660  120.995 38.667 1.00 17.12 ? 81   CYS B O     1 
ATOM   1982 C CB    . CYS B 1 81  ? 20.266  122.506 38.210 1.00 16.18 ? 81   CYS B CB    1 
ATOM   1983 S SG    . CYS B 1 81  ? 20.912  121.650 36.794 1.00 17.55 ? 81   CYS B SG    1 
ATOM   1984 N N     . THR B 1 82  ? 17.326  121.726 36.568 1.00 12.58 ? 82   THR B N     1 
ATOM   1985 C CA    . THR B 1 82  ? 16.397  120.655 36.233 1.00 12.64 ? 82   THR B CA    1 
ATOM   1986 C C     . THR B 1 82  ? 16.722  119.936 34.930 1.00 11.00 ? 82   THR B C     1 
ATOM   1987 O O     . THR B 1 82  ? 17.431  120.467 34.082 1.00 8.63  ? 82   THR B O     1 
ATOM   1988 C CB    . THR B 1 82  ? 14.956  121.184 36.086 1.00 12.85 ? 82   THR B CB    1 
ATOM   1989 O OG1   . THR B 1 82  ? 14.900  122.129 35.007 1.00 10.30 ? 82   THR B OG1   1 
ATOM   1990 C CG2   . THR B 1 82  ? 14.480  121.848 37.376 1.00 13.22 ? 82   THR B CG2   1 
ATOM   1991 N N     . GLY B 1 83  ? 16.159  118.740 34.767 1.00 12.99 ? 83   GLY B N     1 
ATOM   1992 C CA    . GLY B 1 83  ? 16.336  117.969 33.543 1.00 14.97 ? 83   GLY B CA    1 
ATOM   1993 C C     . GLY B 1 83  ? 17.428  116.919 33.407 1.00 15.89 ? 83   GLY B C     1 
ATOM   1994 O O     . GLY B 1 83  ? 17.358  116.085 32.504 1.00 15.32 ? 83   GLY B O     1 
ATOM   1995 N N     . ALA B 1 84  ? 18.454  116.970 34.251 1.00 17.34 ? 84   ALA B N     1 
ATOM   1996 C CA    . ALA B 1 84  ? 19.554  115.999 34.170 1.00 17.90 ? 84   ALA B CA    1 
ATOM   1997 C C     . ALA B 1 84  ? 19.065  114.580 34.412 1.00 18.81 ? 84   ALA B C     1 
ATOM   1998 O O     . ALA B 1 84  ? 18.036  114.367 35.063 1.00 18.11 ? 84   ALA B O     1 
ATOM   1999 C CB    . ALA B 1 84  ? 20.638  116.348 35.168 1.00 17.56 ? 84   ALA B CB    1 
ATOM   2000 N N     . LYS B 1 85  ? 19.829  113.607 33.933 1.00 19.07 ? 85   LYS B N     1 
ATOM   2001 C CA    . LYS B 1 85  ? 19.462  112.201 34.091 1.00 21.73 ? 85   LYS B CA    1 
ATOM   2002 C C     . LYS B 1 85  ? 20.076  111.507 35.312 1.00 21.47 ? 85   LYS B C     1 
ATOM   2003 O O     . LYS B 1 85  ? 19.783  110.334 35.571 1.00 22.36 ? 85   LYS B O     1 
ATOM   2004 C CB    . LYS B 1 85  ? 19.791  111.415 32.818 1.00 22.65 ? 85   LYS B CB    1 
ATOM   2005 C CG    . LYS B 1 85  ? 18.947  111.812 31.619 1.00 23.95 ? 85   LYS B CG    1 
ATOM   2006 C CD    . LYS B 1 85  ? 17.459  111.617 31.900 1.00 25.57 ? 85   LYS B CD    1 
ATOM   2007 C CE    . LYS B 1 85  ? 16.617  111.857 30.640 1.00 25.99 ? 85   LYS B CE    1 
ATOM   2008 N NZ    . LYS B 1 85  ? 15.164  111.643 30.857 1.00 24.78 ? 85   LYS B NZ    1 
ATOM   2009 N N     . SER B 1 86  ? 20.928  112.214 36.050 1.00 20.01 ? 86   SER B N     1 
ATOM   2010 C CA    . SER B 1 86  ? 21.542  111.637 37.237 1.00 18.92 ? 86   SER B CA    1 
ATOM   2011 C C     . SER B 1 86  ? 21.997  112.744 38.154 1.00 18.52 ? 86   SER B C     1 
ATOM   2012 O O     . SER B 1 86  ? 22.075  113.907 37.754 1.00 18.45 ? 86   SER B O     1 
ATOM   2013 C CB    . SER B 1 86  ? 22.734  110.744 36.877 1.00 17.70 ? 86   SER B CB    1 
ATOM   2014 O OG    . SER B 1 86  ? 23.902  111.513 36.682 1.00 17.74 ? 86   SER B OG    1 
ATOM   2015 N N     . GLU B 1 87  ? 22.349  112.362 39.373 1.00 18.11 ? 87   GLU B N     1 
ATOM   2016 C CA    . GLU B 1 87  ? 22.804  113.295 40.394 1.00 17.97 ? 87   GLU B CA    1 
ATOM   2017 C C     . GLU B 1 87  ? 24.126  113.941 39.970 1.00 17.25 ? 87   GLU B C     1 
ATOM   2018 O O     . GLU B 1 87  ? 24.298  115.152 40.113 1.00 17.97 ? 87   GLU B O     1 
ATOM   2019 C CB    . GLU B 1 87  ? 22.950  112.570 41.745 1.00 18.30 ? 87   GLU B CB    1 
ATOM   2020 C CG    . GLU B 1 87  ? 21.675  111.888 42.267 1.00 19.60 ? 87   GLU B CG    1 
ATOM   2021 C CD    . GLU B 1 87  ? 21.531  110.426 41.838 1.00 20.89 ? 87   GLU B CD    1 
ATOM   2022 O OE1   . GLU B 1 87  ? 21.741  110.102 40.654 1.00 21.61 ? 87   GLU B OE1   1 
ATOM   2023 O OE2   . GLU B 1 87  ? 21.179  109.586 42.691 1.00 22.33 ? 87   GLU B OE2   1 
ATOM   2024 N N     . ASP B 1 88  ? 25.039  113.137 39.422 1.00 17.28 ? 88   ASP B N     1 
ATOM   2025 C CA    . ASP B 1 88  ? 26.336  113.626 38.956 1.00 17.10 ? 88   ASP B CA    1 
ATOM   2026 C C     . ASP B 1 88  ? 26.158  114.630 37.827 1.00 17.23 ? 88   ASP B C     1 
ATOM   2027 O O     . ASP B 1 88  ? 26.796  115.686 37.819 1.00 17.08 ? 88   ASP B O     1 
ATOM   2028 C CB    . ASP B 1 88  ? 27.220  112.478 38.464 1.00 17.60 ? 88   ASP B CB    1 
ATOM   2029 C CG    . ASP B 1 88  ? 27.791  111.641 39.596 1.00 18.50 ? 88   ASP B CG    1 
ATOM   2030 O OD1   . ASP B 1 88  ? 27.709  112.055 40.771 1.00 17.75 ? 88   ASP B OD1   1 
ATOM   2031 O OD2   . ASP B 1 88  ? 28.333  110.559 39.298 1.00 18.33 ? 88   ASP B OD2   1 
ATOM   2032 N N     . PHE B 1 89  ? 25.308  114.282 36.866 1.00 16.46 ? 89   PHE B N     1 
ATOM   2033 C CA    . PHE B 1 89  ? 25.016  115.152 35.739 1.00 17.07 ? 89   PHE B CA    1 
ATOM   2034 C C     . PHE B 1 89  ? 24.355  116.450 36.203 1.00 17.11 ? 89   PHE B C     1 
ATOM   2035 O O     . PHE B 1 89  ? 24.666  117.531 35.704 1.00 16.80 ? 89   PHE B O     1 
ATOM   2036 C CB    . PHE B 1 89  ? 24.118  114.434 34.743 1.00 17.43 ? 89   PHE B CB    1 
ATOM   2037 C CG    . PHE B 1 89  ? 24.840  113.452 33.879 1.00 18.92 ? 89   PHE B CG    1 
ATOM   2038 C CD1   . PHE B 1 89  ? 26.123  113.721 33.429 1.00 19.69 ? 89   PHE B CD1   1 
ATOM   2039 C CD2   . PHE B 1 89  ? 24.225  112.274 33.488 1.00 20.58 ? 89   PHE B CD2   1 
ATOM   2040 C CE1   . PHE B 1 89  ? 26.784  112.834 32.603 1.00 20.24 ? 89   PHE B CE1   1 
ATOM   2041 C CE2   . PHE B 1 89  ? 24.873  111.378 32.662 1.00 21.10 ? 89   PHE B CE2   1 
ATOM   2042 C CZ    . PHE B 1 89  ? 26.155  111.657 32.217 1.00 21.34 ? 89   PHE B CZ    1 
ATOM   2043 N N     . SER B 1 90  ? 23.459  116.345 37.174 1.00 17.07 ? 90   SER B N     1 
ATOM   2044 C CA    . SER B 1 90  ? 22.784  117.521 37.696 1.00 17.94 ? 90   SER B CA    1 
ATOM   2045 C C     . SER B 1 90  ? 23.802  118.467 38.334 1.00 19.36 ? 90   SER B C     1 
ATOM   2046 O O     . SER B 1 90  ? 23.764  119.679 38.095 1.00 19.95 ? 90   SER B O     1 
ATOM   2047 C CB    . SER B 1 90  ? 21.725  117.122 38.709 1.00 16.09 ? 90   SER B CB    1 
ATOM   2048 O OG    . SER B 1 90  ? 20.945  118.242 39.053 1.00 16.54 ? 90   SER B OG    1 
ATOM   2049 N N     . LYS B 1 91  ? 24.732  117.912 39.111 1.00 19.30 ? 91   LYS B N     1 
ATOM   2050 C CA    . LYS B 1 91  ? 25.757  118.720 39.765 1.00 20.41 ? 91   LYS B CA    1 
ATOM   2051 C C     . LYS B 1 91  ? 26.710  119.346 38.748 1.00 20.70 ? 91   LYS B C     1 
ATOM   2052 O O     . LYS B 1 91  ? 27.036  120.531 38.842 1.00 20.70 ? 91   LYS B O     1 
ATOM   2053 C CB    . LYS B 1 91  ? 26.538  117.878 40.779 1.00 22.03 ? 91   LYS B CB    1 
ATOM   2054 C CG    . LYS B 1 91  ? 27.509  118.670 41.644 1.00 23.59 ? 91   LYS B CG    1 
ATOM   2055 C CD    . LYS B 1 91  ? 28.115  117.774 42.711 1.00 23.68 ? 91   LYS B CD    1 
ATOM   2056 C CE    . LYS B 1 91  ? 28.860  118.584 43.751 1.00 27.81 ? 91   LYS B CE    1 
ATOM   2057 N NZ    . LYS B 1 91  ? 29.186  117.770 44.978 1.00 30.41 ? 91   LYS B NZ    1 
ATOM   2058 N N     . MET B 1 92  ? 27.131  118.561 37.761 1.00 21.40 ? 92   MET B N     1 
ATOM   2059 C CA    . MET B 1 92  ? 28.032  119.058 36.728 1.00 23.73 ? 92   MET B CA    1 
ATOM   2060 C C     . MET B 1 92  ? 27.357  120.208 35.977 1.00 23.77 ? 92   MET B C     1 
ATOM   2061 O O     . MET B 1 92  ? 27.981  121.253 35.741 1.00 23.57 ? 92   MET B O     1 
ATOM   2062 C CB    A MET B 1 92  ? 28.393  117.925 35.761 0.50 24.97 ? 92   MET B CB    1 
ATOM   2063 C CB    B MET B 1 92  ? 28.426  117.935 35.770 0.50 24.81 ? 92   MET B CB    1 
ATOM   2064 C CG    A MET B 1 92  ? 28.833  118.369 34.363 0.50 28.87 ? 92   MET B CG    1 
ATOM   2065 C CG    B MET B 1 92  ? 29.553  118.294 34.805 0.50 28.64 ? 92   MET B CG    1 
ATOM   2066 S SD    A MET B 1 92  ? 30.343  119.385 34.304 0.50 33.85 ? 92   MET B SD    1 
ATOM   2067 S SD    B MET B 1 92  ? 31.136  118.727 35.603 0.50 31.87 ? 92   MET B SD    1 
ATOM   2068 C CE    A MET B 1 92  ? 31.531  118.194 33.700 0.50 31.85 ? 92   MET B CE    1 
ATOM   2069 C CE    B MET B 1 92  ? 31.269  120.491 35.207 0.50 30.52 ? 92   MET B CE    1 
ATOM   2070 N N     . ALA B 1 93  ? 26.074  120.034 35.645 1.00 22.06 ? 93   ALA B N     1 
ATOM   2071 C CA    . ALA B 1 93  ? 25.314  121.072 34.945 1.00 21.49 ? 93   ALA B CA    1 
ATOM   2072 C C     . ALA B 1 93  ? 25.286  122.338 35.796 1.00 21.40 ? 93   ALA B C     1 
ATOM   2073 O O     . ALA B 1 93  ? 25.556  123.434 35.303 1.00 21.30 ? 93   ALA B O     1 
ATOM   2074 C CB    . ALA B 1 93  ? 23.894  120.599 34.662 1.00 20.51 ? 93   ALA B CB    1 
ATOM   2075 N N     . ALA B 1 94  ? 24.971  122.180 37.079 1.00 20.89 ? 94   ALA B N     1 
ATOM   2076 C CA    . ALA B 1 94  ? 24.934  123.306 38.001 1.00 21.49 ? 94   ALA B CA    1 
ATOM   2077 C C     . ALA B 1 94  ? 26.288  124.028 38.013 1.00 22.44 ? 94   ALA B C     1 
ATOM   2078 O O     . ALA B 1 94  ? 26.349  125.261 38.032 1.00 21.33 ? 94   ALA B O     1 
ATOM   2079 C CB    . ALA B 1 94  ? 24.573  122.829 39.403 1.00 20.81 ? 94   ALA B CB    1 
ATOM   2080 N N     . ARG B 1 95  ? 27.375  123.262 37.984 1.00 23.67 ? 95   ARG B N     1 
ATOM   2081 C CA    . ARG B 1 95  ? 28.695  123.866 37.989 1.00 26.03 ? 95   ARG B CA    1 
ATOM   2082 C C     . ARG B 1 95  ? 28.906  124.694 36.735 1.00 25.85 ? 95   ARG B C     1 
ATOM   2083 O O     . ARG B 1 95  ? 29.499  125.772 36.792 1.00 26.54 ? 95   ARG B O     1 
ATOM   2084 C CB    . ARG B 1 95  ? 29.793  122.815 38.153 1.00 28.51 ? 95   ARG B CB    1 
ATOM   2085 C CG    . ARG B 1 95  ? 29.903  122.291 39.577 1.00 32.52 ? 95   ARG B CG    1 
ATOM   2086 C CD    . ARG B 1 95  ? 31.237  121.601 39.849 1.00 37.74 ? 95   ARG B CD    1 
ATOM   2087 N NE    . ARG B 1 95  ? 31.274  121.079 41.215 1.00 42.78 ? 95   ARG B NE    1 
ATOM   2088 C CZ    . ARG B 1 95  ? 31.686  121.769 42.281 1.00 45.43 ? 95   ARG B CZ    1 
ATOM   2089 N NH1   . ARG B 1 95  ? 32.120  123.023 42.148 1.00 46.14 ? 95   ARG B NH1   1 
ATOM   2090 N NH2   . ARG B 1 95  ? 31.618  121.224 43.496 1.00 45.54 ? 95   ARG B NH2   1 
ATOM   2091 N N     . LYS B 1 96  ? 28.384  124.217 35.611 1.00 25.69 ? 96   LYS B N     1 
ATOM   2092 C CA    . LYS B 1 96  ? 28.512  124.949 34.357 1.00 25.82 ? 96   LYS B CA    1 
ATOM   2093 C C     . LYS B 1 96  ? 27.770  126.274 34.422 1.00 25.01 ? 96   LYS B C     1 
ATOM   2094 O O     . LYS B 1 96  ? 28.317  127.297 34.022 1.00 25.56 ? 96   LYS B O     1 
ATOM   2095 C CB    . LYS B 1 96  ? 28.041  124.108 33.172 1.00 26.58 ? 96   LYS B CB    1 
ATOM   2096 C CG    . LYS B 1 96  ? 28.841  122.832 33.029 1.00 28.83 ? 96   LYS B CG    1 
ATOM   2097 C CD    . LYS B 1 96  ? 28.516  122.076 31.765 1.00 31.34 ? 96   LYS B CD    1 
ATOM   2098 C CE    . LYS B 1 96  ? 29.346  120.814 31.719 1.00 33.98 ? 96   LYS B CE    1 
ATOM   2099 N NZ    . LYS B 1 96  ? 29.501  120.262 30.338 1.00 38.22 ? 96   LYS B NZ    1 
ATOM   2100 N N     . TYR B 1 97  ? 26.548  126.277 34.951 1.00 23.88 ? 97   TYR B N     1 
ATOM   2101 C CA    . TYR B 1 97  ? 25.794  127.527 35.070 1.00 22.93 ? 97   TYR B CA    1 
ATOM   2102 C C     . TYR B 1 97  ? 26.502  128.500 36.016 1.00 24.08 ? 97   TYR B C     1 
ATOM   2103 O O     . TYR B 1 97  ? 26.537  129.704 35.753 1.00 24.88 ? 97   TYR B O     1 
ATOM   2104 C CB    . TYR B 1 97  ? 24.376  127.284 35.576 1.00 20.46 ? 97   TYR B CB    1 
ATOM   2105 C CG    . TYR B 1 97  ? 23.500  126.530 34.615 1.00 19.31 ? 97   TYR B CG    1 
ATOM   2106 C CD1   . TYR B 1 97  ? 23.093  127.108 33.417 1.00 18.59 ? 97   TYR B CD1   1 
ATOM   2107 C CD2   . TYR B 1 97  ? 23.063  125.240 34.908 1.00 18.05 ? 97   TYR B CD2   1 
ATOM   2108 C CE1   . TYR B 1 97  ? 22.266  126.418 32.529 1.00 19.07 ? 97   TYR B CE1   1 
ATOM   2109 C CE2   . TYR B 1 97  ? 22.241  124.543 34.032 1.00 17.87 ? 97   TYR B CE2   1 
ATOM   2110 C CZ    . TYR B 1 97  ? 21.844  125.137 32.842 1.00 18.74 ? 97   TYR B CZ    1 
ATOM   2111 O OH    . TYR B 1 97  ? 21.032  124.447 31.970 1.00 17.19 ? 97   TYR B OH    1 
ATOM   2112 N N     . ALA B 1 98  ? 27.065  127.987 37.109 1.00 24.00 ? 98   ALA B N     1 
ATOM   2113 C CA    . ALA B 1 98  ? 27.769  128.833 38.071 1.00 25.33 ? 98   ALA B CA    1 
ATOM   2114 C C     . ALA B 1 98  ? 28.925  129.556 37.377 1.00 27.29 ? 98   ALA B C     1 
ATOM   2115 O O     . ALA B 1 98  ? 29.166  130.741 37.617 1.00 26.86 ? 98   ALA B O     1 
ATOM   2116 C CB    . ALA B 1 98  ? 28.288  127.997 39.222 1.00 23.92 ? 98   ALA B CB    1 
ATOM   2117 N N     . ARG B 1 99  ? 29.616  128.830 36.497 1.00 29.74 ? 99   ARG B N     1 
ATOM   2118 C CA    . ARG B 1 99  ? 30.753  129.351 35.736 1.00 31.09 ? 99   ARG B CA    1 
ATOM   2119 C C     . ARG B 1 99  ? 30.289  130.412 34.753 1.00 30.54 ? 99   ARG B C     1 
ATOM   2120 O O     . ARG B 1 99  ? 30.949  131.428 34.576 1.00 30.79 ? 99   ARG B O     1 
ATOM   2121 C CB    . ARG B 1 99  ? 31.437  128.218 34.972 1.00 34.02 ? 99   ARG B CB    1 
ATOM   2122 C CG    . ARG B 1 99  ? 32.770  128.597 34.391 1.00 39.22 ? 99   ARG B CG    1 
ATOM   2123 C CD    . ARG B 1 99  ? 33.795  128.836 35.488 1.00 43.26 ? 99   ARG B CD    1 
ATOM   2124 N NE    . ARG B 1 99  ? 35.006  129.438 34.936 1.00 48.04 ? 99   ARG B NE    1 
ATOM   2125 C CZ    . ARG B 1 99  ? 35.117  130.726 34.622 1.00 49.45 ? 99   ARG B CZ    1 
ATOM   2126 N NH1   . ARG B 1 99  ? 34.091  131.544 34.818 1.00 51.38 ? 99   ARG B NH1   1 
ATOM   2127 N NH2   . ARG B 1 99  ? 36.237  131.193 34.077 1.00 49.81 ? 99   ARG B NH2   1 
ATOM   2128 N N     . ILE B 1 100 ? 29.172  130.154 34.082 1.00 29.62 ? 100  ILE B N     1 
ATOM   2129 C CA    . ILE B 1 100 ? 28.616  131.114 33.141 1.00 29.32 ? 100  ILE B CA    1 
ATOM   2130 C C     . ILE B 1 100 ? 28.388  132.427 33.896 1.00 30.57 ? 100  ILE B C     1 
ATOM   2131 O O     . ILE B 1 100 ? 28.819  133.491 33.447 1.00 31.58 ? 100  ILE B O     1 
ATOM   2132 C CB    . ILE B 1 100 ? 27.269  130.608 32.549 1.00 28.28 ? 100  ILE B CB    1 
ATOM   2133 C CG1   . ILE B 1 100 ? 27.530  129.476 31.556 1.00 28.22 ? 100  ILE B CG1   1 
ATOM   2134 C CG2   . ILE B 1 100 ? 26.503  131.747 31.872 1.00 25.70 ? 100  ILE B CG2   1 
ATOM   2135 C CD1   . ILE B 1 100 ? 26.273  128.743 31.111 1.00 27.94 ? 100  ILE B CD1   1 
ATOM   2136 N N     . VAL B 1 101 ? 27.749  132.340 35.063 1.00 30.50 ? 101  VAL B N     1 
ATOM   2137 C CA    . VAL B 1 101 ? 27.458  133.517 35.876 1.00 30.17 ? 101  VAL B CA    1 
ATOM   2138 C C     . VAL B 1 101 ? 28.757  134.208 36.293 1.00 30.49 ? 101  VAL B C     1 
ATOM   2139 O O     . VAL B 1 101 ? 28.851  135.439 36.261 1.00 30.20 ? 101  VAL B O     1 
ATOM   2140 C CB    . VAL B 1 101 ? 26.570  133.154 37.110 1.00 29.37 ? 101  VAL B CB    1 
ATOM   2141 C CG1   . VAL B 1 101 ? 26.411  134.350 38.033 1.00 27.62 ? 101  VAL B CG1   1 
ATOM   2142 C CG2   . VAL B 1 101 ? 25.185  132.687 36.638 1.00 26.65 ? 101  VAL B CG2   1 
ATOM   2143 N N     . GLN B 1 102 ? 29.762  133.417 36.652 1.00 31.64 ? 102  GLN B N     1 
ATOM   2144 C CA    . GLN B 1 102 ? 31.060  133.964 37.037 1.00 33.84 ? 102  GLN B CA    1 
ATOM   2145 C C     . GLN B 1 102 ? 31.619  134.776 35.872 1.00 34.78 ? 102  GLN B C     1 
ATOM   2146 O O     . GLN B 1 102 ? 32.000  135.936 36.040 1.00 35.79 ? 102  GLN B O     1 
ATOM   2147 C CB    . GLN B 1 102 ? 32.048  132.847 37.367 1.00 33.84 ? 102  GLN B CB    1 
ATOM   2148 C CG    . GLN B 1 102 ? 32.116  132.457 38.817 1.00 35.91 ? 102  GLN B CG    1 
ATOM   2149 C CD    . GLN B 1 102 ? 32.957  131.210 39.025 1.00 38.40 ? 102  GLN B CD    1 
ATOM   2150 O OE1   . GLN B 1 102 ? 33.750  130.825 38.162 1.00 38.82 ? 102  GLN B OE1   1 
ATOM   2151 N NE2   . GLN B 1 102 ? 32.761  130.551 40.154 1.00 40.17 ? 102  GLN B NE2   1 
ATOM   2152 N N     . LYS B 1 103 ? 31.647  134.164 34.689 1.00 34.99 ? 103  LYS B N     1 
ATOM   2153 C CA    . LYS B 1 103 ? 32.157  134.815 33.490 1.00 35.11 ? 103  LYS B CA    1 
ATOM   2154 C C     . LYS B 1 103 ? 31.406  136.084 33.118 1.00 35.05 ? 103  LYS B C     1 
ATOM   2155 O O     . LYS B 1 103 ? 31.899  136.879 32.321 1.00 35.92 ? 103  LYS B O     1 
ATOM   2156 C CB    . LYS B 1 103 ? 32.172  133.845 32.317 1.00 35.93 ? 103  LYS B CB    1 
ATOM   2157 C CG    . LYS B 1 103 ? 33.296  132.845 32.401 1.00 37.46 ? 103  LYS B CG    1 
ATOM   2158 C CD    . LYS B 1 103 ? 33.242  131.856 31.260 1.00 40.08 ? 103  LYS B CD    1 
ATOM   2159 C CE    . LYS B 1 103 ? 34.365  130.842 31.366 1.00 40.59 ? 103  LYS B CE    1 
ATOM   2160 N NZ    . LYS B 1 103 ? 34.262  129.803 30.300 1.00 42.96 ? 103  LYS B NZ    1 
ATOM   2161 N N     . LEU B 1 104 ? 30.214  136.268 33.680 1.00 33.74 ? 104  LEU B N     1 
ATOM   2162 C CA    . LEU B 1 104 ? 29.428  137.469 33.424 1.00 33.22 ? 104  LEU B CA    1 
ATOM   2163 C C     . LEU B 1 104 ? 29.807  138.555 34.430 1.00 33.43 ? 104  LEU B C     1 
ATOM   2164 O O     . LEU B 1 104 ? 29.197  139.625 34.465 1.00 33.38 ? 104  LEU B O     1 
ATOM   2165 C CB    . LEU B 1 104 ? 27.928  137.184 33.504 1.00 32.98 ? 104  LEU B CB    1 
ATOM   2166 C CG    . LEU B 1 104 ? 27.266  136.371 32.389 1.00 31.58 ? 104  LEU B CG    1 
ATOM   2167 C CD1   . LEU B 1 104 ? 25.810  136.184 32.732 1.00 31.98 ? 104  LEU B CD1   1 
ATOM   2168 C CD2   . LEU B 1 104 ? 27.405  137.071 31.053 1.00 31.28 ? 104  LEU B CD2   1 
ATOM   2169 N N     . GLY B 1 105 ? 30.786  138.260 35.275 1.00 32.76 ? 105  GLY B N     1 
ATOM   2170 C CA    . GLY B 1 105 ? 31.242  139.238 36.237 1.00 34.11 ? 105  GLY B CA    1 
ATOM   2171 C C     . GLY B 1 105 ? 30.792  139.105 37.678 1.00 35.16 ? 105  GLY B C     1 
ATOM   2172 O O     . GLY B 1 105 ? 31.195  139.912 38.522 1.00 37.07 ? 105  GLY B O     1 
ATOM   2173 N N     . PHE B 1 106 ? 29.957  138.121 37.985 1.00 34.34 ? 106  PHE B N     1 
ATOM   2174 C CA    . PHE B 1 106 ? 29.504  137.953 39.361 1.00 32.52 ? 106  PHE B CA    1 
ATOM   2175 C C     . PHE B 1 106 ? 30.388  136.940 40.071 1.00 32.77 ? 106  PHE B C     1 
ATOM   2176 O O     . PHE B 1 106 ? 30.776  135.928 39.482 1.00 32.65 ? 106  PHE B O     1 
ATOM   2177 C CB    . PHE B 1 106 ? 28.045  137.511 39.384 1.00 31.45 ? 106  PHE B CB    1 
ATOM   2178 C CG    . PHE B 1 106 ? 27.123  138.455 38.670 1.00 29.70 ? 106  PHE B CG    1 
ATOM   2179 C CD1   . PHE B 1 106 ? 26.859  138.295 37.317 1.00 29.31 ? 106  PHE B CD1   1 
ATOM   2180 C CD2   . PHE B 1 106 ? 26.516  139.501 39.351 1.00 29.03 ? 106  PHE B CD2   1 
ATOM   2181 C CE1   . PHE B 1 106 ? 26.006  139.160 36.654 1.00 29.16 ? 106  PHE B CE1   1 
ATOM   2182 C CE2   . PHE B 1 106 ? 25.658  140.373 38.694 1.00 28.92 ? 106  PHE B CE2   1 
ATOM   2183 C CZ    . PHE B 1 106 ? 25.402  140.203 37.345 1.00 29.28 ? 106  PHE B CZ    1 
ATOM   2184 N N     . PRO B 1 107 ? 30.742  137.210 41.340 1.00 33.15 ? 107  PRO B N     1 
ATOM   2185 C CA    . PRO B 1 107 ? 31.591  136.342 42.166 1.00 34.12 ? 107  PRO B CA    1 
ATOM   2186 C C     . PRO B 1 107 ? 30.817  135.123 42.670 1.00 33.76 ? 107  PRO B C     1 
ATOM   2187 O O     . PRO B 1 107 ? 30.726  134.880 43.879 1.00 33.68 ? 107  PRO B O     1 
ATOM   2188 C CB    . PRO B 1 107 ? 31.994  137.274 43.315 1.00 33.60 ? 107  PRO B CB    1 
ATOM   2189 C CG    . PRO B 1 107 ? 30.757  138.066 43.522 1.00 33.97 ? 107  PRO B CG    1 
ATOM   2190 C CD    . PRO B 1 107 ? 30.343  138.411 42.099 1.00 34.31 ? 107  PRO B CD    1 
ATOM   2191 N N     . ALA B 1 108 ? 30.269  134.359 41.734 1.00 34.19 ? 108  ALA B N     1 
ATOM   2192 C CA    . ALA B 1 108 ? 29.482  133.185 42.076 1.00 34.50 ? 108  ALA B CA    1 
ATOM   2193 C C     . ALA B 1 108 ? 30.309  132.055 42.687 1.00 35.09 ? 108  ALA B C     1 
ATOM   2194 O O     . ALA B 1 108 ? 31.386  131.699 42.190 1.00 35.23 ? 108  ALA B O     1 
ATOM   2195 C CB    . ALA B 1 108 ? 28.707  132.686 40.845 1.00 33.35 ? 108  ALA B CB    1 
ATOM   2196 N N     . LYS B 1 109 ? 29.813  131.540 43.803 1.00 35.21 ? 109  LYS B N     1 
ATOM   2197 C CA    . LYS B 1 109 ? 30.425  130.432 44.515 1.00 34.87 ? 109  LYS B CA    1 
ATOM   2198 C C     . LYS B 1 109 ? 29.590  129.197 44.190 1.00 33.14 ? 109  LYS B C     1 
ATOM   2199 O O     . LYS B 1 109 ? 28.840  129.184 43.217 1.00 32.37 ? 109  LYS B O     1 
ATOM   2200 C CB    . LYS B 1 109 ? 30.376  130.694 46.014 1.00 37.92 ? 109  LYS B CB    1 
ATOM   2201 C CG    . LYS B 1 109 ? 31.147  131.920 46.457 1.00 43.27 ? 109  LYS B CG    1 
ATOM   2202 C CD    . LYS B 1 109 ? 30.882  132.197 47.937 1.00 47.27 ? 109  LYS B CD    1 
ATOM   2203 C CE    . LYS B 1 109 ? 31.676  133.394 48.434 1.00 50.28 ? 109  LYS B CE    1 
ATOM   2204 N NZ    . LYS B 1 109 ? 31.143  133.970 49.709 1.00 50.39 ? 109  LYS B NZ    1 
ATOM   2205 N N     . PHE B 1 110 ? 29.691  128.172 45.027 1.00 31.81 ? 110  PHE B N     1 
ATOM   2206 C CA    . PHE B 1 110 ? 28.936  126.938 44.816 1.00 30.00 ? 110  PHE B CA    1 
ATOM   2207 C C     . PHE B 1 110 ? 28.691  126.301 46.171 1.00 29.17 ? 110  PHE B C     1 
ATOM   2208 O O     . PHE B 1 110 ? 29.304  125.288 46.519 1.00 29.86 ? 110  PHE B O     1 
ATOM   2209 C CB    . PHE B 1 110 ? 29.721  125.977 43.914 1.00 28.05 ? 110  PHE B CB    1 
ATOM   2210 C CG    . PHE B 1 110 ? 28.868  124.917 43.268 1.00 26.75 ? 110  PHE B CG    1 
ATOM   2211 C CD1   . PHE B 1 110 ? 28.058  125.229 42.180 1.00 24.69 ? 110  PHE B CD1   1 
ATOM   2212 C CD2   . PHE B 1 110 ? 28.887  123.608 43.734 1.00 24.90 ? 110  PHE B CD2   1 
ATOM   2213 C CE1   . PHE B 1 110 ? 27.282  124.251 41.569 1.00 24.31 ? 110  PHE B CE1   1 
ATOM   2214 C CE2   . PHE B 1 110 ? 28.115  122.627 43.124 1.00 24.13 ? 110  PHE B CE2   1 
ATOM   2215 C CZ    . PHE B 1 110 ? 27.314  122.949 42.042 1.00 23.09 ? 110  PHE B CZ    1 
ATOM   2216 N N     . LYS B 1 111 ? 27.779  126.882 46.936 1.00 28.79 ? 111  LYS B N     1 
ATOM   2217 C CA    . LYS B 1 111 ? 27.513  126.358 48.260 1.00 29.59 ? 111  LYS B CA    1 
ATOM   2218 C C     . LYS B 1 111 ? 26.197  125.624 48.443 1.00 28.49 ? 111  LYS B C     1 
ATOM   2219 O O     . LYS B 1 111 ? 25.186  125.934 47.812 1.00 28.15 ? 111  LYS B O     1 
ATOM   2220 C CB    . LYS B 1 111 ? 27.647  127.460 49.320 1.00 31.63 ? 111  LYS B CB    1 
ATOM   2221 C CG    . LYS B 1 111 ? 26.483  128.423 49.402 1.00 34.20 ? 111  LYS B CG    1 
ATOM   2222 C CD    . LYS B 1 111 ? 26.670  129.427 50.520 1.00 36.91 ? 111  LYS B CD    1 
ATOM   2223 C CE    . LYS B 1 111 ? 26.805  128.754 51.873 1.00 37.17 ? 111  LYS B CE    1 
ATOM   2224 N NZ    . LYS B 1 111 ? 26.569  129.732 52.975 1.00 39.23 ? 111  LYS B NZ    1 
ATOM   2225 N N     . ASP B 1 112 ? 26.245  124.640 49.327 1.00 27.64 ? 112  ASP B N     1 
ATOM   2226 C CA    . ASP B 1 112 ? 25.101  123.831 49.683 1.00 27.42 ? 112  ASP B CA    1 
ATOM   2227 C C     . ASP B 1 112 ? 24.335  123.201 48.534 1.00 26.25 ? 112  ASP B C     1 
ATOM   2228 O O     . ASP B 1 112 ? 23.101  123.210 48.524 1.00 26.57 ? 112  ASP B O     1 
ATOM   2229 C CB    . ASP B 1 112 ? 24.171  124.622 50.592 1.00 29.11 ? 112  ASP B CB    1 
ATOM   2230 C CG    . ASP B 1 112 ? 24.865  125.082 51.852 1.00 31.94 ? 112  ASP B CG    1 
ATOM   2231 O OD1   . ASP B 1 112 ? 25.394  124.220 52.587 1.00 34.43 ? 112  ASP B OD1   1 
ATOM   2232 O OD2   . ASP B 1 112 ? 24.901  126.304 52.098 1.00 33.83 ? 112  ASP B OD2   1 
ATOM   2233 N N     . PHE B 1 113 ? 25.071  122.660 47.568 1.00 24.50 ? 113  PHE B N     1 
ATOM   2234 C CA    . PHE B 1 113 ? 24.453  121.975 46.448 1.00 23.68 ? 113  PHE B CA    1 
ATOM   2235 C C     . PHE B 1 113 ? 23.629  120.845 47.066 1.00 24.19 ? 113  PHE B C     1 
ATOM   2236 O O     . PHE B 1 113 ? 24.114  120.147 47.970 1.00 24.89 ? 113  PHE B O     1 
ATOM   2237 C CB    . PHE B 1 113 ? 25.517  121.381 45.532 1.00 22.95 ? 113  PHE B CB    1 
ATOM   2238 C CG    . PHE B 1 113 ? 24.953  120.477 44.479 1.00 22.05 ? 113  PHE B CG    1 
ATOM   2239 C CD1   . PHE B 1 113 ? 24.383  121.007 43.327 1.00 21.03 ? 113  PHE B CD1   1 
ATOM   2240 C CD2   . PHE B 1 113 ? 24.930  119.101 44.671 1.00 21.45 ? 113  PHE B CD2   1 
ATOM   2241 C CE1   . PHE B 1 113 ? 23.792  120.181 42.389 1.00 20.58 ? 113  PHE B CE1   1 
ATOM   2242 C CE2   . PHE B 1 113 ? 24.340  118.265 43.734 1.00 20.93 ? 113  PHE B CE2   1 
ATOM   2243 C CZ    . PHE B 1 113 ? 23.771  118.807 42.596 1.00 20.38 ? 113  PHE B CZ    1 
ATOM   2244 N N     . LYS B 1 114 ? 22.405  120.645 46.584 1.00 22.44 ? 114  LYS B N     1 
ATOM   2245 C CA    . LYS B 1 114 ? 21.556  119.604 47.148 1.00 22.07 ? 114  LYS B CA    1 
ATOM   2246 C C     . LYS B 1 114 ? 20.601  119.010 46.127 1.00 20.71 ? 114  LYS B C     1 
ATOM   2247 O O     . LYS B 1 114 ? 20.027  119.740 45.326 1.00 21.04 ? 114  LYS B O     1 
ATOM   2248 C CB    . LYS B 1 114 ? 20.762  120.197 48.316 1.00 24.48 ? 114  LYS B CB    1 
ATOM   2249 C CG    . LYS B 1 114 ? 19.892  119.217 49.073 1.00 28.41 ? 114  LYS B CG    1 
ATOM   2250 C CD    . LYS B 1 114 ? 19.386  119.849 50.359 1.00 32.98 ? 114  LYS B CD    1 
ATOM   2251 C CE    . LYS B 1 114 ? 18.538  118.878 51.193 1.00 35.55 ? 114  LYS B CE    1 
ATOM   2252 N NZ    . LYS B 1 114 ? 17.190  118.645 50.602 1.00 38.39 ? 114  LYS B NZ    1 
ATOM   2253 N N     . ILE B 1 115 ? 20.480  117.683 46.117 1.00 19.26 ? 115  ILE B N     1 
ATOM   2254 C CA    . ILE B 1 115 ? 19.550  117.001 45.220 1.00 18.63 ? 115  ILE B CA    1 
ATOM   2255 C C     . ILE B 1 115 ? 18.180  117.141 45.883 1.00 19.59 ? 115  ILE B C     1 
ATOM   2256 O O     . ILE B 1 115 ? 17.975  116.693 47.023 1.00 19.81 ? 115  ILE B O     1 
ATOM   2257 C CB    . ILE B 1 115 ? 19.900  115.510 45.039 1.00 17.44 ? 115  ILE B CB    1 
ATOM   2258 C CG1   . ILE B 1 115 ? 21.279  115.366 44.376 1.00 17.25 ? 115  ILE B CG1   1 
ATOM   2259 C CG2   . ILE B 1 115 ? 18.819  114.810 44.205 1.00 17.20 ? 115  ILE B CG2   1 
ATOM   2260 C CD1   . ILE B 1 115 ? 21.416  116.014 42.993 1.00 15.54 ? 115  ILE B CD1   1 
ATOM   2261 N N     . GLN B 1 116 ? 17.259  117.803 45.189 1.00 18.72 ? 116  GLN B N     1 
ATOM   2262 C CA    . GLN B 1 116 ? 15.932  118.064 45.730 1.00 19.27 ? 116  GLN B CA    1 
ATOM   2263 C C     . GLN B 1 116 ? 14.833  117.101 45.312 1.00 18.81 ? 116  GLN B C     1 
ATOM   2264 O O     . GLN B 1 116 ? 13.833  116.964 46.020 1.00 19.80 ? 116  GLN B O     1 
ATOM   2265 C CB    . GLN B 1 116 ? 15.505  119.492 45.397 1.00 19.43 ? 116  GLN B CB    1 
ATOM   2266 C CG    . GLN B 1 116 ? 16.454  120.562 45.910 1.00 20.75 ? 116  GLN B CG    1 
ATOM   2267 C CD    . GLN B 1 116 ? 16.371  120.756 47.404 1.00 21.18 ? 116  GLN B CD    1 
ATOM   2268 O OE1   . GLN B 1 116 ? 15.676  120.022 48.102 1.00 24.27 ? 116  GLN B OE1   1 
ATOM   2269 N NE2   . GLN B 1 116 ? 17.062  121.760 47.903 1.00 20.74 ? 116  GLN B NE2   1 
ATOM   2270 N N     . ASN B 1 117 ? 14.988  116.470 44.156 1.00 17.27 ? 117  ASN B N     1 
ATOM   2271 C CA    . ASN B 1 117 ? 13.978  115.529 43.684 1.00 17.42 ? 117  ASN B CA    1 
ATOM   2272 C C     . ASN B 1 117 ? 14.546  114.667 42.575 1.00 17.16 ? 117  ASN B C     1 
ATOM   2273 O O     . ASN B 1 117 ? 15.318  115.139 41.733 1.00 16.75 ? 117  ASN B O     1 
ATOM   2274 C CB    . ASN B 1 117 ? 12.723  116.275 43.193 1.00 17.33 ? 117  ASN B CB    1 
ATOM   2275 C CG    . ASN B 1 117 ? 11.603  115.336 42.762 1.00 17.61 ? 117  ASN B CG    1 
ATOM   2276 O OD1   . ASN B 1 117 ? 11.411  114.259 43.332 1.00 16.64 ? 117  ASN B OD1   1 
ATOM   2277 N ND2   . ASN B 1 117 ? 10.854  115.748 41.755 1.00 16.21 ? 117  ASN B ND2   1 
ATOM   2278 N N     . ILE B 1 118 ? 14.202  113.386 42.632 1.00 15.96 ? 118  ILE B N     1 
ATOM   2279 C CA    . ILE B 1 118 ? 14.622  112.400 41.658 1.00 14.46 ? 118  ILE B CA    1 
ATOM   2280 C C     . ILE B 1 118 ? 13.356  111.737 41.119 1.00 15.47 ? 118  ILE B C     1 
ATOM   2281 O O     . ILE B 1 118 ? 12.499  111.297 41.895 1.00 15.10 ? 118  ILE B O     1 
ATOM   2282 C CB    . ILE B 1 118 ? 15.493  111.305 42.310 1.00 13.83 ? 118  ILE B CB    1 
ATOM   2283 C CG1   . ILE B 1 118 ? 16.751  111.922 42.925 1.00 11.83 ? 118  ILE B CG1   1 
ATOM   2284 C CG2   . ILE B 1 118 ? 15.804  110.215 41.294 1.00 11.87 ? 118  ILE B CG2   1 
ATOM   2285 C CD1   . ILE B 1 118 ? 17.676  110.917 43.567 1.00 11.54 ? 118  ILE B CD1   1 
ATOM   2286 N N     . VAL B 1 119 ? 13.217  111.728 39.796 1.00 16.32 ? 119  VAL B N     1 
ATOM   2287 C CA    . VAL B 1 119 ? 12.067  111.114 39.130 1.00 16.15 ? 119  VAL B CA    1 
ATOM   2288 C C     . VAL B 1 119 ? 12.557  109.911 38.322 1.00 16.38 ? 119  VAL B C     1 
ATOM   2289 O O     . VAL B 1 119 ? 13.505  110.020 37.538 1.00 17.43 ? 119  VAL B O     1 
ATOM   2290 C CB    . VAL B 1 119 ? 11.375  112.109 38.174 1.00 15.93 ? 119  VAL B CB    1 
ATOM   2291 C CG1   . VAL B 1 119 ? 10.127  111.472 37.573 1.00 15.74 ? 119  VAL B CG1   1 
ATOM   2292 C CG2   . VAL B 1 119 ? 11.040  113.408 38.908 1.00 13.74 ? 119  VAL B CG2   1 
ATOM   2293 N N     . GLY B 1 120 ? 11.944  108.759 38.533 1.00 16.30 ? 120  GLY B N     1 
ATOM   2294 C CA    . GLY B 1 120 ? 12.357  107.576 37.802 1.00 17.33 ? 120  GLY B CA    1 
ATOM   2295 C C     . GLY B 1 120 ? 11.155  106.871 37.217 1.00 17.77 ? 120  GLY B C     1 
ATOM   2296 O O     . GLY B 1 120 ? 10.018  107.245 37.484 1.00 16.63 ? 120  GLY B O     1 
ATOM   2297 N N     . SER B 1 121 ? 11.393  105.869 36.389 1.00 18.08 ? 121  SER B N     1 
ATOM   2298 C CA    . SER B 1 121 ? 10.289  105.128 35.805 1.00 19.68 ? 121  SER B CA    1 
ATOM   2299 C C     . SER B 1 121 ? 10.740  103.712 35.503 1.00 19.81 ? 121  SER B C     1 
ATOM   2300 O O     . SER B 1 121 ? 11.941  103.452 35.417 1.00 20.10 ? 121  SER B O     1 
ATOM   2301 C CB    . SER B 1 121 ? 9.786   105.822 34.524 1.00 19.27 ? 121  SER B CB    1 
ATOM   2302 O OG    . SER B 1 121 ? 10.735  105.759 33.463 1.00 19.49 ? 121  SER B OG    1 
ATOM   2303 N N     . CYS B 1 122 ? 9.798   102.779 35.479 1.00 20.45 ? 122  CYS B N     1 
ATOM   2304 C CA    . CYS B 1 122 ? 10.114  101.403 35.124 1.00 22.30 ? 122  CYS B CA    1 
ATOM   2305 C C     . CYS B 1 122 ? 8.867   100.697 34.627 1.00 22.01 ? 122  CYS B C     1 
ATOM   2306 O O     . CYS B 1 122 ? 7.788   101.288 34.590 1.00 21.81 ? 122  CYS B O     1 
ATOM   2307 C CB    . CYS B 1 122 ? 10.801  100.632 36.253 1.00 22.91 ? 122  CYS B CB    1 
ATOM   2308 S SG    . CYS B 1 122 ? 9.874   100.589 37.732 1.00 29.89 ? 122  CYS B SG    1 
ATOM   2309 N N     . ASP B 1 123 ? 9.039   99.448  34.219 1.00 22.16 ? 123  ASP B N     1 
ATOM   2310 C CA    . ASP B 1 123 ? 7.982   98.627  33.657 1.00 22.12 ? 123  ASP B CA    1 
ATOM   2311 C C     . ASP B 1 123 ? 7.989   97.259  34.339 1.00 22.94 ? 123  ASP B C     1 
ATOM   2312 O O     . ASP B 1 123 ? 8.991   96.557  34.300 1.00 23.53 ? 123  ASP B O     1 
ATOM   2313 C CB    . ASP B 1 123 ? 8.302   98.470  32.164 1.00 22.43 ? 123  ASP B CB    1 
ATOM   2314 C CG    . ASP B 1 123 ? 7.238   97.723  31.390 1.00 23.70 ? 123  ASP B CG    1 
ATOM   2315 O OD1   . ASP B 1 123 ? 6.249   97.246  31.982 1.00 25.31 ? 123  ASP B OD1   1 
ATOM   2316 O OD2   . ASP B 1 123 ? 7.404   97.615  30.162 1.00 24.49 ? 123  ASP B OD2   1 
ATOM   2317 N N     . VAL B 1 124 ? 6.887   96.872  34.970 1.00 23.49 ? 124  VAL B N     1 
ATOM   2318 C CA    . VAL B 1 124 ? 6.838   95.561  35.615 1.00 23.95 ? 124  VAL B CA    1 
ATOM   2319 C C     . VAL B 1 124 ? 6.568   94.417  34.632 1.00 25.81 ? 124  VAL B C     1 
ATOM   2320 O O     . VAL B 1 124 ? 6.593   93.254  35.010 1.00 26.41 ? 124  VAL B O     1 
ATOM   2321 C CB    . VAL B 1 124 ? 5.823   95.499  36.759 1.00 23.08 ? 124  VAL B CB    1 
ATOM   2322 C CG1   . VAL B 1 124 ? 6.218   96.474  37.847 1.00 22.73 ? 124  VAL B CG1   1 
ATOM   2323 C CG2   . VAL B 1 124 ? 4.421   95.767  36.240 1.00 22.36 ? 124  VAL B CG2   1 
ATOM   2324 N N     . LYS B 1 125 ? 6.266   94.758  33.384 1.00 26.89 ? 125  LYS B N     1 
ATOM   2325 C CA    . LYS B 1 125 ? 6.039   93.770  32.327 1.00 28.94 ? 125  LYS B CA    1 
ATOM   2326 C C     . LYS B 1 125 ? 4.723   92.984  32.350 1.00 28.35 ? 125  LYS B C     1 
ATOM   2327 O O     . LYS B 1 125 ? 4.631   91.889  31.782 1.00 28.38 ? 125  LYS B O     1 
ATOM   2328 C CB    . LYS B 1 125 ? 7.229   92.802  32.247 1.00 30.61 ? 125  LYS B CB    1 
ATOM   2329 C CG    . LYS B 1 125 ? 8.583   93.470  31.994 1.00 33.14 ? 125  LYS B CG    1 
ATOM   2330 C CD    . LYS B 1 125 ? 8.603   94.181  30.665 1.00 33.67 ? 125  LYS B CD    1 
ATOM   2331 C CE    . LYS B 1 125 ? 10.013  94.576  30.304 1.00 37.57 ? 125  LYS B CE    1 
ATOM   2332 N NZ    . LYS B 1 125 ? 10.096  95.037  28.884 1.00 40.57 ? 125  LYS B NZ    1 
ATOM   2333 N N     . PHE B 1 126 ? 3.699   93.547  32.975 1.00 26.83 ? 126  PHE B N     1 
ATOM   2334 C CA    . PHE B 1 126 ? 2.402   92.891  33.022 1.00 25.62 ? 126  PHE B CA    1 
ATOM   2335 C C     . PHE B 1 126 ? 1.346   93.946  33.316 1.00 25.84 ? 126  PHE B C     1 
ATOM   2336 O O     . PHE B 1 126 ? 1.653   94.952  33.964 1.00 25.49 ? 126  PHE B O     1 
ATOM   2337 C CB    . PHE B 1 126 ? 2.380   91.743  34.057 1.00 24.53 ? 126  PHE B CB    1 
ATOM   2338 C CG    . PHE B 1 126 ? 2.623   92.166  35.498 1.00 24.24 ? 126  PHE B CG    1 
ATOM   2339 C CD1   . PHE B 1 126 ? 1.625   92.806  36.243 1.00 23.61 ? 126  PHE B CD1   1 
ATOM   2340 C CD2   . PHE B 1 126 ? 3.834   91.870  36.129 1.00 24.14 ? 126  PHE B CD2   1 
ATOM   2341 C CE1   . PHE B 1 126 ? 1.829   93.143  37.590 1.00 23.26 ? 126  PHE B CE1   1 
ATOM   2342 C CE2   . PHE B 1 126 ? 4.046   92.204  37.477 1.00 23.03 ? 126  PHE B CE2   1 
ATOM   2343 C CZ    . PHE B 1 126 ? 3.041   92.840  38.204 1.00 23.01 ? 126  PHE B CZ    1 
ATOM   2344 N N     . PRO B 1 127 ? 0.132   93.796  32.739 1.00 25.76 ? 127  PRO B N     1 
ATOM   2345 C CA    . PRO B 1 127 ? -0.971  94.746  32.951 1.00 24.41 ? 127  PRO B CA    1 
ATOM   2346 C C     . PRO B 1 127 ? -1.469  94.694  34.393 1.00 23.26 ? 127  PRO B C     1 
ATOM   2347 O O     . PRO B 1 127 ? -1.422  93.647  35.039 1.00 23.90 ? 127  PRO B O     1 
ATOM   2348 C CB    . PRO B 1 127 ? -2.025  94.288  31.933 1.00 25.08 ? 127  PRO B CB    1 
ATOM   2349 C CG    . PRO B 1 127 ? -1.763  92.817  31.797 1.00 25.34 ? 127  PRO B CG    1 
ATOM   2350 C CD    . PRO B 1 127 ? -0.249  92.759  31.761 1.00 25.73 ? 127  PRO B CD    1 
ATOM   2351 N N     . ILE B 1 128 ? -1.980  95.816  34.881 1.00 22.31 ? 128  ILE B N     1 
ATOM   2352 C CA    . ILE B 1 128 ? -2.427  95.921  36.264 1.00 21.49 ? 128  ILE B CA    1 
ATOM   2353 C C     . ILE B 1 128 ? -3.893  96.326  36.443 1.00 22.00 ? 128  ILE B C     1 
ATOM   2354 O O     . ILE B 1 128 ? -4.399  97.200  35.745 1.00 21.68 ? 128  ILE B O     1 
ATOM   2355 C CB    . ILE B 1 128 ? -1.516  96.928  37.022 1.00 20.34 ? 128  ILE B CB    1 
ATOM   2356 C CG1   . ILE B 1 128 ? -0.043  96.522  36.863 1.00 19.91 ? 128  ILE B CG1   1 
ATOM   2357 C CG2   . ILE B 1 128 ? -1.904  97.023  38.487 1.00 20.21 ? 128  ILE B CG2   1 
ATOM   2358 C CD1   . ILE B 1 128 ? 0.937   97.563  37.328 1.00 18.68 ? 128  ILE B CD1   1 
ATOM   2359 N N     . ARG B 1 129 ? -4.560  95.667  37.389 1.00 23.70 ? 129  ARG B N     1 
ATOM   2360 C CA    . ARG B 1 129 ? -5.958  95.931  37.737 1.00 24.52 ? 129  ARG B CA    1 
ATOM   2361 C C     . ARG B 1 129 ? -5.955  97.045  38.775 1.00 23.39 ? 129  ARG B C     1 
ATOM   2362 O O     . ARG B 1 129 ? -6.061  96.789  39.981 1.00 22.88 ? 129  ARG B O     1 
ATOM   2363 C CB    . ARG B 1 129 ? -6.611  94.682  38.339 1.00 27.64 ? 129  ARG B CB    1 
ATOM   2364 C CG    . ARG B 1 129 ? -6.659  93.488  37.402 1.00 31.93 ? 129  ARG B CG    1 
ATOM   2365 C CD    . ARG B 1 129 ? -7.419  92.289  38.011 1.00 35.44 ? 129  ARG B CD    1 
ATOM   2366 N NE    . ARG B 1 129 ? -6.656  91.562  39.029 1.00 36.75 ? 129  ARG B NE    1 
ATOM   2367 C CZ    . ARG B 1 129 ? -6.935  91.593  40.328 1.00 39.39 ? 129  ARG B CZ    1 
ATOM   2368 N NH1   . ARG B 1 129 ? -7.954  92.324  40.773 1.00 41.18 ? 129  ARG B NH1   1 
ATOM   2369 N NH2   . ARG B 1 129 ? -6.232  90.854  41.180 1.00 41.06 ? 129  ARG B NH2   1 
ATOM   2370 N N     . LEU B 1 130 ? -5.830  98.282  38.298 1.00 23.31 ? 130  LEU B N     1 
ATOM   2371 C CA    . LEU B 1 130 ? -5.772  99.461  39.165 1.00 23.28 ? 130  LEU B CA    1 
ATOM   2372 C C     . LEU B 1 130 ? -6.931  99.557  40.143 1.00 25.04 ? 130  LEU B C     1 
ATOM   2373 O O     . LEU B 1 130 ? -6.742  99.898  41.310 1.00 25.69 ? 130  LEU B O     1 
ATOM   2374 C CB    . LEU B 1 130 ? -5.704  100.741 38.324 1.00 20.24 ? 130  LEU B CB    1 
ATOM   2375 C CG    . LEU B 1 130 ? -4.545  100.829 37.340 1.00 17.69 ? 130  LEU B CG    1 
ATOM   2376 C CD1   . LEU B 1 130 ? -4.585  102.147 36.600 1.00 16.60 ? 130  LEU B CD1   1 
ATOM   2377 C CD2   . LEU B 1 130 ? -3.235  100.681 38.100 1.00 17.77 ? 130  LEU B CD2   1 
ATOM   2378 N N     . GLU B 1 131 ? -8.125  99.221  39.671 1.00 27.30 ? 131  GLU B N     1 
ATOM   2379 C CA    . GLU B 1 131 ? -9.320  99.285  40.490 1.00 30.00 ? 131  GLU B CA    1 
ATOM   2380 C C     . GLU B 1 131 ? -9.159  98.426  41.742 1.00 29.65 ? 131  GLU B C     1 
ATOM   2381 O O     . GLU B 1 131 ? -9.481  98.862  42.845 1.00 29.49 ? 131  GLU B O     1 
ATOM   2382 C CB    . GLU B 1 131 ? -10.519 98.832  39.656 1.00 33.91 ? 131  GLU B CB    1 
ATOM   2383 C CG    . GLU B 1 131 ? -11.850 99.426  40.072 1.00 41.14 ? 131  GLU B CG    1 
ATOM   2384 C CD    . GLU B 1 131 ? -12.589 98.564  41.079 1.00 46.27 ? 131  GLU B CD    1 
ATOM   2385 O OE1   . GLU B 1 131 ? -12.938 97.412  40.722 1.00 49.22 ? 131  GLU B OE1   1 
ATOM   2386 O OE2   . GLU B 1 131 ? -12.824 99.037  42.218 1.00 48.85 ? 131  GLU B OE2   1 
ATOM   2387 N N     . GLY B 1 132 ? -8.589  97.234  41.572 1.00 30.14 ? 132  GLY B N     1 
ATOM   2388 C CA    . GLY B 1 132 ? -8.385  96.322  42.691 1.00 28.99 ? 132  GLY B CA    1 
ATOM   2389 C C     . GLY B 1 132 ? -7.309  96.766  43.662 1.00 28.76 ? 132  GLY B C     1 
ATOM   2390 O O     . GLY B 1 132 ? -7.387  96.485  44.865 1.00 27.78 ? 132  GLY B O     1 
ATOM   2391 N N     . LEU B 1 133 ? -6.293  97.438  43.125 1.00 28.10 ? 133  LEU B N     1 
ATOM   2392 C CA    . LEU B 1 133 ? -5.188  97.960  43.917 1.00 27.76 ? 133  LEU B CA    1 
ATOM   2393 C C     . LEU B 1 133 ? -5.700  99.091  44.791 1.00 26.95 ? 133  LEU B C     1 
ATOM   2394 O O     . LEU B 1 133 ? -5.411  99.141  45.990 1.00 26.88 ? 133  LEU B O     1 
ATOM   2395 C CB    . LEU B 1 133 ? -4.074  98.481  42.996 1.00 28.71 ? 133  LEU B CB    1 
ATOM   2396 C CG    . LEU B 1 133 ? -2.913  99.294  43.589 1.00 28.04 ? 133  LEU B CG    1 
ATOM   2397 C CD1   . LEU B 1 133 ? -2.148  98.483  44.632 1.00 29.38 ? 133  LEU B CD1   1 
ATOM   2398 C CD2   . LEU B 1 133 ? -1.981  99.714  42.464 1.00 28.57 ? 133  LEU B CD2   1 
ATOM   2399 N N     . ALA B 1 134 ? -6.470  99.990  44.186 1.00 27.51 ? 134  ALA B N     1 
ATOM   2400 C CA    . ALA B 1 134 ? -7.027  101.135 44.906 1.00 28.22 ? 134  ALA B CA    1 
ATOM   2401 C C     . ALA B 1 134 ? -7.939  100.685 46.034 1.00 28.74 ? 134  ALA B C     1 
ATOM   2402 O O     . ALA B 1 134 ? -7.853  101.194 47.149 1.00 29.44 ? 134  ALA B O     1 
ATOM   2403 C CB    . ALA B 1 134 ? -7.780  102.049 43.953 1.00 25.66 ? 134  ALA B CB    1 
ATOM   2404 N N     . TYR B 1 135 ? -8.779  99.701  45.736 1.00 31.11 ? 135  TYR B N     1 
ATOM   2405 C CA    . TYR B 1 135 ? -9.733  99.147  46.692 1.00 33.45 ? 135  TYR B CA    1 
ATOM   2406 C C     . TYR B 1 135 ? -9.045  98.525  47.914 1.00 33.11 ? 135  TYR B C     1 
ATOM   2407 O O     . TYR B 1 135 ? -9.454  98.766  49.055 1.00 33.48 ? 135  TYR B O     1 
ATOM   2408 C CB    . TYR B 1 135 ? -10.612 98.112  45.980 1.00 36.98 ? 135  TYR B CB    1 
ATOM   2409 C CG    . TYR B 1 135 ? -11.773 97.586  46.788 1.00 40.89 ? 135  TYR B CG    1 
ATOM   2410 C CD1   . TYR B 1 135 ? -12.944 98.333  46.933 1.00 42.96 ? 135  TYR B CD1   1 
ATOM   2411 C CD2   . TYR B 1 135 ? -11.714 96.326  47.384 1.00 42.93 ? 135  TYR B CD2   1 
ATOM   2412 C CE1   . TYR B 1 135 ? -14.034 97.834  47.655 1.00 45.40 ? 135  TYR B CE1   1 
ATOM   2413 C CE2   . TYR B 1 135 ? -12.792 95.816  48.104 1.00 45.59 ? 135  TYR B CE2   1 
ATOM   2414 C CZ    . TYR B 1 135 ? -13.949 96.573  48.237 1.00 46.19 ? 135  TYR B CZ    1 
ATOM   2415 O OH    . TYR B 1 135 ? -15.015 96.059  48.950 1.00 48.22 ? 135  TYR B OH    1 
ATOM   2416 N N     . SER B 1 136 ? -7.993  97.744  47.682 1.00 31.65 ? 136  SER B N     1 
ATOM   2417 C CA    . SER B 1 136 ? -7.268  97.105  48.778 1.00 30.75 ? 136  SER B CA    1 
ATOM   2418 C C     . SER B 1 136 ? -6.320  98.061  49.488 1.00 30.44 ? 136  SER B C     1 
ATOM   2419 O O     . SER B 1 136 ? -5.926  97.817  50.629 1.00 30.41 ? 136  SER B O     1 
ATOM   2420 C CB    . SER B 1 136 ? -6.485  95.901  48.270 1.00 30.13 ? 136  SER B CB    1 
ATOM   2421 O OG    . SER B 1 136 ? -5.597  96.295  47.239 1.00 31.70 ? 136  SER B OG    1 
ATOM   2422 N N     . HIS B 1 137 ? -5.928  99.135  48.810 1.00 30.34 ? 137  HIS B N     1 
ATOM   2423 C CA    . HIS B 1 137 ? -5.020  100.116 49.399 1.00 30.44 ? 137  HIS B CA    1 
ATOM   2424 C C     . HIS B 1 137 ? -5.622  101.517 49.366 1.00 30.45 ? 137  HIS B C     1 
ATOM   2425 O O     . HIS B 1 137 ? -4.977  102.472 48.921 1.00 31.25 ? 137  HIS B O     1 
ATOM   2426 C CB    . HIS B 1 137 ? -3.665  100.096 48.672 1.00 30.01 ? 137  HIS B CB    1 
ATOM   2427 C CG    . HIS B 1 137 ? -2.916  98.808  48.832 1.00 28.84 ? 137  HIS B CG    1 
ATOM   2428 N ND1   . HIS B 1 137 ? -3.314  97.633  48.228 1.00 28.15 ? 137  HIS B ND1   1 
ATOM   2429 C CD2   . HIS B 1 137 ? -1.822  98.501  49.568 1.00 26.98 ? 137  HIS B CD2   1 
ATOM   2430 C CE1   . HIS B 1 137 ? -2.504  96.657  48.591 1.00 26.56 ? 137  HIS B CE1   1 
ATOM   2431 N NE2   . HIS B 1 137 ? -1.591  97.157  49.403 1.00 27.18 ? 137  HIS B NE2   1 
ATOM   2432 N N     . ALA B 1 138 ? -6.828  101.645 49.911 1.00 29.61 ? 138  ALA B N     1 
ATOM   2433 C CA    . ALA B 1 138 ? -7.543  102.913 49.931 1.00 29.38 ? 138  ALA B CA    1 
ATOM   2434 C C     . ALA B 1 138 ? -6.787  104.061 50.584 1.00 29.16 ? 138  ALA B C     1 
ATOM   2435 O O     . ALA B 1 138 ? -6.839  105.197 50.102 1.00 28.43 ? 138  ALA B O     1 
ATOM   2436 C CB    . ALA B 1 138 ? -8.895  102.737 50.601 1.00 30.92 ? 138  ALA B CB    1 
ATOM   2437 N N     . ALA B 1 139 ? -6.090  103.769 51.677 1.00 29.13 ? 139  ALA B N     1 
ATOM   2438 C CA    . ALA B 1 139 ? -5.331  104.788 52.403 1.00 29.18 ? 139  ALA B CA    1 
ATOM   2439 C C     . ALA B 1 139 ? -4.115  105.323 51.654 1.00 28.47 ? 139  ALA B C     1 
ATOM   2440 O O     . ALA B 1 139 ? -3.573  106.373 52.006 1.00 29.97 ? 139  ALA B O     1 
ATOM   2441 C CB    . ALA B 1 139 ? -4.900  104.254 53.754 1.00 29.68 ? 139  ALA B CB    1 
ATOM   2442 N N     . PHE B 1 140 ? -3.684  104.607 50.627 1.00 26.91 ? 140  PHE B N     1 
ATOM   2443 C CA    . PHE B 1 140 ? -2.519  105.034 49.861 1.00 27.49 ? 140  PHE B CA    1 
ATOM   2444 C C     . PHE B 1 140 ? -2.872  105.424 48.445 1.00 26.50 ? 140  PHE B C     1 
ATOM   2445 O O     . PHE B 1 140 ? -2.102  106.118 47.779 1.00 25.77 ? 140  PHE B O     1 
ATOM   2446 C CB    . PHE B 1 140 ? -1.494  103.900 49.779 1.00 27.06 ? 140  PHE B CB    1 
ATOM   2447 C CG    . PHE B 1 140 ? -1.166  103.282 51.099 1.00 27.75 ? 140  PHE B CG    1 
ATOM   2448 C CD1   . PHE B 1 140 ? -0.161  103.815 51.897 1.00 28.42 ? 140  PHE B CD1   1 
ATOM   2449 C CD2   . PHE B 1 140 ? -1.865  102.167 51.545 1.00 27.44 ? 140  PHE B CD2   1 
ATOM   2450 C CE1   . PHE B 1 140 ? 0.146   103.249 53.118 1.00 29.07 ? 140  PHE B CE1   1 
ATOM   2451 C CE2   . PHE B 1 140 ? -1.571  101.592 52.762 1.00 28.25 ? 140  PHE B CE2   1 
ATOM   2452 C CZ    . PHE B 1 140 ? -0.563  102.133 53.553 1.00 28.90 ? 140  PHE B CZ    1 
ATOM   2453 N N     . SER B 1 141 ? -4.050  105.001 48.003 1.00 25.54 ? 141  SER B N     1 
ATOM   2454 C CA    . SER B 1 141 ? -4.460  105.232 46.636 1.00 25.18 ? 141  SER B CA    1 
ATOM   2455 C C     . SER B 1 141 ? -5.503  106.283 46.324 1.00 25.30 ? 141  SER B C     1 
ATOM   2456 O O     . SER B 1 141 ? -6.396  106.571 47.123 1.00 25.59 ? 141  SER B O     1 
ATOM   2457 C CB    . SER B 1 141 ? -4.909  103.911 46.022 1.00 24.26 ? 141  SER B CB    1 
ATOM   2458 O OG    . SER B 1 141 ? -3.991  102.877 46.313 1.00 26.01 ? 141  SER B OG    1 
ATOM   2459 N N     . SER B 1 142 ? -5.345  106.855 45.137 1.00 25.00 ? 142  SER B N     1 
ATOM   2460 C CA    . SER B 1 142 ? -6.261  107.832 44.572 1.00 25.52 ? 142  SER B CA    1 
ATOM   2461 C C     . SER B 1 142 ? -6.312  107.425 43.108 1.00 24.93 ? 142  SER B C     1 
ATOM   2462 O O     . SER B 1 142 ? -5.316  107.508 42.391 1.00 25.63 ? 142  SER B O     1 
ATOM   2463 C CB    . SER B 1 142 ? -5.727  109.256 44.698 1.00 25.41 ? 142  SER B CB    1 
ATOM   2464 O OG    . SER B 1 142 ? -6.601  110.153 44.025 1.00 28.89 ? 142  SER B OG    1 
ATOM   2465 N N     . TYR B 1 143 ? -7.440  106.878 42.694 1.00 24.25 ? 143  TYR B N     1 
ATOM   2466 C CA    . TYR B 1 143 ? -7.603  106.440 41.321 1.00 23.23 ? 143  TYR B CA    1 
ATOM   2467 C C     . TYR B 1 143 ? -8.947  106.939 40.796 1.00 23.43 ? 143  TYR B C     1 
ATOM   2468 O O     . TYR B 1 143 ? -10.006 106.406 41.142 1.00 23.45 ? 143  TYR B O     1 
ATOM   2469 C CB    . TYR B 1 143 ? -7.514  104.914 41.247 1.00 21.63 ? 143  TYR B CB    1 
ATOM   2470 C CG    . TYR B 1 143 ? -7.720  104.369 39.859 1.00 21.68 ? 143  TYR B CG    1 
ATOM   2471 C CD1   . TYR B 1 143 ? -6.999  104.879 38.776 1.00 21.85 ? 143  TYR B CD1   1 
ATOM   2472 C CD2   . TYR B 1 143 ? -8.651  103.355 39.617 1.00 20.87 ? 143  TYR B CD2   1 
ATOM   2473 C CE1   . TYR B 1 143 ? -7.197  104.400 37.494 1.00 20.71 ? 143  TYR B CE1   1 
ATOM   2474 C CE2   . TYR B 1 143 ? -8.856  102.867 38.333 1.00 20.31 ? 143  TYR B CE2   1 
ATOM   2475 C CZ    . TYR B 1 143 ? -8.124  103.396 37.281 1.00 20.57 ? 143  TYR B CZ    1 
ATOM   2476 O OH    . TYR B 1 143 ? -8.326  102.923 36.015 1.00 22.33 ? 143  TYR B OH    1 
ATOM   2477 N N     . GLU B 1 144 ? -8.896  108.005 40.014 1.00 22.26 ? 144  GLU B N     1 
ATOM   2478 C CA    . GLU B 1 144 ? -10.081 108.598 39.427 1.00 22.94 ? 144  GLU B CA    1 
ATOM   2479 C C     . GLU B 1 144 ? -9.749  108.669 37.942 1.00 23.47 ? 144  GLU B C     1 
ATOM   2480 O O     . GLU B 1 144 ? -9.342  109.722 37.436 1.00 23.81 ? 144  GLU B O     1 
ATOM   2481 C CB    . GLU B 1 144 ? -10.297 109.991 40.012 1.00 24.90 ? 144  GLU B CB    1 
ATOM   2482 C CG    . GLU B 1 144 ? -10.442 110.019 41.540 1.00 28.74 ? 144  GLU B CG    1 
ATOM   2483 C CD    . GLU B 1 144 ? -11.619 109.178 42.078 1.00 32.75 ? 144  GLU B CD    1 
ATOM   2484 O OE1   . GLU B 1 144 ? -12.711 109.148 41.460 1.00 34.06 ? 144  GLU B OE1   1 
ATOM   2485 O OE2   . GLU B 1 144 ? -11.460 108.549 43.146 1.00 35.11 ? 144  GLU B OE2   1 
ATOM   2486 N N     . PRO B 1 145 ? -9.954  107.552 37.214 1.00 22.99 ? 145  PRO B N     1 
ATOM   2487 C CA    . PRO B 1 145 ? -9.674  107.430 35.783 1.00 22.70 ? 145  PRO B CA    1 
ATOM   2488 C C     . PRO B 1 145 ? -10.251 108.493 34.849 1.00 24.18 ? 145  PRO B C     1 
ATOM   2489 O O     . PRO B 1 145 ? -9.671  108.770 33.799 1.00 23.48 ? 145  PRO B O     1 
ATOM   2490 C CB    . PRO B 1 145 ? -10.167 106.021 35.456 1.00 22.13 ? 145  PRO B CB    1 
ATOM   2491 C CG    . PRO B 1 145 ? -11.247 105.792 36.444 1.00 22.46 ? 145  PRO B CG    1 
ATOM   2492 C CD    . PRO B 1 145 ? -10.662 106.357 37.703 1.00 21.96 ? 145  PRO B CD    1 
ATOM   2493 N N     . GLU B 1 146 ? -11.382 109.089 35.215 1.00 25.10 ? 146  GLU B N     1 
ATOM   2494 C CA    . GLU B 1 146 ? -11.981 110.122 34.372 1.00 26.08 ? 146  GLU B CA    1 
ATOM   2495 C C     . GLU B 1 146 ? -11.177 111.422 34.433 1.00 26.37 ? 146  GLU B C     1 
ATOM   2496 O O     . GLU B 1 146 ? -11.267 112.269 33.537 1.00 26.71 ? 146  GLU B O     1 
ATOM   2497 C CB    . GLU B 1 146 ? -13.427 110.364 34.787 1.00 26.25 ? 146  GLU B CB    1 
ATOM   2498 C CG    . GLU B 1 146 ? -14.322 109.177 34.523 1.00 28.66 ? 146  GLU B CG    1 
ATOM   2499 C CD    . GLU B 1 146 ? -15.679 109.320 35.165 1.00 31.55 ? 146  GLU B CD    1 
ATOM   2500 O OE1   . GLU B 1 146 ? -15.794 110.106 36.129 1.00 31.86 ? 146  GLU B OE1   1 
ATOM   2501 O OE2   . GLU B 1 146 ? -16.631 108.644 34.712 1.00 32.90 ? 146  GLU B OE2   1 
ATOM   2502 N N     . LEU B 1 147 ? -10.383 111.564 35.488 1.00 26.09 ? 147  LEU B N     1 
ATOM   2503 C CA    . LEU B 1 147 ? -9.551  112.744 35.677 1.00 26.40 ? 147  LEU B CA    1 
ATOM   2504 C C     . LEU B 1 147 ? -8.117  112.489 35.202 1.00 25.91 ? 147  LEU B C     1 
ATOM   2505 O O     . LEU B 1 147 ? -7.530  113.323 34.507 1.00 26.58 ? 147  LEU B O     1 
ATOM   2506 C CB    . LEU B 1 147 ? -9.552  113.147 37.153 1.00 28.06 ? 147  LEU B CB    1 
ATOM   2507 C CG    . LEU B 1 147 ? -10.955 113.300 37.752 1.00 30.14 ? 147  LEU B CG    1 
ATOM   2508 C CD1   . LEU B 1 147 ? -10.888 113.558 39.261 1.00 29.68 ? 147  LEU B CD1   1 
ATOM   2509 C CD2   . LEU B 1 147 ? -11.706 114.421 37.027 1.00 30.21 ? 147  LEU B CD2   1 
ATOM   2510 N N     . PHE B 1 148 ? -7.566  111.334 35.576 1.00 24.34 ? 148  PHE B N     1 
ATOM   2511 C CA    . PHE B 1 148 ? -6.204  110.957 35.205 1.00 21.59 ? 148  PHE B CA    1 
ATOM   2512 C C     . PHE B 1 148 ? -6.174  109.434 35.080 1.00 21.05 ? 148  PHE B C     1 
ATOM   2513 O O     . PHE B 1 148 ? -6.701  108.721 35.928 1.00 20.01 ? 148  PHE B O     1 
ATOM   2514 C CB    . PHE B 1 148 ? -5.199  111.453 36.274 1.00 20.80 ? 148  PHE B CB    1 
ATOM   2515 C CG    . PHE B 1 148 ? -3.750  111.268 35.885 1.00 18.47 ? 148  PHE B CG    1 
ATOM   2516 C CD1   . PHE B 1 148 ? -3.199  111.991 34.831 1.00 17.81 ? 148  PHE B CD1   1 
ATOM   2517 C CD2   . PHE B 1 148 ? -2.971  110.308 36.507 1.00 17.74 ? 148  PHE B CD2   1 
ATOM   2518 C CE1   . PHE B 1 148 ? -1.899  111.750 34.395 1.00 17.54 ? 148  PHE B CE1   1 
ATOM   2519 C CE2   . PHE B 1 148 ? -1.673  110.059 36.078 1.00 17.17 ? 148  PHE B CE2   1 
ATOM   2520 C CZ    . PHE B 1 148 ? -1.137  110.779 35.019 1.00 16.30 ? 148  PHE B CZ    1 
ATOM   2521 N N     . PRO B 1 149 ? -5.582  108.915 33.993 1.00 21.02 ? 149  PRO B N     1 
ATOM   2522 C CA    . PRO B 1 149 ? -5.525  107.463 33.813 1.00 21.21 ? 149  PRO B CA    1 
ATOM   2523 C C     . PRO B 1 149 ? -4.682  106.657 34.805 1.00 21.94 ? 149  PRO B C     1 
ATOM   2524 O O     . PRO B 1 149 ? -4.915  105.460 34.968 1.00 23.19 ? 149  PRO B O     1 
ATOM   2525 C CB    . PRO B 1 149 ? -5.022  107.313 32.377 1.00 22.57 ? 149  PRO B CB    1 
ATOM   2526 C CG    . PRO B 1 149 ? -4.234  108.562 32.146 1.00 22.85 ? 149  PRO B CG    1 
ATOM   2527 C CD    . PRO B 1 149 ? -5.083  109.618 32.800 1.00 21.11 ? 149  PRO B CD    1 
ATOM   2528 N N     . GLY B 1 150 ? -3.719  107.283 35.472 1.00 20.83 ? 150  GLY B N     1 
ATOM   2529 C CA    . GLY B 1 150 ? -2.899  106.530 36.406 1.00 20.60 ? 150  GLY B CA    1 
ATOM   2530 C C     . GLY B 1 150 ? -3.360  106.597 37.847 1.00 21.70 ? 150  GLY B C     1 
ATOM   2531 O O     . GLY B 1 150 ? -3.977  107.587 38.261 1.00 22.45 ? 150  GLY B O     1 
ATOM   2532 N N     . LEU B 1 151 ? -3.088  105.534 38.606 1.00 20.48 ? 151  LEU B N     1 
ATOM   2533 C CA    . LEU B 1 151 ? -3.426  105.472 40.025 1.00 19.34 ? 151  LEU B CA    1 
ATOM   2534 C C     . LEU B 1 151 ? -2.300  106.178 40.770 1.00 19.38 ? 151  LEU B C     1 
ATOM   2535 O O     . LEU B 1 151 ? -1.122  105.930 40.485 1.00 20.30 ? 151  LEU B O     1 
ATOM   2536 C CB    . LEU B 1 151 ? -3.519  104.006 40.492 1.00 18.55 ? 151  LEU B CB    1 
ATOM   2537 C CG    . LEU B 1 151 ? -3.900  103.696 41.950 1.00 18.08 ? 151  LEU B CG    1 
ATOM   2538 C CD1   . LEU B 1 151 ? -4.661  102.380 41.992 1.00 18.08 ? 151  LEU B CD1   1 
ATOM   2539 C CD2   . LEU B 1 151 ? -2.687  103.661 42.884 1.00 17.11 ? 151  LEU B CD2   1 
ATOM   2540 N N     . ILE B 1 152 ? -2.654  107.065 41.694 1.00 18.50 ? 152  ILE B N     1 
ATOM   2541 C CA    . ILE B 1 152 ? -1.671  107.795 42.486 1.00 19.58 ? 152  ILE B CA    1 
ATOM   2542 C C     . ILE B 1 152 ? -1.475  107.052 43.800 1.00 20.07 ? 152  ILE B C     1 
ATOM   2543 O O     . ILE B 1 152 ? -2.392  106.962 44.620 1.00 20.66 ? 152  ILE B O     1 
ATOM   2544 C CB    . ILE B 1 152 ? -2.132  109.244 42.824 1.00 19.89 ? 152  ILE B CB    1 
ATOM   2545 C CG1   . ILE B 1 152 ? -2.752  109.941 41.599 1.00 20.04 ? 152  ILE B CG1   1 
ATOM   2546 C CG2   . ILE B 1 152 ? -0.977  110.037 43.416 1.00 18.81 ? 152  ILE B CG2   1 
ATOM   2547 C CD1   . ILE B 1 152 ? -1.948  109.872 40.354 1.00 21.16 ? 152  ILE B CD1   1 
ATOM   2548 N N     . TYR B 1 153 ? -0.276  106.515 43.994 1.00 20.48 ? 153  TYR B N     1 
ATOM   2549 C CA    . TYR B 1 153 ? 0.043   105.765 45.200 1.00 19.57 ? 153  TYR B CA    1 
ATOM   2550 C C     . TYR B 1 153 ? 0.999   106.556 46.092 1.00 19.98 ? 153  TYR B C     1 
ATOM   2551 O O     . TYR B 1 153 ? 2.165   106.774 45.750 1.00 18.51 ? 153  TYR B O     1 
ATOM   2552 C CB    . TYR B 1 153 ? 0.664   104.405 44.838 1.00 18.98 ? 153  TYR B CB    1 
ATOM   2553 C CG    . TYR B 1 153 ? 0.668   103.428 45.989 1.00 17.58 ? 153  TYR B CG    1 
ATOM   2554 C CD1   . TYR B 1 153 ? 1.664   103.468 46.965 1.00 16.79 ? 153  TYR B CD1   1 
ATOM   2555 C CD2   . TYR B 1 153 ? -0.343  102.484 46.118 1.00 17.24 ? 153  TYR B CD2   1 
ATOM   2556 C CE1   . TYR B 1 153 ? 1.651   102.591 48.049 1.00 17.73 ? 153  TYR B CE1   1 
ATOM   2557 C CE2   . TYR B 1 153 ? -0.368  101.601 47.193 1.00 19.73 ? 153  TYR B CE2   1 
ATOM   2558 C CZ    . TYR B 1 153 ? 0.632   101.659 48.153 1.00 19.28 ? 153  TYR B CZ    1 
ATOM   2559 O OH    . TYR B 1 153 ? 0.602   100.769 49.205 1.00 21.63 ? 153  TYR B OH    1 
ATOM   2560 N N     . ARG B 1 154 ? 0.502   106.990 47.238 1.00 20.02 ? 154  ARG B N     1 
ATOM   2561 C CA    . ARG B 1 154 ? 1.330   107.747 48.148 1.00 20.85 ? 154  ARG B CA    1 
ATOM   2562 C C     . ARG B 1 154 ? 1.902   106.828 49.218 1.00 20.71 ? 154  ARG B C     1 
ATOM   2563 O O     . ARG B 1 154 ? 1.248   106.520 50.213 1.00 21.63 ? 154  ARG B O     1 
ATOM   2564 C CB    . ARG B 1 154 ? 0.532   108.909 48.739 1.00 22.33 ? 154  ARG B CB    1 
ATOM   2565 C CG    . ARG B 1 154 ? 0.191   109.982 47.700 1.00 24.38 ? 154  ARG B CG    1 
ATOM   2566 C CD    . ARG B 1 154 ? -0.462  111.221 48.320 1.00 25.99 ? 154  ARG B CD    1 
ATOM   2567 N NE    . ARG B 1 154 ? -0.554  112.339 47.371 1.00 27.48 ? 154  ARG B NE    1 
ATOM   2568 C CZ    . ARG B 1 154 ? -1.466  112.440 46.403 1.00 28.86 ? 154  ARG B CZ    1 
ATOM   2569 N NH1   . ARG B 1 154 ? -2.391  111.491 46.230 1.00 29.99 ? 154  ARG B NH1   1 
ATOM   2570 N NH2   . ARG B 1 154 ? -1.460  113.498 45.603 1.00 28.14 ? 154  ARG B NH2   1 
ATOM   2571 N N     . MET B 1 155 ? 3.099   106.316 48.953 1.00 20.60 ? 155  MET B N     1 
ATOM   2572 C CA    . MET B 1 155 ? 3.777   105.421 49.882 1.00 21.08 ? 155  MET B CA    1 
ATOM   2573 C C     . MET B 1 155 ? 4.303   106.228 51.078 1.00 22.24 ? 155  MET B C     1 
ATOM   2574 O O     . MET B 1 155 ? 4.753   107.369 50.927 1.00 22.14 ? 155  MET B O     1 
ATOM   2575 C CB    . MET B 1 155 ? 4.916   104.701 49.161 1.00 20.44 ? 155  MET B CB    1 
ATOM   2576 C CG    . MET B 1 155 ? 5.550   103.578 49.945 1.00 20.00 ? 155  MET B CG    1 
ATOM   2577 S SD    . MET B 1 155 ? 6.695   102.624 48.926 1.00 21.10 ? 155  MET B SD    1 
ATOM   2578 C CE    . MET B 1 155 ? 5.596   101.693 47.893 1.00 15.97 ? 155  MET B CE    1 
ATOM   2579 N N     . LYS B 1 156 ? 4.232   105.641 52.268 1.00 23.90 ? 156  LYS B N     1 
ATOM   2580 C CA    . LYS B 1 156 ? 4.675   106.326 53.480 1.00 24.56 ? 156  LYS B CA    1 
ATOM   2581 C C     . LYS B 1 156 ? 6.102   105.997 53.878 1.00 23.74 ? 156  LYS B C     1 
ATOM   2582 O O     . LYS B 1 156 ? 6.810   106.849 54.410 1.00 24.23 ? 156  LYS B O     1 
ATOM   2583 C CB    . LYS B 1 156 ? 3.711   106.044 54.636 1.00 27.98 ? 156  LYS B CB    1 
ATOM   2584 C CG    . LYS B 1 156 ? 2.302   106.575 54.387 1.00 31.06 ? 156  LYS B CG    1 
ATOM   2585 C CD    . LYS B 1 156 ? 1.479   106.589 55.660 1.00 35.73 ? 156  LYS B CD    1 
ATOM   2586 C CE    . LYS B 1 156 ? 0.187   107.409 55.493 1.00 37.71 ? 156  LYS B CE    1 
ATOM   2587 N NZ    . LYS B 1 156 ? -0.893  106.709 54.720 1.00 41.33 ? 156  LYS B NZ    1 
ATOM   2588 N N     . VAL B 1 157 ? 6.537   104.778 53.579 1.00 22.41 ? 157  VAL B N     1 
ATOM   2589 C CA    . VAL B 1 157 ? 7.895   104.349 53.899 1.00 21.95 ? 157  VAL B CA    1 
ATOM   2590 C C     . VAL B 1 157 ? 8.487   103.581 52.716 1.00 21.13 ? 157  VAL B C     1 
ATOM   2591 O O     . VAL B 1 157 ? 8.057   102.459 52.424 1.00 20.85 ? 157  VAL B O     1 
ATOM   2592 C CB    . VAL B 1 157 ? 7.930   103.421 55.150 1.00 21.88 ? 157  VAL B CB    1 
ATOM   2593 C CG1   . VAL B 1 157 ? 9.349   102.938 55.409 1.00 22.87 ? 157  VAL B CG1   1 
ATOM   2594 C CG2   . VAL B 1 157 ? 7.389   104.150 56.376 1.00 22.69 ? 157  VAL B CG2   1 
ATOM   2595 N N     . PRO B 1 158 ? 9.384   104.226 51.948 1.00 20.36 ? 158  PRO B N     1 
ATOM   2596 C CA    . PRO B 1 158 ? 9.822   105.608 52.159 1.00 19.17 ? 158  PRO B CA    1 
ATOM   2597 C C     . PRO B 1 158 ? 8.727   106.524 51.633 1.00 19.35 ? 158  PRO B C     1 
ATOM   2598 O O     . PRO B 1 158 ? 7.819   106.067 50.939 1.00 18.69 ? 158  PRO B O     1 
ATOM   2599 C CB    . PRO B 1 158 ? 11.093  105.694 51.325 1.00 19.14 ? 158  PRO B CB    1 
ATOM   2600 C CG    . PRO B 1 158 ? 10.821  104.773 50.194 1.00 20.14 ? 158  PRO B CG    1 
ATOM   2601 C CD    . PRO B 1 158 ? 10.170  103.587 50.877 1.00 20.64 ? 158  PRO B CD    1 
ATOM   2602 N N     . LYS B 1 159 ? 8.779   107.798 51.989 1.00 19.96 ? 159  LYS B N     1 
ATOM   2603 C CA    . LYS B 1 159 ? 7.752   108.734 51.556 1.00 20.93 ? 159  LYS B CA    1 
ATOM   2604 C C     . LYS B 1 159 ? 7.964   109.034 50.082 1.00 20.07 ? 159  LYS B C     1 
ATOM   2605 O O     . LYS B 1 159 ? 8.717   109.936 49.732 1.00 22.51 ? 159  LYS B O     1 
ATOM   2606 C CB    . LYS B 1 159 ? 7.817   110.010 52.390 1.00 21.19 ? 159  LYS B CB    1 
ATOM   2607 C CG    . LYS B 1 159 ? 6.540   110.805 52.373 1.00 23.86 ? 159  LYS B CG    1 
ATOM   2608 C CD    . LYS B 1 159 ? 6.725   112.116 53.068 1.00 25.62 ? 159  LYS B CD    1 
ATOM   2609 C CE    . LYS B 1 159 ? 5.391   112.752 53.296 1.00 30.13 ? 159  LYS B CE    1 
ATOM   2610 N NZ    . LYS B 1 159 ? 4.570   111.905 54.224 1.00 35.17 ? 159  LYS B NZ    1 
ATOM   2611 N N     . ILE B 1 160 ? 7.281   108.285 49.226 1.00 18.45 ? 160  ILE B N     1 
ATOM   2612 C CA    . ILE B 1 160 ? 7.434   108.413 47.784 1.00 16.86 ? 160  ILE B CA    1 
ATOM   2613 C C     . ILE B 1 160 ? 6.075   108.286 47.098 1.00 16.78 ? 160  ILE B C     1 
ATOM   2614 O O     . ILE B 1 160 ? 5.175   107.610 47.599 1.00 15.59 ? 160  ILE B O     1 
ATOM   2615 C CB    . ILE B 1 160 ? 8.389   107.275 47.260 1.00 16.35 ? 160  ILE B CB    1 
ATOM   2616 C CG1   . ILE B 1 160 ? 9.799   107.461 47.823 1.00 16.62 ? 160  ILE B CG1   1 
ATOM   2617 C CG2   . ILE B 1 160 ? 8.431   107.217 45.736 1.00 15.94 ? 160  ILE B CG2   1 
ATOM   2618 C CD1   . ILE B 1 160 ? 10.508  108.688 47.322 1.00 17.00 ? 160  ILE B CD1   1 
ATOM   2619 N N     . VAL B 1 161 ? 5.910   108.975 45.974 1.00 16.89 ? 161  VAL B N     1 
ATOM   2620 C CA    . VAL B 1 161 ? 4.662   108.890 45.224 1.00 17.05 ? 161  VAL B CA    1 
ATOM   2621 C C     . VAL B 1 161 ? 4.895   108.104 43.913 1.00 16.56 ? 161  VAL B C     1 
ATOM   2622 O O     . VAL B 1 161 ? 5.848   108.362 43.177 1.00 17.26 ? 161  VAL B O     1 
ATOM   2623 C CB    . VAL B 1 161 ? 4.055   110.303 44.921 1.00 16.48 ? 161  VAL B CB    1 
ATOM   2624 C CG1   . VAL B 1 161 ? 2.766   110.158 44.092 1.00 16.22 ? 161  VAL B CG1   1 
ATOM   2625 C CG2   . VAL B 1 161 ? 3.739   111.044 46.226 1.00 16.06 ? 161  VAL B CG2   1 
ATOM   2626 N N     . LEU B 1 162 ? 4.056   107.110 43.660 1.00 15.88 ? 162  LEU B N     1 
ATOM   2627 C CA    . LEU B 1 162 ? 4.173   106.314 42.450 1.00 16.76 ? 162  LEU B CA    1 
ATOM   2628 C C     . LEU B 1 162 ? 2.906   106.471 41.614 1.00 16.20 ? 162  LEU B C     1 
ATOM   2629 O O     . LEU B 1 162 ? 1.803   106.496 42.148 1.00 15.77 ? 162  LEU B O     1 
ATOM   2630 C CB    . LEU B 1 162 ? 4.384   104.822 42.787 1.00 17.77 ? 162  LEU B CB    1 
ATOM   2631 C CG    . LEU B 1 162 ? 5.541   104.369 43.701 1.00 17.64 ? 162  LEU B CG    1 
ATOM   2632 C CD1   . LEU B 1 162 ? 5.148   104.526 45.172 1.00 16.78 ? 162  LEU B CD1   1 
ATOM   2633 C CD2   . LEU B 1 162 ? 5.886   102.908 43.421 1.00 17.77 ? 162  LEU B CD2   1 
ATOM   2634 N N     . LEU B 1 163 ? 3.079   106.665 40.317 1.00 16.49 ? 163  LEU B N     1 
ATOM   2635 C CA    . LEU B 1 163 ? 1.953   106.778 39.396 1.00 18.35 ? 163  LEU B CA    1 
ATOM   2636 C C     . LEU B 1 163 ? 1.940   105.423 38.697 1.00 17.66 ? 163  LEU B C     1 
ATOM   2637 O O     . LEU B 1 163 ? 2.866   105.098 37.952 1.00 19.05 ? 163  LEU B O     1 
ATOM   2638 C CB    . LEU B 1 163 ? 2.165   107.914 38.383 1.00 17.69 ? 163  LEU B CB    1 
ATOM   2639 C CG    . LEU B 1 163 ? 2.514   109.309 38.919 1.00 19.01 ? 163  LEU B CG    1 
ATOM   2640 C CD1   . LEU B 1 163 ? 2.438   110.331 37.784 1.00 19.33 ? 163  LEU B CD1   1 
ATOM   2641 C CD2   . LEU B 1 163 ? 1.577   109.702 40.037 1.00 18.43 ? 163  LEU B CD2   1 
ATOM   2642 N N     . ILE B 1 164 ? 0.915   104.629 38.976 1.00 17.02 ? 164  ILE B N     1 
ATOM   2643 C CA    . ILE B 1 164 ? 0.799   103.281 38.437 1.00 17.26 ? 164  ILE B CA    1 
ATOM   2644 C C     . ILE B 1 164 ? -0.247  103.213 37.323 1.00 17.99 ? 164  ILE B C     1 
ATOM   2645 O O     . ILE B 1 164 ? -1.380  103.656 37.492 1.00 17.62 ? 164  ILE B O     1 
ATOM   2646 C CB    . ILE B 1 164 ? 0.497   102.304 39.605 1.00 16.76 ? 164  ILE B CB    1 
ATOM   2647 C CG1   . ILE B 1 164 ? 1.549   102.530 40.701 1.00 16.70 ? 164  ILE B CG1   1 
ATOM   2648 C CG2   . ILE B 1 164 ? 0.514   100.841 39.129 1.00 15.82 ? 164  ILE B CG2   1 
ATOM   2649 C CD1   . ILE B 1 164 ? 1.218   101.933 42.044 1.00 18.20 ? 164  ILE B CD1   1 
ATOM   2650 N N     . PHE B 1 165 ? 0.147   102.662 36.178 1.00 18.66 ? 165  PHE B N     1 
ATOM   2651 C CA    . PHE B 1 165 ? -0.732  102.590 35.015 1.00 19.39 ? 165  PHE B CA    1 
ATOM   2652 C C     . PHE B 1 165 ? -1.140  101.166 34.664 1.00 19.99 ? 165  PHE B C     1 
ATOM   2653 O O     . PHE B 1 165 ? -0.454  100.212 35.047 1.00 20.04 ? 165  PHE B O     1 
ATOM   2654 C CB    . PHE B 1 165 ? -0.046  103.286 33.827 1.00 18.96 ? 165  PHE B CB    1 
ATOM   2655 C CG    . PHE B 1 165 ? 0.355   104.721 34.118 1.00 18.69 ? 165  PHE B CG    1 
ATOM   2656 C CD1   . PHE B 1 165 ? 1.555   105.005 34.761 1.00 16.15 ? 165  PHE B CD1   1 
ATOM   2657 C CD2   . PHE B 1 165 ? -0.516  105.775 33.829 1.00 18.37 ? 165  PHE B CD2   1 
ATOM   2658 C CE1   . PHE B 1 165 ? 1.877   106.299 35.123 1.00 17.18 ? 165  PHE B CE1   1 
ATOM   2659 C CE2   . PHE B 1 165 ? -0.198  107.085 34.188 1.00 18.50 ? 165  PHE B CE2   1 
ATOM   2660 C CZ    . PHE B 1 165 ? 1.001   107.347 34.840 1.00 18.45 ? 165  PHE B CZ    1 
ATOM   2661 N N     . VAL B 1 166 ? -2.261  101.028 33.948 1.00 20.13 ? 166  VAL B N     1 
ATOM   2662 C CA    . VAL B 1 166 ? -2.786  99.717  33.533 1.00 20.74 ? 166  VAL B CA    1 
ATOM   2663 C C     . VAL B 1 166 ? -1.761  98.930  32.712 1.00 20.91 ? 166  VAL B C     1 
ATOM   2664 O O     . VAL B 1 166 ? -1.685  97.708  32.798 1.00 21.03 ? 166  VAL B O     1 
ATOM   2665 C CB    . VAL B 1 166 ? -4.079  99.851  32.677 1.00 20.86 ? 166  VAL B CB    1 
ATOM   2666 C CG1   . VAL B 1 166 ? -4.485  98.499  32.116 1.00 20.51 ? 166  VAL B CG1   1 
ATOM   2667 C CG2   . VAL B 1 166 ? -5.213  100.410 33.508 1.00 21.57 ? 166  VAL B CG2   1 
ATOM   2668 N N     . SER B 1 167 ? -0.985  99.649  31.912 1.00 20.42 ? 167  SER B N     1 
ATOM   2669 C CA    . SER B 1 167 ? 0.039   99.060  31.073 1.00 20.60 ? 167  SER B CA    1 
ATOM   2670 C C     . SER B 1 167 ? 1.119   98.315  31.851 1.00 20.99 ? 167  SER B C     1 
ATOM   2671 O O     . SER B 1 167 ? 1.737   97.389  31.327 1.00 21.16 ? 167  SER B O     1 
ATOM   2672 C CB    . SER B 1 167 ? 0.713   100.161 30.262 1.00 20.67 ? 167  SER B CB    1 
ATOM   2673 O OG    . SER B 1 167 ? 1.390   101.061 31.122 1.00 19.09 ? 167  SER B OG    1 
ATOM   2674 N N     . GLY B 1 168 ? 1.367   98.742  33.083 1.00 20.97 ? 168  GLY B N     1 
ATOM   2675 C CA    . GLY B 1 168 ? 2.405   98.121  33.878 1.00 20.55 ? 168  GLY B CA    1 
ATOM   2676 C C     . GLY B 1 168 ? 3.573   99.073  34.058 1.00 20.83 ? 168  GLY B C     1 
ATOM   2677 O O     . GLY B 1 168 ? 4.529   98.739  34.758 1.00 21.51 ? 168  GLY B O     1 
ATOM   2678 N N     . LYS B 1 169 ? 3.516   100.232 33.395 1.00 20.79 ? 169  LYS B N     1 
ATOM   2679 C CA    . LYS B 1 169 ? 4.552   101.269 33.499 1.00 21.00 ? 169  LYS B CA    1 
ATOM   2680 C C     . LYS B 1 169 ? 4.327   102.014 34.807 1.00 20.34 ? 169  LYS B C     1 
ATOM   2681 O O     . LYS B 1 169 ? 3.182   102.245 35.200 1.00 21.12 ? 169  LYS B O     1 
ATOM   2682 C CB    . LYS B 1 169 ? 4.458   102.277 32.349 1.00 21.87 ? 169  LYS B CB    1 
ATOM   2683 C CG    . LYS B 1 169 ? 4.577   101.700 30.954 1.00 23.40 ? 169  LYS B CG    1 
ATOM   2684 C CD    . LYS B 1 169 ? 5.905   101.042 30.731 1.00 26.90 ? 169  LYS B CD    1 
ATOM   2685 C CE    . LYS B 1 169 ? 6.004   100.459 29.330 1.00 28.84 ? 169  LYS B CE    1 
ATOM   2686 N NZ    . LYS B 1 169 ? 6.245   101.550 28.352 1.00 31.91 ? 169  LYS B NZ    1 
ATOM   2687 N N     . ILE B 1 170 ? 5.418   102.407 35.462 1.00 20.38 ? 170  ILE B N     1 
ATOM   2688 C CA    . ILE B 1 170 ? 5.364   103.104 36.746 1.00 18.78 ? 170  ILE B CA    1 
ATOM   2689 C C     . ILE B 1 170 ? 6.260   104.338 36.728 1.00 17.92 ? 170  ILE B C     1 
ATOM   2690 O O     . ILE B 1 170 ? 7.343   104.302 36.150 1.00 18.56 ? 170  ILE B O     1 
ATOM   2691 C CB    . ILE B 1 170 ? 5.950   102.227 37.905 1.00 18.98 ? 170  ILE B CB    1 
ATOM   2692 C CG1   . ILE B 1 170 ? 5.479   100.766 37.835 1.00 19.61 ? 170  ILE B CG1   1 
ATOM   2693 C CG2   . ILE B 1 170 ? 5.621   102.852 39.256 1.00 20.62 ? 170  ILE B CG2   1 
ATOM   2694 C CD1   . ILE B 1 170 ? 3.992   100.568 37.979 1.00 21.44 ? 170  ILE B CD1   1 
ATOM   2695 N N     . VAL B 1 171 ? 5.795   105.425 37.333 1.00 16.68 ? 171  VAL B N     1 
ATOM   2696 C CA    . VAL B 1 171 ? 6.597   106.640 37.480 1.00 16.12 ? 171  VAL B CA    1 
ATOM   2697 C C     . VAL B 1 171 ? 6.785   106.740 38.998 1.00 15.12 ? 171  VAL B C     1 
ATOM   2698 O O     . VAL B 1 171 ? 5.836   106.556 39.754 1.00 14.24 ? 171  VAL B O     1 
ATOM   2699 C CB    . VAL B 1 171 ? 5.899   107.919 36.950 1.00 15.87 ? 171  VAL B CB    1 
ATOM   2700 C CG1   . VAL B 1 171 ? 6.690   109.152 37.373 1.00 16.47 ? 171  VAL B CG1   1 
ATOM   2701 C CG2   . VAL B 1 171 ? 5.806   107.886 35.443 1.00 14.56 ? 171  VAL B CG2   1 
ATOM   2702 N N     . ILE B 1 172 ? 8.009   107.002 39.437 1.00 14.38 ? 172  ILE B N     1 
ATOM   2703 C CA    . ILE B 1 172 ? 8.324   107.074 40.859 1.00 15.43 ? 172  ILE B CA    1 
ATOM   2704 C C     . ILE B 1 172 ? 8.945   108.438 41.143 1.00 15.35 ? 172  ILE B C     1 
ATOM   2705 O O     . ILE B 1 172 ? 9.999   108.778 40.589 1.00 14.47 ? 172  ILE B O     1 
ATOM   2706 C CB    . ILE B 1 172 ? 9.329   105.947 41.235 1.00 15.74 ? 172  ILE B CB    1 
ATOM   2707 C CG1   . ILE B 1 172 ? 8.805   104.589 40.757 1.00 15.39 ? 172  ILE B CG1   1 
ATOM   2708 C CG2   . ILE B 1 172 ? 9.544   105.913 42.739 1.00 15.45 ? 172  ILE B CG2   1 
ATOM   2709 C CD1   . ILE B 1 172 ? 9.864   103.517 40.711 1.00 16.35 ? 172  ILE B CD1   1 
ATOM   2710 N N     . THR B 1 173 ? 8.319   109.216 42.019 1.00 14.87 ? 173  THR B N     1 
ATOM   2711 C CA    . THR B 1 173 ? 8.825   110.553 42.281 1.00 16.21 ? 173  THR B CA    1 
ATOM   2712 C C     . THR B 1 173 ? 8.809   110.989 43.752 1.00 16.44 ? 173  THR B C     1 
ATOM   2713 O O     . THR B 1 173 ? 8.116   110.398 44.581 1.00 16.01 ? 173  THR B O     1 
ATOM   2714 C CB    . THR B 1 173 ? 8.080   111.591 41.372 1.00 15.97 ? 173  THR B CB    1 
ATOM   2715 O OG1   . THR B 1 173 ? 8.679   112.888 41.511 1.00 17.08 ? 173  THR B OG1   1 
ATOM   2716 C CG2   . THR B 1 173 ? 6.589   111.660 41.711 1.00 15.82 ? 173  THR B CG2   1 
ATOM   2717 N N     . GLY B 1 174 ? 9.614   112.005 44.064 1.00 16.81 ? 174  GLY B N     1 
ATOM   2718 C CA    . GLY B 1 174 ? 9.687   112.527 45.416 1.00 18.07 ? 174  GLY B CA    1 
ATOM   2719 C C     . GLY B 1 174 ? 10.956  112.197 46.179 1.00 18.39 ? 174  GLY B C     1 
ATOM   2720 O O     . GLY B 1 174 ? 11.163  112.715 47.270 1.00 19.76 ? 174  GLY B O     1 
ATOM   2721 N N     . ALA B 1 175 ? 11.810  111.347 45.615 1.00 18.48 ? 175  ALA B N     1 
ATOM   2722 C CA    . ALA B 1 175 ? 13.049  110.938 46.282 1.00 18.65 ? 175  ALA B CA    1 
ATOM   2723 C C     . ALA B 1 175 ? 14.189  111.948 46.268 1.00 19.32 ? 175  ALA B C     1 
ATOM   2724 O O     . ALA B 1 175 ? 14.392  112.677 45.291 1.00 19.85 ? 175  ALA B O     1 
ATOM   2725 C CB    . ALA B 1 175 ? 13.545  109.629 45.700 1.00 16.98 ? 175  ALA B CB    1 
ATOM   2726 N N     . LYS B 1 176 ? 14.924  111.994 47.371 1.00 20.26 ? 176  LYS B N     1 
ATOM   2727 C CA    . LYS B 1 176 ? 16.092  112.860 47.476 1.00 21.13 ? 176  LYS B CA    1 
ATOM   2728 C C     . LYS B 1 176 ? 17.369  112.026 47.345 1.00 20.59 ? 176  LYS B C     1 
ATOM   2729 O O     . LYS B 1 176 ? 18.458  112.564 47.153 1.00 19.42 ? 176  LYS B O     1 
ATOM   2730 C CB    . LYS B 1 176 ? 16.075  113.649 48.778 1.00 22.28 ? 176  LYS B CB    1 
ATOM   2731 C CG    . LYS B 1 176 ? 15.107  114.807 48.719 1.00 23.90 ? 176  LYS B CG    1 
ATOM   2732 C CD    . LYS B 1 176 ? 15.541  115.913 49.624 1.00 26.04 ? 176  LYS B CD    1 
ATOM   2733 C CE    . LYS B 1 176 ? 14.802  117.181 49.282 1.00 28.02 ? 176  LYS B CE    1 
ATOM   2734 N NZ    . LYS B 1 176 ? 13.369  117.019 49.543 1.00 28.49 ? 176  LYS B NZ    1 
ATOM   2735 N N     . MET B 1 177 ? 17.201  110.706 47.405 1.00 20.73 ? 177  MET B N     1 
ATOM   2736 C CA    . MET B 1 177 ? 18.289  109.742 47.271 1.00 21.58 ? 177  MET B CA    1 
ATOM   2737 C C     . MET B 1 177 ? 17.737  108.655 46.363 1.00 19.93 ? 177  MET B C     1 
ATOM   2738 O O     . MET B 1 177 ? 16.589  108.237 46.538 1.00 20.06 ? 177  MET B O     1 
ATOM   2739 C CB    . MET B 1 177 ? 18.650  109.141 48.629 1.00 24.62 ? 177  MET B CB    1 
ATOM   2740 C CG    . MET B 1 177 ? 19.290  110.126 49.605 1.00 31.92 ? 177  MET B CG    1 
ATOM   2741 S SD    . MET B 1 177 ? 20.932  110.638 49.045 1.00 40.18 ? 177  MET B SD    1 
ATOM   2742 C CE    . MET B 1 177 ? 20.770  112.447 49.030 1.00 38.55 ? 177  MET B CE    1 
ATOM   2743 N N     . ARG B 1 178 ? 18.536  108.201 45.399 1.00 19.65 ? 178  ARG B N     1 
ATOM   2744 C CA    . ARG B 1 178 ? 18.090  107.167 44.465 1.00 20.13 ? 178  ARG B CA    1 
ATOM   2745 C C     . ARG B 1 178 ? 17.689  105.853 45.130 1.00 20.29 ? 178  ARG B C     1 
ATOM   2746 O O     . ARG B 1 178 ? 16.838  105.128 44.618 1.00 19.18 ? 178  ARG B O     1 
ATOM   2747 C CB    . ARG B 1 178 ? 19.117  106.922 43.348 1.00 19.80 ? 178  ARG B CB    1 
ATOM   2748 C CG    . ARG B 1 178 ? 20.412  106.258 43.780 1.00 19.83 ? 178  ARG B CG    1 
ATOM   2749 C CD    . ARG B 1 178 ? 21.147  105.700 42.581 1.00 19.12 ? 178  ARG B CD    1 
ATOM   2750 N NE    . ARG B 1 178 ? 21.583  106.740 41.646 1.00 20.16 ? 178  ARG B NE    1 
ATOM   2751 C CZ    . ARG B 1 178 ? 22.122  106.492 40.458 1.00 20.07 ? 178  ARG B CZ    1 
ATOM   2752 N NH1   . ARG B 1 178 ? 22.284  105.245 40.050 1.00 21.19 ? 178  ARG B NH1   1 
ATOM   2753 N NH2   . ARG B 1 178 ? 22.536  107.487 39.692 1.00 21.19 ? 178  ARG B NH2   1 
ATOM   2754 N N     . ASP B 1 179 ? 18.282  105.551 46.277 1.00 21.07 ? 179  ASP B N     1 
ATOM   2755 C CA    . ASP B 1 179 ? 17.938  104.330 46.983 1.00 22.67 ? 179  ASP B CA    1 
ATOM   2756 C C     . ASP B 1 179 ? 16.480  104.341 47.460 1.00 21.97 ? 179  ASP B C     1 
ATOM   2757 O O     . ASP B 1 179 ? 15.885  103.284 47.673 1.00 20.99 ? 179  ASP B O     1 
ATOM   2758 C CB    . ASP B 1 179 ? 18.914  104.079 48.135 1.00 26.49 ? 179  ASP B CB    1 
ATOM   2759 C CG    . ASP B 1 179 ? 20.263  103.530 47.653 1.00 31.16 ? 179  ASP B CG    1 
ATOM   2760 O OD1   . ASP B 1 179 ? 20.328  102.962 46.534 1.00 32.56 ? 179  ASP B OD1   1 
ATOM   2761 O OD2   . ASP B 1 179 ? 21.266  103.665 48.396 1.00 34.96 ? 179  ASP B OD2   1 
ATOM   2762 N N     . GLU B 1 180 ? 15.892  105.529 47.590 1.00 21.23 ? 180  GLU B N     1 
ATOM   2763 C CA    . GLU B 1 180 ? 14.486  105.633 48.002 1.00 20.86 ? 180  GLU B CA    1 
ATOM   2764 C C     . GLU B 1 180 ? 13.605  105.292 46.790 1.00 19.23 ? 180  GLU B C     1 
ATOM   2765 O O     . GLU B 1 180 ? 12.559  104.659 46.921 1.00 19.13 ? 180  GLU B O     1 
ATOM   2766 C CB    . GLU B 1 180 ? 14.180  107.032 48.540 1.00 22.79 ? 180  GLU B CB    1 
ATOM   2767 C CG    . GLU B 1 180 ? 15.036  107.410 49.750 1.00 24.81 ? 180  GLU B CG    1 
ATOM   2768 C CD    . GLU B 1 180 ? 14.921  108.874 50.132 1.00 26.57 ? 180  GLU B CD    1 
ATOM   2769 O OE1   . GLU B 1 180 ? 14.773  109.736 49.246 1.00 26.60 ? 180  GLU B OE1   1 
ATOM   2770 O OE2   . GLU B 1 180 ? 14.998  109.173 51.336 1.00 30.60 ? 180  GLU B OE2   1 
ATOM   2771 N N     . THR B 1 181 ? 14.064  105.679 45.606 1.00 17.62 ? 181  THR B N     1 
ATOM   2772 C CA    . THR B 1 181 ? 13.355  105.377 44.372 1.00 18.09 ? 181  THR B CA    1 
ATOM   2773 C C     . THR B 1 181 ? 13.291  103.850 44.222 1.00 17.71 ? 181  THR B C     1 
ATOM   2774 O O     . THR B 1 181 ? 12.241  103.274 43.934 1.00 17.45 ? 181  THR B O     1 
ATOM   2775 C CB    . THR B 1 181 ? 14.113  105.959 43.160 1.00 16.48 ? 181  THR B CB    1 
ATOM   2776 O OG1   . THR B 1 181 ? 14.302  107.364 43.348 1.00 14.94 ? 181  THR B OG1   1 
ATOM   2777 C CG2   . THR B 1 181 ? 13.330  105.727 41.877 1.00 17.15 ? 181  THR B CG2   1 
ATOM   2778 N N     . TYR B 1 182 ? 14.432  103.206 44.435 1.00 17.56 ? 182  TYR B N     1 
ATOM   2779 C CA    . TYR B 1 182 ? 14.551  101.752 44.334 1.00 17.58 ? 182  TYR B CA    1 
ATOM   2780 C C     . TYR B 1 182 ? 13.720  101.034 45.393 1.00 17.76 ? 182  TYR B C     1 
ATOM   2781 O O     . TYR B 1 182 ? 13.008  100.072 45.090 1.00 18.33 ? 182  TYR B O     1 
ATOM   2782 C CB    . TYR B 1 182 ? 16.019  101.333 44.468 1.00 17.21 ? 182  TYR B CB    1 
ATOM   2783 C CG    . TYR B 1 182 ? 16.948  101.937 43.437 1.00 17.13 ? 182  TYR B CG    1 
ATOM   2784 C CD1   . TYR B 1 182 ? 16.483  102.297 42.164 1.00 18.48 ? 182  TYR B CD1   1 
ATOM   2785 C CD2   . TYR B 1 182 ? 18.296  102.126 43.719 1.00 17.46 ? 182  TYR B CD2   1 
ATOM   2786 C CE1   . TYR B 1 182 ? 17.345  102.831 41.196 1.00 17.90 ? 182  TYR B CE1   1 
ATOM   2787 C CE2   . TYR B 1 182 ? 19.166  102.655 42.761 1.00 18.25 ? 182  TYR B CE2   1 
ATOM   2788 C CZ    . TYR B 1 182 ? 18.687  103.005 41.504 1.00 18.07 ? 182  TYR B CZ    1 
ATOM   2789 O OH    . TYR B 1 182 ? 19.558  103.515 40.566 1.00 20.07 ? 182  TYR B OH    1 
ATOM   2790 N N     . LYS B 1 183 ? 13.823  101.495 46.634 1.00 18.49 ? 183  LYS B N     1 
ATOM   2791 C CA    . LYS B 1 183 ? 13.090  100.899 47.751 1.00 19.13 ? 183  LYS B CA    1 
ATOM   2792 C C     . LYS B 1 183 ? 11.574  100.987 47.521 1.00 19.42 ? 183  LYS B C     1 
ATOM   2793 O O     . LYS B 1 183 ? 10.845  100.016 47.740 1.00 19.74 ? 183  LYS B O     1 
ATOM   2794 C CB    . LYS B 1 183 ? 13.495  101.579 49.060 1.00 19.70 ? 183  LYS B CB    1 
ATOM   2795 C CG    . LYS B 1 183 ? 12.912  100.953 50.303 1.00 22.24 ? 183  LYS B CG    1 
ATOM   2796 C CD    . LYS B 1 183 ? 13.336  99.500  50.445 1.00 25.71 ? 183  LYS B CD    1 
ATOM   2797 C CE    . LYS B 1 183 ? 12.719  98.908  51.695 1.00 27.41 ? 183  LYS B CE    1 
ATOM   2798 N NZ    . LYS B 1 183 ? 12.972  97.453  51.823 1.00 30.27 ? 183  LYS B NZ    1 
ATOM   2799 N N     . ALA B 1 184 ? 11.106  102.142 47.051 1.00 19.81 ? 184  ALA B N     1 
ATOM   2800 C CA    . ALA B 1 184 ? 9.685   102.336 46.763 1.00 18.99 ? 184  ALA B CA    1 
ATOM   2801 C C     . ALA B 1 184 ? 9.236   101.319 45.711 1.00 18.51 ? 184  ALA B C     1 
ATOM   2802 O O     . ALA B 1 184 ? 8.204   100.676 45.878 1.00 19.34 ? 184  ALA B O     1 
ATOM   2803 C CB    . ALA B 1 184 ? 9.424   103.764 46.277 1.00 17.46 ? 184  ALA B CB    1 
ATOM   2804 N N     . PHE B 1 185 ? 10.010  101.160 44.634 1.00 18.80 ? 185  PHE B N     1 
ATOM   2805 C CA    . PHE B 1 185 ? 9.648   100.184 43.610 1.00 18.25 ? 185  PHE B CA    1 
ATOM   2806 C C     . PHE B 1 185 ? 9.673   98.755  44.152 1.00 17.65 ? 185  PHE B C     1 
ATOM   2807 O O     . PHE B 1 185 ? 8.762   97.973  43.887 1.00 16.85 ? 185  PHE B O     1 
ATOM   2808 C CB    . PHE B 1 185 ? 10.547  100.255 42.371 1.00 18.55 ? 185  PHE B CB    1 
ATOM   2809 C CG    . PHE B 1 185 ? 10.228  99.179  41.349 1.00 19.51 ? 185  PHE B CG    1 
ATOM   2810 C CD1   . PHE B 1 185 ? 8.994   99.177  40.686 1.00 19.68 ? 185  PHE B CD1   1 
ATOM   2811 C CD2   . PHE B 1 185 ? 11.097  98.101  41.148 1.00 18.52 ? 185  PHE B CD2   1 
ATOM   2812 C CE1   . PHE B 1 185 ? 8.628   98.114  39.854 1.00 18.42 ? 185  PHE B CE1   1 
ATOM   2813 C CE2   . PHE B 1 185 ? 10.737  97.040  40.320 1.00 17.33 ? 185  PHE B CE2   1 
ATOM   2814 C CZ    . PHE B 1 185 ? 9.502   97.045  39.676 1.00 17.95 ? 185  PHE B CZ    1 
ATOM   2815 N N     . GLU B 1 186 ? 10.722  98.407  44.891 1.00 17.81 ? 186  GLU B N     1 
ATOM   2816 C CA    . GLU B 1 186 ? 10.827  97.068  45.453 1.00 18.72 ? 186  GLU B CA    1 
ATOM   2817 C C     . GLU B 1 186 ? 9.690   96.809  46.441 1.00 19.39 ? 186  GLU B C     1 
ATOM   2818 O O     . GLU B 1 186 ? 9.195   95.679  46.560 1.00 20.04 ? 186  GLU B O     1 
ATOM   2819 C CB    . GLU B 1 186 ? 12.195  96.864  46.099 1.00 18.57 ? 186  GLU B CB    1 
ATOM   2820 C CG    . GLU B 1 186 ? 13.346  96.911  45.100 1.00 19.76 ? 186  GLU B CG    1 
ATOM   2821 C CD    . GLU B 1 186 ? 13.304  95.785  44.060 1.00 20.45 ? 186  GLU B CD    1 
ATOM   2822 O OE1   . GLU B 1 186 ? 12.691  94.728  44.315 1.00 21.01 ? 186  GLU B OE1   1 
ATOM   2823 O OE2   . GLU B 1 186 ? 13.917  95.941  42.992 1.00 19.81 ? 186  GLU B OE2   1 
ATOM   2824 N N     . ASN B 1 187 ? 9.247   97.867  47.112 1.00 18.45 ? 187  ASN B N     1 
ATOM   2825 C CA    . ASN B 1 187 ? 8.145   97.760  48.046 1.00 19.10 ? 187  ASN B CA    1 
ATOM   2826 C C     . ASN B 1 187 ? 6.830   97.494  47.321 1.00 19.38 ? 187  ASN B C     1 
ATOM   2827 O O     . ASN B 1 187 ? 6.010   96.703  47.784 1.00 21.41 ? 187  ASN B O     1 
ATOM   2828 C CB    . ASN B 1 187 ? 7.992   99.044  48.869 1.00 18.93 ? 187  ASN B CB    1 
ATOM   2829 C CG    . ASN B 1 187 ? 8.963   99.124  50.019 1.00 18.54 ? 187  ASN B CG    1 
ATOM   2830 O OD1   . ASN B 1 187 ? 9.797   98.242  50.206 1.00 20.16 ? 187  ASN B OD1   1 
ATOM   2831 N ND2   . ASN B 1 187 ? 8.862   100.183 50.800 1.00 17.04 ? 187  ASN B ND2   1 
ATOM   2832 N N     . ILE B 1 188 ? 6.619   98.149  46.188 1.00 18.52 ? 188  ILE B N     1 
ATOM   2833 C CA    . ILE B 1 188 ? 5.363   97.992  45.468 1.00 18.08 ? 188  ILE B CA    1 
ATOM   2834 C C     . ILE B 1 188 ? 5.276   96.794  44.528 1.00 18.19 ? 188  ILE B C     1 
ATOM   2835 O O     . ILE B 1 188 ? 4.182   96.288  44.261 1.00 19.04 ? 188  ILE B O     1 
ATOM   2836 C CB    . ILE B 1 188 ? 4.999   99.294  44.684 1.00 18.36 ? 188  ILE B CB    1 
ATOM   2837 C CG1   . ILE B 1 188 ? 3.477   99.405  44.506 1.00 17.91 ? 188  ILE B CG1   1 
ATOM   2838 C CG2   . ILE B 1 188 ? 5.682   99.317  43.308 1.00 17.28 ? 188  ILE B CG2   1 
ATOM   2839 C CD1   . ILE B 1 188 ? 2.714   99.707  45.786 1.00 18.40 ? 188  ILE B CD1   1 
ATOM   2840 N N     . TYR B 1 189 ? 6.421   96.327  44.045 1.00 18.28 ? 189  TYR B N     1 
ATOM   2841 C CA    . TYR B 1 189 ? 6.457   95.223  43.103 1.00 18.36 ? 189  TYR B CA    1 
ATOM   2842 C C     . TYR B 1 189 ? 5.627   93.995  43.502 1.00 19.17 ? 189  TYR B C     1 
ATOM   2843 O O     . TYR B 1 189 ? 4.805   93.522  42.701 1.00 19.03 ? 189  TYR B O     1 
ATOM   2844 C CB    . TYR B 1 189 ? 7.903   94.853  42.782 1.00 18.28 ? 189  TYR B CB    1 
ATOM   2845 C CG    . TYR B 1 189 ? 8.045   93.830  41.683 1.00 20.07 ? 189  TYR B CG    1 
ATOM   2846 C CD1   . TYR B 1 189 ? 7.408   94.003  40.452 1.00 20.37 ? 189  TYR B CD1   1 
ATOM   2847 C CD2   . TYR B 1 189 ? 8.822   92.686  41.865 1.00 18.69 ? 189  TYR B CD2   1 
ATOM   2848 C CE1   . TYR B 1 189 ? 7.540   93.059  39.436 1.00 19.77 ? 189  TYR B CE1   1 
ATOM   2849 C CE2   . TYR B 1 189 ? 8.964   91.748  40.848 1.00 19.57 ? 189  TYR B CE2   1 
ATOM   2850 C CZ    . TYR B 1 189 ? 8.321   91.940  39.644 1.00 18.54 ? 189  TYR B CZ    1 
ATOM   2851 O OH    . TYR B 1 189 ? 8.460   91.014  38.643 1.00 21.26 ? 189  TYR B OH    1 
ATOM   2852 N N     . PRO B 1 190 ? 5.844   93.442  44.718 1.00 19.88 ? 190  PRO B N     1 
ATOM   2853 C CA    . PRO B 1 190 ? 5.065   92.270  45.143 1.00 20.82 ? 190  PRO B CA    1 
ATOM   2854 C C     . PRO B 1 190 ? 3.575   92.557  45.406 1.00 21.56 ? 190  PRO B C     1 
ATOM   2855 O O     . PRO B 1 190 ? 2.786   91.632  45.613 1.00 22.07 ? 190  PRO B O     1 
ATOM   2856 C CB    . PRO B 1 190 ? 5.807   91.796  46.403 1.00 20.43 ? 190  PRO B CB    1 
ATOM   2857 C CG    . PRO B 1 190 ? 6.479   93.022  46.912 1.00 20.62 ? 190  PRO B CG    1 
ATOM   2858 C CD    . PRO B 1 190 ? 6.962   93.680  45.651 1.00 20.32 ? 190  PRO B CD    1 
ATOM   2859 N N     . VAL B 1 191 ? 3.197   93.832  45.440 1.00 21.11 ? 191  VAL B N     1 
ATOM   2860 C CA    . VAL B 1 191 ? 1.800   94.187  45.637 1.00 21.49 ? 191  VAL B CA    1 
ATOM   2861 C C     . VAL B 1 191 ? 1.150   94.132  44.265 1.00 21.74 ? 191  VAL B C     1 
ATOM   2862 O O     . VAL B 1 191 ? 0.104   93.522  44.071 1.00 22.30 ? 191  VAL B O     1 
ATOM   2863 C CB    . VAL B 1 191 ? 1.633   95.615  46.197 1.00 22.15 ? 191  VAL B CB    1 
ATOM   2864 C CG1   . VAL B 1 191 ? 0.144   95.948  46.336 1.00 21.58 ? 191  VAL B CG1   1 
ATOM   2865 C CG2   . VAL B 1 191 ? 2.336   95.752  47.542 1.00 22.06 ? 191  VAL B CG2   1 
ATOM   2866 N N     . LEU B 1 192 ? 1.810   94.746  43.295 1.00 23.34 ? 192  LEU B N     1 
ATOM   2867 C CA    . LEU B 1 192 ? 1.306   94.783  41.928 1.00 23.58 ? 192  LEU B CA    1 
ATOM   2868 C C     . LEU B 1 192 ? 1.096   93.382  41.340 1.00 24.97 ? 192  LEU B C     1 
ATOM   2869 O O     . LEU B 1 192 ? 0.177   93.177  40.543 1.00 25.40 ? 192  LEU B O     1 
ATOM   2870 C CB    . LEU B 1 192 ? 2.250   95.598  41.039 1.00 22.35 ? 192  LEU B CB    1 
ATOM   2871 C CG    . LEU B 1 192 ? 2.516   97.064  41.408 1.00 22.57 ? 192  LEU B CG    1 
ATOM   2872 C CD1   . LEU B 1 192 ? 3.363   97.691  40.312 1.00 21.50 ? 192  LEU B CD1   1 
ATOM   2873 C CD2   . LEU B 1 192 ? 1.205   97.837  41.580 1.00 21.60 ? 192  LEU B CD2   1 
ATOM   2874 N N     . SER B 1 193 ? 1.951   92.424  41.705 1.00 26.10 ? 193  SER B N     1 
ATOM   2875 C CA    . SER B 1 193 ? 1.808   91.057  41.196 1.00 27.14 ? 193  SER B CA    1 
ATOM   2876 C C     . SER B 1 193 ? 0.494   90.432  41.680 1.00 27.68 ? 193  SER B C     1 
ATOM   2877 O O     . SER B 1 193 ? -0.062  89.567  41.009 1.00 28.54 ? 193  SER B O     1 
ATOM   2878 C CB    . SER B 1 193 ? 3.006   90.178  41.584 1.00 25.44 ? 193  SER B CB    1 
ATOM   2879 O OG    . SER B 1 193 ? 3.141   90.085  42.989 1.00 26.68 ? 193  SER B OG    1 
ATOM   2880 N N     . GLU B 1 194 ? -0.015  90.892  42.824 1.00 27.99 ? 194  GLU B N     1 
ATOM   2881 C CA    . GLU B 1 194 ? -1.280  90.391  43.357 1.00 29.38 ? 194  GLU B CA    1 
ATOM   2882 C C     . GLU B 1 194 ? -2.446  90.977  42.562 1.00 29.97 ? 194  GLU B C     1 
ATOM   2883 O O     . GLU B 1 194 ? -3.598  90.584  42.771 1.00 30.39 ? 194  GLU B O     1 
ATOM   2884 C CB    . GLU B 1 194 ? -1.477  90.812  44.813 1.00 31.25 ? 194  GLU B CB    1 
ATOM   2885 C CG    . GLU B 1 194 ? -0.422  90.340  45.779 1.00 36.45 ? 194  GLU B CG    1 
ATOM   2886 C CD    . GLU B 1 194 ? -0.612  90.914  47.173 1.00 39.53 ? 194  GLU B CD    1 
ATOM   2887 O OE1   . GLU B 1 194 ? -1.762  90.888  47.673 1.00 41.54 ? 194  GLU B OE1   1 
ATOM   2888 O OE2   . GLU B 1 194 ? 0.391   91.393  47.763 1.00 40.63 ? 194  GLU B OE2   1 
ATOM   2889 N N     . PHE B 1 195 ? -2.167  91.960  41.705 1.00 28.54 ? 195  PHE B N     1 
ATOM   2890 C CA    . PHE B 1 195 ? -3.223  92.591  40.930 1.00 27.68 ? 195  PHE B CA    1 
ATOM   2891 C C     . PHE B 1 195 ? -2.994  92.598  39.434 1.00 28.34 ? 195  PHE B C     1 
ATOM   2892 O O     . PHE B 1 195 ? -3.465  93.496  38.741 1.00 28.34 ? 195  PHE B O     1 
ATOM   2893 C CB    . PHE B 1 195 ? -3.479  94.009  41.437 1.00 25.43 ? 195  PHE B CB    1 
ATOM   2894 C CG    . PHE B 1 195 ? -3.882  94.059  42.872 1.00 25.37 ? 195  PHE B CG    1 
ATOM   2895 C CD1   . PHE B 1 195 ? -5.191  93.785  43.247 1.00 24.52 ? 195  PHE B CD1   1 
ATOM   2896 C CD2   . PHE B 1 195 ? -2.936  94.323  43.865 1.00 24.56 ? 195  PHE B CD2   1 
ATOM   2897 C CE1   . PHE B 1 195 ? -5.550  93.768  44.596 1.00 26.23 ? 195  PHE B CE1   1 
ATOM   2898 C CE2   . PHE B 1 195 ? -3.282  94.308  45.220 1.00 23.75 ? 195  PHE B CE2   1 
ATOM   2899 C CZ    . PHE B 1 195 ? -4.586  94.030  45.586 1.00 23.64 ? 195  PHE B CZ    1 
ATOM   2900 N N     . ARG B 1 196 ? -2.287  91.592  38.928 1.00 29.29 ? 196  ARG B N     1 
ATOM   2901 C CA    . ARG B 1 196 ? -2.032  91.501  37.495 1.00 30.68 ? 196  ARG B CA    1 
ATOM   2902 C C     . ARG B 1 196 ? -3.390  91.384  36.805 1.00 32.56 ? 196  ARG B C     1 
ATOM   2903 O O     . ARG B 1 196 ? -4.304  90.762  37.341 1.00 33.61 ? 196  ARG B O     1 
ATOM   2904 C CB    . ARG B 1 196 ? -1.191  90.264  37.184 1.00 29.35 ? 196  ARG B CB    1 
ATOM   2905 C CG    . ARG B 1 196 ? -0.729  90.151  35.740 1.00 28.63 ? 196  ARG B CG    1 
ATOM   2906 C CD    . ARG B 1 196 ? -0.016  88.827  35.522 1.00 28.58 ? 196  ARG B CD    1 
ATOM   2907 N NE    . ARG B 1 196 ? 0.798   88.796  34.307 1.00 29.42 ? 196  ARG B NE    1 
ATOM   2908 C CZ    . ARG B 1 196 ? 0.325   88.886  33.066 1.00 30.16 ? 196  ARG B CZ    1 
ATOM   2909 N NH1   . ARG B 1 196 ? -0.980  89.021  32.838 1.00 29.89 ? 196  ARG B NH1   1 
ATOM   2910 N NH2   . ARG B 1 196 ? 1.170   88.822  32.042 1.00 29.17 ? 196  ARG B NH2   1 
ATOM   2911 N N     . LYS B 1 197 ? -3.525  91.990  35.632 1.00 33.77 ? 197  LYS B N     1 
ATOM   2912 C CA    . LYS B 1 197 ? -4.775  91.949  34.888 1.00 35.80 ? 197  LYS B CA    1 
ATOM   2913 C C     . LYS B 1 197 ? -4.775  90.816  33.863 1.00 36.46 ? 197  LYS B C     1 
ATOM   2914 O O     . LYS B 1 197 ? -3.698  90.563  33.273 1.00 37.45 ? 197  LYS B O     1 
ATOM   2915 C CB    . LYS B 1 197 ? -5.016  93.300  34.208 1.00 37.01 ? 197  LYS B CB    1 
ATOM   2916 C CG    . LYS B 1 197 ? -6.120  93.315  33.171 1.00 39.67 ? 197  LYS B CG    1 
ATOM   2917 C CD    . LYS B 1 197 ? -6.425  94.739  32.738 1.00 42.70 ? 197  LYS B CD    1 
ATOM   2918 C CE    . LYS B 1 197 ? -6.305  94.935  31.222 1.00 45.09 ? 197  LYS B CE    1 
ATOM   2919 N NZ    . LYS B 1 197 ? -4.886  95.027  30.722 1.00 46.20 ? 197  LYS B NZ    1 
ATOM   2920 C "C4'" . DG  C 2 1   ? 9.382   57.009  59.646 1.00 55.88 ? 201  DG  C "C4'" 1 
ATOM   2921 O "O4'" . DG  C 2 1   ? 8.586   57.205  60.824 1.00 54.27 ? 201  DG  C "O4'" 1 
ATOM   2922 C "C3'" . DG  C 2 1   ? 8.713   57.893  58.599 1.00 56.27 ? 201  DG  C "C3'" 1 
ATOM   2923 O "O3'" . DG  C 2 1   ? 9.058   57.498  57.253 1.00 58.17 ? 201  DG  C "O3'" 1 
ATOM   2924 C "C2'" . DG  C 2 1   ? 7.255   57.655  58.969 1.00 54.45 ? 201  DG  C "C2'" 1 
ATOM   2925 C "C1'" . DG  C 2 1   ? 7.352   57.852  60.470 1.00 52.42 ? 201  DG  C "C1'" 1 
ATOM   2926 N N9    . DG  C 2 1   ? 7.426   59.284  60.815 1.00 50.47 ? 201  DG  C N9    1 
ATOM   2927 C C8    . DG  C 2 1   ? 8.420   59.942  61.487 1.00 49.74 ? 201  DG  C C8    1 
ATOM   2928 N N7    . DG  C 2 1   ? 8.193   61.214  61.651 1.00 49.68 ? 201  DG  C N7    1 
ATOM   2929 C C5    . DG  C 2 1   ? 6.957   61.421  61.044 1.00 48.68 ? 201  DG  C C5    1 
ATOM   2930 C C6    . DG  C 2 1   ? 6.200   62.617  60.902 1.00 47.98 ? 201  DG  C C6    1 
ATOM   2931 O O6    . DG  C 2 1   ? 6.472   63.752  61.289 1.00 47.14 ? 201  DG  C O6    1 
ATOM   2932 N N1    . DG  C 2 1   ? 5.022   62.388  60.220 1.00 47.28 ? 201  DG  C N1    1 
ATOM   2933 C C2    . DG  C 2 1   ? 4.614   61.167  59.732 1.00 47.55 ? 201  DG  C C2    1 
ATOM   2934 N N2    . DG  C 2 1   ? 3.447   61.144  59.096 1.00 47.64 ? 201  DG  C N2    1 
ATOM   2935 N N3    . DG  C 2 1   ? 5.321   60.040  59.862 1.00 48.03 ? 201  DG  C N3    1 
ATOM   2936 C C4    . DG  C 2 1   ? 6.479   60.244  60.528 1.00 49.12 ? 201  DG  C C4    1 
ATOM   2937 P P     . DC  C 2 2   ? 8.455   56.210  56.478 1.00 59.07 ? 202  DC  C P     1 
ATOM   2938 O OP1   . DC  C 2 2   ? 8.088   55.173  57.475 1.00 58.33 ? 202  DC  C OP1   1 
ATOM   2939 O OP2   . DC  C 2 2   ? 9.393   55.877  55.380 1.00 58.82 ? 202  DC  C OP2   1 
ATOM   2940 O "O5'" . DC  C 2 2   ? 7.101   56.835  55.829 1.00 58.34 ? 202  DC  C "O5'" 1 
ATOM   2941 C "C5'" . DC  C 2 2   ? 5.803   56.221  55.954 1.00 57.24 ? 202  DC  C "C5'" 1 
ATOM   2942 C "C4'" . DC  C 2 2   ? 4.657   57.246  55.845 1.00 55.99 ? 202  DC  C "C4'" 1 
ATOM   2943 O "O4'" . DC  C 2 2   ? 4.815   58.253  56.846 1.00 54.97 ? 202  DC  C "O4'" 1 
ATOM   2944 C "C3'" . DC  C 2 2   ? 4.689   58.014  54.515 1.00 54.81 ? 202  DC  C "C3'" 1 
ATOM   2945 O "O3'" . DC  C 2 2   ? 3.904   57.359  53.516 1.00 54.25 ? 202  DC  C "O3'" 1 
ATOM   2946 C "C2'" . DC  C 2 2   ? 4.016   59.339  54.864 1.00 53.67 ? 202  DC  C "C2'" 1 
ATOM   2947 C "C1'" . DC  C 2 2   ? 4.396   59.527  56.324 1.00 53.22 ? 202  DC  C "C1'" 1 
ATOM   2948 N N1    . DC  C 2 2   ? 5.439   60.560  56.549 1.00 50.20 ? 202  DC  C N1    1 
ATOM   2949 C C2    . DC  C 2 2   ? 5.087   61.889  56.416 1.00 49.30 ? 202  DC  C C2    1 
ATOM   2950 O O2    . DC  C 2 2   ? 3.972   62.209  56.015 1.00 49.01 ? 202  DC  C O2    1 
ATOM   2951 N N3    . DC  C 2 2   ? 6.016   62.830  56.714 1.00 49.04 ? 202  DC  C N3    1 
ATOM   2952 C C4    . DC  C 2 2   ? 7.244   62.488  57.120 1.00 49.50 ? 202  DC  C C4    1 
ATOM   2953 N N4    . DC  C 2 2   ? 8.128   63.440  57.422 1.00 49.93 ? 202  DC  C N4    1 
ATOM   2954 C C5    . DC  C 2 2   ? 7.622   61.119  57.249 1.00 49.82 ? 202  DC  C C5    1 
ATOM   2955 C C6    . DC  C 2 2   ? 6.684   60.200  56.951 1.00 49.82 ? 202  DC  C C6    1 
ATOM   2956 P P     . DT  C 2 3   ? 4.104   57.756  51.968 1.00 54.04 ? 203  DT  C P     1 
ATOM   2957 O OP1   . DT  C 2 3   ? 3.160   56.951  51.159 1.00 53.66 ? 203  DT  C OP1   1 
ATOM   2958 O OP2   . DT  C 2 3   ? 5.554   57.695  51.674 1.00 54.90 ? 203  DT  C OP2   1 
ATOM   2959 O "O5'" . DT  C 2 3   ? 3.633   59.299  51.897 1.00 51.15 ? 203  DT  C "O5'" 1 
ATOM   2960 C "C5'" . DT  C 2 3   ? 2.387   59.673  51.294 1.00 48.98 ? 203  DT  C "C5'" 1 
ATOM   2961 C "C4'" . DT  C 2 3   ? 2.293   61.186  51.057 1.00 46.09 ? 203  DT  C "C4'" 1 
ATOM   2962 O "O4'" . DT  C 2 3   ? 2.720   61.876  52.232 1.00 45.24 ? 203  DT  C "O4'" 1 
ATOM   2963 C "C3'" . DT  C 2 3   ? 3.252   61.654  49.970 1.00 45.46 ? 203  DT  C "C3'" 1 
ATOM   2964 O "O3'" . DT  C 2 3   ? 2.643   61.538  48.674 1.00 45.02 ? 203  DT  C "O3'" 1 
ATOM   2965 C "C2'" . DT  C 2 3   ? 3.423   63.120  50.349 1.00 43.26 ? 203  DT  C "C2'" 1 
ATOM   2966 C "C1'" . DT  C 2 3   ? 3.438   63.057  51.866 1.00 41.82 ? 203  DT  C "C1'" 1 
ATOM   2967 N N1    . DT  C 2 3   ? 4.793   63.022  52.463 1.00 39.78 ? 203  DT  C N1    1 
ATOM   2968 C C2    . DT  C 2 3   ? 5.273   64.191  53.025 1.00 38.45 ? 203  DT  C C2    1 
ATOM   2969 O O2    . DT  C 2 3   ? 4.651   65.253  53.015 1.00 38.92 ? 203  DT  C O2    1 
ATOM   2970 N N3    . DT  C 2 3   ? 6.511   64.105  53.614 1.00 37.41 ? 203  DT  C N3    1 
ATOM   2971 C C4    . DT  C 2 3   ? 7.310   62.990  53.699 1.00 36.87 ? 203  DT  C C4    1 
ATOM   2972 O O4    . DT  C 2 3   ? 8.396   63.056  54.273 1.00 36.25 ? 203  DT  C O4    1 
ATOM   2973 C C5    . DT  C 2 3   ? 6.738   61.818  53.086 1.00 37.09 ? 203  DT  C C5    1 
ATOM   2974 C C7    . DT  C 2 3   ? 7.502   60.506  53.109 1.00 38.03 ? 203  DT  C C7    1 
ATOM   2975 C C6    . DT  C 2 3   ? 5.530   61.866  52.501 1.00 38.43 ? 203  DT  C C6    1 
ATOM   2976 P P     . DA  C 2 4   ? 3.562   61.380  47.359 1.00 45.38 ? 204  DA  C P     1 
ATOM   2977 O OP1   . DA  C 2 4   ? 2.693   61.385  46.159 1.00 43.39 ? 204  DA  C OP1   1 
ATOM   2978 O OP2   . DA  C 2 4   ? 4.520   60.273  47.577 1.00 45.07 ? 204  DA  C OP2   1 
ATOM   2979 O "O5'" . DA  C 2 4   ? 4.393   62.757  47.394 1.00 42.57 ? 204  DA  C "O5'" 1 
ATOM   2980 C "C5'" . DA  C 2 4   ? 3.858   63.976  46.868 1.00 37.22 ? 204  DA  C "C5'" 1 
ATOM   2981 C "C4'" . DA  C 2 4   ? 4.990   64.937  46.574 1.00 32.87 ? 204  DA  C "C4'" 1 
ATOM   2982 O "O4'" . DA  C 2 4   ? 5.729   65.198  47.761 1.00 30.04 ? 204  DA  C "O4'" 1 
ATOM   2983 C "C3'" . DA  C 2 4   ? 5.951   64.265  45.608 1.00 31.07 ? 204  DA  C "C3'" 1 
ATOM   2984 O "O3'" . DA  C 2 4   ? 6.099   65.070  44.441 1.00 32.00 ? 204  DA  C "O3'" 1 
ATOM   2985 C "C2'" . DA  C 2 4   ? 7.250   64.090  46.397 1.00 29.77 ? 204  DA  C "C2'" 1 
ATOM   2986 C "C1'" . DA  C 2 4   ? 7.123   65.125  47.497 1.00 27.24 ? 204  DA  C "C1'" 1 
ATOM   2987 N N9    . DA  C 2 4   ? 7.787   64.691  48.736 1.00 25.82 ? 204  DA  C N9    1 
ATOM   2988 C C8    . DA  C 2 4   ? 7.423   63.677  49.584 1.00 26.31 ? 204  DA  C C8    1 
ATOM   2989 N N7    . DA  C 2 4   ? 8.187   63.561  50.636 1.00 25.74 ? 204  DA  C N7    1 
ATOM   2990 C C5    . DA  C 2 4   ? 9.127   64.569  50.474 1.00 24.41 ? 204  DA  C C5    1 
ATOM   2991 C C6    . DA  C 2 4   ? 10.207  64.979  51.259 1.00 24.25 ? 204  DA  C C6    1 
ATOM   2992 N N6    . DA  C 2 4   ? 10.537  64.399  52.416 1.00 23.18 ? 204  DA  C N6    1 
ATOM   2993 N N1    . DA  C 2 4   ? 10.925  66.018  50.801 1.00 24.17 ? 204  DA  C N1    1 
ATOM   2994 C C2    . DA  C 2 4   ? 10.593  66.602  49.657 1.00 23.16 ? 204  DA  C C2    1 
ATOM   2995 N N3    . DA  C 2 4   ? 9.606   66.313  48.834 1.00 23.20 ? 204  DA  C N3    1 
ATOM   2996 C C4    . DA  C 2 4   ? 8.897   65.264  49.315 1.00 24.85 ? 204  DA  C C4    1 
ATOM   2997 P P     . DT  C 2 5   ? 6.765   64.437  43.134 1.00 32.42 ? 205  DT  C P     1 
ATOM   2998 O OP1   . DT  C 2 5   ? 6.257   65.148  41.939 1.00 32.55 ? 205  DT  C OP1   1 
ATOM   2999 O OP2   . DT  C 2 5   ? 6.670   62.963  43.221 1.00 34.49 ? 205  DT  C OP2   1 
ATOM   3000 O "O5'" . DT  C 2 5   ? 8.288   64.863  43.376 1.00 30.47 ? 205  DT  C "O5'" 1 
ATOM   3001 C "C5'" . DT  C 2 5   ? 8.688   66.216  43.166 1.00 25.79 ? 205  DT  C "C5'" 1 
ATOM   3002 C "C4'" . DT  C 2 5   ? 10.177  66.364  43.359 1.00 24.21 ? 205  DT  C "C4'" 1 
ATOM   3003 O "O4'" . DT  C 2 5   ? 10.508  66.234  44.719 1.00 22.91 ? 205  DT  C "O4'" 1 
ATOM   3004 C "C3'" . DT  C 2 5   ? 10.897  65.195  42.699 1.00 24.56 ? 205  DT  C "C3'" 1 
ATOM   3005 O "O3'" . DT  C 2 5   ? 11.104  65.525  41.327 1.00 26.57 ? 205  DT  C "O3'" 1 
ATOM   3006 C "C2'" . DT  C 2 5   ? 12.206  65.095  43.483 1.00 23.28 ? 205  DT  C "C2'" 1 
ATOM   3007 C "C1'" . DT  C 2 5   ? 11.888  65.854  44.775 1.00 22.04 ? 205  DT  C "C1'" 1 
ATOM   3008 N N1    . DT  C 2 5   ? 12.069  65.066  46.006 1.00 20.90 ? 205  DT  C N1    1 
ATOM   3009 C C2    . DT  C 2 5   ? 13.028  65.496  46.898 1.00 19.76 ? 205  DT  C C2    1 
ATOM   3010 O O2    . DT  C 2 5   ? 13.795  66.422  46.658 1.00 18.95 ? 205  DT  C O2    1 
ATOM   3011 N N3    . DT  C 2 5   ? 13.108  64.798  48.079 1.00 20.16 ? 205  DT  C N3    1 
ATOM   3012 C C4    . DT  C 2 5   ? 12.334  63.720  48.443 1.00 20.04 ? 205  DT  C C4    1 
ATOM   3013 O O4    . DT  C 2 5   ? 12.486  63.207  49.548 1.00 20.55 ? 205  DT  C O4    1 
ATOM   3014 C C5    . DT  C 2 5   ? 11.366  63.324  47.444 1.00 21.05 ? 205  DT  C C5    1 
ATOM   3015 C C7    . DT  C 2 5   ? 10.451  62.124  47.695 1.00 20.86 ? 205  DT  C C7    1 
ATOM   3016 C C6    . DT  C 2 5   ? 11.265  63.994  46.284 1.00 20.41 ? 205  DT  C C6    1 
ATOM   3017 P P     . DA  C 2 6   ? 11.379  64.403  40.222 1.00 29.26 ? 206  DA  C P     1 
ATOM   3018 O OP1   . DA  C 2 6   ? 10.795  64.890  38.959 1.00 31.81 ? 206  DA  C OP1   1 
ATOM   3019 O OP2   . DA  C 2 6   ? 10.987  63.083  40.768 1.00 29.14 ? 206  DA  C OP2   1 
ATOM   3020 O "O5'" . DA  C 2 6   ? 12.977  64.384  40.063 1.00 27.53 ? 206  DA  C "O5'" 1 
ATOM   3021 C "C5'" . DA  C 2 6   ? 13.743  65.525  39.688 1.00 23.96 ? 206  DA  C "C5'" 1 
ATOM   3022 C "C4'" . DA  C 2 6   ? 15.163  65.357  40.187 1.00 23.71 ? 206  DA  C "C4'" 1 
ATOM   3023 O "O4'" . DA  C 2 6   ? 15.159  65.257  41.604 1.00 22.91 ? 206  DA  C "O4'" 1 
ATOM   3024 C "C3'" . DA  C 2 6   ? 15.715  64.024  39.710 1.00 23.97 ? 206  DA  C "C3'" 1 
ATOM   3025 O "O3'" . DA  C 2 6   ? 16.334  64.227  38.433 1.00 26.84 ? 206  DA  C "O3'" 1 
ATOM   3026 C "C2'" . DA  C 2 6   ? 16.741  63.665  40.796 1.00 22.12 ? 206  DA  C "C2'" 1 
ATOM   3027 C "C1'" . DA  C 2 6   ? 16.206  64.386  42.043 1.00 21.01 ? 206  DA  C "C1'" 1 
ATOM   3028 N N9    . DA  C 2 6   ? 15.659  63.499  43.104 1.00 19.10 ? 206  DA  C N9    1 
ATOM   3029 C C8    . DA  C 2 6   ? 14.692  62.539  43.003 1.00 18.47 ? 206  DA  C C8    1 
ATOM   3030 N N7    . DA  C 2 6   ? 14.386  61.980  44.137 1.00 18.54 ? 206  DA  C N7    1 
ATOM   3031 C C5    . DA  C 2 6   ? 15.209  62.610  45.062 1.00 17.93 ? 206  DA  C C5    1 
ATOM   3032 C C6    . DA  C 2 6   ? 15.365  62.466  46.452 1.00 17.43 ? 206  DA  C C6    1 
ATOM   3033 N N6    . DA  C 2 6   ? 14.656  61.610  47.187 1.00 17.86 ? 206  DA  C N6    1 
ATOM   3034 N N1    . DA  C 2 6   ? 16.269  63.245  47.054 1.00 16.74 ? 206  DA  C N1    1 
ATOM   3035 C C2    . DA  C 2 6   ? 16.965  64.105  46.331 1.00 17.15 ? 206  DA  C C2    1 
ATOM   3036 N N3    . DA  C 2 6   ? 16.912  64.337  45.030 1.00 18.19 ? 206  DA  C N3    1 
ATOM   3037 C C4    . DA  C 2 6   ? 15.992  63.537  44.444 1.00 18.54 ? 206  DA  C C4    1 
ATOM   3038 P P     . DA  C 2 7   ? 16.349  63.079  37.303 1.00 29.53 ? 207  DA  C P     1 
ATOM   3039 O OP1   . DA  C 2 7   ? 16.827  63.690  36.045 1.00 30.98 ? 207  DA  C OP1   1 
ATOM   3040 O OP2   . DA  C 2 7   ? 15.053  62.361  37.326 1.00 29.01 ? 207  DA  C OP2   1 
ATOM   3041 O "O5'" . DA  C 2 7   ? 17.493  62.087  37.858 1.00 27.18 ? 207  DA  C "O5'" 1 
ATOM   3042 C "C5'" . DA  C 2 7   ? 18.859  62.508  37.893 1.00 23.40 ? 207  DA  C "C5'" 1 
ATOM   3043 C "C4'" . DA  C 2 7   ? 19.693  61.637  38.807 1.00 22.20 ? 207  DA  C "C4'" 1 
ATOM   3044 O "O4'" . DA  C 2 7   ? 19.324  61.816  40.171 1.00 22.14 ? 207  DA  C "O4'" 1 
ATOM   3045 C "C3'" . DA  C 2 7   ? 19.396  60.177  38.560 1.00 23.57 ? 207  DA  C "C3'" 1 
ATOM   3046 O "O3'" . DA  C 2 7   ? 20.074  59.750  37.376 1.00 24.41 ? 207  DA  C "O3'" 1 
ATOM   3047 C "C2'" . DA  C 2 7   ? 20.008  59.576  39.825 1.00 22.13 ? 207  DA  C "C2'" 1 
ATOM   3048 C "C1'" . DA  C 2 7   ? 19.636  60.617  40.890 1.00 21.07 ? 207  DA  C "C1'" 1 
ATOM   3049 N N9    . DA  C 2 7   ? 18.489  60.184  41.727 1.00 19.66 ? 207  DA  C N9    1 
ATOM   3050 C C8    . DA  C 2 7   ? 17.279  59.653  41.354 1.00 19.12 ? 207  DA  C C8    1 
ATOM   3051 N N7    . DA  C 2 7   ? 16.492  59.371  42.353 1.00 18.10 ? 207  DA  C N7    1 
ATOM   3052 C C5    . DA  C 2 7   ? 17.231  59.740  43.472 1.00 18.42 ? 207  DA  C C5    1 
ATOM   3053 C C6    . DA  C 2 7   ? 16.969  59.680  44.860 1.00 18.50 ? 207  DA  C C6    1 
ATOM   3054 N N6    . DA  C 2 7   ? 15.834  59.205  45.393 1.00 16.01 ? 207  DA  C N6    1 
ATOM   3055 N N1    . DA  C 2 7   ? 17.936  60.120  45.677 1.00 18.33 ? 207  DA  C N1    1 
ATOM   3056 C C2    . DA  C 2 7   ? 19.067  60.579  45.160 1.00 19.34 ? 207  DA  C C2    1 
ATOM   3057 N N3    . DA  C 2 7   ? 19.431  60.685  43.890 1.00 18.97 ? 207  DA  C N3    1 
ATOM   3058 C C4    . DA  C 2 7   ? 18.448  60.239  43.090 1.00 18.82 ? 207  DA  C C4    1 
ATOM   3059 P P     . DG  C 2 8   ? 19.809  58.317  36.708 1.00 26.10 ? 208  DG  C P     1 
ATOM   3060 O OP1   . DG  C 2 8   ? 20.302  58.392  35.319 1.00 28.85 ? 208  DG  C OP1   1 
ATOM   3061 O OP2   . DG  C 2 8   ? 18.416  57.896  36.971 1.00 26.26 ? 208  DG  C OP2   1 
ATOM   3062 O "O5'" . DG  C 2 8   ? 20.769  57.330  37.535 1.00 24.30 ? 208  DG  C "O5'" 1 
ATOM   3063 C "C5'" . DG  C 2 8   ? 22.187  57.453  37.441 1.00 22.08 ? 208  DG  C "C5'" 1 
ATOM   3064 C "C4'" . DG  C 2 8   ? 22.869  56.755  38.605 1.00 21.35 ? 208  DG  C "C4'" 1 
ATOM   3065 O "O4'" . DG  C 2 8   ? 22.396  57.284  39.841 1.00 21.66 ? 208  DG  C "O4'" 1 
ATOM   3066 C "C3'" . DG  C 2 8   ? 22.530  55.285  38.605 1.00 21.50 ? 208  DG  C "C3'" 1 
ATOM   3067 O "O3'" . DG  C 2 8   ? 23.567  54.628  37.877 1.00 23.73 ? 208  DG  C "O3'" 1 
ATOM   3068 C "C2'" . DG  C 2 8   ? 22.592  54.948  40.099 1.00 20.86 ? 208  DG  C "C2'" 1 
ATOM   3069 C "C1'" . DG  C 2 8   ? 22.140  56.247  40.765 1.00 18.82 ? 208  DG  C "C1'" 1 
ATOM   3070 N N9    . DG  C 2 8   ? 20.716  56.246  41.157 1.00 18.68 ? 208  DG  C N9    1 
ATOM   3071 C C8    . DG  C 2 8   ? 19.579  56.028  40.410 1.00 18.54 ? 208  DG  C C8    1 
ATOM   3072 N N7    . DG  C 2 8   ? 18.473  56.066  41.109 1.00 18.85 ? 208  DG  C N7    1 
ATOM   3073 C C5    . DG  C 2 8   ? 18.907  56.331  42.408 1.00 17.93 ? 208  DG  C C5    1 
ATOM   3074 C C6    . DG  C 2 8   ? 18.170  56.471  43.625 1.00 18.30 ? 208  DG  C C6    1 
ATOM   3075 O O6    . DG  C 2 8   ? 16.959  56.390  43.824 1.00 17.18 ? 208  DG  C O6    1 
ATOM   3076 N N1    . DG  C 2 8   ? 19.017  56.718  44.697 1.00 18.91 ? 208  DG  C N1    1 
ATOM   3077 C C2    . DG  C 2 8   ? 20.387  56.819  44.621 1.00 17.74 ? 208  DG  C C2    1 
ATOM   3078 N N2    . DG  C 2 8   ? 21.040  57.073  45.748 1.00 17.80 ? 208  DG  C N2    1 
ATOM   3079 N N3    . DG  C 2 8   ? 21.071  56.684  43.491 1.00 18.13 ? 208  DG  C N3    1 
ATOM   3080 C C4    . DG  C 2 8   ? 20.274  56.444  42.434 1.00 18.51 ? 208  DG  C C4    1 
ATOM   3081 P P     . DA  C 2 9   ? 23.289  53.498  36.755 1.00 24.78 ? 209  DA  C P     1 
ATOM   3082 O OP1   . DA  C 2 9   ? 24.436  53.540  35.826 1.00 26.79 ? 209  DA  C OP1   1 
ATOM   3083 O OP2   . DA  C 2 9   ? 21.918  53.651  36.241 1.00 24.05 ? 209  DA  C OP2   1 
ATOM   3084 O "O5'" . DA  C 2 9   ? 23.350  52.108  37.551 1.00 24.15 ? 209  DA  C "O5'" 1 
ATOM   3085 C "C5'" . DA  C 2 9   ? 24.564  51.679  38.187 1.00 23.64 ? 209  DA  C "C5'" 1 
ATOM   3086 C "C4'" . DA  C 2 9   ? 24.275  50.998  39.521 1.00 22.66 ? 209  DA  C "C4'" 1 
ATOM   3087 O "O4'" . DA  C 2 9   ? 23.517  51.866  40.360 1.00 22.24 ? 209  DA  C "O4'" 1 
ATOM   3088 C "C3'" . DA  C 2 9   ? 23.390  49.783  39.308 1.00 23.59 ? 209  DA  C "C3'" 1 
ATOM   3089 O "O3'" . DA  C 2 9   ? 24.233  48.658  39.032 1.00 25.13 ? 209  DA  C "O3'" 1 
ATOM   3090 C "C2'" . DA  C 2 9   ? 22.678  49.653  40.659 1.00 21.84 ? 209  DA  C "C2'" 1 
ATOM   3091 C "C1'" . DA  C 2 9   ? 22.610  51.102  41.147 1.00 21.27 ? 209  DA  C "C1'" 1 
ATOM   3092 N N9    . DA  C 2 9   ? 21.257  51.670  41.047 1.00 21.43 ? 209  DA  C N9    1 
ATOM   3093 C C8    . DA  C 2 9   ? 20.457  51.835  39.943 1.00 21.86 ? 209  DA  C C8    1 
ATOM   3094 N N7    . DA  C 2 9   ? 19.284  52.347  40.209 1.00 21.94 ? 209  DA  C N7    1 
ATOM   3095 C C5    . DA  C 2 9   ? 19.311  52.535  41.590 1.00 21.71 ? 209  DA  C C5    1 
ATOM   3096 C C6    . DA  C 2 9   ? 18.370  53.046  42.502 1.00 21.46 ? 209  DA  C C6    1 
ATOM   3097 N N6    . DA  C 2 9   ? 17.158  53.466  42.154 1.00 20.02 ? 209  DA  C N6    1 
ATOM   3098 N N1    . DA  C 2 9   ? 18.735  53.095  43.794 1.00 22.27 ? 209  DA  C N1    1 
ATOM   3099 C C2    . DA  C 2 9   ? 19.940  52.668  44.154 1.00 22.27 ? 209  DA  C C2    1 
ATOM   3100 N N3    . DA  C 2 9   ? 20.905  52.166  43.402 1.00 22.05 ? 209  DA  C N3    1 
ATOM   3101 C C4    . DA  C 2 9   ? 20.513  52.128  42.106 1.00 21.97 ? 209  DA  C C4    1 
ATOM   3102 P P     . DG  C 2 10  ? 23.808  47.469  38.013 1.00 27.68 ? 210  DG  C P     1 
ATOM   3103 O OP1   . DG  C 2 10  ? 25.022  46.659  37.747 1.00 26.87 ? 210  DG  C OP1   1 
ATOM   3104 O OP2   . DG  C 2 10  ? 23.041  48.055  36.889 1.00 27.38 ? 210  DG  C OP2   1 
ATOM   3105 O "O5'" . DG  C 2 10  ? 22.784  46.590  38.892 1.00 26.16 ? 210  DG  C "O5'" 1 
ATOM   3106 C "C5'" . DG  C 2 10  ? 23.215  45.935  40.080 1.00 25.79 ? 210  DG  C "C5'" 1 
ATOM   3107 C "C4'" . DG  C 2 10  ? 22.083  45.171  40.753 1.00 27.39 ? 210  DG  C "C4'" 1 
ATOM   3108 O "O4'" . DG  C 2 10  ? 21.075  46.030  41.297 1.00 25.65 ? 210  DG  C "O4'" 1 
ATOM   3109 C "C3'" . DG  C 2 10  ? 21.376  44.246  39.760 1.00 28.19 ? 210  DG  C "C3'" 1 
ATOM   3110 O "O3'" . DG  C 2 10  ? 21.091  43.030  40.421 1.00 31.60 ? 210  DG  C "O3'" 1 
ATOM   3111 C "C2'" . DG  C 2 10  ? 20.078  44.975  39.489 1.00 26.45 ? 210  DG  C "C2'" 1 
ATOM   3112 C "C1'" . DG  C 2 10  ? 19.797  45.574  40.857 1.00 24.73 ? 210  DG  C "C1'" 1 
ATOM   3113 N N9    . DG  C 2 10  ? 18.848  46.705  40.775 1.00 23.44 ? 210  DG  C N9    1 
ATOM   3114 C C8    . DG  C 2 10  ? 17.762  46.956  41.576 1.00 23.08 ? 210  DG  C C8    1 
ATOM   3115 N N7    . DG  C 2 10  ? 17.113  48.041  41.262 1.00 23.12 ? 210  DG  C N7    1 
ATOM   3116 C C5    . DG  C 2 10  ? 17.813  48.550  40.175 1.00 22.62 ? 210  DG  C C5    1 
ATOM   3117 C C6    . DG  C 2 10  ? 17.571  49.714  39.412 1.00 22.62 ? 210  DG  C C6    1 
ATOM   3118 O O6    . DG  C 2 10  ? 16.673  50.539  39.559 1.00 23.41 ? 210  DG  C O6    1 
ATOM   3119 N N1    . DG  C 2 10  ? 18.511  49.871  38.399 1.00 22.35 ? 210  DG  C N1    1 
ATOM   3120 C C2    . DG  C 2 10  ? 19.560  49.011  38.152 1.00 21.90 ? 210  DG  C C2    1 
ATOM   3121 N N2    . DG  C 2 10  ? 20.373  49.312  37.136 1.00 21.83 ? 210  DG  C N2    1 
ATOM   3122 N N3    . DG  C 2 10  ? 19.786  47.916  38.872 1.00 21.92 ? 210  DG  C N3    1 
ATOM   3123 C C4    . DG  C 2 10  ? 18.878  47.745  39.865 1.00 22.72 ? 210  DG  C C4    1 
ATOM   3124 P P     . DG  C 2 11  ? 20.865  41.687  39.608 1.00 33.99 ? 211  DG  C P     1 
ATOM   3125 O OP1   . DG  C 2 11  ? 22.030  40.810  39.851 1.00 35.43 ? 211  DG  C OP1   1 
ATOM   3126 O OP2   . DG  C 2 11  ? 20.432  42.014  38.224 1.00 33.37 ? 211  DG  C OP2   1 
ATOM   3127 O "O5'" . DG  C 2 11  ? 19.625  41.092  40.400 1.00 33.10 ? 211  DG  C "O5'" 1 
ATOM   3128 C "C5'" . DG  C 2 11  ? 19.754  40.742  41.770 1.00 29.94 ? 211  DG  C "C5'" 1 
ATOM   3129 C "C4'" . DG  C 2 11  ? 18.390  40.580  42.381 1.00 29.39 ? 211  DG  C "C4'" 1 
ATOM   3130 O "O4'" . DG  C 2 11  ? 17.668  41.813  42.299 1.00 28.48 ? 211  DG  C "O4'" 1 
ATOM   3131 C "C3'" . DG  C 2 11  ? 17.571  39.549  41.615 1.00 29.67 ? 211  DG  C "C3'" 1 
ATOM   3132 O "O3'" . DG  C 2 11  ? 16.768  38.814  42.551 1.00 34.61 ? 211  DG  C "O3'" 1 
ATOM   3133 C "C2'" . DG  C 2 11  ? 16.737  40.430  40.676 1.00 27.93 ? 211  DG  C "C2'" 1 
ATOM   3134 C "C1'" . DG  C 2 11  ? 16.469  41.666  41.532 1.00 26.16 ? 211  DG  C "C1'" 1 
ATOM   3135 N N9    . DG  C 2 11  ? 16.295  42.884  40.707 1.00 23.67 ? 211  DG  C N9    1 
ATOM   3136 C C8    . DG  C 2 11  ? 17.042  43.298  39.634 1.00 23.64 ? 211  DG  C C8    1 
ATOM   3137 N N7    . DG  C 2 11  ? 16.676  44.448  39.140 1.00 23.09 ? 211  DG  C N7    1 
ATOM   3138 C C5    . DG  C 2 11  ? 15.609  44.826  39.939 1.00 21.82 ? 211  DG  C C5    1 
ATOM   3139 C C6    . DG  C 2 11  ? 14.812  45.989  39.878 1.00 21.74 ? 211  DG  C C6    1 
ATOM   3140 O O6    . DG  C 2 11  ? 14.899  46.935  39.098 1.00 21.85 ? 211  DG  C O6    1 
ATOM   3141 N N1    . DG  C 2 11  ? 13.840  45.985  40.858 1.00 22.53 ? 211  DG  C N1    1 
ATOM   3142 C C2    . DG  C 2 11  ? 13.656  44.986  41.787 1.00 21.91 ? 211  DG  C C2    1 
ATOM   3143 N N2    . DG  C 2 11  ? 12.651  45.157  42.638 1.00 23.29 ? 211  DG  C N2    1 
ATOM   3144 N N3    . DG  C 2 11  ? 14.407  43.888  41.854 1.00 21.85 ? 211  DG  C N3    1 
ATOM   3145 C C4    . DG  C 2 11  ? 15.363  43.876  40.899 1.00 22.36 ? 211  DG  C C4    1 
ATOM   3146 P P     . DG  C 2 12  ? 15.761  37.641  42.110 1.00 34.89 ? 212  DG  C P     1 
ATOM   3147 O OP1   . DG  C 2 12  ? 15.623  36.701  43.241 1.00 37.55 ? 212  DG  C OP1   1 
ATOM   3148 O OP2   . DG  C 2 12  ? 16.169  37.150  40.780 1.00 37.93 ? 212  DG  C OP2   1 
ATOM   3149 O "O5'" . DG  C 2 12  ? 14.401  38.437  41.957 1.00 34.95 ? 212  DG  C "O5'" 1 
ATOM   3150 C "C5'" . DG  C 2 12  ? 13.762  38.938  43.122 1.00 36.97 ? 212  DG  C "C5'" 1 
ATOM   3151 C "C4'" . DG  C 2 12  ? 12.410  39.508  42.781 1.00 39.20 ? 212  DG  C "C4'" 1 
ATOM   3152 O "O4'" . DG  C 2 12  ? 12.538  40.759  42.101 1.00 37.96 ? 212  DG  C "O4'" 1 
ATOM   3153 C "C3'" . DG  C 2 12  ? 11.716  38.565  41.798 1.00 41.98 ? 212  DG  C "C3'" 1 
ATOM   3154 O "O3'" . DG  C 2 12  ? 10.338  38.479  42.101 1.00 47.71 ? 212  DG  C "O3'" 1 
ATOM   3155 C "C2'" . DG  C 2 12  ? 11.907  39.267  40.462 1.00 39.56 ? 212  DG  C "C2'" 1 
ATOM   3156 C "C1'" . DG  C 2 12  ? 11.769  40.713  40.901 1.00 35.84 ? 212  DG  C "C1'" 1 
ATOM   3157 N N9    . DG  C 2 12  ? 12.338  41.608  39.887 1.00 31.64 ? 212  DG  C N9    1 
ATOM   3158 C C8    . DG  C 2 12  ? 13.416  41.407  39.069 1.00 30.58 ? 212  DG  C C8    1 
ATOM   3159 N N7    . DG  C 2 12  ? 13.656  42.401  38.262 1.00 30.12 ? 212  DG  C N7    1 
ATOM   3160 C C5    . DG  C 2 12  ? 12.665  43.322  38.572 1.00 29.25 ? 212  DG  C C5    1 
ATOM   3161 C C6    . DG  C 2 12  ? 12.409  44.593  38.014 1.00 29.25 ? 212  DG  C C6    1 
ATOM   3162 O O6    . DG  C 2 12  ? 13.035  45.162  37.124 1.00 30.19 ? 212  DG  C O6    1 
ATOM   3163 N N1    . DG  C 2 12  ? 11.303  45.195  38.601 1.00 28.68 ? 212  DG  C N1    1 
ATOM   3164 C C2    . DG  C 2 12  ? 10.541  44.637  39.602 1.00 27.79 ? 212  DG  C C2    1 
ATOM   3165 N N2    . DG  C 2 12  ? 9.512   45.346  40.045 1.00 27.49 ? 212  DG  C N2    1 
ATOM   3166 N N3    . DG  C 2 12  ? 10.785  43.439  40.128 1.00 29.08 ? 212  DG  C N3    1 
ATOM   3167 C C4    . DG  C 2 12  ? 11.857  42.844  39.566 1.00 29.37 ? 212  DG  C C4    1 
ATOM   3168 P P     . DC  C 2 13  ? 9.490   37.201  41.625 1.00 52.04 ? 213  DC  C P     1 
ATOM   3169 O OP1   . DC  C 2 13  ? 9.150   36.411  42.835 1.00 50.96 ? 213  DC  C OP1   1 
ATOM   3170 O OP2   . DC  C 2 13  ? 10.171  36.553  40.472 1.00 51.01 ? 213  DC  C OP2   1 
ATOM   3171 O "O5'" . DC  C 2 13  ? 8.174   37.944  41.080 1.00 49.95 ? 213  DC  C "O5'" 1 
ATOM   3172 C "C5'" . DC  C 2 13  ? 7.504   38.904  41.896 1.00 48.26 ? 213  DC  C "C5'" 1 
ATOM   3173 C "C4'" . DC  C 2 13  ? 6.782   39.937  41.043 1.00 47.65 ? 213  DC  C "C4'" 1 
ATOM   3174 O "O4'" . DC  C 2 13  ? 7.709   40.785  40.356 1.00 45.22 ? 213  DC  C "O4'" 1 
ATOM   3175 C "C3'" . DC  C 2 13  ? 5.959   39.229  39.971 1.00 47.15 ? 213  DC  C "C3'" 1 
ATOM   3176 O "O3'" . DC  C 2 13  ? 4.638   39.756  39.921 1.00 49.37 ? 213  DC  C "O3'" 1 
ATOM   3177 C "C2'" . DC  C 2 13  ? 6.703   39.566  38.694 1.00 44.83 ? 213  DC  C "C2'" 1 
ATOM   3178 C "C1'" . DC  C 2 13  ? 7.257   40.947  39.017 1.00 43.03 ? 213  DC  C "C1'" 1 
ATOM   3179 N N1    . DC  C 2 13  ? 8.399   41.244  38.125 1.00 40.84 ? 213  DC  C N1    1 
ATOM   3180 C C2    . DC  C 2 13  ? 8.492   42.508  37.544 1.00 39.68 ? 213  DC  C C2    1 
ATOM   3181 O O2    . DC  C 2 13  ? 7.655   43.384  37.772 1.00 38.57 ? 213  DC  C O2    1 
ATOM   3182 N N3    . DC  C 2 13  ? 9.548   42.744  36.715 1.00 39.15 ? 213  DC  C N3    1 
ATOM   3183 C C4    . DC  C 2 13  ? 10.467  41.790  36.471 1.00 38.70 ? 213  DC  C C4    1 
ATOM   3184 N N4    . DC  C 2 13  ? 11.489  42.049  35.660 1.00 39.12 ? 213  DC  C N4    1 
ATOM   3185 C C5    . DC  C 2 13  ? 10.378  40.497  37.064 1.00 39.11 ? 213  DC  C C5    1 
ATOM   3186 C C6    . DC  C 2 13  ? 9.330   40.274  37.880 1.00 39.84 ? 213  DC  C C6    1 
ATOM   3187 P P     . DA  C 2 14  ? 3.386   38.780  39.642 1.00 49.92 ? 214  DA  C P     1 
ATOM   3188 O OP1   . DA  C 2 14  ? 2.646   38.606  40.913 1.00 50.24 ? 214  DA  C OP1   1 
ATOM   3189 O OP2   . DA  C 2 14  ? 3.858   37.592  38.890 1.00 49.50 ? 214  DA  C OP2   1 
ATOM   3190 O "O5'" . DA  C 2 14  ? 2.503   39.692  38.663 1.00 48.00 ? 214  DA  C "O5'" 1 
ATOM   3191 C "C5'" . DA  C 2 14  ? 1.845   40.832  39.210 1.00 46.41 ? 214  DA  C "C5'" 1 
ATOM   3192 C "C4'" . DA  C 2 14  ? 1.864   42.022  38.262 1.00 45.33 ? 214  DA  C "C4'" 1 
ATOM   3193 O "O4'" . DA  C 2 14  ? 3.174   42.191  37.717 1.00 43.24 ? 214  DA  C "O4'" 1 
ATOM   3194 C "C3'" . DA  C 2 14  ? 0.937   41.824  37.064 1.00 45.48 ? 214  DA  C "C3'" 1 
ATOM   3195 O "O3'" . DA  C 2 14  ? 0.520   43.115  36.593 1.00 48.35 ? 214  DA  C "O3'" 1 
ATOM   3196 C "C2'" . DA  C 2 14  ? 1.897   41.164  36.074 1.00 43.29 ? 214  DA  C "C2'" 1 
ATOM   3197 C "C1'" . DA  C 2 14  ? 3.109   42.052  36.298 1.00 40.68 ? 214  DA  C "C1'" 1 
ATOM   3198 N N9    . DA  C 2 14  ? 4.365   41.478  35.789 1.00 37.40 ? 214  DA  C N9    1 
ATOM   3199 C C8    . DA  C 2 14  ? 4.854   40.194  35.867 1.00 36.78 ? 214  DA  C C8    1 
ATOM   3200 N N7    . DA  C 2 14  ? 6.032   40.042  35.312 1.00 35.59 ? 214  DA  C N7    1 
ATOM   3201 C C5    . DA  C 2 14  ? 6.335   41.316  34.838 1.00 34.07 ? 214  DA  C C5    1 
ATOM   3202 C C6    . DA  C 2 14  ? 7.447   41.836  34.161 1.00 33.42 ? 214  DA  C C6    1 
ATOM   3203 N N6    . DA  C 2 14  ? 8.498   41.099  33.802 1.00 33.37 ? 214  DA  C N6    1 
ATOM   3204 N N1    . DA  C 2 14  ? 7.420   43.141  33.863 1.00 32.45 ? 214  DA  C N1    1 
ATOM   3205 C C2    . DA  C 2 14  ? 6.363   43.869  34.211 1.00 33.55 ? 214  DA  C C2    1 
ATOM   3206 N N3    . DA  C 2 14  ? 5.260   43.505  34.841 1.00 34.22 ? 214  DA  C N3    1 
ATOM   3207 C C4    . DA  C 2 14  ? 5.321   42.190  35.128 1.00 34.96 ? 214  DA  C C4    1 
ATOM   3208 O "O5'" . DT  D 3 1   ? 10.769  49.474  27.050 1.00 53.67 ? 215  DT  D "O5'" 1 
ATOM   3209 C "C5'" . DT  D 3 1   ? 9.383   49.601  26.719 1.00 53.42 ? 215  DT  D "C5'" 1 
ATOM   3210 C "C4'" . DT  D 3 1   ? 8.489   49.069  27.833 1.00 53.56 ? 215  DT  D "C4'" 1 
ATOM   3211 O "O4'" . DT  D 3 1   ? 8.697   47.683  28.099 1.00 53.31 ? 215  DT  D "O4'" 1 
ATOM   3212 C "C3'" . DT  D 3 1   ? 8.896   49.666  29.160 1.00 54.36 ? 215  DT  D "C3'" 1 
ATOM   3213 O "O3'" . DT  D 3 1   ? 8.509   51.044  29.294 1.00 57.58 ? 215  DT  D "O3'" 1 
ATOM   3214 C "C2'" . DT  D 3 1   ? 8.173   48.751  30.138 1.00 52.66 ? 215  DT  D "C2'" 1 
ATOM   3215 C "C1'" . DT  D 3 1   ? 8.071   47.444  29.369 1.00 50.39 ? 215  DT  D "C1'" 1 
ATOM   3216 N N1    . DT  D 3 1   ? 8.678   46.328  30.136 1.00 48.13 ? 215  DT  D N1    1 
ATOM   3217 C C2    . DT  D 3 1   ? 7.957   45.841  31.217 1.00 47.43 ? 215  DT  D C2    1 
ATOM   3218 O O2    . DT  D 3 1   ? 6.887   46.331  31.585 1.00 46.45 ? 215  DT  D O2    1 
ATOM   3219 N N3    . DT  D 3 1   ? 8.519   44.762  31.884 1.00 46.18 ? 215  DT  D N3    1 
ATOM   3220 C C4    . DT  D 3 1   ? 9.712   44.134  31.583 1.00 45.56 ? 215  DT  D C4    1 
ATOM   3221 O O4    . DT  D 3 1   ? 10.087  43.161  32.243 1.00 44.52 ? 215  DT  D O4    1 
ATOM   3222 C C5    . DT  D 3 1   ? 10.399  44.714  30.449 1.00 45.98 ? 215  DT  D C5    1 
ATOM   3223 C C7    . DT  D 3 1   ? 11.737  44.133  30.013 1.00 45.90 ? 215  DT  D C7    1 
ATOM   3224 C C6    . DT  D 3 1   ? 9.879   45.764  29.774 1.00 47.04 ? 215  DT  D C6    1 
ATOM   3225 P P     . DG  D 3 2   ? 7.001   51.596  29.091 1.00 59.95 ? 216  DG  D P     1 
ATOM   3226 O OP1   . DG  D 3 2   ? 6.505   51.121  27.780 1.00 58.68 ? 216  DG  D OP1   1 
ATOM   3227 O OP2   . DG  D 3 2   ? 7.000   53.052  29.391 1.00 60.22 ? 216  DG  D OP2   1 
ATOM   3228 O "O5'" . DG  D 3 2   ? 6.189   50.833  30.276 1.00 58.79 ? 216  DG  D "O5'" 1 
ATOM   3229 C "C5'" . DG  D 3 2   ? 5.861   51.461  31.529 1.00 55.52 ? 216  DG  D "C5'" 1 
ATOM   3230 C "C4'" . DG  D 3 2   ? 6.826   51.153  32.704 1.00 52.23 ? 216  DG  D "C4'" 1 
ATOM   3231 O "O4'" . DG  D 3 2   ? 7.288   49.795  32.758 1.00 49.31 ? 216  DG  D "O4'" 1 
ATOM   3232 C "C3'" . DG  D 3 2   ? 8.091   52.036  32.699 1.00 52.13 ? 216  DG  D "C3'" 1 
ATOM   3233 O "O3'" . DG  D 3 2   ? 8.221   52.765  33.928 1.00 55.33 ? 216  DG  D "O3'" 1 
ATOM   3234 C "C2'" . DG  D 3 2   ? 9.204   50.989  32.672 1.00 48.70 ? 216  DG  D "C2'" 1 
ATOM   3235 C "C1'" . DG  D 3 2   ? 8.524   49.886  33.461 1.00 45.20 ? 216  DG  D "C1'" 1 
ATOM   3236 N N9    . DG  D 3 2   ? 9.325   48.637  33.499 1.00 40.41 ? 216  DG  D N9    1 
ATOM   3237 C C8    . DG  D 3 2   ? 10.457  48.321  32.794 1.00 38.72 ? 216  DG  D C8    1 
ATOM   3238 N N7    . DG  D 3 2   ? 10.961  47.158  33.096 1.00 37.95 ? 216  DG  D N7    1 
ATOM   3239 C C5    . DG  D 3 2   ? 10.101  46.659  34.073 1.00 36.47 ? 216  DG  D C5    1 
ATOM   3240 C C6    . DG  D 3 2   ? 10.152  45.436  34.789 1.00 35.20 ? 216  DG  D C6    1 
ATOM   3241 O O6    . DG  D 3 2   ? 10.976  44.535  34.693 1.00 35.25 ? 216  DG  D O6    1 
ATOM   3242 N N1    . DG  D 3 2   ? 9.114   45.318  35.689 1.00 34.72 ? 216  DG  D N1    1 
ATOM   3243 C C2    . DG  D 3 2   ? 8.133   46.263  35.888 1.00 35.09 ? 216  DG  D C2    1 
ATOM   3244 N N2    . DG  D 3 2   ? 7.204   45.970  36.798 1.00 34.61 ? 216  DG  D N2    1 
ATOM   3245 N N3    . DG  D 3 2   ? 8.079   47.422  35.219 1.00 36.27 ? 216  DG  D N3    1 
ATOM   3246 C C4    . DG  D 3 2   ? 9.095   47.553  34.327 1.00 37.74 ? 216  DG  D C4    1 
ATOM   3247 P P     . DC  D 3 3   ? 7.058   53.726  34.549 1.00 59.34 ? 217  DC  D P     1 
ATOM   3248 O OP1   . DC  D 3 3   ? 6.079   54.060  33.482 1.00 58.35 ? 217  DC  D OP1   1 
ATOM   3249 O OP2   . DC  D 3 3   ? 7.722   54.820  35.305 1.00 58.94 ? 217  DC  D OP2   1 
ATOM   3250 O "O5'" . DC  D 3 3   ? 6.318   52.759  35.616 1.00 55.43 ? 217  DC  D "O5'" 1 
ATOM   3251 C "C5'" . DC  D 3 3   ? 6.947   51.566  36.058 1.00 49.86 ? 217  DC  D "C5'" 1 
ATOM   3252 C "C4'" . DC  D 3 3   ? 6.743   51.303  37.526 1.00 47.01 ? 217  DC  D "C4'" 1 
ATOM   3253 O "O4'" . DC  D 3 3   ? 7.475   50.122  37.853 1.00 44.90 ? 217  DC  D "O4'" 1 
ATOM   3254 C "C3'" . DC  D 3 3   ? 7.368   52.397  38.390 1.00 46.15 ? 217  DC  D "C3'" 1 
ATOM   3255 O "O3'" . DC  D 3 3   ? 6.997   52.222  39.767 1.00 46.20 ? 217  DC  D "O3'" 1 
ATOM   3256 C "C2'" . DC  D 3 3   ? 8.833   52.023  38.182 1.00 44.56 ? 217  DC  D "C2'" 1 
ATOM   3257 C "C1'" . DC  D 3 3   ? 8.754   50.503  38.350 1.00 42.12 ? 217  DC  D "C1'" 1 
ATOM   3258 N N1    . DC  D 3 3   ? 9.858   49.786  37.659 1.00 38.85 ? 217  DC  D N1    1 
ATOM   3259 C C2    . DC  D 3 3   ? 10.049  48.455  37.989 1.00 37.91 ? 217  DC  D C2    1 
ATOM   3260 O O2    . DC  D 3 3   ? 9.295   47.897  38.783 1.00 38.17 ? 217  DC  D O2    1 
ATOM   3261 N N3    . DC  D 3 3   ? 11.081  47.786  37.415 1.00 36.06 ? 217  DC  D N3    1 
ATOM   3262 C C4    . DC  D 3 3   ? 11.892  48.396  36.550 1.00 35.85 ? 217  DC  D C4    1 
ATOM   3263 N N4    . DC  D 3 3   ? 12.898  47.711  36.017 1.00 36.57 ? 217  DC  D N4    1 
ATOM   3264 C C5    . DC  D 3 3   ? 11.707  49.766  36.192 1.00 36.08 ? 217  DC  D C5    1 
ATOM   3265 C C6    . DC  D 3 3   ? 10.679  50.416  36.772 1.00 37.35 ? 217  DC  D C6    1 
ATOM   3266 P P     . DC  D 3 4   ? 6.948   53.441  40.832 1.00 47.13 ? 218  DC  D P     1 
ATOM   3267 O OP1   . DC  D 3 4   ? 5.561   53.960  40.881 1.00 47.36 ? 218  DC  D OP1   1 
ATOM   3268 O OP2   . DC  D 3 4   ? 8.080   54.360  40.570 1.00 47.08 ? 218  DC  D OP2   1 
ATOM   3269 O "O5'" . DC  D 3 4   ? 7.246   52.696  42.220 1.00 44.48 ? 218  DC  D "O5'" 1 
ATOM   3270 C "C5'" . DC  D 3 4   ? 6.437   51.604  42.651 1.00 40.84 ? 218  DC  D "C5'" 1 
ATOM   3271 C "C4'" . DC  D 3 4   ? 7.296   50.507  43.240 1.00 38.38 ? 218  DC  D "C4'" 1 
ATOM   3272 O "O4'" . DC  D 3 4   ? 8.109   49.914  42.227 1.00 37.70 ? 218  DC  D "O4'" 1 
ATOM   3273 C "C3'" . DC  D 3 4   ? 8.264   51.124  44.245 1.00 37.68 ? 218  DC  D "C3'" 1 
ATOM   3274 O "O3'" . DC  D 3 4   ? 7.974   50.712  45.580 1.00 37.75 ? 218  DC  D "O3'" 1 
ATOM   3275 C "C2'" . DC  D 3 4   ? 9.643   50.629  43.815 1.00 36.69 ? 218  DC  D "C2'" 1 
ATOM   3276 C "C1'" . DC  D 3 4   ? 9.332   49.503  42.836 1.00 35.77 ? 218  DC  D "C1'" 1 
ATOM   3277 N N1    . DC  D 3 4   ? 10.430  49.457  41.857 1.00 32.49 ? 218  DC  D N1    1 
ATOM   3278 C C2    . DC  D 3 4   ? 11.149  48.285  41.728 1.00 31.31 ? 218  DC  D C2    1 
ATOM   3279 O O2    . DC  D 3 4   ? 10.865  47.298  42.401 1.00 30.08 ? 218  DC  D O2    1 
ATOM   3280 N N3    . DC  D 3 4   ? 12.178  48.265  40.834 1.00 30.74 ? 218  DC  D N3    1 
ATOM   3281 C C4    . DC  D 3 4   ? 12.484  49.346  40.099 1.00 30.24 ? 218  DC  D C4    1 
ATOM   3282 N N4    . DC  D 3 4   ? 13.489  49.291  39.230 1.00 30.21 ? 218  DC  D N4    1 
ATOM   3283 C C5    . DC  D 3 4   ? 11.744  50.561  40.227 1.00 31.19 ? 218  DC  D C5    1 
ATOM   3284 C C6    . DC  D 3 4   ? 10.731  50.565  41.115 1.00 32.17 ? 218  DC  D C6    1 
ATOM   3285 P P     . DC  D 3 5   ? 8.964   51.128  46.782 1.00 37.04 ? 219  DC  D P     1 
ATOM   3286 O OP1   . DC  D 3 5   ? 8.201   51.043  48.044 1.00 40.18 ? 219  DC  D OP1   1 
ATOM   3287 O OP2   . DC  D 3 5   ? 9.631   52.398  46.419 1.00 38.39 ? 219  DC  D OP2   1 
ATOM   3288 O "O5'" . DC  D 3 5   ? 10.081  49.964  46.780 1.00 34.70 ? 219  DC  D "O5'" 1 
ATOM   3289 C "C5'" . DC  D 3 5   ? 9.870   48.662  47.332 1.00 30.83 ? 219  DC  D "C5'" 1 
ATOM   3290 C "C4'" . DC  D 3 5   ? 11.097  47.786  47.100 1.00 30.75 ? 219  DC  D "C4'" 1 
ATOM   3291 O "O4'" . DC  D 3 5   ? 11.460  47.792  45.720 1.00 30.04 ? 219  DC  D "O4'" 1 
ATOM   3292 C "C3'" . DC  D 3 5   ? 12.308  48.394  47.779 1.00 31.10 ? 219  DC  D "C3'" 1 
ATOM   3293 O "O3'" . DC  D 3 5   ? 12.335  47.983  49.149 1.00 31.85 ? 219  DC  D "O3'" 1 
ATOM   3294 C "C2'" . DC  D 3 5   ? 13.462  47.770  46.990 1.00 30.53 ? 219  DC  D "C2'" 1 
ATOM   3295 C "C1'" . DC  D 3 5   ? 12.869  47.584  45.589 1.00 29.53 ? 219  DC  D "C1'" 1 
ATOM   3296 N N1    . DC  D 3 5   ? 13.440  48.517  44.581 1.00 29.49 ? 219  DC  D N1    1 
ATOM   3297 C C2    . DC  D 3 5   ? 14.539  48.099  43.837 1.00 28.97 ? 219  DC  D C2    1 
ATOM   3298 O O2    . DC  D 3 5   ? 15.045  46.992  44.012 1.00 28.85 ? 219  DC  D O2    1 
ATOM   3299 N N3    . DC  D 3 5   ? 15.046  48.954  42.907 1.00 29.62 ? 219  DC  D N3    1 
ATOM   3300 C C4    . DC  D 3 5   ? 14.512  50.172  42.703 1.00 29.56 ? 219  DC  D C4    1 
ATOM   3301 N N4    . DC  D 3 5   ? 15.044  50.976  41.775 1.00 28.45 ? 219  DC  D N4    1 
ATOM   3302 C C5    . DC  D 3 5   ? 13.382  50.615  43.464 1.00 28.93 ? 219  DC  D C5    1 
ATOM   3303 C C6    . DC  D 3 5   ? 12.888  49.755  44.384 1.00 29.42 ? 219  DC  D C6    1 
ATOM   3304 P P     . DT  D 3 6   ? 12.470  49.050  50.363 1.00 33.11 ? 220  DT  D P     1 
ATOM   3305 O OP1   . DT  D 3 6   ? 12.199  48.338  51.634 1.00 33.81 ? 220  DT  D OP1   1 
ATOM   3306 O OP2   . DT  D 3 6   ? 11.720  50.285  50.030 1.00 32.34 ? 220  DT  D OP2   1 
ATOM   3307 O "O5'" . DT  D 3 6   ? 14.027  49.398  50.297 1.00 29.32 ? 220  DT  D "O5'" 1 
ATOM   3308 C "C5'" . DT  D 3 6   ? 15.032  48.419  50.523 1.00 26.54 ? 220  DT  D "C5'" 1 
ATOM   3309 C "C4'" . DT  D 3 6   ? 16.380  49.068  50.382 1.00 24.57 ? 220  DT  D "C4'" 1 
ATOM   3310 O "O4'" . DT  D 3 6   ? 16.553  49.544  49.047 1.00 25.86 ? 220  DT  D "O4'" 1 
ATOM   3311 C "C3'" . DT  D 3 6   ? 16.442  50.283  51.292 1.00 24.45 ? 220  DT  D "C3'" 1 
ATOM   3312 O "O3'" . DT  D 3 6   ? 17.586  50.164  52.114 1.00 25.65 ? 220  DT  D "O3'" 1 
ATOM   3313 C "C2'" . DT  D 3 6   ? 16.534  51.486  50.348 1.00 24.96 ? 220  DT  D "C2'" 1 
ATOM   3314 C "C1'" . DT  D 3 6   ? 17.087  50.870  49.063 1.00 24.62 ? 220  DT  D "C1'" 1 
ATOM   3315 N N1    . DT  D 3 6   ? 16.580  51.586  47.873 1.00 24.08 ? 220  DT  D N1    1 
ATOM   3316 C C2    . DT  D 3 6   ? 17.490  52.103  46.956 1.00 23.76 ? 220  DT  D C2    1 
ATOM   3317 O O2    . DT  D 3 6   ? 18.709  52.044  47.092 1.00 22.48 ? 220  DT  D O2    1 
ATOM   3318 N N3    . DT  D 3 6   ? 16.942  52.732  45.860 1.00 23.32 ? 220  DT  D N3    1 
ATOM   3319 C C4    . DT  D 3 6   ? 15.603  52.898  45.596 1.00 23.01 ? 220  DT  D C4    1 
ATOM   3320 O O4    . DT  D 3 6   ? 15.253  53.466  44.566 1.00 24.19 ? 220  DT  D O4    1 
ATOM   3321 C C5    . DT  D 3 6   ? 14.734  52.339  46.605 1.00 23.07 ? 220  DT  D C5    1 
ATOM   3322 C C7    . DT  D 3 6   ? 13.225  52.470  46.479 1.00 23.64 ? 220  DT  D C7    1 
ATOM   3323 C C6    . DT  D 3 6   ? 15.236  51.715  47.680 1.00 23.27 ? 220  DT  D C6    1 
ATOM   3324 P P     . DC  D 3 7   ? 17.769  51.029  53.449 1.00 26.30 ? 221  DC  D P     1 
ATOM   3325 O OP1   . DC  D 3 7   ? 18.715  50.281  54.306 1.00 26.75 ? 221  DC  D OP1   1 
ATOM   3326 O OP2   . DC  D 3 7   ? 16.437  51.419  53.959 1.00 27.39 ? 221  DC  D OP2   1 
ATOM   3327 O "O5'" . DC  D 3 7   ? 18.479  52.367  52.951 1.00 23.37 ? 221  DC  D "O5'" 1 
ATOM   3328 C "C5'" . DC  D 3 7   ? 19.862  52.391  52.614 1.00 20.99 ? 221  DC  D "C5'" 1 
ATOM   3329 C "C4'" . DC  D 3 7   ? 20.193  53.719  51.978 1.00 20.14 ? 221  DC  D "C4'" 1 
ATOM   3330 O "O4'" . DC  D 3 7   ? 19.450  53.868  50.782 1.00 20.49 ? 221  DC  D "O4'" 1 
ATOM   3331 C "C3'" . DC  D 3 7   ? 19.671  54.853  52.852 1.00 20.77 ? 221  DC  D "C3'" 1 
ATOM   3332 O "O3'" . DC  D 3 7   ? 20.736  55.278  53.722 1.00 21.57 ? 221  DC  D "O3'" 1 
ATOM   3333 C "C2'" . DC  D 3 7   ? 19.207  55.934  51.829 1.00 20.04 ? 221  DC  D "C2'" 1 
ATOM   3334 C "C1'" . DC  D 3 7   ? 19.434  55.256  50.480 1.00 19.36 ? 221  DC  D "C1'" 1 
ATOM   3335 N N1    . DC  D 3 7   ? 18.378  55.472  49.458 1.00 19.58 ? 221  DC  D N1    1 
ATOM   3336 C C2    . DC  D 3 7   ? 18.758  56.069  48.267 1.00 18.93 ? 221  DC  D C2    1 
ATOM   3337 O O2    . DC  D 3 7   ? 19.909  56.461  48.108 1.00 19.03 ? 221  DC  D O2    1 
ATOM   3338 N N3    . DC  D 3 7   ? 17.826  56.216  47.289 1.00 18.39 ? 221  DC  D N3    1 
ATOM   3339 C C4    . DC  D 3 7   ? 16.568  55.800  47.461 1.00 17.66 ? 221  DC  D C4    1 
ATOM   3340 N N4    . DC  D 3 7   ? 15.702  55.938  46.460 1.00 17.57 ? 221  DC  D N4    1 
ATOM   3341 C C5    . DC  D 3 7   ? 16.154  55.188  48.686 1.00 18.28 ? 221  DC  D C5    1 
ATOM   3342 C C6    . DC  D 3 7   ? 17.092  55.047  49.651 1.00 19.61 ? 221  DC  D C6    1 
ATOM   3343 P P     . DT  D 3 8   ? 20.540  56.394  54.857 1.00 19.17 ? 222  DT  D P     1 
ATOM   3344 O OP1   . DT  D 3 8   ? 21.565  56.183  55.904 1.00 20.83 ? 222  DT  D OP1   1 
ATOM   3345 O OP2   . DT  D 3 8   ? 19.112  56.445  55.203 1.00 22.27 ? 222  DT  D OP2   1 
ATOM   3346 O "O5'" . DT  D 3 8   ? 20.860  57.761  54.118 1.00 20.36 ? 222  DT  D "O5'" 1 
ATOM   3347 C "C5'" . DT  D 3 8   ? 22.162  58.095  53.665 1.00 19.70 ? 222  DT  D "C5'" 1 
ATOM   3348 C "C4'" . DT  D 3 8   ? 22.047  59.198  52.645 1.00 18.68 ? 222  DT  D "C4'" 1 
ATOM   3349 O "O4'" . DT  D 3 8   ? 21.166  58.814  51.589 1.00 18.24 ? 222  DT  D "O4'" 1 
ATOM   3350 C "C3'" . DT  D 3 8   ? 21.375  60.391  53.290 1.00 18.29 ? 222  DT  D "C3'" 1 
ATOM   3351 O "O3'" . DT  D 3 8   ? 22.406  61.185  53.891 1.00 17.78 ? 222  DT  D "O3'" 1 
ATOM   3352 C "C2'" . DT  D 3 8   ? 20.666  61.083  52.099 1.00 18.20 ? 222  DT  D "C2'" 1 
ATOM   3353 C "C1'" . DT  D 3 8   ? 20.718  60.019  50.983 1.00 17.66 ? 222  DT  D "C1'" 1 
ATOM   3354 N N1    . DT  D 3 8   ? 19.427  59.736  50.330 1.00 17.56 ? 222  DT  D N1    1 
ATOM   3355 C C2    . DT  D 3 8   ? 19.339  59.972  48.966 1.00 16.98 ? 222  DT  D C2    1 
ATOM   3356 O O2    . DT  D 3 8   ? 20.263  60.443  48.303 1.00 17.09 ? 222  DT  D O2    1 
ATOM   3357 N N3    . DT  D 3 8   ? 18.130  59.650  48.379 1.00 16.63 ? 222  DT  D N3    1 
ATOM   3358 C C4    . DT  D 3 8   ? 17.022  59.126  49.014 1.00 15.92 ? 222  DT  D C4    1 
ATOM   3359 O O4    . DT  D 3 8   ? 16.009  58.867  48.369 1.00 17.68 ? 222  DT  D O4    1 
ATOM   3360 C C5    . DT  D 3 8   ? 17.196  58.918  50.430 1.00 15.75 ? 222  DT  D C5    1 
ATOM   3361 C C7    . DT  D 3 8   ? 16.043  58.346  51.246 1.00 15.36 ? 222  DT  D C7    1 
ATOM   3362 C C6    . DT  D 3 8   ? 18.363  59.221  51.034 1.00 16.37 ? 222  DT  D C6    1 
ATOM   3363 P P     . DT  D 3 9   ? 22.160  62.059  55.212 1.00 20.16 ? 223  DT  D P     1 
ATOM   3364 O OP1   . DT  D 3 9   ? 23.465  62.515  55.730 1.00 18.67 ? 223  DT  D OP1   1 
ATOM   3365 O OP2   . DT  D 3 9   ? 21.233  61.316  56.092 1.00 19.08 ? 223  DT  D OP2   1 
ATOM   3366 O "O5'" . DT  D 3 9   ? 21.373  63.336  54.658 1.00 17.98 ? 223  DT  D "O5'" 1 
ATOM   3367 C "C5'" . DT  D 3 9   ? 22.068  64.416  54.039 1.00 17.45 ? 223  DT  D "C5'" 1 
ATOM   3368 C "C4'" . DT  D 3 9   ? 21.092  65.255  53.249 1.00 17.89 ? 223  DT  D "C4'" 1 
ATOM   3369 O "O4'" . DT  D 3 9   ? 20.423  64.456  52.297 1.00 17.06 ? 223  DT  D "O4'" 1 
ATOM   3370 C "C3'" . DT  D 3 9   ? 19.947  65.687  54.127 1.00 19.31 ? 223  DT  D "C3'" 1 
ATOM   3371 O "O3'" . DT  D 3 9   ? 20.371  66.805  54.915 1.00 21.27 ? 223  DT  D "O3'" 1 
ATOM   3372 C "C2'" . DT  D 3 9   ? 18.896  66.052  53.073 1.00 18.24 ? 223  DT  D "C2'" 1 
ATOM   3373 C "C1'" . DT  D 3 9   ? 19.284  65.178  51.880 1.00 17.62 ? 223  DT  D "C1'" 1 
ATOM   3374 N N1    . DT  D 3 9   ? 18.252  64.212  51.453 1.00 18.19 ? 223  DT  D N1    1 
ATOM   3375 C C2    . DT  D 3 9   ? 17.998  64.112  50.092 1.00 18.58 ? 223  DT  D C2    1 
ATOM   3376 O O2    . DT  D 3 9   ? 18.617  64.755  49.244 1.00 19.75 ? 223  DT  D O2    1 
ATOM   3377 N N3    . DT  D 3 9   ? 17.025  63.210  49.721 1.00 18.35 ? 223  DT  D N3    1 
ATOM   3378 C C4    . DT  D 3 9   ? 16.296  62.404  50.570 1.00 18.44 ? 223  DT  D C4    1 
ATOM   3379 O O4    . DT  D 3 9   ? 15.442  61.644  50.116 1.00 19.04 ? 223  DT  D O4    1 
ATOM   3380 C C5    . DT  D 3 9   ? 16.632  62.567  51.966 1.00 18.03 ? 223  DT  D C5    1 
ATOM   3381 C C7    . DT  D 3 9   ? 15.918  61.726  53.008 1.00 18.26 ? 223  DT  D C7    1 
ATOM   3382 C C6    . DT  D 3 9   ? 17.573  63.445  52.357 1.00 17.98 ? 223  DT  D C6    1 
ATOM   3383 P P     . DA  D 3 10  ? 19.551  67.323  56.201 1.00 22.04 ? 224  DA  D P     1 
ATOM   3384 O OP1   . DA  D 3 10  ? 20.516  67.832  57.194 1.00 24.60 ? 224  DA  D OP1   1 
ATOM   3385 O OP2   . DA  D 3 10  ? 18.564  66.295  56.591 1.00 22.27 ? 224  DA  D OP2   1 
ATOM   3386 O "O5'" . DA  D 3 10  ? 18.772  68.575  55.582 1.00 22.71 ? 224  DA  D "O5'" 1 
ATOM   3387 C "C5'" . DA  D 3 10  ? 19.474  69.740  55.130 1.00 20.83 ? 224  DA  D "C5'" 1 
ATOM   3388 C "C4'" . DA  D 3 10  ? 18.698  70.434  54.016 1.00 19.83 ? 224  DA  D "C4'" 1 
ATOM   3389 O "O4'" . DA  D 3 10  ? 18.493  69.537  52.924 1.00 18.71 ? 224  DA  D "O4'" 1 
ATOM   3390 C "C3'" . DA  D 3 10  ? 17.305  70.805  54.503 1.00 21.40 ? 224  DA  D "C3'" 1 
ATOM   3391 O "O3'" . DA  D 3 10  ? 17.352  72.094  55.150 1.00 23.97 ? 224  DA  D "O3'" 1 
ATOM   3392 C "C2'" . DA  D 3 10  ? 16.539  70.832  53.180 1.00 18.80 ? 224  DA  D "C2'" 1 
ATOM   3393 C "C1'" . DA  D 3 10  ? 17.167  69.674  52.415 1.00 17.75 ? 224  DA  D "C1'" 1 
ATOM   3394 N N9    . DA  D 3 10  ? 16.400  68.415  52.548 1.00 17.71 ? 224  DA  D N9    1 
ATOM   3395 C C8    . DA  D 3 10  ? 15.957  67.778  53.679 1.00 17.50 ? 224  DA  D C8    1 
ATOM   3396 N N7    . DA  D 3 10  ? 15.286  66.680  53.443 1.00 16.80 ? 224  DA  D N7    1 
ATOM   3397 C C5    . DA  D 3 10  ? 15.284  66.583  52.061 1.00 17.36 ? 224  DA  D C5    1 
ATOM   3398 C C6    . DA  D 3 10  ? 14.731  65.647  51.182 1.00 17.34 ? 224  DA  D C6    1 
ATOM   3399 N N6    . DA  D 3 10  ? 14.033  64.591  51.596 1.00 18.37 ? 224  DA  D N6    1 
ATOM   3400 N N1    . DA  D 3 10  ? 14.910  65.847  49.869 1.00 17.56 ? 224  DA  D N1    1 
ATOM   3401 C C2    . DA  D 3 10  ? 15.590  66.905  49.459 1.00 17.34 ? 224  DA  D C2    1 
ATOM   3402 N N3    . DA  D 3 10  ? 16.155  67.856  50.184 1.00 18.99 ? 224  DA  D N3    1 
ATOM   3403 C C4    . DA  D 3 10  ? 15.960  67.629  51.504 1.00 17.55 ? 224  DA  D C4    1 
ATOM   3404 P P     . DT  D 3 11  ? 16.283  72.552  56.277 1.00 25.09 ? 225  DT  D P     1 
ATOM   3405 O OP1   . DT  D 3 11  ? 16.562  73.961  56.626 1.00 26.46 ? 225  DT  D OP1   1 
ATOM   3406 O OP2   . DT  D 3 11  ? 16.220  71.521  57.333 1.00 26.19 ? 225  DT  D OP2   1 
ATOM   3407 O "O5'" . DT  D 3 11  ? 14.910  72.497  55.471 1.00 24.45 ? 225  DT  D "O5'" 1 
ATOM   3408 C "C5'" . DT  D 3 11  ? 14.599  73.508  54.516 1.00 22.95 ? 225  DT  D "C5'" 1 
ATOM   3409 C "C4'" . DT  D 3 11  ? 13.323  73.167  53.791 1.00 22.21 ? 225  DT  D "C4'" 1 
ATOM   3410 O "O4'" . DT  D 3 11  ? 13.444  71.886  53.209 1.00 21.68 ? 225  DT  D "O4'" 1 
ATOM   3411 C "C3'" . DT  D 3 11  ? 12.166  73.032  54.773 1.00 22.61 ? 225  DT  D "C3'" 1 
ATOM   3412 O "O3'" . DT  D 3 11  ? 11.600  74.329  54.990 1.00 24.40 ? 225  DT  D "O3'" 1 
ATOM   3413 C "C2'" . DT  D 3 11  ? 11.202  72.137  53.996 1.00 21.37 ? 225  DT  D "C2'" 1 
ATOM   3414 C "C1'" . DT  D 3 11  ? 12.139  71.320  53.098 1.00 21.75 ? 225  DT  D "C1'" 1 
ATOM   3415 N N1    . DT  D 3 11  ? 12.186  69.892  53.468 1.00 21.32 ? 225  DT  D N1    1 
ATOM   3416 C C2    . DT  D 3 11  ? 11.814  68.976  52.504 1.00 20.75 ? 225  DT  D C2    1 
ATOM   3417 O O2    . DT  D 3 11  ? 11.469  69.300  51.373 1.00 20.21 ? 225  DT  D O2    1 
ATOM   3418 N N3    . DT  D 3 11  ? 11.875  67.656  52.875 1.00 21.41 ? 225  DT  D N3    1 
ATOM   3419 C C4    . DT  D 3 11  ? 12.272  67.168  54.105 1.00 21.76 ? 225  DT  D C4    1 
ATOM   3420 O O4    . DT  D 3 11  ? 12.275  65.955  54.315 1.00 23.55 ? 225  DT  D O4    1 
ATOM   3421 C C5    . DT  D 3 11  ? 12.649  68.193  55.049 1.00 21.48 ? 225  DT  D C5    1 
ATOM   3422 C C7    . DT  D 3 11  ? 13.125  67.803  56.440 1.00 21.44 ? 225  DT  D C7    1 
ATOM   3423 C C6    . DT  D 3 11  ? 12.595  69.492  54.714 1.00 21.08 ? 225  DT  D C6    1 
ATOM   3424 P P     . DA  D 3 12  ? 10.870  74.727  56.357 1.00 23.97 ? 226  DA  D P     1 
ATOM   3425 O OP1   . DA  D 3 12  ? 10.505  76.155  56.290 1.00 24.57 ? 226  DA  D OP1   1 
ATOM   3426 O OP2   . DA  D 3 12  ? 11.660  74.223  57.500 1.00 25.08 ? 226  DA  D OP2   1 
ATOM   3427 O "O5'" . DA  D 3 12  ? 9.549   73.873  56.218 1.00 25.30 ? 226  DA  D "O5'" 1 
ATOM   3428 C "C5'" . DA  D 3 12  ? 8.555   74.326  55.299 1.00 29.27 ? 226  DA  D "C5'" 1 
ATOM   3429 C "C4'" . DA  D 3 12  ? 7.290   73.494  55.348 1.00 31.09 ? 226  DA  D "C4'" 1 
ATOM   3430 O "O4'" . DA  D 3 12  ? 7.555   72.146  54.955 1.00 30.07 ? 226  DA  D "O4'" 1 
ATOM   3431 C "C3'" . DA  D 3 12  ? 6.749   73.425  56.780 1.00 32.77 ? 226  DA  D "C3'" 1 
ATOM   3432 O "O3'" . DA  D 3 12  ? 5.333   73.290  56.758 1.00 38.75 ? 226  DA  D "O3'" 1 
ATOM   3433 C "C2'" . DA  D 3 12  ? 7.368   72.137  57.286 1.00 30.29 ? 226  DA  D "C2'" 1 
ATOM   3434 C "C1'" . DA  D 3 12  ? 7.181   71.298  56.041 1.00 29.50 ? 226  DA  D "C1'" 1 
ATOM   3435 N N9    . DA  D 3 12  ? 7.993   70.073  56.075 1.00 27.45 ? 226  DA  D N9    1 
ATOM   3436 C C8    . DA  D 3 12  ? 9.213   69.820  56.655 1.00 26.74 ? 226  DA  D C8    1 
ATOM   3437 N N7    . DA  D 3 12  ? 9.617   68.585  56.494 1.00 26.77 ? 226  DA  D N7    1 
ATOM   3438 C C5    . DA  D 3 12  ? 8.594   67.994  55.759 1.00 26.01 ? 226  DA  D C5    1 
ATOM   3439 C C6    . DA  D 3 12  ? 8.406   66.706  55.250 1.00 26.07 ? 226  DA  D C6    1 
ATOM   3440 N N6    . DA  D 3 12  ? 9.264   65.698  55.415 1.00 26.78 ? 226  DA  D N6    1 
ATOM   3441 N N1    . DA  D 3 12  ? 7.282   66.493  54.563 1.00 25.78 ? 226  DA  D N1    1 
ATOM   3442 C C2    . DA  D 3 12  ? 6.408   67.469  54.391 1.00 25.94 ? 226  DA  D C2    1 
ATOM   3443 N N3    . DA  D 3 12  ? 6.468   68.709  54.818 1.00 25.48 ? 226  DA  D N3    1 
ATOM   3444 C C4    . DA  D 3 12  ? 7.607   68.900  55.504 1.00 26.15 ? 226  DA  D C4    1 
ATOM   3445 P P     . DG  D 3 13  ? 4.451   74.337  57.598 1.00 43.27 ? 227  DG  D P     1 
ATOM   3446 O OP1   . DG  D 3 13  ? 4.270   75.537  56.747 1.00 43.71 ? 227  DG  D OP1   1 
ATOM   3447 O OP2   . DG  D 3 13  ? 5.053   74.464  58.950 1.00 41.62 ? 227  DG  D OP2   1 
ATOM   3448 O "O5'" . DG  D 3 13  ? 3.029   73.575  57.736 1.00 42.49 ? 227  DG  D "O5'" 1 
ATOM   3449 C "C5'" . DG  D 3 13  ? 2.187   73.364  56.600 1.00 42.22 ? 227  DG  D "C5'" 1 
ATOM   3450 C "C4'" . DG  D 3 13  ? 1.643   71.933  56.521 1.00 42.86 ? 227  DG  D "C4'" 1 
ATOM   3451 O "O4'" . DG  D 3 13  ? 2.688   70.979  56.275 1.00 41.23 ? 227  DG  D "O4'" 1 
ATOM   3452 C "C3'" . DG  D 3 13  ? 0.948   71.505  57.829 1.00 43.81 ? 227  DG  D "C3'" 1 
ATOM   3453 O "O3'" . DG  D 3 13  ? -0.271  70.800  57.529 1.00 48.10 ? 227  DG  D "O3'" 1 
ATOM   3454 C "C2'" . DG  D 3 13  ? 1.971   70.530  58.400 1.00 41.63 ? 227  DG  D "C2'" 1 
ATOM   3455 C "C1'" . DG  D 3 13  ? 2.467   69.859  57.124 1.00 39.09 ? 227  DG  D "C1'" 1 
ATOM   3456 N N9    . DG  D 3 13  ? 3.695   69.097  57.429 1.00 35.99 ? 227  DG  D N9    1 
ATOM   3457 C C8    . DG  D 3 13  ? 4.794   69.495  58.145 1.00 35.28 ? 227  DG  D C8    1 
ATOM   3458 N N7    . DG  D 3 13  ? 5.685   68.556  58.314 1.00 34.52 ? 227  DG  D N7    1 
ATOM   3459 C C5    . DG  D 3 13  ? 5.142   67.453  57.662 1.00 33.74 ? 227  DG  D C5    1 
ATOM   3460 C C6    . DG  D 3 13  ? 5.647   66.130  57.538 1.00 33.48 ? 227  DG  D C6    1 
ATOM   3461 O O6    . DG  D 3 13  ? 6.692   65.666  57.988 1.00 33.12 ? 227  DG  D O6    1 
ATOM   3462 N N1    . DG  D 3 13  ? 4.779   65.316  56.830 1.00 32.40 ? 227  DG  D N1    1 
ATOM   3463 C C2    . DG  D 3 13  ? 3.569   65.718  56.305 1.00 33.50 ? 227  DG  D C2    1 
ATOM   3464 N N2    . DG  D 3 13  ? 2.864   64.789  55.659 1.00 33.86 ? 227  DG  D N2    1 
ATOM   3465 N N3    . DG  D 3 13  ? 3.085   66.963  56.421 1.00 33.61 ? 227  DG  D N3    1 
ATOM   3466 C C4    . DG  D 3 13  ? 3.925   67.775  57.111 1.00 34.77 ? 227  DG  D C4    1 
ATOM   3467 P P     . DC  D 3 14  ? -1.492  70.622  58.579 1.00 48.58 ? 228  DC  D P     1 
ATOM   3468 O OP1   . DC  D 3 14  ? -2.721  71.125  57.921 1.00 49.02 ? 228  DC  D OP1   1 
ATOM   3469 O OP2   . DC  D 3 14  ? -1.074  71.177  59.890 1.00 50.08 ? 228  DC  D OP2   1 
ATOM   3470 O "O5'" . DC  D 3 14  ? -1.600  69.018  58.728 1.00 47.02 ? 228  DC  D "O5'" 1 
ATOM   3471 C "C5'" . DC  D 3 14  ? -1.922  68.222  57.588 1.00 45.51 ? 228  DC  D "C5'" 1 
ATOM   3472 C "C4'" . DC  D 3 14  ? -1.183  66.890  57.597 1.00 45.30 ? 228  DC  D "C4'" 1 
ATOM   3473 O "O4'" . DC  D 3 14  ? 0.128   67.023  58.142 1.00 43.94 ? 228  DC  D "O4'" 1 
ATOM   3474 C "C3'" . DC  D 3 14  ? -1.873  65.868  58.495 1.00 45.67 ? 228  DC  D "C3'" 1 
ATOM   3475 O "O3'" . DC  D 3 14  ? -2.530  64.883  57.683 1.00 47.33 ? 228  DC  D "O3'" 1 
ATOM   3476 C "C2'" . DC  D 3 14  ? -0.713  65.251  59.321 1.00 44.25 ? 228  DC  D "C2'" 1 
ATOM   3477 C "C1'" . DC  D 3 14  ? 0.515   65.719  58.566 1.00 39.92 ? 228  DC  D "C1'" 1 
ATOM   3478 N N1    . DC  D 3 14  ? 1.735   65.821  59.393 1.00 36.73 ? 228  DC  D N1    1 
ATOM   3479 C C2    . DC  D 3 14  ? 2.570   64.714  59.484 1.00 36.23 ? 228  DC  D C2    1 
ATOM   3480 O O2    . DC  D 3 14  ? 2.272   63.643  58.959 1.00 35.49 ? 228  DC  D O2    1 
ATOM   3481 N N3    . DC  D 3 14  ? 3.728   64.843  60.184 1.00 35.79 ? 228  DC  D N3    1 
ATOM   3482 C C4    . DC  D 3 14  ? 4.058   66.002  60.777 1.00 36.08 ? 228  DC  D C4    1 
ATOM   3483 N N4    . DC  D 3 14  ? 5.213   66.089  61.440 1.00 36.44 ? 228  DC  D N4    1 
ATOM   3484 C C5    . DC  D 3 14  ? 3.202   67.145  60.699 1.00 35.52 ? 228  DC  D C5    1 
ATOM   3485 C C6    . DC  D 3 14  ? 2.057   67.003  59.999 1.00 36.34 ? 228  DC  D C6    1 
ATOM   3486 O "O5'" . DG  E 2 1   ? 1.225   121.968 24.400 1.00 56.25 ? 201  DG  E "O5'" 1 
ATOM   3487 C "C5'" . DG  E 2 1   ? 0.319   121.562 25.430 1.00 54.09 ? 201  DG  E "C5'" 1 
ATOM   3488 C "C4'" . DG  E 2 1   ? -1.137  121.605 24.971 1.00 53.25 ? 201  DG  E "C4'" 1 
ATOM   3489 O "O4'" . DG  E 2 1   ? -1.365  120.689 23.902 1.00 50.56 ? 201  DG  E "O4'" 1 
ATOM   3490 C "C3'" . DG  E 2 1   ? -2.038  121.118 26.092 1.00 54.21 ? 201  DG  E "C3'" 1 
ATOM   3491 O "O3'" . DG  E 2 1   ? -2.399  122.205 26.949 1.00 57.26 ? 201  DG  E "O3'" 1 
ATOM   3492 C "C2'" . DG  E 2 1   ? -3.264  120.632 25.331 1.00 51.84 ? 201  DG  E "C2'" 1 
ATOM   3493 C "C1'" . DG  E 2 1   ? -2.642  120.047 24.074 1.00 48.62 ? 201  DG  E "C1'" 1 
ATOM   3494 N N9    . DG  E 2 1   ? -2.459  118.575 24.103 1.00 45.08 ? 201  DG  E N9    1 
ATOM   3495 C C8    . DG  E 2 1   ? -1.386  117.892 23.608 1.00 44.20 ? 201  DG  E C8    1 
ATOM   3496 N N7    . DG  E 2 1   ? -1.490  116.603 23.685 1.00 42.87 ? 201  DG  E N7    1 
ATOM   3497 C C5    . DG  E 2 1   ? -2.722  116.401 24.278 1.00 41.81 ? 201  DG  E C5    1 
ATOM   3498 C C6    . DG  E 2 1   ? -3.359  115.186 24.594 1.00 41.49 ? 201  DG  E C6    1 
ATOM   3499 O O6    . DG  E 2 1   ? -2.930  114.052 24.406 1.00 41.94 ? 201  DG  E O6    1 
ATOM   3500 N N1    . DG  E 2 1   ? -4.597  115.381 25.175 1.00 39.80 ? 201  DG  E N1    1 
ATOM   3501 C C2    . DG  E 2 1   ? -5.163  116.608 25.427 1.00 39.81 ? 201  DG  E C2    1 
ATOM   3502 N N2    . DG  E 2 1   ? -6.364  116.589 26.009 1.00 37.38 ? 201  DG  E N2    1 
ATOM   3503 N N3    . DG  E 2 1   ? -4.560  117.775 25.127 1.00 41.08 ? 201  DG  E N3    1 
ATOM   3504 C C4    . DG  E 2 1   ? -3.338  117.594 24.552 1.00 42.72 ? 201  DG  E C4    1 
ATOM   3505 P P     . DC  E 2 2   ? -1.905  122.268 28.488 1.00 59.39 ? 202  DC  E P     1 
ATOM   3506 O OP1   . DC  E 2 2   ? -0.702  123.140 28.553 1.00 59.60 ? 202  DC  E OP1   1 
ATOM   3507 O OP2   . DC  E 2 2   ? -1.848  120.896 29.047 1.00 59.00 ? 202  DC  E OP2   1 
ATOM   3508 O "O5'" . DC  E 2 2   ? -3.143  123.034 29.185 1.00 56.91 ? 202  DC  E "O5'" 1 
ATOM   3509 C "C5'" . DC  E 2 2   ? -4.488  122.816 28.752 1.00 53.60 ? 202  DC  E "C5'" 1 
ATOM   3510 C "C4'" . DC  E 2 2   ? -5.040  121.400 28.992 1.00 50.97 ? 202  DC  E "C4'" 1 
ATOM   3511 O "O4'" . DC  E 2 2   ? -4.480  120.427 28.122 1.00 49.16 ? 202  DC  E "O4'" 1 
ATOM   3512 C "C3'" . DC  E 2 2   ? -4.657  120.823 30.333 1.00 50.59 ? 202  DC  E "C3'" 1 
ATOM   3513 O "O3'" . DC  E 2 2   ? -5.337  121.473 31.413 1.00 51.27 ? 202  DC  E "O3'" 1 
ATOM   3514 C "C2'" . DC  E 2 2   ? -5.193  119.405 30.129 1.00 49.62 ? 202  DC  E "C2'" 1 
ATOM   3515 C "C1'" . DC  E 2 2   ? -4.892  119.150 28.646 1.00 48.34 ? 202  DC  E "C1'" 1 
ATOM   3516 N N1    . DC  E 2 2   ? -3.869  118.079 28.425 1.00 45.28 ? 202  DC  E N1    1 
ATOM   3517 C C2    . DC  E 2 2   ? -4.228  116.747 28.635 1.00 44.27 ? 202  DC  E C2    1 
ATOM   3518 O O2    . DC  E 2 2   ? -5.346  116.436 29.047 1.00 44.15 ? 202  DC  E O2    1 
ATOM   3519 N N3    . DC  E 2 2   ? -3.302  115.785 28.378 1.00 42.96 ? 202  DC  E N3    1 
ATOM   3520 C C4    . DC  E 2 2   ? -2.079  116.099 27.938 1.00 43.23 ? 202  DC  E C4    1 
ATOM   3521 N N4    . DC  E 2 2   ? -1.204  115.127 27.686 1.00 43.28 ? 202  DC  E N4    1 
ATOM   3522 C C5    . DC  E 2 2   ? -1.695  117.460 27.725 1.00 43.52 ? 202  DC  E C5    1 
ATOM   3523 C C6    . DC  E 2 2   ? -2.623  118.403 27.983 1.00 44.15 ? 202  DC  E C6    1 
ATOM   3524 P P     . DT  E 2 3   ? -4.753  121.351 32.915 1.00 50.88 ? 203  DT  E P     1 
ATOM   3525 O OP1   . DT  E 2 3   ? -5.485  122.303 33.785 1.00 52.24 ? 203  DT  E OP1   1 
ATOM   3526 O OP2   . DT  E 2 3   ? -3.273  121.413 32.835 1.00 50.38 ? 203  DT  E OP2   1 
ATOM   3527 O "O5'" . DT  E 2 3   ? -5.190  119.854 33.340 1.00 48.22 ? 203  DT  E "O5'" 1 
ATOM   3528 C "C5'" . DT  E 2 3   ? -6.546  119.530 33.670 1.00 43.71 ? 203  DT  E "C5'" 1 
ATOM   3529 C "C4'" . DT  E 2 3   ? -6.758  118.022 33.753 1.00 40.58 ? 203  DT  E "C4'" 1 
ATOM   3530 O "O4'" . DT  E 2 3   ? -6.355  117.391 32.541 1.00 39.98 ? 203  DT  E "O4'" 1 
ATOM   3531 C "C3'" . DT  E 2 3   ? -5.846  117.404 34.790 1.00 39.71 ? 203  DT  E "C3'" 1 
ATOM   3532 O "O3'" . DT  E 2 3   ? -6.461  117.499 36.059 1.00 39.34 ? 203  DT  E "O3'" 1 
ATOM   3533 C "C2'" . DT  E 2 3   ? -5.826  115.958 34.335 1.00 38.01 ? 203  DT  E "C2'" 1 
ATOM   3534 C "C1'" . DT  E 2 3   ? -5.733  116.131 32.831 1.00 36.83 ? 203  DT  E "C1'" 1 
ATOM   3535 N N1    . DT  E 2 3   ? -4.335  116.131 32.346 1.00 33.52 ? 203  DT  E N1    1 
ATOM   3536 C C2    . DT  E 2 3   ? -3.779  114.921 32.004 1.00 31.65 ? 203  DT  E C2    1 
ATOM   3537 O O2    . DT  E 2 3   ? -4.381  113.855 32.099 1.00 30.90 ? 203  DT  E O2    1 
ATOM   3538 N N3    . DT  E 2 3   ? -2.489  114.978 31.522 1.00 31.74 ? 203  DT  E N3    1 
ATOM   3539 C C4    . DT  E 2 3   ? -1.718  116.106 31.348 1.00 31.45 ? 203  DT  E C4    1 
ATOM   3540 O O4    . DT  E 2 3   ? -0.580  116.016 30.894 1.00 31.61 ? 203  DT  E O4    1 
ATOM   3541 C C5    . DT  E 2 3   ? -2.380  117.324 31.731 1.00 32.07 ? 203  DT  E C5    1 
ATOM   3542 C C7    . DT  E 2 3   ? -1.663  118.661 31.568 1.00 32.19 ? 203  DT  E C7    1 
ATOM   3543 C C6    . DT  E 2 3   ? -3.634  117.300 32.209 1.00 32.90 ? 203  DT  E C6    1 
ATOM   3544 P P     . DA  E 2 4   ? -5.594  117.825 37.364 1.00 41.51 ? 204  DA  E P     1 
ATOM   3545 O OP1   . DA  E 2 4   ? -6.531  117.818 38.515 1.00 41.53 ? 204  DA  E OP1   1 
ATOM   3546 O OP2   . DA  E 2 4   ? -4.728  119.004 37.103 1.00 37.61 ? 204  DA  E OP2   1 
ATOM   3547 O "O5'" . DA  E 2 4   ? -4.649  116.536 37.488 1.00 37.00 ? 204  DA  E "O5'" 1 
ATOM   3548 C "C5'" . DA  E 2 4   ? -5.142  115.338 38.084 1.00 32.27 ? 204  DA  E "C5'" 1 
ATOM   3549 C "C4'" . DA  E 2 4   ? -3.982  114.463 38.465 1.00 29.48 ? 204  DA  E "C4'" 1 
ATOM   3550 O "O4'" . DA  E 2 4   ? -3.194  114.163 37.314 1.00 26.78 ? 204  DA  E "O4'" 1 
ATOM   3551 C "C3'" . DA  E 2 4   ? -3.095  115.230 39.428 1.00 28.17 ? 204  DA  E "C3'" 1 
ATOM   3552 O "O3'" . DA  E 2 4   ? -2.899  114.422 40.585 1.00 28.48 ? 204  DA  E "O3'" 1 
ATOM   3553 C "C2'" . DA  E 2 4   ? -1.812  115.502 38.628 1.00 27.54 ? 204  DA  E "C2'" 1 
ATOM   3554 C "C1'" . DA  E 2 4   ? -1.815  114.376 37.602 1.00 26.38 ? 204  DA  E "C1'" 1 
ATOM   3555 N N9    . DA  E 2 4   ? -1.141  114.756 36.344 1.00 24.64 ? 204  DA  E N9    1 
ATOM   3556 C C8    . DA  E 2 4   ? -1.510  115.713 35.436 1.00 24.62 ? 204  DA  E C8    1 
ATOM   3557 N N7    . DA  E 2 4   ? -0.736  115.780 34.388 1.00 24.69 ? 204  DA  E N7    1 
ATOM   3558 C C5    . DA  E 2 4   ? 0.221   114.795 34.614 1.00 23.13 ? 204  DA  E C5    1 
ATOM   3559 C C6    . DA  E 2 4   ? 1.321   114.347 33.858 1.00 22.72 ? 204  DA  E C6    1 
ATOM   3560 N N6    . DA  E 2 4   ? 1.668   114.852 32.673 1.00 21.11 ? 204  DA  E N6    1 
ATOM   3561 N N1    . DA  E 2 4   ? 2.041   113.346 34.376 1.00 22.39 ? 204  DA  E N1    1 
ATOM   3562 C C2    . DA  E 2 4   ? 1.694   112.836 35.552 1.00 21.96 ? 204  DA  E C2    1 
ATOM   3563 N N3    . DA  E 2 4   ? 0.695   113.162 36.355 1.00 22.26 ? 204  DA  E N3    1 
ATOM   3564 C C4    . DA  E 2 4   ? -0.017  114.169 35.809 1.00 23.31 ? 204  DA  E C4    1 
ATOM   3565 P P     . DT  E 2 5   ? -2.230  115.001 41.915 1.00 29.11 ? 205  DT  E P     1 
ATOM   3566 O OP1   . DT  E 2 5   ? -2.792  114.272 43.075 1.00 28.40 ? 205  DT  E OP1   1 
ATOM   3567 O OP2   . DT  E 2 5   ? -2.255  116.477 41.872 1.00 27.79 ? 205  DT  E OP2   1 
ATOM   3568 O "O5'" . DT  E 2 5   ? -0.717  114.534 41.695 1.00 27.68 ? 205  DT  E "O5'" 1 
ATOM   3569 C "C5'" . DT  E 2 5   ? -0.266  113.221 42.040 1.00 25.57 ? 205  DT  E "C5'" 1 
ATOM   3570 C "C4'" . DT  E 2 5   ? 1.236   113.130 41.873 1.00 23.18 ? 205  DT  E "C4'" 1 
ATOM   3571 O "O4'" . DT  E 2 5   ? 1.584   113.253 40.508 1.00 22.28 ? 205  DT  E "O4'" 1 
ATOM   3572 C "C3'" . DT  E 2 5   ? 1.876   114.356 42.497 1.00 23.66 ? 205  DT  E "C3'" 1 
ATOM   3573 O "O3'" . DT  E 2 5   ? 2.069   114.127 43.895 1.00 24.67 ? 205  DT  E "O3'" 1 
ATOM   3574 C "C2'" . DT  E 2 5   ? 3.190   114.515 41.720 1.00 22.40 ? 205  DT  E "C2'" 1 
ATOM   3575 C "C1'" . DT  E 2 5   ? 2.935   113.710 40.447 1.00 21.12 ? 205  DT  E "C1'" 1 
ATOM   3576 N N1    . DT  E 2 5   ? 3.116   114.472 39.190 1.00 21.27 ? 205  DT  E N1    1 
ATOM   3577 C C2    . DT  E 2 5   ? 4.091   114.022 38.305 1.00 20.66 ? 205  DT  E C2    1 
ATOM   3578 O O2    . DT  E 2 5   ? 4.864   113.105 38.564 1.00 20.79 ? 205  DT  E O2    1 
ATOM   3579 N N3    . DT  E 2 5   ? 4.173   114.694 37.103 1.00 21.17 ? 205  DT  E N3    1 
ATOM   3580 C C4    . DT  E 2 5   ? 3.389   115.762 36.707 1.00 20.33 ? 205  DT  E C4    1 
ATOM   3581 O O4    . DT  E 2 5   ? 3.549   116.255 35.596 1.00 21.75 ? 205  DT  E O4    1 
ATOM   3582 C C5    . DT  E 2 5   ? 2.410   116.180 37.683 1.00 20.14 ? 205  DT  E C5    1 
ATOM   3583 C C7    . DT  E 2 5   ? 1.496   117.357 37.367 1.00 19.32 ? 205  DT  E C7    1 
ATOM   3584 C C6    . DT  E 2 5   ? 2.302   115.539 38.870 1.00 21.01 ? 205  DT  E C6    1 
ATOM   3585 P P     . DA  E 2 6   ? 2.382   115.332 44.917 1.00 26.44 ? 206  DA  E P     1 
ATOM   3586 O OP1   . DA  E 2 6   ? 1.904   114.932 46.256 1.00 28.11 ? 206  DA  E OP1   1 
ATOM   3587 O OP2   . DA  E 2 6   ? 1.933   116.609 44.317 1.00 27.19 ? 206  DA  E OP2   1 
ATOM   3588 O "O5'" . DA  E 2 6   ? 3.979   115.359 44.944 1.00 24.70 ? 206  DA  E "O5'" 1 
ATOM   3589 C "C5'" . DA  E 2 6   ? 4.752   114.233 45.361 1.00 22.63 ? 206  DA  E "C5'" 1 
ATOM   3590 C "C4'" . DA  E 2 6   ? 6.186   114.410 44.918 1.00 21.02 ? 206  DA  E "C4'" 1 
ATOM   3591 O "O4'" . DA  E 2 6   ? 6.240   114.472 43.506 1.00 21.08 ? 206  DA  E "O4'" 1 
ATOM   3592 C "C3'" . DA  E 2 6   ? 6.664   115.763 45.398 1.00 21.48 ? 206  DA  E "C3'" 1 
ATOM   3593 O "O3'" . DA  E 2 6   ? 7.330   115.557 46.643 1.00 25.67 ? 206  DA  E "O3'" 1 
ATOM   3594 C "C2'" . DA  E 2 6   ? 7.619   116.247 44.311 1.00 20.20 ? 206  DA  E "C2'" 1 
ATOM   3595 C "C1'" . DA  E 2 6   ? 7.218   115.422 43.092 1.00 19.57 ? 206  DA  E "C1'" 1 
ATOM   3596 N N9    . DA  E 2 6   ? 6.642   116.227 42.002 1.00 18.32 ? 206  DA  E N9    1 
ATOM   3597 C C8    . DA  E 2 6   ? 5.636   117.158 42.049 1.00 17.28 ? 206  DA  E C8    1 
ATOM   3598 N N7    . DA  E 2 6   ? 5.330   117.653 40.883 1.00 17.58 ? 206  DA  E N7    1 
ATOM   3599 C C5    . DA  E 2 6   ? 6.193   117.010 40.005 1.00 17.02 ? 206  DA  E C5    1 
ATOM   3600 C C6    . DA  E 2 6   ? 6.366   117.089 38.619 1.00 17.70 ? 206  DA  E C6    1 
ATOM   3601 N N6    . DA  E 2 6   ? 5.661   117.901 37.836 1.00 18.77 ? 206  DA  E N6    1 
ATOM   3602 N N1    . DA  E 2 6   ? 7.300   116.306 38.075 1.00 18.90 ? 206  DA  E N1    1 
ATOM   3603 C C2    . DA  E 2 6   ? 8.015   115.503 38.851 1.00 17.96 ? 206  DA  E C2    1 
ATOM   3604 N N3    . DA  E 2 6   ? 7.950   115.338 40.157 1.00 17.60 ? 206  DA  E N3    1 
ATOM   3605 C C4    . DA  E 2 6   ? 6.997   116.139 40.678 1.00 17.97 ? 206  DA  E C4    1 
ATOM   3606 P P     . DA  E 2 7   ? 7.341   116.664 47.797 1.00 27.66 ? 207  DA  E P     1 
ATOM   3607 O OP1   . DA  E 2 7   ? 7.837   115.990 49.016 1.00 30.99 ? 207  DA  E OP1   1 
ATOM   3608 O OP2   . DA  E 2 7   ? 6.050   117.384 47.811 1.00 27.42 ? 207  DA  E OP2   1 
ATOM   3609 O "O5'" . DA  E 2 7   ? 8.462   117.692 47.305 1.00 27.89 ? 207  DA  E "O5'" 1 
ATOM   3610 C "C5'" . DA  E 2 7   ? 9.834   117.284 47.246 1.00 25.72 ? 207  DA  E "C5'" 1 
ATOM   3611 C "C4'" . DA  E 2 7   ? 10.643  118.166 46.308 1.00 22.46 ? 207  DA  E "C4'" 1 
ATOM   3612 O "O4'" . DA  E 2 7   ? 10.283  117.932 44.953 1.00 21.98 ? 207  DA  E "O4'" 1 
ATOM   3613 C "C3'" . DA  E 2 7   ? 10.298  119.628 46.515 1.00 22.39 ? 207  DA  E "C3'" 1 
ATOM   3614 O "O3'" . DA  E 2 7   ? 10.959  120.094 47.705 1.00 25.94 ? 207  DA  E "O3'" 1 
ATOM   3615 C "C2'" . DA  E 2 7   ? 10.909  120.196 45.236 1.00 21.17 ? 207  DA  E "C2'" 1 
ATOM   3616 C "C1'" . DA  E 2 7   ? 10.566  119.115 44.203 1.00 19.95 ? 207  DA  E "C1'" 1 
ATOM   3617 N N9    . DA  E 2 7   ? 9.421   119.490 43.333 1.00 18.56 ? 207  DA  E N9    1 
ATOM   3618 C C8    . DA  E 2 7   ? 8.194   120.011 43.666 1.00 18.06 ? 207  DA  E C8    1 
ATOM   3619 N N7    . DA  E 2 7   ? 7.424   120.248 42.642 1.00 17.94 ? 207  DA  E N7    1 
ATOM   3620 C C5    . DA  E 2 7   ? 8.191   119.859 41.553 1.00 17.03 ? 207  DA  E C5    1 
ATOM   3621 C C6    . DA  E 2 7   ? 7.953   119.868 40.169 1.00 17.16 ? 207  DA  E C6    1 
ATOM   3622 N N6    . DA  E 2 7   ? 6.821   120.303 39.614 1.00 15.34 ? 207  DA  E N6    1 
ATOM   3623 N N1    . DA  E 2 7   ? 8.936   119.417 39.377 1.00 17.49 ? 207  DA  E N1    1 
ATOM   3624 C C2    . DA  E 2 7   ? 10.067  118.991 39.915 1.00 17.68 ? 207  DA  E C2    1 
ATOM   3625 N N3    . DA  E 2 7   ? 10.411  118.935 41.188 1.00 18.99 ? 207  DA  E N3    1 
ATOM   3626 C C4    . DA  E 2 7   ? 9.406   119.394 41.966 1.00 18.34 ? 207  DA  E C4    1 
ATOM   3627 P P     . DG  E 2 8   ? 10.691  121.527 48.388 1.00 25.63 ? 208  DG  E P     1 
ATOM   3628 O OP1   . DG  E 2 8   ? 11.144  121.453 49.789 1.00 28.69 ? 208  DG  E OP1   1 
ATOM   3629 O OP2   . DG  E 2 8   ? 9.313   121.954 48.076 1.00 25.71 ? 208  DG  E OP2   1 
ATOM   3630 O "O5'" . DG  E 2 8   ? 11.696  122.480 47.605 1.00 23.07 ? 208  DG  E "O5'" 1 
ATOM   3631 C "C5'" . DG  E 2 8   ? 13.100  122.265 47.676 1.00 22.22 ? 208  DG  E "C5'" 1 
ATOM   3632 C "C4'" . DG  E 2 8   ? 13.795  122.962 46.531 1.00 20.79 ? 208  DG  E "C4'" 1 
ATOM   3633 O "O4'" . DG  E 2 8   ? 13.316  122.451 45.297 1.00 21.03 ? 208  DG  E "O4'" 1 
ATOM   3634 C "C3'" . DG  E 2 8   ? 13.453  124.437 46.550 1.00 21.10 ? 208  DG  E "C3'" 1 
ATOM   3635 O "O3'" . DG  E 2 8   ? 14.491  125.098 47.270 1.00 21.72 ? 208  DG  E "O3'" 1 
ATOM   3636 C "C2'" . DG  E 2 8   ? 13.476  124.811 45.069 1.00 20.08 ? 208  DG  E "C2'" 1 
ATOM   3637 C "C1'" . DG  E 2 8   ? 13.076  123.510 44.382 1.00 19.39 ? 208  DG  E "C1'" 1 
ATOM   3638 N N9    . DG  E 2 8   ? 11.670  123.490 43.936 1.00 18.35 ? 208  DG  E N9    1 
ATOM   3639 C C8    . DG  E 2 8   ? 10.522  123.699 44.648 1.00 16.39 ? 208  DG  E C8    1 
ATOM   3640 N N7    . DG  E 2 8   ? 9.443   123.619 43.925 1.00 17.58 ? 208  DG  E N7    1 
ATOM   3641 C C5    . DG  E 2 8   ? 9.906   123.335 42.638 1.00 17.87 ? 208  DG  E C5    1 
ATOM   3642 C C6    . DG  E 2 8   ? 9.195   123.155 41.404 1.00 17.92 ? 208  DG  E C6    1 
ATOM   3643 O O6    . DG  E 2 8   ? 7.984   123.197 41.192 1.00 17.22 ? 208  DG  E O6    1 
ATOM   3644 N N1    . DG  E 2 8   ? 10.060  122.909 40.351 1.00 18.62 ? 208  DG  E N1    1 
ATOM   3645 C C2    . DG  E 2 8   ? 11.433  122.840 40.456 1.00 18.46 ? 208  DG  E C2    1 
ATOM   3646 N N2    . DG  E 2 8   ? 12.122  122.580 39.350 1.00 19.04 ? 208  DG  E N2    1 
ATOM   3647 N N3    . DG  E 2 8   ? 12.091  123.008 41.598 1.00 19.50 ? 208  DG  E N3    1 
ATOM   3648 C C4    . DG  E 2 8   ? 11.269  123.252 42.644 1.00 18.59 ? 208  DG  E C4    1 
ATOM   3649 P P     . DA  E 2 9   ? 14.204  126.278 48.314 1.00 21.85 ? 209  DA  E P     1 
ATOM   3650 O OP1   . DA  E 2 9   ? 15.348  126.317 49.253 1.00 24.74 ? 209  DA  E OP1   1 
ATOM   3651 O OP2   . DA  E 2 9   ? 12.823  126.134 48.821 1.00 23.72 ? 209  DA  E OP2   1 
ATOM   3652 O "O5'" . DA  E 2 9   ? 14.258  127.607 47.442 1.00 23.27 ? 209  DA  E "O5'" 1 
ATOM   3653 C "C5'" . DA  E 2 9   ? 15.482  128.051 46.839 1.00 22.57 ? 209  DA  E "C5'" 1 
ATOM   3654 C "C4'" . DA  E 2 9   ? 15.195  128.753 45.520 1.00 21.39 ? 209  DA  E "C4'" 1 
ATOM   3655 O "O4'" . DA  E 2 9   ? 14.460  127.882 44.671 1.00 21.14 ? 209  DA  E "O4'" 1 
ATOM   3656 C "C3'" . DA  E 2 9   ? 14.282  129.948 45.759 1.00 22.22 ? 209  DA  E "C3'" 1 
ATOM   3657 O "O3'" . DA  E 2 9   ? 15.099  131.101 46.020 1.00 24.75 ? 209  DA  E "O3'" 1 
ATOM   3658 C "C2'" . DA  E 2 9   ? 13.534  130.065 44.431 1.00 20.81 ? 209  DA  E "C2'" 1 
ATOM   3659 C "C1'" . DA  E 2 9   ? 13.507  128.621 43.925 1.00 20.28 ? 209  DA  E "C1'" 1 
ATOM   3660 N N9    . DA  E 2 9   ? 12.163  128.026 44.034 1.00 20.55 ? 209  DA  E N9    1 
ATOM   3661 C C8    . DA  E 2 9   ? 11.361  127.860 45.141 1.00 20.02 ? 209  DA  E C8    1 
ATOM   3662 N N7    . DA  E 2 9   ? 10.185  127.357 44.868 1.00 19.81 ? 209  DA  E N7    1 
ATOM   3663 C C5    . DA  E 2 9   ? 10.210  127.175 43.485 1.00 19.13 ? 209  DA  E C5    1 
ATOM   3664 C C6    . DA  E 2 9   ? 9.270   126.668 42.569 1.00 18.11 ? 209  DA  E C6    1 
ATOM   3665 N N6    . DA  E 2 9   ? 8.043   126.280 42.902 1.00 16.60 ? 209  DA  E N6    1 
ATOM   3666 N N1    . DA  E 2 9   ? 9.640   126.611 41.285 1.00 18.77 ? 209  DA  E N1    1 
ATOM   3667 C C2    . DA  E 2 9   ? 10.845  127.029 40.932 1.00 18.48 ? 209  DA  E C2    1 
ATOM   3668 N N3    . DA  E 2 9   ? 11.809  127.529 41.684 1.00 20.20 ? 209  DA  E N3    1 
ATOM   3669 C C4    . DA  E 2 9   ? 11.414  127.574 42.974 1.00 19.80 ? 209  DA  E C4    1 
ATOM   3670 P P     . DG  E 2 10  ? 14.650  132.278 47.016 1.00 25.91 ? 210  DG  E P     1 
ATOM   3671 O OP1   . DG  E 2 10  ? 15.843  133.098 47.301 1.00 25.20 ? 210  DG  E OP1   1 
ATOM   3672 O OP2   . DG  E 2 10  ? 13.860  131.698 48.125 1.00 27.39 ? 210  DG  E OP2   1 
ATOM   3673 O "O5'" . DG  E 2 10  ? 13.636  133.127 46.138 1.00 25.38 ? 210  DG  E "O5'" 1 
ATOM   3674 C "C5'" . DG  E 2 10  ? 14.099  133.858 45.020 1.00 26.16 ? 210  DG  E "C5'" 1 
ATOM   3675 C "C4'" . DG  E 2 10  ? 12.948  134.490 44.279 1.00 27.42 ? 210  DG  E "C4'" 1 
ATOM   3676 O "O4'" . DG  E 2 10  ? 12.007  133.499 43.859 1.00 27.24 ? 210  DG  E "O4'" 1 
ATOM   3677 C "C3'" . DG  E 2 10  ? 12.182  135.451 45.174 1.00 28.61 ? 210  DG  E "C3'" 1 
ATOM   3678 O "O3'" . DG  E 2 10  ? 11.955  136.641 44.433 1.00 33.25 ? 210  DG  E "O3'" 1 
ATOM   3679 C "C2'" . DG  E 2 10  ? 10.870  134.705 45.421 1.00 26.74 ? 210  DG  E "C2'" 1 
ATOM   3680 C "C1'" . DG  E 2 10  ? 10.700  134.005 44.083 1.00 24.96 ? 210  DG  E "C1'" 1 
ATOM   3681 N N9    . DG  E 2 10  ? 9.726   132.895 44.141 1.00 23.10 ? 210  DG  E N9    1 
ATOM   3682 C C8    . DG  E 2 10  ? 8.635   132.676 43.333 1.00 22.23 ? 210  DG  E C8    1 
ATOM   3683 N N7    . DG  E 2 10  ? 7.942   131.621 43.651 1.00 21.52 ? 210  DG  E N7    1 
ATOM   3684 C C5    . DG  E 2 10  ? 8.620   131.099 44.750 1.00 21.58 ? 210  DG  E C5    1 
ATOM   3685 C C6    . DG  E 2 10  ? 8.333   129.950 45.529 1.00 21.19 ? 210  DG  E C6    1 
ATOM   3686 O O6    . DG  E 2 10  ? 7.396   129.168 45.409 1.00 20.29 ? 210  DG  E O6    1 
ATOM   3687 N N1    . DG  E 2 10  ? 9.267   129.771 46.537 1.00 21.05 ? 210  DG  E N1    1 
ATOM   3688 C C2    . DG  E 2 10  ? 10.349  130.596 46.775 1.00 21.57 ? 210  DG  E C2    1 
ATOM   3689 N N2    . DG  E 2 10  ? 11.157  130.261 47.787 1.00 21.93 ? 210  DG  E N2    1 
ATOM   3690 N N3    . DG  E 2 10  ? 10.619  131.681 46.045 1.00 21.75 ? 210  DG  E N3    1 
ATOM   3691 C C4    . DG  E 2 10  ? 9.716   131.870 45.054 1.00 22.29 ? 210  DG  E C4    1 
ATOM   3692 P P     . DG  E 2 11  ? 11.743  138.042 45.187 1.00 36.62 ? 211  DG  E P     1 
ATOM   3693 O OP1   . DG  E 2 11  ? 12.810  138.971 44.743 1.00 38.34 ? 211  DG  E OP1   1 
ATOM   3694 O OP2   . DG  E 2 11  ? 11.519  137.797 46.634 1.00 35.87 ? 211  DG  E OP2   1 
ATOM   3695 O "O5'" . DG  E 2 11  ? 10.372  138.499 44.522 1.00 34.55 ? 211  DG  E "O5'" 1 
ATOM   3696 C "C5'" . DG  E 2 11  ? 10.378  138.834 43.142 1.00 33.56 ? 211  DG  E "C5'" 1 
ATOM   3697 C "C4'" . DG  E 2 11  ? 8.974   138.982 42.618 1.00 33.64 ? 211  DG  E "C4'" 1 
ATOM   3698 O "O4'" . DG  E 2 11  ? 8.252   137.751 42.728 1.00 33.22 ? 211  DG  E "O4'" 1 
ATOM   3699 C "C3'" . DG  E 2 11  ? 8.193   139.997 43.424 1.00 33.84 ? 211  DG  E "C3'" 1 
ATOM   3700 O "O3'" . DG  E 2 11  ? 7.283   140.622 42.527 1.00 38.24 ? 211  DG  E "O3'" 1 
ATOM   3701 C "C2'" . DG  E 2 11  ? 7.473   139.103 44.445 1.00 33.07 ? 211  DG  E "C2'" 1 
ATOM   3702 C "C1'" . DG  E 2 11  ? 7.118   137.892 43.592 1.00 30.08 ? 211  DG  E "C1'" 1 
ATOM   3703 N N9    . DG  E 2 11  ? 6.991   136.654 44.386 1.00 25.80 ? 211  DG  E N9    1 
ATOM   3704 C C8    . DG  E 2 11  ? 7.742   136.240 45.442 1.00 24.34 ? 211  DG  E C8    1 
ATOM   3705 N N7    . DG  E 2 11  ? 7.418   135.063 45.895 1.00 24.01 ? 211  DG  E N7    1 
ATOM   3706 C C5    . DG  E 2 11  ? 6.370   134.665 45.079 1.00 23.52 ? 211  DG  E C5    1 
ATOM   3707 C C6    . DG  E 2 11  ? 5.609   133.464 45.093 1.00 22.62 ? 211  DG  E C6    1 
ATOM   3708 O O6    . DG  E 2 11  ? 5.730   132.493 45.838 1.00 22.43 ? 211  DG  E O6    1 
ATOM   3709 N N1    . DG  E 2 11  ? 4.641   133.466 44.104 1.00 22.45 ? 211  DG  E N1    1 
ATOM   3710 C C2    . DG  E 2 11  ? 4.430   134.495 43.211 1.00 23.74 ? 211  DG  E C2    1 
ATOM   3711 N N2    . DG  E 2 11  ? 3.442   134.346 42.337 1.00 23.33 ? 211  DG  E N2    1 
ATOM   3712 N N3    . DG  E 2 11  ? 5.148   135.619 43.196 1.00 24.07 ? 211  DG  E N3    1 
ATOM   3713 C C4    . DG  E 2 11  ? 6.098   135.635 44.155 1.00 24.35 ? 211  DG  E C4    1 
ATOM   3714 P P     . DG  E 2 12  ? 6.298   141.802 42.984 1.00 39.97 ? 212  DG  E P     1 
ATOM   3715 O OP1   . DG  E 2 12  ? 6.156   142.730 41.840 1.00 41.46 ? 212  DG  E OP1   1 
ATOM   3716 O OP2   . DG  E 2 12  ? 6.738   142.307 44.304 1.00 40.63 ? 212  DG  E OP2   1 
ATOM   3717 O "O5'" . DG  E 2 12  ? 4.916   141.017 43.175 1.00 38.18 ? 212  DG  E "O5'" 1 
ATOM   3718 C "C5'" . DG  E 2 12  ? 4.250   140.537 42.013 1.00 38.05 ? 212  DG  E "C5'" 1 
ATOM   3719 C "C4'" . DG  E 2 12  ? 3.010   139.769 42.383 1.00 38.18 ? 212  DG  E "C4'" 1 
ATOM   3720 O "O4'" . DG  E 2 12  ? 3.362   138.619 43.140 1.00 36.41 ? 212  DG  E "O4'" 1 
ATOM   3721 C "C3'" . DG  E 2 12  ? 2.124   140.621 43.279 1.00 38.99 ? 212  DG  E "C3'" 1 
ATOM   3722 O "O3'" . DG  E 2 12  ? 0.842   140.783 42.650 1.00 42.44 ? 212  DG  E "O3'" 1 
ATOM   3723 C "C2'" . DG  E 2 12  ? 2.070   139.804 44.587 1.00 37.55 ? 212  DG  E "C2'" 1 
ATOM   3724 C "C1'" . DG  E 2 12  ? 2.359   138.389 44.108 1.00 33.56 ? 212  DG  E "C1'" 1 
ATOM   3725 N N9    . DG  E 2 12  ? 2.925   137.540 45.175 1.00 30.49 ? 212  DG  E N9    1 
ATOM   3726 C C8    . DG  E 2 12  ? 4.000   137.787 45.992 1.00 29.17 ? 212  DG  E C8    1 
ATOM   3727 N N7    . DG  E 2 12  ? 4.258   136.821 46.828 1.00 28.73 ? 212  DG  E N7    1 
ATOM   3728 C C5    . DG  E 2 12  ? 3.287   135.863 46.548 1.00 28.02 ? 212  DG  E C5    1 
ATOM   3729 C C6    . DG  E 2 12  ? 3.053   134.601 47.147 1.00 27.66 ? 212  DG  E C6    1 
ATOM   3730 O O6    . DG  E 2 12  ? 3.679   134.062 48.052 1.00 29.52 ? 212  DG  E O6    1 
ATOM   3731 N N1    . DG  E 2 12  ? 1.967   133.953 46.592 1.00 27.48 ? 212  DG  E N1    1 
ATOM   3732 C C2    . DG  E 2 12  ? 1.191   134.458 45.577 1.00 28.10 ? 212  DG  E C2    1 
ATOM   3733 N N2    . DG  E 2 12  ? 0.172   133.706 45.171 1.00 27.99 ? 212  DG  E N2    1 
ATOM   3734 N N3    . DG  E 2 12  ? 1.407   135.648 45.007 1.00 29.02 ? 212  DG  E N3    1 
ATOM   3735 C C4    . DG  E 2 12  ? 2.468   136.294 45.541 1.00 28.86 ? 212  DG  E C4    1 
ATOM   3736 P P     . DC  E 2 13  ? -0.242  141.894 43.143 1.00 44.45 ? 213  DC  E P     1 
ATOM   3737 O OP1   . DC  E 2 13  ? -0.451  142.865 42.045 1.00 44.72 ? 213  DC  E OP1   1 
ATOM   3738 O OP2   . DC  E 2 13  ? 0.145   142.367 44.494 1.00 43.60 ? 213  DC  E OP2   1 
ATOM   3739 O "O5'" . DC  E 2 13  ? -1.555  140.990 43.275 1.00 43.68 ? 213  DC  E "O5'" 1 
ATOM   3740 C "C5'" . DC  E 2 13  ? -1.349  139.681 43.784 1.00 44.47 ? 213  DC  E "C5'" 1 
ATOM   3741 C "C4'" . DC  E 2 13  ? -2.617  138.926 44.059 1.00 44.76 ? 213  DC  E "C4'" 1 
ATOM   3742 O "O4'" . DC  E 2 13  ? -2.258  137.770 44.820 1.00 43.15 ? 213  DC  E "O4'" 1 
ATOM   3743 C "C3'" . DC  E 2 13  ? -3.542  139.723 44.966 1.00 46.03 ? 213  DC  E "C3'" 1 
ATOM   3744 O "O3'" . DC  E 2 13  ? -4.833  139.108 45.052 1.00 49.90 ? 213  DC  E "O3'" 1 
ATOM   3745 C "C2'" . DC  E 2 13  ? -2.791  139.552 46.269 1.00 44.55 ? 213  DC  E "C2'" 1 
ATOM   3746 C "C1'" . DC  E 2 13  ? -2.436  138.060 46.203 1.00 41.30 ? 213  DC  E "C1'" 1 
ATOM   3747 N N1    . DC  E 2 13  ? -1.225  137.773 47.002 1.00 38.30 ? 213  DC  E N1    1 
ATOM   3748 C C2    . DC  E 2 13  ? -1.105  136.512 47.552 1.00 36.88 ? 213  DC  E C2    1 
ATOM   3749 O O2    . DC  E 2 13  ? -1.948  135.644 47.335 1.00 36.99 ? 213  DC  E O2    1 
ATOM   3750 N N3    . DC  E 2 13  ? -0.027  136.256 48.333 1.00 36.25 ? 213  DC  E N3    1 
ATOM   3751 C C4    . DC  E 2 13  ? 0.897   137.194 48.564 1.00 36.10 ? 213  DC  E C4    1 
ATOM   3752 N N4    . DC  E 2 13  ? 1.938   136.903 49.340 1.00 35.79 ? 213  DC  E N4    1 
ATOM   3753 C C5    . DC  E 2 13  ? 0.790   138.499 47.997 1.00 35.77 ? 213  DC  E C5    1 
ATOM   3754 C C6    . DC  E 2 13  ? -0.286  138.737 47.225 1.00 36.76 ? 213  DC  E C6    1 
ATOM   3755 P P     . DA  E 2 14  ? -6.093  139.954 45.601 1.00 52.07 ? 214  DA  E P     1 
ATOM   3756 O OP1   . DA  E 2 14  ? -6.220  141.178 44.773 1.00 51.96 ? 214  DA  E OP1   1 
ATOM   3757 O OP2   . DA  E 2 14  ? -5.973  140.072 47.075 1.00 51.16 ? 214  DA  E OP2   1 
ATOM   3758 O "O5'" . DA  E 2 14  ? -7.332  138.977 45.252 1.00 50.70 ? 214  DA  E "O5'" 1 
ATOM   3759 C "C5'" . DA  E 2 14  ? -8.292  138.685 46.263 1.00 49.72 ? 214  DA  E "C5'" 1 
ATOM   3760 C "C4'" . DA  E 2 14  ? -7.963  137.393 46.994 1.00 48.84 ? 214  DA  E "C4'" 1 
ATOM   3761 O "O4'" . DA  E 2 14  ? -6.566  137.319 47.327 1.00 47.73 ? 214  DA  E "O4'" 1 
ATOM   3762 C "C3'" . DA  E 2 14  ? -8.712  137.339 48.328 1.00 48.70 ? 214  DA  E "C3'" 1 
ATOM   3763 O "O3'" . DA  E 2 14  ? -9.094  135.987 48.598 1.00 50.09 ? 214  DA  E "O3'" 1 
ATOM   3764 C "C2'" . DA  E 2 14  ? -7.618  137.801 49.297 1.00 47.11 ? 214  DA  E "C2'" 1 
ATOM   3765 C "C1'" . DA  E 2 14  ? -6.451  137.031 48.718 1.00 45.17 ? 214  DA  E "C1'" 1 
ATOM   3766 N N9    . DA  E 2 14  ? -5.148  137.476 49.250 1.00 43.05 ? 214  DA  E N9    1 
ATOM   3767 C C8    . DA  E 2 14  ? -4.526  138.699 49.156 1.00 41.71 ? 214  DA  E C8    1 
ATOM   3768 N N7    . DA  E 2 14  ? -3.353  138.742 49.738 1.00 41.17 ? 214  DA  E N7    1 
ATOM   3769 C C5    . DA  E 2 14  ? -3.191  137.457 50.253 1.00 39.91 ? 214  DA  E C5    1 
ATOM   3770 C C6    . DA  E 2 14  ? -2.167  136.856 50.992 1.00 38.80 ? 214  DA  E C6    1 
ATOM   3771 N N6    . DA  E 2 14  ? -1.056  137.492 51.349 1.00 38.38 ? 214  DA  E N6    1 
ATOM   3772 N N1    . DA  E 2 14  ? -2.339  135.578 51.347 1.00 38.56 ? 214  DA  E N1    1 
ATOM   3773 C C2    . DA  E 2 14  ? -3.450  134.946 50.990 1.00 39.19 ? 214  DA  E C2    1 
ATOM   3774 N N3    . DA  E 2 14  ? -4.484  135.391 50.301 1.00 39.79 ? 214  DA  E N3    1 
ATOM   3775 C C4    . DA  E 2 14  ? -4.280  136.681 49.959 1.00 40.96 ? 214  DA  E C4    1 
ATOM   3776 O "O5'" . DT  F 3 1   ? -0.980  130.840 59.628 1.00 50.26 ? 215  DT  F "O5'" 1 
ATOM   3777 C "C5'" . DT  F 3 1   ? -0.517  129.785 58.776 1.00 50.23 ? 215  DT  F "C5'" 1 
ATOM   3778 C "C4'" . DT  F 3 1   ? -1.284  129.738 57.451 1.00 49.67 ? 215  DT  F "C4'" 1 
ATOM   3779 O "O4'" . DT  F 3 1   ? -1.364  131.050 56.890 1.00 48.29 ? 215  DT  F "O4'" 1 
ATOM   3780 C "C3'" . DT  F 3 1   ? -0.485  128.951 56.415 1.00 50.11 ? 215  DT  F "C3'" 1 
ATOM   3781 O "O3'" . DT  F 3 1   ? -0.779  127.524 56.419 1.00 53.82 ? 215  DT  F "O3'" 1 
ATOM   3782 C "C2'" . DT  F 3 1   ? -0.770  129.645 55.073 1.00 47.30 ? 215  DT  F "C2'" 1 
ATOM   3783 C "C1'" . DT  F 3 1   ? -1.485  130.937 55.468 1.00 44.98 ? 215  DT  F "C1'" 1 
ATOM   3784 N N1    . DT  F 3 1   ? -0.923  132.145 54.812 1.00 41.94 ? 215  DT  F N1    1 
ATOM   3785 C C2    . DT  F 3 1   ? -1.636  132.690 53.757 1.00 40.83 ? 215  DT  F C2    1 
ATOM   3786 O O2    . DT  F 3 1   ? -2.667  132.189 53.322 1.00 41.80 ? 215  DT  F O2    1 
ATOM   3787 N N3    . DT  F 3 1   ? -1.119  133.840 53.193 1.00 40.00 ? 215  DT  F N3    1 
ATOM   3788 C C4    . DT  F 3 1   ? 0.035   134.491 53.576 1.00 39.23 ? 215  DT  F C4    1 
ATOM   3789 O O4    . DT  F 3 1   ? 0.383   135.520 52.997 1.00 38.16 ? 215  DT  F O4    1 
ATOM   3790 C C5    . DT  F 3 1   ? 0.725   133.851 54.678 1.00 39.75 ? 215  DT  F C5    1 
ATOM   3791 C C7    . DT  F 3 1   ? 2.028   134.452 55.197 1.00 38.83 ? 215  DT  F C7    1 
ATOM   3792 C C6    . DT  F 3 1   ? 0.238   132.728 55.249 1.00 40.70 ? 215  DT  F C6    1 
ATOM   3793 P P     . DG  F 3 2   ? -2.215  126.759 56.220 1.00 54.77 ? 216  DG  F P     1 
ATOM   3794 O OP1   . DG  F 3 2   ? -3.310  127.684 56.610 1.00 55.35 ? 216  DG  F OP1   1 
ATOM   3795 O OP2   . DG  F 3 2   ? -2.110  125.436 56.874 1.00 54.19 ? 216  DG  F OP2   1 
ATOM   3796 O "O5'" . DG  F 3 2   ? -2.288  126.504 54.618 1.00 53.75 ? 216  DG  F "O5'" 1 
ATOM   3797 C "C5'" . DG  F 3 2   ? -3.031  127.367 53.742 1.00 51.40 ? 216  DG  F "C5'" 1 
ATOM   3798 C "C4'" . DG  F 3 2   ? -2.333  127.625 52.392 1.00 50.08 ? 216  DG  F "C4'" 1 
ATOM   3799 O "O4'" . DG  F 3 2   ? -1.971  129.005 52.236 1.00 46.88 ? 216  DG  F "O4'" 1 
ATOM   3800 C "C3'" . DG  F 3 2   ? -1.024  126.817 52.240 1.00 50.40 ? 216  DG  F "C3'" 1 
ATOM   3801 O "O3'" . DG  F 3 2   ? -0.977  125.987 51.068 1.00 54.63 ? 216  DG  F "O3'" 1 
ATOM   3802 C "C2'" . DG  F 3 2   ? 0.016   127.913 52.067 1.00 47.45 ? 216  DG  F "C2'" 1 
ATOM   3803 C "C1'" . DG  F 3 2   ? -0.814  129.010 51.416 1.00 43.00 ? 216  DG  F "C1'" 1 
ATOM   3804 N N9    . DG  F 3 2   ? -0.076  130.289 51.447 1.00 38.80 ? 216  DG  F N9    1 
ATOM   3805 C C8    . DG  F 3 2   ? 1.029   130.620 52.190 1.00 37.96 ? 216  DG  F C8    1 
ATOM   3806 N N7    . DG  F 3 2   ? 1.497   131.813 51.951 1.00 37.13 ? 216  DG  F N7    1 
ATOM   3807 C C5    . DG  F 3 2   ? 0.639   132.316 50.978 1.00 35.88 ? 216  DG  F C5    1 
ATOM   3808 C C6    . DG  F 3 2   ? 0.656   133.570 50.321 1.00 34.84 ? 216  DG  F C6    1 
ATOM   3809 O O6    . DG  F 3 2   ? 1.455   134.489 50.465 1.00 34.81 ? 216  DG  F O6    1 
ATOM   3810 N N1    . DG  F 3 2   ? -0.377  133.683 49.410 1.00 33.02 ? 216  DG  F N1    1 
ATOM   3811 C C2    . DG  F 3 2   ? -1.312  132.710 49.155 1.00 33.07 ? 216  DG  F C2    1 
ATOM   3812 N N2    . DG  F 3 2   ? -2.231  132.996 48.239 1.00 33.10 ? 216  DG  F N2    1 
ATOM   3813 N N3    . DG  F 3 2   ? -1.330  131.525 49.768 1.00 34.43 ? 216  DG  F N3    1 
ATOM   3814 C C4    . DG  F 3 2   ? -0.329  131.395 50.665 1.00 36.62 ? 216  DG  F C4    1 
ATOM   3815 P P     . DC  F 3 3   ? -2.283  125.383 50.323 1.00 57.63 ? 217  DC  F P     1 
ATOM   3816 O OP1   . DC  F 3 3   ? -3.217  124.876 51.359 1.00 57.28 ? 217  DC  F OP1   1 
ATOM   3817 O OP2   . DC  F 3 3   ? -1.813  124.479 49.239 1.00 56.93 ? 217  DC  F OP2   1 
ATOM   3818 O "O5'" . DC  F 3 3   ? -2.922  126.719 49.650 1.00 54.55 ? 217  DC  F "O5'" 1 
ATOM   3819 C "C5'" . DC  F 3 3   ? -3.585  126.701 48.382 1.00 50.34 ? 217  DC  F "C5'" 1 
ATOM   3820 C "C4'" . DC  F 3 3   ? -2.832  127.486 47.301 1.00 46.52 ? 217  DC  F "C4'" 1 
ATOM   3821 O "O4'" . DC  F 3 3   ? -1.985  128.496 47.863 1.00 43.74 ? 217  DC  F "O4'" 1 
ATOM   3822 C "C3'" . DC  F 3 3   ? -1.926  126.576 46.457 1.00 45.72 ? 217  DC  F "C3'" 1 
ATOM   3823 O "O3'" . DC  F 3 3   ? -2.247  126.696 45.064 1.00 45.34 ? 217  DC  F "O3'" 1 
ATOM   3824 C "C2'" . DC  F 3 3   ? -0.543  127.172 46.714 1.00 43.30 ? 217  DC  F "C2'" 1 
ATOM   3825 C "C1'" . DC  F 3 3   ? -0.897  128.623 46.960 1.00 40.60 ? 217  DC  F "C1'" 1 
ATOM   3826 N N1    . DC  F 3 3   ? 0.261   129.369 47.517 1.00 36.91 ? 217  DC  F N1    1 
ATOM   3827 C C2    . DC  F 3 3   ? 0.433   130.681 47.101 1.00 35.71 ? 217  DC  F C2    1 
ATOM   3828 O O2    . DC  F 3 3   ? -0.374  131.198 46.332 1.00 35.70 ? 217  DC  F O2    1 
ATOM   3829 N N3    . DC  F 3 3   ? 1.507   131.378 47.565 1.00 34.09 ? 217  DC  F N3    1 
ATOM   3830 C C4    . DC  F 3 3   ? 2.377   130.808 48.407 1.00 33.70 ? 217  DC  F C4    1 
ATOM   3831 N N4    . DC  F 3 3   ? 3.419   131.513 48.841 1.00 32.98 ? 217  DC  F N4    1 
ATOM   3832 C C5    . DC  F 3 3   ? 2.210   129.455 48.849 1.00 34.15 ? 217  DC  F C5    1 
ATOM   3833 C C6    . DC  F 3 3   ? 1.141   128.782 48.378 1.00 35.06 ? 217  DC  F C6    1 
ATOM   3834 P P     . DC  F 3 4   ? -1.734  125.624 43.958 1.00 45.15 ? 218  DC  F P     1 
ATOM   3835 O OP1   . DC  F 3 4   ? -2.891  124.786 43.563 1.00 46.80 ? 218  DC  F OP1   1 
ATOM   3836 O OP2   . DC  F 3 4   ? -0.489  124.983 44.445 1.00 44.99 ? 218  DC  F OP2   1 
ATOM   3837 O "O5'" . DC  F 3 4   ? -1.351  126.563 42.708 1.00 42.80 ? 218  DC  F "O5'" 1 
ATOM   3838 C "C5'" . DC  F 3 4   ? -2.335  127.403 42.099 1.00 38.87 ? 218  DC  F "C5'" 1 
ATOM   3839 C "C4'" . DC  F 3 4   ? -1.766  128.775 41.796 1.00 36.94 ? 218  DC  F "C4'" 1 
ATOM   3840 O "O4'" . DC  F 3 4   ? -1.160  129.307 42.963 1.00 36.75 ? 218  DC  F "O4'" 1 
ATOM   3841 C "C3'" . DC  F 3 4   ? -0.597  128.693 40.842 1.00 36.76 ? 218  DC  F "C3'" 1 
ATOM   3842 O "O3'" . DC  F 3 4   ? -1.065  128.624 39.498 1.00 35.89 ? 218  DC  F "O3'" 1 
ATOM   3843 C "C2'" . DC  F 3 4   ? 0.058   130.049 41.082 1.00 36.03 ? 218  DC  F "C2'" 1 
ATOM   3844 C "C1'" . DC  F 3 4   ? -0.180  130.270 42.560 1.00 34.68 ? 218  DC  F "C1'" 1 
ATOM   3845 N N1    . DC  F 3 4   ? 1.069   130.143 43.348 1.00 32.14 ? 218  DC  F N1    1 
ATOM   3846 C C2    . DC  F 3 4   ? 1.916   131.236 43.372 1.00 30.92 ? 218  DC  F C2    1 
ATOM   3847 O O2    . DC  F 3 4   ? 1.662   132.240 42.710 1.00 30.63 ? 218  DC  F O2    1 
ATOM   3848 N N3    . DC  F 3 4   ? 3.034   131.162 44.136 1.00 30.19 ? 218  DC  F N3    1 
ATOM   3849 C C4    . DC  F 3 4   ? 3.314   130.062 44.847 1.00 30.58 ? 218  DC  F C4    1 
ATOM   3850 N N4    . DC  F 3 4   ? 4.415   130.039 45.597 1.00 30.72 ? 218  DC  F N4    1 
ATOM   3851 C C5    . DC  F 3 4   ? 2.450   128.922 44.824 1.00 30.72 ? 218  DC  F C5    1 
ATOM   3852 C C6    . DC  F 3 4   ? 1.344   129.012 44.060 1.00 30.87 ? 218  DC  F C6    1 
ATOM   3853 P P     . DC  F 3 5   ? -0.049  128.268 38.311 1.00 35.16 ? 219  DC  F P     1 
ATOM   3854 O OP1   . DC  F 3 5   ? -0.813  128.327 37.047 1.00 36.83 ? 219  DC  F OP1   1 
ATOM   3855 O OP2   . DC  F 3 5   ? 0.653   127.024 38.700 1.00 35.29 ? 219  DC  F OP2   1 
ATOM   3856 O "O5'" . DC  F 3 5   ? 1.029   129.463 38.293 1.00 31.40 ? 219  DC  F "O5'" 1 
ATOM   3857 C "C5'" . DC  F 3 5   ? 0.810   130.695 37.612 1.00 27.98 ? 219  DC  F "C5'" 1 
ATOM   3858 C "C4'" . DC  F 3 5   ? 1.994   131.631 37.803 1.00 27.62 ? 219  DC  F "C4'" 1 
ATOM   3859 O "O4'" . DC  F 3 5   ? 2.304   131.768 39.188 1.00 27.60 ? 219  DC  F "O4'" 1 
ATOM   3860 C "C3'" . DC  F 3 5   ? 3.250   131.015 37.217 1.00 27.90 ? 219  DC  F "C3'" 1 
ATOM   3861 O "O3'" . DC  F 3 5   ? 3.299   131.311 35.825 1.00 29.77 ? 219  DC  F "O3'" 1 
ATOM   3862 C "C2'" . DC  F 3 5   ? 4.344   131.778 37.968 1.00 27.28 ? 219  DC  F "C2'" 1 
ATOM   3863 C "C1'" . DC  F 3 5   ? 3.713   131.978 39.351 1.00 25.74 ? 219  DC  F "C1'" 1 
ATOM   3864 N N1    . DC  F 3 5   ? 4.250   131.048 40.377 1.00 24.15 ? 219  DC  F N1    1 
ATOM   3865 C C2    . DC  F 3 5   ? 5.337   131.469 41.133 1.00 22.95 ? 219  DC  F C2    1 
ATOM   3866 O O2    . DC  F 3 5   ? 5.865   132.560 40.933 1.00 23.42 ? 219  DC  F O2    1 
ATOM   3867 N N3    . DC  F 3 5   ? 5.813   130.632 42.091 1.00 22.61 ? 219  DC  F N3    1 
ATOM   3868 C C4    . DC  F 3 5   ? 5.259   129.429 42.306 1.00 22.72 ? 219  DC  F C4    1 
ATOM   3869 N N4    . DC  F 3 5   ? 5.762   128.644 43.260 1.00 21.93 ? 219  DC  F N4    1 
ATOM   3870 C C5    . DC  F 3 5   ? 4.140   128.978 41.533 1.00 22.99 ? 219  DC  F C5    1 
ATOM   3871 C C6    . DC  F 3 5   ? 3.674   129.821 40.585 1.00 23.53 ? 219  DC  F C6    1 
ATOM   3872 P P     . DT  F 3 6   ? 3.327   130.159 34.705 1.00 30.35 ? 220  DT  F P     1 
ATOM   3873 O OP1   . DT  F 3 6   ? 2.879   130.752 33.429 1.00 31.23 ? 220  DT  F OP1   1 
ATOM   3874 O OP2   . DT  F 3 6   ? 2.655   128.951 35.240 1.00 30.62 ? 220  DT  F OP2   1 
ATOM   3875 O "O5'" . DT  F 3 6   ? 4.897   129.866 34.597 1.00 27.75 ? 220  DT  F "O5'" 1 
ATOM   3876 C "C5'" . DT  F 3 6   ? 5.820   130.934 34.421 1.00 24.96 ? 220  DT  F "C5'" 1 
ATOM   3877 C "C4'" . DT  F 3 6   ? 7.248   130.452 34.573 1.00 25.27 ? 220  DT  F "C4'" 1 
ATOM   3878 O "O4'" . DT  F 3 6   ? 7.517   130.024 35.910 1.00 24.22 ? 220  DT  F "O4'" 1 
ATOM   3879 C "C3'" . DT  F 3 6   ? 7.453   129.252 33.672 1.00 25.05 ? 220  DT  F "C3'" 1 
ATOM   3880 O "O3'" . DT  F 3 6   ? 8.615   129.466 32.880 1.00 26.10 ? 220  DT  F "O3'" 1 
ATOM   3881 C "C2'" . DT  F 3 6   ? 7.585   128.051 34.630 1.00 23.76 ? 220  DT  F "C2'" 1 
ATOM   3882 C "C1'" . DT  F 3 6   ? 8.050   128.694 35.932 1.00 22.40 ? 220  DT  F "C1'" 1 
ATOM   3883 N N1    . DT  F 3 6   ? 7.501   127.994 37.122 1.00 21.15 ? 220  DT  F N1    1 
ATOM   3884 C C2    . DT  F 3 6   ? 8.391   127.539 38.081 1.00 20.57 ? 220  DT  F C2    1 
ATOM   3885 O O2    . DT  F 3 6   ? 9.606   127.638 37.964 1.00 21.42 ? 220  DT  F O2    1 
ATOM   3886 N N3    . DT  F 3 6   ? 7.844   126.933 39.186 1.00 19.51 ? 220  DT  F N3    1 
ATOM   3887 C C4    . DT  F 3 6   ? 6.511   126.732 39.422 1.00 19.11 ? 220  DT  F C4    1 
ATOM   3888 O O4    . DT  F 3 6   ? 6.161   126.179 40.460 1.00 19.33 ? 220  DT  F O4    1 
ATOM   3889 C C5    . DT  F 3 6   ? 5.648   127.227 38.368 1.00 19.60 ? 220  DT  F C5    1 
ATOM   3890 C C7    . DT  F 3 6   ? 4.141   127.044 38.459 1.00 19.50 ? 220  DT  F C7    1 
ATOM   3891 C C6    . DT  F 3 6   ? 6.156   127.829 37.281 1.00 19.85 ? 220  DT  F C6    1 
ATOM   3892 P P     . DC  F 3 7   ? 8.806   128.645 31.507 1.00 28.49 ? 221  DC  F P     1 
ATOM   3893 O OP1   . DC  F 3 7   ? 9.790   129.384 30.674 1.00 29.48 ? 221  DC  F OP1   1 
ATOM   3894 O OP2   . DC  F 3 7   ? 7.467   128.319 30.965 1.00 25.92 ? 221  DC  F OP2   1 
ATOM   3895 O "O5'" . DC  F 3 7   ? 9.490   127.263 31.999 1.00 24.80 ? 221  DC  F "O5'" 1 
ATOM   3896 C "C5'" . DC  F 3 7   ? 10.867  127.194 32.386 1.00 21.97 ? 221  DC  F "C5'" 1 
ATOM   3897 C "C4'" . DC  F 3 7   ? 11.181  125.850 33.029 1.00 21.59 ? 221  DC  F "C4'" 1 
ATOM   3898 O "O4'" . DC  F 3 7   ? 10.490  125.689 34.257 1.00 20.82 ? 221  DC  F "O4'" 1 
ATOM   3899 C "C3'" . DC  F 3 7   ? 10.658  124.715 32.155 1.00 21.25 ? 221  DC  F "C3'" 1 
ATOM   3900 O "O3'" . DC  F 3 7   ? 11.743  124.270 31.339 1.00 21.46 ? 221  DC  F "O3'" 1 
ATOM   3901 C "C2'" . DC  F 3 7   ? 10.185  123.647 33.166 1.00 20.99 ? 221  DC  F "C2'" 1 
ATOM   3902 C "C1'" . DC  F 3 7   ? 10.457  124.295 34.520 1.00 19.78 ? 221  DC  F "C1'" 1 
ATOM   3903 N N1    . DC  F 3 7   ? 9.412   124.046 35.547 1.00 20.01 ? 221  DC  F N1    1 
ATOM   3904 C C2    . DC  F 3 7   ? 9.818   123.426 36.720 1.00 20.00 ? 221  DC  F C2    1 
ATOM   3905 O O2    . DC  F 3 7   ? 10.975  123.029 36.845 1.00 20.45 ? 221  DC  F O2    1 
ATOM   3906 N N3    . DC  F 3 7   ? 8.905   123.253 37.712 1.00 18.66 ? 221  DC  F N3    1 
ATOM   3907 C C4    . DC  F 3 7   ? 7.644   123.665 37.566 1.00 17.77 ? 221  DC  F C4    1 
ATOM   3908 N N4    . DC  F 3 7   ? 6.797   123.499 38.581 1.00 17.34 ? 221  DC  F N4    1 
ATOM   3909 C C5    . DC  F 3 7   ? 7.204   124.299 36.355 1.00 17.74 ? 221  DC  F C5    1 
ATOM   3910 C C6    . DC  F 3 7   ? 8.121   124.466 35.381 1.00 18.79 ? 221  DC  F C6    1 
ATOM   3911 P P     . DT  F 3 8   ? 11.568  123.198 30.165 1.00 21.21 ? 222  DT  F P     1 
ATOM   3912 O OP1   . DT  F 3 8   ? 12.633  123.445 29.167 1.00 20.97 ? 222  DT  F OP1   1 
ATOM   3913 O OP2   . DT  F 3 8   ? 10.149  123.175 29.752 1.00 21.32 ? 222  DT  F OP2   1 
ATOM   3914 O "O5'" . DT  F 3 8   ? 11.879  121.809 30.904 1.00 21.40 ? 222  DT  F "O5'" 1 
ATOM   3915 C "C5'" . DT  F 3 8   ? 13.164  121.519 31.456 1.00 19.77 ? 222  DT  F "C5'" 1 
ATOM   3916 C "C4'" . DT  F 3 8   ? 13.064  120.393 32.465 1.00 18.43 ? 222  DT  F "C4'" 1 
ATOM   3917 O "O4'" . DT  F 3 8   ? 12.187  120.743 33.512 1.00 17.01 ? 222  DT  F "O4'" 1 
ATOM   3918 C "C3'" . DT  F 3 8   ? 12.421  119.176 31.834 1.00 18.67 ? 222  DT  F "C3'" 1 
ATOM   3919 O "O3'" . DT  F 3 8   ? 13.466  118.352 31.301 1.00 18.32 ? 222  DT  F "O3'" 1 
ATOM   3920 C "C2'" . DT  F 3 8   ? 11.674  118.503 33.000 1.00 17.52 ? 222  DT  F "C2'" 1 
ATOM   3921 C "C1'" . DT  F 3 8   ? 11.766  119.535 34.127 1.00 16.85 ? 222  DT  F "C1'" 1 
ATOM   3922 N N1    . DT  F 3 8   ? 10.476  119.812 34.780 1.00 15.69 ? 222  DT  F N1    1 
ATOM   3923 C C2    . DT  F 3 8   ? 10.352  119.587 36.143 1.00 15.37 ? 222  DT  F C2    1 
ATOM   3924 O O2    . DT  F 3 8   ? 11.249  119.126 36.843 1.00 14.94 ? 222  DT  F O2    1 
ATOM   3925 N N3    . DT  F 3 8   ? 9.134   119.915 36.694 1.00 15.84 ? 222  DT  F N3    1 
ATOM   3926 C C4    . DT  F 3 8   ? 8.048   120.439 36.025 1.00 15.81 ? 222  DT  F C4    1 
ATOM   3927 O O4    . DT  F 3 8   ? 7.022   120.705 36.646 1.00 16.10 ? 222  DT  F O4    1 
ATOM   3928 C C5    . DT  F 3 8   ? 8.267   120.637 34.610 1.00 15.00 ? 222  DT  F C5    1 
ATOM   3929 C C7    . DT  F 3 8   ? 7.164   121.219 33.728 1.00 15.28 ? 222  DT  F C7    1 
ATOM   3930 C C6    . DT  F 3 8   ? 9.442   120.324 34.047 1.00 15.54 ? 222  DT  F C6    1 
ATOM   3931 P P     . DT  F 3 9   ? 13.242  117.487 29.974 1.00 21.10 ? 223  DT  F P     1 
ATOM   3932 O OP1   . DT  F 3 9   ? 14.572  117.099 29.451 1.00 20.49 ? 223  DT  F OP1   1 
ATOM   3933 O OP2   . DT  F 3 9   ? 12.287  118.209 29.107 1.00 20.41 ? 223  DT  F OP2   1 
ATOM   3934 O "O5'" . DT  F 3 9   ? 12.502  116.176 30.520 1.00 18.77 ? 223  DT  F "O5'" 1 
ATOM   3935 C "C5'" . DT  F 3 9   ? 13.215  115.171 31.244 1.00 17.73 ? 223  DT  F "C5'" 1 
ATOM   3936 C "C4'" . DT  F 3 9   ? 12.264  114.283 32.035 1.00 16.94 ? 223  DT  F "C4'" 1 
ATOM   3937 O "O4'" . DT  F 3 9   ? 11.611  115.018 33.051 1.00 16.23 ? 223  DT  F "O4'" 1 
ATOM   3938 C "C3'" . DT  F 3 9   ? 11.120  113.810 31.165 1.00 17.02 ? 223  DT  F "C3'" 1 
ATOM   3939 O "O3'" . DT  F 3 9   ? 11.589  112.707 30.396 1.00 17.68 ? 223  DT  F "O3'" 1 
ATOM   3940 C "C2'" . DT  F 3 9   ? 10.101  113.393 32.227 1.00 15.80 ? 223  DT  F "C2'" 1 
ATOM   3941 C "C1'" . DT  F 3 9   ? 10.440  114.303 33.419 1.00 15.90 ? 223  DT  F "C1'" 1 
ATOM   3942 N N1    . DT  F 3 9   ? 9.386   115.279 33.774 1.00 15.77 ? 223  DT  F N1    1 
ATOM   3943 C C2    . DT  F 3 9   ? 9.120   115.443 35.120 1.00 17.19 ? 223  DT  F C2    1 
ATOM   3944 O O2    . DT  F 3 9   ? 9.727   114.831 35.998 1.00 18.83 ? 223  DT  F O2    1 
ATOM   3945 N N3    . DT  F 3 9   ? 8.136   116.364 35.438 1.00 17.95 ? 223  DT  F N3    1 
ATOM   3946 C C4    . DT  F 3 9   ? 7.403   117.128 34.542 1.00 17.11 ? 223  DT  F C4    1 
ATOM   3947 O O4    . DT  F 3 9   ? 6.546   117.913 34.950 1.00 17.20 ? 223  DT  F O4    1 
ATOM   3948 C C5    . DT  F 3 9   ? 7.750   116.891 33.159 1.00 16.39 ? 223  DT  F C5    1 
ATOM   3949 C C7    . DT  F 3 9   ? 7.021   117.659 32.068 1.00 16.17 ? 223  DT  F C7    1 
ATOM   3950 C C6    . DT  F 3 9   ? 8.705   115.999 32.823 1.00 15.60 ? 223  DT  F C6    1 
ATOM   3951 P P     . DA  F 3 10  ? 10.782  112.119 29.143 1.00 17.33 ? 224  DA  F P     1 
ATOM   3952 O OP1   . DA  F 3 10  ? 11.779  111.642 28.166 1.00 20.99 ? 224  DA  F OP1   1 
ATOM   3953 O OP2   . DA  F 3 10  ? 9.764   113.101 28.726 1.00 21.31 ? 224  DA  F OP2   1 
ATOM   3954 O "O5'" . DA  F 3 10  ? 10.021  110.849 29.755 1.00 20.19 ? 224  DA  F "O5'" 1 
ATOM   3955 C "C5'" . DA  F 3 10  ? 10.730  109.697 30.235 1.00 19.90 ? 224  DA  F "C5'" 1 
ATOM   3956 C "C4'" . DA  F 3 10  ? 9.958   108.980 31.331 1.00 18.20 ? 224  DA  F "C4'" 1 
ATOM   3957 O "O4'" . DA  F 3 10  ? 9.730   109.877 32.412 1.00 19.24 ? 224  DA  F "O4'" 1 
ATOM   3958 C "C3'" . DA  F 3 10  ? 8.583   108.571 30.853 1.00 19.70 ? 224  DA  F "C3'" 1 
ATOM   3959 O "O3'" . DA  F 3 10  ? 8.647   107.263 30.282 1.00 22.10 ? 224  DA  F "O3'" 1 
ATOM   3960 C "C2'" . DA  F 3 10  ? 7.803   108.559 32.169 1.00 19.20 ? 224  DA  F "C2'" 1 
ATOM   3961 C "C1'" . DA  F 3 10  ? 8.401   109.746 32.920 1.00 18.32 ? 224  DA  F "C1'" 1 
ATOM   3962 N N9    . DA  F 3 10  ? 7.624   111.006 32.734 1.00 17.81 ? 224  DA  F N9    1 
ATOM   3963 C C8    . DA  F 3 10  ? 7.230   111.619 31.568 1.00 16.71 ? 224  DA  F C8    1 
ATOM   3964 N N7    . DA  F 3 10  ? 6.553   112.716 31.750 1.00 16.89 ? 224  DA  F N7    1 
ATOM   3965 C C5    . DA  F 3 10  ? 6.486   112.851 33.129 1.00 16.55 ? 224  DA  F C5    1 
ATOM   3966 C C6    . DA  F 3 10  ? 5.898   113.815 33.958 1.00 16.36 ? 224  DA  F C6    1 
ATOM   3967 N N6    . DA  F 3 10  ? 5.208   114.853 33.490 1.00 16.16 ? 224  DA  F N6    1 
ATOM   3968 N N1    . DA  F 3 10  ? 6.023   113.656 35.280 1.00 16.52 ? 224  DA  F N1    1 
ATOM   3969 C C2    . DA  F 3 10  ? 6.685   112.605 35.743 1.00 17.49 ? 224  DA  F C2    1 
ATOM   3970 N N3    . DA  F 3 10  ? 7.280   111.627 35.074 1.00 18.14 ? 224  DA  F N3    1 
ATOM   3971 C C4    . DA  F 3 10  ? 7.138   111.817 33.742 1.00 17.59 ? 224  DA  F C4    1 
ATOM   3972 P P     . DT  F 3 11  ? 7.560   106.776 29.193 1.00 24.31 ? 225  DT  F P     1 
ATOM   3973 O OP1   . DT  F 3 11  ? 7.899   105.396 28.792 1.00 27.42 ? 225  DT  F OP1   1 
ATOM   3974 O OP2   . DT  F 3 11  ? 7.422   107.835 28.172 1.00 23.69 ? 225  DT  F OP2   1 
ATOM   3975 O "O5'" . DT  F 3 11  ? 6.208   106.710 30.009 1.00 22.01 ? 225  DT  F "O5'" 1 
ATOM   3976 C "C5'" . DT  F 3 11  ? 5.948   105.683 30.962 1.00 21.75 ? 225  DT  F "C5'" 1 
ATOM   3977 C "C4'" . DT  F 3 11  ? 4.681   106.027 31.734 1.00 21.56 ? 225  DT  F "C4'" 1 
ATOM   3978 O "O4'" . DT  F 3 11  ? 4.781   107.344 32.263 1.00 22.21 ? 225  DT  F "O4'" 1 
ATOM   3979 C "C3'" . DT  F 3 11  ? 3.518   106.128 30.759 1.00 21.78 ? 225  DT  F "C3'" 1 
ATOM   3980 O "O3'" . DT  F 3 11  ? 2.979   104.815 30.563 1.00 22.68 ? 225  DT  F "O3'" 1 
ATOM   3981 C "C2'" . DT  F 3 11  ? 2.547   107.066 31.488 1.00 20.96 ? 225  DT  F "C2'" 1 
ATOM   3982 C "C1'" . DT  F 3 11  ? 3.477   107.913 32.369 1.00 20.75 ? 225  DT  F "C1'" 1 
ATOM   3983 N N1    . DT  F 3 11  ? 3.516   109.325 31.951 1.00 20.46 ? 225  DT  F N1    1 
ATOM   3984 C C2    . DT  F 3 11  ? 3.056   110.278 32.848 1.00 19.89 ? 225  DT  F C2    1 
ATOM   3985 O O2    . DT  F 3 11  ? 2.670   109.999 33.978 1.00 19.79 ? 225  DT  F O2    1 
ATOM   3986 N N3    . DT  F 3 11  ? 3.092   111.586 32.410 1.00 20.49 ? 225  DT  F N3    1 
ATOM   3987 C C4    . DT  F 3 11  ? 3.549   112.017 31.171 1.00 20.71 ? 225  DT  F C4    1 
ATOM   3988 O O4    . DT  F 3 11  ? 3.540   113.214 30.890 1.00 22.69 ? 225  DT  F O4    1 
ATOM   3989 C C5    . DT  F 3 11  ? 4.016   110.952 30.308 1.00 20.76 ? 225  DT  F C5    1 
ATOM   3990 C C7    . DT  F 3 11  ? 4.572   111.274 28.924 1.00 20.04 ? 225  DT  F C7    1 
ATOM   3991 C C6    . DT  F 3 11  ? 3.983   109.672 30.714 1.00 20.33 ? 225  DT  F C6    1 
ATOM   3992 P P     . DA  F 3 12  ? 2.296   104.411 29.168 1.00 23.23 ? 226  DA  F P     1 
ATOM   3993 O OP1   . DA  F 3 12  ? 2.017   102.960 29.208 1.00 26.20 ? 226  DA  F OP1   1 
ATOM   3994 O OP2   . DA  F 3 12  ? 3.091   104.981 28.060 1.00 22.56 ? 226  DA  F OP2   1 
ATOM   3995 O "O5'" . DA  F 3 12  ? 0.906   105.187 29.251 1.00 22.65 ? 226  DA  F "O5'" 1 
ATOM   3996 C "C5'" . DA  F 3 12  ? -0.078  104.789 30.203 1.00 24.71 ? 226  DA  F "C5'" 1 
ATOM   3997 C "C4'" . DA  F 3 12  ? -1.316  105.649 30.114 1.00 26.40 ? 226  DA  F "C4'" 1 
ATOM   3998 O "O4'" . DA  F 3 12  ? -1.001  107.014 30.408 1.00 26.34 ? 226  DA  F "O4'" 1 
ATOM   3999 C "C3'" . DA  F 3 12  ? -1.853  105.634 28.686 1.00 28.34 ? 226  DA  F "C3'" 1 
ATOM   4000 O "O3'" . DA  F 3 12  ? -3.274  105.603 28.687 1.00 34.03 ? 226  DA  F "O3'" 1 
ATOM   4001 C "C2'" . DA  F 3 12  ? -1.356  106.960 28.123 1.00 26.96 ? 226  DA  F "C2'" 1 
ATOM   4002 C "C1'" . DA  F 3 12  ? -1.510  107.820 29.350 1.00 25.41 ? 226  DA  F "C1'" 1 
ATOM   4003 N N9    . DA  F 3 12  ? -0.755  109.073 29.254 1.00 23.38 ? 226  DA  F N9    1 
ATOM   4004 C C8    . DA  F 3 12  ? 0.439   109.344 28.638 1.00 22.75 ? 226  DA  F C8    1 
ATOM   4005 N N7    . DA  F 3 12  ? 0.817   110.589 28.764 1.00 22.49 ? 226  DA  F N7    1 
ATOM   4006 C C5    . DA  F 3 12  ? -0.198  111.177 29.514 1.00 21.94 ? 226  DA  F C5    1 
ATOM   4007 C C6    . DA  F 3 12  ? -0.395  112.473 30.009 1.00 22.15 ? 226  DA  F C6    1 
ATOM   4008 N N6    . DA  F 3 12  ? 0.441   113.489 29.799 1.00 22.22 ? 226  DA  F N6    1 
ATOM   4009 N N1    . DA  F 3 12  ? -1.500  112.682 30.727 1.00 21.37 ? 226  DA  F N1    1 
ATOM   4010 C C2    . DA  F 3 12  ? -2.350  111.693 30.940 1.00 20.49 ? 226  DA  F C2    1 
ATOM   4011 N N3    . DA  F 3 12  ? -2.286  110.445 30.536 1.00 20.90 ? 226  DA  F N3    1 
ATOM   4012 C C4    . DA  F 3 12  ? -1.159  110.255 29.814 1.00 22.51 ? 226  DA  F C4    1 
ATOM   4013 P P     . DG  F 3 13  ? -4.017  104.741 27.552 1.00 38.32 ? 227  DG  F P     1 
ATOM   4014 O OP1   . DG  F 3 13  ? -4.044  103.327 27.988 1.00 38.48 ? 227  DG  F OP1   1 
ATOM   4015 O OP2   . DG  F 3 13  ? -3.449  105.106 26.235 1.00 36.75 ? 227  DG  F OP2   1 
ATOM   4016 O "O5'" . DG  F 3 13  ? -5.496  105.321 27.632 1.00 38.32 ? 227  DG  F "O5'" 1 
ATOM   4017 C "C5'" . DG  F 3 13  ? -6.225  105.302 28.856 1.00 38.99 ? 227  DG  F "C5'" 1 
ATOM   4018 C "C4'" . DG  F 3 13  ? -7.097  106.532 28.954 1.00 38.70 ? 227  DG  F "C4'" 1 
ATOM   4019 O "O4'" . DG  F 3 13  ? -6.293  107.696 29.125 1.00 36.36 ? 227  DG  F "O4'" 1 
ATOM   4020 C "C3'" . DG  F 3 13  ? -7.846  106.700 27.639 1.00 40.57 ? 227  DG  F "C3'" 1 
ATOM   4021 O "O3'" . DG  F 3 13  ? -9.240  106.866 27.883 1.00 45.02 ? 227  DG  F "O3'" 1 
ATOM   4022 C "C2'" . DG  F 3 13  ? -7.217  107.934 26.996 1.00 37.42 ? 227  DG  F "C2'" 1 
ATOM   4023 C "C1'" . DG  F 3 13  ? -6.676  108.697 28.194 1.00 35.57 ? 227  DG  F "C1'" 1 
ATOM   4024 N N9    . DG  F 3 13  ? -5.479  109.450 27.805 1.00 33.09 ? 227  DG  F N9    1 
ATOM   4025 C C8    . DG  F 3 13  ? -4.368  108.998 27.138 1.00 32.67 ? 227  DG  F C8    1 
ATOM   4026 N N7    . DG  F 3 13  ? -3.461  109.911 26.940 1.00 31.60 ? 227  DG  F N7    1 
ATOM   4027 C C5    . DG  F 3 13  ? -4.008  111.049 27.517 1.00 30.86 ? 227  DG  F C5    1 
ATOM   4028 C C6    . DG  F 3 13  ? -3.469  112.352 27.622 1.00 30.59 ? 227  DG  F C6    1 
ATOM   4029 O O6    . DG  F 3 13  ? -2.388  112.760 27.209 1.00 30.35 ? 227  DG  F O6    1 
ATOM   4030 N N1    . DG  F 3 13  ? -4.330  113.207 28.293 1.00 29.76 ? 227  DG  F N1    1 
ATOM   4031 C C2    . DG  F 3 13  ? -5.560  112.854 28.802 1.00 30.27 ? 227  DG  F C2    1 
ATOM   4032 N N2    . DG  F 3 13  ? -6.241  113.813 29.426 1.00 31.18 ? 227  DG  F N2    1 
ATOM   4033 N N3    . DG  F 3 13  ? -6.076  111.622 28.703 1.00 31.41 ? 227  DG  F N3    1 
ATOM   4034 C C4    . DG  F 3 13  ? -5.243  110.777 28.050 1.00 31.46 ? 227  DG  F C4    1 
ATOM   4035 P P     . DC  F 3 14  ? -10.289 106.813 26.662 1.00 48.20 ? 228  DC  F P     1 
ATOM   4036 O OP1   . DC  F 3 14  ? -11.522 106.145 27.143 1.00 48.24 ? 228  DC  F OP1   1 
ATOM   4037 O OP2   . DC  F 3 14  ? -9.589  106.291 25.460 1.00 49.51 ? 228  DC  F OP2   1 
ATOM   4038 O "O5'" . DC  F 3 14  ? -10.583 108.380 26.450 1.00 44.59 ? 228  DC  F "O5'" 1 
ATOM   4039 C "C5'" . DC  F 3 14  ? -11.137 109.106 27.540 1.00 42.47 ? 228  DC  F "C5'" 1 
ATOM   4040 C "C4'" . DC  F 3 14  ? -10.832 110.574 27.423 1.00 42.39 ? 228  DC  F "C4'" 1 
ATOM   4041 O "O4'" . DC  F 3 14  ? -9.447  110.757 27.125 1.00 41.79 ? 228  DC  F "O4'" 1 
ATOM   4042 C "C3'" . DC  F 3 14  ? -11.597 111.213 26.263 1.00 42.87 ? 228  DC  F "C3'" 1 
ATOM   4043 O "O3'" . DC  F 3 14  ? -12.216 112.433 26.712 1.00 45.67 ? 228  DC  F "O3'" 1 
ATOM   4044 C "C2'" . DC  F 3 14  ? -10.468 111.497 25.258 1.00 42.07 ? 228  DC  F "C2'" 1 
ATOM   4045 C "C1'" . DC  F 3 14  ? -9.349  111.845 26.218 1.00 39.68 ? 228  DC  F "C1'" 1 
ATOM   4046 N N1    . DC  F 3 14  ? -8.011  111.869 25.598 1.00 37.13 ? 228  DC  F N1    1 
ATOM   4047 C C2    . DC  F 3 14  ? -7.258  113.023 25.725 1.00 35.73 ? 228  DC  F C2    1 
ATOM   4048 O O2    . DC  F 3 14  ? -7.722  114.009 26.296 1.00 35.96 ? 228  DC  F O2    1 
ATOM   4049 N N3    . DC  F 3 14  ? -6.008  113.037 25.188 1.00 34.65 ? 228  DC  F N3    1 
ATOM   4050 C C4    . DC  F 3 14  ? -5.523  111.967 24.553 1.00 34.60 ? 228  DC  F C4    1 
ATOM   4051 N N4    . DC  F 3 14  ? -4.295  111.996 24.050 1.00 34.21 ? 228  DC  F N4    1 
ATOM   4052 C C5    . DC  F 3 14  ? -6.295  110.775 24.411 1.00 35.83 ? 228  DC  F C5    1 
ATOM   4053 C C6    . DC  F 3 14  ? -7.529  110.776 24.951 1.00 36.72 ? 228  DC  F C6    1 
HETATM 4054 O O     . HOH G 4 .   ? 23.421  81.589  43.729 1.00 27.08 ? 2001 HOH A O     1 
HETATM 4055 O O     . HOH G 4 .   ? 20.790  88.916  49.492 1.00 46.15 ? 2002 HOH A O     1 
HETATM 4056 O O     . HOH G 4 .   ? 25.127  82.557  51.125 1.00 40.65 ? 2003 HOH A O     1 
HETATM 4057 O O     . HOH G 4 .   ? 22.542  79.046  51.593 1.00 42.11 ? 2004 HOH A O     1 
HETATM 4058 O O     . HOH G 4 .   ? 26.507  78.641  50.975 1.00 41.02 ? 2005 HOH A O     1 
HETATM 4059 O O     . HOH G 4 .   ? 27.520  75.915  47.636 1.00 21.42 ? 2006 HOH A O     1 
HETATM 4060 O O     . HOH G 4 .   ? 19.142  87.827  51.859 1.00 58.82 ? 2007 HOH A O     1 
HETATM 4061 O O     . HOH G 4 .   ? 22.320  76.332  54.664 1.00 54.21 ? 2008 HOH A O     1 
HETATM 4062 O O     . HOH G 4 .   ? 28.075  74.297  50.034 1.00 32.05 ? 2009 HOH A O     1 
HETATM 4063 O O     . HOH G 4 .   ? 27.718  71.832  52.253 1.00 33.60 ? 2010 HOH A O     1 
HETATM 4064 O O     . HOH G 4 .   ? 30.914  70.689  54.501 1.00 60.30 ? 2011 HOH A O     1 
HETATM 4065 O O     . HOH G 4 .   ? 21.368  74.100  55.950 1.00 43.27 ? 2012 HOH A O     1 
HETATM 4066 O O     . HOH G 4 .   ? 28.104  61.075  48.259 1.00 16.45 ? 2013 HOH A O     1 
HETATM 4067 O O     . HOH G 4 .   ? 19.823  37.345  44.214 1.00 52.19 ? 2014 HOH A O     1 
HETATM 4068 O O     . HOH G 4 .   ? 31.458  68.278  55.528 1.00 42.81 ? 2015 HOH A O     1 
HETATM 4069 O O     . HOH G 4 .   ? 34.021  44.296  35.429 1.00 51.17 ? 2016 HOH A O     1 
HETATM 4070 O O     . HOH G 4 .   ? 19.742  39.821  45.227 1.00 38.77 ? 2017 HOH A O     1 
HETATM 4071 O O     . HOH G 4 .   ? 28.147  37.702  42.802 1.00 55.04 ? 2018 HOH A O     1 
HETATM 4072 O O     . HOH G 4 .   ? 28.578  54.658  60.597 1.00 43.87 ? 2019 HOH A O     1 
HETATM 4073 O O     . HOH G 4 .   ? 27.989  57.260  60.471 1.00 48.91 ? 2020 HOH A O     1 
HETATM 4074 O O     . HOH G 4 .   ? 28.087  59.859  61.274 1.00 43.59 ? 2021 HOH A O     1 
HETATM 4075 O O     . HOH G 4 .   ? 36.647  53.551  63.457 1.00 48.71 ? 2022 HOH A O     1 
HETATM 4076 O O     . HOH G 4 .   ? 27.214  38.305  45.346 1.00 25.81 ? 2023 HOH A O     1 
HETATM 4077 O O     . HOH G 4 .   ? 32.574  65.959  55.282 1.00 38.20 ? 2024 HOH A O     1 
HETATM 4078 O O     . HOH G 4 .   ? 27.548  65.673  56.815 1.00 49.29 ? 2025 HOH A O     1 
HETATM 4079 O O     . HOH G 4 .   ? 26.467  36.693  47.400 1.00 38.06 ? 2026 HOH A O     1 
HETATM 4080 O O     . HOH G 4 .   ? 33.965  35.749  53.314 1.00 43.43 ? 2027 HOH A O     1 
HETATM 4081 O O     . HOH G 4 .   ? 37.962  39.622  56.875 1.00 46.65 ? 2028 HOH A O     1 
HETATM 4082 O O     . HOH G 4 .   ? 29.122  42.668  58.776 1.00 35.25 ? 2029 HOH A O     1 
HETATM 4083 O O     . HOH G 4 .   ? 30.219  38.519  60.325 1.00 36.59 ? 2030 HOH A O     1 
HETATM 4084 O O     . HOH G 4 .   ? 32.668  41.327  60.668 1.00 50.42 ? 2031 HOH A O     1 
HETATM 4085 O O     . HOH G 4 .   ? 34.397  70.738  43.375 1.00 44.53 ? 2032 HOH A O     1 
HETATM 4086 O O     . HOH G 4 .   ? 31.835  71.696  39.247 1.00 36.58 ? 2033 HOH A O     1 
HETATM 4087 O O     . HOH G 4 .   ? 26.446  50.935  58.805 1.00 45.75 ? 2034 HOH A O     1 
HETATM 4088 O O     . HOH G 4 .   ? 26.251  44.528  60.302 1.00 52.52 ? 2035 HOH A O     1 
HETATM 4089 O O     . HOH G 4 .   ? 37.663  54.631  55.060 1.00 51.00 ? 2036 HOH A O     1 
HETATM 4090 O O     . HOH G 4 .   ? 39.406  48.459  55.740 1.00 43.81 ? 2037 HOH A O     1 
HETATM 4091 O O     . HOH G 4 .   ? 22.187  40.587  45.512 1.00 40.10 ? 2038 HOH A O     1 
HETATM 4092 O O     . HOH G 4 .   ? 22.029  42.668  56.816 1.00 39.55 ? 2039 HOH A O     1 
HETATM 4093 O O     . HOH G 4 .   ? 18.636  46.885  53.240 1.00 48.05 ? 2040 HOH A O     1 
HETATM 4094 O O     . HOH G 4 .   ? 17.017  41.205  45.197 1.00 42.66 ? 2041 HOH A O     1 
HETATM 4095 O O     . HOH G 4 .   ? 41.243  56.341  42.199 1.00 57.70 ? 2042 HOH A O     1 
HETATM 4096 O O     . HOH G 4 .   ? 12.441  44.129  46.640 1.00 32.21 ? 2043 HOH A O     1 
HETATM 4097 O O     . HOH G 4 .   ? 32.328  66.907  38.687 1.00 50.17 ? 2044 HOH A O     1 
HETATM 4098 O O     . HOH G 4 .   ? 23.959  43.119  43.252 1.00 24.18 ? 2045 HOH A O     1 
HETATM 4099 O O     . HOH G 4 .   ? 20.507  44.537  50.934 1.00 24.26 ? 2046 HOH A O     1 
HETATM 4100 O O     . HOH G 4 .   ? 20.840  50.611  56.048 1.00 42.11 ? 2047 HOH A O     1 
HETATM 4101 O O     . HOH G 4 .   ? 30.615  52.862  60.059 1.00 51.15 ? 2048 HOH A O     1 
HETATM 4102 O O     . HOH G 4 .   ? 27.572  57.304  57.614 1.00 30.93 ? 2049 HOH A O     1 
HETATM 4103 O O     . HOH G 4 .   ? 34.350  55.499  65.778 1.00 37.95 ? 2050 HOH A O     1 
HETATM 4104 O O     . HOH G 4 .   ? 34.069  54.818  59.838 1.00 25.81 ? 2051 HOH A O     1 
HETATM 4105 O O     . HOH G 4 .   ? 30.094  61.584  60.749 1.00 42.92 ? 2052 HOH A O     1 
HETATM 4106 O O     . HOH G 4 .   ? 34.141  61.663  64.011 1.00 56.53 ? 2053 HOH A O     1 
HETATM 4107 O O     . HOH G 4 .   ? 36.239  60.213  63.243 1.00 43.32 ? 2054 HOH A O     1 
HETATM 4108 O O     . HOH G 4 .   ? 35.543  57.457  58.246 1.00 32.48 ? 2055 HOH A O     1 
HETATM 4109 O O     . HOH G 4 .   ? 34.958  64.639  55.928 1.00 43.44 ? 2056 HOH A O     1 
HETATM 4110 O O     . HOH G 4 .   ? 31.599  64.146  57.135 1.00 37.10 ? 2057 HOH A O     1 
HETATM 4111 O O     . HOH G 4 .   ? 25.583  60.760  55.101 1.00 14.84 ? 2058 HOH A O     1 
HETATM 4112 O O     . HOH G 4 .   ? 28.702  64.045  54.797 1.00 19.45 ? 2059 HOH A O     1 
HETATM 4113 O O     . HOH G 4 .   ? 26.050  61.315  62.457 1.00 50.00 ? 2060 HOH A O     1 
HETATM 4114 O O     . HOH G 4 .   ? 13.749  80.584  34.467 1.00 39.95 ? 2061 HOH A O     1 
HETATM 4115 O O     . HOH G 4 .   ? 25.304  58.170  55.908 1.00 25.77 ? 2062 HOH A O     1 
HETATM 4116 O O     . HOH G 4 .   ? 11.335  69.522  33.457 1.00 46.09 ? 2063 HOH A O     1 
HETATM 4117 O O     . HOH G 4 .   ? 24.943  43.096  40.322 1.00 26.99 ? 2064 HOH A O     1 
HETATM 4118 O O     . HOH G 4 .   ? 25.349  51.024  34.833 1.00 50.24 ? 2065 HOH A O     1 
HETATM 4119 O O     . HOH G 4 .   ? 25.188  64.441  54.963 1.00 32.40 ? 2066 HOH A O     1 
HETATM 4120 O O     . HOH G 4 .   ? 15.210  83.304  33.727 1.00 42.11 ? 2067 HOH A O     1 
HETATM 4121 O O     . HOH G 4 .   ? 30.493  65.209  53.331 1.00 22.42 ? 2068 HOH A O     1 
HETATM 4122 O O     . HOH G 4 .   ? 29.766  71.884  50.073 1.00 38.26 ? 2069 HOH A O     1 
HETATM 4123 O O     . HOH G 4 .   ? 23.030  66.826  56.822 1.00 43.90 ? 2070 HOH A O     1 
HETATM 4124 O O     . HOH G 4 .   ? 34.585  64.874  42.193 1.00 43.30 ? 2071 HOH A O     1 
HETATM 4125 O O     . HOH G 4 .   ? 29.903  70.268  40.195 1.00 20.41 ? 2072 HOH A O     1 
HETATM 4126 O O     . HOH G 4 .   ? 33.694  69.683  45.820 1.00 24.69 ? 2073 HOH A O     1 
HETATM 4127 O O     . HOH G 4 .   ? 37.908  70.834  47.764 1.00 26.08 ? 2074 HOH A O     1 
HETATM 4128 O O     . HOH G 4 .   ? 38.541  59.015  39.073 1.00 39.35 ? 2075 HOH A O     1 
HETATM 4129 O O     . HOH G 4 .   ? 39.983  59.406  49.790 1.00 46.39 ? 2076 HOH A O     1 
HETATM 4130 O O     . HOH G 4 .   ? 41.205  53.487  46.841 1.00 50.59 ? 2077 HOH A O     1 
HETATM 4131 O O     . HOH G 4 .   ? 39.293  53.190  53.396 1.00 37.61 ? 2078 HOH A O     1 
HETATM 4132 O O     . HOH G 4 .   ? 38.758  46.033  54.638 1.00 42.60 ? 2079 HOH A O     1 
HETATM 4133 O O     . HOH G 4 .   ? 40.570  50.970  54.102 1.00 36.82 ? 2080 HOH A O     1 
HETATM 4134 O O     . HOH G 4 .   ? 38.367  37.261  45.800 1.00 43.33 ? 2081 HOH A O     1 
HETATM 4135 O O     . HOH G 4 .   ? 39.767  44.460  38.286 1.00 58.49 ? 2082 HOH A O     1 
HETATM 4136 O O     . HOH G 4 .   ? 43.003  46.306  42.891 1.00 40.84 ? 2083 HOH A O     1 
HETATM 4137 O O     . HOH G 4 .   ? 40.805  52.856  38.014 1.00 53.27 ? 2084 HOH A O     1 
HETATM 4138 O O     . HOH G 4 .   ? 41.047  55.864  38.237 1.00 46.14 ? 2085 HOH A O     1 
HETATM 4139 O O     . HOH G 4 .   ? 29.808  55.390  37.160 1.00 24.46 ? 2086 HOH A O     1 
HETATM 4140 O O     . HOH G 4 .   ? 31.357  51.972  33.751 1.00 42.85 ? 2087 HOH A O     1 
HETATM 4141 O O     . HOH G 4 .   ? 37.908  55.709  34.346 1.00 36.85 ? 2088 HOH A O     1 
HETATM 4142 O O     . HOH G 4 .   ? 36.917  57.302  37.873 1.00 32.79 ? 2089 HOH A O     1 
HETATM 4143 O O     . HOH G 4 .   ? 32.058  60.145  34.145 1.00 52.77 ? 2090 HOH A O     1 
HETATM 4144 O O     . HOH G 4 .   ? 31.162  63.862  37.336 1.00 41.53 ? 2091 HOH A O     1 
HETATM 4145 O O     . HOH G 4 .   ? 25.783  56.640  34.701 1.00 45.28 ? 2092 HOH A O     1 
HETATM 4146 O O     . HOH G 4 .   ? 20.798  70.937  42.678 1.00 15.71 ? 2093 HOH A O     1 
HETATM 4147 O O     . HOH G 4 .   ? 19.873  77.069  53.823 1.00 47.58 ? 2094 HOH A O     1 
HETATM 4148 O O     . HOH G 4 .   ? 20.411  80.281  52.604 1.00 23.93 ? 2095 HOH A O     1 
HETATM 4149 O O     . HOH G 4 .   ? 15.355  83.038  57.907 1.00 42.14 ? 2096 HOH A O     1 
HETATM 4150 O O     . HOH G 4 .   ? 18.160  79.775  57.290 1.00 56.55 ? 2097 HOH A O     1 
HETATM 4151 O O     . HOH G 4 .   ? 16.456  87.863  50.193 1.00 33.33 ? 2098 HOH A O     1 
HETATM 4152 O O     . HOH G 4 .   ? 15.023  89.864  53.384 1.00 57.87 ? 2099 HOH A O     1 
HETATM 4153 O O     . HOH G 4 .   ? 3.191   89.009  45.955 1.00 27.20 ? 2100 HOH A O     1 
HETATM 4154 O O     . HOH G 4 .   ? -1.105  86.686  42.560 1.00 35.49 ? 2101 HOH A O     1 
HETATM 4155 O O     . HOH G 4 .   ? -0.345  81.082  48.387 1.00 38.64 ? 2102 HOH A O     1 
HETATM 4156 O O     . HOH G 4 .   ? -0.805  83.546  46.517 1.00 39.20 ? 2103 HOH A O     1 
HETATM 4157 O O     . HOH G 4 .   ? -0.428  84.702  39.568 1.00 39.73 ? 2104 HOH A O     1 
HETATM 4158 O O     . HOH G 4 .   ? -1.857  83.715  34.431 1.00 43.20 ? 2105 HOH A O     1 
HETATM 4159 O O     . HOH G 4 .   ? 6.011   81.849  33.240 1.00 49.46 ? 2106 HOH A O     1 
HETATM 4160 O O     . HOH G 4 .   ? 4.456   85.883  36.217 1.00 35.95 ? 2107 HOH A O     1 
HETATM 4161 O O     . HOH G 4 .   ? 1.241   80.365  33.977 1.00 45.14 ? 2108 HOH A O     1 
HETATM 4162 O O     . HOH G 4 .   ? 2.710   71.933  35.562 1.00 35.74 ? 2109 HOH A O     1 
HETATM 4163 O O     . HOH G 4 .   ? 0.303   74.105  37.110 1.00 47.53 ? 2110 HOH A O     1 
HETATM 4164 O O     . HOH G 4 .   ? 5.458   71.141  35.630 1.00 41.54 ? 2111 HOH A O     1 
HETATM 4165 O O     . HOH G 4 .   ? 6.010   70.978  38.312 1.00 23.32 ? 2112 HOH A O     1 
HETATM 4166 O O     . HOH G 4 .   ? -0.880  73.472  41.169 1.00 55.40 ? 2113 HOH A O     1 
HETATM 4167 O O     . HOH G 4 .   ? 1.581   75.063  51.506 1.00 28.37 ? 2114 HOH A O     1 
HETATM 4168 O O     . HOH G 4 .   ? -0.907  70.352  40.106 1.00 47.28 ? 2115 HOH A O     1 
HETATM 4169 O O     . HOH G 4 .   ? 2.038   68.737  44.346 1.00 43.48 ? 2116 HOH A O     1 
HETATM 4170 O O     . HOH G 4 .   ? 0.493   68.809  54.156 1.00 55.53 ? 2117 HOH A O     1 
HETATM 4171 O O     . HOH G 4 .   ? -7.625  71.914  47.768 1.00 37.22 ? 2118 HOH A O     1 
HETATM 4172 O O     . HOH G 4 .   ? -9.541  72.948  49.283 1.00 48.64 ? 2119 HOH A O     1 
HETATM 4173 O O     . HOH G 4 .   ? 0.101   64.856  53.495 1.00 47.69 ? 2120 HOH A O     1 
HETATM 4174 O O     . HOH G 4 .   ? 2.506   70.696  46.592 1.00 22.66 ? 2121 HOH A O     1 
HETATM 4175 O O     . HOH G 4 .   ? 5.235   75.606  52.244 1.00 21.80 ? 2122 HOH A O     1 
HETATM 4176 O O     . HOH G 4 .   ? 11.487  78.917  34.263 1.00 38.42 ? 2123 HOH A O     1 
HETATM 4177 O O     . HOH G 4 .   ? 12.858  70.215  35.423 1.00 19.85 ? 2124 HOH A O     1 
HETATM 4178 O O     . HOH G 4 .   ? 18.175  72.851  29.997 1.00 59.02 ? 2125 HOH A O     1 
HETATM 4179 O O     . HOH G 4 .   ? 12.669  77.189  32.556 1.00 22.74 ? 2126 HOH A O     1 
HETATM 4180 O O     . HOH G 4 .   ? 8.943   71.761  33.074 1.00 34.13 ? 2127 HOH A O     1 
HETATM 4181 O O     . HOH G 4 .   ? 14.838  78.668  32.719 1.00 38.55 ? 2128 HOH A O     1 
HETATM 4182 O O     . HOH G 4 .   ? 13.994  67.898  36.021 1.00 40.65 ? 2129 HOH A O     1 
HETATM 4183 O O     . HOH G 4 .   ? 19.768  67.924  34.684 1.00 34.40 ? 2130 HOH A O     1 
HETATM 4184 O O     . HOH G 4 .   ? 16.547  67.812  37.116 1.00 23.31 ? 2131 HOH A O     1 
HETATM 4185 O O     . HOH G 4 .   ? 20.177  71.392  32.098 1.00 42.13 ? 2132 HOH A O     1 
HETATM 4186 O O     . HOH G 4 .   ? 10.080  84.046  56.124 1.00 44.26 ? 2133 HOH A O     1 
HETATM 4187 O O     . HOH G 4 .   ? 12.745  81.614  56.101 1.00 28.33 ? 2134 HOH A O     1 
HETATM 4188 O O     . HOH G 4 .   ? 18.415  66.016  36.338 1.00 50.72 ? 2135 HOH A O     1 
HETATM 4189 O O     . HOH G 4 .   ? 21.014  64.679  37.642 1.00 43.43 ? 2136 HOH A O     1 
HETATM 4190 O O     . HOH G 4 .   ? 29.767  67.707  39.504 1.00 24.91 ? 2137 HOH A O     1 
HETATM 4191 O O     . HOH G 4 .   ? 28.520  65.220  36.672 1.00 40.70 ? 2138 HOH A O     1 
HETATM 4192 O O     . HOH G 4 .   ? 22.482  63.955  33.425 1.00 60.49 ? 2139 HOH A O     1 
HETATM 4193 O O     . HOH G 4 .   ? 26.031  79.334  38.299 1.00 50.56 ? 2140 HOH A O     1 
HETATM 4194 O O     . HOH G 4 .   ? 29.761  73.099  38.117 1.00 33.31 ? 2141 HOH A O     1 
HETATM 4195 O O     . HOH G 4 .   ? 21.028  70.152  35.095 1.00 44.74 ? 2142 HOH A O     1 
HETATM 4196 O O     . HOH G 4 .   ? 22.786  72.554  31.908 1.00 51.40 ? 2143 HOH A O     1 
HETATM 4197 O O     . HOH G 4 .   ? 18.003  86.201  36.872 1.00 42.79 ? 2144 HOH A O     1 
HETATM 4198 O O     . HOH G 4 .   ? 20.540  83.449  36.171 1.00 41.20 ? 2145 HOH A O     1 
HETATM 4199 O O     . HOH G 4 .   ? 14.911  84.892  35.920 1.00 47.30 ? 2146 HOH A O     1 
HETATM 4200 O O     . HOH G 4 .   ? 15.369  90.474  50.158 1.00 50.57 ? 2147 HOH A O     1 
HETATM 4201 O O     . HOH G 4 .   ? 18.240  90.626  47.696 1.00 47.72 ? 2148 HOH A O     1 
HETATM 4202 O O     . HOH G 4 .   ? 12.436  90.330  47.991 1.00 31.44 ? 2149 HOH A O     1 
HETATM 4203 O O     . HOH G 4 .   ? 10.124  91.346  46.928 1.00 20.74 ? 2150 HOH A O     1 
HETATM 4204 O O     . HOH G 4 .   ? 6.749   89.339  34.867 1.00 36.52 ? 2151 HOH A O     1 
HETATM 4205 O O     . HOH G 4 .   ? 3.170   88.210  36.963 1.00 47.49 ? 2152 HOH A O     1 
HETATM 4206 O O     . HOH G 4 .   ? 7.053   86.008  36.622 1.00 44.60 ? 2153 HOH A O     1 
HETATM 4207 O O     . HOH G 4 .   ? 11.541  93.675  48.675 1.00 42.60 ? 2154 HOH A O     1 
HETATM 4208 O O     . HOH G 4 .   ? 6.565   96.272  51.521 1.00 41.34 ? 2155 HOH A O     1 
HETATM 4209 O O     . HOH G 4 .   ? 7.134   90.205  53.117 1.00 44.37 ? 2156 HOH A O     1 
HETATM 4210 O O     . HOH G 4 .   ? 1.649   81.097  50.440 1.00 37.66 ? 2157 HOH A O     1 
HETATM 4211 O O     . HOH G 4 .   ? 3.979   88.053  55.408 1.00 48.60 ? 2158 HOH A O     1 
HETATM 4212 O O     . HOH G 4 .   ? 1.354   89.579  49.651 1.00 37.73 ? 2159 HOH A O     1 
HETATM 4213 O O     . HOH H 4 .   ? 20.645  89.352  37.984 1.00 45.71 ? 2001 HOH B O     1 
HETATM 4214 O O     . HOH H 4 .   ? 22.016  96.766  39.787 1.00 43.02 ? 2002 HOH B O     1 
HETATM 4215 O O     . HOH H 4 .   ? 16.304  98.468  47.162 1.00 46.86 ? 2003 HOH B O     1 
HETATM 4216 O O     . HOH H 4 .   ? 14.752  98.280  41.991 1.00 24.67 ? 2004 HOH B O     1 
HETATM 4217 O O     . HOH H 4 .   ? 21.738  100.292 41.356 1.00 31.66 ? 2005 HOH B O     1 
HETATM 4218 O O     . HOH H 4 .   ? 10.768  89.764  39.194 1.00 28.86 ? 2006 HOH B O     1 
HETATM 4219 O O     . HOH H 4 .   ? 13.308  91.074  36.356 1.00 55.54 ? 2007 HOH B O     1 
HETATM 4220 O O     . HOH H 4 .   ? 15.619  94.155  34.163 1.00 48.36 ? 2008 HOH B O     1 
HETATM 4221 O O     . HOH H 4 .   ? 13.796  100.269 34.047 1.00 32.11 ? 2009 HOH B O     1 
HETATM 4222 O O     . HOH H 4 .   ? 15.920  96.791  34.712 1.00 26.35 ? 2010 HOH B O     1 
HETATM 4223 O O     . HOH H 4 .   ? 17.640  101.264 34.365 1.00 41.18 ? 2011 HOH B O     1 
HETATM 4224 O O     . HOH H 4 .   ? 19.374  107.861 33.263 1.00 49.06 ? 2012 HOH B O     1 
HETATM 4225 O O     . HOH H 4 .   ? 19.202  105.312 35.562 1.00 24.59 ? 2013 HOH B O     1 
HETATM 4226 O O     . HOH H 4 .   ? 21.133  108.677 31.234 1.00 48.10 ? 2014 HOH B O     1 
HETATM 4227 O O     . HOH H 4 .   ? 13.649  105.488 29.328 1.00 34.53 ? 2015 HOH B O     1 
HETATM 4228 O O     . HOH H 4 .   ? 22.224  143.433 42.586 1.00 54.29 ? 2016 HOH B O     1 
HETATM 4229 O O     . HOH H 4 .   ? 28.784  125.820 24.084 1.00 55.13 ? 2017 HOH B O     1 
HETATM 4230 O O     . HOH H 4 .   ? 27.403  133.935 28.748 1.00 51.68 ? 2018 HOH B O     1 
HETATM 4231 O O     . HOH H 4 .   ? 10.428  140.103 40.004 1.00 54.24 ? 2019 HOH B O     1 
HETATM 4232 O O     . HOH H 4 .   ? 19.921  135.640 49.376 1.00 44.92 ? 2020 HOH B O     1 
HETATM 4233 O O     . HOH H 4 .   ? 24.351  141.997 41.882 1.00 43.65 ? 2021 HOH B O     1 
HETATM 4234 O O     . HOH H 4 .   ? 26.858  140.639 43.262 1.00 53.00 ? 2022 HOH B O     1 
HETATM 4235 O O     . HOH H 4 .   ? 18.348  141.304 39.855 1.00 32.25 ? 2023 HOH B O     1 
HETATM 4236 O O     . HOH H 4 .   ? 24.988  144.423 37.246 1.00 41.01 ? 2024 HOH B O     1 
HETATM 4237 O O     . HOH H 4 .   ? 18.109  143.093 37.887 1.00 39.40 ? 2025 HOH B O     1 
HETATM 4238 O O     . HOH H 4 .   ? 26.821  123.467 23.893 1.00 36.70 ? 2026 HOH B O     1 
HETATM 4239 O O     . HOH H 4 .   ? 20.824  115.364 24.908 1.00 41.31 ? 2027 HOH B O     1 
HETATM 4240 O O     . HOH H 4 .   ? 19.563  119.924 24.095 1.00 40.37 ? 2028 HOH B O     1 
HETATM 4241 O O     . HOH H 4 .   ? 23.807  113.780 30.411 1.00 29.57 ? 2029 HOH B O     1 
HETATM 4242 O O     . HOH H 4 .   ? 20.338  114.148 27.494 1.00 48.10 ? 2030 HOH B O     1 
HETATM 4243 O O     . HOH H 4 .   ? 19.270  122.515 24.721 1.00 34.72 ? 2031 HOH B O     1 
HETATM 4244 O O     . HOH H 4 .   ? 21.320  142.065 25.002 1.00 41.97 ? 2032 HOH B O     1 
HETATM 4245 O O     . HOH H 4 .   ? 26.824  144.275 27.072 1.00 31.55 ? 2033 HOH B O     1 
HETATM 4246 O O     . HOH H 4 .   ? 20.281  136.933 26.091 1.00 36.75 ? 2034 HOH B O     1 
HETATM 4247 O O     . HOH H 4 .   ? 22.464  111.292 30.726 1.00 52.20 ? 2035 HOH B O     1 
HETATM 4248 O O     . HOH H 4 .   ? 25.281  132.248 27.735 1.00 48.03 ? 2036 HOH B O     1 
HETATM 4249 O O     . HOH H 4 .   ? 26.548  133.750 18.733 1.00 40.24 ? 2037 HOH B O     1 
HETATM 4250 O O     . HOH H 4 .   ? 22.919  108.215 46.414 1.00 32.13 ? 2038 HOH B O     1 
HETATM 4251 O O     . HOH H 4 .   ? 15.931  131.372 25.697 1.00 39.19 ? 2039 HOH B O     1 
HETATM 4252 O O     . HOH H 4 .   ? 19.742  129.320 27.267 1.00 34.19 ? 2040 HOH B O     1 
HETATM 4253 O O     . HOH H 4 .   ? 20.121  128.613 23.180 1.00 29.44 ? 2041 HOH B O     1 
HETATM 4254 O O     . HOH H 4 .   ? 21.075  135.256 23.410 1.00 43.68 ? 2042 HOH B O     1 
HETATM 4255 O O     . HOH H 4 .   ? 16.703  135.471 25.570 1.00 40.62 ? 2043 HOH B O     1 
HETATM 4256 O O     . HOH H 4 .   ? 30.175  131.140 30.000 1.00 48.80 ? 2044 HOH B O     1 
HETATM 4257 O O     . HOH H 4 .   ? 12.741  139.289 39.087 1.00 45.51 ? 2045 HOH B O     1 
HETATM 4258 O O     . HOH H 4 .   ? 10.476  133.630 31.514 1.00 49.46 ? 2046 HOH B O     1 
HETATM 4259 O O     . HOH H 4 .   ? 3.514   135.689 38.264 1.00 40.35 ? 2047 HOH B O     1 
HETATM 4260 O O     . HOH H 4 .   ? 19.155  114.300 51.089 1.00 57.36 ? 2048 HOH B O     1 
HETATM 4261 O O     . HOH H 4 .   ? 14.870  136.660 41.652 1.00 24.19 ? 2049 HOH B O     1 
HETATM 4262 O O     . HOH H 4 .   ? 11.431  134.904 33.957 1.00 25.08 ? 2050 HOH B O     1 
HETATM 4263 O O     . HOH H 4 .   ? -7.810  99.887  31.080 1.00 51.10 ? 2051 HOH B O     1 
HETATM 4264 O O     . HOH H 4 .   ? 20.865  128.340 25.135 1.00 34.60 ? 2052 HOH B O     1 
HETATM 4265 O O     . HOH H 4 .   ? 16.763  128.798 26.499 1.00 41.74 ? 2053 HOH B O     1 
HETATM 4266 O O     . HOH H 4 .   ? -1.863  97.899  53.754 1.00 45.72 ? 2054 HOH B O     1 
HETATM 4267 O O     . HOH H 4 .   ? 26.000  123.803 21.388 1.00 35.57 ? 2055 HOH B O     1 
HETATM 4268 O O     . HOH H 4 .   ? 21.375  118.033 24.507 1.00 33.40 ? 2056 HOH B O     1 
HETATM 4269 O O     . HOH H 4 .   ? 25.141  124.478 25.463 1.00 27.91 ? 2057 HOH B O     1 
HETATM 4270 O O     . HOH H 4 .   ? 2.437   96.829  51.177 1.00 38.25 ? 2058 HOH B O     1 
HETATM 4271 O O     . HOH H 4 .   ? 26.843  122.537 27.187 1.00 36.40 ? 2059 HOH B O     1 
HETATM 4272 O O     . HOH H 4 .   ? 26.475  114.690 29.494 1.00 29.74 ? 2060 HOH B O     1 
HETATM 4273 O O     . HOH H 4 .   ? 26.103  117.857 22.879 1.00 53.18 ? 2061 HOH B O     1 
HETATM 4274 O O     . HOH H 4 .   ? -6.331  111.501 39.996 1.00 38.72 ? 2062 HOH B O     1 
HETATM 4275 O O     . HOH H 4 .   ? -17.318 107.363 44.276 1.00 52.78 ? 2063 HOH B O     1 
HETATM 4276 O O     . HOH H 4 .   ? 22.661  115.371 28.350 1.00 24.79 ? 2064 HOH B O     1 
HETATM 4277 O O     . HOH H 4 .   ? 19.611  115.609 30.681 1.00 18.72 ? 2065 HOH B O     1 
HETATM 4278 O O     . HOH H 4 .   ? 18.417  122.266 27.644 1.00 22.44 ? 2066 HOH B O     1 
HETATM 4279 O O     . HOH H 4 .   ? 0.989   99.037  52.619 1.00 41.74 ? 2067 HOH B O     1 
HETATM 4280 O O     . HOH H 4 .   ? 4.814   99.525  50.864 1.00 25.53 ? 2068 HOH B O     1 
HETATM 4281 O O     . HOH H 4 .   ? 16.408  121.293 29.472 1.00 18.90 ? 2069 HOH B O     1 
HETATM 4282 O O     . HOH H 4 .   ? 5.184   107.573 58.219 1.00 49.95 ? 2070 HOH B O     1 
HETATM 4283 O O     . HOH H 4 .   ? 20.004  141.037 43.616 1.00 54.50 ? 2071 HOH B O     1 
HETATM 4284 O O     . HOH H 4 .   ? 15.626  136.445 44.408 1.00 26.00 ? 2072 HOH B O     1 
HETATM 4285 O O     . HOH H 4 .   ? 20.727  127.016 48.842 1.00 55.76 ? 2073 HOH B O     1 
HETATM 4286 O O     . HOH H 4 .   ? 17.143  101.486 51.131 1.00 42.47 ? 2074 HOH B O     1 
HETATM 4287 O O     . HOH H 4 .   ? 12.806  102.746 53.445 1.00 33.49 ? 2075 HOH B O     1 
HETATM 4288 O O     . HOH H 4 .   ? 17.652  112.658 52.471 1.00 42.09 ? 2076 HOH B O     1 
HETATM 4289 O O     . HOH H 4 .   ? 16.617  114.954 30.201 1.00 25.50 ? 2077 HOH B O     1 
HETATM 4290 O O     . HOH H 4 .   ? 20.870  107.843 35.625 1.00 29.66 ? 2078 HOH B O     1 
HETATM 4291 O O     . HOH H 4 .   ? 21.788  114.482 32.253 1.00 19.46 ? 2079 HOH B O     1 
HETATM 4292 O O     . HOH H 4 .   ? -0.697  86.327  37.363 1.00 45.30 ? 2080 HOH B O     1 
HETATM 4293 O O     . HOH H 4 .   ? 21.002  109.651 45.174 1.00 17.25 ? 2081 HOH B O     1 
HETATM 4294 O O     . HOH H 4 .   ? 24.921  110.005 39.295 1.00 17.39 ? 2082 HOH B O     1 
HETATM 4295 O O     . HOH H 4 .   ? 29.194  116.043 39.670 1.00 41.28 ? 2083 HOH B O     1 
HETATM 4296 O O     . HOH H 4 .   ? 28.891  108.612 37.579 1.00 25.57 ? 2084 HOH B O     1 
HETATM 4297 O O     . HOH H 4 .   ? 27.507  114.540 42.206 1.00 43.52 ? 2085 HOH B O     1 
HETATM 4298 O O     . HOH H 4 .   ? 30.628  112.951 43.622 1.00 61.15 ? 2086 HOH B O     1 
HETATM 4299 O O     . HOH H 4 .   ? 19.285  118.788 36.944 1.00 19.72 ? 2087 HOH B O     1 
HETATM 4300 O O     . HOH H 4 .   ? 30.023  120.644 45.904 1.00 57.42 ? 2088 HOH B O     1 
HETATM 4301 O O     . HOH H 4 .   ? 31.053  117.878 39.653 1.00 41.30 ? 2089 HOH B O     1 
HETATM 4302 O O     . HOH H 4 .   ? 30.074  126.778 31.843 1.00 29.80 ? 2090 HOH B O     1 
HETATM 4303 O O     . HOH H 4 .   ? 29.295  133.723 30.588 1.00 35.96 ? 2091 HOH B O     1 
HETATM 4304 O O     . HOH H 4 .   ? 33.395  137.095 38.167 1.00 51.52 ? 2092 HOH B O     1 
HETATM 4305 O O     . HOH H 4 .   ? 31.424  129.026 31.008 1.00 59.74 ? 2093 HOH B O     1 
HETATM 4306 O O     . HOH H 4 .   ? 28.982  142.309 36.299 1.00 49.32 ? 2094 HOH B O     1 
HETATM 4307 O O     . HOH H 4 .   ? 27.639  141.048 31.980 1.00 49.29 ? 2095 HOH B O     1 
HETATM 4308 O O     . HOH H 4 .   ? 30.368  135.872 46.514 1.00 35.50 ? 2096 HOH B O     1 
HETATM 4309 O O     . HOH H 4 .   ? 27.916  123.062 47.542 1.00 31.88 ? 2097 HOH B O     1 
HETATM 4310 O O     . HOH H 4 .   ? 29.038  123.584 50.300 1.00 49.32 ? 2098 HOH B O     1 
HETATM 4311 O O     . HOH H 4 .   ? 23.058  127.980 50.924 1.00 37.89 ? 2099 HOH B O     1 
HETATM 4312 O O     . HOH H 4 .   ? 20.825  124.570 47.832 1.00 29.31 ? 2100 HOH B O     1 
HETATM 4313 O O     . HOH H 4 .   ? 25.083  117.604 47.786 1.00 47.95 ? 2101 HOH B O     1 
HETATM 4314 O O     . HOH H 4 .   ? 19.571  115.594 48.865 1.00 41.37 ? 2102 HOH B O     1 
HETATM 4315 O O     . HOH H 4 .   ? 22.083  116.084 47.930 1.00 32.60 ? 2103 HOH B O     1 
HETATM 4316 O O     . HOH H 4 .   ? 11.938  108.909 42.800 1.00 18.54 ? 2104 HOH B O     1 
HETATM 4317 O O     . HOH H 4 .   ? 9.783   103.847 31.390 1.00 50.64 ? 2105 HOH B O     1 
HETATM 4318 O O     . HOH H 4 .   ? 9.989   98.534  29.345 1.00 41.60 ? 2106 HOH B O     1 
HETATM 4319 O O     . HOH H 4 .   ? 11.783  98.699  33.541 1.00 31.29 ? 2107 HOH B O     1 
HETATM 4320 O O     . HOH H 4 .   ? 6.385   95.218  28.027 1.00 55.92 ? 2108 HOH B O     1 
HETATM 4321 O O     . HOH H 4 .   ? 4.368   97.503  30.056 1.00 44.26 ? 2109 HOH B O     1 
HETATM 4322 O O     . HOH H 4 .   ? 11.397  96.025  33.087 1.00 31.52 ? 2110 HOH B O     1 
HETATM 4323 O O     . HOH H 4 .   ? 7.939   91.429  35.908 1.00 22.41 ? 2111 HOH B O     1 
HETATM 4324 O O     . HOH H 4 .   ? 6.081   89.479  32.314 1.00 49.70 ? 2112 HOH B O     1 
HETATM 4325 O O     . HOH H 4 .   ? -7.159  98.386  34.992 1.00 42.09 ? 2113 HOH B O     1 
HETATM 4326 O O     . HOH H 4 .   ? -12.078 100.446 44.513 1.00 47.88 ? 2114 HOH B O     1 
HETATM 4327 O O     . HOH H 4 .   ? -8.822  98.079  37.068 1.00 43.25 ? 2115 HOH B O     1 
HETATM 4328 O O     . HOH H 4 .   ? -11.960 99.921  49.487 1.00 49.00 ? 2116 HOH B O     1 
HETATM 4329 O O     . HOH H 4 .   ? -4.220  99.045  52.827 1.00 50.79 ? 2117 HOH B O     1 
HETATM 4330 O O     . HOH H 4 .   ? -8.032  99.511  51.796 1.00 33.20 ? 2118 HOH B O     1 
HETATM 4331 O O     . HOH H 4 .   ? 0.235   95.625  50.836 1.00 36.54 ? 2119 HOH B O     1 
HETATM 4332 O O     . HOH H 4 .   ? -6.653  107.907 49.618 1.00 48.13 ? 2120 HOH B O     1 
HETATM 4333 O O     . HOH H 4 .   ? -3.523  108.679 49.912 1.00 51.80 ? 2121 HOH B O     1 
HETATM 4334 O O     . HOH H 4 .   ? -5.928  101.237 53.187 1.00 38.52 ? 2122 HOH B O     1 
HETATM 4335 O O     . HOH H 4 .   ? -2.780  108.800 47.100 1.00 28.22 ? 2123 HOH B O     1 
HETATM 4336 O O     . HOH H 4 .   ? -8.152  109.389 47.560 1.00 49.84 ? 2124 HOH B O     1 
HETATM 4337 O O     . HOH H 4 .   ? -9.142  105.554 47.771 1.00 44.66 ? 2125 HOH B O     1 
HETATM 4338 O O     . HOH H 4 .   ? -6.766  112.233 42.510 1.00 47.81 ? 2126 HOH B O     1 
HETATM 4339 O O     . HOH H 4 .   ? -9.244  110.195 45.151 1.00 56.25 ? 2127 HOH B O     1 
HETATM 4340 O O     . HOH H 4 .   ? -7.203  104.160 33.986 1.00 24.59 ? 2128 HOH B O     1 
HETATM 4341 O O     . HOH H 4 .   ? -16.309 108.771 41.818 1.00 44.93 ? 2129 HOH B O     1 
HETATM 4342 O O     . HOH H 4 .   ? -9.677  107.412 44.863 1.00 34.57 ? 2130 HOH B O     1 
HETATM 4343 O O     . HOH H 4 .   ? -8.620  107.399 31.906 1.00 33.34 ? 2131 HOH B O     1 
HETATM 4344 O O     . HOH H 4 .   ? -8.168  110.043 31.253 1.00 32.62 ? 2132 HOH B O     1 
HETATM 4345 O O     . HOH H 4 .   ? -19.340 109.366 33.689 1.00 56.57 ? 2133 HOH B O     1 
HETATM 4346 O O     . HOH H 4 .   ? -12.679 115.180 34.271 1.00 34.69 ? 2134 HOH B O     1 
HETATM 4347 O O     . HOH H 4 .   ? -12.012 111.592 30.793 1.00 35.18 ? 2135 HOH B O     1 
HETATM 4348 O O     . HOH H 4 .   ? -9.057  115.155 32.846 1.00 38.31 ? 2136 HOH B O     1 
HETATM 4349 O O     . HOH H 4 .   ? -6.428  108.852 38.709 1.00 23.35 ? 2137 HOH B O     1 
HETATM 4350 O O     . HOH H 4 .   ? 2.575   100.927 51.099 1.00 36.65 ? 2138 HOH B O     1 
HETATM 4351 O O     . HOH H 4 .   ? 0.081   108.050 52.234 1.00 33.94 ? 2139 HOH B O     1 
HETATM 4352 O O     . HOH H 4 .   ? 3.770   109.721 50.115 1.00 20.95 ? 2140 HOH B O     1 
HETATM 4353 O O     . HOH H 4 .   ? 8.227   109.043 56.732 1.00 58.62 ? 2141 HOH B O     1 
HETATM 4354 O O     . HOH H 4 .   ? 5.791   109.099 55.414 1.00 44.77 ? 2142 HOH B O     1 
HETATM 4355 O O     . HOH H 4 .   ? 3.937   102.711 53.073 1.00 23.78 ? 2143 HOH B O     1 
HETATM 4356 O O     . HOH H 4 .   ? 6.020   100.906 52.701 1.00 26.11 ? 2144 HOH B O     1 
HETATM 4357 O O     . HOH H 4 .   ? 2.329   109.880 52.397 1.00 43.21 ? 2145 HOH B O     1 
HETATM 4358 O O     . HOH H 4 .   ? 2.869   109.784 55.020 1.00 36.34 ? 2146 HOH B O     1 
HETATM 4359 O O     . HOH H 4 .   ? 11.686  109.789 50.238 1.00 40.69 ? 2147 HOH B O     1 
HETATM 4360 O O     . HOH H 4 .   ? 7.352   112.278 48.264 1.00 24.71 ? 2148 HOH B O     1 
HETATM 4361 O O     . HOH H 4 .   ? 11.295  109.192 52.900 1.00 32.46 ? 2149 HOH B O     1 
HETATM 4362 O O     . HOH H 4 .   ? -3.352  103.627 33.169 1.00 24.32 ? 2150 HOH B O     1 
HETATM 4363 O O     . HOH H 4 .   ? 1.709   94.934  29.588 1.00 46.92 ? 2151 HOH B O     1 
HETATM 4364 O O     . HOH H 4 .   ? -2.101  102.221 30.761 1.00 30.89 ? 2152 HOH B O     1 
HETATM 4365 O O     . HOH H 4 .   ? 12.674  112.096 49.780 1.00 29.78 ? 2153 HOH B O     1 
HETATM 4366 O O     . HOH H 4 .   ? 12.040  115.400 47.579 1.00 40.38 ? 2154 HOH B O     1 
HETATM 4367 O O     . HOH H 4 .   ? 20.936  112.312 45.897 1.00 28.05 ? 2155 HOH B O     1 
HETATM 4368 O O     . HOH H 4 .   ? 22.607  102.561 42.470 1.00 41.46 ? 2156 HOH B O     1 
HETATM 4369 O O     . HOH H 4 .   ? 23.403  106.971 36.780 1.00 31.80 ? 2157 HOH B O     1 
HETATM 4370 O O     . HOH H 4 .   ? 23.375  104.286 37.302 1.00 52.78 ? 2158 HOH B O     1 
HETATM 4371 O O     . HOH H 4 .   ? 15.065  103.586 51.164 1.00 48.11 ? 2159 HOH B O     1 
HETATM 4372 O O     . HOH H 4 .   ? 22.521  103.412 45.052 1.00 44.84 ? 2160 HOH B O     1 
HETATM 4373 O O     . HOH H 4 .   ? 17.187  100.776 48.336 1.00 37.91 ? 2161 HOH B O     1 
HETATM 4374 O O     . HOH H 4 .   ? 20.962  106.516 47.499 1.00 21.48 ? 2162 HOH B O     1 
HETATM 4375 O O     . HOH H 4 .   ? 13.313  107.696 53.845 1.00 46.77 ? 2163 HOH B O     1 
HETATM 4376 O O     . HOH H 4 .   ? 15.087  111.787 52.181 1.00 61.49 ? 2164 HOH B O     1 
HETATM 4377 O O     . HOH H 4 .   ? 18.830  103.751 37.960 1.00 22.21 ? 2165 HOH B O     1 
HETATM 4378 O O     . HOH H 4 .   ? 10.556  93.474  45.435 1.00 22.43 ? 2166 HOH B O     1 
HETATM 4379 O O     . HOH H 4 .   ? 10.757  100.541 53.316 1.00 35.87 ? 2167 HOH B O     1 
HETATM 4380 O O     . HOH H 4 .   ? 11.578  96.038  49.738 1.00 56.36 ? 2168 HOH B O     1 
HETATM 4381 O O     . HOH H 4 .   ? 0.936   87.766  39.007 1.00 31.22 ? 2169 HOH B O     1 
HETATM 4382 O O     . HOH H 4 .   ? -3.255  93.584  48.972 1.00 43.97 ? 2170 HOH B O     1 
HETATM 4383 O O     . HOH I 4 .   ? 11.268  58.175  42.786 1.00 46.23 ? 2001 HOH C O     1 
HETATM 4384 O O     . HOH I 4 .   ? 21.020  51.645  32.918 1.00 40.93 ? 2002 HOH C O     1 
HETATM 4385 O O     . HOH I 4 .   ? 29.716  53.061  35.710 1.00 44.07 ? 2003 HOH C O     1 
HETATM 4386 O O     . HOH I 4 .   ? 25.794  41.375  38.101 1.00 45.76 ? 2004 HOH C O     1 
HETATM 4387 O O     . HOH I 4 .   ? 4.014   56.834  48.929 1.00 43.26 ? 2005 HOH C O     1 
HETATM 4388 O O     . HOH I 4 .   ? -0.464  55.896  51.658 1.00 48.90 ? 2006 HOH C O     1 
HETATM 4389 O O     . HOH I 4 .   ? 6.031   59.410  49.455 1.00 49.61 ? 2007 HOH C O     1 
HETATM 4390 O O     . HOH I 4 .   ? 7.385   60.818  45.406 1.00 46.92 ? 2008 HOH C O     1 
HETATM 4391 O O     . HOH I 4 .   ? 12.808  60.819  51.331 1.00 38.59 ? 2009 HOH C O     1 
HETATM 4392 O O     . HOH I 4 .   ? 12.696  59.499  46.485 1.00 35.98 ? 2010 HOH C O     1 
HETATM 4393 O O     . HOH I 4 .   ? 12.380  60.284  43.980 1.00 39.90 ? 2011 HOH C O     1 
HETATM 4394 O O     . HOH I 4 .   ? 10.167  61.788  43.857 1.00 41.37 ? 2012 HOH C O     1 
HETATM 4395 O O     . HOH I 4 .   ? 12.885  61.063  40.381 1.00 42.85 ? 2013 HOH C O     1 
HETATM 4396 O O     . HOH I 4 .   ? 11.864  66.287  36.603 1.00 51.62 ? 2014 HOH C O     1 
HETATM 4397 O O     . HOH I 4 .   ? 13.752  58.345  42.020 1.00 49.89 ? 2015 HOH C O     1 
HETATM 4398 O O     . HOH I 4 .   ? 19.173  64.323  34.305 1.00 39.52 ? 2016 HOH C O     1 
HETATM 4399 O O     . HOH I 4 .   ? 13.330  57.542  44.667 1.00 46.51 ? 2017 HOH C O     1 
HETATM 4400 O O     . HOH I 4 .   ? 12.699  63.781  35.810 1.00 40.66 ? 2018 HOH C O     1 
HETATM 4401 O O     . HOH I 4 .   ? 18.822  56.444  33.371 1.00 47.96 ? 2019 HOH C O     1 
HETATM 4402 O O     . HOH I 4 .   ? 14.844  55.821  42.215 1.00 53.49 ? 2020 HOH C O     1 
HETATM 4403 O O     . HOH I 4 .   ? 16.247  58.227  38.313 1.00 34.97 ? 2021 HOH C O     1 
HETATM 4404 O O     . HOH I 4 .   ? 15.877  56.171  39.915 1.00 34.93 ? 2022 HOH C O     1 
HETATM 4405 O O     . HOH I 4 .   ? 18.079  55.148  37.247 1.00 52.98 ? 2023 HOH C O     1 
HETATM 4406 O O     . HOH I 4 .   ? 23.438  52.700  33.448 1.00 49.33 ? 2024 HOH C O     1 
HETATM 4407 O O     . HOH I 4 .   ? 27.144  53.140  36.221 1.00 40.97 ? 2025 HOH C O     1 
HETATM 4408 O O     . HOH I 4 .   ? 20.328  51.667  35.364 1.00 41.55 ? 2026 HOH C O     1 
HETATM 4409 O O     . HOH I 4 .   ? 18.286  52.520  37.399 1.00 53.89 ? 2027 HOH C O     1 
HETATM 4410 O O     . HOH I 4 .   ? 24.075  43.369  37.182 1.00 61.41 ? 2028 HOH C O     1 
HETATM 4411 O O     . HOH I 4 .   ? 20.980  46.457  35.575 1.00 31.90 ? 2029 HOH C O     1 
HETATM 4412 O O     . HOH I 4 .   ? 25.957  46.787  35.076 1.00 43.08 ? 2030 HOH C O     1 
HETATM 4413 O O     . HOH I 4 .   ? 16.180  53.255  39.413 1.00 32.55 ? 2031 HOH C O     1 
HETATM 4414 O O     . HOH I 4 .   ? 23.679  48.876  34.637 1.00 39.23 ? 2032 HOH C O     1 
HETATM 4415 O O     . HOH I 4 .   ? 23.510  40.539  42.968 1.00 42.61 ? 2033 HOH C O     1 
HETATM 4416 O O     . HOH I 4 .   ? 12.268  42.892  44.393 1.00 56.03 ? 2034 HOH C O     1 
HETATM 4417 O O     . HOH I 4 .   ? 19.999  43.907  36.229 1.00 38.61 ? 2035 HOH C O     1 
HETATM 4418 O O     . HOH I 4 .   ? 14.870  42.766  44.829 1.00 36.41 ? 2036 HOH C O     1 
HETATM 4419 O O     . HOH I 4 .   ? 20.811  37.390  41.384 1.00 41.74 ? 2037 HOH C O     1 
HETATM 4420 O O     . HOH I 4 .   ? 15.486  42.292  36.346 1.00 33.67 ? 2038 HOH C O     1 
HETATM 4421 O O     . HOH I 4 .   ? 16.204  38.353  45.709 1.00 57.29 ? 2039 HOH C O     1 
HETATM 4422 O O     . HOH I 4 .   ? 7.585   43.399  42.233 1.00 50.26 ? 2040 HOH C O     1 
HETATM 4423 O O     . HOH J 4 .   ? 20.506  51.600  61.254 1.00 58.07 ? 2001 HOH D O     1 
HETATM 4424 O O     . HOH J 4 .   ? 15.272  58.610  55.015 1.00 57.05 ? 2002 HOH D O     1 
HETATM 4425 O O     . HOH J 4 .   ? 24.131  57.014  59.809 1.00 36.69 ? 2003 HOH D O     1 
HETATM 4426 O O     . HOH J 4 .   ? 21.844  53.891  61.810 1.00 35.40 ? 2004 HOH D O     1 
HETATM 4427 O O     . HOH J 4 .   ? 14.588  65.372  58.358 1.00 50.77 ? 2005 HOH D O     1 
HETATM 4428 O O     . HOH J 4 .   ? 9.763   71.180  60.489 1.00 51.53 ? 2006 HOH D O     1 
HETATM 4429 O O     . HOH J 4 .   ? 0.195   73.410  53.473 1.00 48.92 ? 2007 HOH D O     1 
HETATM 4430 O O     . HOH J 4 .   ? 10.900  51.721  29.915 1.00 51.17 ? 2008 HOH D O     1 
HETATM 4431 O O     . HOH J 4 .   ? 12.982  45.386  33.165 1.00 54.34 ? 2009 HOH D O     1 
HETATM 4432 O O     . HOH J 4 .   ? 11.550  54.027  39.846 1.00 58.85 ? 2010 HOH D O     1 
HETATM 4433 O O     . HOH J 4 .   ? 13.937  51.915  37.868 1.00 32.65 ? 2011 HOH D O     1 
HETATM 4434 O O     . HOH J 4 .   ? 9.263   45.531  44.555 1.00 41.13 ? 2012 HOH D O     1 
HETATM 4435 O O     . HOH J 4 .   ? 11.015  53.561  43.317 1.00 55.29 ? 2013 HOH D O     1 
HETATM 4436 O O     . HOH J 4 .   ? 10.150  54.124  48.444 1.00 47.42 ? 2014 HOH D O     1 
HETATM 4437 O O     . HOH J 4 .   ? 13.501  53.326  41.439 1.00 30.23 ? 2015 HOH D O     1 
HETATM 4438 O O     . HOH J 4 .   ? 17.068  44.983  44.201 1.00 26.03 ? 2016 HOH D O     1 
HETATM 4439 O O     . HOH J 4 .   ? 15.659  54.589  52.577 1.00 41.30 ? 2017 HOH D O     1 
HETATM 4440 O O     . HOH J 4 .   ? 12.790  56.130  47.232 1.00 38.41 ? 2018 HOH D O     1 
HETATM 4441 O O     . HOH J 4 .   ? 20.549  55.422  59.277 1.00 55.55 ? 2019 HOH D O     1 
HETATM 4442 O O     . HOH J 4 .   ? 18.898  57.637  58.432 1.00 43.30 ? 2020 HOH D O     1 
HETATM 4443 O O     . HOH J 4 .   ? 13.271  58.528  48.915 1.00 27.79 ? 2021 HOH D O     1 
HETATM 4444 O O     . HOH J 4 .   ? 23.161  57.578  57.283 1.00 26.10 ? 2022 HOH D O     1 
HETATM 4445 O O     . HOH J 4 .   ? 17.889  58.967  54.402 1.00 19.67 ? 2023 HOH D O     1 
HETATM 4446 O O     . HOH J 4 .   ? 18.643  61.141  55.812 1.00 31.76 ? 2024 HOH D O     1 
HETATM 4447 O O     . HOH J 4 .   ? 23.682  63.646  58.067 1.00 38.68 ? 2025 HOH D O     1 
HETATM 4448 O O     . HOH J 4 .   ? 21.629  59.596  58.006 1.00 30.50 ? 2026 HOH D O     1 
HETATM 4449 O O     . HOH J 4 .   ? 20.483  65.011  59.022 1.00 50.33 ? 2027 HOH D O     1 
HETATM 4450 O O     . HOH J 4 .   ? 16.371  67.503  57.983 1.00 38.86 ? 2028 HOH D O     1 
HETATM 4451 O O     . HOH J 4 .   ? 17.292  64.131  55.857 1.00 32.10 ? 2029 HOH D O     1 
HETATM 4452 O O     . HOH J 4 .   ? 14.749  64.450  55.169 1.00 27.20 ? 2030 HOH D O     1 
HETATM 4453 O O     . HOH J 4 .   ? 20.108  70.173  58.606 1.00 58.07 ? 2031 HOH D O     1 
HETATM 4454 O O     . HOH J 4 .   ? 12.655  62.621  54.929 1.00 53.84 ? 2032 HOH D O     1 
HETATM 4455 O O     . HOH J 4 .   ? 18.357  75.376  55.204 1.00 49.18 ? 2033 HOH D O     1 
HETATM 4456 O O     . HOH J 4 .   ? 13.634  70.378  58.566 1.00 50.87 ? 2034 HOH D O     1 
HETATM 4457 O O     . HOH J 4 .   ? 14.133  75.134  58.516 1.00 39.97 ? 2035 HOH D O     1 
HETATM 4458 O O     . HOH J 4 .   ? 8.502   76.926  57.795 1.00 44.38 ? 2036 HOH D O     1 
HETATM 4459 O O     . HOH J 4 .   ? 11.196  71.515  58.266 1.00 35.97 ? 2037 HOH D O     1 
HETATM 4460 O O     . HOH J 4 .   ? 10.805  67.541  59.079 1.00 51.49 ? 2038 HOH D O     1 
HETATM 4461 O O     . HOH J 4 .   ? 11.511  78.439  58.284 1.00 47.33 ? 2039 HOH D O     1 
HETATM 4462 O O     . HOH J 4 .   ? 6.579   77.031  55.201 1.00 36.98 ? 2040 HOH D O     1 
HETATM 4463 O O     . HOH J 4 .   ? 2.507   75.995  53.903 1.00 43.21 ? 2041 HOH D O     1 
HETATM 4464 O O     . HOH J 4 .   ? 7.730   69.484  59.866 1.00 39.02 ? 2042 HOH D O     1 
HETATM 4465 O O     . HOH J 4 .   ? 8.267   66.936  59.770 1.00 55.30 ? 2043 HOH D O     1 
HETATM 4466 O O     . HOH K 4 .   ? -1.231  119.299 39.099 1.00 48.99 ? 2001 HOH E O     1 
HETATM 4467 O O     . HOH K 4 .   ? 1.871   121.440 42.300 1.00 43.89 ? 2002 HOH E O     1 
HETATM 4468 O O     . HOH K 4 .   ? 0.816   120.838 38.106 1.00 37.13 ? 2003 HOH E O     1 
HETATM 4469 O O     . HOH K 4 .   ? 4.931   112.137 49.272 1.00 27.92 ? 2004 HOH E O     1 
HETATM 4470 O O     . HOH K 4 .   ? 1.696   123.296 22.180 1.00 45.63 ? 2005 HOH E O     1 
HETATM 4471 O O     . HOH K 4 .   ? 1.622   117.628 30.179 1.00 54.77 ? 2006 HOH E O     1 
HETATM 4472 O O     . HOH K 4 .   ? -2.442  119.327 35.892 1.00 42.80 ? 2007 HOH E O     1 
HETATM 4473 O O     . HOH K 4 .   ? 0.447   117.560 40.713 1.00 43.89 ? 2008 HOH E O     1 
HETATM 4474 O O     . HOH K 4 .   ? 3.622   118.741 34.273 1.00 34.18 ? 2009 HOH E O     1 
HETATM 4475 O O     . HOH K 4 .   ? 2.706   118.832 41.221 1.00 44.97 ? 2010 HOH E O     1 
HETATM 4476 O O     . HOH K 4 .   ? 3.424   120.112 38.469 1.00 30.52 ? 2011 HOH E O     1 
HETATM 4477 O O     . HOH K 4 .   ? 2.305   113.321 48.486 1.00 50.97 ? 2012 HOH E O     1 
HETATM 4478 O O     . HOH K 4 .   ? 3.879   119.231 44.379 1.00 40.25 ? 2013 HOH E O     1 
HETATM 4479 O O     . HOH K 4 .   ? 5.845   119.023 46.090 1.00 44.00 ? 2014 HOH E O     1 
HETATM 4480 O O     . HOH K 4 .   ? 3.431   116.108 48.922 1.00 48.41 ? 2015 HOH E O     1 
HETATM 4481 O O     . HOH K 4 .   ? 4.434   121.160 41.235 1.00 54.53 ? 2016 HOH E O     1 
HETATM 4482 O O     . HOH K 4 .   ? 6.948   123.294 44.933 1.00 27.74 ? 2017 HOH E O     1 
HETATM 4483 O O     . HOH K 4 .   ? 5.520   123.030 42.822 1.00 52.64 ? 2018 HOH E O     1 
HETATM 4484 O O     . HOH K 4 .   ? 9.237   122.913 51.523 1.00 42.90 ? 2019 HOH E O     1 
HETATM 4485 O O     . HOH K 4 .   ? 7.273   121.389 46.645 1.00 29.85 ? 2020 HOH E O     1 
HETATM 4486 O O     . HOH K 4 .   ? 13.460  122.061 51.126 1.00 53.81 ? 2021 HOH E O     1 
HETATM 4487 O O     . HOH K 4 .   ? 9.018   125.097 47.630 1.00 48.46 ? 2022 HOH E O     1 
HETATM 4488 O O     . HOH K 4 .   ? 7.276   120.483 50.487 1.00 42.61 ? 2023 HOH E O     1 
HETATM 4489 O O     . HOH K 4 .   ? 12.987  119.742 49.630 1.00 52.75 ? 2024 HOH E O     1 
HETATM 4490 O O     . HOH K 4 .   ? 14.794  126.164 52.733 1.00 51.86 ? 2025 HOH E O     1 
HETATM 4491 O O     . HOH K 4 .   ? 18.050  126.350 48.921 1.00 32.63 ? 2026 HOH E O     1 
HETATM 4492 O O     . HOH K 4 .   ? 11.491  128.230 49.530 1.00 36.35 ? 2027 HOH E O     1 
HETATM 4493 O O     . HOH K 4 .   ? 12.147  124.391 50.777 1.00 33.44 ? 2028 HOH E O     1 
HETATM 4494 O O     . HOH K 4 .   ? 6.907   126.479 45.639 1.00 38.64 ? 2029 HOH E O     1 
HETATM 4495 O O     . HOH K 4 .   ? 14.047  130.212 50.414 1.00 33.97 ? 2030 HOH E O     1 
HETATM 4496 O O     . HOH K 4 .   ? 8.929   127.356 49.062 1.00 53.93 ? 2031 HOH E O     1 
HETATM 4497 O O     . HOH K 4 .   ? 15.741  136.056 48.984 1.00 54.83 ? 2032 HOH E O     1 
HETATM 4498 O O     . HOH K 4 .   ? 17.076  133.155 49.558 1.00 30.61 ? 2033 HOH E O     1 
HETATM 4499 O O     . HOH K 4 .   ? 11.744  133.516 49.734 1.00 36.80 ? 2034 HOH E O     1 
HETATM 4500 O O     . HOH K 4 .   ? 6.129   136.940 40.016 1.00 35.93 ? 2035 HOH E O     1 
HETATM 4501 O O     . HOH K 4 .   ? 3.545   136.584 40.645 1.00 47.15 ? 2036 HOH E O     1 
HETATM 4502 O O     . HOH K 4 .   ? -0.255  136.205 42.142 1.00 44.87 ? 2037 HOH E O     1 
HETATM 4503 O O     . HOH K 4 .   ? 6.096   136.795 48.873 1.00 39.94 ? 2038 HOH E O     1 
HETATM 4504 O O     . HOH K 4 .   ? 5.236   141.183 46.368 1.00 42.30 ? 2039 HOH E O     1 
HETATM 4505 O O     . HOH K 4 .   ? 1.562   142.316 46.764 1.00 49.63 ? 2040 HOH E O     1 
HETATM 4506 O O     . HOH K 4 .   ? -0.074  140.052 50.799 1.00 48.63 ? 2041 HOH E O     1 
HETATM 4507 O O     . HOH L 4 .   ? 4.599   122.630 31.980 1.00 53.86 ? 2001 HOH F O     1 
HETATM 4508 O O     . HOH L 4 .   ? 3.880   123.691 35.504 1.00 53.33 ? 2002 HOH F O     1 
HETATM 4509 O O     . HOH L 4 .   ? 6.190   120.962 30.191 1.00 36.41 ? 2003 HOH F O     1 
HETATM 4510 O O     . HOH L 4 .   ? 6.546   124.587 32.295 1.00 32.61 ? 2004 HOH F O     1 
HETATM 4511 O O     . HOH L 4 .   ? 14.916  122.755 25.859 1.00 32.45 ? 2005 HOH F O     1 
HETATM 4512 O O     . HOH L 4 .   ? 9.073   126.882 27.699 1.00 53.22 ? 2006 HOH F O     1 
HETATM 4513 O O     . HOH L 4 .   ? 5.404   113.965 26.607 1.00 42.34 ? 2007 HOH F O     1 
HETATM 4514 O O     . HOH L 4 .   ? 12.011  107.082 27.726 1.00 53.06 ? 2008 HOH F O     1 
HETATM 4515 O O     . HOH L 4 .   ? 3.881   111.057 25.223 1.00 51.12 ? 2009 HOH F O     1 
HETATM 4516 O O     . HOH L 4 .   ? 0.966   107.723 25.176 1.00 41.76 ? 2010 HOH F O     1 
HETATM 4517 O O     . HOH L 4 .   ? 4.763   131.194 52.682 1.00 48.73 ? 2011 HOH F O     1 
HETATM 4518 O O     . HOH L 4 .   ? 4.911   127.723 47.172 1.00 32.59 ? 2012 HOH F O     1 
HETATM 4519 O O     . HOH L 4 .   ? 0.140   133.325 40.703 1.00 42.50 ? 2013 HOH F O     1 
HETATM 4520 O O     . HOH L 4 .   ? 4.488   126.237 43.706 1.00 27.08 ? 2014 HOH F O     1 
HETATM 4521 O O     . HOH L 4 .   ? 7.793   134.628 40.661 1.00 23.47 ? 2015 HOH F O     1 
HETATM 4522 O O     . HOH L 4 .   ? 1.020   126.985 34.703 1.00 48.20 ? 2016 HOH F O     1 
HETATM 4523 O O     . HOH L 4 .   ? 3.695   126.376 35.048 1.00 45.79 ? 2017 HOH F O     1 
HETATM 4524 O O     . HOH L 4 .   ? 3.938   123.342 38.134 1.00 37.71 ? 2018 HOH F O     1 
HETATM 4525 O O     . HOH L 4 .   ? 11.098  128.425 28.499 1.00 42.74 ? 2019 HOH F O     1 
HETATM 4526 O O     . HOH L 4 .   ? 12.431  124.124 25.721 1.00 56.82 ? 2020 HOH F O     1 
HETATM 4527 O O     . HOH L 4 .   ? 4.492   121.186 36.249 1.00 28.07 ? 2021 HOH F O     1 
HETATM 4528 O O     . HOH L 4 .   ? 7.246   124.306 29.600 1.00 47.11 ? 2022 HOH F O     1 
HETATM 4529 O O     . HOH L 4 .   ? 8.904   120.499 30.528 1.00 22.59 ? 2023 HOH F O     1 
HETATM 4530 O O     . HOH L 4 .   ? 14.338  121.908 27.955 1.00 21.80 ? 2024 HOH F O     1 
HETATM 4531 O O     . HOH L 4 .   ? 9.657   118.004 29.402 1.00 25.37 ? 2025 HOH F O     1 
HETATM 4532 O O     . HOH L 4 .   ? 12.998  119.677 27.122 1.00 30.08 ? 2026 HOH F O     1 
HETATM 4533 O O     . HOH L 4 .   ? 14.964  115.691 27.336 1.00 47.93 ? 2027 HOH F O     1 
HETATM 4534 O O     . HOH L 4 .   ? 16.651  118.826 30.316 1.00 17.61 ? 2028 HOH F O     1 
HETATM 4535 O O     . HOH L 4 .   ? 14.220  112.453 28.240 1.00 40.38 ? 2029 HOH F O     1 
HETATM 4536 O O     . HOH L 4 .   ? 11.690  114.995 26.467 1.00 38.03 ? 2030 HOH F O     1 
HETATM 4537 O O     . HOH L 4 .   ? 5.961   114.970 29.996 1.00 27.98 ? 2031 HOH F O     1 
HETATM 4538 O O     . HOH L 4 .   ? 11.319  109.588 26.243 1.00 41.24 ? 2032 HOH F O     1 
HETATM 4539 O O     . HOH L 4 .   ? 8.529   115.366 29.387 1.00 31.54 ? 2033 HOH F O     1 
HETATM 4540 O O     . HOH L 4 .   ? 7.584   112.443 27.221 1.00 37.19 ? 2034 HOH F O     1 
HETATM 4541 O O     . HOH L 4 .   ? 4.089   116.735 30.550 1.00 50.20 ? 2035 HOH F O     1 
HETATM 4542 O O     . HOH L 4 .   ? 5.261   108.201 26.271 1.00 32.04 ? 2036 HOH F O     1 
HETATM 4543 O O     . HOH L 4 .   ? 8.585   110.133 26.073 1.00 47.26 ? 2037 HOH F O     1 
HETATM 4544 O O     . HOH L 4 .   ? 5.427   104.005 27.559 1.00 34.20 ? 2038 HOH F O     1 
HETATM 4545 O O     . HOH L 4 .   ? 3.338   101.131 27.601 1.00 33.10 ? 2039 HOH F O     1 
HETATM 4546 O O     . HOH L 4 .   ? 2.057   111.942 26.856 1.00 34.82 ? 2040 HOH F O     1 
HETATM 4547 O O     . HOH L 4 .   ? 2.725   107.392 27.101 1.00 29.43 ? 2041 HOH F O     1 
HETATM 4548 O O     . HOH L 4 .   ? 2.854   114.363 28.087 1.00 44.48 ? 2042 HOH F O     1 
HETATM 4549 O O     . HOH L 4 .   ? -0.431  112.236 25.601 1.00 37.19 ? 2043 HOH F O     1 
HETATM 4550 O O     . HOH L 4 .   ? -0.972  109.656 25.256 1.00 42.79 ? 2044 HOH F O     1 
HETATM 4551 O O     . HOH L 4 .   ? -4.885  103.020 31.103 1.00 48.06 ? 2045 HOH F O     1 
HETATM 4552 O O     . HOH L 4 .   ? -9.411  112.177 30.326 1.00 55.58 ? 2046 HOH F O     1 
HETATM 4553 O O     . HOH L 4 .   ? -15.231 112.303 28.059 1.00 47.13 ? 2047 HOH F O     1 
HETATM 4554 O O     . HOH L 4 .   ? -10.154 114.254 27.733 1.00 50.61 ? 2048 HOH F O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   THR 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   ?   ?   ?   A . n 
A 1 4   GLN 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   ?   ?   ?   A . n 
A 1 6   LEU 6   6   ?   ?   ?   A . n 
A 1 7   GLU 7   7   ?   ?   ?   A . n 
A 1 8   GLY 8   8   ?   ?   ?   A . n 
A 1 9   SER 9   9   ?   ?   ?   A . n 
A 1 10  ASN 10  10  ?   ?   ?   A . n 
A 1 11  PRO 11  11  ?   ?   ?   A . n 
A 1 12  VAL 12  12  ?   ?   ?   A . n 
A 1 13  ASP 13  13  ?   ?   ?   A . n 
A 1 14  LEU 14  14  ?   ?   ?   A . n 
A 1 15  SER 15  15  ?   ?   ?   A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  HIS 17  17  17  HIS HIS A . n 
A 1 18  PRO 18  18  18  PRO PRO A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ILE 21  21  21  ILE ILE A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  PRO 23  23  23  PRO PRO A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  GLN 26  26  26  GLN GLN A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  ILE 28  28  28  ILE ILE A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  THR 31  31  31  THR THR A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  ASN 33  33  33  ASN ASN A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  CYS 36  36  36  CYS CYS A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  ILE 43  43  43  ILE ILE A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  GLN 46  46  46  GLN GLN A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  ARG 48  48  48  ARG ARG A . n 
A 1 49  ASN 49  49  49  ASN ASN A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  TYR 52  52  52  TYR TYR A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  PHE 57  57  57  PHE PHE A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  MET 62  62  62  MET MET A . n 
A 1 63  ARG 63  63  63  ARG ARG A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  ARG 65  65  65  ARG ARG A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  PRO 67  67  67  PRO PRO A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  PHE 74  74  74  PHE PHE A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  MET 79  79  79  MET MET A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  CYS 81  81  81  CYS CYS A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  LYS 85  85  85  LYS LYS A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  MET 92  92  92  MET MET A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  ARG 95  95  95  ARG ARG A . n 
A 1 96  LYS 96  96  96  LYS LYS A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 GLN 102 102 102 GLN GLN A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 GLY 105 105 105 GLY GLY A . n 
A 1 106 PHE 106 106 106 PHE PHE A . n 
A 1 107 PRO 107 107 107 PRO PRO A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 PHE 110 110 110 PHE PHE A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 PHE 113 113 113 PHE PHE A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 GLN 116 116 116 GLN GLN A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 CYS 122 122 122 CYS CYS A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 PHE 126 126 126 PHE PHE A . n 
A 1 127 PRO 127 127 127 PRO PRO A . n 
A 1 128 ILE 128 128 128 ILE ILE A . n 
A 1 129 ARG 129 129 129 ARG ARG A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 TYR 135 135 135 TYR TYR A . n 
A 1 136 SER 136 136 136 SER SER A . n 
A 1 137 HIS 137 137 137 HIS HIS A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 PHE 140 140 140 PHE PHE A . n 
A 1 141 SER 141 141 141 SER SER A . n 
A 1 142 SER 142 142 142 SER SER A . n 
A 1 143 TYR 143 143 143 TYR TYR A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 GLU 146 146 146 GLU GLU A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 PHE 148 148 148 PHE PHE A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 TYR 153 153 153 TYR TYR A . n 
A 1 154 ARG 154 154 154 ARG ARG A . n 
A 1 155 MET 155 155 155 MET MET A . n 
A 1 156 LYS 156 156 156 LYS LYS A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 LYS 159 159 159 LYS LYS A . n 
A 1 160 ILE 160 160 160 ILE ILE A . n 
A 1 161 VAL 161 161 161 VAL VAL A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 ILE 164 164 164 ILE ILE A . n 
A 1 165 PHE 165 165 165 PHE PHE A . n 
A 1 166 VAL 166 166 166 VAL VAL A . n 
A 1 167 SER 167 167 167 SER SER A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 ILE 170 170 170 ILE ILE A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 THR 173 173 173 THR THR A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 ALA 175 175 175 ALA ALA A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 MET 177 177 177 MET MET A . n 
A 1 178 ARG 178 178 178 ARG ARG A . n 
A 1 179 ASP 179 179 179 ASP ASP A . n 
A 1 180 GLU 180 180 180 GLU GLU A . n 
A 1 181 THR 181 181 181 THR THR A . n 
A 1 182 TYR 182 182 182 TYR TYR A . n 
A 1 183 LYS 183 183 183 LYS LYS A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 ASN 187 187 187 ASN ASN A . n 
A 1 188 ILE 188 188 188 ILE ILE A . n 
A 1 189 TYR 189 189 189 TYR TYR A . n 
A 1 190 PRO 190 190 190 PRO PRO A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 SER 193 193 193 SER SER A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 PHE 195 195 195 PHE PHE A . n 
A 1 196 ARG 196 196 196 ARG ARG A . n 
A 1 197 LYS 197 197 197 LYS LYS A . n 
A 1 198 ILE 198 198 198 ILE ILE A . n 
A 1 199 GLN 199 199 ?   ?   ?   A . n 
A 1 200 GLN 200 200 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   THR 2   2   ?   ?   ?   B . n 
B 1 3   ASP 3   3   ?   ?   ?   B . n 
B 1 4   GLN 4   4   ?   ?   ?   B . n 
B 1 5   GLY 5   5   ?   ?   ?   B . n 
B 1 6   LEU 6   6   ?   ?   ?   B . n 
B 1 7   GLU 7   7   ?   ?   ?   B . n 
B 1 8   GLY 8   8   ?   ?   ?   B . n 
B 1 9   SER 9   9   ?   ?   ?   B . n 
B 1 10  ASN 10  10  ?   ?   ?   B . n 
B 1 11  PRO 11  11  ?   ?   ?   B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  ASP 13  13  13  ASP ASP B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  SER 15  15  15  SER SER B . n 
B 1 16  LYS 16  16  16  LYS LYS B . n 
B 1 17  HIS 17  17  17  HIS HIS B . n 
B 1 18  PRO 18  18  18  PRO PRO B . n 
B 1 19  SER 19  19  19  SER SER B . n 
B 1 20  GLY 20  20  20  GLY GLY B . n 
B 1 21  ILE 21  21  21  ILE ILE B . n 
B 1 22  VAL 22  22  22  VAL VAL B . n 
B 1 23  PRO 23  23  23  PRO PRO B . n 
B 1 24  THR 24  24  24  THR THR B . n 
B 1 25  LEU 25  25  25  LEU LEU B . n 
B 1 26  GLN 26  26  26  GLN GLN B . n 
B 1 27  ASN 27  27  27  ASN ASN B . n 
B 1 28  ILE 28  28  28  ILE ILE B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  THR 31  31  31  THR THR B . n 
B 1 32  VAL 32  32  32  VAL VAL B . n 
B 1 33  ASN 33  33  33  ASN ASN B . n 
B 1 34  LEU 34  34  34  LEU LEU B . n 
B 1 35  ASP 35  35  35  ASP ASP B . n 
B 1 36  CYS 36  36  36  CYS CYS B . n 
B 1 37  LYS 37  37  37  LYS LYS B . n 
B 1 38  LEU 38  38  38  LEU LEU B . n 
B 1 39  ASP 39  39  39  ASP ASP B . n 
B 1 40  LEU 40  40  40  LEU LEU B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  ALA 42  42  42  ALA ALA B . n 
B 1 43  ILE 43  43  43  ILE ILE B . n 
B 1 44  ALA 44  44  44  ALA ALA B . n 
B 1 45  LEU 45  45  45  LEU LEU B . n 
B 1 46  GLN 46  46  46  GLN GLN B . n 
B 1 47  ALA 47  47  47  ALA ALA B . n 
B 1 48  ARG 48  48  48  ARG ARG B . n 
B 1 49  ASN 49  49  49  ASN ASN B . n 
B 1 50  ALA 50  50  50  ALA ALA B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  TYR 52  52  52  TYR TYR B . n 
B 1 53  ASN 53  53  53  ASN ASN B . n 
B 1 54  PRO 54  54  54  PRO PRO B . n 
B 1 55  LYS 55  55  55  LYS LYS B . n 
B 1 56  ARG 56  56  56  ARG ARG B . n 
B 1 57  PHE 57  57  57  PHE PHE B . n 
B 1 58  ALA 58  58  58  ALA ALA B . n 
B 1 59  ALA 59  59  59  ALA ALA B . n 
B 1 60  VAL 60  60  60  VAL VAL B . n 
B 1 61  ILE 61  61  61  ILE ILE B . n 
B 1 62  MET 62  62  62  MET MET B . n 
B 1 63  ARG 63  63  63  ARG ARG B . n 
B 1 64  ILE 64  64  64  ILE ILE B . n 
B 1 65  ARG 65  65  65  ARG ARG B . n 
B 1 66  GLU 66  66  66  GLU GLU B . n 
B 1 67  PRO 67  67  67  PRO PRO B . n 
B 1 68  LYS 68  68  68  LYS LYS B . n 
B 1 69  THR 69  69  69  THR THR B . n 
B 1 70  THR 70  70  70  THR THR B . n 
B 1 71  ALA 71  71  71  ALA ALA B . n 
B 1 72  LEU 72  72  72  LEU LEU B . n 
B 1 73  ILE 73  73  73  ILE ILE B . n 
B 1 74  PHE 74  74  74  PHE PHE B . n 
B 1 75  ALA 75  75  75  ALA ALA B . n 
B 1 76  SER 76  76  76  SER SER B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  LYS 78  78  78  LYS LYS B . n 
B 1 79  MET 79  79  79  MET MET B . n 
B 1 80  VAL 80  80  80  VAL VAL B . n 
B 1 81  CYS 81  81  81  CYS CYS B . n 
B 1 82  THR 82  82  82  THR THR B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  ALA 84  84  84  ALA ALA B . n 
B 1 85  LYS 85  85  85  LYS LYS B . n 
B 1 86  SER 86  86  86  SER SER B . n 
B 1 87  GLU 87  87  87  GLU GLU B . n 
B 1 88  ASP 88  88  88  ASP ASP B . n 
B 1 89  PHE 89  89  89  PHE PHE B . n 
B 1 90  SER 90  90  90  SER SER B . n 
B 1 91  LYS 91  91  91  LYS LYS B . n 
B 1 92  MET 92  92  92  MET MET B . n 
B 1 93  ALA 93  93  93  ALA ALA B . n 
B 1 94  ALA 94  94  94  ALA ALA B . n 
B 1 95  ARG 95  95  95  ARG ARG B . n 
B 1 96  LYS 96  96  96  LYS LYS B . n 
B 1 97  TYR 97  97  97  TYR TYR B . n 
B 1 98  ALA 98  98  98  ALA ALA B . n 
B 1 99  ARG 99  99  99  ARG ARG B . n 
B 1 100 ILE 100 100 100 ILE ILE B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 GLN 102 102 102 GLN GLN B . n 
B 1 103 LYS 103 103 103 LYS LYS B . n 
B 1 104 LEU 104 104 104 LEU LEU B . n 
B 1 105 GLY 105 105 105 GLY GLY B . n 
B 1 106 PHE 106 106 106 PHE PHE B . n 
B 1 107 PRO 107 107 107 PRO PRO B . n 
B 1 108 ALA 108 108 108 ALA ALA B . n 
B 1 109 LYS 109 109 109 LYS LYS B . n 
B 1 110 PHE 110 110 110 PHE PHE B . n 
B 1 111 LYS 111 111 111 LYS LYS B . n 
B 1 112 ASP 112 112 112 ASP ASP B . n 
B 1 113 PHE 113 113 113 PHE PHE B . n 
B 1 114 LYS 114 114 114 LYS LYS B . n 
B 1 115 ILE 115 115 115 ILE ILE B . n 
B 1 116 GLN 116 116 116 GLN GLN B . n 
B 1 117 ASN 117 117 117 ASN ASN B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 VAL 119 119 119 VAL VAL B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 SER 121 121 121 SER SER B . n 
B 1 122 CYS 122 122 122 CYS CYS B . n 
B 1 123 ASP 123 123 123 ASP ASP B . n 
B 1 124 VAL 124 124 124 VAL VAL B . n 
B 1 125 LYS 125 125 125 LYS LYS B . n 
B 1 126 PHE 126 126 126 PHE PHE B . n 
B 1 127 PRO 127 127 127 PRO PRO B . n 
B 1 128 ILE 128 128 128 ILE ILE B . n 
B 1 129 ARG 129 129 129 ARG ARG B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 GLU 131 131 131 GLU GLU B . n 
B 1 132 GLY 132 132 132 GLY GLY B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 ALA 134 134 134 ALA ALA B . n 
B 1 135 TYR 135 135 135 TYR TYR B . n 
B 1 136 SER 136 136 136 SER SER B . n 
B 1 137 HIS 137 137 137 HIS HIS B . n 
B 1 138 ALA 138 138 138 ALA ALA B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 PHE 140 140 140 PHE PHE B . n 
B 1 141 SER 141 141 141 SER SER B . n 
B 1 142 SER 142 142 142 SER SER B . n 
B 1 143 TYR 143 143 143 TYR TYR B . n 
B 1 144 GLU 144 144 144 GLU GLU B . n 
B 1 145 PRO 145 145 145 PRO PRO B . n 
B 1 146 GLU 146 146 146 GLU GLU B . n 
B 1 147 LEU 147 147 147 LEU LEU B . n 
B 1 148 PHE 148 148 148 PHE PHE B . n 
B 1 149 PRO 149 149 149 PRO PRO B . n 
B 1 150 GLY 150 150 150 GLY GLY B . n 
B 1 151 LEU 151 151 151 LEU LEU B . n 
B 1 152 ILE 152 152 152 ILE ILE B . n 
B 1 153 TYR 153 153 153 TYR TYR B . n 
B 1 154 ARG 154 154 154 ARG ARG B . n 
B 1 155 MET 155 155 155 MET MET B . n 
B 1 156 LYS 156 156 156 LYS LYS B . n 
B 1 157 VAL 157 157 157 VAL VAL B . n 
B 1 158 PRO 158 158 158 PRO PRO B . n 
B 1 159 LYS 159 159 159 LYS LYS B . n 
B 1 160 ILE 160 160 160 ILE ILE B . n 
B 1 161 VAL 161 161 161 VAL VAL B . n 
B 1 162 LEU 162 162 162 LEU LEU B . n 
B 1 163 LEU 163 163 163 LEU LEU B . n 
B 1 164 ILE 164 164 164 ILE ILE B . n 
B 1 165 PHE 165 165 165 PHE PHE B . n 
B 1 166 VAL 166 166 166 VAL VAL B . n 
B 1 167 SER 167 167 167 SER SER B . n 
B 1 168 GLY 168 168 168 GLY GLY B . n 
B 1 169 LYS 169 169 169 LYS LYS B . n 
B 1 170 ILE 170 170 170 ILE ILE B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 ILE 172 172 172 ILE ILE B . n 
B 1 173 THR 173 173 173 THR THR B . n 
B 1 174 GLY 174 174 174 GLY GLY B . n 
B 1 175 ALA 175 175 175 ALA ALA B . n 
B 1 176 LYS 176 176 176 LYS LYS B . n 
B 1 177 MET 177 177 177 MET MET B . n 
B 1 178 ARG 178 178 178 ARG ARG B . n 
B 1 179 ASP 179 179 179 ASP ASP B . n 
B 1 180 GLU 180 180 180 GLU GLU B . n 
B 1 181 THR 181 181 181 THR THR B . n 
B 1 182 TYR 182 182 182 TYR TYR B . n 
B 1 183 LYS 183 183 183 LYS LYS B . n 
B 1 184 ALA 184 184 184 ALA ALA B . n 
B 1 185 PHE 185 185 185 PHE PHE B . n 
B 1 186 GLU 186 186 186 GLU GLU B . n 
B 1 187 ASN 187 187 187 ASN ASN B . n 
B 1 188 ILE 188 188 188 ILE ILE B . n 
B 1 189 TYR 189 189 189 TYR TYR B . n 
B 1 190 PRO 190 190 190 PRO PRO B . n 
B 1 191 VAL 191 191 191 VAL VAL B . n 
B 1 192 LEU 192 192 192 LEU LEU B . n 
B 1 193 SER 193 193 193 SER SER B . n 
B 1 194 GLU 194 194 194 GLU GLU B . n 
B 1 195 PHE 195 195 195 PHE PHE B . n 
B 1 196 ARG 196 196 196 ARG ARG B . n 
B 1 197 LYS 197 197 197 LYS LYS B . n 
B 1 198 ILE 198 198 ?   ?   ?   B . n 
B 1 199 GLN 199 199 ?   ?   ?   B . n 
B 1 200 GLN 200 200 ?   ?   ?   B . n 
C 2 1   DG  1   201 201 DG  DG  C . n 
C 2 2   DC  2   202 202 DC  DC  C . n 
C 2 3   DT  3   203 203 DT  DT  C . n 
C 2 4   DA  4   204 204 DA  DA  C . n 
C 2 5   DT  5   205 205 DT  DT  C . n 
C 2 6   DA  6   206 206 DA  DA  C . n 
C 2 7   DA  7   207 207 DA  DA  C . n 
C 2 8   DG  8   208 208 DG  DG  C . n 
C 2 9   DA  9   209 209 DA  DA  C . n 
C 2 10  DG  10  210 210 DG  DG  C . n 
C 2 11  DG  11  211 211 DG  DG  C . n 
C 2 12  DG  12  212 212 DG  DG  C . n 
C 2 13  DC  13  213 213 DC  DC  C . n 
C 2 14  DA  14  214 214 DA  DA  C . n 
D 3 1   DT  1   215 215 DT  DT  D . n 
D 3 2   DG  2   216 216 DG  DG  D . n 
D 3 3   DC  3   217 217 DC  DC  D . n 
D 3 4   DC  4   218 218 DC  DC  D . n 
D 3 5   DC  5   219 219 DC  DC  D . n 
D 3 6   DT  6   220 220 DT  DT  D . n 
D 3 7   DC  7   221 221 DC  DC  D . n 
D 3 8   DT  8   222 222 DT  DT  D . n 
D 3 9   DT  9   223 223 DT  DT  D . n 
D 3 10  DA  10  224 224 DA  DA  D . n 
D 3 11  DT  11  225 225 DT  DT  D . n 
D 3 12  DA  12  226 226 DA  DA  D . n 
D 3 13  DG  13  227 227 DG  DG  D . n 
D 3 14  DC  14  228 228 DC  DC  D . n 
E 2 1   DG  1   201 201 DG  DG  E . n 
E 2 2   DC  2   202 202 DC  DC  E . n 
E 2 3   DT  3   203 203 DT  DT  E . n 
E 2 4   DA  4   204 204 DA  DA  E . n 
E 2 5   DT  5   205 205 DT  DT  E . n 
E 2 6   DA  6   206 206 DA  DA  E . n 
E 2 7   DA  7   207 207 DA  DA  E . n 
E 2 8   DG  8   208 208 DG  DG  E . n 
E 2 9   DA  9   209 209 DA  DA  E . n 
E 2 10  DG  10  210 210 DG  DG  E . n 
E 2 11  DG  11  211 211 DG  DG  E . n 
E 2 12  DG  12  212 212 DG  DG  E . n 
E 2 13  DC  13  213 213 DC  DC  E . n 
E 2 14  DA  14  214 214 DA  DA  E . n 
F 3 1   DT  1   215 215 DT  DT  F . n 
F 3 2   DG  2   216 216 DG  DG  F . n 
F 3 3   DC  3   217 217 DC  DC  F . n 
F 3 4   DC  4   218 218 DC  DC  F . n 
F 3 5   DC  5   219 219 DC  DC  F . n 
F 3 6   DT  6   220 220 DT  DT  F . n 
F 3 7   DC  7   221 221 DC  DC  F . n 
F 3 8   DT  8   222 222 DT  DT  F . n 
F 3 9   DT  9   223 223 DT  DT  F . n 
F 3 10  DA  10  224 224 DA  DA  F . n 
F 3 11  DT  11  225 225 DT  DT  F . n 
F 3 12  DA  12  226 226 DA  DA  F . n 
F 3 13  DG  13  227 227 DG  DG  F . n 
F 3 14  DC  14  228 228 DC  DC  F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 HOH 1   2001 2001 HOH HOH A . 
G 4 HOH 2   2002 2002 HOH HOH A . 
G 4 HOH 3   2003 2003 HOH HOH A . 
G 4 HOH 4   2004 2004 HOH HOH A . 
G 4 HOH 5   2005 2005 HOH HOH A . 
G 4 HOH 6   2006 2006 HOH HOH A . 
G 4 HOH 7   2007 2007 HOH HOH A . 
G 4 HOH 8   2008 2008 HOH HOH A . 
G 4 HOH 9   2009 2009 HOH HOH A . 
G 4 HOH 10  2010 2010 HOH HOH A . 
G 4 HOH 11  2011 2011 HOH HOH A . 
G 4 HOH 12  2012 2012 HOH HOH A . 
G 4 HOH 13  2013 2013 HOH HOH A . 
G 4 HOH 14  2014 2014 HOH HOH A . 
G 4 HOH 15  2015 2015 HOH HOH A . 
G 4 HOH 16  2016 2016 HOH HOH A . 
G 4 HOH 17  2017 2017 HOH HOH A . 
G 4 HOH 18  2018 2018 HOH HOH A . 
G 4 HOH 19  2019 2019 HOH HOH A . 
G 4 HOH 20  2020 2020 HOH HOH A . 
G 4 HOH 21  2021 2021 HOH HOH A . 
G 4 HOH 22  2022 2022 HOH HOH A . 
G 4 HOH 23  2023 2023 HOH HOH A . 
G 4 HOH 24  2024 2024 HOH HOH A . 
G 4 HOH 25  2025 2025 HOH HOH A . 
G 4 HOH 26  2026 2026 HOH HOH A . 
G 4 HOH 27  2027 2027 HOH HOH A . 
G 4 HOH 28  2028 2028 HOH HOH A . 
G 4 HOH 29  2029 2029 HOH HOH A . 
G 4 HOH 30  2030 2030 HOH HOH A . 
G 4 HOH 31  2031 2031 HOH HOH A . 
G 4 HOH 32  2032 2032 HOH HOH A . 
G 4 HOH 33  2033 2033 HOH HOH A . 
G 4 HOH 34  2034 2034 HOH HOH A . 
G 4 HOH 35  2035 2035 HOH HOH A . 
G 4 HOH 36  2036 2036 HOH HOH A . 
G 4 HOH 37  2037 2037 HOH HOH A . 
G 4 HOH 38  2038 2038 HOH HOH A . 
G 4 HOH 39  2039 2039 HOH HOH A . 
G 4 HOH 40  2040 2040 HOH HOH A . 
G 4 HOH 41  2041 2041 HOH HOH A . 
G 4 HOH 42  2042 2042 HOH HOH A . 
G 4 HOH 43  2043 2043 HOH HOH A . 
G 4 HOH 44  2044 2044 HOH HOH A . 
G 4 HOH 45  2045 2045 HOH HOH A . 
G 4 HOH 46  2046 2046 HOH HOH A . 
G 4 HOH 47  2047 2047 HOH HOH A . 
G 4 HOH 48  2048 2048 HOH HOH A . 
G 4 HOH 49  2049 2049 HOH HOH A . 
G 4 HOH 50  2050 2050 HOH HOH A . 
G 4 HOH 51  2051 2051 HOH HOH A . 
G 4 HOH 52  2052 2052 HOH HOH A . 
G 4 HOH 53  2053 2053 HOH HOH A . 
G 4 HOH 54  2054 2054 HOH HOH A . 
G 4 HOH 55  2055 2055 HOH HOH A . 
G 4 HOH 56  2056 2056 HOH HOH A . 
G 4 HOH 57  2057 2057 HOH HOH A . 
G 4 HOH 58  2058 2058 HOH HOH A . 
G 4 HOH 59  2059 2059 HOH HOH A . 
G 4 HOH 60  2060 2060 HOH HOH A . 
G 4 HOH 61  2061 2061 HOH HOH A . 
G 4 HOH 62  2062 2062 HOH HOH A . 
G 4 HOH 63  2063 2063 HOH HOH A . 
G 4 HOH 64  2064 2064 HOH HOH A . 
G 4 HOH 65  2065 2065 HOH HOH A . 
G 4 HOH 66  2066 2066 HOH HOH A . 
G 4 HOH 67  2067 2067 HOH HOH A . 
G 4 HOH 68  2068 2068 HOH HOH A . 
G 4 HOH 69  2069 2069 HOH HOH A . 
G 4 HOH 70  2070 2070 HOH HOH A . 
G 4 HOH 71  2071 2071 HOH HOH A . 
G 4 HOH 72  2072 2072 HOH HOH A . 
G 4 HOH 73  2073 2073 HOH HOH A . 
G 4 HOH 74  2074 2074 HOH HOH A . 
G 4 HOH 75  2075 2075 HOH HOH A . 
G 4 HOH 76  2076 2076 HOH HOH A . 
G 4 HOH 77  2077 2077 HOH HOH A . 
G 4 HOH 78  2078 2078 HOH HOH A . 
G 4 HOH 79  2079 2079 HOH HOH A . 
G 4 HOH 80  2080 2080 HOH HOH A . 
G 4 HOH 81  2081 2081 HOH HOH A . 
G 4 HOH 82  2082 2082 HOH HOH A . 
G 4 HOH 83  2083 2083 HOH HOH A . 
G 4 HOH 84  2084 2084 HOH HOH A . 
G 4 HOH 85  2085 2085 HOH HOH A . 
G 4 HOH 86  2086 2086 HOH HOH A . 
G 4 HOH 87  2087 2087 HOH HOH A . 
G 4 HOH 88  2088 2088 HOH HOH A . 
G 4 HOH 89  2089 2089 HOH HOH A . 
G 4 HOH 90  2090 2090 HOH HOH A . 
G 4 HOH 91  2091 2091 HOH HOH A . 
G 4 HOH 92  2092 2092 HOH HOH A . 
G 4 HOH 93  2093 2093 HOH HOH A . 
G 4 HOH 94  2094 2094 HOH HOH A . 
G 4 HOH 95  2095 2095 HOH HOH A . 
G 4 HOH 96  2096 2096 HOH HOH A . 
G 4 HOH 97  2097 2097 HOH HOH A . 
G 4 HOH 98  2098 2098 HOH HOH A . 
G 4 HOH 99  2099 2099 HOH HOH A . 
G 4 HOH 100 2100 2100 HOH HOH A . 
G 4 HOH 101 2101 2101 HOH HOH A . 
G 4 HOH 102 2102 2102 HOH HOH A . 
G 4 HOH 103 2103 2103 HOH HOH A . 
G 4 HOH 104 2104 2104 HOH HOH A . 
G 4 HOH 105 2105 2105 HOH HOH A . 
G 4 HOH 106 2106 2106 HOH HOH A . 
G 4 HOH 107 2107 2107 HOH HOH A . 
G 4 HOH 108 2108 2108 HOH HOH A . 
G 4 HOH 109 2109 2109 HOH HOH A . 
G 4 HOH 110 2110 2110 HOH HOH A . 
G 4 HOH 111 2111 2111 HOH HOH A . 
G 4 HOH 112 2112 2112 HOH HOH A . 
G 4 HOH 113 2113 2113 HOH HOH A . 
G 4 HOH 114 2114 2114 HOH HOH A . 
G 4 HOH 115 2115 2115 HOH HOH A . 
G 4 HOH 116 2116 2116 HOH HOH A . 
G 4 HOH 117 2117 2117 HOH HOH A . 
G 4 HOH 118 2118 2118 HOH HOH A . 
G 4 HOH 119 2119 2119 HOH HOH A . 
G 4 HOH 120 2120 2120 HOH HOH A . 
G 4 HOH 121 2121 2121 HOH HOH A . 
G 4 HOH 122 2122 2122 HOH HOH A . 
G 4 HOH 123 2123 2123 HOH HOH A . 
G 4 HOH 124 2124 2124 HOH HOH A . 
G 4 HOH 125 2125 2125 HOH HOH A . 
G 4 HOH 126 2126 2126 HOH HOH A . 
G 4 HOH 127 2127 2127 HOH HOH A . 
G 4 HOH 128 2128 2128 HOH HOH A . 
G 4 HOH 129 2129 2129 HOH HOH A . 
G 4 HOH 130 2130 2130 HOH HOH A . 
G 4 HOH 131 2131 2131 HOH HOH A . 
G 4 HOH 132 2132 2132 HOH HOH A . 
G 4 HOH 133 2133 2133 HOH HOH A . 
G 4 HOH 134 2134 2134 HOH HOH A . 
G 4 HOH 135 2135 2135 HOH HOH A . 
G 4 HOH 136 2136 2136 HOH HOH A . 
G 4 HOH 137 2137 2137 HOH HOH A . 
G 4 HOH 138 2138 2138 HOH HOH A . 
G 4 HOH 139 2139 2139 HOH HOH A . 
G 4 HOH 140 2140 2140 HOH HOH A . 
G 4 HOH 141 2141 2141 HOH HOH A . 
G 4 HOH 142 2142 2142 HOH HOH A . 
G 4 HOH 143 2143 2143 HOH HOH A . 
G 4 HOH 144 2144 2144 HOH HOH A . 
G 4 HOH 145 2145 2145 HOH HOH A . 
G 4 HOH 146 2146 2146 HOH HOH A . 
G 4 HOH 147 2147 2147 HOH HOH A . 
G 4 HOH 148 2148 2148 HOH HOH A . 
G 4 HOH 149 2149 2149 HOH HOH A . 
G 4 HOH 150 2150 2150 HOH HOH A . 
G 4 HOH 151 2151 2151 HOH HOH A . 
G 4 HOH 152 2152 2152 HOH HOH A . 
G 4 HOH 153 2153 2153 HOH HOH A . 
G 4 HOH 154 2154 2154 HOH HOH A . 
G 4 HOH 155 2155 2155 HOH HOH A . 
G 4 HOH 156 2156 2156 HOH HOH A . 
G 4 HOH 157 2157 2157 HOH HOH A . 
G 4 HOH 158 2158 2158 HOH HOH A . 
G 4 HOH 159 2159 2159 HOH HOH A . 
H 4 HOH 1   2001 2001 HOH HOH B . 
H 4 HOH 2   2002 2002 HOH HOH B . 
H 4 HOH 3   2003 2003 HOH HOH B . 
H 4 HOH 4   2004 2004 HOH HOH B . 
H 4 HOH 5   2005 2005 HOH HOH B . 
H 4 HOH 6   2006 2006 HOH HOH B . 
H 4 HOH 7   2007 2007 HOH HOH B . 
H 4 HOH 8   2008 2008 HOH HOH B . 
H 4 HOH 9   2009 2009 HOH HOH B . 
H 4 HOH 10  2010 2010 HOH HOH B . 
H 4 HOH 11  2011 2011 HOH HOH B . 
H 4 HOH 12  2012 2012 HOH HOH B . 
H 4 HOH 13  2013 2013 HOH HOH B . 
H 4 HOH 14  2014 2014 HOH HOH B . 
H 4 HOH 15  2015 2015 HOH HOH B . 
H 4 HOH 16  2016 2016 HOH HOH B . 
H 4 HOH 17  2017 2017 HOH HOH B . 
H 4 HOH 18  2018 2018 HOH HOH B . 
H 4 HOH 19  2019 2019 HOH HOH B . 
H 4 HOH 20  2020 2020 HOH HOH B . 
H 4 HOH 21  2021 2021 HOH HOH B . 
H 4 HOH 22  2022 2022 HOH HOH B . 
H 4 HOH 23  2023 2023 HOH HOH B . 
H 4 HOH 24  2024 2024 HOH HOH B . 
H 4 HOH 25  2025 2025 HOH HOH B . 
H 4 HOH 26  2026 2026 HOH HOH B . 
H 4 HOH 27  2027 2027 HOH HOH B . 
H 4 HOH 28  2028 2028 HOH HOH B . 
H 4 HOH 29  2029 2029 HOH HOH B . 
H 4 HOH 30  2030 2030 HOH HOH B . 
H 4 HOH 31  2031 2031 HOH HOH B . 
H 4 HOH 32  2032 2032 HOH HOH B . 
H 4 HOH 33  2033 2033 HOH HOH B . 
H 4 HOH 34  2034 2034 HOH HOH B . 
H 4 HOH 35  2035 2035 HOH HOH B . 
H 4 HOH 36  2036 2036 HOH HOH B . 
H 4 HOH 37  2037 2037 HOH HOH B . 
H 4 HOH 38  2038 2038 HOH HOH B . 
H 4 HOH 39  2039 2039 HOH HOH B . 
H 4 HOH 40  2040 2040 HOH HOH B . 
H 4 HOH 41  2041 2041 HOH HOH B . 
H 4 HOH 42  2042 2042 HOH HOH B . 
H 4 HOH 43  2043 2043 HOH HOH B . 
H 4 HOH 44  2044 2044 HOH HOH B . 
H 4 HOH 45  2045 2045 HOH HOH B . 
H 4 HOH 46  2046 2046 HOH HOH B . 
H 4 HOH 47  2047 2047 HOH HOH B . 
H 4 HOH 48  2048 2048 HOH HOH B . 
H 4 HOH 49  2049 2049 HOH HOH B . 
H 4 HOH 50  2050 2050 HOH HOH B . 
H 4 HOH 51  2051 2051 HOH HOH B . 
H 4 HOH 52  2052 2052 HOH HOH B . 
H 4 HOH 53  2053 2053 HOH HOH B . 
H 4 HOH 54  2054 2054 HOH HOH B . 
H 4 HOH 55  2055 2055 HOH HOH B . 
H 4 HOH 56  2056 2056 HOH HOH B . 
H 4 HOH 57  2057 2057 HOH HOH B . 
H 4 HOH 58  2058 2058 HOH HOH B . 
H 4 HOH 59  2059 2059 HOH HOH B . 
H 4 HOH 60  2060 2060 HOH HOH B . 
H 4 HOH 61  2061 2061 HOH HOH B . 
H 4 HOH 62  2062 2062 HOH HOH B . 
H 4 HOH 63  2063 2063 HOH HOH B . 
H 4 HOH 64  2064 2064 HOH HOH B . 
H 4 HOH 65  2065 2065 HOH HOH B . 
H 4 HOH 66  2066 2066 HOH HOH B . 
H 4 HOH 67  2067 2067 HOH HOH B . 
H 4 HOH 68  2068 2068 HOH HOH B . 
H 4 HOH 69  2069 2069 HOH HOH B . 
H 4 HOH 70  2070 2070 HOH HOH B . 
H 4 HOH 71  2071 2071 HOH HOH B . 
H 4 HOH 72  2072 2072 HOH HOH B . 
H 4 HOH 73  2073 2073 HOH HOH B . 
H 4 HOH 74  2074 2074 HOH HOH B . 
H 4 HOH 75  2075 2075 HOH HOH B . 
H 4 HOH 76  2076 2076 HOH HOH B . 
H 4 HOH 77  2077 2077 HOH HOH B . 
H 4 HOH 78  2078 2078 HOH HOH B . 
H 4 HOH 79  2079 2079 HOH HOH B . 
H 4 HOH 80  2080 2080 HOH HOH B . 
H 4 HOH 81  2081 2081 HOH HOH B . 
H 4 HOH 82  2082 2082 HOH HOH B . 
H 4 HOH 83  2083 2083 HOH HOH B . 
H 4 HOH 84  2084 2084 HOH HOH B . 
H 4 HOH 85  2085 2085 HOH HOH B . 
H 4 HOH 86  2086 2086 HOH HOH B . 
H 4 HOH 87  2087 2087 HOH HOH B . 
H 4 HOH 88  2088 2088 HOH HOH B . 
H 4 HOH 89  2089 2089 HOH HOH B . 
H 4 HOH 90  2090 2090 HOH HOH B . 
H 4 HOH 91  2091 2091 HOH HOH B . 
H 4 HOH 92  2092 2092 HOH HOH B . 
H 4 HOH 93  2093 2093 HOH HOH B . 
H 4 HOH 94  2094 2094 HOH HOH B . 
H 4 HOH 95  2095 2095 HOH HOH B . 
H 4 HOH 96  2096 2096 HOH HOH B . 
H 4 HOH 97  2097 2097 HOH HOH B . 
H 4 HOH 98  2098 2098 HOH HOH B . 
H 4 HOH 99  2099 2099 HOH HOH B . 
H 4 HOH 100 2100 2100 HOH HOH B . 
H 4 HOH 101 2101 2101 HOH HOH B . 
H 4 HOH 102 2102 2102 HOH HOH B . 
H 4 HOH 103 2103 2103 HOH HOH B . 
H 4 HOH 104 2104 2104 HOH HOH B . 
H 4 HOH 105 2105 2105 HOH HOH B . 
H 4 HOH 106 2106 2106 HOH HOH B . 
H 4 HOH 107 2107 2107 HOH HOH B . 
H 4 HOH 108 2108 2108 HOH HOH B . 
H 4 HOH 109 2109 2109 HOH HOH B . 
H 4 HOH 110 2110 2110 HOH HOH B . 
H 4 HOH 111 2111 2111 HOH HOH B . 
H 4 HOH 112 2112 2112 HOH HOH B . 
H 4 HOH 113 2113 2113 HOH HOH B . 
H 4 HOH 114 2114 2114 HOH HOH B . 
H 4 HOH 115 2115 2115 HOH HOH B . 
H 4 HOH 116 2116 2116 HOH HOH B . 
H 4 HOH 117 2117 2117 HOH HOH B . 
H 4 HOH 118 2118 2118 HOH HOH B . 
H 4 HOH 119 2119 2119 HOH HOH B . 
H 4 HOH 120 2120 2120 HOH HOH B . 
H 4 HOH 121 2121 2121 HOH HOH B . 
H 4 HOH 122 2122 2122 HOH HOH B . 
H 4 HOH 123 2123 2123 HOH HOH B . 
H 4 HOH 124 2124 2124 HOH HOH B . 
H 4 HOH 125 2125 2125 HOH HOH B . 
H 4 HOH 126 2126 2126 HOH HOH B . 
H 4 HOH 127 2127 2127 HOH HOH B . 
H 4 HOH 128 2128 2128 HOH HOH B . 
H 4 HOH 129 2129 2129 HOH HOH B . 
H 4 HOH 130 2130 2130 HOH HOH B . 
H 4 HOH 131 2131 2131 HOH HOH B . 
H 4 HOH 132 2132 2132 HOH HOH B . 
H 4 HOH 133 2133 2133 HOH HOH B . 
H 4 HOH 134 2134 2134 HOH HOH B . 
H 4 HOH 135 2135 2135 HOH HOH B . 
H 4 HOH 136 2136 2136 HOH HOH B . 
H 4 HOH 137 2137 2137 HOH HOH B . 
H 4 HOH 138 2138 2138 HOH HOH B . 
H 4 HOH 139 2139 2139 HOH HOH B . 
H 4 HOH 140 2140 2140 HOH HOH B . 
H 4 HOH 141 2141 2141 HOH HOH B . 
H 4 HOH 142 2142 2142 HOH HOH B . 
H 4 HOH 143 2143 2143 HOH HOH B . 
H 4 HOH 144 2144 2144 HOH HOH B . 
H 4 HOH 145 2145 2145 HOH HOH B . 
H 4 HOH 146 2146 2146 HOH HOH B . 
H 4 HOH 147 2147 2147 HOH HOH B . 
H 4 HOH 148 2148 2148 HOH HOH B . 
H 4 HOH 149 2149 2149 HOH HOH B . 
H 4 HOH 150 2150 2150 HOH HOH B . 
H 4 HOH 151 2151 2151 HOH HOH B . 
H 4 HOH 152 2152 2152 HOH HOH B . 
H 4 HOH 153 2153 2153 HOH HOH B . 
H 4 HOH 154 2154 2154 HOH HOH B . 
H 4 HOH 155 2155 2155 HOH HOH B . 
H 4 HOH 156 2156 2156 HOH HOH B . 
H 4 HOH 157 2157 2157 HOH HOH B . 
H 4 HOH 158 2158 2158 HOH HOH B . 
H 4 HOH 159 2159 2159 HOH HOH B . 
H 4 HOH 160 2160 2160 HOH HOH B . 
H 4 HOH 161 2161 2161 HOH HOH B . 
H 4 HOH 162 2162 2162 HOH HOH B . 
H 4 HOH 163 2163 2163 HOH HOH B . 
H 4 HOH 164 2164 2164 HOH HOH B . 
H 4 HOH 165 2165 2165 HOH HOH B . 
H 4 HOH 166 2166 2166 HOH HOH B . 
H 4 HOH 167 2167 2167 HOH HOH B . 
H 4 HOH 168 2168 2168 HOH HOH B . 
H 4 HOH 169 2169 2169 HOH HOH B . 
H 4 HOH 170 2170 2170 HOH HOH B . 
I 4 HOH 1   2001 2001 HOH HOH C . 
I 4 HOH 2   2002 2002 HOH HOH C . 
I 4 HOH 3   2003 2003 HOH HOH C . 
I 4 HOH 4   2004 2004 HOH HOH C . 
I 4 HOH 5   2005 2005 HOH HOH C . 
I 4 HOH 6   2006 2006 HOH HOH C . 
I 4 HOH 7   2007 2007 HOH HOH C . 
I 4 HOH 8   2008 2008 HOH HOH C . 
I 4 HOH 9   2009 2009 HOH HOH C . 
I 4 HOH 10  2010 2010 HOH HOH C . 
I 4 HOH 11  2011 2011 HOH HOH C . 
I 4 HOH 12  2012 2012 HOH HOH C . 
I 4 HOH 13  2013 2013 HOH HOH C . 
I 4 HOH 14  2014 2014 HOH HOH C . 
I 4 HOH 15  2015 2015 HOH HOH C . 
I 4 HOH 16  2016 2016 HOH HOH C . 
I 4 HOH 17  2017 2017 HOH HOH C . 
I 4 HOH 18  2018 2018 HOH HOH C . 
I 4 HOH 19  2019 2019 HOH HOH C . 
I 4 HOH 20  2020 2020 HOH HOH C . 
I 4 HOH 21  2021 2021 HOH HOH C . 
I 4 HOH 22  2022 2022 HOH HOH C . 
I 4 HOH 23  2023 2023 HOH HOH C . 
I 4 HOH 24  2024 2024 HOH HOH C . 
I 4 HOH 25  2025 2025 HOH HOH C . 
I 4 HOH 26  2026 2026 HOH HOH C . 
I 4 HOH 27  2027 2027 HOH HOH C . 
I 4 HOH 28  2028 2028 HOH HOH C . 
I 4 HOH 29  2029 2029 HOH HOH C . 
I 4 HOH 30  2030 2030 HOH HOH C . 
I 4 HOH 31  2031 2031 HOH HOH C . 
I 4 HOH 32  2032 2032 HOH HOH C . 
I 4 HOH 33  2033 2033 HOH HOH C . 
I 4 HOH 34  2034 2034 HOH HOH C . 
I 4 HOH 35  2035 2035 HOH HOH C . 
I 4 HOH 36  2036 2036 HOH HOH C . 
I 4 HOH 37  2037 2037 HOH HOH C . 
I 4 HOH 38  2038 2038 HOH HOH C . 
I 4 HOH 39  2039 2039 HOH HOH C . 
I 4 HOH 40  2040 2040 HOH HOH C . 
J 4 HOH 1   2001 2001 HOH HOH D . 
J 4 HOH 2   2002 2002 HOH HOH D . 
J 4 HOH 3   2003 2003 HOH HOH D . 
J 4 HOH 4   2004 2004 HOH HOH D . 
J 4 HOH 5   2005 2005 HOH HOH D . 
J 4 HOH 6   2006 2006 HOH HOH D . 
J 4 HOH 7   2007 2007 HOH HOH D . 
J 4 HOH 8   2008 2008 HOH HOH D . 
J 4 HOH 9   2009 2009 HOH HOH D . 
J 4 HOH 10  2010 2010 HOH HOH D . 
J 4 HOH 11  2011 2011 HOH HOH D . 
J 4 HOH 12  2012 2012 HOH HOH D . 
J 4 HOH 13  2013 2013 HOH HOH D . 
J 4 HOH 14  2014 2014 HOH HOH D . 
J 4 HOH 15  2015 2015 HOH HOH D . 
J 4 HOH 16  2016 2016 HOH HOH D . 
J 4 HOH 17  2017 2017 HOH HOH D . 
J 4 HOH 18  2018 2018 HOH HOH D . 
J 4 HOH 19  2019 2019 HOH HOH D . 
J 4 HOH 20  2020 2020 HOH HOH D . 
J 4 HOH 21  2021 2021 HOH HOH D . 
J 4 HOH 22  2022 2022 HOH HOH D . 
J 4 HOH 23  2023 2023 HOH HOH D . 
J 4 HOH 24  2024 2024 HOH HOH D . 
J 4 HOH 25  2025 2025 HOH HOH D . 
J 4 HOH 26  2026 2026 HOH HOH D . 
J 4 HOH 27  2027 2027 HOH HOH D . 
J 4 HOH 28  2028 2028 HOH HOH D . 
J 4 HOH 29  2029 2029 HOH HOH D . 
J 4 HOH 30  2030 2030 HOH HOH D . 
J 4 HOH 31  2031 2031 HOH HOH D . 
J 4 HOH 32  2032 2032 HOH HOH D . 
J 4 HOH 33  2033 2033 HOH HOH D . 
J 4 HOH 34  2034 2034 HOH HOH D . 
J 4 HOH 35  2035 2035 HOH HOH D . 
J 4 HOH 36  2036 2036 HOH HOH D . 
J 4 HOH 37  2037 2037 HOH HOH D . 
J 4 HOH 38  2038 2038 HOH HOH D . 
J 4 HOH 39  2039 2039 HOH HOH D . 
J 4 HOH 40  2040 2040 HOH HOH D . 
J 4 HOH 41  2041 2041 HOH HOH D . 
J 4 HOH 42  2042 2042 HOH HOH D . 
J 4 HOH 43  2043 2043 HOH HOH D . 
K 4 HOH 1   2001 2001 HOH HOH E . 
K 4 HOH 2   2002 2002 HOH HOH E . 
K 4 HOH 3   2003 2003 HOH HOH E . 
K 4 HOH 4   2004 2004 HOH HOH E . 
K 4 HOH 5   2005 2005 HOH HOH E . 
K 4 HOH 6   2006 2006 HOH HOH E . 
K 4 HOH 7   2007 2007 HOH HOH E . 
K 4 HOH 8   2008 2008 HOH HOH E . 
K 4 HOH 9   2009 2009 HOH HOH E . 
K 4 HOH 10  2010 2010 HOH HOH E . 
K 4 HOH 11  2011 2011 HOH HOH E . 
K 4 HOH 12  2012 2012 HOH HOH E . 
K 4 HOH 13  2013 2013 HOH HOH E . 
K 4 HOH 14  2014 2014 HOH HOH E . 
K 4 HOH 15  2015 2015 HOH HOH E . 
K 4 HOH 16  2016 2016 HOH HOH E . 
K 4 HOH 17  2017 2017 HOH HOH E . 
K 4 HOH 18  2018 2018 HOH HOH E . 
K 4 HOH 19  2019 2019 HOH HOH E . 
K 4 HOH 20  2020 2020 HOH HOH E . 
K 4 HOH 21  2021 2021 HOH HOH E . 
K 4 HOH 22  2022 2022 HOH HOH E . 
K 4 HOH 23  2023 2023 HOH HOH E . 
K 4 HOH 24  2024 2024 HOH HOH E . 
K 4 HOH 25  2025 2025 HOH HOH E . 
K 4 HOH 26  2026 2026 HOH HOH E . 
K 4 HOH 27  2027 2027 HOH HOH E . 
K 4 HOH 28  2028 2028 HOH HOH E . 
K 4 HOH 29  2029 2029 HOH HOH E . 
K 4 HOH 30  2030 2030 HOH HOH E . 
K 4 HOH 31  2031 2031 HOH HOH E . 
K 4 HOH 32  2032 2032 HOH HOH E . 
K 4 HOH 33  2033 2033 HOH HOH E . 
K 4 HOH 34  2034 2034 HOH HOH E . 
K 4 HOH 35  2035 2035 HOH HOH E . 
K 4 HOH 36  2036 2036 HOH HOH E . 
K 4 HOH 37  2037 2037 HOH HOH E . 
K 4 HOH 38  2038 2038 HOH HOH E . 
K 4 HOH 39  2039 2039 HOH HOH E . 
K 4 HOH 40  2040 2040 HOH HOH E . 
K 4 HOH 41  2041 2041 HOH HOH E . 
L 4 HOH 1   2001 2001 HOH HOH F . 
L 4 HOH 2   2002 2002 HOH HOH F . 
L 4 HOH 3   2003 2003 HOH HOH F . 
L 4 HOH 4   2004 2004 HOH HOH F . 
L 4 HOH 5   2005 2005 HOH HOH F . 
L 4 HOH 6   2006 2006 HOH HOH F . 
L 4 HOH 7   2007 2007 HOH HOH F . 
L 4 HOH 8   2008 2008 HOH HOH F . 
L 4 HOH 9   2009 2009 HOH HOH F . 
L 4 HOH 10  2010 2010 HOH HOH F . 
L 4 HOH 11  2011 2011 HOH HOH F . 
L 4 HOH 12  2012 2012 HOH HOH F . 
L 4 HOH 13  2013 2013 HOH HOH F . 
L 4 HOH 14  2014 2014 HOH HOH F . 
L 4 HOH 15  2015 2015 HOH HOH F . 
L 4 HOH 16  2016 2016 HOH HOH F . 
L 4 HOH 17  2017 2017 HOH HOH F . 
L 4 HOH 18  2018 2018 HOH HOH F . 
L 4 HOH 19  2019 2019 HOH HOH F . 
L 4 HOH 20  2020 2020 HOH HOH F . 
L 4 HOH 21  2021 2021 HOH HOH F . 
L 4 HOH 22  2022 2022 HOH HOH F . 
L 4 HOH 23  2023 2023 HOH HOH F . 
L 4 HOH 24  2024 2024 HOH HOH F . 
L 4 HOH 25  2025 2025 HOH HOH F . 
L 4 HOH 26  2026 2026 HOH HOH F . 
L 4 HOH 27  2027 2027 HOH HOH F . 
L 4 HOH 28  2028 2028 HOH HOH F . 
L 4 HOH 29  2029 2029 HOH HOH F . 
L 4 HOH 30  2030 2030 HOH HOH F . 
L 4 HOH 31  2031 2031 HOH HOH F . 
L 4 HOH 32  2032 2032 HOH HOH F . 
L 4 HOH 33  2033 2033 HOH HOH F . 
L 4 HOH 34  2034 2034 HOH HOH F . 
L 4 HOH 35  2035 2035 HOH HOH F . 
L 4 HOH 36  2036 2036 HOH HOH F . 
L 4 HOH 37  2037 2037 HOH HOH F . 
L 4 HOH 38  2038 2038 HOH HOH F . 
L 4 HOH 39  2039 2039 HOH HOH F . 
L 4 HOH 40  2040 2040 HOH HOH F . 
L 4 HOH 41  2041 2041 HOH HOH F . 
L 4 HOH 42  2042 2042 HOH HOH F . 
L 4 HOH 43  2043 2043 HOH HOH F . 
L 4 HOH 44  2044 2044 HOH HOH F . 
L 4 HOH 45  2045 2045 HOH HOH F . 
L 4 HOH 46  2046 2046 HOH HOH F . 
L 4 HOH 47  2047 2047 HOH HOH F . 
L 4 HOH 48  2048 2048 HOH HOH F . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 software_defined_assembly PQS trimeric 3 
2 software_defined_assembly PQS trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G,I,J 
2 1 B,E,F,H,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4800  ? 
1 MORE         -10.0 ? 
1 'SSA (A^2)'  14980 ? 
2 'ABSA (A^2)' 4820  ? 
2 MORE         -8.9  ? 
2 'SSA (A^2)'  15410 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-02-07 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-02-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' audit_author    
2 4 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_audit_author.identifier_ORCID'    
2 4 'Structure model' '_citation_author.identifier_ORCID' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    refinement       . ? 1 
DENZO     'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
X-PLOR    phasing          . ? 4 
# 
_pdbx_entry_details.entry_id                 1QN5 
_pdbx_entry_details.compound_details         
;DNA MOLECULES BOUND WITHIN THE SERIES

        CHAIN C, E        CHAIN D, F
  1QN3 GCTATAAACGGGCA   TGCCCGTTTATAGC
  1QN4 GCTATAAAATGGCA   TGCCATTTTATAGC
  1QN5 GCTATAAGAGGGCA   TGCCCTCTTATAGC
  1QN6 GCTATAATAGGGCA   TGCCCTATTATAGC
  1QN7 GCTATATAAGGGCA   TGCCCTTATATAGC
  1QN8 GCTATTAAAGGGCA   TGCCCTTTAATAGC
  1QN9 GCTACAAAAGGGCA   TGCCCTTTTGTAGC
  1QNA GCTTTAAAAGGGCA   TGCCCTTTTAAAGC
  1QNB GCTATAAATGGGCA   TGCCCATTTATAGC
  1QNC GCAATAAAAGGGCA   TGCCCTTTTATTGC
  1QNE GCTATAAAAGGGCA   TGCCCTTTTATAGC
;
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NH1 B ARG 48   ? ? O B HOH 2037 ? ? 2.03 
2 1 N   B ASN 49   ? ? O B HOH 2042 ? ? 2.05 
3 1 O   B HOH 2041 ? ? O B HOH 2052 ? ? 2.11 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 NH1 B ARG 65 ? ? 1_555 O6 C DG 211 ? ? 2_656 2.18 
2 1 NH2 B ARG 65 ? ? 1_555 N7 C DG 211 ? ? 2_656 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" C DC 202 ? ? "C1'" C DC 202 ? ? N1    C DC 202 ? ? 110.87 108.30 2.57  0.30 N 
2  1 C6    C DT 205 ? ? C5    C DT 205 ? ? C7    C DT 205 ? ? 119.20 122.90 -3.70 0.60 N 
3  1 "O4'" C DA 207 ? ? "C1'" C DA 207 ? ? N9    C DA 207 ? ? 111.03 108.30 2.73  0.30 N 
4  1 "O4'" C DG 208 ? ? "C1'" C DG 208 ? ? N9    C DG 208 ? ? 110.42 108.30 2.12  0.30 N 
5  1 "O4'" C DG 210 ? ? "C1'" C DG 210 ? ? N9    C DG 210 ? ? 110.34 108.30 2.04  0.30 N 
6  1 "O4'" C DG 212 ? ? "C1'" C DG 212 ? ? N9    C DG 212 ? ? 110.66 108.30 2.36  0.30 N 
7  1 "O4'" C DC 213 ? ? "C1'" C DC 213 ? ? N1    C DC 213 ? ? 110.19 108.30 1.89  0.30 N 
8  1 "O4'" D DT 215 ? ? "C4'" D DT 215 ? ? "C3'" D DT 215 ? ? 100.42 104.50 -4.08 0.40 N 
9  1 "O4'" D DT 215 ? ? "C1'" D DT 215 ? ? N1    D DT 215 ? ? 113.83 108.30 5.53  0.30 N 
10 1 "C1'" D DG 216 ? ? "O4'" D DG 216 ? ? "C4'" D DG 216 ? ? 103.73 110.10 -6.37 1.00 N 
11 1 "O4'" D DG 216 ? ? "C1'" D DG 216 ? ? "C2'" D DG 216 ? ? 100.29 105.90 -5.61 0.80 N 
12 1 "O4'" D DG 216 ? ? "C1'" D DG 216 ? ? N9    D DG 216 ? ? 115.28 108.30 6.98  0.30 N 
13 1 "O4'" D DC 217 ? ? "C1'" D DC 217 ? ? N1    D DC 217 ? ? 112.07 108.30 3.77  0.30 N 
14 1 "O4'" D DC 218 ? ? "C1'" D DC 218 ? ? N1    D DC 218 ? ? 111.38 108.30 3.08  0.30 N 
15 1 "O4'" D DC 219 ? ? "C1'" D DC 219 ? ? N1    D DC 219 ? ? 110.43 108.30 2.13  0.30 N 
16 1 C6    D DT 220 ? ? C5    D DT 220 ? ? C7    D DT 220 ? ? 118.58 122.90 -4.32 0.60 N 
17 1 "O4'" D DT 223 ? ? "C4'" D DT 223 ? ? "C3'" D DT 223 ? ? 101.26 104.50 -3.24 0.40 N 
18 1 "O4'" D DA 224 ? ? "C1'" D DA 224 ? ? N9    D DA 224 ? ? 111.58 108.30 3.28  0.30 N 
19 1 C6    D DT 225 ? ? C5    D DT 225 ? ? C7    D DT 225 ? ? 119.27 122.90 -3.63 0.60 N 
20 1 "O4'" D DA 226 ? ? "C1'" D DA 226 ? ? N9    D DA 226 ? ? 111.58 108.30 3.28  0.30 N 
21 1 "O4'" D DG 227 ? ? "C1'" D DG 227 ? ? N9    D DG 227 ? ? 113.59 108.30 5.29  0.30 N 
22 1 "O4'" E DC 202 ? ? "C4'" E DC 202 ? ? "C3'" E DC 202 ? ? 100.50 104.50 -4.00 0.40 N 
23 1 "O4'" E DC 202 ? ? "C1'" E DC 202 ? ? N1    E DC 202 ? ? 112.64 108.30 4.34  0.30 N 
24 1 "O4'" E DA 207 ? ? "C1'" E DA 207 ? ? N9    E DA 207 ? ? 111.32 108.30 3.02  0.30 N 
25 1 "O4'" E DG 208 ? ? "C1'" E DG 208 ? ? N9    E DG 208 ? ? 110.23 108.30 1.93  0.30 N 
26 1 "O4'" E DA 209 ? ? "C1'" E DA 209 ? ? N9    E DA 209 ? ? 111.32 108.30 3.02  0.30 N 
27 1 "O4'" E DG 210 ? ? "C1'" E DG 210 ? ? N9    E DG 210 ? ? 110.20 108.30 1.90  0.30 N 
28 1 "O4'" E DC 213 ? ? "C1'" E DC 213 ? ? N1    E DC 213 ? ? 112.50 108.30 4.20  0.30 N 
29 1 "O4'" E DA 214 ? ? "C1'" E DA 214 ? ? N9    E DA 214 ? ? 111.23 108.30 2.93  0.30 N 
30 1 "C3'" F DT 215 ? ? "O3'" F DT 215 ? ? P     F DG 216 ? ? 129.31 119.70 9.61  1.20 Y 
31 1 "O4'" F DG 216 ? ? "C1'" F DG 216 ? ? N9    F DG 216 ? ? 113.49 108.30 5.19  0.30 N 
32 1 "O4'" F DC 217 ? ? "C1'" F DC 217 ? ? N1    F DC 217 ? ? 113.81 108.30 5.51  0.30 N 
33 1 "O4'" F DC 218 ? ? "C4'" F DC 218 ? ? "C3'" F DC 218 ? ? 102.08 104.50 -2.42 0.40 N 
34 1 "O4'" F DC 218 ? ? "C1'" F DC 218 ? ? N1    F DC 218 ? ? 111.68 108.30 3.38  0.30 N 
35 1 C6    F DT 220 ? ? C5    F DT 220 ? ? C7    F DT 220 ? ? 118.52 122.90 -4.38 0.60 N 
36 1 C6    F DT 222 ? ? C5    F DT 222 ? ? C7    F DT 222 ? ? 118.66 122.90 -4.24 0.60 N 
37 1 "O4'" F DA 224 ? ? "C1'" F DA 224 ? ? N9    F DA 224 ? ? 111.26 108.30 2.96  0.30 N 
38 1 C6    F DT 225 ? ? C5    F DT 225 ? ? C7    F DT 225 ? ? 118.96 122.90 -3.94 0.60 N 
39 1 "O4'" F DA 226 ? ? "C1'" F DA 226 ? ? N9    F DA 226 ? ? 110.38 108.30 2.08  0.30 N 
40 1 "O4'" F DC 228 ? ? "C1'" F DC 228 ? ? "C2'" F DC 228 ? ? 100.24 105.90 -5.66 0.80 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 CYS A 36  ? ? -178.32 140.12  
2  1 ALA A 58  ? ? -67.80  14.68   
3  1 LYS A 109 ? ? -105.76 -156.00 
4  1 PHE A 110 ? ? -152.14 69.26   
5  1 CYS B 36  ? ? -172.15 142.09  
6  1 ASN B 49  ? ? 57.05   70.95   
7  1 TYR B 52  ? ? -166.46 101.84  
8  1 ALA B 58  ? ? -82.50  47.13   
9  1 LYS B 109 ? ? -103.31 -159.66 
10 1 PHE B 110 ? ? -151.64 74.02   
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2022 ? 5.82 . 
2 1 O ? B HOH 2017 ? 6.89 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 C DG 201 ? "O5'" ? C DG 1 "O5'" 
2 1 Y 1 C DG 201 ? "C5'" ? C DG 1 "C5'" 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A THR 2   ? A THR 2   
3  1 Y 1 A ASP 3   ? A ASP 3   
4  1 Y 1 A GLN 4   ? A GLN 4   
5  1 Y 1 A GLY 5   ? A GLY 5   
6  1 Y 1 A LEU 6   ? A LEU 6   
7  1 Y 1 A GLU 7   ? A GLU 7   
8  1 Y 1 A GLY 8   ? A GLY 8   
9  1 Y 1 A SER 9   ? A SER 9   
10 1 Y 1 A ASN 10  ? A ASN 10  
11 1 Y 1 A PRO 11  ? A PRO 11  
12 1 Y 1 A VAL 12  ? A VAL 12  
13 1 Y 1 A ASP 13  ? A ASP 13  
14 1 Y 1 A LEU 14  ? A LEU 14  
15 1 Y 1 A SER 15  ? A SER 15  
16 1 Y 1 A GLN 199 ? A GLN 199 
17 1 Y 1 A GLN 200 ? A GLN 200 
18 1 Y 1 B MET 1   ? B MET 1   
19 1 Y 1 B THR 2   ? B THR 2   
20 1 Y 1 B ASP 3   ? B ASP 3   
21 1 Y 1 B GLN 4   ? B GLN 4   
22 1 Y 1 B GLY 5   ? B GLY 5   
23 1 Y 1 B LEU 6   ? B LEU 6   
24 1 Y 1 B GLU 7   ? B GLU 7   
25 1 Y 1 B GLY 8   ? B GLY 8   
26 1 Y 1 B SER 9   ? B SER 9   
27 1 Y 1 B ASN 10  ? B ASN 10  
28 1 Y 1 B PRO 11  ? B PRO 11  
29 1 Y 1 B ILE 198 ? B ILE 198 
30 1 Y 1 B GLN 199 ? B GLN 199 
31 1 Y 1 B GLN 200 ? B GLN 200 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1QN5 'double helix'        
1QN5 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 1  1_555 D DC 14 1_555 -0.580 -0.406 -0.028 -3.276  -5.235  -3.482 1  C_DG201:DC228_D C 201 ? D 228 ? 19 1 
1 C DC 2  1_555 D DG 13 1_555 0.493  -0.392 0.565  -14.996 -11.203 -5.077 2  C_DC202:DG227_D C 202 ? D 227 ? 19 1 
1 C DT 3  1_555 D DA 12 1_555 0.099  -0.240 -0.085 -2.256  -1.183  7.845  3  C_DT203:DA226_D C 203 ? D 226 ? 20 1 
1 C DA 4  1_555 D DT 11 1_555 -0.159 -0.068 -0.024 -38.810 13.884  6.165  4  C_DA204:DT225_D C 204 ? D 225 ? 20 1 
1 C DT 5  1_555 D DA 10 1_555 0.006  -0.144 0.064  -27.181 -8.057  3.573  5  C_DT205:DA224_D C 205 ? D 224 ? 20 1 
1 C DA 6  1_555 D DT 9  1_555 0.107  -0.136 -0.284 -3.734  -2.025  4.783  6  C_DA206:DT223_D C 206 ? D 223 ? 20 1 
1 C DA 7  1_555 D DT 8  1_555 0.116  -0.146 -0.095 12.790  -2.261  5.529  7  C_DA207:DT222_D C 207 ? D 222 ? 20 1 
1 C DG 8  1_555 D DC 7  1_555 -0.313 -0.002 0.438  32.949  2.205   2.945  8  C_DG208:DC221_D C 208 ? D 221 ? 19 1 
1 C DA 9  1_555 D DT 6  1_555 0.076  0.059  0.403  42.492  -4.196  7.842  9  C_DA209:DT220_D C 209 ? D 220 ? 20 1 
1 C DG 10 1_555 D DC 5  1_555 0.782  -3.579 -0.555 5.001   7.845   72.562 10 C_DG210:DC219_D C 210 ? D 219 ? ?  3 
1 C DG 11 1_555 D DC 4  1_555 -0.209 -0.257 -0.188 -5.842  -8.773  -2.519 11 C_DG211:DC218_D C 211 ? D 218 ? 19 1 
1 C DG 12 1_555 D DC 3  1_555 -0.572 -0.308 -0.186 -8.356  -3.358  -2.838 12 C_DG212:DC217_D C 212 ? D 217 ? 19 1 
1 C DC 13 1_555 D DG 2  1_555 0.740  -0.435 -0.152 7.694   -0.223  -4.093 13 C_DC213:DG216_D C 213 ? D 216 ? 19 1 
1 C DA 14 1_555 D DT 1  1_555 0.805  -0.114 0.244  23.777  -15.886 4.685  14 C_DA214:DT215_D C 214 ? D 215 ? 20 1 
1 E DG 1  1_555 F DC 14 1_555 -0.177 -0.368 0.017  -17.078 -12.220 -9.805 15 E_DG201:DC228_F E 201 ? F 228 ? 19 1 
1 E DC 2  1_555 F DG 13 1_555 0.237  -0.316 0.553  -16.573 -9.170  -4.946 16 E_DC202:DG227_F E 202 ? F 227 ? 19 1 
1 E DT 3  1_555 F DA 12 1_555 -0.104 -0.268 0.128  -11.833 -3.674  7.141  17 E_DT203:DA226_F E 203 ? F 226 ? 20 1 
1 E DA 4  1_555 F DT 11 1_555 -0.154 -0.038 0.036  -35.997 15.210  6.568  18 E_DA204:DT225_F E 204 ? F 225 ? 20 1 
1 E DT 5  1_555 F DA 10 1_555 -0.066 -0.070 0.027  -26.048 -6.902  4.901  19 E_DT205:DA224_F E 205 ? F 224 ? 20 1 
1 E DA 6  1_555 F DT 9  1_555 0.050  -0.173 -0.443 -4.545  -0.642  4.610  20 E_DA206:DT223_F E 206 ? F 223 ? 20 1 
1 E DA 7  1_555 F DT 8  1_555 0.032  -0.172 -0.140 14.253  -0.930  5.730  21 E_DA207:DT222_F E 207 ? F 222 ? 20 1 
1 E DG 8  1_555 F DC 7  1_555 -0.218 0.019  0.601  35.048  2.816   0.493  22 E_DG208:DC221_F E 208 ? F 221 ? 19 1 
1 E DA 9  1_555 F DT 6  1_555 0.061  0.051  0.338  39.266  -4.912  8.335  23 E_DA209:DT220_F E 209 ? F 220 ? 20 1 
1 E DG 10 1_555 F DC 5  1_555 0.702  -3.502 -0.451 3.671   9.002   73.343 24 E_DG210:DC219_F E 210 ? F 219 ? ?  3 
1 E DG 11 1_555 F DC 4  1_555 -0.280 -0.260 0.132  4.709   -11.051 -1.435 25 E_DG211:DC218_F E 211 ? F 218 ? 19 1 
1 E DG 12 1_555 F DC 3  1_555 -0.123 -0.262 -0.043 -6.047  -6.934  -3.773 26 E_DG212:DC217_F E 212 ? F 217 ? 19 1 
1 E DC 13 1_555 F DG 2  1_555 0.646  -0.406 -0.271 7.038   3.917   -3.903 27 E_DC213:DG216_F E 213 ? F 216 ? 19 1 
1 E DA 14 1_555 F DT 1  1_555 0.699  -0.099 0.291  18.621  -6.884  1.199  28 E_DA214:DT215_F E 214 ? F 215 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 1  1_555 D DC 14 1_555 C DC 2  1_555 D DG 13 1_555 -0.660 -1.296 3.792  -3.618   -7.894   40.474   -0.814 0.467  4.007  
-11.255 5.159   41.357   1  CC_DG201DC202:DG227DC228_DD C 201 ? D 228 ? C 202 ? D 227 ? 
1 C DC 2  1_555 D DG 13 1_555 C DT 3  1_555 D DA 12 1_555 0.728  -0.411 2.948  8.058    2.518    36.318   -0.952 -0.155 3.002  
3.974   -12.716 37.254   2  CC_DC202DT203:DA226DG227_DD C 202 ? D 227 ? C 203 ? D 226 ? 
1 C DT 3  1_555 D DA 12 1_555 C DA 4  1_555 D DT 11 1_555 0.149  -0.502 4.703  -4.634   49.141   16.024   -5.261 -0.613 1.015  
72.803  6.866   51.739   3  CC_DT203DA204:DT225DA226_DD C 203 ? D 226 ? C 204 ? D 225 ? 
1 C DA 4  1_555 D DT 11 1_555 C DT 5  1_555 D DA 10 1_555 -1.166 -0.369 3.416  1.137    19.351   21.124   -5.146 2.619  2.242  
42.903  -2.520  28.596   4  CC_DA204DT205:DA224DT225_DD C 204 ? D 225 ? C 205 ? D 224 ? 
1 C DT 5  1_555 D DA 10 1_555 C DA 6  1_555 D DT 9  1_555 -0.118 1.985  3.083  0.474    9.239    24.073   1.723  0.405  3.582  
21.178  -1.086  25.765   5  CC_DT205DA206:DT223DA224_DD C 205 ? D 224 ? C 206 ? D 223 ? 
1 C DA 6  1_555 D DT 9  1_555 C DA 7  1_555 D DT 8  1_555 0.265  1.229  3.225  -1.202   23.424   12.972   -4.759 -0.952 2.634  
61.366  3.148   26.759   6  CC_DA206DA207:DT222DT223_DD C 206 ? D 223 ? C 207 ? D 222 ? 
1 C DA 7  1_555 D DT 8  1_555 C DG 8  1_555 D DC 7  1_555 0.288  0.774  3.080  -0.908   11.727   19.457   -2.305 -1.061 3.029  
31.271  2.422   22.707   7  CC_DA207DG208:DC221DT222_DD C 207 ? D 222 ? C 208 ? D 221 ? 
1 C DG 8  1_555 D DC 7  1_555 C DA 9  1_555 D DT 6  1_555 0.211  0.642  3.457  4.073    21.736   22.368   -3.532 0.495  2.948  
44.440  -8.327  31.355   8  CC_DG208DA209:DT220DC221_DD C 208 ? D 221 ? C 209 ? D 220 ? 
1 C DA 9  1_555 D DT 6  1_555 C DG 10 1_555 D DC 5  1_555 -1.805 5.349  -0.264 132.650  -14.941  -139.169 -2.698 -0.890 0.524  
7.618   67.635  -164.167 9  CC_DA209DG210:DC219DT220_DD C 209 ? D 220 ? C 210 ? D 219 ? 
1 C DG 10 1_555 D DC 5  1_555 C DG 11 1_555 D DC 4  1_555 -0.501 4.602  -1.268 -135.709 111.388  -130.695 -2.038 0.070  -2.531 
-55.822 -68.010 -178.152 10 CC_DG210DG211:DC218DC219_DD C 210 ? D 219 ? C 211 ? D 218 ? 
1 C DG 11 1_555 D DC 4  1_555 C DG 12 1_555 D DC 3  1_555 0.273  -0.140 3.335  1.157    3.976    30.508   -1.056 -0.284 3.299  
7.513   -2.187  30.781   11 CC_DG211DG212:DC217DC218_DD C 211 ? D 218 ? C 212 ? D 217 ? 
1 C DG 12 1_555 D DC 3  1_555 C DC 13 1_555 D DG 2  1_555 -0.105 0.101  3.031  -1.177   3.261    36.364   -0.257 0.016  3.030  
5.210   1.881   36.523   12 CC_DG212DC213:DG216DC217_DD C 212 ? D 217 ? C 213 ? D 216 ? 
1 C DC 13 1_555 D DG 2  1_555 C DA 14 1_555 D DT 1  1_555 -0.350 0.437  3.047  0.118    5.724    28.553   -0.313 0.722  3.072  
11.460  -0.236  29.110   13 CC_DC213DA214:DT215DG216_DD C 213 ? D 216 ? C 214 ? D 215 ? 
1 E DG 1  1_555 F DC 14 1_555 E DC 2  1_555 F DG 13 1_555 -0.156 -0.603 3.407  -3.086   -3.509   34.603   -0.446 -0.232 3.450  
-5.867  5.159   34.907   14 EE_DG201DC202:DG227DC228_FF E 201 ? F 228 ? E 202 ? F 227 ? 
1 E DC 2  1_555 F DG 13 1_555 E DT 3  1_555 F DA 12 1_555 1.140  -0.100 3.198  5.046    1.939    37.782   -0.398 -1.107 3.309  
2.976   -7.743  38.153   15 EE_DC202DT203:DA226DG227_FF E 202 ? F 227 ? E 203 ? F 226 ? 
1 E DT 3  1_555 F DA 12 1_555 E DA 4  1_555 F DT 11 1_555 0.299  -0.720 4.464  -3.752   48.120   17.044   -5.125 -0.681 0.840  
71.480  5.574   51.017   16 EE_DT203DA204:DT225DA226_FF E 203 ? F 226 ? E 204 ? F 225 ? 
1 E DA 4  1_555 F DT 11 1_555 E DT 5  1_555 F DA 10 1_555 -1.086 -0.412 3.470  2.212    17.823   22.197   -4.957 2.720  2.378  
39.084  -4.851  28.481   17 EE_DA204DT205:DA224DT225_FF E 204 ? F 225 ? E 205 ? F 224 ? 
1 E DT 5  1_555 F DA 10 1_555 E DA 6  1_555 F DT 9  1_555 -0.129 1.991  3.120  1.282    10.959   23.662   1.154  0.667  3.654  
25.053  -2.932  26.075   18 EE_DT205DA206:DT223DA224_FF E 205 ? F 224 ? E 206 ? F 223 ? 
1 E DA 6  1_555 F DT 9  1_555 E DA 7  1_555 F DT 8  1_555 0.225  1.242  3.117  -2.857   22.299   13.325   -4.408 -1.415 2.635  
59.240  7.590   26.090   19 EE_DA206DA207:DT222DT223_FF E 206 ? F 223 ? E 207 ? F 222 ? 
1 E DA 7  1_555 F DT 8  1_555 E DG 8  1_555 F DC 7  1_555 0.129  0.775  3.072  -1.561   11.793   20.926   -1.946 -0.813 3.046  
29.585  3.917   24.038   20 EE_DA207DG208:DC221DT222_FF E 207 ? F 222 ? E 208 ? F 221 ? 
1 E DG 8  1_555 F DC 7  1_555 E DA 9  1_555 F DT 6  1_555 0.376  0.665  3.692  5.121    21.786   21.803   -3.905 0.509  3.121  
45.060  -10.591 31.147   21 EE_DG208DA209:DT220DC221_FF E 208 ? F 221 ? E 209 ? F 220 ? 
1 E DA 9  1_555 F DT 6  1_555 E DG 10 1_555 F DC 5  1_555 -1.651 5.245  -0.497 133.898  -16.317  -135.389 -2.653 -0.849 0.340  
8.344   68.473  -163.258 22 EE_DA209DG210:DC219DT220_FF E 209 ? F 220 ? E 210 ? F 219 ? 
1 E DG 10 1_555 F DC 5  1_555 E DG 11 1_555 F DC 4  1_555 -0.422 -3.320 -2.955 134.181  -110.459 146.357  -1.908 -0.089 -2.313 
-55.314 -67.193 178.206  23 EE_DG210DG211:DC218DC219_FF E 210 ? F 219 ? E 211 ? F 218 ? 
1 E DG 11 1_555 F DC 4  1_555 E DG 12 1_555 F DC 3  1_555 0.078  -0.630 3.614  1.083    1.352    33.759   -1.325 0.059  3.587  
2.325   -1.864  33.803   24 EE_DG211DG212:DC217DC218_FF E 211 ? F 218 ? E 212 ? F 217 ? 
1 E DG 12 1_555 F DC 3  1_555 E DC 13 1_555 F DG 2  1_555 -0.212 -0.053 3.056  2.375    1.886    33.814   -0.373 0.718  3.027  
3.234   -4.074  33.946   25 EE_DG212DC213:DG216DC217_FF E 212 ? F 217 ? E 213 ? F 216 ? 
1 E DC 13 1_555 F DG 2  1_555 E DA 14 1_555 F DT 1  1_555 -0.603 0.237  3.111  -2.229   5.706    25.654   -0.956 0.747  3.129  
12.623  4.931   26.363   26 EE_DC213DA214:DT215DG216_FF E 213 ? F 216 ? E 214 ? F 215 ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#