data_1QN7
# 
_entry.id   1QN7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QN7         
PDBE  EBI-4266     
WWPDB D_1290004266 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1QN3 unspecified 
;CRYSTAL STRUCTURE OF THE C(-25) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QN4 unspecified 
;CRYSTAL STRUCTURE OF THE T(-24) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QN5 unspecified 
;CRYSTAL STRUCTURE OF THE G(-26) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QN6 unspecified 
;CRYSTAL STRUCTURE OF THE T(-26) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QN8 unspecified 
;CRYSTAL STRUCTURE OF THE T(-28) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QN9 unspecified 
;CRYSTAL STRUCTURE OF THE C(-29) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QNA unspecified 
;CRYSTAL STRUCTURE OF THE T(-30) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QNB unspecified 
;CRYSTAL STRUCTURE OF THE T(-25) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QNC unspecified 
;CRYSTAL STRUCTURE OF THE A(-31) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QNE unspecified 
'CRYSTAL STRUCTURE OF THE ADENOVIRUS MAJOR LATE PROMOTER TATA BOX BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2).' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QN7 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   1999-10-14 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Patikoglou, G.A.' 1 
'Kim, J.L.'        2 
'Sun, L.'          3 
'Yang, S.-H.'      4 
'Kodadek, T.'      5 
'Burley, S.K.'     6 
# 
_citation.id                        primary 
_citation.title                     
'TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution' 
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_volume            13 
_citation.page_first                3217 
_citation.page_last                 ? 
_citation.year                      1999 
_citation.journal_id_ASTM           GEDEEP 
_citation.country                   US 
_citation.journal_id_ISSN           0890-9369 
_citation.journal_id_CSD            2056 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10617571 
_citation.pdbx_database_id_DOI      10.1101/GAD.13.24.3217 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Patikoglou, G.A.' 1 
primary 'Kim, J.L.'        2 
primary 'Sun, L.'          3 
primary 'Yang, S.-H.'      4 
primary 'Kodadek, T.'      5 
primary 'Burley, S.K.'     6 
# 
_cell.entry_id           1QN7 
_cell.length_a           41.800 
_cell.length_b           146.700 
_cell.length_c           57.400 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.50 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QN7 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'TRANSCRIPTION INITIATION FACTOR TFIID-1'                  22400.354 2   ? ? ? ? 
2 polymer syn 
;DNA (5'-D(*GP*CP*TP*AP*TP*AP*TP*AP*AP*GP*GP*GP*CP*A)-3')
;
4328.841  2   ? ? ? ? 
3 polymer syn 
;DNA (5'-D(*TP*GP*CP*CP*CP*TP*TP*AP*TP*AP*TP*AP*GP*C)-3')
;
4230.765  2   ? ? ? ? 
4 water   nat water                                                      18.015    263 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TATA-BOX FACTOR 1, TATA SEQUENCE-BINDING PROTEIN 1, TBP1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MTDQGLEGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMV
CTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKI
VLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKIQQ
;
;MTDQGLEGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMV
CTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKI
VLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKIQQ
;
A,B ? 
2 polydeoxyribonucleotide no no '(DG)(DC)(DT)(DA)(DT)(DA)(DT)(DA)(DA)(DG)(DG)(DG)(DC)(DA)' GCTATATAAGGGCA C,E ? 
3 polydeoxyribonucleotide no no '(DT)(DG)(DC)(DC)(DC)(DT)(DT)(DA)(DT)(DA)(DT)(DA)(DG)(DC)' TGCCCTTATATAGC D,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   ASP n 
1 4   GLN n 
1 5   GLY n 
1 6   LEU n 
1 7   GLU n 
1 8   GLY n 
1 9   SER n 
1 10  ASN n 
1 11  PRO n 
1 12  VAL n 
1 13  ASP n 
1 14  LEU n 
1 15  SER n 
1 16  LYS n 
1 17  HIS n 
1 18  PRO n 
1 19  SER n 
1 20  GLY n 
1 21  ILE n 
1 22  VAL n 
1 23  PRO n 
1 24  THR n 
1 25  LEU n 
1 26  GLN n 
1 27  ASN n 
1 28  ILE n 
1 29  VAL n 
1 30  SER n 
1 31  THR n 
1 32  VAL n 
1 33  ASN n 
1 34  LEU n 
1 35  ASP n 
1 36  CYS n 
1 37  LYS n 
1 38  LEU n 
1 39  ASP n 
1 40  LEU n 
1 41  LYS n 
1 42  ALA n 
1 43  ILE n 
1 44  ALA n 
1 45  LEU n 
1 46  GLN n 
1 47  ALA n 
1 48  ARG n 
1 49  ASN n 
1 50  ALA n 
1 51  GLU n 
1 52  TYR n 
1 53  ASN n 
1 54  PRO n 
1 55  LYS n 
1 56  ARG n 
1 57  PHE n 
1 58  ALA n 
1 59  ALA n 
1 60  VAL n 
1 61  ILE n 
1 62  MET n 
1 63  ARG n 
1 64  ILE n 
1 65  ARG n 
1 66  GLU n 
1 67  PRO n 
1 68  LYS n 
1 69  THR n 
1 70  THR n 
1 71  ALA n 
1 72  LEU n 
1 73  ILE n 
1 74  PHE n 
1 75  ALA n 
1 76  SER n 
1 77  GLY n 
1 78  LYS n 
1 79  MET n 
1 80  VAL n 
1 81  CYS n 
1 82  THR n 
1 83  GLY n 
1 84  ALA n 
1 85  LYS n 
1 86  SER n 
1 87  GLU n 
1 88  ASP n 
1 89  PHE n 
1 90  SER n 
1 91  LYS n 
1 92  MET n 
1 93  ALA n 
1 94  ALA n 
1 95  ARG n 
1 96  LYS n 
1 97  TYR n 
1 98  ALA n 
1 99  ARG n 
1 100 ILE n 
1 101 VAL n 
1 102 GLN n 
1 103 LYS n 
1 104 LEU n 
1 105 GLY n 
1 106 PHE n 
1 107 PRO n 
1 108 ALA n 
1 109 LYS n 
1 110 PHE n 
1 111 LYS n 
1 112 ASP n 
1 113 PHE n 
1 114 LYS n 
1 115 ILE n 
1 116 GLN n 
1 117 ASN n 
1 118 ILE n 
1 119 VAL n 
1 120 GLY n 
1 121 SER n 
1 122 CYS n 
1 123 ASP n 
1 124 VAL n 
1 125 LYS n 
1 126 PHE n 
1 127 PRO n 
1 128 ILE n 
1 129 ARG n 
1 130 LEU n 
1 131 GLU n 
1 132 GLY n 
1 133 LEU n 
1 134 ALA n 
1 135 TYR n 
1 136 SER n 
1 137 HIS n 
1 138 ALA n 
1 139 ALA n 
1 140 PHE n 
1 141 SER n 
1 142 SER n 
1 143 TYR n 
1 144 GLU n 
1 145 PRO n 
1 146 GLU n 
1 147 LEU n 
1 148 PHE n 
1 149 PRO n 
1 150 GLY n 
1 151 LEU n 
1 152 ILE n 
1 153 TYR n 
1 154 ARG n 
1 155 MET n 
1 156 LYS n 
1 157 VAL n 
1 158 PRO n 
1 159 LYS n 
1 160 ILE n 
1 161 VAL n 
1 162 LEU n 
1 163 LEU n 
1 164 ILE n 
1 165 PHE n 
1 166 VAL n 
1 167 SER n 
1 168 GLY n 
1 169 LYS n 
1 170 ILE n 
1 171 VAL n 
1 172 ILE n 
1 173 THR n 
1 174 GLY n 
1 175 ALA n 
1 176 LYS n 
1 177 MET n 
1 178 ARG n 
1 179 ASP n 
1 180 GLU n 
1 181 THR n 
1 182 TYR n 
1 183 LYS n 
1 184 ALA n 
1 185 PHE n 
1 186 GLU n 
1 187 ASN n 
1 188 ILE n 
1 189 TYR n 
1 190 PRO n 
1 191 VAL n 
1 192 LEU n 
1 193 SER n 
1 194 GLU n 
1 195 PHE n 
1 196 ARG n 
1 197 LYS n 
1 198 ILE n 
1 199 GLN n 
1 200 GLN n 
2 1   DG  n 
2 2   DC  n 
2 3   DT  n 
2 4   DA  n 
2 5   DT  n 
2 6   DA  n 
2 7   DT  n 
2 8   DA  n 
2 9   DA  n 
2 10  DG  n 
2 11  DG  n 
2 12  DG  n 
2 13  DC  n 
2 14  DA  n 
3 1   DT  n 
3 2   DG  n 
3 3   DC  n 
3 4   DC  n 
3 5   DC  n 
3 6   DT  n 
3 7   DT  n 
3 8   DA  n 
3 9   DT  n 
3 10  DA  n 
3 11  DT  n 
3 12  DA  n 
3 13  DG  n 
3 14  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'MOUSE-EAR CRESS' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'ARABIDOPSIS THALIANA' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     3702 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP TF21_ARATH 1 ? ? P28147 ? 
2 PDB 1QN7       2 ? ? 1QN7   ? 
3 PDB 1QN7       3 ? ? 1QN7   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1QN7 A 1 ? 200 ? P28147 1   ? 200 ? 1   200 
2 1 1QN7 B 1 ? 200 ? P28147 1   ? 200 ? 1   200 
3 2 1QN7 C 1 ? 14  ? 1QN7   201 ? 214 ? 201 214 
4 3 1QN7 D 1 ? 14  ? 1QN7   215 ? 228 ? 215 228 
5 2 1QN7 E 1 ? 14  ? 1QN7   201 ? 214 ? 201 214 
6 3 1QN7 F 1 ? 14  ? 1QN7   215 ? 228 ? 215 228 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1QN7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.84 
_exptl_crystal.density_percent_sol   56.72 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 6.00' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9200 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             0.9200 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1QN7 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             15.000 
_reflns.d_resolution_high            2.300 
_reflns.number_obs                   30019 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.05800 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.900 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1QN7 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     27681 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6 
_refine.ls_d_res_high                            2.3 
_refine.ls_percent_reflns_obs                    96.2 
_refine.ls_R_factor_obs                          .194 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       .194 
_refine.ls_R_factor_R_free                       .263 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  2481 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2911 
_refine_hist.pdbx_number_atoms_nucleic_acid   1134 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             263 
_refine_hist.number_atoms_total               4308 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        6 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                .009 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.4  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?    ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.999990 
_struct_ncs_oper.matrix[1][2]   0.001720 
_struct_ncs_oper.matrix[1][3]   -0.002890 
_struct_ncs_oper.matrix[2][1]   0.001760 
_struct_ncs_oper.matrix[2][2]   -0.999890 
_struct_ncs_oper.matrix[2][3]   0.014620 
_struct_ncs_oper.matrix[3][1]   -0.002870 
_struct_ncs_oper.matrix[3][2]   -0.014630 
_struct_ncs_oper.matrix[3][3]   -0.999890 
_struct_ncs_oper.vector[1]      8.99841 
_struct_ncs_oper.vector[2]      -88.32040 
_struct_ncs_oper.vector[3]      217.52924 
# 
_struct.entry_id                  1QN7 
_struct.title                     
;Crystal structure of the T(-27) Adenovirus major late promoter TATA box variant bound to wild-type TBP (Arabidopsis thaliana TBP isoform 2). TATA element recognition by the TATA box-binding protein has been conserved throughout evolution.
;
_struct.pdbx_descriptor           'TRANSCRIPTION INITIATION FACTOR TFIID-1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QN7 
_struct_keywords.pdbx_keywords   'TATA BOX-BINDING PROTEIN (TBP)' 
_struct_keywords.text            
;TATA BOX-BINDING PROTEIN (TBP), ADENOVIRUS MAJOR LATE PROMOTER (ADMLP) TATA BOX, TBP-TATA ELEMENT COMPLEXES, T (- 27) TATA BOX VARIANT
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 39  ? ALA A 47  ? ASP A 39  ALA A 47  1 ? 9  
HELX_P HELX_P2 2 SER A 86  ? LYS A 103 ? SER A 86  LYS A 103 1 ? 18 
HELX_P HELX_P3 3 ARG A 129 ? HIS A 137 ? ARG A 129 HIS A 137 1 ? 9  
HELX_P HELX_P4 4 MET A 177 ? PHE A 195 ? MET A 177 PHE A 195 1 ? 19 
HELX_P HELX_P5 5 ASP B 39  ? ALA B 47  ? ASP B 39  ALA B 47  1 ? 9  
HELX_P HELX_P6 6 SER B 86  ? LEU B 104 ? SER B 86  LEU B 104 1 ? 19 
HELX_P HELX_P7 7 ARG B 129 ? HIS B 137 ? ARG B 129 HIS B 137 1 ? 9  
HELX_P HELX_P8 8 MET B 177 ? SER B 193 ? MET B 177 SER B 193 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? C DG 1  N1 ? ? ? 1_555 D DC 14 N3 ? ? C DG 201 D DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? C DG 1  N2 ? ? ? 1_555 D DC 14 O2 ? ? C DG 201 D DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? C DG 1  O6 ? ? ? 1_555 D DC 14 N4 ? ? C DG 201 D DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? C DC 2  N3 ? ? ? 1_555 D DG 13 N1 ? ? C DC 202 D DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? C DC 2  N4 ? ? ? 1_555 D DG 13 O6 ? ? C DC 202 D DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? C DC 2  O2 ? ? ? 1_555 D DG 13 N2 ? ? C DC 202 D DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? C DT 3  N3 ? ? ? 1_555 D DA 12 N1 ? ? C DT 203 D DA 226 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? C DT 3  O4 ? ? ? 1_555 D DA 12 N6 ? ? C DT 203 D DA 226 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? C DA 4  N1 ? ? ? 1_555 D DT 11 N3 ? ? C DA 204 D DT 225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? C DA 4  N6 ? ? ? 1_555 D DT 11 O4 ? ? C DA 204 D DT 225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? C DT 5  N3 ? ? ? 1_555 D DA 10 N1 ? ? C DT 205 D DA 224 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? C DT 5  O4 ? ? ? 1_555 D DA 10 N6 ? ? C DT 205 D DA 224 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? C DA 6  N1 ? ? ? 1_555 D DT 9  N3 ? ? C DA 206 D DT 223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? C DA 6  N6 ? ? ? 1_555 D DT 9  O4 ? ? C DA 206 D DT 223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? C DT 7  N3 ? ? ? 1_555 D DA 8  N1 ? ? C DT 207 D DA 222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? C DT 7  O4 ? ? ? 1_555 D DA 8  N6 ? ? C DT 207 D DA 222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? C DA 8  N1 ? ? ? 1_555 D DT 7  N3 ? ? C DA 208 D DT 221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? C DA 8  N6 ? ? ? 1_555 D DT 7  O4 ? ? C DA 208 D DT 221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? C DA 9  N1 ? ? ? 1_555 D DT 6  N3 ? ? C DA 209 D DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? C DA 9  N6 ? ? ? 1_555 D DT 6  O4 ? ? C DA 209 D DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? C DG 10 O6 ? ? ? 1_555 D DC 5  N4 ? ? C DG 210 D DC 219 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog22 hydrog ? ? C DG 11 N1 ? ? ? 1_555 D DC 4  N3 ? ? C DG 211 D DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? C DG 11 N2 ? ? ? 1_555 D DC 4  O2 ? ? C DG 211 D DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? C DG 11 O6 ? ? ? 1_555 D DC 4  N4 ? ? C DG 211 D DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? C DG 12 N1 ? ? ? 1_555 D DC 3  N3 ? ? C DG 212 D DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? C DG 12 N2 ? ? ? 1_555 D DC 3  O2 ? ? C DG 212 D DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? C DG 12 O6 ? ? ? 1_555 D DC 3  N4 ? ? C DG 212 D DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? C DC 13 N3 ? ? ? 1_555 D DG 2  N1 ? ? C DC 213 D DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? C DC 13 N4 ? ? ? 1_555 D DG 2  O6 ? ? C DC 213 D DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? C DC 13 O2 ? ? ? 1_555 D DG 2  N2 ? ? C DC 213 D DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? C DA 14 N1 ? ? ? 1_555 D DT 1  N3 ? ? C DA 214 D DT 215 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? C DA 14 N6 ? ? ? 1_555 D DT 1  O4 ? ? C DA 214 D DT 215 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? E DG 1  N1 ? ? ? 1_555 F DC 14 N3 ? ? E DG 201 F DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? E DG 1  N2 ? ? ? 1_555 F DC 14 O2 ? ? E DG 201 F DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? E DG 1  O6 ? ? ? 1_555 F DC 14 N4 ? ? E DG 201 F DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? E DC 2  N3 ? ? ? 1_555 F DG 13 N1 ? ? E DC 202 F DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? E DC 2  N4 ? ? ? 1_555 F DG 13 O6 ? ? E DC 202 F DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? E DC 2  O2 ? ? ? 1_555 F DG 13 N2 ? ? E DC 202 F DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? E DT 3  N3 ? ? ? 1_555 F DA 12 N1 ? ? E DT 203 F DA 226 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? E DT 3  O4 ? ? ? 1_555 F DA 12 N6 ? ? E DT 203 F DA 226 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? E DA 4  N1 ? ? ? 1_555 F DT 11 N3 ? ? E DA 204 F DT 225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? E DA 4  N6 ? ? ? 1_555 F DT 11 O4 ? ? E DA 204 F DT 225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? E DT 5  N3 ? ? ? 1_555 F DA 10 N1 ? ? E DT 205 F DA 224 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? E DT 5  O4 ? ? ? 1_555 F DA 10 N6 ? ? E DT 205 F DA 224 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? E DA 6  N1 ? ? ? 1_555 F DT 9  N3 ? ? E DA 206 F DT 223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? E DA 6  N6 ? ? ? 1_555 F DT 9  O4 ? ? E DA 206 F DT 223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? E DT 7  N3 ? ? ? 1_555 F DA 8  N1 ? ? E DT 207 F DA 222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? E DT 7  O4 ? ? ? 1_555 F DA 8  N6 ? ? E DT 207 F DA 222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? E DA 8  N1 ? ? ? 1_555 F DT 7  N3 ? ? E DA 208 F DT 221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50 hydrog ? ? E DA 8  N6 ? ? ? 1_555 F DT 7  O4 ? ? E DA 208 F DT 221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51 hydrog ? ? E DA 9  N1 ? ? ? 1_555 F DT 6  N3 ? ? E DA 209 F DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52 hydrog ? ? E DA 9  N6 ? ? ? 1_555 F DT 6  O4 ? ? E DA 209 F DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53 hydrog ? ? E DG 10 O6 ? ? ? 1_555 F DC 5  N4 ? ? E DG 210 F DC 219 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog54 hydrog ? ? E DG 11 N1 ? ? ? 1_555 F DC 4  N3 ? ? E DG 211 F DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55 hydrog ? ? E DG 11 N2 ? ? ? 1_555 F DC 4  O2 ? ? E DG 211 F DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56 hydrog ? ? E DG 11 O6 ? ? ? 1_555 F DC 4  N4 ? ? E DG 211 F DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57 hydrog ? ? E DG 12 N1 ? ? ? 1_555 F DC 3  N3 ? ? E DG 212 F DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58 hydrog ? ? E DG 12 N2 ? ? ? 1_555 F DC 3  O2 ? ? E DG 212 F DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59 hydrog ? ? E DG 12 O6 ? ? ? 1_555 F DC 3  N4 ? ? E DG 212 F DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60 hydrog ? ? E DC 13 N3 ? ? ? 1_555 F DG 2  N1 ? ? E DC 213 F DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61 hydrog ? ? E DC 13 N4 ? ? ? 1_555 F DG 2  O6 ? ? E DC 213 F DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62 hydrog ? ? E DC 13 O2 ? ? ? 1_555 F DG 2  N2 ? ? E DC 213 F DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63 hydrog ? ? E DA 14 N1 ? ? ? 1_555 F DT 1  N3 ? ? E DA 214 F DT 215 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64 hydrog ? ? E DA 14 N6 ? ? ? 1_555 F DT 1  O4 ? ? E DA 214 F DT 215 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 66  A . ? GLU 66  A PRO 67  A ? PRO 67  A 1 -0.50 
2 VAL 157 A . ? VAL 157 A PRO 158 A ? PRO 158 A 1 -0.62 
3 GLU 66  B . ? GLU 66  B PRO 67  B ? PRO 67  B 1 -0.37 
4 VAL 157 B . ? VAL 157 B PRO 158 B ? PRO 158 B 1 -0.47 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 4 ? 
D ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 30  ? ASN A 33  ? SER A 30  ASN A 33  
A 2 LYS A 78  ? THR A 82  ? LYS A 78  THR A 82  
A 3 THR A 69  ? ILE A 73  ? THR A 69  ILE A 73  
A 4 VAL A 60  ? ILE A 64  ? VAL A 60  ILE A 64  
A 5 ALA A 50  ? TYR A 52  ? ALA A 50  TYR A 52  
B 1 LEU A 151 ? MET A 155 ? LEU A 151 MET A 155 
B 2 ILE A 160 ? ILE A 164 ? ILE A 160 ILE A 164 
B 3 LYS A 169 ? ALA A 175 ? LYS A 169 ALA A 175 
B 4 ASN A 117 ? ASP A 123 ? ASN A 117 ASP A 123 
B 5 THR A 24  ? VAL A 29  ? THR A 24  VAL A 29  
C 1 SER B 30  ? ASN B 33  ? SER B 30  ASN B 33  
C 2 LYS B 78  ? THR B 82  ? LYS B 78  THR B 82  
C 3 THR B 69  ? PHE B 74  ? THR B 69  PHE B 74  
C 4 ALA B 59  ? ILE B 64  ? ALA B 59  ILE B 64  
D 1 LEU B 151 ? MET B 155 ? LEU B 151 MET B 155 
D 2 ILE B 160 ? ILE B 164 ? ILE B 160 ILE B 164 
D 3 LYS B 169 ? ALA B 175 ? LYS B 169 ALA B 175 
D 4 ASN B 117 ? ASP B 123 ? ASN B 117 ASP B 123 
D 5 THR B 24  ? VAL B 29  ? THR B 24  VAL B 29  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER A 30  ? O SER A 30  N CYS A 81  ? N CYS A 81  
A 2 3 O VAL A 80  ? O VAL A 80  N LEU A 72  ? N LEU A 72  
A 3 4 O THR A 69  ? O THR A 69  N ILE A 64  ? N ILE A 64  
A 4 5 O ILE A 61  ? O ILE A 61  N GLU A 51  ? N GLU A 51  
B 1 2 O LEU A 151 ? O LEU A 151 N ILE A 164 ? N ILE A 164 
B 2 3 O VAL A 161 ? O VAL A 161 N THR A 173 ? N THR A 173 
B 3 4 O ILE A 170 ? O ILE A 170 N CYS A 122 ? N CYS A 122 
B 4 5 O ASN A 117 ? O ASN A 117 N VAL A 29  ? N VAL A 29  
C 1 2 O SER B 30  ? O SER B 30  N CYS B 81  ? N CYS B 81  
C 2 3 O VAL B 80  ? O VAL B 80  N LEU B 72  ? N LEU B 72  
C 3 4 O THR B 69  ? O THR B 69  N ILE B 64  ? N ILE B 64  
D 1 2 O LEU B 151 ? O LEU B 151 N ILE B 164 ? N ILE B 164 
D 2 3 O VAL B 161 ? O VAL B 161 N THR B 173 ? N THR B 173 
D 3 4 O ILE B 170 ? O ILE B 170 N CYS B 122 ? N CYS B 122 
D 4 5 O ASN B 117 ? O ASN B 117 N VAL B 29  ? N VAL B 29  
# 
_database_PDB_matrix.entry_id          1QN7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QN7 
_atom_sites.fract_transf_matrix[1][1]   0.023923 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000209 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006817 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017422 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ASP A 1 13  ? 30.472  87.649  47.307 1.00 47.67 ? 13   ASP A N     1 
ATOM   2    C CA    . ASP A 1 13  ? 30.868  87.331  45.902 1.00 47.69 ? 13   ASP A CA    1 
ATOM   3    C C     . ASP A 1 13  ? 29.744  87.666  44.918 1.00 48.27 ? 13   ASP A C     1 
ATOM   4    O O     . ASP A 1 13  ? 29.406  86.865  44.036 1.00 48.71 ? 13   ASP A O     1 
ATOM   5    C CB    . ASP A 1 13  ? 31.249  85.865  45.790 1.00 47.10 ? 13   ASP A CB    1 
ATOM   6    N N     . LEU A 1 14  ? 29.215  88.881  45.033 1.00 48.52 ? 14   LEU A N     1 
ATOM   7    C CA    . LEU A 1 14  ? 28.121  89.346  44.179 1.00 48.13 ? 14   LEU A CA    1 
ATOM   8    C C     . LEU A 1 14  ? 28.389  89.240  42.680 1.00 47.95 ? 14   LEU A C     1 
ATOM   9    O O     . LEU A 1 14  ? 27.482  89.441  41.873 1.00 48.55 ? 14   LEU A O     1 
ATOM   10   C CB    . LEU A 1 14  ? 27.742  90.794  44.516 1.00 49.01 ? 14   LEU A CB    1 
ATOM   11   C CG    . LEU A 1 14  ? 27.127  91.137  45.878 1.00 49.49 ? 14   LEU A CG    1 
ATOM   12   C CD1   . LEU A 1 14  ? 26.046  90.131  46.224 1.00 49.23 ? 14   LEU A CD1   1 
ATOM   13   C CD2   . LEU A 1 14  ? 28.203  91.157  46.958 1.00 51.69 ? 14   LEU A CD2   1 
ATOM   14   N N     . SER A 1 15  ? 29.630  88.949  42.303 1.00 47.10 ? 15   SER A N     1 
ATOM   15   C CA    . SER A 1 15  ? 29.967  88.830  40.892 1.00 46.34 ? 15   SER A CA    1 
ATOM   16   C C     . SER A 1 15  ? 29.502  87.476  40.331 1.00 45.61 ? 15   SER A C     1 
ATOM   17   O O     . SER A 1 15  ? 29.081  87.383  39.173 1.00 45.61 ? 15   SER A O     1 
ATOM   18   C CB    . SER A 1 15  ? 31.475  89.019  40.693 1.00 45.48 ? 15   SER A CB    1 
ATOM   19   O OG    . SER A 1 15  ? 31.776  89.339  39.345 1.00 45.60 ? 15   SER A OG    1 
ATOM   20   N N     . LYS A 1 16  ? 29.558  86.439  41.165 1.00 44.58 ? 16   LYS A N     1 
ATOM   21   C CA    . LYS A 1 16  ? 29.152  85.096  40.756 1.00 43.93 ? 16   LYS A CA    1 
ATOM   22   C C     . LYS A 1 16  ? 27.722  84.830  41.224 1.00 42.83 ? 16   LYS A C     1 
ATOM   23   O O     . LYS A 1 16  ? 26.952  84.126  40.567 1.00 42.53 ? 16   LYS A O     1 
ATOM   24   C CB    . LYS A 1 16  ? 30.108  84.059  41.370 1.00 45.51 ? 16   LYS A CB    1 
ATOM   25   C CG    . LYS A 1 16  ? 30.207  82.704  40.631 1.00 47.17 ? 16   LYS A CG    1 
ATOM   26   C CD    . LYS A 1 16  ? 28.983  81.781  40.819 1.00 46.89 ? 16   LYS A CD    1 
ATOM   27   C CE    . LYS A 1 16  ? 29.251  80.359  40.306 1.00 46.06 ? 16   LYS A CE    1 
ATOM   28   N NZ    . LYS A 1 16  ? 30.383  79.681  41.014 1.00 47.12 ? 16   LYS A NZ    1 
ATOM   29   N N     . HIS A 1 17  ? 27.384  85.381  42.382 1.00 41.00 ? 17   HIS A N     1 
ATOM   30   C CA    . HIS A 1 17  ? 26.065  85.198  42.956 1.00 39.78 ? 17   HIS A CA    1 
ATOM   31   C C     . HIS A 1 17  ? 25.438  86.557  43.208 1.00 39.28 ? 17   HIS A C     1 
ATOM   32   O O     . HIS A 1 17  ? 25.490  87.091  44.321 1.00 39.86 ? 17   HIS A O     1 
ATOM   33   C CB    . HIS A 1 17  ? 26.165  84.395  44.263 1.00 39.31 ? 17   HIS A CB    1 
ATOM   34   C CG    . HIS A 1 17  ? 26.756  83.030  44.086 1.00 38.45 ? 17   HIS A CG    1 
ATOM   35   N ND1   . HIS A 1 17  ? 25.988  81.912  43.850 1.00 38.86 ? 17   HIS A ND1   1 
ATOM   36   C CD2   . HIS A 1 17  ? 28.044  82.613  44.047 1.00 38.42 ? 17   HIS A CD2   1 
ATOM   37   C CE1   . HIS A 1 17  ? 26.772  80.867  43.665 1.00 37.98 ? 17   HIS A CE1   1 
ATOM   38   N NE2   . HIS A 1 17  ? 28.025  81.266  43.779 1.00 38.18 ? 17   HIS A NE2   1 
ATOM   39   N N     . PRO A 1 18  ? 24.828  87.136  42.166 1.00 38.75 ? 18   PRO A N     1 
ATOM   40   C CA    . PRO A 1 18  ? 24.158  88.443  42.169 1.00 38.68 ? 18   PRO A CA    1 
ATOM   41   C C     . PRO A 1 18  ? 23.098  88.628  43.250 1.00 38.62 ? 18   PRO A C     1 
ATOM   42   O O     . PRO A 1 18  ? 22.845  89.745  43.686 1.00 40.11 ? 18   PRO A O     1 
ATOM   43   C CB    . PRO A 1 18  ? 23.557  88.513  40.772 1.00 39.22 ? 18   PRO A CB    1 
ATOM   44   C CG    . PRO A 1 18  ? 24.571  87.767  39.958 1.00 39.72 ? 18   PRO A CG    1 
ATOM   45   C CD    . PRO A 1 18  ? 24.828  86.554  40.816 1.00 38.60 ? 18   PRO A CD    1 
ATOM   46   N N     . SER A 1 19  ? 22.455  87.539  43.655 1.00 38.74 ? 19   SER A N     1 
ATOM   47   C CA    . SER A 1 19  ? 21.437  87.583  44.699 1.00 38.10 ? 19   SER A CA    1 
ATOM   48   C C     . SER A 1 19  ? 22.107  87.731  46.062 1.00 38.41 ? 19   SER A C     1 
ATOM   49   O O     . SER A 1 19  ? 21.458  88.054  47.063 1.00 38.44 ? 19   SER A O     1 
ATOM   50   C CB    . SER A 1 19  ? 20.623  86.287  44.681 1.00 38.32 ? 19   SER A CB    1 
ATOM   51   O OG    . SER A 1 19  ? 21.473  85.157  44.806 1.00 36.92 ? 19   SER A OG    1 
ATOM   52   N N     . GLY A 1 20  ? 23.408  87.460  46.096 1.00 37.69 ? 20   GLY A N     1 
ATOM   53   C CA    . GLY A 1 20  ? 24.148  87.553  47.337 1.00 36.18 ? 20   GLY A CA    1 
ATOM   54   C C     . GLY A 1 20  ? 23.915  86.333  48.194 1.00 34.99 ? 20   GLY A C     1 
ATOM   55   O O     . GLY A 1 20  ? 24.215  86.349  49.386 1.00 35.87 ? 20   GLY A O     1 
ATOM   56   N N     . ILE A 1 21  ? 23.366  85.281  47.591 1.00 33.99 ? 21   ILE A N     1 
ATOM   57   C CA    . ILE A 1 21  ? 23.092  84.034  48.298 1.00 32.04 ? 21   ILE A CA    1 
ATOM   58   C C     . ILE A 1 21  ? 23.696  82.885  47.518 1.00 30.78 ? 21   ILE A C     1 
ATOM   59   O O     . ILE A 1 21  ? 23.658  82.868  46.286 1.00 30.93 ? 21   ILE A O     1 
ATOM   60   C CB    . ILE A 1 21  ? 21.571  83.751  48.453 1.00 32.47 ? 21   ILE A CB    1 
ATOM   61   C CG1   . ILE A 1 21  ? 20.867  84.929  49.131 1.00 32.41 ? 21   ILE A CG1   1 
ATOM   62   C CG2   . ILE A 1 21  ? 21.349  82.472  49.269 1.00 30.95 ? 21   ILE A CG2   1 
ATOM   63   C CD1   . ILE A 1 21  ? 19.385  84.738  49.290 1.00 32.33 ? 21   ILE A CD1   1 
ATOM   64   N N     . VAL A 1 22  ? 24.293  81.948  48.240 1.00 30.30 ? 22   VAL A N     1 
ATOM   65   C CA    . VAL A 1 22  ? 24.888  80.769  47.627 1.00 29.44 ? 22   VAL A CA    1 
ATOM   66   C C     . VAL A 1 22  ? 24.201  79.532  48.205 1.00 28.25 ? 22   VAL A C     1 
ATOM   67   O O     . VAL A 1 22  ? 24.241  79.303  49.421 1.00 27.58 ? 22   VAL A O     1 
ATOM   68   C CB    . VAL A 1 22  ? 26.410  80.665  47.927 1.00 30.64 ? 22   VAL A CB    1 
ATOM   69   C CG1   . VAL A 1 22  ? 27.017  79.468  47.181 1.00 28.38 ? 22   VAL A CG1   1 
ATOM   70   C CG2   . VAL A 1 22  ? 27.128  81.970  47.556 1.00 31.09 ? 22   VAL A CG2   1 
ATOM   71   N N     . PRO A 1 23  ? 23.505  78.757  47.355 1.00 26.82 ? 23   PRO A N     1 
ATOM   72   C CA    . PRO A 1 23  ? 22.820  77.543  47.808 1.00 26.40 ? 23   PRO A CA    1 
ATOM   73   C C     . PRO A 1 23  ? 23.843  76.613  48.466 1.00 27.43 ? 23   PRO A C     1 
ATOM   74   O O     . PRO A 1 23  ? 24.979  76.484  47.980 1.00 28.85 ? 23   PRO A O     1 
ATOM   75   C CB    . PRO A 1 23  ? 22.330  76.925  46.503 1.00 24.33 ? 23   PRO A CB    1 
ATOM   76   C CG    . PRO A 1 23  ? 22.137  78.086  45.619 1.00 25.28 ? 23   PRO A CG    1 
ATOM   77   C CD    . PRO A 1 23  ? 23.320  78.957  45.907 1.00 26.41 ? 23   PRO A CD    1 
ATOM   78   N N     . THR A 1 24  ? 23.459  75.989  49.574 1.00 26.83 ? 24   THR A N     1 
ATOM   79   C CA    . THR A 1 24  ? 24.340  75.062  50.273 1.00 26.11 ? 24   THR A CA    1 
ATOM   80   C C     . THR A 1 24  ? 24.184  73.669  49.684 1.00 24.76 ? 24   THR A C     1 
ATOM   81   O O     . THR A 1 24  ? 23.075  73.231  49.406 1.00 25.71 ? 24   THR A O     1 
ATOM   82   C CB    . THR A 1 24  ? 23.985  75.011  51.756 1.00 28.29 ? 24   THR A CB    1 
ATOM   83   O OG1   . THR A 1 24  ? 24.293  76.280  52.341 1.00 33.15 ? 24   THR A OG1   1 
ATOM   84   C CG2   . THR A 1 24  ? 24.756  73.915  52.475 1.00 26.16 ? 24   THR A CG2   1 
ATOM   85   N N     . LEU A 1 25  ? 25.293  72.999  49.418 1.00 23.24 ? 25   LEU A N     1 
ATOM   86   C CA    . LEU A 1 25  ? 25.211  71.661  48.874 1.00 21.71 ? 25   LEU A CA    1 
ATOM   87   C C     . LEU A 1 25  ? 24.933  70.792  50.082 1.00 21.23 ? 25   LEU A C     1 
ATOM   88   O O     . LEU A 1 25  ? 25.586  70.941  51.117 1.00 21.78 ? 25   LEU A O     1 
ATOM   89   C CB    . LEU A 1 25  ? 26.510  71.271  48.160 1.00 21.91 ? 25   LEU A CB    1 
ATOM   90   C CG    . LEU A 1 25  ? 26.930  72.203  47.005 1.00 21.93 ? 25   LEU A CG    1 
ATOM   91   C CD1   . LEU A 1 25  ? 27.978  71.500  46.151 1.00 19.21 ? 25   LEU A CD1   1 
ATOM   92   C CD2   . LEU A 1 25  ? 25.708  72.622  46.133 1.00 21.49 ? 25   LEU A CD2   1 
ATOM   93   N N     . GLN A 1 26  ? 23.904  69.955  49.974 1.00 20.70 ? 26   GLN A N     1 
ATOM   94   C CA    . GLN A 1 26  ? 23.469  69.085  51.064 1.00 19.40 ? 26   GLN A CA    1 
ATOM   95   C C     . GLN A 1 26  ? 23.705  67.585  50.879 1.00 18.34 ? 26   GLN A C     1 
ATOM   96   O O     . GLN A 1 26  ? 23.933  66.858  51.853 1.00 16.79 ? 26   GLN A O     1 
ATOM   97   C CB    . GLN A 1 26  ? 21.974  69.313  51.328 1.00 19.72 ? 26   GLN A CB    1 
ATOM   98   C CG    . GLN A 1 26  ? 21.569  70.755  51.643 1.00 16.97 ? 26   GLN A CG    1 
ATOM   99   C CD    . GLN A 1 26  ? 22.047  71.242  53.001 1.00 18.34 ? 26   GLN A CD    1 
ATOM   100  O OE1   . GLN A 1 26  ? 22.659  70.507  53.775 1.00 19.45 ? 26   GLN A OE1   1 
ATOM   101  N NE2   . GLN A 1 26  ? 21.748  72.485  53.303 1.00 17.84 ? 26   GLN A NE2   1 
ATOM   102  N N     . ASN A 1 27  ? 23.639  67.123  49.640 1.00 17.20 ? 27   ASN A N     1 
ATOM   103  C CA    . ASN A 1 27  ? 23.790  65.706  49.351 1.00 18.02 ? 27   ASN A CA    1 
ATOM   104  C C     . ASN A 1 27  ? 24.275  65.550  47.928 1.00 19.45 ? 27   ASN A C     1 
ATOM   105  O O     . ASN A 1 27  ? 23.859  66.303  47.045 1.00 19.67 ? 27   ASN A O     1 
ATOM   106  C CB    . ASN A 1 27  ? 22.424  65.019  49.500 1.00 17.13 ? 27   ASN A CB    1 
ATOM   107  C CG    . ASN A 1 27  ? 22.478  63.532  49.259 1.00 15.68 ? 27   ASN A CG    1 
ATOM   108  O OD1   . ASN A 1 27  ? 23.432  62.865  49.632 1.00 15.50 ? 27   ASN A OD1   1 
ATOM   109  N ND2   . ASN A 1 27  ? 21.433  62.999  48.653 1.00 17.32 ? 27   ASN A ND2   1 
ATOM   110  N N     . ILE A 1 28  ? 25.200  64.621  47.721 1.00 19.46 ? 28   ILE A N     1 
ATOM   111  C CA    . ILE A 1 28  ? 25.731  64.354  46.394 1.00 18.87 ? 28   ILE A CA    1 
ATOM   112  C C     . ILE A 1 28  ? 25.638  62.848  46.166 1.00 19.70 ? 28   ILE A C     1 
ATOM   113  O O     . ILE A 1 28  ? 25.918  62.068  47.073 1.00 19.90 ? 28   ILE A O     1 
ATOM   114  C CB    . ILE A 1 28  ? 27.229  64.828  46.231 1.00 19.27 ? 28   ILE A CB    1 
ATOM   115  C CG1   . ILE A 1 28  ? 27.308  66.283  45.748 1.00 16.72 ? 28   ILE A CG1   1 
ATOM   116  C CG2   . ILE A 1 28  ? 27.940  63.977  45.175 1.00 17.85 ? 28   ILE A CG2   1 
ATOM   117  C CD1   . ILE A 1 28  ? 26.883  67.297  46.741 1.00 19.89 ? 28   ILE A CD1   1 
ATOM   118  N N     . VAL A 1 29  ? 25.183  62.455  44.978 1.00 19.40 ? 29   VAL A N     1 
ATOM   119  C CA    . VAL A 1 29  ? 25.059  61.056  44.599 1.00 18.70 ? 29   VAL A CA    1 
ATOM   120  C C     . VAL A 1 29  ? 26.055  60.816  43.480 1.00 19.68 ? 29   VAL A C     1 
ATOM   121  O O     . VAL A 1 29  ? 26.087  61.574  42.513 1.00 19.19 ? 29   VAL A O     1 
ATOM   122  C CB    . VAL A 1 29  ? 23.648  60.749  44.068 1.00 17.93 ? 29   VAL A CB    1 
ATOM   123  C CG1   . VAL A 1 29  ? 23.537  59.294  43.585 1.00 17.48 ? 29   VAL A CG1   1 
ATOM   124  C CG2   . VAL A 1 29  ? 22.644  61.022  45.151 1.00 18.64 ? 29   VAL A CG2   1 
ATOM   125  N N     . SER A 1 30  ? 26.864  59.774  43.608 1.00 20.45 ? 30   SER A N     1 
ATOM   126  C CA    . SER A 1 30  ? 27.845  59.457  42.587 1.00 21.53 ? 30   SER A CA    1 
ATOM   127  C C     . SER A 1 30  ? 27.897  57.961  42.338 1.00 23.37 ? 30   SER A C     1 
ATOM   128  O O     . SER A 1 30  ? 27.370  57.165  43.115 1.00 24.32 ? 30   SER A O     1 
ATOM   129  C CB    . SER A 1 30  ? 29.232  59.981  42.968 1.00 21.84 ? 30   SER A CB    1 
ATOM   130  O OG    . SER A 1 30  ? 29.773  59.316  44.094 1.00 22.01 ? 30   SER A OG    1 
ATOM   131  N N     . THR A 1 31  ? 28.477  57.587  41.210 1.00 24.03 ? 31   THR A N     1 
ATOM   132  C CA    . THR A 1 31  ? 28.607  56.200  40.851 1.00 23.27 ? 31   THR A CA    1 
ATOM   133  C C     . THR A 1 31  ? 30.024  56.008  40.361 1.00 23.96 ? 31   THR A C     1 
ATOM   134  O O     . THR A 1 31  ? 30.677  56.963  39.930 1.00 23.21 ? 31   THR A O     1 
ATOM   135  C CB    . THR A 1 31  ? 27.637  55.812  39.708 1.00 24.82 ? 31   THR A CB    1 
ATOM   136  O OG1   . THR A 1 31  ? 27.800  56.720  38.611 1.00 28.48 ? 31   THR A OG1   1 
ATOM   137  C CG2   . THR A 1 31  ? 26.199  55.834  40.174 1.00 21.36 ? 31   THR A CG2   1 
ATOM   138  N N     . VAL A 1 32  ? 30.519  54.785  40.497 1.00 24.34 ? 32   VAL A N     1 
ATOM   139  C CA    . VAL A 1 32  ? 31.842  54.432  40.035 1.00 23.34 ? 32   VAL A CA    1 
ATOM   140  C C     . VAL A 1 32  ? 31.756  52.951  39.716 1.00 25.74 ? 32   VAL A C     1 
ATOM   141  O O     . VAL A 1 32  ? 30.859  52.254  40.210 1.00 26.14 ? 32   VAL A O     1 
ATOM   142  C CB    . VAL A 1 32  ? 32.939  54.741  41.076 1.00 23.45 ? 32   VAL A CB    1 
ATOM   143  C CG1   . VAL A 1 32  ? 32.759  53.917  42.326 1.00 22.40 ? 32   VAL A CG1   1 
ATOM   144  C CG2   . VAL A 1 32  ? 34.300  54.504  40.471 1.00 23.00 ? 32   VAL A CG2   1 
ATOM   145  N N     . ASN A 1 33  ? 32.610  52.506  38.797 1.00 27.65 ? 33   ASN A N     1 
ATOM   146  C CA    . ASN A 1 33  ? 32.652  51.117  38.350 1.00 28.55 ? 33   ASN A CA    1 
ATOM   147  C C     . ASN A 1 33  ? 33.915  50.526  38.930 1.00 29.16 ? 33   ASN A C     1 
ATOM   148  O O     . ASN A 1 33  ? 35.007  50.969  38.601 1.00 29.69 ? 33   ASN A O     1 
ATOM   149  C CB    . ASN A 1 33  ? 32.705  51.076  36.811 1.00 29.83 ? 33   ASN A CB    1 
ATOM   150  C CG    . ASN A 1 33  ? 32.609  49.667  36.243 1.00 31.02 ? 33   ASN A CG    1 
ATOM   151  O OD1   . ASN A 1 33  ? 32.368  48.707  36.966 1.00 34.33 ? 33   ASN A OD1   1 
ATOM   152  N ND2   . ASN A 1 33  ? 32.782  49.545  34.931 1.00 31.76 ? 33   ASN A ND2   1 
ATOM   153  N N     . LEU A 1 34  ? 33.766  49.590  39.857 1.00 30.21 ? 34   LEU A N     1 
ATOM   154  C CA    . LEU A 1 34  ? 34.925  48.954  40.472 1.00 32.02 ? 34   LEU A CA    1 
ATOM   155  C C     . LEU A 1 34  ? 35.631  48.059  39.453 1.00 32.97 ? 34   LEU A C     1 
ATOM   156  O O     . LEU A 1 34  ? 36.787  47.682  39.624 1.00 32.18 ? 34   LEU A O     1 
ATOM   157  C CB    . LEU A 1 34  ? 34.520  48.184  41.734 1.00 31.02 ? 34   LEU A CB    1 
ATOM   158  C CG    . LEU A 1 34  ? 33.947  49.053  42.859 1.00 30.53 ? 34   LEU A CG    1 
ATOM   159  C CD1   . LEU A 1 34  ? 33.810  48.221  44.118 1.00 29.99 ? 34   LEU A CD1   1 
ATOM   160  C CD2   . LEU A 1 34  ? 34.844  50.270  43.122 1.00 30.81 ? 34   LEU A CD2   1 
ATOM   161  N N     . ASP A 1 35  ? 34.906  47.713  38.398 1.00 35.28 ? 35   ASP A N     1 
ATOM   162  C CA    . ASP A 1 35  ? 35.444  46.927  37.306 1.00 37.74 ? 35   ASP A CA    1 
ATOM   163  C C     . ASP A 1 35  ? 35.795  45.489  37.649 1.00 38.47 ? 35   ASP A C     1 
ATOM   164  O O     . ASP A 1 35  ? 36.714  44.917  37.065 1.00 39.55 ? 35   ASP A O     1 
ATOM   165  C CB    . ASP A 1 35  ? 36.665  47.652  36.714 1.00 40.11 ? 35   ASP A CB    1 
ATOM   166  C CG    . ASP A 1 35  ? 36.850  47.400  35.220 1.00 42.05 ? 35   ASP A CG    1 
ATOM   167  O OD1   . ASP A 1 35  ? 36.080  46.606  34.622 1.00 42.71 ? 35   ASP A OD1   1 
ATOM   168  O OD2   . ASP A 1 35  ? 37.776  48.018  34.644 1.00 42.96 ? 35   ASP A OD2   1 
ATOM   169  N N     . CYS A 1 36  ? 35.074  44.901  38.595 1.00 38.98 ? 36   CYS A N     1 
ATOM   170  C CA    . CYS A 1 36  ? 35.302  43.508  38.965 1.00 38.95 ? 36   CYS A CA    1 
ATOM   171  C C     . CYS A 1 36  ? 34.062  42.977  39.644 1.00 38.83 ? 36   CYS A C     1 
ATOM   172  O O     . CYS A 1 36  ? 33.408  43.697  40.396 1.00 39.65 ? 36   CYS A O     1 
ATOM   173  C CB    . CYS A 1 36  ? 36.533  43.334  39.868 1.00 38.91 ? 36   CYS A CB    1 
ATOM   174  S SG    . CYS A 1 36  ? 36.443  44.020  41.547 1.00 44.05 ? 36   CYS A SG    1 
ATOM   175  N N     . LYS A 1 37  ? 33.688  41.748  39.307 1.00 38.84 ? 37   LYS A N     1 
ATOM   176  C CA    . LYS A 1 37  ? 32.516  41.131  39.906 1.00 38.07 ? 37   LYS A CA    1 
ATOM   177  C C     . LYS A 1 37  ? 32.851  40.889  41.363 1.00 36.30 ? 37   LYS A C     1 
ATOM   178  O O     . LYS A 1 37  ? 33.960  40.469  41.691 1.00 35.36 ? 37   LYS A O     1 
ATOM   179  C CB    . LYS A 1 37  ? 32.162  39.837  39.183 1.00 39.97 ? 37   LYS A CB    1 
ATOM   180  C CG    . LYS A 1 37  ? 31.640  40.058  37.770 1.00 43.54 ? 37   LYS A CG    1 
ATOM   181  C CD    . LYS A 1 37  ? 30.343  40.850  37.784 1.00 46.29 ? 37   LYS A CD    1 
ATOM   182  C CE    . LYS A 1 37  ? 29.621  40.771  36.445 1.00 48.53 ? 37   LYS A CE    1 
ATOM   183  N NZ    . LYS A 1 37  ? 28.185  41.196  36.550 1.00 48.69 ? 37   LYS A NZ    1 
ATOM   184  N N     . LEU A 1 38  ? 31.911  41.217  42.237 1.00 35.07 ? 38   LEU A N     1 
ATOM   185  C CA    . LEU A 1 38  ? 32.121  41.084  43.669 1.00 33.50 ? 38   LEU A CA    1 
ATOM   186  C C     . LEU A 1 38  ? 31.195  40.037  44.245 1.00 33.51 ? 38   LEU A C     1 
ATOM   187  O O     . LEU A 1 38  ? 30.045  39.945  43.843 1.00 35.05 ? 38   LEU A O     1 
ATOM   188  C CB    . LEU A 1 38  ? 31.860  42.434  44.337 1.00 30.75 ? 38   LEU A CB    1 
ATOM   189  C CG    . LEU A 1 38  ? 32.593  43.637  43.735 1.00 28.60 ? 38   LEU A CG    1 
ATOM   190  C CD1   . LEU A 1 38  ? 31.963  44.935  44.209 1.00 28.72 ? 38   LEU A CD1   1 
ATOM   191  C CD2   . LEU A 1 38  ? 34.059  43.592  44.105 1.00 27.69 ? 38   LEU A CD2   1 
ATOM   192  N N     . ASP A 1 39  ? 31.715  39.201  45.135 1.00 33.65 ? 39   ASP A N     1 
ATOM   193  C CA    . ASP A 1 39  ? 30.903  38.176  45.781 1.00 32.31 ? 39   ASP A CA    1 
ATOM   194  C C     . ASP A 1 39  ? 30.317  38.940  46.954 1.00 30.75 ? 39   ASP A C     1 
ATOM   195  O O     . ASP A 1 39  ? 31.025  39.257  47.910 1.00 29.78 ? 39   ASP A O     1 
ATOM   196  C CB    . ASP A 1 39  ? 31.795  37.039  46.280 1.00 34.86 ? 39   ASP A CB    1 
ATOM   197  C CG    . ASP A 1 39  ? 31.005  35.874  46.851 1.00 37.70 ? 39   ASP A CG    1 
ATOM   198  O OD1   . ASP A 1 39  ? 30.142  36.078  47.736 1.00 37.33 ? 39   ASP A OD1   1 
ATOM   199  O OD2   . ASP A 1 39  ? 31.269  34.734  46.420 1.00 41.27 ? 39   ASP A OD2   1 
ATOM   200  N N     . LEU A 1 40  ? 29.031  39.247  46.879 1.00 30.09 ? 40   LEU A N     1 
ATOM   201  C CA    . LEU A 1 40  ? 28.394  40.030  47.927 1.00 30.55 ? 40   LEU A CA    1 
ATOM   202  C C     . LEU A 1 40  ? 28.228  39.366  49.286 1.00 31.84 ? 40   LEU A C     1 
ATOM   203  O O     . LEU A 1 40  ? 28.338  40.033  50.327 1.00 31.03 ? 40   LEU A O     1 
ATOM   204  C CB    . LEU A 1 40  ? 27.070  40.633  47.436 1.00 27.50 ? 40   LEU A CB    1 
ATOM   205  C CG    . LEU A 1 40  ? 27.167  41.619  46.260 1.00 24.55 ? 40   LEU A CG    1 
ATOM   206  C CD1   . LEU A 1 40  ? 25.832  42.295  46.089 1.00 19.99 ? 40   LEU A CD1   1 
ATOM   207  C CD2   . LEU A 1 40  ? 28.264  42.660  46.489 1.00 21.25 ? 40   LEU A CD2   1 
ATOM   208  N N     . LYS A 1 41  ? 27.984  38.060  49.301 1.00 33.77 ? 41   LYS A N     1 
ATOM   209  C CA    . LYS A 1 41  ? 27.823  37.382  50.583 1.00 34.86 ? 41   LYS A CA    1 
ATOM   210  C C     . LYS A 1 41  ? 29.182  37.272  51.265 1.00 34.56 ? 41   LYS A C     1 
ATOM   211  O O     . LYS A 1 41  ? 29.287  37.410  52.484 1.00 34.91 ? 41   LYS A O     1 
ATOM   212  C CB    . LYS A 1 41  ? 27.141  36.021  50.422 1.00 35.99 ? 41   LYS A CB    1 
ATOM   213  C CG    . LYS A 1 41  ? 26.820  35.347  51.739 1.00 39.39 ? 41   LYS A CG    1 
ATOM   214  C CD    . LYS A 1 41  ? 26.285  36.336  52.809 1.00 42.40 ? 41   LYS A CD    1 
ATOM   215  C CE    . LYS A 1 41  ? 24.831  36.771  52.569 1.00 43.53 ? 41   LYS A CE    1 
ATOM   216  N NZ    . LYS A 1 41  ? 24.283  37.614  53.685 1.00 42.92 ? 41   LYS A NZ    1 
ATOM   217  N N     . ALA A 1 42  ? 30.233  37.117  50.467 1.00 33.45 ? 42   ALA A N     1 
ATOM   218  C CA    . ALA A 1 42  ? 31.579  37.037  51.014 1.00 33.36 ? 42   ALA A CA    1 
ATOM   219  C C     . ALA A 1 42  ? 31.899  38.374  51.653 1.00 33.66 ? 42   ALA A C     1 
ATOM   220  O O     . ALA A 1 42  ? 32.451  38.435  52.752 1.00 34.89 ? 42   ALA A O     1 
ATOM   221  C CB    . ALA A 1 42  ? 32.585  36.736  49.916 1.00 34.33 ? 42   ALA A CB    1 
ATOM   222  N N     . ILE A 1 43  ? 31.517  39.447  50.969 1.00 33.71 ? 43   ILE A N     1 
ATOM   223  C CA    . ILE A 1 43  ? 31.762  40.795  51.462 1.00 34.54 ? 43   ILE A CA    1 
ATOM   224  C C     . ILE A 1 43  ? 30.930  41.100  52.709 1.00 35.26 ? 43   ILE A C     1 
ATOM   225  O O     . ILE A 1 43  ? 31.420  41.719  53.652 1.00 35.47 ? 43   ILE A O     1 
ATOM   226  C CB    . ILE A 1 43  ? 31.498  41.847  50.359 1.00 32.82 ? 43   ILE A CB    1 
ATOM   227  C CG1   . ILE A 1 43  ? 32.515  41.670  49.239 1.00 32.71 ? 43   ILE A CG1   1 
ATOM   228  C CG2   . ILE A 1 43  ? 31.579  43.266  50.916 1.00 31.67 ? 43   ILE A CG2   1 
ATOM   229  C CD1   . ILE A 1 43  ? 32.312  42.621  48.079 1.00 33.10 ? 43   ILE A CD1   1 
ATOM   230  N N     . ALA A 1 44  ? 29.687  40.636  52.726 1.00 35.87 ? 44   ALA A N     1 
ATOM   231  C CA    . ALA A 1 44  ? 28.803  40.876  53.856 1.00 36.07 ? 44   ALA A CA    1 
ATOM   232  C C     . ALA A 1 44  ? 29.262  40.125  55.114 1.00 37.65 ? 44   ALA A C     1 
ATOM   233  O O     . ALA A 1 44  ? 28.951  40.528  56.242 1.00 36.94 ? 44   ALA A O     1 
ATOM   234  C CB    . ALA A 1 44  ? 27.386  40.484  53.486 1.00 35.12 ? 44   ALA A CB    1 
ATOM   235  N N     . LEU A 1 45  ? 29.988  39.028  54.912 1.00 38.74 ? 45   LEU A N     1 
ATOM   236  C CA    . LEU A 1 45  ? 30.491  38.216  56.013 1.00 40.18 ? 45   LEU A CA    1 
ATOM   237  C C     . LEU A 1 45  ? 31.786  38.785  56.568 1.00 39.96 ? 45   LEU A C     1 
ATOM   238  O O     . LEU A 1 45  ? 31.994  38.810  57.776 1.00 40.03 ? 45   LEU A O     1 
ATOM   239  C CB    . LEU A 1 45  ? 30.692  36.772  55.543 1.00 42.45 ? 45   LEU A CB    1 
ATOM   240  C CG    . LEU A 1 45  ? 29.421  36.121  54.961 1.00 44.10 ? 45   LEU A CG    1 
ATOM   241  C CD1   . LEU A 1 45  ? 29.755  34.808  54.266 1.00 45.40 ? 45   LEU A CD1   1 
ATOM   242  C CD2   . LEU A 1 45  ? 28.370  35.909  56.039 1.00 44.89 ? 45   LEU A CD2   1 
ATOM   243  N N     . GLN A 1 46  ? 32.651  39.249  55.675 1.00 41.13 ? 46   GLN A N     1 
ATOM   244  C CA    . GLN A 1 46  ? 33.932  39.832  56.060 1.00 41.65 ? 46   GLN A CA    1 
ATOM   245  C C     . GLN A 1 46  ? 33.831  41.294  56.494 1.00 42.43 ? 46   GLN A C     1 
ATOM   246  O O     . GLN A 1 46  ? 34.593  41.740  57.346 1.00 43.59 ? 46   GLN A O     1 
ATOM   247  C CB    . GLN A 1 46  ? 34.913  39.772  54.895 1.00 41.59 ? 46   GLN A CB    1 
ATOM   248  C CG    . GLN A 1 46  ? 35.273  38.397  54.394 1.00 42.85 ? 46   GLN A CG    1 
ATOM   249  C CD    . GLN A 1 46  ? 36.079  38.476  53.109 1.00 44.24 ? 46   GLN A CD    1 
ATOM   250  O OE1   . GLN A 1 46  ? 35.572  38.192  52.028 1.00 45.54 ? 46   GLN A OE1   1 
ATOM   251  N NE2   . GLN A 1 46  ? 37.332  38.899  53.220 1.00 45.90 ? 46   GLN A NE2   1 
ATOM   252  N N     . ALA A 1 47  ? 32.960  42.058  55.845 1.00 42.52 ? 47   ALA A N     1 
ATOM   253  C CA    . ALA A 1 47  ? 32.814  43.471  56.157 1.00 43.76 ? 47   ALA A CA    1 
ATOM   254  C C     . ALA A 1 47  ? 32.053  43.691  57.449 1.00 46.17 ? 47   ALA A C     1 
ATOM   255  O O     . ALA A 1 47  ? 31.063  43.002  57.723 1.00 46.42 ? 47   ALA A O     1 
ATOM   256  C CB    . ALA A 1 47  ? 32.140  44.195  55.021 1.00 42.29 ? 47   ALA A CB    1 
ATOM   257  N N     . ARG A 1 48  ? 32.515  44.665  58.235 1.00 47.70 ? 48   ARG A N     1 
ATOM   258  C CA    . ARG A 1 48  ? 31.887  44.988  59.520 1.00 48.58 ? 48   ARG A CA    1 
ATOM   259  C C     . ARG A 1 48  ? 30.747  45.994  59.373 1.00 48.33 ? 48   ARG A C     1 
ATOM   260  O O     . ARG A 1 48  ? 29.593  45.679  59.677 1.00 49.12 ? 48   ARG A O     1 
ATOM   261  C CB    . ARG A 1 48  ? 32.932  45.491  60.533 1.00 47.83 ? 48   ARG A CB    1 
ATOM   262  N N     . ASN A 1 49  ? 31.062  47.184  58.870 1.00 47.53 ? 49   ASN A N     1 
ATOM   263  C CA    . ASN A 1 49  ? 30.049  48.220  58.689 1.00 47.74 ? 49   ASN A CA    1 
ATOM   264  C C     . ASN A 1 49  ? 29.223  47.986  57.422 1.00 47.29 ? 49   ASN A C     1 
ATOM   265  O O     . ASN A 1 49  ? 29.000  48.923  56.644 1.00 46.82 ? 49   ASN A O     1 
ATOM   266  C CB    . ASN A 1 49  ? 30.710  49.594  58.640 1.00 48.73 ? 49   ASN A CB    1 
ATOM   267  N N     . ALA A 1 50  ? 28.717  46.761  57.261 1.00 45.79 ? 50   ALA A N     1 
ATOM   268  C CA    . ALA A 1 50  ? 27.943  46.389  56.082 1.00 44.50 ? 50   ALA A CA    1 
ATOM   269  C C     . ALA A 1 50  ? 26.683  45.591  56.403 1.00 43.49 ? 50   ALA A C     1 
ATOM   270  O O     . ALA A 1 50  ? 26.614  44.913  57.425 1.00 44.52 ? 50   ALA A O     1 
ATOM   271  C CB    . ALA A 1 50  ? 28.823  45.596  55.120 1.00 42.46 ? 50   ALA A CB    1 
ATOM   272  N N     . GLU A 1 51  ? 25.673  45.724  55.545 1.00 41.89 ? 51   GLU A N     1 
ATOM   273  C CA    . GLU A 1 51  ? 24.413  44.999  55.688 1.00 40.07 ? 51   GLU A CA    1 
ATOM   274  C C     . GLU A 1 51  ? 24.004  44.554  54.306 1.00 37.73 ? 51   GLU A C     1 
ATOM   275  O O     . GLU A 1 51  ? 24.173  45.282  53.345 1.00 36.48 ? 51   GLU A O     1 
ATOM   276  C CB    . GLU A 1 51  ? 23.318  45.845  56.361 1.00 42.28 ? 51   GLU A CB    1 
ATOM   277  C CG    . GLU A 1 51  ? 22.948  47.143  55.687 1.00 44.15 ? 51   GLU A CG    1 
ATOM   278  C CD    . GLU A 1 51  ? 22.675  48.267  56.688 1.00 46.28 ? 51   GLU A CD    1 
ATOM   279  O OE1   . GLU A 1 51  ? 23.431  48.394  57.678 1.00 46.76 ? 51   GLU A OE1   1 
ATOM   280  O OE2   . GLU A 1 51  ? 21.721  49.045  56.465 1.00 47.58 ? 51   GLU A OE2   1 
ATOM   281  N N     . TYR A 1 52  ? 23.531  43.324  54.202 1.00 37.02 ? 52   TYR A N     1 
ATOM   282  C CA    . TYR A 1 52  ? 23.153  42.768  52.919 1.00 36.52 ? 52   TYR A CA    1 
ATOM   283  C C     . TYR A 1 52  ? 21.954  41.841  53.019 1.00 37.90 ? 52   TYR A C     1 
ATOM   284  O O     . TYR A 1 52  ? 22.064  40.730  53.541 1.00 40.38 ? 52   TYR A O     1 
ATOM   285  C CB    . TYR A 1 52  ? 24.337  41.998  52.338 1.00 32.87 ? 52   TYR A CB    1 
ATOM   286  C CG    . TYR A 1 52  ? 24.025  41.254  51.064 1.00 32.28 ? 52   TYR A CG    1 
ATOM   287  C CD1   . TYR A 1 52  ? 23.370  41.883  50.004 1.00 31.85 ? 52   TYR A CD1   1 
ATOM   288  C CD2   . TYR A 1 52  ? 24.420  39.932  50.898 1.00 31.82 ? 52   TYR A CD2   1 
ATOM   289  C CE1   . TYR A 1 52  ? 23.125  41.219  48.812 1.00 30.98 ? 52   TYR A CE1   1 
ATOM   290  C CE2   . TYR A 1 52  ? 24.182  39.260  49.711 1.00 32.21 ? 52   TYR A CE2   1 
ATOM   291  C CZ    . TYR A 1 52  ? 23.538  39.911  48.671 1.00 31.90 ? 52   TYR A CZ    1 
ATOM   292  O OH    . TYR A 1 52  ? 23.345  39.258  47.477 1.00 33.92 ? 52   TYR A OH    1 
ATOM   293  N N     . ASN A 1 53  ? 20.816  42.292  52.508 1.00 38.01 ? 53   ASN A N     1 
ATOM   294  C CA    . ASN A 1 53  ? 19.608  41.487  52.511 1.00 37.35 ? 53   ASN A CA    1 
ATOM   295  C C     . ASN A 1 53  ? 19.138  41.451  51.070 1.00 36.93 ? 53   ASN A C     1 
ATOM   296  O O     . ASN A 1 53  ? 18.347  42.289  50.635 1.00 35.91 ? 53   ASN A O     1 
ATOM   297  C CB    . ASN A 1 53  ? 18.536  42.102  53.409 1.00 39.69 ? 53   ASN A CB    1 
ATOM   298  C CG    . ASN A 1 53  ? 17.247  41.287  53.423 1.00 42.00 ? 53   ASN A CG    1 
ATOM   299  O OD1   . ASN A 1 53  ? 17.209  40.124  52.983 1.00 41.22 ? 53   ASN A OD1   1 
ATOM   300  N ND2   . ASN A 1 53  ? 16.180  41.899  53.923 1.00 43.46 ? 53   ASN A ND2   1 
ATOM   301  N N     . PRO A 1 54  ? 19.624  40.467  50.305 1.00 36.82 ? 54   PRO A N     1 
ATOM   302  C CA    . PRO A 1 54  ? 19.257  40.328  48.901 1.00 37.67 ? 54   PRO A CA    1 
ATOM   303  C C     . PRO A 1 54  ? 17.759  40.323  48.613 1.00 38.96 ? 54   PRO A C     1 
ATOM   304  O O     . PRO A 1 54  ? 17.331  40.888  47.609 1.00 40.28 ? 54   PRO A O     1 
ATOM   305  C CB    . PRO A 1 54  ? 19.957  39.029  48.486 1.00 37.51 ? 54   PRO A CB    1 
ATOM   306  C CG    . PRO A 1 54  ? 20.158  38.291  49.765 1.00 37.38 ? 54   PRO A CG    1 
ATOM   307  C CD    . PRO A 1 54  ? 20.520  39.375  50.724 1.00 37.60 ? 54   PRO A CD    1 
ATOM   308  N N     . LYS A 1 55  ? 16.961  39.742  49.507 1.00 39.51 ? 55   LYS A N     1 
ATOM   309  C CA    . LYS A 1 55  ? 15.514  39.685  49.307 1.00 39.22 ? 55   LYS A CA    1 
ATOM   310  C C     . LYS A 1 55  ? 14.883  41.059  49.373 1.00 38.78 ? 55   LYS A C     1 
ATOM   311  O O     . LYS A 1 55  ? 13.754  41.255  48.932 1.00 40.78 ? 55   LYS A O     1 
ATOM   312  C CB    . LYS A 1 55  ? 14.849  38.752  50.328 1.00 40.78 ? 55   LYS A CB    1 
ATOM   313  C CG    . LYS A 1 55  ? 14.879  39.197  51.808 1.00 43.60 ? 55   LYS A CG    1 
ATOM   314  C CD    . LYS A 1 55  ? 13.767  40.202  52.165 1.00 46.25 ? 55   LYS A CD    1 
ATOM   315  C CE    . LYS A 1 55  ? 13.171  39.973  53.566 1.00 46.55 ? 55   LYS A CE    1 
ATOM   316  N NZ    . LYS A 1 55  ? 14.092  40.273  54.709 1.00 47.55 ? 55   LYS A NZ    1 
ATOM   317  N N     . ARG A 1 56  ? 15.602  41.996  49.968 1.00 37.98 ? 56   ARG A N     1 
ATOM   318  C CA    . ARG A 1 56  ? 15.129  43.361  50.122 1.00 37.42 ? 56   ARG A CA    1 
ATOM   319  C C     . ARG A 1 56  ? 15.707  44.242  49.000 1.00 35.55 ? 56   ARG A C     1 
ATOM   320  O O     . ARG A 1 56  ? 14.973  44.951  48.298 1.00 34.99 ? 56   ARG A O     1 
ATOM   321  C CB    . ARG A 1 56  ? 15.532  43.866  51.525 1.00 39.68 ? 56   ARG A CB    1 
ATOM   322  C CG    . ARG A 1 56  ? 15.252  45.343  51.839 1.00 43.12 ? 56   ARG A CG    1 
ATOM   323  C CD    . ARG A 1 56  ? 15.763  45.720  53.246 1.00 44.40 ? 56   ARG A CD    1 
ATOM   324  N NE    . ARG A 1 56  ? 15.896  47.165  53.483 1.00 44.70 ? 56   ARG A NE    1 
ATOM   325  C CZ    . ARG A 1 56  ? 14.872  48.008  53.615 1.00 45.70 ? 56   ARG A CZ    1 
ATOM   326  N NH1   . ARG A 1 56  ? 13.625  47.572  53.524 1.00 45.54 ? 56   ARG A NH1   1 
ATOM   327  N NH2   . ARG A 1 56  ? 15.091  49.286  53.888 1.00 46.12 ? 56   ARG A NH2   1 
ATOM   328  N N     . PHE A 1 57  ? 17.017  44.146  48.796 1.00 33.49 ? 57   PHE A N     1 
ATOM   329  C CA    . PHE A 1 57  ? 17.686  44.943  47.777 1.00 32.01 ? 57   PHE A CA    1 
ATOM   330  C C     . PHE A 1 57  ? 18.963  44.202  47.385 1.00 30.92 ? 57   PHE A C     1 
ATOM   331  O O     . PHE A 1 57  ? 19.658  43.654  48.236 1.00 30.57 ? 57   PHE A O     1 
ATOM   332  C CB    . PHE A 1 57  ? 17.980  46.358  48.326 1.00 30.81 ? 57   PHE A CB    1 
ATOM   333  C CG    . PHE A 1 57  ? 18.409  47.354  47.277 1.00 28.68 ? 57   PHE A CG    1 
ATOM   334  C CD1   . PHE A 1 57  ? 17.601  47.625  46.183 1.00 27.50 ? 57   PHE A CD1   1 
ATOM   335  C CD2   . PHE A 1 57  ? 19.657  47.970  47.355 1.00 28.95 ? 57   PHE A CD2   1 
ATOM   336  C CE1   . PHE A 1 57  ? 18.028  48.483  45.170 1.00 27.93 ? 57   PHE A CE1   1 
ATOM   337  C CE2   . PHE A 1 57  ? 20.094  48.830  46.347 1.00 28.62 ? 57   PHE A CE2   1 
ATOM   338  C CZ    . PHE A 1 57  ? 19.276  49.084  45.250 1.00 28.26 ? 57   PHE A CZ    1 
ATOM   339  N N     . ALA A 1 58  ? 19.251  44.167  46.090 1.00 30.29 ? 58   ALA A N     1 
ATOM   340  C CA    . ALA A 1 58  ? 20.415  43.465  45.575 1.00 30.18 ? 58   ALA A CA    1 
ATOM   341  C C     . ALA A 1 58  ? 21.721  44.237  45.717 1.00 30.57 ? 58   ALA A C     1 
ATOM   342  O O     . ALA A 1 58  ? 22.426  44.459  44.734 1.00 33.60 ? 58   ALA A O     1 
ATOM   343  C CB    . ALA A 1 58  ? 20.183  43.106  44.128 1.00 29.60 ? 58   ALA A CB    1 
ATOM   344  N N     . ALA A 1 59  ? 22.075  44.616  46.934 1.00 29.47 ? 59   ALA A N     1 
ATOM   345  C CA    . ALA A 1 59  ? 23.307  45.358  47.141 1.00 27.80 ? 59   ALA A CA    1 
ATOM   346  C C     . ALA A 1 59  ? 23.733  45.320  48.592 1.00 28.06 ? 59   ALA A C     1 
ATOM   347  O O     . ALA A 1 59  ? 22.897  45.155  49.494 1.00 27.49 ? 59   ALA A O     1 
ATOM   348  C CB    . ALA A 1 59  ? 23.122  46.798  46.716 1.00 25.92 ? 59   ALA A CB    1 
ATOM   349  N N     . VAL A 1 60  ? 25.041  45.406  48.810 1.00 26.87 ? 60   VAL A N     1 
ATOM   350  C CA    . VAL A 1 60  ? 25.570  45.460  50.159 1.00 27.40 ? 60   VAL A CA    1 
ATOM   351  C C     . VAL A 1 60  ? 25.548  46.949  50.471 1.00 26.77 ? 60   VAL A C     1 
ATOM   352  O O     . VAL A 1 60  ? 25.851  47.770  49.602 1.00 27.88 ? 60   VAL A O     1 
ATOM   353  C CB    . VAL A 1 60  ? 27.014  44.925  50.233 1.00 28.14 ? 60   VAL A CB    1 
ATOM   354  C CG1   . VAL A 1 60  ? 27.683  45.353  51.552 1.00 25.99 ? 60   VAL A CG1   1 
ATOM   355  C CG2   . VAL A 1 60  ? 27.002  43.403  50.103 1.00 28.86 ? 60   VAL A CG2   1 
ATOM   356  N N     . ILE A 1 61  ? 25.099  47.296  51.669 1.00 26.34 ? 61   ILE A N     1 
ATOM   357  C CA    . ILE A 1 61  ? 25.024  48.682  52.095 1.00 26.10 ? 61   ILE A CA    1 
ATOM   358  C C     . ILE A 1 61  ? 26.127  48.911  53.100 1.00 25.59 ? 61   ILE A C     1 
ATOM   359  O O     . ILE A 1 61  ? 26.139  48.315  54.175 1.00 24.60 ? 61   ILE A O     1 
ATOM   360  C CB    . ILE A 1 61  ? 23.662  48.994  52.710 1.00 25.73 ? 61   ILE A CB    1 
ATOM   361  C CG1   . ILE A 1 61  ? 22.581  48.816  51.648 1.00 26.96 ? 61   ILE A CG1   1 
ATOM   362  C CG2   . ILE A 1 61  ? 23.639  50.405  53.247 1.00 26.67 ? 61   ILE A CG2   1 
ATOM   363  C CD1   . ILE A 1 61  ? 21.179  48.783  52.188 1.00 29.39 ? 61   ILE A CD1   1 
ATOM   364  N N     . MET A 1 62  ? 27.061  49.772  52.726 1.00 25.96 ? 62   MET A N     1 
ATOM   365  C CA    . MET A 1 62  ? 28.209  50.081  53.552 1.00 27.18 ? 62   MET A CA    1 
ATOM   366  C C     . MET A 1 62  ? 28.207  51.563  53.907 1.00 27.23 ? 62   MET A C     1 
ATOM   367  O O     . MET A 1 62  ? 27.611  52.366  53.203 1.00 28.32 ? 62   MET A O     1 
ATOM   368  C CB    . MET A 1 62  ? 29.471  49.727  52.769 1.00 28.95 ? 62   MET A CB    1 
ATOM   369  C CG    . MET A 1 62  ? 30.633  49.258  53.616 1.00 30.51 ? 62   MET A CG    1 
ATOM   370  S SD    . MET A 1 62  ? 31.939  48.567  52.581 1.00 34.87 ? 62   MET A SD    1 
ATOM   371  C CE    . MET A 1 62  ? 31.635  46.761  52.726 1.00 30.51 ? 62   MET A CE    1 
ATOM   372  N N     . ARG A 1 63  ? 28.883  51.934  54.989 1.00 27.13 ? 63   ARG A N     1 
ATOM   373  C CA    . ARG A 1 63  ? 28.937  53.333  55.408 1.00 26.26 ? 63   ARG A CA    1 
ATOM   374  C C     . ARG A 1 63  ? 30.279  53.647  56.057 1.00 26.39 ? 63   ARG A C     1 
ATOM   375  O O     . ARG A 1 63  ? 30.928  52.753  56.592 1.00 26.99 ? 63   ARG A O     1 
ATOM   376  C CB    . ARG A 1 63  ? 27.821  53.631  56.419 1.00 24.53 ? 63   ARG A CB    1 
ATOM   377  C CG    . ARG A 1 63  ? 26.415  53.369  55.924 1.00 22.54 ? 63   ARG A CG    1 
ATOM   378  C CD    . ARG A 1 63  ? 25.397  53.722  56.990 1.00 23.45 ? 63   ARG A CD    1 
ATOM   379  N NE    . ARG A 1 63  ? 24.034  53.826  56.456 1.00 25.27 ? 63   ARG A NE    1 
ATOM   380  C CZ    . ARG A 1 63  ? 23.214  52.796  56.249 1.00 23.93 ? 63   ARG A CZ    1 
ATOM   381  N NH1   . ARG A 1 63  ? 23.596  51.558  56.524 1.00 24.52 ? 63   ARG A NH1   1 
ATOM   382  N NH2   . ARG A 1 63  ? 22.006  53.007  55.751 1.00 24.19 ? 63   ARG A NH2   1 
ATOM   383  N N     . ILE A 1 64  ? 30.722  54.898  55.945 1.00 26.63 ? 64   ILE A N     1 
ATOM   384  C CA    . ILE A 1 64  ? 31.964  55.352  56.575 1.00 25.33 ? 64   ILE A CA    1 
ATOM   385  C C     . ILE A 1 64  ? 31.666  56.680  57.252 1.00 26.40 ? 64   ILE A C     1 
ATOM   386  O O     . ILE A 1 64  ? 30.776  57.414  56.824 1.00 27.00 ? 64   ILE A O     1 
ATOM   387  C CB    . ILE A 1 64  ? 33.140  55.519  55.590 1.00 25.03 ? 64   ILE A CB    1 
ATOM   388  C CG1   . ILE A 1 64  ? 32.844  56.600  54.553 1.00 22.92 ? 64   ILE A CG1   1 
ATOM   389  C CG2   . ILE A 1 64  ? 33.489  54.184  54.960 1.00 24.62 ? 64   ILE A CG2   1 
ATOM   390  C CD1   . ILE A 1 64  ? 33.986  56.844  53.614 1.00 22.27 ? 64   ILE A CD1   1 
ATOM   391  N N     . ARG A 1 65  ? 32.384  56.965  58.331 1.00 28.43 ? 65   ARG A N     1 
ATOM   392  C CA    . ARG A 1 65  ? 32.184  58.186  59.106 1.00 29.93 ? 65   ARG A CA    1 
ATOM   393  C C     . ARG A 1 65  ? 32.641  59.474  58.455 1.00 30.46 ? 65   ARG A C     1 
ATOM   394  O O     . ARG A 1 65  ? 31.998  60.509  58.619 1.00 30.68 ? 65   ARG A O     1 
ATOM   395  C CB    . ARG A 1 65  ? 32.878  58.079  60.462 1.00 30.51 ? 65   ARG A CB    1 
ATOM   396  C CG    . ARG A 1 65  ? 32.107  57.334  61.508 1.00 31.10 ? 65   ARG A CG    1 
ATOM   397  C CD    . ARG A 1 65  ? 32.822  57.437  62.840 1.00 32.09 ? 65   ARG A CD    1 
ATOM   398  N NE    . ARG A 1 65  ? 32.717  58.774  63.409 1.00 33.13 ? 65   ARG A NE    1 
ATOM   399  C CZ    . ARG A 1 65  ? 33.491  59.237  64.388 1.00 34.09 ? 65   ARG A CZ    1 
ATOM   400  N NH1   . ARG A 1 65  ? 34.448  58.476  64.915 1.00 32.95 ? 65   ARG A NH1   1 
ATOM   401  N NH2   . ARG A 1 65  ? 33.283  60.459  64.864 1.00 33.84 ? 65   ARG A NH2   1 
ATOM   402  N N     . GLU A 1 66  ? 33.793  59.426  57.800 1.00 31.52 ? 66   GLU A N     1 
ATOM   403  C CA    . GLU A 1 66  ? 34.363  60.604  57.164 1.00 33.24 ? 66   GLU A CA    1 
ATOM   404  C C     . GLU A 1 66  ? 34.964  60.218  55.829 1.00 31.83 ? 66   GLU A C     1 
ATOM   405  O O     . GLU A 1 66  ? 35.875  59.389  55.783 1.00 34.42 ? 66   GLU A O     1 
ATOM   406  C CB    . GLU A 1 66  ? 35.488  61.193  58.026 1.00 36.02 ? 66   GLU A CB    1 
ATOM   407  C CG    . GLU A 1 66  ? 35.240  61.217  59.528 1.00 41.37 ? 66   GLU A CG    1 
ATOM   408  C CD    . GLU A 1 66  ? 34.345  62.355  59.991 1.00 46.38 ? 66   GLU A CD    1 
ATOM   409  O OE1   . GLU A 1 66  ? 34.184  63.356  59.246 1.00 47.62 ? 66   GLU A OE1   1 
ATOM   410  O OE2   . GLU A 1 66  ? 33.815  62.251  61.126 1.00 51.26 ? 66   GLU A OE2   1 
ATOM   411  N N     . PRO A 1 67  ? 34.422  60.752  54.722 1.00 30.10 ? 67   PRO A N     1 
ATOM   412  C CA    . PRO A 1 67  ? 33.279  61.677  54.717 1.00 28.90 ? 67   PRO A CA    1 
ATOM   413  C C     . PRO A 1 67  ? 32.046  60.842  55.042 1.00 27.29 ? 67   PRO A C     1 
ATOM   414  O O     . PRO A 1 67  ? 31.991  59.672  54.682 1.00 28.47 ? 67   PRO A O     1 
ATOM   415  C CB    . PRO A 1 67  ? 33.242  62.166  53.265 1.00 29.09 ? 67   PRO A CB    1 
ATOM   416  C CG    . PRO A 1 67  ? 34.659  61.929  52.769 1.00 28.21 ? 67   PRO A CG    1 
ATOM   417  C CD    . PRO A 1 67  ? 35.001  60.620  53.375 1.00 27.88 ? 67   PRO A CD    1 
ATOM   418  N N     . LYS A 1 68  ? 31.088  61.402  55.767 1.00 26.88 ? 68   LYS A N     1 
ATOM   419  C CA    . LYS A 1 68  ? 29.886  60.646  56.130 1.00 26.27 ? 68   LYS A CA    1 
ATOM   420  C C     . LYS A 1 68  ? 29.059  60.308  54.882 1.00 24.84 ? 68   LYS A C     1 
ATOM   421  O O     . LYS A 1 68  ? 28.372  61.170  54.320 1.00 24.23 ? 68   LYS A O     1 
ATOM   422  C CB    . LYS A 1 68  ? 29.050  61.432  57.137 1.00 25.96 ? 68   LYS A CB    1 
ATOM   423  C CG    . LYS A 1 68  ? 27.985  60.607  57.810 1.00 29.38 ? 68   LYS A CG    1 
ATOM   424  C CD    . LYS A 1 68  ? 27.025  61.506  58.557 1.00 33.04 ? 68   LYS A CD    1 
ATOM   425  C CE    . LYS A 1 68  ? 25.795  60.738  59.042 1.00 36.62 ? 68   LYS A CE    1 
ATOM   426  N NZ    . LYS A 1 68  ? 24.703  61.659  59.541 1.00 39.70 ? 68   LYS A NZ    1 
ATOM   427  N N     . THR A 1 69  ? 29.119  59.050  54.463 1.00 22.56 ? 69   THR A N     1 
ATOM   428  C CA    . THR A 1 69  ? 28.416  58.611  53.272 1.00 21.71 ? 69   THR A CA    1 
ATOM   429  C C     . THR A 1 69  ? 27.919  57.170  53.387 1.00 21.75 ? 69   THR A C     1 
ATOM   430  O O     . THR A 1 69  ? 28.219  56.470  54.353 1.00 22.40 ? 69   THR A O     1 
ATOM   431  C CB    . THR A 1 69  ? 29.357  58.667  52.077 1.00 20.38 ? 69   THR A CB    1 
ATOM   432  O OG1   . THR A 1 69  ? 30.512  57.885  52.381 1.00 20.68 ? 69   THR A OG1   1 
ATOM   433  C CG2   . THR A 1 69  ? 29.786  60.084  51.786 1.00 19.18 ? 69   THR A CG2   1 
ATOM   434  N N     . THR A 1 70  ? 27.171  56.730  52.380 1.00 20.82 ? 70   THR A N     1 
ATOM   435  C CA    . THR A 1 70  ? 26.650  55.378  52.327 1.00 19.77 ? 70   THR A CA    1 
ATOM   436  C C     . THR A 1 70  ? 26.849  54.909  50.898 1.00 19.35 ? 70   THR A C     1 
ATOM   437  O O     . THR A 1 70  ? 26.562  55.638  49.960 1.00 20.73 ? 70   THR A O     1 
ATOM   438  C CB    . THR A 1 70  ? 25.149  55.349  52.680 1.00 20.91 ? 70   THR A CB    1 
ATOM   439  O OG1   . THR A 1 70  ? 24.971  55.771  54.039 1.00 22.10 ? 70   THR A OG1   1 
ATOM   440  C CG2   . THR A 1 70  ? 24.572  53.941  52.518 1.00 19.58 ? 70   THR A CG2   1 
ATOM   441  N N     . ALA A 1 71  ? 27.380  53.709  50.733 1.00 19.44 ? 71   ALA A N     1 
ATOM   442  C CA    . ALA A 1 71  ? 27.610  53.140  49.413 1.00 19.03 ? 71   ALA A CA    1 
ATOM   443  C C     . ALA A 1 71  ? 26.712  51.923  49.204 1.00 19.38 ? 71   ALA A C     1 
ATOM   444  O O     . ALA A 1 71  ? 26.416  51.184  50.150 1.00 20.41 ? 71   ALA A O     1 
ATOM   445  C CB    . ALA A 1 71  ? 29.061  52.728  49.269 1.00 16.46 ? 71   ALA A CB    1 
ATOM   446  N N     . LEU A 1 72  ? 26.231  51.746  47.984 1.00 18.00 ? 72   LEU A N     1 
ATOM   447  C CA    . LEU A 1 72  ? 25.415  50.594  47.667 1.00 18.28 ? 72   LEU A CA    1 
ATOM   448  C C     . LEU A 1 72  ? 26.354  49.891  46.725 1.00 17.88 ? 72   LEU A C     1 
ATOM   449  O O     . LEU A 1 72  ? 26.739  50.446  45.707 1.00 18.10 ? 72   LEU A O     1 
ATOM   450  C CB    . LEU A 1 72  ? 24.127  51.011  46.956 1.00 19.04 ? 72   LEU A CB    1 
ATOM   451  C CG    . LEU A 1 72  ? 23.187  51.958  47.716 1.00 19.01 ? 72   LEU A CG    1 
ATOM   452  C CD1   . LEU A 1 72  ? 22.193  52.608  46.758 1.00 20.47 ? 72   LEU A CD1   1 
ATOM   453  C CD2   . LEU A 1 72  ? 22.455  51.218  48.795 1.00 20.39 ? 72   LEU A CD2   1 
ATOM   454  N N     . ILE A 1 73  ? 26.817  48.722  47.135 1.00 20.06 ? 73   ILE A N     1 
ATOM   455  C CA    . ILE A 1 73  ? 27.771  47.935  46.362 1.00 21.07 ? 73   ILE A CA    1 
ATOM   456  C C     . ILE A 1 73  ? 27.060  46.759  45.718 1.00 20.84 ? 73   ILE A C     1 
ATOM   457  O O     . ILE A 1 73  ? 26.414  45.970  46.415 1.00 22.03 ? 73   ILE A O     1 
ATOM   458  C CB    . ILE A 1 73  ? 28.912  47.457  47.294 1.00 20.54 ? 73   ILE A CB    1 
ATOM   459  C CG1   . ILE A 1 73  ? 29.601  48.687  47.893 1.00 19.74 ? 73   ILE A CG1   1 
ATOM   460  C CG2   . ILE A 1 73  ? 29.905  46.568  46.542 1.00 21.36 ? 73   ILE A CG2   1 
ATOM   461  C CD1   . ILE A 1 73  ? 30.482  48.411  49.073 1.00 20.48 ? 73   ILE A CD1   1 
ATOM   462  N N     . PHE A 1 74  ? 27.153  46.656  44.392 1.00 20.57 ? 74   PHE A N     1 
ATOM   463  C CA    . PHE A 1 74  ? 26.482  45.586  43.667 1.00 21.55 ? 74   PHE A CA    1 
ATOM   464  C C     . PHE A 1 74  ? 27.449  44.510  43.183 1.00 23.93 ? 74   PHE A C     1 
ATOM   465  O O     . PHE A 1 74  ? 28.642  44.766  43.010 1.00 24.61 ? 74   PHE A O     1 
ATOM   466  C CB    . PHE A 1 74  ? 25.690  46.170  42.500 1.00 21.66 ? 74   PHE A CB    1 
ATOM   467  C CG    . PHE A 1 74  ? 24.700  47.239  42.916 1.00 20.11 ? 74   PHE A CG    1 
ATOM   468  C CD1   . PHE A 1 74  ? 25.120  48.542  43.128 1.00 15.33 ? 74   PHE A CD1   1 
ATOM   469  C CD2   . PHE A 1 74  ? 23.360  46.920  43.143 1.00 20.79 ? 74   PHE A CD2   1 
ATOM   470  C CE1   . PHE A 1 74  ? 24.246  49.503  43.559 1.00 15.61 ? 74   PHE A CE1   1 
ATOM   471  C CE2   . PHE A 1 74  ? 22.463  47.886  43.579 1.00 20.49 ? 74   PHE A CE2   1 
ATOM   472  C CZ    . PHE A 1 74  ? 22.911  49.184  43.790 1.00 17.60 ? 74   PHE A CZ    1 
ATOM   473  N N     . ALA A 1 75  ? 26.933  43.299  42.980 1.00 25.52 ? 75   ALA A N     1 
ATOM   474  C CA    . ALA A 1 75  ? 27.744  42.160  42.530 1.00 26.01 ? 75   ALA A CA    1 
ATOM   475  C C     . ALA A 1 75  ? 28.480  42.461  41.225 1.00 26.36 ? 75   ALA A C     1 
ATOM   476  O O     . ALA A 1 75  ? 29.570  41.953  40.978 1.00 26.77 ? 75   ALA A O     1 
ATOM   477  C CB    . ALA A 1 75  ? 26.858  40.925  42.372 1.00 23.90 ? 75   ALA A CB    1 
ATOM   478  N N     . SER A 1 76  ? 27.876  43.312  40.407 1.00 27.31 ? 76   SER A N     1 
ATOM   479  C CA    . SER A 1 76  ? 28.438  43.716  39.131 1.00 27.91 ? 76   SER A CA    1 
ATOM   480  C C     . SER A 1 76  ? 29.718  44.529  39.279 1.00 28.23 ? 76   SER A C     1 
ATOM   481  O O     . SER A 1 76  ? 30.446  44.736  38.306 1.00 29.97 ? 76   SER A O     1 
ATOM   482  C CB    . SER A 1 76  ? 27.401  44.543  38.353 1.00 28.99 ? 76   SER A CB    1 
ATOM   483  O OG    . SER A 1 76  ? 27.043  45.745  39.037 1.00 29.95 ? 76   SER A OG    1 
ATOM   484  N N     . GLY A 1 77  ? 29.999  44.991  40.488 1.00 27.94 ? 77   GLY A N     1 
ATOM   485  C CA    . GLY A 1 77  ? 31.180  45.811  40.685 1.00 27.95 ? 77   GLY A CA    1 
ATOM   486  C C     . GLY A 1 77  ? 30.825  47.287  40.619 1.00 27.48 ? 77   GLY A C     1 
ATOM   487  O O     . GLY A 1 77  ? 31.678  48.145  40.845 1.00 28.02 ? 77   GLY A O     1 
ATOM   488  N N     . LYS A 1 78  ? 29.577  47.583  40.267 1.00 27.63 ? 78   LYS A N     1 
ATOM   489  C CA    . LYS A 1 78  ? 29.093  48.959  40.196 1.00 27.86 ? 78   LYS A CA    1 
ATOM   490  C C     . LYS A 1 78  ? 28.859  49.424  41.627 1.00 27.46 ? 78   LYS A C     1 
ATOM   491  O O     . LYS A 1 78  ? 28.586  48.602  42.514 1.00 27.33 ? 78   LYS A O     1 
ATOM   492  C CB    . LYS A 1 78  ? 27.770  49.023  39.439 1.00 29.15 ? 78   LYS A CB    1 
ATOM   493  C CG    . LYS A 1 78  ? 27.841  48.603  37.985 1.00 31.20 ? 78   LYS A CG    1 
ATOM   494  C CD    . LYS A 1 78  ? 28.669  49.565  37.159 1.00 31.65 ? 78   LYS A CD    1 
ATOM   495  C CE    . LYS A 1 78  ? 28.452  49.340  35.664 1.00 30.27 ? 78   LYS A CE    1 
ATOM   496  N NZ    . LYS A 1 78  ? 27.144  49.873  35.195 1.00 32.83 ? 78   LYS A NZ    1 
ATOM   497  N N     . MET A 1 79  ? 28.902  50.736  41.845 1.00 26.71 ? 79   MET A N     1 
ATOM   498  C CA    . MET A 1 79  ? 28.711  51.273  43.186 1.00 25.89 ? 79   MET A CA    1 
ATOM   499  C C     . MET A 1 79  ? 28.097  52.671  43.213 1.00 24.80 ? 79   MET A C     1 
ATOM   500  O O     . MET A 1 79  ? 28.443  53.527  42.412 1.00 26.03 ? 79   MET A O     1 
ATOM   501  C CB    . MET A 1 79  ? 30.056  51.269  43.933 1.00 25.53 ? 79   MET A CB    1 
ATOM   502  C CG    . MET A 1 79  ? 30.009  51.891  45.309 1.00 28.83 ? 79   MET A CG    1 
ATOM   503  S SD    . MET A 1 79  ? 31.537  51.695  46.234 1.00 32.38 ? 79   MET A SD    1 
ATOM   504  C CE    . MET A 1 79  ? 32.364  53.173  45.801 1.00 29.01 ? 79   MET A CE    1 
ATOM   505  N N     . VAL A 1 80  ? 27.157  52.877  44.125 1.00 23.44 ? 80   VAL A N     1 
ATOM   506  C CA    . VAL A 1 80  ? 26.503  54.167  44.304 1.00 21.54 ? 80   VAL A CA    1 
ATOM   507  C C     . VAL A 1 80  ? 27.005  54.748  45.630 1.00 22.05 ? 80   VAL A C     1 
ATOM   508  O O     . VAL A 1 80  ? 27.160  54.018  46.615 1.00 21.88 ? 80   VAL A O     1 
ATOM   509  C CB    . VAL A 1 80  ? 24.967  54.017  44.384 1.00 20.56 ? 80   VAL A CB    1 
ATOM   510  C CG1   . VAL A 1 80  ? 24.327  55.347  44.713 1.00 20.28 ? 80   VAL A CG1   1 
ATOM   511  C CG2   . VAL A 1 80  ? 24.427  53.487  43.097 1.00 19.62 ? 80   VAL A CG2   1 
ATOM   512  N N     . CYS A 1 81  ? 27.293  56.044  45.651 1.00 21.86 ? 81   CYS A N     1 
ATOM   513  C CA    . CYS A 1 81  ? 27.756  56.707  46.864 1.00 20.59 ? 81   CYS A CA    1 
ATOM   514  C C     . CYS A 1 81  ? 26.811  57.875  47.100 1.00 19.97 ? 81   CYS A C     1 
ATOM   515  O O     . CYS A 1 81  ? 26.543  58.637  46.176 1.00 20.62 ? 81   CYS A O     1 
ATOM   516  C CB    . CYS A 1 81  ? 29.196  57.196  46.698 1.00 19.71 ? 81   CYS A CB    1 
ATOM   517  S SG    . CYS A 1 81  ? 29.894  57.867  48.205 1.00 19.54 ? 81   CYS A SG    1 
ATOM   518  N N     . THR A 1 82  ? 26.256  57.978  48.305 1.00 19.44 ? 82   THR A N     1 
ATOM   519  C CA    . THR A 1 82  ? 25.304  59.047  48.633 1.00 19.92 ? 82   THR A CA    1 
ATOM   520  C C     . THR A 1 82  ? 25.644  59.677  49.976 1.00 18.15 ? 82   THR A C     1 
ATOM   521  O O     . THR A 1 82  ? 26.315  59.065  50.797 1.00 17.80 ? 82   THR A O     1 
ATOM   522  C CB    . THR A 1 82  ? 23.842  58.501  48.777 1.00 21.10 ? 82   THR A CB    1 
ATOM   523  O OG1   . THR A 1 82  ? 23.786  57.580  49.878 1.00 24.20 ? 82   THR A OG1   1 
ATOM   524  C CG2   . THR A 1 82  ? 23.400  57.765  47.543 1.00 22.11 ? 82   THR A CG2   1 
ATOM   525  N N     . GLY A 1 83  ? 25.153  60.887  50.208 1.00 17.59 ? 83   GLY A N     1 
ATOM   526  C CA    . GLY A 1 83  ? 25.388  61.532  51.479 1.00 17.05 ? 83   GLY A CA    1 
ATOM   527  C C     . GLY A 1 83  ? 26.487  62.559  51.586 1.00 18.47 ? 83   GLY A C     1 
ATOM   528  O O     . GLY A 1 83  ? 26.469  63.345  52.529 1.00 20.29 ? 83   GLY A O     1 
ATOM   529  N N     . ALA A 1 84  ? 27.438  62.582  50.659 1.00 18.87 ? 84   ALA A N     1 
ATOM   530  C CA    . ALA A 1 84  ? 28.517  63.556  50.756 1.00 19.80 ? 84   ALA A CA    1 
ATOM   531  C C     . ALA A 1 84  ? 28.008  64.985  50.577 1.00 20.77 ? 84   ALA A C     1 
ATOM   532  O O     . ALA A 1 84  ? 27.010  65.207  49.901 1.00 21.16 ? 84   ALA A O     1 
ATOM   533  C CB    . ALA A 1 84  ? 29.612  63.236  49.761 1.00 20.65 ? 84   ALA A CB    1 
ATOM   534  N N     . LYS A 1 85  ? 28.683  65.948  51.204 1.00 22.89 ? 85   LYS A N     1 
ATOM   535  C CA    . LYS A 1 85  ? 28.295  67.353  51.120 1.00 23.19 ? 85   LYS A CA    1 
ATOM   536  C C     . LYS A 1 85  ? 28.924  68.080  49.951 1.00 23.40 ? 85   LYS A C     1 
ATOM   537  O O     . LYS A 1 85  ? 28.603  69.239  49.706 1.00 23.45 ? 85   LYS A O     1 
ATOM   538  C CB    . LYS A 1 85  ? 28.628  68.099  52.409 1.00 23.94 ? 85   LYS A CB    1 
ATOM   539  C CG    . LYS A 1 85  ? 27.892  67.593  53.623 1.00 27.05 ? 85   LYS A CG    1 
ATOM   540  C CD    . LYS A 1 85  ? 26.394  67.663  53.396 1.00 29.58 ? 85   LYS A CD    1 
ATOM   541  C CE    . LYS A 1 85  ? 25.598  67.377  54.668 1.00 29.22 ? 85   LYS A CE    1 
ATOM   542  N NZ    . LYS A 1 85  ? 24.130  67.322  54.362 1.00 31.36 ? 85   LYS A NZ    1 
ATOM   543  N N     . SER A 1 86  ? 29.844  67.424  49.252 1.00 23.96 ? 86   SER A N     1 
ATOM   544  C CA    . SER A 1 86  ? 30.483  68.037  48.092 1.00 24.30 ? 86   SER A CA    1 
ATOM   545  C C     . SER A 1 86  ? 30.856  66.956  47.102 1.00 24.31 ? 86   SER A C     1 
ATOM   546  O O     . SER A 1 86  ? 30.822  65.769  47.435 1.00 25.20 ? 86   SER A O     1 
ATOM   547  C CB    . SER A 1 86  ? 31.738  68.796  48.495 1.00 23.20 ? 86   SER A CB    1 
ATOM   548  O OG    . SER A 1 86  ? 32.783  67.889  48.781 1.00 24.27 ? 86   SER A OG    1 
ATOM   549  N N     . GLU A 1 87  ? 31.301  67.375  45.919 1.00 24.24 ? 87   GLU A N     1 
ATOM   550  C CA    . GLU A 1 87  ? 31.682  66.452  44.863 1.00 21.74 ? 87   GLU A CA    1 
ATOM   551  C C     . GLU A 1 87  ? 33.001  65.791  45.213 1.00 22.40 ? 87   GLU A C     1 
ATOM   552  O O     . GLU A 1 87  ? 33.138  64.573  45.104 1.00 22.48 ? 87   GLU A O     1 
ATOM   553  C CB    . GLU A 1 87  ? 31.781  67.184  43.531 1.00 20.18 ? 87   GLU A CB    1 
ATOM   554  C CG    . GLU A 1 87  ? 30.503  67.877  43.113 1.00 19.59 ? 87   GLU A CG    1 
ATOM   555  C CD    . GLU A 1 87  ? 30.471  69.343  43.514 1.00 21.04 ? 87   GLU A CD    1 
ATOM   556  O OE1   . GLU A 1 87  ? 30.595  69.663  44.715 1.00 19.57 ? 87   GLU A OE1   1 
ATOM   557  O OE2   . GLU A 1 87  ? 30.322  70.190  42.611 1.00 22.59 ? 87   GLU A OE2   1 
ATOM   558  N N     . ASP A 1 88  ? 33.960  66.586  45.678 1.00 23.35 ? 88   ASP A N     1 
ATOM   559  C CA    . ASP A 1 88  ? 35.262  66.043  46.057 1.00 23.94 ? 88   ASP A CA    1 
ATOM   560  C C     . ASP A 1 88  ? 35.072  65.017  47.150 1.00 24.14 ? 88   ASP A C     1 
ATOM   561  O O     . ASP A 1 88  ? 35.657  63.937  47.108 1.00 25.75 ? 88   ASP A O     1 
ATOM   562  C CB    . ASP A 1 88  ? 36.191  67.140  46.576 1.00 25.46 ? 88   ASP A CB    1 
ATOM   563  C CG    . ASP A 1 88  ? 36.707  68.041  45.479 1.00 26.44 ? 88   ASP A CG    1 
ATOM   564  O OD1   . ASP A 1 88  ? 36.505  67.724  44.286 1.00 27.33 ? 88   ASP A OD1   1 
ATOM   565  O OD2   . ASP A 1 88  ? 37.322  69.076  45.827 1.00 26.66 ? 88   ASP A OD2   1 
ATOM   566  N N     . PHE A 1 89  ? 34.269  65.376  48.145 1.00 24.47 ? 89   PHE A N     1 
ATOM   567  C CA    . PHE A 1 89  ? 33.978  64.483  49.258 1.00 24.26 ? 89   PHE A CA    1 
ATOM   568  C C     . PHE A 1 89  ? 33.354  63.185  48.772 1.00 25.28 ? 89   PHE A C     1 
ATOM   569  O O     . PHE A 1 89  ? 33.643  62.114  49.304 1.00 27.27 ? 89   PHE A O     1 
ATOM   570  C CB    . PHE A 1 89  ? 33.067  65.173  50.272 1.00 22.37 ? 89   PHE A CB    1 
ATOM   571  C CG    . PHE A 1 89  ? 33.795  66.087  51.213 1.00 21.19 ? 89   PHE A CG    1 
ATOM   572  C CD1   . PHE A 1 89  ? 35.083  65.777  51.645 1.00 19.79 ? 89   PHE A CD1   1 
ATOM   573  C CD2   . PHE A 1 89  ? 33.195  67.248  51.680 1.00 21.82 ? 89   PHE A CD2   1 
ATOM   574  C CE1   . PHE A 1 89  ? 35.764  66.600  52.523 1.00 18.18 ? 89   PHE A CE1   1 
ATOM   575  C CE2   . PHE A 1 89  ? 33.872  68.080  52.565 1.00 21.36 ? 89   PHE A CE2   1 
ATOM   576  C CZ    . PHE A 1 89  ? 35.163  67.749  52.984 1.00 19.20 ? 89   PHE A CZ    1 
ATOM   577  N N     . SER A 1 90  ? 32.539  63.270  47.729 1.00 26.33 ? 90   SER A N     1 
ATOM   578  C CA    . SER A 1 90  ? 31.910  62.085  47.169 1.00 27.11 ? 90   SER A CA    1 
ATOM   579  C C     . SER A 1 90  ? 32.945  61.198  46.459 1.00 27.41 ? 90   SER A C     1 
ATOM   580  O O     . SER A 1 90  ? 32.907  59.976  46.583 1.00 27.83 ? 90   SER A O     1 
ATOM   581  C CB    . SER A 1 90  ? 30.790  62.487  46.210 1.00 26.14 ? 90   SER A CB    1 
ATOM   582  O OG    . SER A 1 90  ? 29.926  61.396  45.947 1.00 24.39 ? 90   SER A OG    1 
ATOM   583  N N     . LYS A 1 91  ? 33.872  61.807  45.728 1.00 29.08 ? 91   LYS A N     1 
ATOM   584  C CA    . LYS A 1 91  ? 34.906  61.046  45.024 1.00 31.02 ? 91   LYS A CA    1 
ATOM   585  C C     . LYS A 1 91  ? 35.806  60.370  46.044 1.00 31.07 ? 91   LYS A C     1 
ATOM   586  O O     . LYS A 1 91  ? 36.173  59.207  45.905 1.00 31.59 ? 91   LYS A O     1 
ATOM   587  C CB    . LYS A 1 91  ? 35.743  61.969  44.148 1.00 32.50 ? 91   LYS A CB    1 
ATOM   588  C CG    . LYS A 1 91  ? 36.722  61.251  43.244 1.00 33.86 ? 91   LYS A CG    1 
ATOM   589  C CD    . LYS A 1 91  ? 37.295  62.230  42.239 1.00 37.67 ? 91   LYS A CD    1 
ATOM   590  C CE    . LYS A 1 91  ? 37.932  61.511  41.053 1.00 42.33 ? 91   LYS A CE    1 
ATOM   591  N NZ    . LYS A 1 91  ? 38.312  62.444  39.932 1.00 44.16 ? 91   LYS A NZ    1 
ATOM   592  N N     . MET A 1 92  ? 36.119  61.132  47.081 1.00 31.37 ? 92   MET A N     1 
ATOM   593  C CA    . MET A 1 92  ? 36.951  60.727  48.198 1.00 30.80 ? 92   MET A CA    1 
ATOM   594  C C     . MET A 1 92  ? 36.339  59.525  48.926 1.00 29.60 ? 92   MET A C     1 
ATOM   595  O O     . MET A 1 92  ? 37.014  58.521  49.168 1.00 28.72 ? 92   MET A O     1 
ATOM   596  C CB    . MET A 1 92  ? 37.053  61.918  49.152 1.00 34.79 ? 92   MET A CB    1 
ATOM   597  C CG    . MET A 1 92  ? 38.175  61.860  50.157 1.00 40.42 ? 92   MET A CG    1 
ATOM   598  S SD    . MET A 1 92  ? 38.134  63.298  51.240 1.00 45.87 ? 92   MET A SD    1 
ATOM   599  C CE    . MET A 1 92  ? 37.832  64.610  50.053 1.00 40.19 ? 92   MET A CE    1 
ATOM   600  N N     . ALA A 1 93  ? 35.063  59.631  49.288 1.00 27.74 ? 93   ALA A N     1 
ATOM   601  C CA    . ALA A 1 93  ? 34.388  58.545  49.987 1.00 27.24 ? 93   ALA A CA    1 
ATOM   602  C C     . ALA A 1 93  ? 34.303  57.320  49.081 1.00 27.38 ? 93   ALA A C     1 
ATOM   603  O O     . ALA A 1 93  ? 34.488  56.190  49.532 1.00 27.44 ? 93   ALA A O     1 
ATOM   604  C CB    . ALA A 1 93  ? 33.002  58.983  50.428 1.00 25.60 ? 93   ALA A CB    1 
ATOM   605  N N     . ALA A 1 94  ? 34.057  57.557  47.793 1.00 27.20 ? 94   ALA A N     1 
ATOM   606  C CA    . ALA A 1 94  ? 33.954  56.489  46.810 1.00 26.80 ? 94   ALA A CA    1 
ATOM   607  C C     . ALA A 1 94  ? 35.258  55.701  46.746 1.00 28.15 ? 94   ALA A C     1 
ATOM   608  O O     . ALA A 1 94  ? 35.248  54.474  46.605 1.00 28.23 ? 94   ALA A O     1 
ATOM   609  C CB    . ALA A 1 94  ? 33.607  57.064  45.451 1.00 25.04 ? 94   ALA A CB    1 
ATOM   610  N N     . ARG A 1 95  ? 36.376  56.414  46.865 1.00 29.64 ? 95   ARG A N     1 
ATOM   611  C CA    . ARG A 1 95  ? 37.701  55.807  46.842 1.00 29.93 ? 95   ARG A CA    1 
ATOM   612  C C     . ARG A 1 95  ? 37.975  55.019  48.119 1.00 29.75 ? 95   ARG A C     1 
ATOM   613  O O     . ARG A 1 95  ? 38.578  53.945  48.069 1.00 31.35 ? 95   ARG A O     1 
ATOM   614  C CB    . ARG A 1 95  ? 38.778  56.866  46.603 1.00 33.04 ? 95   ARG A CB    1 
ATOM   615  C CG    . ARG A 1 95  ? 38.715  57.488  45.207 1.00 35.41 ? 95   ARG A CG    1 
ATOM   616  C CD    . ARG A 1 95  ? 39.901  58.391  44.898 1.00 38.58 ? 95   ARG A CD    1 
ATOM   617  N NE    . ARG A 1 95  ? 39.987  59.538  45.798 1.00 42.72 ? 95   ARG A NE    1 
ATOM   618  C CZ    . ARG A 1 95  ? 40.258  60.782  45.406 1.00 45.60 ? 95   ARG A CZ    1 
ATOM   619  N NH1   . ARG A 1 95  ? 40.467  61.056  44.120 1.00 46.53 ? 95   ARG A NH1   1 
ATOM   620  N NH2   . ARG A 1 95  ? 40.333  61.755  46.305 1.00 46.17 ? 95   ARG A NH2   1 
ATOM   621  N N     . LYS A 1 96  ? 37.514  55.516  49.261 1.00 28.92 ? 96   LYS A N     1 
ATOM   622  C CA    . LYS A 1 96  ? 37.711  54.779  50.501 1.00 29.13 ? 96   LYS A CA    1 
ATOM   623  C C     . LYS A 1 96  ? 36.951  53.443  50.439 1.00 29.41 ? 96   LYS A C     1 
ATOM   624  O O     . LYS A 1 96  ? 37.452  52.411  50.898 1.00 30.13 ? 96   LYS A O     1 
ATOM   625  C CB    . LYS A 1 96  ? 37.291  55.611  51.713 1.00 29.52 ? 96   LYS A CB    1 
ATOM   626  C CG    . LYS A 1 96  ? 38.211  56.819  51.941 1.00 33.23 ? 96   LYS A CG    1 
ATOM   627  C CD    . LYS A 1 96  ? 37.956  57.570  53.269 1.00 34.74 ? 96   LYS A CD    1 
ATOM   628  C CE    . LYS A 1 96  ? 38.814  58.847  53.353 1.00 35.55 ? 96   LYS A CE    1 
ATOM   629  N NZ    . LYS A 1 96  ? 38.852  59.492  54.706 1.00 36.00 ? 96   LYS A NZ    1 
ATOM   630  N N     . TYR A 1 97  ? 35.768  53.454  49.826 1.00 28.85 ? 97   TYR A N     1 
ATOM   631  C CA    . TYR A 1 97  ? 34.967  52.243  49.684 1.00 28.23 ? 97   TYR A CA    1 
ATOM   632  C C     . TYR A 1 97  ? 35.643  51.274  48.736 1.00 29.40 ? 97   TYR A C     1 
ATOM   633  O O     . TYR A 1 97  ? 35.656  50.073  48.988 1.00 30.56 ? 97   TYR A O     1 
ATOM   634  C CB    . TYR A 1 97  ? 33.573  52.552  49.133 1.00 26.55 ? 97   TYR A CB    1 
ATOM   635  C CG    . TYR A 1 97  ? 32.638  53.238  50.098 1.00 24.44 ? 97   TYR A CG    1 
ATOM   636  C CD1   . TYR A 1 97  ? 32.208  52.594  51.265 1.00 22.22 ? 97   TYR A CD1   1 
ATOM   637  C CD2   . TYR A 1 97  ? 32.175  54.531  49.840 1.00 21.92 ? 97   TYR A CD2   1 
ATOM   638  C CE1   . TYR A 1 97  ? 31.338  53.228  52.154 1.00 22.58 ? 97   TYR A CE1   1 
ATOM   639  C CE2   . TYR A 1 97  ? 31.310  55.174  50.717 1.00 21.46 ? 97   TYR A CE2   1 
ATOM   640  C CZ    . TYR A 1 97  ? 30.892  54.526  51.873 1.00 22.20 ? 97   TYR A CZ    1 
ATOM   641  O OH    . TYR A 1 97  ? 30.047  55.181  52.751 1.00 21.52 ? 97   TYR A OH    1 
ATOM   642  N N     . ALA A 1 98  ? 36.169  51.786  47.625 1.00 30.76 ? 98   ALA A N     1 
ATOM   643  C CA    . ALA A 1 98  ? 36.839  50.938  46.643 1.00 31.40 ? 98   ALA A CA    1 
ATOM   644  C C     . ALA A 1 98  ? 38.033  50.250  47.287 1.00 32.83 ? 98   ALA A C     1 
ATOM   645  O O     . ALA A 1 98  ? 38.281  49.072  47.038 1.00 33.19 ? 98   ALA A O     1 
ATOM   646  C CB    . ALA A 1 98  ? 37.280  51.751  45.441 1.00 29.96 ? 98   ALA A CB    1 
ATOM   647  N N     . ARG A 1 99  ? 38.753  50.982  48.133 1.00 34.62 ? 99   ARG A N     1 
ATOM   648  C CA    . ARG A 1 99  ? 39.916  50.441  48.828 1.00 36.45 ? 99   ARG A CA    1 
ATOM   649  C C     . ARG A 1 99  ? 39.523  49.405  49.886 1.00 36.51 ? 99   ARG A C     1 
ATOM   650  O O     . ARG A 1 99  ? 40.280  48.476  50.155 1.00 37.55 ? 99   ARG A O     1 
ATOM   651  C CB    . ARG A 1 99  ? 40.752  51.571  49.427 1.00 38.57 ? 99   ARG A CB    1 
ATOM   652  C CG    . ARG A 1 99  ? 41.657  52.274  48.397 1.00 43.59 ? 99   ARG A CG    1 
ATOM   653  C CD    . ARG A 1 99  ? 41.772  53.779  48.643 1.00 47.22 ? 99   ARG A CD    1 
ATOM   654  N NE    . ARG A 1 99  ? 41.918  54.094  50.066 1.00 50.04 ? 99   ARG A NE    1 
ATOM   655  C CZ    . ARG A 1 99  ? 41.554  55.244  50.628 1.00 49.75 ? 99   ARG A CZ    1 
ATOM   656  N NH1   . ARG A 1 99  ? 41.024  56.218  49.895 1.00 50.62 ? 99   ARG A NH1   1 
ATOM   657  N NH2   . ARG A 1 99  ? 41.682  55.404  51.937 1.00 48.95 ? 99   ARG A NH2   1 
ATOM   658  N N     . ILE A 1 100 ? 38.341  49.563  50.483 1.00 35.75 ? 100  ILE A N     1 
ATOM   659  C CA    . ILE A 1 100 ? 37.829  48.609  51.467 1.00 32.75 ? 100  ILE A CA    1 
ATOM   660  C C     . ILE A 1 100 ? 37.620  47.302  50.718 1.00 33.46 ? 100  ILE A C     1 
ATOM   661  O O     . ILE A 1 100 ? 38.047  46.243  51.174 1.00 34.08 ? 100  ILE A O     1 
ATOM   662  C CB    . ILE A 1 100 ? 36.471  49.057  52.035 1.00 31.61 ? 100  ILE A CB    1 
ATOM   663  C CG1   . ILE A 1 100 ? 36.669  50.193  53.031 1.00 30.74 ? 100  ILE A CG1   1 
ATOM   664  C CG2   . ILE A 1 100 ? 35.740  47.887  52.672 1.00 29.88 ? 100  ILE A CG2   1 
ATOM   665  C CD1   . ILE A 1 100 ? 35.373  50.772  53.549 1.00 30.98 ? 100  ILE A CD1   1 
ATOM   666  N N     . VAL A 1 101 ? 36.978  47.395  49.555 1.00 33.23 ? 101  VAL A N     1 
ATOM   667  C CA    . VAL A 1 101 ? 36.715  46.235  48.709 1.00 32.79 ? 101  VAL A CA    1 
ATOM   668  C C     . VAL A 1 101 ? 38.050  45.622  48.253 1.00 33.94 ? 101  VAL A C     1 
ATOM   669  O O     . VAL A 1 101 ? 38.211  44.398  48.244 1.00 34.05 ? 101  VAL A O     1 
ATOM   670  C CB    . VAL A 1 101 ? 35.807  46.619  47.504 1.00 31.79 ? 101  VAL A CB    1 
ATOM   671  C CG1   . VAL A 1 101 ? 35.669  45.457  46.529 1.00 31.34 ? 101  VAL A CG1   1 
ATOM   672  C CG2   . VAL A 1 101 ? 34.422  47.039  48.005 1.00 30.13 ? 101  VAL A CG2   1 
ATOM   673  N N     . GLN A 1 102 ? 39.011  46.475  47.913 1.00 34.92 ? 102  GLN A N     1 
ATOM   674  C CA    . GLN A 1 102 ? 40.333  46.014  47.507 1.00 36.54 ? 102  GLN A CA    1 
ATOM   675  C C     . GLN A 1 102 ? 40.921  45.208  48.653 1.00 37.37 ? 102  GLN A C     1 
ATOM   676  O O     . GLN A 1 102 ? 41.352  44.074  48.460 1.00 39.05 ? 102  GLN A O     1 
ATOM   677  C CB    . GLN A 1 102 ? 41.262  47.194  47.213 1.00 38.21 ? 102  GLN A CB    1 
ATOM   678  C CG    . GLN A 1 102 ? 41.063  47.869  45.852 1.00 40.18 ? 102  GLN A CG    1 
ATOM   679  C CD    . GLN A 1 102 ? 41.738  49.236  45.774 1.00 40.60 ? 102  GLN A CD    1 
ATOM   680  O OE1   . GLN A 1 102 ? 42.393  49.675  46.724 1.00 41.25 ? 102  GLN A OE1   1 
ATOM   681  N NE2   . GLN A 1 102 ? 41.559  49.924  44.649 1.00 40.69 ? 102  GLN A NE2   1 
ATOM   682  N N     . LYS A 1 103 ? 40.887  45.779  49.857 1.00 38.15 ? 103  LYS A N     1 
ATOM   683  C CA    . LYS A 1 103 ? 41.422  45.124  51.045 1.00 38.96 ? 103  LYS A CA    1 
ATOM   684  C C     . LYS A 1 103 ? 40.630  43.894  51.439 1.00 40.22 ? 103  LYS A C     1 
ATOM   685  O O     . LYS A 1 103 ? 41.036  43.146  52.328 1.00 41.98 ? 103  LYS A O     1 
ATOM   686  C CB    . LYS A 1 103 ? 41.524  46.099  52.223 1.00 39.00 ? 103  LYS A CB    1 
ATOM   687  C CG    . LYS A 1 103 ? 42.506  47.234  51.967 1.00 41.05 ? 103  LYS A CG    1 
ATOM   688  C CD    . LYS A 1 103 ? 42.782  48.091  53.196 1.00 43.63 ? 103  LYS A CD    1 
ATOM   689  C CE    . LYS A 1 103 ? 43.834  47.469  54.113 1.00 46.18 ? 103  LYS A CE    1 
ATOM   690  N NZ    . LYS A 1 103 ? 44.304  48.426  55.167 1.00 45.00 ? 103  LYS A NZ    1 
ATOM   691  N N     . LEU A 1 104 ? 39.503  43.679  50.771 1.00 40.47 ? 104  LEU A N     1 
ATOM   692  C CA    . LEU A 1 104 ? 38.669  42.521  51.042 1.00 39.96 ? 104  LEU A CA    1 
ATOM   693  C C     . LEU A 1 104 ? 39.051  41.406  50.076 1.00 40.36 ? 104  LEU A C     1 
ATOM   694  O O     . LEU A 1 104 ? 38.456  40.338  50.092 1.00 42.02 ? 104  LEU A O     1 
ATOM   695  C CB    . LEU A 1 104 ? 37.194  42.884  50.891 1.00 39.43 ? 104  LEU A CB    1 
ATOM   696  C CG    . LEU A 1 104 ? 36.276  42.458  52.034 1.00 39.70 ? 104  LEU A CG    1 
ATOM   697  C CD1   . LEU A 1 104 ? 37.015  42.516  53.363 1.00 39.88 ? 104  LEU A CD1   1 
ATOM   698  C CD2   . LEU A 1 104 ? 35.069  43.369  52.059 1.00 39.03 ? 104  LEU A CD2   1 
ATOM   699  N N     . GLY A 1 105 ? 40.003  41.685  49.191 1.00 40.10 ? 105  GLY A N     1 
ATOM   700  C CA    . GLY A 1 105 ? 40.466  40.673  48.263 1.00 39.11 ? 105  GLY A CA    1 
ATOM   701  C C     . GLY A 1 105 ? 40.059  40.738  46.808 1.00 39.51 ? 105  GLY A C     1 
ATOM   702  O O     . GLY A 1 105 ? 40.477  39.877  46.030 1.00 41.28 ? 105  GLY A O     1 
ATOM   703  N N     . PHE A 1 106 ? 39.277  41.739  46.414 1.00 37.93 ? 106  PHE A N     1 
ATOM   704  C CA    . PHE A 1 106 ? 38.838  41.843  45.023 1.00 34.63 ? 106  PHE A CA    1 
ATOM   705  C C     . PHE A 1 106 ? 39.675  42.878  44.295 1.00 35.51 ? 106  PHE A C     1 
ATOM   706  O O     . PHE A 1 106 ? 39.956  43.937  44.844 1.00 36.95 ? 106  PHE A O     1 
ATOM   707  C CB    . PHE A 1 106 ? 37.367  42.249  44.975 1.00 31.51 ? 106  PHE A CB    1 
ATOM   708  C CG    . PHE A 1 106 ? 36.481  41.412  45.852 1.00 27.85 ? 106  PHE A CG    1 
ATOM   709  C CD1   . PHE A 1 106 ? 36.386  41.673  47.207 1.00 27.22 ? 106  PHE A CD1   1 
ATOM   710  C CD2   . PHE A 1 106 ? 35.775  40.338  45.328 1.00 27.01 ? 106  PHE A CD2   1 
ATOM   711  C CE1   . PHE A 1 106 ? 35.604  40.867  48.030 1.00 27.98 ? 106  PHE A CE1   1 
ATOM   712  C CE2   . PHE A 1 106 ? 34.994  39.533  46.138 1.00 26.08 ? 106  PHE A CE2   1 
ATOM   713  C CZ    . PHE A 1 106 ? 34.909  39.795  47.493 1.00 27.51 ? 106  PHE A CZ    1 
ATOM   714  N N     . PRO A 1 107 ? 40.101  42.587  43.052 1.00 36.56 ? 107  PRO A N     1 
ATOM   715  C CA    . PRO A 1 107 ? 40.913  43.532  42.271 1.00 37.08 ? 107  PRO A CA    1 
ATOM   716  C C     . PRO A 1 107 ? 40.067  44.743  41.827 1.00 37.30 ? 107  PRO A C     1 
ATOM   717  O O     . PRO A 1 107 ? 39.756  44.901  40.640 1.00 37.96 ? 107  PRO A O     1 
ATOM   718  C CB    . PRO A 1 107 ? 41.346  42.684  41.076 1.00 36.16 ? 107  PRO A CB    1 
ATOM   719  C CG    . PRO A 1 107 ? 40.149  41.822  40.852 1.00 36.26 ? 107  PRO A CG    1 
ATOM   720  C CD    . PRO A 1 107 ? 39.821  41.372  42.266 1.00 36.55 ? 107  PRO A CD    1 
ATOM   721  N N     . ALA A 1 108 ? 39.707  45.583  42.794 1.00 36.63 ? 108  ALA A N     1 
ATOM   722  C CA    . ALA A 1 108 ? 38.874  46.746  42.549 1.00 35.97 ? 108  ALA A CA    1 
ATOM   723  C C     . ALA A 1 108 ? 39.626  47.922  41.949 1.00 36.01 ? 108  ALA A C     1 
ATOM   724  O O     . ALA A 1 108 ? 40.712  48.281  42.399 1.00 35.00 ? 108  ALA A O     1 
ATOM   725  C CB    . ALA A 1 108 ? 38.169  47.173  43.837 1.00 33.83 ? 108  ALA A CB    1 
ATOM   726  N N     . LYS A 1 109 ? 39.038  48.493  40.904 1.00 36.64 ? 109  LYS A N     1 
ATOM   727  C CA    . LYS A 1 109 ? 39.583  49.652  40.214 1.00 36.70 ? 109  LYS A CA    1 
ATOM   728  C C     . LYS A 1 109 ? 38.654  50.816  40.566 1.00 35.72 ? 109  LYS A C     1 
ATOM   729  O O     . LYS A 1 109 ? 37.817  50.700  41.461 1.00 35.34 ? 109  LYS A O     1 
ATOM   730  C CB    . LYS A 1 109 ? 39.586  49.425  38.694 1.00 37.86 ? 109  LYS A CB    1 
ATOM   731  C CG    . LYS A 1 109 ? 40.323  48.173  38.236 1.00 40.97 ? 109  LYS A CG    1 
ATOM   732  C CD    . LYS A 1 109 ? 41.717  48.099  38.862 1.00 44.44 ? 109  LYS A CD    1 
ATOM   733  C CE    . LYS A 1 109 ? 42.350  46.714  38.693 1.00 46.58 ? 109  LYS A CE    1 
ATOM   734  N NZ    . LYS A 1 109 ? 43.412  46.479  39.727 1.00 47.66 ? 109  LYS A NZ    1 
ATOM   735  N N     . PHE A 1 110 ? 38.776  51.916  39.835 1.00 34.66 ? 110  PHE A N     1 
ATOM   736  C CA    . PHE A 1 110 ? 37.951  53.093  40.070 1.00 34.13 ? 110  PHE A CA    1 
ATOM   737  C C     . PHE A 1 110 ? 37.677  53.646  38.689 1.00 33.70 ? 110  PHE A C     1 
ATOM   738  O O     . PHE A 1 110 ? 38.288  54.626  38.266 1.00 34.54 ? 110  PHE A O     1 
ATOM   739  C CB    . PHE A 1 110 ? 38.730  54.109  40.906 1.00 33.22 ? 110  PHE A CB    1 
ATOM   740  C CG    . PHE A 1 110 ? 37.857  55.087  41.638 1.00 32.73 ? 110  PHE A CG    1 
ATOM   741  C CD1   . PHE A 1 110 ? 37.196  54.708  42.798 1.00 29.66 ? 110  PHE A CD1   1 
ATOM   742  C CD2   . PHE A 1 110 ? 37.697  56.386  41.169 1.00 32.65 ? 110  PHE A CD2   1 
ATOM   743  C CE1   . PHE A 1 110 ? 36.399  55.590  43.469 1.00 30.87 ? 110  PHE A CE1   1 
ATOM   744  C CE2   . PHE A 1 110 ? 36.895  57.283  41.846 1.00 32.73 ? 110  PHE A CE2   1 
ATOM   745  C CZ    . PHE A 1 110 ? 36.245  56.887  42.995 1.00 31.84 ? 110  PHE A CZ    1 
ATOM   746  N N     . LYS A 1 111 ? 36.755  53.001  37.992 1.00 33.94 ? 111  LYS A N     1 
ATOM   747  C CA    . LYS A 1 111 ? 36.419  53.356  36.624 1.00 34.66 ? 111  LYS A CA    1 
ATOM   748  C C     . LYS A 1 111 ? 35.151  54.187  36.420 1.00 35.61 ? 111  LYS A C     1 
ATOM   749  O O     . LYS A 1 111 ? 34.077  53.853  36.931 1.00 35.84 ? 111  LYS A O     1 
ATOM   750  C CB    . LYS A 1 111 ? 36.324  52.065  35.805 1.00 35.70 ? 111  LYS A CB    1 
ATOM   751  C CG    . LYS A 1 111 ? 36.129  52.241  34.304 1.00 39.30 ? 111  LYS A CG    1 
ATOM   752  C CD    . LYS A 1 111 ? 35.879  50.897  33.621 1.00 40.85 ? 111  LYS A CD    1 
ATOM   753  C CE    . LYS A 1 111 ? 35.741  51.035  32.111 1.00 41.81 ? 111  LYS A CE    1 
ATOM   754  N NZ    . LYS A 1 111 ? 35.493  49.701  31.468 1.00 42.54 ? 111  LYS A NZ    1 
ATOM   755  N N     . ASP A 1 112 ? 35.286  55.269  35.658 1.00 34.29 ? 112  ASP A N     1 
ATOM   756  C CA    . ASP A 1 112 ? 34.165  56.124  35.323 1.00 32.92 ? 112  ASP A CA    1 
ATOM   757  C C     . ASP A 1 112 ? 33.414  56.715  36.518 1.00 31.42 ? 112  ASP A C     1 
ATOM   758  O O     . ASP A 1 112 ? 32.199  56.535  36.641 1.00 30.84 ? 112  ASP A O     1 
ATOM   759  C CB    . ASP A 1 112 ? 33.172  55.333  34.469 1.00 35.79 ? 112  ASP A CB    1 
ATOM   760  C CG    . ASP A 1 112 ? 33.837  54.556  33.352 1.00 38.46 ? 112  ASP A CG    1 
ATOM   761  O OD1   . ASP A 1 112 ? 34.628  55.164  32.594 1.00 40.19 ? 112  ASP A OD1   1 
ATOM   762  O OD2   . ASP A 1 112 ? 33.550  53.336  33.232 1.00 40.19 ? 112  ASP A OD2   1 
ATOM   763  N N     . PHE A 1 113 ? 34.122  57.391  37.411 1.00 29.36 ? 113  PHE A N     1 
ATOM   764  C CA    . PHE A 1 113 ? 33.463  58.010  38.551 1.00 27.37 ? 113  PHE A CA    1 
ATOM   765  C C     . PHE A 1 113 ? 32.619  59.141  37.996 1.00 26.69 ? 113  PHE A C     1 
ATOM   766  O O     . PHE A 1 113 ? 33.130  59.982  37.274 1.00 28.83 ? 113  PHE A O     1 
ATOM   767  C CB    . PHE A 1 113 ? 34.482  58.598  39.528 1.00 25.20 ? 113  PHE A CB    1 
ATOM   768  C CG    . PHE A 1 113 ? 33.864  59.480  40.567 1.00 22.98 ? 113  PHE A CG    1 
ATOM   769  C CD1   . PHE A 1 113 ? 33.672  60.834  40.321 1.00 23.25 ? 113  PHE A CD1   1 
ATOM   770  C CD2   . PHE A 1 113 ? 33.404  58.947  41.756 1.00 21.24 ? 113  PHE A CD2   1 
ATOM   771  C CE1   . PHE A 1 113 ? 33.022  61.647  41.242 1.00 22.76 ? 113  PHE A CE1   1 
ATOM   772  C CE2   . PHE A 1 113 ? 32.752  59.745  42.686 1.00 22.40 ? 113  PHE A CE2   1 
ATOM   773  C CZ    . PHE A 1 113 ? 32.558  61.100  42.429 1.00 23.68 ? 113  PHE A CZ    1 
ATOM   774  N N     . LYS A 1 114 ? 31.352  59.205  38.371 1.00 25.80 ? 114  LYS A N     1 
ATOM   775  C CA    . LYS A 1 114 ? 30.503  60.266  37.872 1.00 24.29 ? 114  LYS A CA    1 
ATOM   776  C C     . LYS A 1 114 ? 29.526  60.773  38.901 1.00 21.87 ? 114  LYS A C     1 
ATOM   777  O O     . LYS A 1 114 ? 28.927  59.989  39.625 1.00 21.26 ? 114  LYS A O     1 
ATOM   778  C CB    . LYS A 1 114 ? 29.719  59.784  36.644 1.00 29.30 ? 114  LYS A CB    1 
ATOM   779  C CG    . LYS A 1 114 ? 28.788  60.848  36.062 1.00 32.60 ? 114  LYS A CG    1 
ATOM   780  C CD    . LYS A 1 114 ? 28.056  60.400  34.817 1.00 35.13 ? 114  LYS A CD    1 
ATOM   781  C CE    . LYS A 1 114 ? 27.168  61.542  34.305 1.00 37.31 ? 114  LYS A CE    1 
ATOM   782  N NZ    . LYS A 1 114 ? 26.236  61.123  33.200 1.00 40.96 ? 114  LYS A NZ    1 
ATOM   783  N N     . ILE A 1 115 ? 29.398  62.092  38.985 1.00 21.38 ? 115  ILE A N     1 
ATOM   784  C CA    . ILE A 1 115 ? 28.436  62.740  39.884 1.00 20.73 ? 115  ILE A CA    1 
ATOM   785  C C     . ILE A 1 115 ? 27.082  62.629  39.170 1.00 20.83 ? 115  ILE A C     1 
ATOM   786  O O     . ILE A 1 115 ? 26.951  63.043  38.016 1.00 21.39 ? 115  ILE A O     1 
ATOM   787  C CB    . ILE A 1 115 ? 28.770  64.226  40.088 1.00 19.70 ? 115  ILE A CB    1 
ATOM   788  C CG1   . ILE A 1 115 ? 30.163  64.362  40.731 1.00 17.20 ? 115  ILE A CG1   1 
ATOM   789  C CG2   . ILE A 1 115 ? 27.642  64.924  40.878 1.00 18.29 ? 115  ILE A CG2   1 
ATOM   790  C CD1   . ILE A 1 115 ? 30.292  63.773  42.107 1.00 13.65 ? 115  ILE A CD1   1 
ATOM   791  N N     . GLN A 1 116 ? 26.103  62.031  39.840 1.00 20.21 ? 116  GLN A N     1 
ATOM   792  C CA    . GLN A 1 116 ? 24.781  61.812  39.257 1.00 20.74 ? 116  GLN A CA    1 
ATOM   793  C C     . GLN A 1 116 ? 23.667  62.763  39.712 1.00 20.18 ? 116  GLN A C     1 
ATOM   794  O O     . GLN A 1 116 ? 22.683  62.953  39.002 1.00 20.49 ? 116  GLN A O     1 
ATOM   795  C CB    . GLN A 1 116 ? 24.351  60.378  39.532 1.00 21.05 ? 116  GLN A CB    1 
ATOM   796  C CG    . GLN A 1 116 ? 25.315  59.337  39.031 1.00 21.47 ? 116  GLN A CG    1 
ATOM   797  C CD    . GLN A 1 116 ? 25.137  59.061  37.576 1.00 22.54 ? 116  GLN A CD    1 
ATOM   798  O OE1   . GLN A 1 116 ? 24.307  59.679  36.907 1.00 23.57 ? 116  GLN A OE1   1 
ATOM   799  N NE2   . GLN A 1 116 ? 25.891  58.109  37.068 1.00 23.22 ? 116  GLN A NE2   1 
ATOM   800  N N     . ASN A 1 117 ? 23.807  63.340  40.896 1.00 19.69 ? 117  ASN A N     1 
ATOM   801  C CA    . ASN A 1 117 ? 22.799  64.247  41.409 1.00 19.00 ? 117  ASN A CA    1 
ATOM   802  C C     . ASN A 1 117 ? 23.402  65.066  42.539 1.00 19.06 ? 117  ASN A C     1 
ATOM   803  O O     . ASN A 1 117 ? 24.135  64.542  43.371 1.00 19.64 ? 117  ASN A O     1 
ATOM   804  C CB    . ASN A 1 117 ? 21.601  63.431  41.912 1.00 20.34 ? 117  ASN A CB    1 
ATOM   805  C CG    . ASN A 1 117 ? 20.447  64.302  42.424 1.00 21.57 ? 117  ASN A CG    1 
ATOM   806  O OD1   . ASN A 1 117 ? 20.139  65.363  41.878 1.00 20.42 ? 117  ASN A OD1   1 
ATOM   807  N ND2   . ASN A 1 117 ? 19.792  63.831  43.470 1.00 22.10 ? 117  ASN A ND2   1 
ATOM   808  N N     . ILE A 1 118 ? 23.178  66.369  42.507 1.00 19.40 ? 118  ILE A N     1 
ATOM   809  C CA    . ILE A 1 118 ? 23.662  67.261  43.546 1.00 18.80 ? 118  ILE A CA    1 
ATOM   810  C C     . ILE A 1 118 ? 22.393  67.868  44.124 1.00 19.50 ? 118  ILE A C     1 
ATOM   811  O O     . ILE A 1 118 ? 21.512  68.307  43.373 1.00 18.91 ? 118  ILE A O     1 
ATOM   812  C CB    . ILE A 1 118 ? 24.522  68.412  42.967 1.00 19.18 ? 118  ILE A CB    1 
ATOM   813  C CG1   . ILE A 1 118 ? 25.769  67.863  42.271 1.00 17.70 ? 118  ILE A CG1   1 
ATOM   814  C CG2   . ILE A 1 118 ? 24.876  69.419  44.058 1.00 17.12 ? 118  ILE A CG2   1 
ATOM   815  C CD1   . ILE A 1 118 ? 26.582  68.929  41.629 1.00 14.93 ? 118  ILE A CD1   1 
ATOM   816  N N     . VAL A 1 119 ? 22.292  67.883  45.447 1.00 19.62 ? 119  VAL A N     1 
ATOM   817  C CA    . VAL A 1 119 ? 21.122  68.445  46.124 1.00 19.09 ? 119  VAL A CA    1 
ATOM   818  C C     . VAL A 1 119 ? 21.566  69.673  46.924 1.00 17.65 ? 119  VAL A C     1 
ATOM   819  O O     . VAL A 1 119 ? 22.510  69.591  47.691 1.00 18.39 ? 119  VAL A O     1 
ATOM   820  C CB    . VAL A 1 119 ? 20.478  67.375  47.065 1.00 18.85 ? 119  VAL A CB    1 
ATOM   821  C CG1   . VAL A 1 119 ? 19.192  67.907  47.714 1.00 15.57 ? 119  VAL A CG1   1 
ATOM   822  C CG2   . VAL A 1 119 ? 20.224  66.088  46.274 1.00 16.36 ? 119  VAL A CG2   1 
ATOM   823  N N     . GLY A 1 120 ? 20.914  70.809  46.734 1.00 16.97 ? 120  GLY A N     1 
ATOM   824  C CA    . GLY A 1 120 ? 21.310  71.990  47.474 1.00 16.92 ? 120  GLY A CA    1 
ATOM   825  C C     . GLY A 1 120 ? 20.083  72.675  48.026 1.00 18.27 ? 120  GLY A C     1 
ATOM   826  O O     . GLY A 1 120 ? 18.978  72.360  47.596 1.00 18.94 ? 120  GLY A O     1 
ATOM   827  N N     . SER A 1 121 ? 20.262  73.605  48.958 1.00 18.42 ? 121  SER A N     1 
ATOM   828  C CA    . SER A 1 121 ? 19.146  74.334  49.546 1.00 20.19 ? 121  SER A CA    1 
ATOM   829  C C     . SER A 1 121 ? 19.609  75.678  50.061 1.00 22.54 ? 121  SER A C     1 
ATOM   830  O O     . SER A 1 121 ? 20.787  75.848  50.390 1.00 23.48 ? 121  SER A O     1 
ATOM   831  C CB    . SER A 1 121 ? 18.554  73.565  50.723 1.00 19.20 ? 121  SER A CB    1 
ATOM   832  O OG    . SER A 1 121 ? 19.402  73.644  51.857 1.00 19.97 ? 121  SER A OG    1 
ATOM   833  N N     . CYS A 1 122 ? 18.691  76.638  50.113 1.00 24.51 ? 122  CYS A N     1 
ATOM   834  C CA    . CYS A 1 122 ? 18.992  77.963  50.649 1.00 26.59 ? 122  CYS A CA    1 
ATOM   835  C C     . CYS A 1 122 ? 17.752  78.655  51.195 1.00 26.55 ? 122  CYS A C     1 
ATOM   836  O O     . CYS A 1 122 ? 16.637  78.157  51.061 1.00 25.99 ? 122  CYS A O     1 
ATOM   837  C CB    . CYS A 1 122 ? 19.736  78.837  49.647 1.00 28.36 ? 122  CYS A CB    1 
ATOM   838  S SG    . CYS A 1 122 ? 18.947  78.940  48.116 1.00 32.18 ? 122  CYS A SG    1 
ATOM   839  N N     . ASP A 1 123 ? 17.964  79.795  51.834 1.00 27.02 ? 123  ASP A N     1 
ATOM   840  C CA    . ASP A 1 123 ? 16.902  80.537  52.476 1.00 27.32 ? 123  ASP A CA    1 
ATOM   841  C C     . ASP A 1 123 ? 16.932  81.955  51.956 1.00 28.57 ? 123  ASP A C     1 
ATOM   842  O O     . ASP A 1 123 ? 17.884  82.673  52.218 1.00 29.56 ? 123  ASP A O     1 
ATOM   843  C CB    . ASP A 1 123 ? 17.206  80.529  53.973 1.00 27.88 ? 123  ASP A CB    1 
ATOM   844  C CG    . ASP A 1 123 ? 16.113  81.141  54.820 1.00 29.88 ? 123  ASP A CG    1 
ATOM   845  O OD1   . ASP A 1 123 ? 15.085  81.608  54.281 1.00 29.23 ? 123  ASP A OD1   1 
ATOM   846  O OD2   . ASP A 1 123 ? 16.295  81.134  56.060 1.00 32.02 ? 123  ASP A OD2   1 
ATOM   847  N N     . VAL A 1 124 ? 15.903  82.358  51.214 1.00 29.74 ? 124  VAL A N     1 
ATOM   848  C CA    . VAL A 1 124 ? 15.835  83.715  50.675 1.00 30.31 ? 124  VAL A CA    1 
ATOM   849  C C     . VAL A 1 124 ? 15.467  84.699  51.778 1.00 31.28 ? 124  VAL A C     1 
ATOM   850  O O     . VAL A 1 124 ? 15.530  85.913  51.601 1.00 31.44 ? 124  VAL A O     1 
ATOM   851  C CB    . VAL A 1 124 ? 14.834  83.839  49.501 1.00 31.55 ? 124  VAL A CB    1 
ATOM   852  C CG1   . VAL A 1 124 ? 15.274  82.939  48.350 1.00 31.28 ? 124  VAL A CG1   1 
ATOM   853  C CG2   . VAL A 1 124 ? 13.396  83.522  49.961 1.00 30.29 ? 124  VAL A CG2   1 
ATOM   854  N N     . LYS A 1 125 ? 15.052  84.155  52.911 1.00 32.11 ? 125  LYS A N     1 
ATOM   855  C CA    . LYS A 1 125 ? 14.707  84.947  54.078 1.00 33.71 ? 125  LYS A CA    1 
ATOM   856  C C     . LYS A 1 125 ? 13.461  85.822  53.980 1.00 33.74 ? 125  LYS A C     1 
ATOM   857  O O     . LYS A 1 125 ? 13.354  86.862  54.641 1.00 35.45 ? 125  LYS A O     1 
ATOM   858  C CB    . LYS A 1 125 ? 15.928  85.742  54.544 1.00 35.12 ? 125  LYS A CB    1 
ATOM   859  C CG    . LYS A 1 125 ? 17.064  84.845  54.993 1.00 38.39 ? 125  LYS A CG    1 
ATOM   860  C CD    . LYS A 1 125 ? 18.236  85.643  55.517 1.00 42.26 ? 125  LYS A CD    1 
ATOM   861  C CE    . LYS A 1 125 ? 19.210  84.741  56.260 1.00 44.91 ? 125  LYS A CE    1 
ATOM   862  N NZ    . LYS A 1 125 ? 20.203  85.532  57.049 1.00 47.44 ? 125  LYS A NZ    1 
ATOM   863  N N     . PHE A 1 126 ? 12.523  85.397  53.141 1.00 32.49 ? 126  PHE A N     1 
ATOM   864  C CA    . PHE A 1 126 ? 11.234  86.068  52.998 1.00 29.01 ? 126  PHE A CA    1 
ATOM   865  C C     . PHE A 1 126 ? 10.229  85.029  52.502 1.00 28.29 ? 126  PHE A C     1 
ATOM   866  O O     . PHE A 1 126 ? 10.608  84.078  51.803 1.00 27.71 ? 126  PHE A O     1 
ATOM   867  C CB    . PHE A 1 126 ? 11.300  87.334  52.111 1.00 25.58 ? 126  PHE A CB    1 
ATOM   868  C CG    . PHE A 1 126 ? 11.698  87.091  50.675 1.00 24.99 ? 126  PHE A CG    1 
ATOM   869  C CD1   . PHE A 1 126 ? 10.796  86.555  49.755 1.00 24.39 ? 126  PHE A CD1   1 
ATOM   870  C CD2   . PHE A 1 126 ? 12.961  87.463  50.221 1.00 24.35 ? 126  PHE A CD2   1 
ATOM   871  C CE1   . PHE A 1 126 ? 11.146  86.401  48.415 1.00 23.82 ? 126  PHE A CE1   1 
ATOM   872  C CE2   . PHE A 1 126 ? 13.321  87.311  48.875 1.00 23.38 ? 126  PHE A CE2   1 
ATOM   873  C CZ    . PHE A 1 126 ? 12.418  86.783  47.978 1.00 22.80 ? 126  PHE A CZ    1 
ATOM   874  N N     . PRO A 1 127 ? 8.976   85.102  52.991 1.00 27.29 ? 127  PRO A N     1 
ATOM   875  C CA    . PRO A 1 127 ? 7.927   84.162  52.583 1.00 26.25 ? 127  PRO A CA    1 
ATOM   876  C C     . PRO A 1 127 ? 7.427   84.383  51.143 1.00 25.66 ? 127  PRO A C     1 
ATOM   877  O O     . PRO A 1 127 ? 7.444   85.504  50.614 1.00 23.51 ? 127  PRO A O     1 
ATOM   878  C CB    . PRO A 1 127 ? 6.842   84.371  53.645 1.00 25.80 ? 127  PRO A CB    1 
ATOM   879  C CG    . PRO A 1 127 ? 6.984   85.798  53.991 1.00 27.37 ? 127  PRO A CG    1 
ATOM   880  C CD    . PRO A 1 127 ? 8.491   86.003  54.051 1.00 27.41 ? 127  PRO A CD    1 
ATOM   881  N N     . ILE A 1 128 ? 6.958   83.298  50.530 1.00 25.87 ? 128  ILE A N     1 
ATOM   882  C CA    . ILE A 1 128 ? 6.491   83.308  49.148 1.00 24.75 ? 128  ILE A CA    1 
ATOM   883  C C     . ILE A 1 128 ? 4.996   83.045  49.023 1.00 24.98 ? 128  ILE A C     1 
ATOM   884  O O     . ILE A 1 128 ? 4.433   82.230  49.759 1.00 24.28 ? 128  ILE A O     1 
ATOM   885  C CB    . ILE A 1 128 ? 7.226   82.207  48.313 1.00 24.29 ? 128  ILE A CB    1 
ATOM   886  C CG1   . ILE A 1 128 ? 8.711   82.133  48.698 1.00 25.47 ? 128  ILE A CG1   1 
ATOM   887  C CG2   . ILE A 1 128 ? 7.068   82.452  46.796 1.00 22.22 ? 128  ILE A CG2   1 
ATOM   888  C CD1   . ILE A 1 128 ? 9.480   83.406  48.474 1.00 25.19 ? 128  ILE A CD1   1 
ATOM   889  N N     . ARG A 1 129 ? 4.360   83.750  48.088 1.00 25.37 ? 129  ARG A N     1 
ATOM   890  C CA    . ARG A 1 129 ? 2.948   83.575  47.785 1.00 24.65 ? 129  ARG A CA    1 
ATOM   891  C C     . ARG A 1 129 ? 2.964   82.443  46.778 1.00 23.90 ? 129  ARG A C     1 
ATOM   892  O O     . ARG A 1 129 ? 2.892   82.686  45.573 1.00 24.35 ? 129  ARG A O     1 
ATOM   893  C CB    . ARG A 1 129 ? 2.373   84.799  47.085 1.00 25.06 ? 129  ARG A CB    1 
ATOM   894  C CG    . ARG A 1 129 ? 2.083   85.983  47.967 1.00 27.40 ? 129  ARG A CG    1 
ATOM   895  C CD    . ARG A 1 129 ? 1.059   86.909  47.291 1.00 27.88 ? 129  ARG A CD    1 
ATOM   896  N NE    . ARG A 1 129 ? 1.418   87.254  45.916 1.00 29.53 ? 129  ARG A NE    1 
ATOM   897  C CZ    . ARG A 1 129 ? 0.693   86.938  44.850 1.00 30.37 ? 129  ARG A CZ    1 
ATOM   898  N NH1   . ARG A 1 129 ? -0.435  86.255  44.988 1.00 28.47 ? 129  ARG A NH1   1 
ATOM   899  N NH2   . ARG A 1 129 ? 1.093   87.324  43.643 1.00 32.45 ? 129  ARG A NH2   1 
ATOM   900  N N     . LEU A 1 130 ? 3.071   81.214  47.272 1.00 23.77 ? 130  LEU A N     1 
ATOM   901  C CA    . LEU A 1 130 ? 3.143   80.037  46.420 1.00 23.41 ? 130  LEU A CA    1 
ATOM   902  C C     . LEU A 1 130 ? 2.046   79.891  45.387 1.00 25.14 ? 130  LEU A C     1 
ATOM   903  O O     . LEU A 1 130 ? 2.320   79.485  44.260 1.00 26.47 ? 130  LEU A O     1 
ATOM   904  C CB    . LEU A 1 130 ? 3.225   78.776  47.270 1.00 21.64 ? 130  LEU A CB    1 
ATOM   905  C CG    . LEU A 1 130 ? 4.495   78.640  48.097 1.00 18.63 ? 130  LEU A CG    1 
ATOM   906  C CD1   . LEU A 1 130 ? 4.561   77.255  48.706 1.00 18.63 ? 130  LEU A CD1   1 
ATOM   907  C CD2   . LEU A 1 130 ? 5.693   78.867  47.198 1.00 17.12 ? 130  LEU A CD2   1 
ATOM   908  N N     . GLU A 1 131 ? 0.811   80.228  45.754 1.00 27.49 ? 131  GLU A N     1 
ATOM   909  C CA    . GLU A 1 131 ? -0.316  80.113  44.834 1.00 28.30 ? 131  GLU A CA    1 
ATOM   910  C C     . GLU A 1 131 ? -0.188  81.078  43.666 1.00 27.06 ? 131  GLU A C     1 
ATOM   911  O O     . GLU A 1 131 ? -0.483  80.717  42.531 1.00 27.67 ? 131  GLU A O     1 
ATOM   912  C CB    . GLU A 1 131 ? -1.646  80.313  45.566 1.00 33.72 ? 131  GLU A CB    1 
ATOM   913  C CG    . GLU A 1 131 ? -2.881  79.916  44.743 1.00 41.92 ? 131  GLU A CG    1 
ATOM   914  C CD    . GLU A 1 131 ? -2.706  78.572  44.014 1.00 48.02 ? 131  GLU A CD    1 
ATOM   915  O OE1   . GLU A 1 131 ? -2.695  77.508  44.685 1.00 51.85 ? 131  GLU A OE1   1 
ATOM   916  O OE2   . GLU A 1 131 ? -2.571  78.585  42.765 1.00 51.16 ? 131  GLU A OE2   1 
ATOM   917  N N     . GLY A 1 132 ? 0.275   82.294  43.938 1.00 26.17 ? 132  GLY A N     1 
ATOM   918  C CA    . GLY A 1 132 ? 0.456   83.263  42.877 1.00 25.43 ? 132  GLY A CA    1 
ATOM   919  C C     . GLY A 1 132 ? 1.596   82.849  41.966 1.00 26.81 ? 132  GLY A C     1 
ATOM   920  O O     . GLY A 1 132 ? 1.510   82.955  40.737 1.00 26.14 ? 132  GLY A O     1 
ATOM   921  N N     . LEU A 1 133 ? 2.677   82.366  42.566 1.00 27.22 ? 133  LEU A N     1 
ATOM   922  C CA    . LEU A 1 133 ? 3.816   81.927  41.773 1.00 28.71 ? 133  LEU A CA    1 
ATOM   923  C C     . LEU A 1 133 ? 3.348   80.797  40.876 1.00 28.86 ? 133  LEU A C     1 
ATOM   924  O O     . LEU A 1 133 ? 3.632   80.784  39.682 1.00 30.39 ? 133  LEU A O     1 
ATOM   925  C CB    . LEU A 1 133 ? 4.974   81.461  42.670 1.00 28.14 ? 133  LEU A CB    1 
ATOM   926  C CG    . LEU A 1 133 ? 6.401   81.532  42.091 1.00 27.56 ? 133  LEU A CG    1 
ATOM   927  C CD1   . LEU A 1 133 ? 7.403   81.335  43.200 1.00 26.62 ? 133  LEU A CD1   1 
ATOM   928  C CD2   . LEU A 1 133 ? 6.619   80.513  40.976 1.00 26.85 ? 133  LEU A CD2   1 
ATOM   929  N N     . ALA A 1 134 ? 2.597   79.870  41.455 1.00 30.17 ? 134  ALA A N     1 
ATOM   930  C CA    . ALA A 1 134 ? 2.085   78.729  40.716 1.00 32.56 ? 134  ALA A CA    1 
ATOM   931  C C     . ALA A 1 134 ? 1.191   79.183  39.578 1.00 34.81 ? 134  ALA A C     1 
ATOM   932  O O     . ALA A 1 134 ? 1.381   78.779  38.431 1.00 35.77 ? 134  ALA A O     1 
ATOM   933  C CB    . ALA A 1 134 ? 1.317   77.803  41.650 1.00 30.96 ? 134  ALA A CB    1 
ATOM   934  N N     . TYR A 1 135 ? 0.239   80.055  39.896 1.00 37.90 ? 135  TYR A N     1 
ATOM   935  C CA    . TYR A 1 135 ? -0.709  80.562  38.911 1.00 39.41 ? 135  TYR A CA    1 
ATOM   936  C C     . TYR A 1 135 ? -0.027  81.317  37.777 1.00 39.21 ? 135  TYR A C     1 
ATOM   937  O O     . TYR A 1 135 ? -0.407  81.172  36.610 1.00 39.60 ? 135  TYR A O     1 
ATOM   938  C CB    . TYR A 1 135 ? -1.773  81.446  39.581 1.00 41.83 ? 135  TYR A CB    1 
ATOM   939  C CG    . TYR A 1 135 ? -2.825  81.946  38.619 1.00 44.61 ? 135  TYR A CG    1 
ATOM   940  C CD1   . TYR A 1 135 ? -3.823  81.096  38.146 1.00 46.59 ? 135  TYR A CD1   1 
ATOM   941  C CD2   . TYR A 1 135 ? -2.784  83.247  38.123 1.00 45.60 ? 135  TYR A CD2   1 
ATOM   942  C CE1   . TYR A 1 135 ? -4.751  81.526  37.195 1.00 47.30 ? 135  TYR A CE1   1 
ATOM   943  C CE2   . TYR A 1 135 ? -3.706  83.687  37.172 1.00 47.12 ? 135  TYR A CE2   1 
ATOM   944  C CZ    . TYR A 1 135 ? -4.683  82.821  36.709 1.00 47.49 ? 135  TYR A CZ    1 
ATOM   945  O OH    . TYR A 1 135 ? -5.571  83.235  35.740 1.00 48.61 ? 135  TYR A OH    1 
ATOM   946  N N     . SER A 1 136 ? 1.004   82.083  38.102 1.00 38.87 ? 136  SER A N     1 
ATOM   947  C CA    . SER A 1 136 ? 1.696   82.843  37.076 1.00 40.60 ? 136  SER A CA    1 
ATOM   948  C C     . SER A 1 136 ? 2.638   81.988  36.251 1.00 41.55 ? 136  SER A C     1 
ATOM   949  O O     . SER A 1 136 ? 3.099   82.422  35.192 1.00 42.52 ? 136  SER A O     1 
ATOM   950  C CB    . SER A 1 136 ? 2.479   83.992  37.695 1.00 41.42 ? 136  SER A CB    1 
ATOM   951  O OG    . SER A 1 136 ? 3.485   83.497  38.559 1.00 44.21 ? 136  SER A OG    1 
ATOM   952  N N     . HIS A 1 137 ? 2.976   80.801  36.754 1.00 41.98 ? 137  HIS A N     1 
ATOM   953  C CA    . HIS A 1 137 ? 3.890   79.896  36.050 1.00 40.52 ? 137  HIS A CA    1 
ATOM   954  C C     . HIS A 1 137 ? 3.356   78.478  36.027 1.00 39.41 ? 137  HIS A C     1 
ATOM   955  O O     . HIS A 1 137 ? 4.069   77.549  36.398 1.00 40.44 ? 137  HIS A O     1 
ATOM   956  C CB    . HIS A 1 137 ? 5.265   79.870  36.734 1.00 41.05 ? 137  HIS A CB    1 
ATOM   957  C CG    . HIS A 1 137 ? 5.962   81.192  36.762 1.00 39.58 ? 137  HIS A CG    1 
ATOM   958  N ND1   . HIS A 1 137 ? 7.141   81.425  36.089 1.00 38.95 ? 137  HIS A ND1   1 
ATOM   959  C CD2   . HIS A 1 137 ? 5.647   82.351  37.385 1.00 38.30 ? 137  HIS A CD2   1 
ATOM   960  C CE1   . HIS A 1 137 ? 7.520   82.672  36.292 1.00 39.07 ? 137  HIS A CE1   1 
ATOM   961  N NE2   . HIS A 1 137 ? 6.629   83.256  37.073 1.00 38.74 ? 137  HIS A NE2   1 
ATOM   962  N N     . ALA A 1 138 ? 2.128   78.299  35.563 1.00 38.72 ? 138  ALA A N     1 
ATOM   963  C CA    . ALA A 1 138 ? 1.527   76.970  35.522 1.00 37.92 ? 138  ALA A CA    1 
ATOM   964  C C     . ALA A 1 138 ? 2.360   75.968  34.730 1.00 37.30 ? 138  ALA A C     1 
ATOM   965  O O     . ALA A 1 138 ? 2.544   74.834  35.150 1.00 38.84 ? 138  ALA A O     1 
ATOM   966  C CB    . ALA A 1 138 ? 0.122   77.047  34.963 1.00 37.93 ? 138  ALA A CB    1 
ATOM   967  N N     . ALA A 1 139 ? 2.907   76.408  33.608 1.00 37.35 ? 139  ALA A N     1 
ATOM   968  C CA    . ALA A 1 139 ? 3.719   75.546  32.756 1.00 37.20 ? 139  ALA A CA    1 
ATOM   969  C C     . ALA A 1 139 ? 4.904   74.857  33.461 1.00 37.79 ? 139  ALA A C     1 
ATOM   970  O O     . ALA A 1 139 ? 5.358   73.802  33.018 1.00 39.20 ? 139  ALA A O     1 
ATOM   971  C CB    . ALA A 1 139 ? 4.214   76.340  31.560 1.00 36.33 ? 139  ALA A CB    1 
ATOM   972  N N     . PHE A 1 140 ? 5.400   75.447  34.546 1.00 36.80 ? 140  PHE A N     1 
ATOM   973  C CA    . PHE A 1 140 ? 6.538   74.889  35.271 1.00 35.67 ? 140  PHE A CA    1 
ATOM   974  C C     . PHE A 1 140 ? 6.204   74.425  36.673 1.00 34.22 ? 140  PHE A C     1 
ATOM   975  O O     . PHE A 1 140 ? 6.992   73.710  37.288 1.00 33.51 ? 140  PHE A O     1 
ATOM   976  C CB    . PHE A 1 140 ? 7.614   75.948  35.459 1.00 38.16 ? 140  PHE A CB    1 
ATOM   977  C CG    . PHE A 1 140 ? 7.971   76.685  34.224 1.00 41.15 ? 140  PHE A CG    1 
ATOM   978  C CD1   . PHE A 1 140 ? 7.219   77.780  33.818 1.00 42.96 ? 140  PHE A CD1   1 
ATOM   979  C CD2   . PHE A 1 140 ? 9.089   76.317  33.482 1.00 42.08 ? 140  PHE A CD2   1 
ATOM   980  C CE1   . PHE A 1 140 ? 7.578   78.506  32.682 1.00 44.23 ? 140  PHE A CE1   1 
ATOM   981  C CE2   . PHE A 1 140 ? 9.458   77.032  32.350 1.00 43.06 ? 140  PHE A CE2   1 
ATOM   982  C CZ    . PHE A 1 140 ? 8.702   78.130  31.947 1.00 43.62 ? 140  PHE A CZ    1 
ATOM   983  N N     . SER A 1 141 ? 5.054   74.841  37.185 1.00 32.16 ? 141  SER A N     1 
ATOM   984  C CA    . SER A 1 141 ? 4.699   74.547  38.554 1.00 30.31 ? 141  SER A CA    1 
ATOM   985  C C     . SER A 1 141 ? 3.681   73.457  38.826 1.00 30.42 ? 141  SER A C     1 
ATOM   986  O O     . SER A 1 141 ? 2.815   73.179  38.003 1.00 32.20 ? 141  SER A O     1 
ATOM   987  C CB    . SER A 1 141 ? 4.221   75.842  39.215 1.00 30.23 ? 141  SER A CB    1 
ATOM   988  O OG    . SER A 1 141 ? 5.090   76.933  38.938 1.00 29.68 ? 141  SER A OG    1 
ATOM   989  N N     . SER A 1 142 ? 3.810   72.852  40.004 1.00 29.28 ? 142  SER A N     1 
ATOM   990  C CA    . SER A 1 142 ? 2.900   71.833  40.507 1.00 28.84 ? 142  SER A CA    1 
ATOM   991  C C     . SER A 1 142 ? 2.813   72.182  41.981 1.00 28.13 ? 142  SER A C     1 
ATOM   992  O O     . SER A 1 142 ? 3.778   71.992  42.720 1.00 27.59 ? 142  SER A O     1 
ATOM   993  C CB    . SER A 1 142 ? 3.469   70.414  40.382 1.00 30.16 ? 142  SER A CB    1 
ATOM   994  O OG    . SER A 1 142 ? 3.765   70.057  39.041 1.00 35.08 ? 142  SER A OG    1 
ATOM   995  N N     . TYR A 1 143 ? 1.702   72.779  42.390 1.00 27.48 ? 143  TYR A N     1 
ATOM   996  C CA    . TYR A 1 143 ? 1.501   73.148  43.784 1.00 26.83 ? 143  TYR A CA    1 
ATOM   997  C C     . TYR A 1 143 ? 0.147   72.590  44.228 1.00 28.92 ? 143  TYR A C     1 
ATOM   998  O O     . TYR A 1 143 ? -0.896  73.017  43.743 1.00 30.55 ? 143  TYR A O     1 
ATOM   999  C CB    . TYR A 1 143 ? 1.521   74.672  43.931 1.00 24.03 ? 143  TYR A CB    1 
ATOM   1000 C CG    . TYR A 1 143 ? 1.270   75.177  45.337 1.00 21.55 ? 143  TYR A CG    1 
ATOM   1001 C CD1   . TYR A 1 143 ? 1.982   74.677  46.427 1.00 20.60 ? 143  TYR A CD1   1 
ATOM   1002 C CD2   . TYR A 1 143 ? 0.320   76.165  45.575 1.00 20.51 ? 143  TYR A CD2   1 
ATOM   1003 C CE1   . TYR A 1 143 ? 1.747   75.159  47.722 1.00 18.75 ? 143  TYR A CE1   1 
ATOM   1004 C CE2   . TYR A 1 143 ? 0.081   76.642  46.852 1.00 16.86 ? 143  TYR A CE2   1 
ATOM   1005 C CZ    . TYR A 1 143 ? 0.798   76.143  47.912 1.00 17.58 ? 143  TYR A CZ    1 
ATOM   1006 O OH    . TYR A 1 143 ? 0.584   76.672  49.153 1.00 18.46 ? 143  TYR A OH    1 
ATOM   1007 N N     . GLU A 1 144 ? 0.184   71.566  45.069 1.00 29.23 ? 144  GLU A N     1 
ATOM   1008 C CA    . GLU A 1 144 ? -1.007  70.930  45.611 1.00 28.74 ? 144  GLU A CA    1 
ATOM   1009 C C     . GLU A 1 144 ? -0.648  70.780  47.077 1.00 28.47 ? 144  GLU A C     1 
ATOM   1010 O O     . GLU A 1 144 ? -0.228  69.712  47.529 1.00 29.69 ? 144  GLU A O     1 
ATOM   1011 C CB    . GLU A 1 144 ? -1.227  69.558  44.975 1.00 30.06 ? 144  GLU A CB    1 
ATOM   1012 C CG    . GLU A 1 144 ? -1.474  69.593  43.469 1.00 35.57 ? 144  GLU A CG    1 
ATOM   1013 C CD    . GLU A 1 144 ? -2.771  70.316  43.073 1.00 39.89 ? 144  GLU A CD    1 
ATOM   1014 O OE1   . GLU A 1 144 ? -3.574  70.668  43.968 1.00 42.32 ? 144  GLU A OE1   1 
ATOM   1015 O OE2   . GLU A 1 144 ? -2.992  70.532  41.857 1.00 40.84 ? 144  GLU A OE2   1 
ATOM   1016 N N     . PRO A 1 145 ? -0.795  71.866  47.842 1.00 27.15 ? 145  PRO A N     1 
ATOM   1017 C CA    . PRO A 1 145 ? -0.488  71.927  49.273 1.00 27.75 ? 145  PRO A CA    1 
ATOM   1018 C C     . PRO A 1 145 ? -1.044  70.788  50.125 1.00 29.32 ? 145  PRO A C     1 
ATOM   1019 O O     . PRO A 1 145 ? -0.464  70.441  51.160 1.00 29.68 ? 145  PRO A O     1 
ATOM   1020 C CB    . PRO A 1 145 ? -1.050  73.287  49.682 1.00 26.92 ? 145  PRO A CB    1 
ATOM   1021 C CG    . PRO A 1 145 ? -2.123  73.546  48.658 1.00 26.40 ? 145  PRO A CG    1 
ATOM   1022 C CD    . PRO A 1 145 ? -1.485  73.087  47.402 1.00 26.10 ? 145  PRO A CD    1 
ATOM   1023 N N     . GLU A 1 146 ? -2.169  70.216  49.710 1.00 29.29 ? 146  GLU A N     1 
ATOM   1024 C CA    . GLU A 1 146 ? -2.756  69.116  50.458 1.00 29.67 ? 146  GLU A CA    1 
ATOM   1025 C C     . GLU A 1 146 ? -1.967  67.826  50.301 1.00 29.41 ? 146  GLU A C     1 
ATOM   1026 O O     . GLU A 1 146 ? -2.050  66.947  51.149 1.00 31.06 ? 146  GLU A O     1 
ATOM   1027 C CB    . GLU A 1 146 ? -4.221  68.942  50.078 1.00 29.79 ? 146  GLU A CB    1 
ATOM   1028 C CG    . GLU A 1 146 ? -5.032  70.138  50.533 1.00 29.06 ? 146  GLU A CG    1 
ATOM   1029 C CD    . GLU A 1 146 ? -6.414  70.179  49.957 1.00 29.28 ? 146  GLU A CD    1 
ATOM   1030 O OE1   . GLU A 1 146 ? -6.701  69.387  49.041 1.00 28.97 ? 146  GLU A OE1   1 
ATOM   1031 O OE2   . GLU A 1 146 ? -7.214  71.019  50.419 1.00 31.58 ? 146  GLU A OE2   1 
ATOM   1032 N N     . LEU A 1 147 ? -1.167  67.744  49.242 1.00 30.00 ? 147  LEU A N     1 
ATOM   1033 C CA    . LEU A 1 147 ? -0.328  66.578  48.975 1.00 29.29 ? 147  LEU A CA    1 
ATOM   1034 C C     . LEU A 1 147 ? 1.098   66.816  49.506 1.00 27.78 ? 147  LEU A C     1 
ATOM   1035 O O     . LEU A 1 147 ? 1.649   65.996  50.235 1.00 26.73 ? 147  LEU A O     1 
ATOM   1036 C CB    . LEU A 1 147 ? -0.301  66.292  47.468 1.00 30.98 ? 147  LEU A CB    1 
ATOM   1037 C CG    . LEU A 1 147 ? -1.673  66.105  46.799 1.00 32.50 ? 147  LEU A CG    1 
ATOM   1038 C CD1   . LEU A 1 147 ? -1.572  66.153  45.272 1.00 33.10 ? 147  LEU A CD1   1 
ATOM   1039 C CD2   . LEU A 1 147 ? -2.288  64.789  47.244 1.00 33.56 ? 147  LEU A CD2   1 
ATOM   1040 N N     . PHE A 1 148 ? 1.673   67.959  49.154 1.00 26.38 ? 148  PHE A N     1 
ATOM   1041 C CA    . PHE A 1 148 ? 3.024   68.333  49.579 1.00 25.11 ? 148  PHE A CA    1 
ATOM   1042 C C     . PHE A 1 148 ? 2.983   69.856  49.721 1.00 24.42 ? 148  PHE A C     1 
ATOM   1043 O O     . PHE A 1 148 ? 2.620   70.563  48.779 1.00 24.84 ? 148  PHE A O     1 
ATOM   1044 C CB    . PHE A 1 148 ? 4.066   67.903  48.520 1.00 26.22 ? 148  PHE A CB    1 
ATOM   1045 C CG    . PHE A 1 148 ? 5.501   68.153  48.932 1.00 25.70 ? 148  PHE A CG    1 
ATOM   1046 C CD1   . PHE A 1 148 ? 6.048   67.501  50.041 1.00 25.55 ? 148  PHE A CD1   1 
ATOM   1047 C CD2   . PHE A 1 148 ? 6.283   69.081  48.255 1.00 25.26 ? 148  PHE A CD2   1 
ATOM   1048 C CE1   . PHE A 1 148 ? 7.349   67.780  50.473 1.00 24.50 ? 148  PHE A CE1   1 
ATOM   1049 C CE2   . PHE A 1 148 ? 7.588   69.367  48.682 1.00 24.33 ? 148  PHE A CE2   1 
ATOM   1050 C CZ    . PHE A 1 148 ? 8.116   68.717  49.790 1.00 22.84 ? 148  PHE A CZ    1 
ATOM   1051 N N     . PRO A 1 149 ? 3.375   70.383  50.889 1.00 22.86 ? 149  PRO A N     1 
ATOM   1052 C CA    . PRO A 1 149 ? 3.364   71.823  51.144 1.00 22.68 ? 149  PRO A CA    1 
ATOM   1053 C C     . PRO A 1 149 ? 4.288   72.681  50.273 1.00 23.85 ? 149  PRO A C     1 
ATOM   1054 O O     . PRO A 1 149 ? 4.263   73.912  50.363 1.00 24.28 ? 149  PRO A O     1 
ATOM   1055 C CB    . PRO A 1 149 ? 3.760   71.901  52.616 1.00 22.65 ? 149  PRO A CB    1 
ATOM   1056 C CG    . PRO A 1 149 ? 4.720   70.772  52.751 1.00 22.87 ? 149  PRO A CG    1 
ATOM   1057 C CD    . PRO A 1 149 ? 4.011   69.663  52.009 1.00 21.93 ? 149  PRO A CD    1 
ATOM   1058 N N     . GLY A 1 150 ? 5.107   72.052  49.444 1.00 23.32 ? 150  GLY A N     1 
ATOM   1059 C CA    . GLY A 1 150 ? 6.002   72.828  48.617 1.00 22.11 ? 150  GLY A CA    1 
ATOM   1060 C C     . GLY A 1 150 ? 5.552   72.914  47.183 1.00 22.08 ? 150  GLY A C     1 
ATOM   1061 O O     . GLY A 1 150 ? 4.791   72.071  46.714 1.00 22.86 ? 150  GLY A O     1 
ATOM   1062 N N     . LEU A 1 151 ? 5.981   73.964  46.501 1.00 20.87 ? 151  LEU A N     1 
ATOM   1063 C CA    . LEU A 1 151 ? 5.659   74.150  45.102 1.00 20.73 ? 151  LEU A CA    1 
ATOM   1064 C C     . LEU A 1 151 ? 6.768   73.444  44.319 1.00 21.85 ? 151  LEU A C     1 
ATOM   1065 O O     . LEU A 1 151 ? 7.961   73.622  44.605 1.00 21.82 ? 151  LEU A O     1 
ATOM   1066 C CB    . LEU A 1 151 ? 5.611   75.648  44.769 1.00 19.46 ? 151  LEU A CB    1 
ATOM   1067 C CG    . LEU A 1 151 ? 5.292   76.064  43.331 1.00 19.78 ? 151  LEU A CG    1 
ATOM   1068 C CD1   . LEU A 1 151 ? 4.628   77.416  43.325 1.00 21.02 ? 151  LEU A CD1   1 
ATOM   1069 C CD2   . LEU A 1 151 ? 6.545   76.088  42.484 1.00 18.32 ? 151  LEU A CD2   1 
ATOM   1070 N N     . ILE A 1 152 ? 6.380   72.598  43.377 1.00 21.80 ? 152  ILE A N     1 
ATOM   1071 C CA    . ILE A 1 152 ? 7.349   71.879  42.582 1.00 21.80 ? 152  ILE A CA    1 
ATOM   1072 C C     . ILE A 1 152 ? 7.564   72.675  41.304 1.00 21.75 ? 152  ILE A C     1 
ATOM   1073 O O     . ILE A 1 152 ? 6.665   72.816  40.496 1.00 21.16 ? 152  ILE A O     1 
ATOM   1074 C CB    . ILE A 1 152 ? 6.856   70.454  42.236 1.00 23.64 ? 152  ILE A CB    1 
ATOM   1075 C CG1   . ILE A 1 152 ? 6.335   69.724  43.493 1.00 23.04 ? 152  ILE A CG1   1 
ATOM   1076 C CG2   . ILE A 1 152 ? 7.949   69.671  41.485 1.00 23.56 ? 152  ILE A CG2   1 
ATOM   1077 C CD1   . ILE A 1 152 ? 7.253   69.711  44.669 1.00 23.69 ? 152  ILE A CD1   1 
ATOM   1078 N N     . TYR A 1 153 ? 8.765   73.202  41.135 1.00 23.30 ? 153  TYR A N     1 
ATOM   1079 C CA    . TYR A 1 153 ? 9.089   74.004  39.968 1.00 25.32 ? 153  TYR A CA    1 
ATOM   1080 C C     . TYR A 1 153 ? 10.119  73.314  39.091 1.00 26.45 ? 153  TYR A C     1 
ATOM   1081 O O     . TYR A 1 153 ? 11.282  73.185  39.459 1.00 26.37 ? 153  TYR A O     1 
ATOM   1082 C CB    . TYR A 1 153 ? 9.590   75.379  40.409 1.00 25.23 ? 153  TYR A CB    1 
ATOM   1083 C CG    . TYR A 1 153 ? 9.595   76.421  39.323 1.00 25.64 ? 153  TYR A CG    1 
ATOM   1084 C CD1   . TYR A 1 153 ? 10.574  76.417  38.334 1.00 25.27 ? 153  TYR A CD1   1 
ATOM   1085 C CD2   . TYR A 1 153 ? 8.647   77.441  39.310 1.00 25.46 ? 153  TYR A CD2   1 
ATOM   1086 C CE1   . TYR A 1 153 ? 10.619  77.403  37.364 1.00 25.61 ? 153  TYR A CE1   1 
ATOM   1087 C CE2   . TYR A 1 153 ? 8.683   78.436  38.340 1.00 26.90 ? 153  TYR A CE2   1 
ATOM   1088 C CZ    . TYR A 1 153 ? 9.674   78.415  37.372 1.00 26.64 ? 153  TYR A CZ    1 
ATOM   1089 O OH    . TYR A 1 153 ? 9.751   79.425  36.430 1.00 27.13 ? 153  TYR A OH    1 
ATOM   1090 N N     . ARG A 1 154 ? 9.670   72.842  37.937 1.00 28.57 ? 154  ARG A N     1 
ATOM   1091 C CA    . ARG A 1 154 ? 10.541  72.159  37.004 1.00 29.78 ? 154  ARG A CA    1 
ATOM   1092 C C     . ARG A 1 154 ? 11.088  73.142  35.990 1.00 30.71 ? 154  ARG A C     1 
ATOM   1093 O O     . ARG A 1 154 ? 10.401  73.506  35.020 1.00 29.88 ? 154  ARG A O     1 
ATOM   1094 C CB    . ARG A 1 154 ? 9.798   71.011  36.326 1.00 30.64 ? 154  ARG A CB    1 
ATOM   1095 C CG    . ARG A 1 154 ? 9.414   69.904  37.301 1.00 32.87 ? 154  ARG A CG    1 
ATOM   1096 C CD    . ARG A 1 154 ? 9.607   68.517  36.675 1.00 36.76 ? 154  ARG A CD    1 
ATOM   1097 N NE    . ARG A 1 154 ? 9.569   67.424  37.649 1.00 37.29 ? 154  ARG A NE    1 
ATOM   1098 C CZ    . ARG A 1 154 ? 8.501   67.112  38.374 1.00 38.78 ? 154  ARG A CZ    1 
ATOM   1099 N NH1   . ARG A 1 154 ? 7.375   67.805  38.244 1.00 40.79 ? 154  ARG A NH1   1 
ATOM   1100 N NH2   . ARG A 1 154 ? 8.556   66.114  39.240 1.00 41.08 ? 154  ARG A NH2   1 
ATOM   1101 N N     . MET A 1 155 ? 12.299  73.628  36.275 1.00 31.13 ? 155  MET A N     1 
ATOM   1102 C CA    . MET A 1 155 ? 12.994  74.583  35.417 1.00 32.17 ? 155  MET A CA    1 
ATOM   1103 C C     . MET A 1 155 ? 13.501  73.895  34.145 1.00 33.46 ? 155  MET A C     1 
ATOM   1104 O O     . MET A 1 155 ? 13.958  72.751  34.175 1.00 34.92 ? 155  MET A O     1 
ATOM   1105 C CB    . MET A 1 155 ? 14.153  75.238  36.174 1.00 30.99 ? 155  MET A CB    1 
ATOM   1106 C CG    . MET A 1 155 ? 14.728  76.480  35.501 1.00 28.46 ? 155  MET A CG    1 
ATOM   1107 S SD    . MET A 1 155 ? 15.821  77.395  36.587 1.00 28.01 ? 155  MET A SD    1 
ATOM   1108 C CE    . MET A 1 155 ? 14.677  78.321  37.550 1.00 27.10 ? 155  MET A CE    1 
ATOM   1109 N N     . LYS A 1 156 ? 13.405  74.601  33.028 1.00 34.76 ? 156  LYS A N     1 
ATOM   1110 C CA    . LYS A 1 156 ? 13.819  74.061  31.746 1.00 36.42 ? 156  LYS A CA    1 
ATOM   1111 C C     . LYS A 1 156 ? 15.294  74.322  31.435 1.00 36.30 ? 156  LYS A C     1 
ATOM   1112 O O     . LYS A 1 156 ? 15.970  73.501  30.806 1.00 36.27 ? 156  LYS A O     1 
ATOM   1113 C CB    . LYS A 1 156 ? 12.908  74.619  30.647 1.00 39.02 ? 156  LYS A CB    1 
ATOM   1114 C CG    . LYS A 1 156 ? 11.440  74.193  30.796 1.00 42.76 ? 156  LYS A CG    1 
ATOM   1115 C CD    . LYS A 1 156 ? 10.552  74.819  29.717 1.00 46.47 ? 156  LYS A CD    1 
ATOM   1116 C CE    . LYS A 1 156 ? 9.121   74.253  29.726 1.00 48.22 ? 156  LYS A CE    1 
ATOM   1117 N NZ    . LYS A 1 156 ? 8.284   74.667  30.894 1.00 48.50 ? 156  LYS A NZ    1 
ATOM   1118 N N     . VAL A 1 157 ? 15.792  75.473  31.866 1.00 35.89 ? 157  VAL A N     1 
ATOM   1119 C CA    . VAL A 1 157 ? 17.184  75.820  31.648 1.00 35.24 ? 157  VAL A CA    1 
ATOM   1120 C C     . VAL A 1 157 ? 17.743  76.458  32.903 1.00 34.95 ? 157  VAL A C     1 
ATOM   1121 O O     . VAL A 1 157 ? 17.372  77.582  33.254 1.00 35.83 ? 157  VAL A O     1 
ATOM   1122 C CB    . VAL A 1 157 ? 17.369  76.786  30.459 1.00 35.55 ? 157  VAL A CB    1 
ATOM   1123 C CG1   . VAL A 1 157 ? 18.794  77.342  30.456 1.00 35.21 ? 157  VAL A CG1   1 
ATOM   1124 C CG2   . VAL A 1 157 ? 17.082  76.059  29.148 1.00 34.13 ? 157  VAL A CG2   1 
ATOM   1125 N N     . PRO A 1 158 ? 18.569  75.706  33.649 1.00 33.87 ? 158  PRO A N     1 
ATOM   1126 C CA    . PRO A 1 158 ? 18.903  74.328  33.274 1.00 32.67 ? 158  PRO A CA    1 
ATOM   1127 C C     . PRO A 1 158 ? 17.775  73.396  33.729 1.00 32.17 ? 158  PRO A C     1 
ATOM   1128 O O     . PRO A 1 158 ? 16.843  73.851  34.398 1.00 32.68 ? 158  PRO A O     1 
ATOM   1129 C CB    . PRO A 1 158 ? 20.206  74.086  34.036 1.00 32.08 ? 158  PRO A CB    1 
ATOM   1130 C CG    . PRO A 1 158 ? 20.050  74.916  35.271 1.00 31.82 ? 158  PRO A CG    1 
ATOM   1131 C CD    . PRO A 1 158 ? 19.394  76.176  34.781 1.00 32.26 ? 158  PRO A CD    1 
ATOM   1132 N N     . LYS A 1 159 ? 17.808  72.129  33.322 1.00 30.91 ? 159  LYS A N     1 
ATOM   1133 C CA    . LYS A 1 159 ? 16.771  71.187  33.740 1.00 30.70 ? 159  LYS A CA    1 
ATOM   1134 C C     . LYS A 1 159 ? 17.000  70.886  35.204 1.00 29.95 ? 159  LYS A C     1 
ATOM   1135 O O     . LYS A 1 159 ? 17.691  69.928  35.556 1.00 30.62 ? 159  LYS A O     1 
ATOM   1136 C CB    . LYS A 1 159 ? 16.831  69.887  32.946 1.00 32.71 ? 159  LYS A CB    1 
ATOM   1137 C CG    . LYS A 1 159 ? 15.952  69.887  31.726 1.00 36.28 ? 159  LYS A CG    1 
ATOM   1138 C CD    . LYS A 1 159 ? 15.794  68.492  31.150 1.00 38.10 ? 159  LYS A CD    1 
ATOM   1139 C CE    . LYS A 1 159 ? 15.074  67.564  32.112 1.00 37.76 ? 159  LYS A CE    1 
ATOM   1140 N NZ    . LYS A 1 159 ? 14.559  66.347  31.417 1.00 38.70 ? 159  LYS A NZ    1 
ATOM   1141 N N     . ILE A 1 160 ? 16.385  71.694  36.054 1.00 28.37 ? 160  ILE A N     1 
ATOM   1142 C CA    . ILE A 1 160 ? 16.542  71.570  37.491 1.00 26.25 ? 160  ILE A CA    1 
ATOM   1143 C C     . ILE A 1 160 ? 15.177  71.669  38.146 1.00 25.39 ? 160  ILE A C     1 
ATOM   1144 O O     . ILE A 1 160 ? 14.305  72.384  37.655 1.00 25.58 ? 160  ILE A O     1 
ATOM   1145 C CB    . ILE A 1 160 ? 17.453  72.723  37.997 1.00 26.31 ? 160  ILE A CB    1 
ATOM   1146 C CG1   . ILE A 1 160 ? 18.875  72.523  37.478 1.00 25.21 ? 160  ILE A CG1   1 
ATOM   1147 C CG2   . ILE A 1 160 ? 17.401  72.855  39.502 1.00 24.78 ? 160  ILE A CG2   1 
ATOM   1148 C CD1   . ILE A 1 160 ? 19.480  71.197  37.851 1.00 25.41 ? 160  ILE A CD1   1 
ATOM   1149 N N     . VAL A 1 161 ? 14.977  70.914  39.222 1.00 23.13 ? 161  VAL A N     1 
ATOM   1150 C CA    . VAL A 1 161 ? 13.715  70.949  39.948 1.00 20.74 ? 161  VAL A CA    1 
ATOM   1151 C C     . VAL A 1 161 ? 13.925  71.676  41.278 1.00 20.11 ? 161  VAL A C     1 
ATOM   1152 O O     . VAL A 1 161 ? 14.862  71.394  42.020 1.00 21.17 ? 161  VAL A O     1 
ATOM   1153 C CB    . VAL A 1 161 ? 13.134  69.528  40.174 1.00 20.31 ? 161  VAL A CB    1 
ATOM   1154 C CG1   . VAL A 1 161 ? 11.879  69.584  41.044 1.00 19.83 ? 161  VAL A CG1   1 
ATOM   1155 C CG2   . VAL A 1 161 ? 12.793  68.892  38.837 1.00 17.70 ? 161  VAL A CG2   1 
ATOM   1156 N N     . LEU A 1 162 ? 13.074  72.655  41.539 1.00 19.37 ? 162  LEU A N     1 
ATOM   1157 C CA    . LEU A 1 162 ? 13.150  73.435  42.756 1.00 18.29 ? 162  LEU A CA    1 
ATOM   1158 C C     . LEU A 1 162 ? 11.931  73.184  43.610 1.00 17.72 ? 162  LEU A C     1 
ATOM   1159 O O     . LEU A 1 162 ? 10.832  73.022  43.096 1.00 17.43 ? 162  LEU A O     1 
ATOM   1160 C CB    . LEU A 1 162 ? 13.254  74.940  42.432 1.00 18.76 ? 162  LEU A CB    1 
ATOM   1161 C CG    . LEU A 1 162 ? 14.508  75.398  41.666 1.00 18.31 ? 162  LEU A CG    1 
ATOM   1162 C CD1   . LEU A 1 162 ? 14.222  75.534  40.175 1.00 16.98 ? 162  LEU A CD1   1 
ATOM   1163 C CD2   . LEU A 1 162 ? 14.998  76.720  42.251 1.00 17.82 ? 162  LEU A CD2   1 
ATOM   1164 N N     . LEU A 1 163 ? 12.144  73.077  44.914 1.00 17.81 ? 163  LEU A N     1 
ATOM   1165 C CA    . LEU A 1 163 ? 11.055  72.884  45.843 1.00 17.99 ? 163  LEU A CA    1 
ATOM   1166 C C     . LEU A 1 163 ? 11.030  74.208  46.583 1.00 19.42 ? 163  LEU A C     1 
ATOM   1167 O O     . LEU A 1 163 ? 11.978  74.556  47.279 1.00 19.30 ? 163  LEU A O     1 
ATOM   1168 C CB    . LEU A 1 163 ? 11.324  71.719  46.796 1.00 17.63 ? 163  LEU A CB    1 
ATOM   1169 C CG    . LEU A 1 163 ? 11.634  70.333  46.224 1.00 15.95 ? 163  LEU A CG    1 
ATOM   1170 C CD1   . LEU A 1 163 ? 11.591  69.314  47.349 1.00 17.81 ? 163  LEU A CD1   1 
ATOM   1171 C CD2   . LEU A 1 163 ? 10.633  69.956  45.177 1.00 17.20 ? 163  LEU A CD2   1 
ATOM   1172 N N     . ILE A 1 164 ? 9.965   74.972  46.346 1.00 21.68 ? 164  ILE A N     1 
ATOM   1173 C CA    . ILE A 1 164 ? 9.770   76.303  46.916 1.00 20.36 ? 164  ILE A CA    1 
ATOM   1174 C C     . ILE A 1 164 ? 8.766   76.250  48.061 1.00 21.33 ? 164  ILE A C     1 
ATOM   1175 O O     . ILE A 1 164 ? 7.658   75.734  47.905 1.00 22.28 ? 164  ILE A O     1 
ATOM   1176 C CB    . ILE A 1 164 ? 9.262   77.264  45.811 1.00 20.26 ? 164  ILE A CB    1 
ATOM   1177 C CG1   . ILE A 1 164 ? 10.165  77.131  44.580 1.00 19.47 ? 164  ILE A CG1   1 
ATOM   1178 C CG2   . ILE A 1 164 ? 9.260   78.708  46.293 1.00 18.42 ? 164  ILE A CG2   1 
ATOM   1179 C CD1   . ILE A 1 164 ? 9.718   77.925  43.409 1.00 18.96 ? 164  ILE A CD1   1 
ATOM   1180 N N     . PHE A 1 165 ? 9.153   76.780  49.214 1.00 21.67 ? 165  PHE A N     1 
ATOM   1181 C CA    . PHE A 1 165 ? 8.272   76.772  50.367 1.00 21.51 ? 165  PHE A CA    1 
ATOM   1182 C C     . PHE A 1 165 ? 7.821   78.167  50.774 1.00 22.22 ? 165  PHE A C     1 
ATOM   1183 O O     . PHE A 1 165 ? 8.433   79.172  50.368 1.00 22.38 ? 165  PHE A O     1 
ATOM   1184 C CB    . PHE A 1 165 ? 8.949   76.024  51.506 1.00 19.97 ? 165  PHE A CB    1 
ATOM   1185 C CG    . PHE A 1 165 ? 9.256   74.606  51.157 1.00 19.08 ? 165  PHE A CG    1 
ATOM   1186 C CD1   . PHE A 1 165 ? 10.453  74.275  50.542 1.00 17.67 ? 165  PHE A CD1   1 
ATOM   1187 C CD2   . PHE A 1 165 ? 8.312   73.604  51.376 1.00 19.76 ? 165  PHE A CD2   1 
ATOM   1188 C CE1   . PHE A 1 165 ? 10.707  72.973  50.144 1.00 15.93 ? 165  PHE A CE1   1 
ATOM   1189 C CE2   . PHE A 1 165 ? 8.560   72.292  50.981 1.00 17.67 ? 165  PHE A CE2   1 
ATOM   1190 C CZ    . PHE A 1 165 ? 9.763   71.985  50.362 1.00 16.37 ? 165  PHE A CZ    1 
ATOM   1191 N N     . VAL A 1 166 ? 6.721   78.226  51.525 1.00 22.60 ? 166  VAL A N     1 
ATOM   1192 C CA    . VAL A 1 166 ? 6.153   79.495  51.983 1.00 22.24 ? 166  VAL A CA    1 
ATOM   1193 C C     . VAL A 1 166 ? 7.145   80.220  52.858 1.00 21.99 ? 166  VAL A C     1 
ATOM   1194 O O     . VAL A 1 166 ? 7.200   81.442  52.864 1.00 22.55 ? 166  VAL A O     1 
ATOM   1195 C CB    . VAL A 1 166 ? 4.844   79.302  52.793 1.00 22.65 ? 166  VAL A CB    1 
ATOM   1196 C CG1   . VAL A 1 166 ? 4.386   80.632  53.353 1.00 24.00 ? 166  VAL A CG1   1 
ATOM   1197 C CG2   . VAL A 1 166 ? 3.745   78.726  51.918 1.00 20.08 ? 166  VAL A CG2   1 
ATOM   1198 N N     . SER A 1 167 ? 7.936   79.450  53.588 1.00 21.73 ? 167  SER A N     1 
ATOM   1199 C CA    . SER A 1 167 ? 8.941   79.989  54.489 1.00 20.90 ? 167  SER A CA    1 
ATOM   1200 C C     . SER A 1 167 ? 10.097  80.720  53.812 1.00 21.99 ? 167  SER A C     1 
ATOM   1201 O O     . SER A 1 167 ? 10.854  81.436  54.472 1.00 23.64 ? 167  SER A O     1 
ATOM   1202 C CB    . SER A 1 167 ? 9.530   78.843  55.293 1.00 19.39 ? 167  SER A CB    1 
ATOM   1203 O OG    . SER A 1 167 ? 10.187  77.947  54.419 1.00 19.32 ? 167  SER A OG    1 
ATOM   1204 N N     . GLY A 1 168 ? 10.266  80.517  52.510 1.00 22.90 ? 168  GLY A N     1 
ATOM   1205 C CA    . GLY A 1 168 ? 11.385  81.133  51.815 1.00 22.32 ? 168  GLY A CA    1 
ATOM   1206 C C     . GLY A 1 168 ? 12.552  80.153  51.723 1.00 21.72 ? 168  GLY A C     1 
ATOM   1207 O O     . GLY A 1 168 ? 13.651  80.517  51.321 1.00 21.66 ? 168  GLY A O     1 
ATOM   1208 N N     . LYS A 1 169 ? 12.330  78.927  52.182 1.00 22.04 ? 169  LYS A N     1 
ATOM   1209 C CA    . LYS A 1 169 ? 13.324  77.866  52.119 1.00 22.60 ? 169  LYS A CA    1 
ATOM   1210 C C     . LYS A 1 169 ? 13.180  77.237  50.723 1.00 22.16 ? 169  LYS A C     1 
ATOM   1211 O O     . LYS A 1 169 ? 12.056  76.973  50.276 1.00 22.24 ? 169  LYS A O     1 
ATOM   1212 C CB    . LYS A 1 169 ? 13.036  76.814  53.191 1.00 23.39 ? 169  LYS A CB    1 
ATOM   1213 C CG    . LYS A 1 169 ? 13.923  76.875  54.393 1.00 22.38 ? 169  LYS A CG    1 
ATOM   1214 C CD    . LYS A 1 169 ? 13.687  78.106  55.172 1.00 27.14 ? 169  LYS A CD    1 
ATOM   1215 C CE    . LYS A 1 169 ? 14.107  77.884  56.606 1.00 29.17 ? 169  LYS A CE    1 
ATOM   1216 N NZ    . LYS A 1 169 ? 15.469  77.282  56.663 1.00 32.88 ? 169  LYS A NZ    1 
ATOM   1217 N N     . ILE A 1 170 ? 14.305  76.990  50.053 1.00 21.53 ? 170  ILE A N     1 
ATOM   1218 C CA    . ILE A 1 170 ? 14.306  76.437  48.702 1.00 20.82 ? 170  ILE A CA    1 
ATOM   1219 C C     . ILE A 1 170 ? 15.222  75.213  48.607 1.00 21.07 ? 170  ILE A C     1 
ATOM   1220 O O     . ILE A 1 170 ? 16.306  75.189  49.184 1.00 20.31 ? 170  ILE A O     1 
ATOM   1221 C CB    . ILE A 1 170 ? 14.846  77.484  47.669 1.00 19.55 ? 170  ILE A CB    1 
ATOM   1222 C CG1   . ILE A 1 170 ? 14.273  78.875  47.936 1.00 20.71 ? 170  ILE A CG1   1 
ATOM   1223 C CG2   . ILE A 1 170 ? 14.492  77.077  46.258 1.00 19.26 ? 170  ILE A CG2   1 
ATOM   1224 C CD1   . ILE A 1 170 ? 12.774  78.994  47.725 1.00 17.93 ? 170  ILE A CD1   1 
ATOM   1225 N N     . VAL A 1 171 ? 14.789  74.206  47.859 1.00 21.10 ? 171  VAL A N     1 
ATOM   1226 C CA    . VAL A 1 171 ? 15.587  73.010  47.641 1.00 20.19 ? 171  VAL A CA    1 
ATOM   1227 C C     . VAL A 1 171 ? 15.767  72.927  46.129 1.00 20.29 ? 171  VAL A C     1 
ATOM   1228 O O     . VAL A 1 171 ? 14.798  73.010  45.390 1.00 21.41 ? 171  VAL A O     1 
ATOM   1229 C CB    . VAL A 1 171 ? 14.885  71.745  48.170 1.00 19.90 ? 171  VAL A CB    1 
ATOM   1230 C CG1   . VAL A 1 171 ? 15.630  70.508  47.730 1.00 19.95 ? 171  VAL A CG1   1 
ATOM   1231 C CG2   . VAL A 1 171 ? 14.822  71.783  49.679 1.00 18.61 ? 171  VAL A CG2   1 
ATOM   1232 N N     . ILE A 1 172 ? 17.016  72.870  45.675 1.00 20.29 ? 172  ILE A N     1 
ATOM   1233 C CA    . ILE A 1 172 ? 17.338  72.794  44.252 1.00 18.62 ? 172  ILE A CA    1 
ATOM   1234 C C     . ILE A 1 172 ? 17.913  71.395  44.051 1.00 17.93 ? 172  ILE A C     1 
ATOM   1235 O O     . ILE A 1 172 ? 18.866  71.012  44.719 1.00 17.93 ? 172  ILE A O     1 
ATOM   1236 C CB    . ILE A 1 172 ? 18.427  73.871  43.851 1.00 19.09 ? 172  ILE A CB    1 
ATOM   1237 C CG1   . ILE A 1 172 ? 17.983  75.294  44.213 1.00 19.11 ? 172  ILE A CG1   1 
ATOM   1238 C CG2   . ILE A 1 172 ? 18.671  73.863  42.357 1.00 19.00 ? 172  ILE A CG2   1 
ATOM   1239 C CD1   . ILE A 1 172 ? 18.439  75.784  45.566 1.00 17.27 ? 172  ILE A CD1   1 
ATOM   1240 N N     . THR A 1 173 ? 17.331  70.612  43.163 1.00 18.65 ? 173  THR A N     1 
ATOM   1241 C CA    . THR A 1 173 ? 17.851  69.276  42.948 1.00 19.85 ? 173  THR A CA    1 
ATOM   1242 C C     . THR A 1 173 ? 17.909  68.836  41.482 1.00 20.76 ? 173  THR A C     1 
ATOM   1243 O O     . THR A 1 173 ? 17.358  69.491  40.596 1.00 21.63 ? 173  THR A O     1 
ATOM   1244 C CB    . THR A 1 173 ? 17.103  68.233  43.798 1.00 18.89 ? 173  THR A CB    1 
ATOM   1245 O OG1   . THR A 1 173 ? 17.778  66.971  43.692 1.00 19.26 ? 173  THR A OG1   1 
ATOM   1246 C CG2   . THR A 1 173 ? 15.655  68.097  43.343 1.00 17.43 ? 173  THR A CG2   1 
ATOM   1247 N N     . GLY A 1 174 ? 18.642  67.758  41.227 1.00 21.20 ? 174  GLY A N     1 
ATOM   1248 C CA    . GLY A 1 174 ? 18.762  67.264  39.873 1.00 21.49 ? 174  GLY A CA    1 
ATOM   1249 C C     . GLY A 1 174 ? 19.999  67.732  39.140 1.00 22.53 ? 174  GLY A C     1 
ATOM   1250 O O     . GLY A 1 174 ? 20.193  67.350  37.989 1.00 24.99 ? 174  GLY A O     1 
ATOM   1251 N N     . ALA A 1 175 ? 20.841  68.542  39.778 1.00 22.14 ? 175  ALA A N     1 
ATOM   1252 C CA    . ALA A 1 175 ? 22.054  69.033  39.127 1.00 22.00 ? 175  ALA A CA    1 
ATOM   1253 C C     . ALA A 1 175 ? 23.151  67.978  39.110 1.00 24.07 ? 175  ALA A C     1 
ATOM   1254 O O     . ALA A 1 175 ? 23.213  67.110  39.981 1.00 25.06 ? 175  ALA A O     1 
ATOM   1255 C CB    . ALA A 1 175 ? 22.566  70.288  39.813 1.00 18.80 ? 175  ALA A CB    1 
ATOM   1256 N N     . LYS A 1 176 ? 23.988  68.039  38.083 1.00 25.64 ? 176  LYS A N     1 
ATOM   1257 C CA    . LYS A 1 176 ? 25.121  67.142  37.939 1.00 25.92 ? 176  LYS A CA    1 
ATOM   1258 C C     . LYS A 1 176 ? 26.395  67.966  37.946 1.00 26.62 ? 176  LYS A C     1 
ATOM   1259 O O     . LYS A 1 176 ? 27.492  67.425  37.959 1.00 28.73 ? 176  LYS A O     1 
ATOM   1260 C CB    . LYS A 1 176 ? 24.992  66.315  36.670 1.00 25.79 ? 176  LYS A CB    1 
ATOM   1261 C CG    . LYS A 1 176 ? 24.035  65.158  36.847 1.00 24.97 ? 176  LYS A CG    1 
ATOM   1262 C CD    . LYS A 1 176 ? 23.710  64.525  35.539 1.00 26.41 ? 176  LYS A CD    1 
ATOM   1263 C CE    . LYS A 1 176 ? 22.737  63.376  35.726 1.00 28.44 ? 176  LYS A CE    1 
ATOM   1264 N NZ    . LYS A 1 176 ? 23.443  62.103  36.016 1.00 30.32 ? 176  LYS A NZ    1 
ATOM   1265 N N     . MET A 1 177 ? 26.227  69.284  37.996 1.00 28.03 ? 177  MET A N     1 
ATOM   1266 C CA    . MET A 1 177 ? 27.316  70.261  38.060 1.00 29.77 ? 177  MET A CA    1 
ATOM   1267 C C     . MET A 1 177 ? 26.766  71.281  39.053 1.00 29.47 ? 177  MET A C     1 
ATOM   1268 O O     . MET A 1 177 ? 25.595  71.644  38.952 1.00 29.93 ? 177  MET A O     1 
ATOM   1269 C CB    . MET A 1 177 ? 27.513  70.956  36.708 1.00 33.69 ? 177  MET A CB    1 
ATOM   1270 C CG    . MET A 1 177 ? 28.018  70.079  35.580 1.00 37.99 ? 177  MET A CG    1 
ATOM   1271 S SD    . MET A 1 177 ? 29.724  69.601  35.861 1.00 46.25 ? 177  MET A SD    1 
ATOM   1272 C CE    . MET A 1 177 ? 30.579  71.078  35.242 1.00 44.06 ? 177  MET A CE    1 
ATOM   1273 N N     . ARG A 1 178 ? 27.581  71.760  39.989 1.00 28.86 ? 178  ARG A N     1 
ATOM   1274 C CA    . ARG A 1 178 ? 27.097  72.719  40.978 1.00 29.17 ? 178  ARG A CA    1 
ATOM   1275 C C     . ARG A 1 178 ? 26.662  74.067  40.403 1.00 30.26 ? 178  ARG A C     1 
ATOM   1276 O O     . ARG A 1 178 ? 25.864  74.793  41.009 1.00 30.45 ? 178  ARG A O     1 
ATOM   1277 C CB    . ARG A 1 178 ? 28.118  72.933  42.091 1.00 28.50 ? 178  ARG A CB    1 
ATOM   1278 C CG    . ARG A 1 178 ? 29.301  73.775  41.713 1.00 27.76 ? 178  ARG A CG    1 
ATOM   1279 C CD    . ARG A 1 178 ? 30.011  74.229  42.959 1.00 28.69 ? 178  ARG A CD    1 
ATOM   1280 N NE    . ARG A 1 178 ? 30.463  73.108  43.777 1.00 30.69 ? 178  ARG A NE    1 
ATOM   1281 C CZ    . ARG A 1 178 ? 31.071  73.246  44.951 1.00 31.38 ? 178  ARG A CZ    1 
ATOM   1282 N NH1   . ARG A 1 178 ? 31.304  74.454  45.434 1.00 31.33 ? 178  ARG A NH1   1 
ATOM   1283 N NH2   . ARG A 1 178 ? 31.413  72.178  45.663 1.00 31.53 ? 178  ARG A NH2   1 
ATOM   1284 N N     . ASP A 1 179 ? 27.182  74.414  39.237 1.00 31.32 ? 179  ASP A N     1 
ATOM   1285 C CA    . ASP A 1 179 ? 26.804  75.668  38.618 1.00 31.26 ? 179  ASP A CA    1 
ATOM   1286 C C     . ASP A 1 179 ? 25.358  75.634  38.171 1.00 29.49 ? 179  ASP A C     1 
ATOM   1287 O O     . ASP A 1 179 ? 24.742  76.679  38.015 1.00 29.53 ? 179  ASP A O     1 
ATOM   1288 C CB    . ASP A 1 179 ? 27.729  75.990  37.454 1.00 35.54 ? 179  ASP A CB    1 
ATOM   1289 C CG    . ASP A 1 179 ? 29.126  76.379  37.919 1.00 41.53 ? 179  ASP A CG    1 
ATOM   1290 O OD1   . ASP A 1 179 ? 29.293  76.741  39.113 1.00 43.45 ? 179  ASP A OD1   1 
ATOM   1291 O OD2   . ASP A 1 179 ? 30.065  76.324  37.087 1.00 47.32 ? 179  ASP A OD2   1 
ATOM   1292 N N     . GLU A 1 180 ? 24.814  74.437  37.967 1.00 27.46 ? 180  GLU A N     1 
ATOM   1293 C CA    . GLU A 1 180 ? 23.419  74.303  37.560 1.00 25.59 ? 180  GLU A CA    1 
ATOM   1294 C C     . GLU A 1 180 ? 22.561  74.650  38.765 1.00 24.53 ? 180  GLU A C     1 
ATOM   1295 O O     . GLU A 1 180 ? 21.515  75.266  38.632 1.00 25.08 ? 180  GLU A O     1 
ATOM   1296 C CB    . GLU A 1 180 ? 23.120  72.886  37.077 1.00 25.21 ? 180  GLU A CB    1 
ATOM   1297 C CG    . GLU A 1 180 ? 23.698  72.543  35.717 1.00 24.69 ? 180  GLU A CG    1 
ATOM   1298 C CD    . GLU A 1 180 ? 23.585  71.069  35.385 1.00 25.89 ? 180  GLU A CD    1 
ATOM   1299 O OE1   . GLU A 1 180 ? 23.399  70.264  36.307 1.00 27.44 ? 180  GLU A OE1   1 
ATOM   1300 O OE2   . GLU A 1 180 ? 23.689  70.695  34.200 1.00 29.92 ? 180  GLU A OE2   1 
ATOM   1301 N N     . THR A 1 181 ? 23.057  74.294  39.943 1.00 23.30 ? 181  THR A N     1 
ATOM   1302 C CA    . THR A 1 181 ? 22.397  74.568  41.208 1.00 22.79 ? 181  THR A CA    1 
ATOM   1303 C C     . THR A 1 181 ? 22.366  76.083  41.433 1.00 23.73 ? 181  THR A C     1 
ATOM   1304 O O     . THR A 1 181 ? 21.322  76.663  41.760 1.00 22.74 ? 181  THR A O     1 
ATOM   1305 C CB    . THR A 1 181 ? 23.181  73.886  42.364 1.00 21.18 ? 181  THR A CB    1 
ATOM   1306 O OG1   . THR A 1 181 ? 23.305  72.490  42.078 1.00 23.37 ? 181  THR A OG1   1 
ATOM   1307 C CG2   . THR A 1 181 ? 22.481  74.062  43.705 1.00 19.31 ? 181  THR A CG2   1 
ATOM   1308 N N     . TYR A 1 182 ? 23.520  76.719  41.252 1.00 24.60 ? 182  TYR A N     1 
ATOM   1309 C CA    . TYR A 1 182 ? 23.647  78.160  41.429 1.00 24.94 ? 182  TYR A CA    1 
ATOM   1310 C C     . TYR A 1 182 ? 22.859  78.926  40.378 1.00 25.28 ? 182  TYR A C     1 
ATOM   1311 O O     . TYR A 1 182 ? 22.146  79.873  40.698 1.00 26.74 ? 182  TYR A O     1 
ATOM   1312 C CB    . TYR A 1 182 ? 25.111  78.566  41.364 1.00 25.06 ? 182  TYR A CB    1 
ATOM   1313 C CG    . TYR A 1 182 ? 26.004  77.857  42.357 1.00 27.01 ? 182  TYR A CG    1 
ATOM   1314 C CD1   . TYR A 1 182 ? 25.522  77.441  43.605 1.00 26.87 ? 182  TYR A CD1   1 
ATOM   1315 C CD2   . TYR A 1 182 ? 27.349  77.634  42.065 1.00 28.36 ? 182  TYR A CD2   1 
ATOM   1316 C CE1   . TYR A 1 182 ? 26.365  76.823  44.544 1.00 27.33 ? 182  TYR A CE1   1 
ATOM   1317 C CE2   . TYR A 1 182 ? 28.202  77.017  42.998 1.00 28.83 ? 182  TYR A CE2   1 
ATOM   1318 C CZ    . TYR A 1 182 ? 27.707  76.619  44.232 1.00 27.63 ? 182  TYR A CZ    1 
ATOM   1319 O OH    . TYR A 1 182 ? 28.574  76.050  45.141 1.00 26.20 ? 182  TYR A OH    1 
ATOM   1320 N N     . LYS A 1 183 ? 22.974  78.503  39.126 1.00 26.53 ? 183  LYS A N     1 
ATOM   1321 C CA    . LYS A 1 183 ? 22.273  79.144  38.020 1.00 28.97 ? 183  LYS A CA    1 
ATOM   1322 C C     . LYS A 1 183 ? 20.766  79.095  38.216 1.00 29.52 ? 183  LYS A C     1 
ATOM   1323 O O     . LYS A 1 183 ? 20.099  80.116  38.055 1.00 31.84 ? 183  LYS A O     1 
ATOM   1324 C CB    . LYS A 1 183 ? 22.658  78.489  36.698 1.00 31.18 ? 183  LYS A CB    1 
ATOM   1325 C CG    . LYS A 1 183 ? 22.102  79.164  35.453 1.00 36.14 ? 183  LYS A CG    1 
ATOM   1326 C CD    . LYS A 1 183 ? 22.583  80.614  35.294 1.00 40.43 ? 183  LYS A CD    1 
ATOM   1327 C CE    . LYS A 1 183 ? 22.330  81.145  33.870 1.00 41.73 ? 183  LYS A CE    1 
ATOM   1328 N NZ    . LYS A 1 183 ? 20.969  80.767  33.334 1.00 44.41 ? 183  LYS A NZ    1 
ATOM   1329 N N     . ALA A 1 184 ? 20.235  77.916  38.555 1.00 28.81 ? 184  ALA A N     1 
ATOM   1330 C CA    . ALA A 1 184 ? 18.796  77.721  38.808 1.00 26.79 ? 184  ALA A CA    1 
ATOM   1331 C C     . ALA A 1 184 ? 18.287  78.647  39.912 1.00 25.24 ? 184  ALA A C     1 
ATOM   1332 O O     . ALA A 1 184 ? 17.209  79.226  39.801 1.00 25.36 ? 184  ALA A O     1 
ATOM   1333 C CB    . ALA A 1 184 ? 18.520  76.289  39.188 1.00 26.04 ? 184  ALA A CB    1 
ATOM   1334 N N     . PHE A 1 185 ? 19.055  78.772  40.986 1.00 24.97 ? 185  PHE A N     1 
ATOM   1335 C CA    . PHE A 1 185 ? 18.675  79.650  42.077 1.00 24.91 ? 185  PHE A CA    1 
ATOM   1336 C C     . PHE A 1 185 ? 18.719  81.121  41.656 1.00 25.50 ? 185  PHE A C     1 
ATOM   1337 O O     . PHE A 1 185 ? 17.899  81.923  42.097 1.00 26.75 ? 185  PHE A O     1 
ATOM   1338 C CB    . PHE A 1 185 ? 19.574  79.431  43.291 1.00 23.60 ? 185  PHE A CB    1 
ATOM   1339 C CG    . PHE A 1 185 ? 19.335  80.419  44.391 1.00 22.89 ? 185  PHE A CG    1 
ATOM   1340 C CD1   . PHE A 1 185 ? 18.157  80.392  45.114 1.00 21.84 ? 185  PHE A CD1   1 
ATOM   1341 C CD2   . PHE A 1 185 ? 20.254  81.431  44.643 1.00 22.71 ? 185  PHE A CD2   1 
ATOM   1342 C CE1   . PHE A 1 185 ? 17.894  81.372  46.072 1.00 22.89 ? 185  PHE A CE1   1 
ATOM   1343 C CE2   . PHE A 1 185 ? 20.003  82.403  45.588 1.00 21.43 ? 185  PHE A CE2   1 
ATOM   1344 C CZ    . PHE A 1 185 ? 18.817  82.379  46.306 1.00 22.95 ? 185  PHE A CZ    1 
ATOM   1345 N N     . GLU A 1 186 ? 19.692  81.487  40.834 1.00 25.51 ? 186  GLU A N     1 
ATOM   1346 C CA    . GLU A 1 186 ? 19.786  82.863  40.376 1.00 25.79 ? 186  GLU A CA    1 
ATOM   1347 C C     . GLU A 1 186 ? 18.610  83.207  39.468 1.00 25.41 ? 186  GLU A C     1 
ATOM   1348 O O     . GLU A 1 186 ? 18.052  84.298  39.565 1.00 25.48 ? 186  GLU A O     1 
ATOM   1349 C CB    . GLU A 1 186 ? 21.119  83.125  39.668 1.00 26.73 ? 186  GLU A CB    1 
ATOM   1350 C CG    . GLU A 1 186 ? 22.331  83.193  40.616 1.00 28.07 ? 186  GLU A CG    1 
ATOM   1351 C CD    . GLU A 1 186 ? 22.147  84.161  41.789 1.00 29.35 ? 186  GLU A CD    1 
ATOM   1352 O OE1   . GLU A 1 186 ? 21.690  85.309  41.583 1.00 31.63 ? 186  GLU A OE1   1 
ATOM   1353 O OE2   . GLU A 1 186 ? 22.484  83.780  42.930 1.00 30.36 ? 186  GLU A OE2   1 
ATOM   1354 N N     . ASN A 1 187 ? 18.217  82.265  38.613 1.00 25.64 ? 187  ASN A N     1 
ATOM   1355 C CA    . ASN A 1 187 ? 17.086  82.445  37.700 1.00 24.68 ? 187  ASN A CA    1 
ATOM   1356 C C     . ASN A 1 187 ? 15.766  82.566  38.465 1.00 25.70 ? 187  ASN A C     1 
ATOM   1357 O O     . ASN A 1 187 ? 14.906  83.395  38.120 1.00 27.41 ? 187  ASN A O     1 
ATOM   1358 C CB    . ASN A 1 187 ? 16.979  81.266  36.731 1.00 23.59 ? 187  ASN A CB    1 
ATOM   1359 C CG    . ASN A 1 187 ? 18.155  81.174  35.786 1.00 23.45 ? 187  ASN A CG    1 
ATOM   1360 O OD1   . ASN A 1 187 ? 18.983  82.074  35.718 1.00 25.11 ? 187  ASN A OD1   1 
ATOM   1361 N ND2   . ASN A 1 187 ? 18.228  80.086  35.042 1.00 23.65 ? 187  ASN A ND2   1 
ATOM   1362 N N     . ILE A 1 188 ? 15.607  81.744  39.502 1.00 24.18 ? 188  ILE A N     1 
ATOM   1363 C CA    . ILE A 1 188 ? 14.381  81.746  40.295 1.00 24.00 ? 188  ILE A CA    1 
ATOM   1364 C C     . ILE A 1 188 ? 14.306  82.898  41.287 1.00 25.14 ? 188  ILE A C     1 
ATOM   1365 O O     . ILE A 1 188 ? 13.209  83.298  41.695 1.00 27.24 ? 188  ILE A O     1 
ATOM   1366 C CB    . ILE A 1 188 ? 14.192  80.411  41.092 1.00 21.61 ? 188  ILE A CB    1 
ATOM   1367 C CG1   . ILE A 1 188 ? 12.709  80.149  41.369 1.00 19.32 ? 188  ILE A CG1   1 
ATOM   1368 C CG2   . ILE A 1 188 ? 14.914  80.478  42.429 1.00 19.76 ? 188  ILE A CG2   1 
ATOM   1369 C CD1   . ILE A 1 188 ? 11.921  79.757  40.162 1.00 15.38 ? 188  ILE A CD1   1 
ATOM   1370 N N     . TYR A 1 189 ? 15.455  83.435  41.684 1.00 24.80 ? 189  TYR A N     1 
ATOM   1371 C CA    . TYR A 1 189 ? 15.465  84.504  42.671 1.00 23.53 ? 189  TYR A CA    1 
ATOM   1372 C C     . TYR A 1 189 ? 14.539  85.689  42.372 1.00 24.20 ? 189  TYR A C     1 
ATOM   1373 O O     . TYR A 1 189 ? 13.680  86.024  43.190 1.00 25.14 ? 189  TYR A O     1 
ATOM   1374 C CB    . TYR A 1 189 ? 16.882  84.971  42.979 1.00 22.10 ? 189  TYR A CB    1 
ATOM   1375 C CG    . TYR A 1 189 ? 16.921  85.829  44.211 1.00 21.33 ? 189  TYR A CG    1 
ATOM   1376 C CD1   . TYR A 1 189 ? 16.588  85.299  45.449 1.00 20.16 ? 189  TYR A CD1   1 
ATOM   1377 C CD2   . TYR A 1 189 ? 17.239  87.182  44.135 1.00 21.82 ? 189  TYR A CD2   1 
ATOM   1378 C CE1   . TYR A 1 189 ? 16.567  86.084  46.582 1.00 20.87 ? 189  TYR A CE1   1 
ATOM   1379 C CE2   . TYR A 1 189 ? 17.215  87.985  45.275 1.00 21.01 ? 189  TYR A CE2   1 
ATOM   1380 C CZ    . TYR A 1 189 ? 16.879  87.424  46.492 1.00 20.90 ? 189  TYR A CZ    1 
ATOM   1381 O OH    . TYR A 1 189 ? 16.876  88.195  47.626 1.00 22.09 ? 189  TYR A OH    1 
ATOM   1382 N N     . PRO A 1 190 ? 14.676  86.323  41.198 1.00 24.53 ? 190  PRO A N     1 
ATOM   1383 C CA    . PRO A 1 190 ? 13.783  87.455  40.915 1.00 25.23 ? 190  PRO A CA    1 
ATOM   1384 C C     . PRO A 1 190 ? 12.307  87.052  40.873 1.00 25.23 ? 190  PRO A C     1 
ATOM   1385 O O     . PRO A 1 190 ? 11.421  87.876  41.128 1.00 26.26 ? 190  PRO A O     1 
ATOM   1386 C CB    . PRO A 1 190 ? 14.295  87.979  39.566 1.00 25.13 ? 190  PRO A CB    1 
ATOM   1387 C CG    . PRO A 1 190 ? 14.969  86.783  38.946 1.00 26.13 ? 190  PRO A CG    1 
ATOM   1388 C CD    . PRO A 1 190 ? 15.664  86.142  40.121 1.00 24.55 ? 190  PRO A CD    1 
ATOM   1389 N N     . VAL A 1 191 ? 12.049  85.777  40.599 1.00 24.69 ? 191  VAL A N     1 
ATOM   1390 C CA    . VAL A 1 191 ? 10.691  85.254  40.556 1.00 23.21 ? 191  VAL A CA    1 
ATOM   1391 C C     . VAL A 1 191 ? 10.136  85.152  41.973 1.00 23.37 ? 191  VAL A C     1 
ATOM   1392 O O     . VAL A 1 191 ? 8.996   85.524  42.218 1.00 24.39 ? 191  VAL A O     1 
ATOM   1393 C CB    . VAL A 1 191 ? 10.639  83.859  39.910 1.00 23.49 ? 191  VAL A CB    1 
ATOM   1394 C CG1   . VAL A 1 191 ? 9.196   83.354  39.842 1.00 21.96 ? 191  VAL A CG1   1 
ATOM   1395 C CG2   . VAL A 1 191 ? 11.255  83.901  38.530 1.00 22.84 ? 191  VAL A CG2   1 
ATOM   1396 N N     . LEU A 1 192 ? 10.937  84.647  42.904 1.00 22.94 ? 192  LEU A N     1 
ATOM   1397 C CA    . LEU A 1 192 ? 10.499  84.509  44.288 1.00 23.23 ? 192  LEU A CA    1 
ATOM   1398 C C     . LEU A 1 192 ? 10.202  85.890  44.866 1.00 24.78 ? 192  LEU A C     1 
ATOM   1399 O O     . LEU A 1 192 ? 9.292   86.043  45.676 1.00 26.26 ? 192  LEU A O     1 
ATOM   1400 C CB    . LEU A 1 192 ? 11.589  83.839  45.130 1.00 21.95 ? 192  LEU A CB    1 
ATOM   1401 C CG    . LEU A 1 192 ? 12.129  82.477  44.675 1.00 23.14 ? 192  LEU A CG    1 
ATOM   1402 C CD1   . LEU A 1 192 ? 13.276  82.034  45.553 1.00 18.14 ? 192  LEU A CD1   1 
ATOM   1403 C CD2   . LEU A 1 192 ? 11.012  81.457  44.709 1.00 21.04 ? 192  LEU A CD2   1 
ATOM   1404 N N     . SER A 1 193 ? 11.023  86.872  44.488 1.00 26.49 ? 193  SER A N     1 
ATOM   1405 C CA    . SER A 1 193 ? 10.894  88.263  44.940 1.00 26.19 ? 193  SER A CA    1 
ATOM   1406 C C     . SER A 1 193 ? 9.580   88.852  44.458 1.00 25.83 ? 193  SER A C     1 
ATOM   1407 O O     . SER A 1 193 ? 8.863   89.532  45.209 1.00 25.30 ? 193  SER A O     1 
ATOM   1408 C CB    . SER A 1 193 ? 12.063  89.107  44.406 1.00 27.21 ? 193  SER A CB    1 
ATOM   1409 O OG    . SER A 1 193 ? 13.291  88.750  45.020 1.00 25.36 ? 193  SER A OG    1 
ATOM   1410 N N     . GLU A 1 194 ? 9.263   88.567  43.201 1.00 25.54 ? 194  GLU A N     1 
ATOM   1411 C CA    . GLU A 1 194 ? 8.031   89.038  42.605 1.00 25.73 ? 194  GLU A CA    1 
ATOM   1412 C C     . GLU A 1 194 ? 6.821   88.544  43.377 1.00 26.04 ? 194  GLU A C     1 
ATOM   1413 O O     . GLU A 1 194 ? 5.801   89.223  43.435 1.00 27.93 ? 194  GLU A O     1 
ATOM   1414 C CB    . GLU A 1 194 ? 7.916   88.575  41.161 1.00 24.73 ? 194  GLU A CB    1 
ATOM   1415 C CG    . GLU A 1 194 ? 6.643   89.048  40.511 1.00 24.86 ? 194  GLU A CG    1 
ATOM   1416 C CD    . GLU A 1 194 ? 6.512   88.626  39.081 1.00 27.53 ? 194  GLU A CD    1 
ATOM   1417 O OE1   . GLU A 1 194 ? 7.415   87.937  38.548 1.00 27.70 ? 194  GLU A OE1   1 
ATOM   1418 O OE2   . GLU A 1 194 ? 5.479   88.989  38.483 1.00 30.97 ? 194  GLU A OE2   1 
ATOM   1419 N N     . PHE A 1 195 ? 6.933   87.370  43.981 1.00 25.15 ? 195  PHE A N     1 
ATOM   1420 C CA    . PHE A 1 195 ? 5.821   86.817  44.718 1.00 23.68 ? 195  PHE A CA    1 
ATOM   1421 C C     . PHE A 1 195 ? 6.084   86.708  46.199 1.00 25.06 ? 195  PHE A C     1 
ATOM   1422 O O     . PHE A 1 195 ? 5.691   85.735  46.831 1.00 25.78 ? 195  PHE A O     1 
ATOM   1423 C CB    . PHE A 1 195 ? 5.420   85.472  44.126 1.00 22.94 ? 195  PHE A CB    1 
ATOM   1424 C CG    . PHE A 1 195 ? 4.919   85.567  42.707 1.00 21.33 ? 195  PHE A CG    1 
ATOM   1425 C CD1   . PHE A 1 195 ? 3.594   85.890  42.447 1.00 20.20 ? 195  PHE A CD1   1 
ATOM   1426 C CD2   . PHE A 1 195 ? 5.776   85.359  41.634 1.00 20.58 ? 195  PHE A CD2   1 
ATOM   1427 C CE1   . PHE A 1 195 ? 3.136   86.006  41.144 1.00 17.91 ? 195  PHE A CE1   1 
ATOM   1428 C CE2   . PHE A 1 195 ? 5.321   85.475  40.329 1.00 18.96 ? 195  PHE A CE2   1 
ATOM   1429 C CZ    . PHE A 1 195 ? 3.999   85.800  40.093 1.00 17.55 ? 195  PHE A CZ    1 
ATOM   1430 N N     . ARG A 1 196 ? 6.762   87.710  46.749 1.00 26.06 ? 196  ARG A N     1 
ATOM   1431 C CA    . ARG A 1 196 ? 7.052   87.759  48.178 1.00 26.83 ? 196  ARG A CA    1 
ATOM   1432 C C     . ARG A 1 196 ? 5.727   88.025  48.859 1.00 28.14 ? 196  ARG A C     1 
ATOM   1433 O O     . ARG A 1 196 ? 4.918   88.815  48.362 1.00 28.33 ? 196  ARG A O     1 
ATOM   1434 C CB    . ARG A 1 196 ? 8.039   88.898  48.481 1.00 28.17 ? 196  ARG A CB    1 
ATOM   1435 C CG    . ARG A 1 196 ? 8.217   89.244  49.962 1.00 27.92 ? 196  ARG A CG    1 
ATOM   1436 C CD    . ARG A 1 196 ? 9.517   90.010  50.221 1.00 30.26 ? 196  ARG A CD    1 
ATOM   1437 N NE    . ARG A 1 196 ? 9.602   91.311  49.553 1.00 33.41 ? 196  ARG A NE    1 
ATOM   1438 C CZ    . ARG A 1 196 ? 9.054   92.441  50.019 1.00 36.88 ? 196  ARG A CZ    1 
ATOM   1439 N NH1   . ARG A 1 196 ? 8.365   92.439  51.158 1.00 36.98 ? 196  ARG A NH1   1 
ATOM   1440 N NH2   . ARG A 1 196 ? 9.230   93.595  49.375 1.00 36.12 ? 196  ARG A NH2   1 
ATOM   1441 N N     . LYS A 1 197 ? 5.499   87.366  49.987 1.00 30.01 ? 197  LYS A N     1 
ATOM   1442 C CA    . LYS A 1 197 ? 4.261   87.526  50.735 1.00 31.59 ? 197  LYS A CA    1 
ATOM   1443 C C     . LYS A 1 197 ? 4.441   88.696  51.675 1.00 32.55 ? 197  LYS A C     1 
ATOM   1444 O O     . LYS A 1 197 ? 5.425   88.749  52.404 1.00 33.32 ? 197  LYS A O     1 
ATOM   1445 C CB    . LYS A 1 197 ? 3.983   86.252  51.525 1.00 33.40 ? 197  LYS A CB    1 
ATOM   1446 C CG    . LYS A 1 197 ? 2.696   86.251  52.311 1.00 35.25 ? 197  LYS A CG    1 
ATOM   1447 C CD    . LYS A 1 197 ? 2.575   85.003  53.189 1.00 38.25 ? 197  LYS A CD    1 
ATOM   1448 C CE    . LYS A 1 197 ? 2.500   83.708  52.358 1.00 40.64 ? 197  LYS A CE    1 
ATOM   1449 N NZ    . LYS A 1 197 ? 1.987   82.535  53.156 1.00 39.62 ? 197  LYS A NZ    1 
ATOM   1450 N N     . ILE A 1 198 ? 3.510   89.644  51.647 1.00 34.99 ? 198  ILE A N     1 
ATOM   1451 C CA    . ILE A 1 198 ? 3.595   90.833  52.512 1.00 36.58 ? 198  ILE A CA    1 
ATOM   1452 C C     . ILE A 1 198 ? 2.609   90.864  53.691 1.00 36.76 ? 198  ILE A C     1 
ATOM   1453 O O     . ILE A 1 198 ? 1.445   90.444  53.506 1.00 37.85 ? 198  ILE A O     1 
ATOM   1454 C CB    . ILE A 1 198 ? 3.458   92.140  51.700 1.00 36.01 ? 198  ILE A CB    1 
ATOM   1455 C CG1   . ILE A 1 198 ? 4.562   92.212  50.644 1.00 36.85 ? 198  ILE A CG1   1 
ATOM   1456 C CG2   . ILE A 1 198 ? 3.565   93.334  52.626 1.00 36.43 ? 198  ILE A CG2   1 
ATOM   1457 C CD1   . ILE A 1 198 ? 4.502   93.438  49.775 1.00 39.49 ? 198  ILE A CD1   1 
ATOM   1458 N N     . VAL B 1 12  ? 22.453  93.098  36.818 1.00 36.03 ? 12   VAL B N     1 
ATOM   1459 C CA    . VAL B 1 12  ? 21.647  93.715  37.916 1.00 36.19 ? 12   VAL B CA    1 
ATOM   1460 C C     . VAL B 1 12  ? 22.046  93.172  39.295 1.00 37.16 ? 12   VAL B C     1 
ATOM   1461 O O     . VAL B 1 12  ? 22.110  91.960  39.500 1.00 38.73 ? 12   VAL B O     1 
ATOM   1462 C CB    . VAL B 1 12  ? 20.131  93.476  37.696 1.00 34.17 ? 12   VAL B CB    1 
ATOM   1463 C CG1   . VAL B 1 12  ? 19.317  94.074  38.842 1.00 30.76 ? 12   VAL B CG1   1 
ATOM   1464 C CG2   . VAL B 1 12  ? 19.705  94.073  36.370 1.00 32.62 ? 12   VAL B CG2   1 
ATOM   1465 N N     . ASP B 1 13  ? 22.324  94.073  40.233 1.00 37.15 ? 13   ASP B N     1 
ATOM   1466 C CA    . ASP B 1 13  ? 22.693  93.679  41.582 1.00 36.70 ? 13   ASP B CA    1 
ATOM   1467 C C     . ASP B 1 13  ? 21.424  93.272  42.312 1.00 35.69 ? 13   ASP B C     1 
ATOM   1468 O O     . ASP B 1 13  ? 20.726  94.119  42.869 1.00 35.83 ? 13   ASP B O     1 
ATOM   1469 C CB    . ASP B 1 13  ? 23.368  94.847  42.308 1.00 39.63 ? 13   ASP B CB    1 
ATOM   1470 C CG    . ASP B 1 13  ? 23.786  94.497  43.734 1.00 43.35 ? 13   ASP B CG    1 
ATOM   1471 O OD1   . ASP B 1 13  ? 24.291  93.369  43.973 1.00 45.72 ? 13   ASP B OD1   1 
ATOM   1472 O OD2   . ASP B 1 13  ? 23.615  95.366  44.623 1.00 47.98 ? 13   ASP B OD2   1 
ATOM   1473 N N     . LEU B 1 14  ? 21.135  91.974  42.311 1.00 35.28 ? 14   LEU B N     1 
ATOM   1474 C CA    . LEU B 1 14  ? 19.940  91.445  42.957 1.00 35.28 ? 14   LEU B CA    1 
ATOM   1475 C C     . LEU B 1 14  ? 19.886  91.697  44.450 1.00 36.60 ? 14   LEU B C     1 
ATOM   1476 O O     . LEU B 1 14  ? 18.823  91.584  45.058 1.00 38.26 ? 14   LEU B O     1 
ATOM   1477 C CB    . LEU B 1 14  ? 19.779  89.957  42.675 1.00 34.69 ? 14   LEU B CB    1 
ATOM   1478 C CG    . LEU B 1 14  ? 19.320  89.548  41.276 1.00 34.47 ? 14   LEU B CG    1 
ATOM   1479 C CD1   . LEU B 1 14  ? 19.224  88.024  41.200 1.00 34.79 ? 14   LEU B CD1   1 
ATOM   1480 C CD2   . LEU B 1 14  ? 17.970  90.180  40.953 1.00 32.46 ? 14   LEU B CD2   1 
ATOM   1481 N N     . SER B 1 15  ? 21.030  92.021  45.044 1.00 37.10 ? 15   SER B N     1 
ATOM   1482 C CA    . SER B 1 15  ? 21.095  92.315  46.474 1.00 36.91 ? 15   SER B CA    1 
ATOM   1483 C C     . SER B 1 15  ? 20.333  93.611  46.755 1.00 36.23 ? 15   SER B C     1 
ATOM   1484 O O     . SER B 1 15  ? 19.727  93.763  47.815 1.00 36.04 ? 15   SER B O     1 
ATOM   1485 C CB    . SER B 1 15  ? 22.552  92.496  46.920 1.00 37.89 ? 15   SER B CB    1 
ATOM   1486 O OG    . SER B 1 15  ? 23.387  91.455  46.444 1.00 40.35 ? 15   SER B OG    1 
ATOM   1487 N N     . LYS B 1 16  ? 20.416  94.557  45.818 1.00 35.80 ? 16   LYS B N     1 
ATOM   1488 C CA    . LYS B 1 16  ? 19.745  95.857  45.937 1.00 35.12 ? 16   LYS B CA    1 
ATOM   1489 C C     . LYS B 1 16  ? 18.480  95.917  45.079 1.00 32.91 ? 16   LYS B C     1 
ATOM   1490 O O     . LYS B 1 16  ? 17.626  96.793  45.251 1.00 33.03 ? 16   LYS B O     1 
ATOM   1491 C CB    . LYS B 1 16  ? 20.706  96.994  45.545 1.00 37.66 ? 16   LYS B CB    1 
ATOM   1492 C CG    . LYS B 1 16  ? 20.057  98.400  45.480 1.00 41.14 ? 16   LYS B CG    1 
ATOM   1493 C CD    . LYS B 1 16  ? 19.300  98.784  46.771 1.00 42.31 ? 16   LYS B CD    1 
ATOM   1494 C CE    . LYS B 1 16  ? 18.456  100.046 46.567 1.00 43.82 ? 16   LYS B CE    1 
ATOM   1495 N NZ    . LYS B 1 16  ? 17.582  100.460 47.716 1.00 42.17 ? 16   LYS B NZ    1 
ATOM   1496 N N     . HIS B 1 17  ? 18.380  94.998  44.132 1.00 30.45 ? 17   HIS B N     1 
ATOM   1497 C CA    . HIS B 1 17  ? 17.227  94.942  43.256 1.00 28.03 ? 17   HIS B CA    1 
ATOM   1498 C C     . HIS B 1 17  ? 16.768  93.486  43.092 1.00 26.22 ? 17   HIS B C     1 
ATOM   1499 O O     . HIS B 1 17  ? 16.899  92.903  42.016 1.00 24.92 ? 17   HIS B O     1 
ATOM   1500 C CB    . HIS B 1 17  ? 17.577  95.558  41.895 1.00 28.09 ? 17   HIS B CB    1 
ATOM   1501 C CG    . HIS B 1 17  ? 18.226  96.908  41.984 1.00 27.85 ? 17   HIS B CG    1 
ATOM   1502 N ND1   . HIS B 1 17  ? 17.515  98.085  41.906 1.00 28.41 ? 17   HIS B ND1   1 
ATOM   1503 C CD2   . HIS B 1 17  ? 19.526  97.265  42.117 1.00 27.56 ? 17   HIS B CD2   1 
ATOM   1504 C CE1   . HIS B 1 17  ? 18.343  99.109  41.983 1.00 27.20 ? 17   HIS B CE1   1 
ATOM   1505 N NE2   . HIS B 1 17  ? 19.570  98.640  42.112 1.00 28.45 ? 17   HIS B NE2   1 
ATOM   1506 N N     . PRO B 1 18  ? 16.198  92.894  44.157 1.00 25.57 ? 18   PRO B N     1 
ATOM   1507 C CA    . PRO B 1 18  ? 15.691  91.510  44.211 1.00 26.84 ? 18   PRO B CA    1 
ATOM   1508 C C     . PRO B 1 18  ? 14.745  91.175  43.046 1.00 27.93 ? 18   PRO B C     1 
ATOM   1509 O O     . PRO B 1 18  ? 14.700  90.043  42.551 1.00 29.13 ? 18   PRO B O     1 
ATOM   1510 C CB    . PRO B 1 18  ? 14.947  91.477  45.542 1.00 26.34 ? 18   PRO B CB    1 
ATOM   1511 C CG    . PRO B 1 18  ? 15.685  92.471  46.358 1.00 26.29 ? 18   PRO B CG    1 
ATOM   1512 C CD    . PRO B 1 18  ? 15.914  93.598  45.418 1.00 24.50 ? 18   PRO B CD    1 
ATOM   1513 N N     . SER B 1 19  ? 13.977  92.177  42.630 1.00 28.14 ? 19   SER B N     1 
ATOM   1514 C CA    . SER B 1 19  ? 13.036  92.056  41.521 1.00 26.13 ? 19   SER B CA    1 
ATOM   1515 C C     . SER B 1 19  ? 13.804  91.812  40.231 1.00 24.94 ? 19   SER B C     1 
ATOM   1516 O O     . SER B 1 19  ? 13.276  91.248  39.277 1.00 24.89 ? 19   SER B O     1 
ATOM   1517 C CB    . SER B 1 19  ? 12.254  93.367  41.379 1.00 25.70 ? 19   SER B CB    1 
ATOM   1518 O OG    . SER B 1 19  ? 13.116  94.453  41.069 1.00 22.45 ? 19   SER B OG    1 
ATOM   1519 N N     . GLY B 1 20  ? 15.040  92.288  40.208 1.00 23.96 ? 20   GLY B N     1 
ATOM   1520 C CA    . GLY B 1 20  ? 15.864  92.168  39.032 1.00 24.57 ? 20   GLY B CA    1 
ATOM   1521 C C     . GLY B 1 20  ? 15.598  93.332  38.091 1.00 25.22 ? 20   GLY B C     1 
ATOM   1522 O O     . GLY B 1 20  ? 16.157  93.379  36.983 1.00 26.50 ? 20   GLY B O     1 
ATOM   1523 N N     . ILE B 1 21  ? 14.760  94.275  38.533 1.00 23.72 ? 21   ILE B N     1 
ATOM   1524 C CA    . ILE B 1 21  ? 14.398  95.443  37.728 1.00 23.29 ? 21   ILE B CA    1 
ATOM   1525 C C     . ILE B 1 21  ? 14.927  96.709  38.370 1.00 23.12 ? 21   ILE B C     1 
ATOM   1526 O O     . ILE B 1 21  ? 14.714  96.943  39.554 1.00 24.78 ? 21   ILE B O     1 
ATOM   1527 C CB    . ILE B 1 21  ? 12.874  95.573  37.574 1.00 23.36 ? 21   ILE B CB    1 
ATOM   1528 C CG1   . ILE B 1 21  ? 12.319  94.349  36.836 1.00 21.79 ? 21   ILE B CG1   1 
ATOM   1529 C CG2   . ILE B 1 21  ? 12.533  96.847  36.822 1.00 22.32 ? 21   ILE B CG2   1 
ATOM   1530 C CD1   . ILE B 1 21  ? 10.862  94.023  37.161 1.00 20.87 ? 21   ILE B CD1   1 
ATOM   1531 N N     . VAL B 1 22  ? 15.604  97.529  37.574 1.00 23.09 ? 22   VAL B N     1 
ATOM   1532 C CA    . VAL B 1 22  ? 16.197  98.773  38.049 1.00 20.95 ? 22   VAL B CA    1 
ATOM   1533 C C     . VAL B 1 22  ? 15.496  99.977  37.425 1.00 20.40 ? 22   VAL B C     1 
ATOM   1534 O O     . VAL B 1 22  ? 15.492  100.122 36.203 1.00 20.97 ? 22   VAL B O     1 
ATOM   1535 C CB    . VAL B 1 22  ? 17.695  98.853  37.658 1.00 20.37 ? 22   VAL B CB    1 
ATOM   1536 C CG1   . VAL B 1 22  ? 18.366  100.007 38.366 1.00 18.29 ? 22   VAL B CG1   1 
ATOM   1537 C CG2   . VAL B 1 22  ? 18.395  97.536  37.963 1.00 19.59 ? 22   VAL B CG2   1 
ATOM   1538 N N     . PRO B 1 23  ? 14.793  100.780 38.243 1.00 19.35 ? 23   PRO B N     1 
ATOM   1539 C CA    . PRO B 1 23  ? 14.111  101.962 37.715 1.00 18.46 ? 23   PRO B CA    1 
ATOM   1540 C C     . PRO B 1 23  ? 15.134  102.898 37.060 1.00 19.47 ? 23   PRO B C     1 
ATOM   1541 O O     . PRO B 1 23  ? 16.279  102.998 37.523 1.00 20.29 ? 23   PRO B O     1 
ATOM   1542 C CB    . PRO B 1 23  ? 13.531  102.598 38.973 1.00 18.48 ? 23   PRO B CB    1 
ATOM   1543 C CG    . PRO B 1 23  ? 13.186  101.417 39.812 1.00 18.04 ? 23   PRO B CG    1 
ATOM   1544 C CD    . PRO B 1 23  ? 14.379  100.508 39.635 1.00 18.97 ? 23   PRO B CD    1 
ATOM   1545 N N     . THR B 1 24  ? 14.735  103.546 35.968 1.00 18.33 ? 24   THR B N     1 
ATOM   1546 C CA    . THR B 1 24  ? 15.581  104.488 35.254 1.00 18.40 ? 24   THR B CA    1 
ATOM   1547 C C     . THR B 1 24  ? 15.361  105.887 35.815 1.00 18.61 ? 24   THR B C     1 
ATOM   1548 O O     . THR B 1 24  ? 14.216  106.310 35.966 1.00 18.50 ? 24   THR B O     1 
ATOM   1549 C CB    . THR B 1 24  ? 15.183  104.522 33.789 1.00 19.73 ? 24   THR B CB    1 
ATOM   1550 O OG1   . THR B 1 24  ? 15.215  103.191 33.275 1.00 22.00 ? 24   THR B OG1   1 
ATOM   1551 C CG2   . THR B 1 24  ? 16.131  105.391 32.983 1.00 18.42 ? 24   THR B CG2   1 
ATOM   1552 N N     . LEU B 1 25  ? 16.438  106.577 36.190 1.00 19.05 ? 25   LEU B N     1 
ATOM   1553 C CA    . LEU B 1 25  ? 16.313  107.944 36.700 1.00 19.36 ? 25   LEU B CA    1 
ATOM   1554 C C     . LEU B 1 25  ? 16.070  108.814 35.467 1.00 21.08 ? 25   LEU B C     1 
ATOM   1555 O O     . LEU B 1 25  ? 16.843  108.766 34.501 1.00 22.90 ? 25   LEU B O     1 
ATOM   1556 C CB    . LEU B 1 25  ? 17.573  108.387 37.433 1.00 17.37 ? 25   LEU B CB    1 
ATOM   1557 C CG    . LEU B 1 25  ? 18.019  107.538 38.626 1.00 17.21 ? 25   LEU B CG    1 
ATOM   1558 C CD1   . LEU B 1 25  ? 19.014  108.332 39.432 1.00 16.15 ? 25   LEU B CD1   1 
ATOM   1559 C CD2   . LEU B 1 25  ? 16.841  107.121 39.496 1.00 16.19 ? 25   LEU B CD2   1 
ATOM   1560 N N     . GLN B 1 26  ? 14.989  109.591 35.500 1.00 21.08 ? 26   GLN B N     1 
ATOM   1561 C CA    . GLN B 1 26  ? 14.564  110.426 34.368 1.00 18.81 ? 26   GLN B CA    1 
ATOM   1562 C C     . GLN B 1 26  ? 14.718  111.934 34.496 1.00 17.19 ? 26   GLN B C     1 
ATOM   1563 O O     . GLN B 1 26  ? 14.758  112.637 33.497 1.00 16.40 ? 26   GLN B O     1 
ATOM   1564 C CB    . GLN B 1 26  ? 13.093  110.121 34.060 1.00 17.55 ? 26   GLN B CB    1 
ATOM   1565 C CG    . GLN B 1 26  ? 12.782  108.638 33.866 1.00 17.77 ? 26   GLN B CG    1 
ATOM   1566 C CD    . GLN B 1 26  ? 13.276  108.092 32.542 1.00 20.03 ? 26   GLN B CD    1 
ATOM   1567 O OE1   . GLN B 1 26  ? 13.923  108.787 31.760 1.00 20.93 ? 26   GLN B OE1   1 
ATOM   1568 N NE2   . GLN B 1 26  ? 12.944  106.846 32.269 1.00 24.24 ? 26   GLN B NE2   1 
ATOM   1569 N N     . ASN B 1 27  ? 14.780  112.426 35.726 1.00 17.92 ? 27   ASN B N     1 
ATOM   1570 C CA    . ASN B 1 27  ? 14.881  113.857 35.978 1.00 17.16 ? 27   ASN B CA    1 
ATOM   1571 C C     . ASN B 1 27  ? 15.394  114.064 37.386 1.00 17.16 ? 27   ASN B C     1 
ATOM   1572 O O     . ASN B 1 27  ? 14.961  113.387 38.322 1.00 17.47 ? 27   ASN B O     1 
ATOM   1573 C CB    . ASN B 1 27  ? 13.493  114.505 35.831 1.00 16.30 ? 27   ASN B CB    1 
ATOM   1574 C CG    . ASN B 1 27  ? 13.517  116.021 35.999 1.00 16.01 ? 27   ASN B CG    1 
ATOM   1575 O OD1   . ASN B 1 27  ? 14.448  116.685 35.577 1.00 16.60 ? 27   ASN B OD1   1 
ATOM   1576 N ND2   . ASN B 1 27  ? 12.470  116.568 36.603 1.00 15.57 ? 27   ASN B ND2   1 
ATOM   1577 N N     . ILE B 1 28  ? 16.326  114.991 37.535 1.00 17.25 ? 28   ILE B N     1 
ATOM   1578 C CA    . ILE B 1 28  ? 16.897  115.295 38.838 1.00 18.06 ? 28   ILE B CA    1 
ATOM   1579 C C     . ILE B 1 28  ? 16.764  116.804 39.033 1.00 19.14 ? 28   ILE B C     1 
ATOM   1580 O O     . ILE B 1 28  ? 17.090  117.576 38.125 1.00 19.61 ? 28   ILE B O     1 
ATOM   1581 C CB    . ILE B 1 28  ? 18.424  114.902 38.919 1.00 16.68 ? 28   ILE B CB    1 
ATOM   1582 C CG1   . ILE B 1 28  ? 18.644  113.437 38.527 1.00 14.18 ? 28   ILE B CG1   1 
ATOM   1583 C CG2   . ILE B 1 28  ? 18.969  115.154 40.311 1.00 15.61 ? 28   ILE B CG2   1 
ATOM   1584 C CD1   . ILE B 1 28  ? 18.106  112.438 39.472 1.00 13.58 ? 28   ILE B CD1   1 
ATOM   1585 N N     . VAL B 1 29  ? 16.207  117.207 40.172 1.00 18.10 ? 29   VAL B N     1 
ATOM   1586 C CA    . VAL B 1 29  ? 16.040  118.614 40.514 1.00 17.63 ? 29   VAL B CA    1 
ATOM   1587 C C     . VAL B 1 29  ? 16.996  118.829 41.678 1.00 18.07 ? 29   VAL B C     1 
ATOM   1588 O O     . VAL B 1 29  ? 17.003  118.044 42.631 1.00 19.11 ? 29   VAL B O     1 
ATOM   1589 C CB    . VAL B 1 29  ? 14.587  118.911 40.996 1.00 18.06 ? 29   VAL B CB    1 
ATOM   1590 C CG1   . VAL B 1 29  ? 14.406  120.395 41.351 1.00 15.90 ? 29   VAL B CG1   1 
ATOM   1591 C CG2   . VAL B 1 29  ? 13.591  118.466 39.953 1.00 15.96 ? 29   VAL B CG2   1 
ATOM   1592 N N     . SER B 1 30  ? 17.794  119.884 41.614 1.00 18.00 ? 30   SER B N     1 
ATOM   1593 C CA    . SER B 1 30  ? 18.743  120.183 42.669 1.00 18.23 ? 30   SER B CA    1 
ATOM   1594 C C     . SER B 1 30  ? 18.833  121.681 42.822 1.00 19.79 ? 30   SER B C     1 
ATOM   1595 O O     . SER B 1 30  ? 18.366  122.414 41.968 1.00 20.69 ? 30   SER B O     1 
ATOM   1596 C CB    . SER B 1 30  ? 20.105  119.636 42.300 1.00 18.27 ? 30   SER B CB    1 
ATOM   1597 O OG    . SER B 1 30  ? 20.600  120.291 41.158 1.00 20.73 ? 30   SER B OG    1 
ATOM   1598 N N     . THR B 1 31  ? 19.372  122.143 43.937 1.00 21.01 ? 31   THR B N     1 
ATOM   1599 C CA    . THR B 1 31  ? 19.521  123.572 44.162 1.00 21.65 ? 31   THR B CA    1 
ATOM   1600 C C     . THR B 1 31  ? 20.913  123.817 44.698 1.00 23.21 ? 31   THR B C     1 
ATOM   1601 O O     . THR B 1 31  ? 21.559  122.904 45.212 1.00 22.43 ? 31   THR B O     1 
ATOM   1602 C CB    . THR B 1 31  ? 18.530  124.115 45.220 1.00 22.16 ? 31   THR B CB    1 
ATOM   1603 O OG1   . THR B 1 31  ? 18.673  123.372 46.436 1.00 22.14 ? 31   THR B OG1   1 
ATOM   1604 C CG2   . THR B 1 31  ? 17.093  124.008 44.736 1.00 21.80 ? 31   THR B CG2   1 
ATOM   1605 N N     . VAL B 1 32  ? 21.394  125.039 44.524 1.00 24.90 ? 32   VAL B N     1 
ATOM   1606 C CA    . VAL B 1 32  ? 22.694  125.424 45.044 1.00 25.52 ? 32   VAL B CA    1 
ATOM   1607 C C     . VAL B 1 32  ? 22.615  126.904 45.339 1.00 27.32 ? 32   VAL B C     1 
ATOM   1608 O O     . VAL B 1 32  ? 21.798  127.623 44.742 1.00 26.91 ? 32   VAL B O     1 
ATOM   1609 C CB    . VAL B 1 32  ? 23.839  125.176 44.068 1.00 25.91 ? 32   VAL B CB    1 
ATOM   1610 C CG1   . VAL B 1 32  ? 23.756  126.154 42.910 1.00 27.01 ? 32   VAL B CG1   1 
ATOM   1611 C CG2   . VAL B 1 32  ? 25.175  125.304 44.799 1.00 23.75 ? 32   VAL B CG2   1 
ATOM   1612 N N     . ASN B 1 33  ? 23.441  127.335 46.289 1.00 28.76 ? 33   ASN B N     1 
ATOM   1613 C CA    . ASN B 1 33  ? 23.501  128.726 46.710 1.00 29.98 ? 33   ASN B CA    1 
ATOM   1614 C C     . ASN B 1 33  ? 24.792  129.346 46.170 1.00 30.78 ? 33   ASN B C     1 
ATOM   1615 O O     . ASN B 1 33  ? 25.892  129.025 46.630 1.00 29.99 ? 33   ASN B O     1 
ATOM   1616 C CB    . ASN B 1 33  ? 23.451  128.807 48.239 1.00 29.62 ? 33   ASN B CB    1 
ATOM   1617 C CG    . ASN B 1 33  ? 23.232  130.215 48.742 1.00 30.63 ? 33   ASN B CG    1 
ATOM   1618 O OD1   . ASN B 1 33  ? 23.351  131.183 47.997 1.00 31.90 ? 33   ASN B OD1   1 
ATOM   1619 N ND2   . ASN B 1 33  ? 22.906  130.338 50.015 1.00 30.76 ? 33   ASN B ND2   1 
ATOM   1620 N N     . LEU B 1 34  ? 24.657  130.181 45.146 1.00 31.50 ? 34   LEU B N     1 
ATOM   1621 C CA    . LEU B 1 34  ? 25.818  130.828 44.561 1.00 33.27 ? 34   LEU B CA    1 
ATOM   1622 C C     . LEU B 1 34  ? 26.424  131.766 45.602 1.00 35.35 ? 34   LEU B C     1 
ATOM   1623 O O     . LEU B 1 34  ? 27.553  132.225 45.460 1.00 36.57 ? 34   LEU B O     1 
ATOM   1624 C CB    . LEU B 1 34  ? 25.452  131.549 43.260 1.00 31.14 ? 34   LEU B CB    1 
ATOM   1625 C CG    . LEU B 1 34  ? 24.951  130.599 42.166 1.00 30.72 ? 34   LEU B CG    1 
ATOM   1626 C CD1   . LEU B 1 34  ? 24.717  131.373 40.875 1.00 29.17 ? 34   LEU B CD1   1 
ATOM   1627 C CD2   . LEU B 1 34  ? 25.939  129.439 41.955 1.00 27.74 ? 34   LEU B CD2   1 
ATOM   1628 N N     . ASP B 1 35  ? 25.654  132.057 46.644 1.00 37.21 ? 35   ASP B N     1 
ATOM   1629 C CA    . ASP B 1 35  ? 26.138  132.867 47.741 1.00 38.84 ? 35   ASP B CA    1 
ATOM   1630 C C     . ASP B 1 35  ? 26.655  134.227 47.303 1.00 40.01 ? 35   ASP B C     1 
ATOM   1631 O O     . ASP B 1 35  ? 27.818  134.567 47.537 1.00 40.23 ? 35   ASP B O     1 
ATOM   1632 C CB    . ASP B 1 35  ? 27.238  132.091 48.462 1.00 41.27 ? 35   ASP B CB    1 
ATOM   1633 C CG    . ASP B 1 35  ? 27.487  132.582 49.866 1.00 44.46 ? 35   ASP B CG    1 
ATOM   1634 O OD1   . ASP B 1 35  ? 26.533  133.086 50.512 1.00 46.15 ? 35   ASP B OD1   1 
ATOM   1635 O OD2   . ASP B 1 35  ? 28.645  132.430 50.332 1.00 47.18 ? 35   ASP B OD2   1 
ATOM   1636 N N     . CYS B 1 36  ? 25.799  134.970 46.607 1.00 40.43 ? 36   CYS B N     1 
ATOM   1637 C CA    . CYS B 1 36  ? 26.106  136.324 46.155 1.00 40.44 ? 36   CYS B CA    1 
ATOM   1638 C C     . CYS B 1 36  ? 24.858  136.845 45.471 1.00 39.70 ? 36   CYS B C     1 
ATOM   1639 O O     . CYS B 1 36  ? 24.135  136.076 44.844 1.00 38.81 ? 36   CYS B O     1 
ATOM   1640 C CB    . CYS B 1 36  ? 27.334  136.372 45.231 1.00 40.31 ? 36   CYS B CB    1 
ATOM   1641 S SG    . CYS B 1 36  ? 27.057  136.053 43.501 1.00 45.39 ? 36   CYS B SG    1 
ATOM   1642 N N     . LYS B 1 37  ? 24.549  138.121 45.688 1.00 39.52 ? 37   LYS B N     1 
ATOM   1643 C CA    . LYS B 1 37  ? 23.361  138.736 45.097 1.00 39.61 ? 37   LYS B CA    1 
ATOM   1644 C C     . LYS B 1 37  ? 23.601  138.897 43.598 1.00 38.41 ? 37   LYS B C     1 
ATOM   1645 O O     . LYS B 1 37  ? 24.717  139.203 43.176 1.00 39.05 ? 37   LYS B O     1 
ATOM   1646 C CB    . LYS B 1 37  ? 23.081  140.098 45.752 1.00 41.79 ? 37   LYS B CB    1 
ATOM   1647 C CG    . LYS B 1 37  ? 23.047  140.090 47.304 1.00 44.23 ? 37   LYS B CG    1 
ATOM   1648 C CD    . LYS B 1 37  ? 21.631  140.091 47.908 1.00 44.81 ? 37   LYS B CD    1 
ATOM   1649 C CE    . LYS B 1 37  ? 20.909  138.759 47.721 1.00 44.94 ? 37   LYS B CE    1 
ATOM   1650 N NZ    . LYS B 1 37  ? 19.449  138.851 48.041 1.00 44.06 ? 37   LYS B NZ    1 
ATOM   1651 N N     . LEU B 1 38  ? 22.573  138.677 42.789 1.00 36.01 ? 38   LEU B N     1 
ATOM   1652 C CA    . LEU B 1 38  ? 22.742  138.789 41.353 1.00 34.72 ? 38   LEU B CA    1 
ATOM   1653 C C     . LEU B 1 38  ? 21.878  139.872 40.761 1.00 34.90 ? 38   LEU B C     1 
ATOM   1654 O O     . LEU B 1 38  ? 20.888  140.274 41.352 1.00 36.23 ? 38   LEU B O     1 
ATOM   1655 C CB    . LEU B 1 38  ? 22.449  137.449 40.678 1.00 33.61 ? 38   LEU B CB    1 
ATOM   1656 C CG    . LEU B 1 38  ? 23.276  136.245 41.147 1.00 31.12 ? 38   LEU B CG    1 
ATOM   1657 C CD1   . LEU B 1 38  ? 22.743  134.970 40.503 1.00 30.90 ? 38   LEU B CD1   1 
ATOM   1658 C CD2   . LEU B 1 38  ? 24.748  136.442 40.827 1.00 29.72 ? 38   LEU B CD2   1 
ATOM   1659 N N     . ASP B 1 39  ? 22.304  140.390 39.616 1.00 36.20 ? 39   ASP B N     1 
ATOM   1660 C CA    . ASP B 1 39  ? 21.577  141.438 38.904 1.00 36.30 ? 39   ASP B CA    1 
ATOM   1661 C C     . ASP B 1 39  ? 20.974  140.725 37.715 1.00 35.25 ? 39   ASP B C     1 
ATOM   1662 O O     . ASP B 1 39  ? 21.632  140.537 36.692 1.00 34.16 ? 39   ASP B O     1 
ATOM   1663 C CB    . ASP B 1 39  ? 22.548  142.524 38.433 1.00 38.36 ? 39   ASP B CB    1 
ATOM   1664 C CG    . ASP B 1 39  ? 21.862  143.654 37.671 1.00 39.50 ? 39   ASP B CG    1 
ATOM   1665 O OD1   . ASP B 1 39  ? 20.668  143.545 37.307 1.00 40.61 ? 39   ASP B OD1   1 
ATOM   1666 O OD2   . ASP B 1 39  ? 22.548  144.663 37.407 1.00 43.55 ? 39   ASP B OD2   1 
ATOM   1667 N N     . LEU B 1 40  ? 19.710  140.350 37.852 1.00 35.00 ? 40   LEU B N     1 
ATOM   1668 C CA    . LEU B 1 40  ? 19.033  139.605 36.808 1.00 35.51 ? 40   LEU B CA    1 
ATOM   1669 C C     . LEU B 1 40  ? 18.892  140.346 35.481 1.00 36.93 ? 40   LEU B C     1 
ATOM   1670 O O     . LEU B 1 40  ? 19.007  139.736 34.413 1.00 37.45 ? 40   LEU B O     1 
ATOM   1671 C CB    . LEU B 1 40  ? 17.693  139.072 37.317 1.00 33.10 ? 40   LEU B CB    1 
ATOM   1672 C CG    . LEU B 1 40  ? 17.774  138.158 38.555 1.00 31.42 ? 40   LEU B CG    1 
ATOM   1673 C CD1   . LEU B 1 40  ? 16.404  137.547 38.835 1.00 29.78 ? 40   LEU B CD1   1 
ATOM   1674 C CD2   . LEU B 1 40  ? 18.810  137.054 38.355 1.00 27.72 ? 40   LEU B CD2   1 
ATOM   1675 N N     . LYS B 1 41  ? 18.690  141.660 35.537 1.00 38.72 ? 41   LYS B N     1 
ATOM   1676 C CA    . LYS B 1 41  ? 18.565  142.448 34.309 1.00 38.85 ? 41   LYS B CA    1 
ATOM   1677 C C     . LYS B 1 41  ? 19.908  142.402 33.593 1.00 38.64 ? 41   LYS B C     1 
ATOM   1678 O O     . LYS B 1 41  ? 19.975  142.150 32.396 1.00 38.72 ? 41   LYS B O     1 
ATOM   1679 C CB    . LYS B 1 41  ? 18.176  143.882 34.627 1.00 39.34 ? 41   LYS B CB    1 
ATOM   1680 N N     . ALA B 1 42  ? 20.975  142.561 34.366 1.00 39.08 ? 42   ALA B N     1 
ATOM   1681 C CA    . ALA B 1 42  ? 22.333  142.527 33.841 1.00 39.51 ? 42   ALA B CA    1 
ATOM   1682 C C     . ALA B 1 42  ? 22.663  141.166 33.248 1.00 40.39 ? 42   ALA B C     1 
ATOM   1683 O O     . ALA B 1 42  ? 23.226  141.089 32.156 1.00 42.88 ? 42   ALA B O     1 
ATOM   1684 C CB    . ALA B 1 42  ? 23.331  142.869 34.936 1.00 38.88 ? 42   ALA B CB    1 
ATOM   1685 N N     . ILE B 1 43  ? 22.334  140.096 33.972 1.00 40.31 ? 43   ILE B N     1 
ATOM   1686 C CA    . ILE B 1 43  ? 22.596  138.736 33.502 1.00 39.18 ? 43   ILE B CA    1 
ATOM   1687 C C     . ILE B 1 43  ? 21.885  138.487 32.169 1.00 38.01 ? 43   ILE B C     1 
ATOM   1688 O O     . ILE B 1 43  ? 22.507  138.072 31.193 1.00 37.28 ? 43   ILE B O     1 
ATOM   1689 C CB    . ILE B 1 43  ? 22.147  137.675 34.548 1.00 39.59 ? 43   ILE B CB    1 
ATOM   1690 C CG1   . ILE B 1 43  ? 23.147  137.620 35.706 1.00 38.98 ? 43   ILE B CG1   1 
ATOM   1691 C CG2   . ILE B 1 43  ? 21.986  136.295 33.891 1.00 39.43 ? 43   ILE B CG2   1 
ATOM   1692 C CD1   . ILE B 1 43  ? 22.772  136.630 36.795 1.00 37.23 ? 43   ILE B CD1   1 
ATOM   1693 N N     . ALA B 1 44  ? 20.590  138.778 32.127 1.00 37.74 ? 44   ALA B N     1 
ATOM   1694 C CA    . ALA B 1 44  ? 19.804  138.589 30.913 1.00 38.52 ? 44   ALA B CA    1 
ATOM   1695 C C     . ALA B 1 44  ? 20.302  139.475 29.760 1.00 39.36 ? 44   ALA B C     1 
ATOM   1696 O O     . ALA B 1 44  ? 20.156  139.118 28.591 1.00 40.16 ? 44   ALA B O     1 
ATOM   1697 C CB    . ALA B 1 44  ? 18.334  138.842 31.193 1.00 36.12 ? 44   ALA B CB    1 
ATOM   1698 N N     . LEU B 1 45  ? 20.876  140.627 30.090 1.00 39.88 ? 45   LEU B N     1 
ATOM   1699 C CA    . LEU B 1 45  ? 21.411  141.528 29.073 1.00 41.26 ? 45   LEU B CA    1 
ATOM   1700 C C     . LEU B 1 45  ? 22.690  140.942 28.484 1.00 41.59 ? 45   LEU B C     1 
ATOM   1701 O O     . LEU B 1 45  ? 22.796  140.719 27.281 1.00 42.02 ? 45   LEU B O     1 
ATOM   1702 C CB    . LEU B 1 45  ? 21.732  142.903 29.672 1.00 41.80 ? 45   LEU B CB    1 
ATOM   1703 C CG    . LEU B 1 45  ? 20.600  143.869 30.033 1.00 43.65 ? 45   LEU B CG    1 
ATOM   1704 C CD1   . LEU B 1 45  ? 21.159  145.044 30.843 1.00 43.33 ? 45   LEU B CD1   1 
ATOM   1705 C CD2   . LEU B 1 45  ? 19.896  144.356 28.768 1.00 44.50 ? 45   LEU B CD2   1 
ATOM   1706 N N     . GLN B 1 46  ? 23.663  140.699 29.351 1.00 42.55 ? 46   GLN B N     1 
ATOM   1707 C CA    . GLN B 1 46  ? 24.948  140.159 28.945 1.00 43.65 ? 46   GLN B CA    1 
ATOM   1708 C C     . GLN B 1 46  ? 24.827  138.755 28.365 1.00 43.68 ? 46   GLN B C     1 
ATOM   1709 O O     . GLN B 1 46  ? 25.736  138.290 27.680 1.00 43.93 ? 46   GLN B O     1 
ATOM   1710 C CB    . GLN B 1 46  ? 25.919  140.181 30.130 1.00 45.09 ? 46   GLN B CB    1 
ATOM   1711 C CG    . GLN B 1 46  ? 27.198  140.976 29.878 1.00 48.54 ? 46   GLN B CG    1 
ATOM   1712 C CD    . GLN B 1 46  ? 28.107  140.337 28.822 1.00 50.44 ? 46   GLN B CD    1 
ATOM   1713 O OE1   . GLN B 1 46  ? 27.831  140.404 27.624 1.00 50.11 ? 46   GLN B OE1   1 
ATOM   1714 N NE2   . GLN B 1 46  ? 29.202  139.719 29.271 1.00 50.81 ? 46   GLN B NE2   1 
ATOM   1715 N N     . ALA B 1 47  ? 23.718  138.078 28.660 1.00 44.64 ? 47   ALA B N     1 
ATOM   1716 C CA    . ALA B 1 47  ? 23.456  136.727 28.151 1.00 45.99 ? 47   ALA B CA    1 
ATOM   1717 C C     . ALA B 1 47  ? 22.091  136.727 27.463 1.00 47.49 ? 47   ALA B C     1 
ATOM   1718 O O     . ALA B 1 47  ? 21.112  136.220 28.006 1.00 48.40 ? 47   ALA B O     1 
ATOM   1719 C CB    . ALA B 1 47  ? 23.473  135.705 29.293 1.00 44.49 ? 47   ALA B CB    1 
ATOM   1720 N N     . ARG B 1 48  ? 22.041  137.292 26.261 1.00 48.46 ? 48   ARG B N     1 
ATOM   1721 C CA    . ARG B 1 48  ? 20.812  137.401 25.471 1.00 48.66 ? 48   ARG B CA    1 
ATOM   1722 C C     . ARG B 1 48  ? 20.031  136.094 25.318 1.00 48.79 ? 48   ARG B C     1 
ATOM   1723 O O     . ARG B 1 48  ? 18.835  136.102 24.991 1.00 49.62 ? 48   ARG B O     1 
ATOM   1724 C CB    . ARG B 1 48  ? 21.143  137.977 24.096 1.00 48.32 ? 48   ARG B CB    1 
ATOM   1725 N N     . ASN B 1 49  ? 20.734  134.978 25.510 1.00 48.76 ? 49   ASN B N     1 
ATOM   1726 C CA    . ASN B 1 49  ? 20.168  133.628 25.410 1.00 47.66 ? 49   ASN B CA    1 
ATOM   1727 C C     . ASN B 1 49  ? 19.438  133.206 26.688 1.00 46.95 ? 49   ASN B C     1 
ATOM   1728 O O     . ASN B 1 49  ? 18.896  132.103 26.766 1.00 48.38 ? 49   ASN B O     1 
ATOM   1729 C CB    . ASN B 1 49  ? 21.287  132.632 25.145 1.00 47.50 ? 49   ASN B CB    1 
ATOM   1730 C CG    . ASN B 1 49  ? 22.346  132.686 26.209 1.00 48.12 ? 49   ASN B CG    1 
ATOM   1731 O OD1   . ASN B 1 49  ? 23.063  133.684 26.332 1.00 48.69 ? 49   ASN B OD1   1 
ATOM   1732 N ND2   . ASN B 1 49  ? 22.412  131.649 27.030 1.00 49.00 ? 49   ASN B ND2   1 
ATOM   1733 N N     . ALA B 1 50  ? 19.494  134.047 27.711 1.00 45.26 ? 50   ALA B N     1 
ATOM   1734 C CA    . ALA B 1 50  ? 18.821  133.769 28.968 1.00 43.78 ? 50   ALA B CA    1 
ATOM   1735 C C     . ALA B 1 50  ? 17.444  134.407 28.878 1.00 42.80 ? 50   ALA B C     1 
ATOM   1736 O O     . ALA B 1 50  ? 17.295  135.460 28.263 1.00 43.05 ? 50   ALA B O     1 
ATOM   1737 C CB    . ALA B 1 50  ? 19.601  134.375 30.121 1.00 42.88 ? 50   ALA B CB    1 
ATOM   1738 N N     . GLU B 1 51  ? 16.435  133.749 29.443 1.00 41.93 ? 51   GLU B N     1 
ATOM   1739 C CA    . GLU B 1 51  ? 15.074  134.275 29.445 1.00 40.56 ? 51   GLU B CA    1 
ATOM   1740 C C     . GLU B 1 51  ? 14.823  134.949 30.773 1.00 40.04 ? 51   GLU B C     1 
ATOM   1741 O O     . GLU B 1 51  ? 15.122  134.389 31.820 1.00 39.29 ? 51   GLU B O     1 
ATOM   1742 C CB    . GLU B 1 51  ? 14.062  133.160 29.292 1.00 41.12 ? 51   GLU B CB    1 
ATOM   1743 C CG    . GLU B 1 51  ? 14.297  132.280 28.097 1.00 45.06 ? 51   GLU B CG    1 
ATOM   1744 C CD    . GLU B 1 51  ? 13.412  131.050 28.112 1.00 48.18 ? 51   GLU B CD    1 
ATOM   1745 O OE1   . GLU B 1 51  ? 12.474  130.989 28.942 1.00 48.89 ? 51   GLU B OE1   1 
ATOM   1746 O OE2   . GLU B 1 51  ? 13.664  130.137 27.294 1.00 50.65 ? 51   GLU B OE2   1 
ATOM   1747 N N     . TYR B 1 52  ? 14.292  136.161 30.733 1.00 40.33 ? 52   TYR B N     1 
ATOM   1748 C CA    . TYR B 1 52  ? 13.996  136.879 31.957 1.00 40.46 ? 52   TYR B CA    1 
ATOM   1749 C C     . TYR B 1 52  ? 12.724  137.705 31.860 1.00 41.34 ? 52   TYR B C     1 
ATOM   1750 O O     . TYR B 1 52  ? 12.715  138.784 31.270 1.00 42.22 ? 52   TYR B O     1 
ATOM   1751 C CB    . TYR B 1 52  ? 15.162  137.775 32.384 1.00 38.26 ? 52   TYR B CB    1 
ATOM   1752 C CG    . TYR B 1 52  ? 14.896  138.459 33.705 1.00 37.17 ? 52   TYR B CG    1 
ATOM   1753 C CD1   . TYR B 1 52  ? 14.284  137.766 34.750 1.00 36.84 ? 52   TYR B CD1   1 
ATOM   1754 C CD2   . TYR B 1 52  ? 15.237  139.797 33.908 1.00 37.10 ? 52   TYR B CD2   1 
ATOM   1755 C CE1   . TYR B 1 52  ? 14.017  138.378 35.964 1.00 37.50 ? 52   TYR B CE1   1 
ATOM   1756 C CE2   . TYR B 1 52  ? 14.972  140.432 35.127 1.00 37.46 ? 52   TYR B CE2   1 
ATOM   1757 C CZ    . TYR B 1 52  ? 14.360  139.711 36.151 1.00 38.76 ? 52   TYR B CZ    1 
ATOM   1758 O OH    . TYR B 1 52  ? 14.082  140.307 37.364 1.00 39.58 ? 52   TYR B OH    1 
ATOM   1759 N N     . ASN B 1 53  ? 11.646  137.187 32.431 1.00 42.15 ? 53   ASN B N     1 
ATOM   1760 C CA    . ASN B 1 53  ? 10.384  137.903 32.437 1.00 42.43 ? 53   ASN B CA    1 
ATOM   1761 C C     . ASN B 1 53  ? 9.896   137.970 33.879 1.00 41.19 ? 53   ASN B C     1 
ATOM   1762 O O     . ASN B 1 53  ? 9.118   137.126 34.331 1.00 39.84 ? 53   ASN B O     1 
ATOM   1763 C CB    . ASN B 1 53  ? 9.336   137.229 31.541 1.00 44.57 ? 53   ASN B CB    1 
ATOM   1764 C CG    . ASN B 1 53  ? 8.027   138.026 31.471 1.00 46.98 ? 53   ASN B CG    1 
ATOM   1765 O OD1   . ASN B 1 53  ? 7.904   139.117 32.060 1.00 46.48 ? 53   ASN B OD1   1 
ATOM   1766 N ND2   . ASN B 1 53  ? 7.040   137.480 30.757 1.00 47.09 ? 53   ASN B ND2   1 
ATOM   1767 N N     . PRO B 1 54  ? 10.349  138.991 34.616 1.00 40.54 ? 54   PRO B N     1 
ATOM   1768 C CA    . PRO B 1 54  ? 9.977   139.197 36.014 1.00 40.62 ? 54   PRO B CA    1 
ATOM   1769 C C     . PRO B 1 54  ? 8.466   139.348 36.221 1.00 40.81 ? 54   PRO B C     1 
ATOM   1770 O O     . PRO B 1 54  ? 7.960   139.126 37.321 1.00 41.61 ? 54   PRO B O     1 
ATOM   1771 C CB    . PRO B 1 54  ? 10.764  140.451 36.391 1.00 40.22 ? 54   PRO B CB    1 
ATOM   1772 C CG    . PRO B 1 54  ? 10.907  141.169 35.099 1.00 40.95 ? 54   PRO B CG    1 
ATOM   1773 C CD    . PRO B 1 54  ? 11.236  140.068 34.151 1.00 40.34 ? 54   PRO B CD    1 
ATOM   1774 N N     . LYS B 1 55  ? 7.746   139.737 35.177 1.00 40.44 ? 55   LYS B N     1 
ATOM   1775 C CA    . LYS B 1 55  ? 6.307   139.855 35.290 1.00 40.28 ? 55   LYS B CA    1 
ATOM   1776 C C     . LYS B 1 55  ? 5.752   138.440 35.364 1.00 40.37 ? 55   LYS B C     1 
ATOM   1777 O O     . LYS B 1 55  ? 4.738   138.182 36.017 1.00 41.56 ? 55   LYS B O     1 
ATOM   1778 C CB    . LYS B 1 55  ? 5.721   140.565 34.069 1.00 41.93 ? 55   LYS B CB    1 
ATOM   1779 C CG    . LYS B 1 55  ? 5.578   142.068 34.217 1.00 44.69 ? 55   LYS B CG    1 
ATOM   1780 C CD    . LYS B 1 55  ? 4.762   142.654 33.071 1.00 47.04 ? 55   LYS B CD    1 
ATOM   1781 C CE    . LYS B 1 55  ? 4.524   144.162 33.246 1.00 49.51 ? 55   LYS B CE    1 
ATOM   1782 N NZ    . LYS B 1 55  ? 3.601   144.719 32.195 1.00 48.72 ? 55   LYS B NZ    1 
ATOM   1783 N N     . ARG B 1 56  ? 6.455   137.521 34.712 1.00 40.27 ? 56   ARG B N     1 
ATOM   1784 C CA    . ARG B 1 56  ? 6.063   136.118 34.644 1.00 39.56 ? 56   ARG B CA    1 
ATOM   1785 C C     . ARG B 1 56  ? 6.673   135.285 35.784 1.00 37.79 ? 56   ARG B C     1 
ATOM   1786 O O     . ARG B 1 56  ? 5.944   134.635 36.542 1.00 38.83 ? 56   ARG B O     1 
ATOM   1787 C CB    . ARG B 1 56  ? 6.450   135.566 33.264 1.00 40.10 ? 56   ARG B CB    1 
ATOM   1788 C CG    . ARG B 1 56  ? 6.013   134.146 32.944 1.00 41.60 ? 56   ARG B CG    1 
ATOM   1789 C CD    . ARG B 1 56  ? 6.494   133.781 31.531 1.00 43.08 ? 56   ARG B CD    1 
ATOM   1790 N NE    . ARG B 1 56  ? 6.446   132.351 31.217 1.00 43.44 ? 56   ARG B NE    1 
ATOM   1791 C CZ    . ARG B 1 56  ? 5.335   131.619 31.184 1.00 44.91 ? 56   ARG B CZ    1 
ATOM   1792 N NH1   . ARG B 1 56  ? 4.159   132.172 31.461 1.00 45.72 ? 56   ARG B NH1   1 
ATOM   1793 N NH2   . ARG B 1 56  ? 5.388   130.341 30.811 1.00 44.87 ? 56   ARG B NH2   1 
ATOM   1794 N N     . PHE B 1 57  ? 7.995   135.302 35.910 1.00 34.47 ? 57   PHE B N     1 
ATOM   1795 C CA    . PHE B 1 57  ? 8.664   134.543 36.961 1.00 31.65 ? 57   PHE B CA    1 
ATOM   1796 C C     . PHE B 1 57  ? 9.877   135.336 37.417 1.00 29.79 ? 57   PHE B C     1 
ATOM   1797 O O     . PHE B 1 57  ? 10.551  135.970 36.609 1.00 29.02 ? 57   PHE B O     1 
ATOM   1798 C CB    . PHE B 1 57  ? 9.074   133.140 36.462 1.00 31.27 ? 57   PHE B CB    1 
ATOM   1799 C CG    . PHE B 1 57  ? 9.455   132.175 37.572 1.00 29.96 ? 57   PHE B CG    1 
ATOM   1800 C CD1   . PHE B 1 57  ? 8.583   131.924 38.629 1.00 28.76 ? 57   PHE B CD1   1 
ATOM   1801 C CD2   . PHE B 1 57  ? 10.704  131.553 37.580 1.00 29.59 ? 57   PHE B CD2   1 
ATOM   1802 C CE1   . PHE B 1 57  ? 8.949   131.073 39.685 1.00 28.51 ? 57   PHE B CE1   1 
ATOM   1803 C CE2   . PHE B 1 57  ? 11.077  130.705 38.627 1.00 28.38 ? 57   PHE B CE2   1 
ATOM   1804 C CZ    . PHE B 1 57  ? 10.194  130.469 39.682 1.00 28.28 ? 57   PHE B CZ    1 
ATOM   1805 N N     . ALA B 1 58  ? 10.136  135.295 38.719 1.00 29.06 ? 58   ALA B N     1 
ATOM   1806 C CA    . ALA B 1 58  ? 11.239  136.013 39.345 1.00 28.82 ? 58   ALA B CA    1 
ATOM   1807 C C     . ALA B 1 58  ? 12.644  135.441 39.136 1.00 28.52 ? 58   ALA B C     1 
ATOM   1808 O O     . ALA B 1 58  ? 13.542  135.721 39.924 1.00 30.00 ? 58   ALA B O     1 
ATOM   1809 C CB    . ALA B 1 58  ? 10.959  136.151 40.848 1.00 30.61 ? 58   ALA B CB    1 
ATOM   1810 N N     . ALA B 1 59  ? 12.867  134.695 38.067 1.00 27.90 ? 59   ALA B N     1 
ATOM   1811 C CA    . ALA B 1 59  ? 14.184  134.120 37.838 1.00 26.79 ? 59   ALA B CA    1 
ATOM   1812 C C     . ALA B 1 59  ? 14.595  134.207 36.385 1.00 26.52 ? 59   ALA B C     1 
ATOM   1813 O O     . ALA B 1 59  ? 13.744  134.359 35.500 1.00 27.75 ? 59   ALA B O     1 
ATOM   1814 C CB    . ALA B 1 59  ? 14.175  132.671 38.249 1.00 25.61 ? 59   ALA B CB    1 
ATOM   1815 N N     . VAL B 1 60  ? 15.903  134.128 36.153 1.00 25.50 ? 60   VAL B N     1 
ATOM   1816 C CA    . VAL B 1 60  ? 16.479  134.104 34.810 1.00 24.08 ? 60   VAL B CA    1 
ATOM   1817 C C     . VAL B 1 60  ? 16.497  132.607 34.435 1.00 23.47 ? 60   VAL B C     1 
ATOM   1818 O O     . VAL B 1 60  ? 16.954  131.777 35.219 1.00 21.32 ? 60   VAL B O     1 
ATOM   1819 C CB    . VAL B 1 60  ? 17.934  134.688 34.806 1.00 24.60 ? 60   VAL B CB    1 
ATOM   1820 C CG1   . VAL B 1 60  ? 18.714  134.224 33.571 1.00 24.21 ? 60   VAL B CG1   1 
ATOM   1821 C CG2   . VAL B 1 60  ? 17.890  136.217 34.832 1.00 22.76 ? 60   VAL B CG2   1 
ATOM   1822 N N     . ILE B 1 61  ? 15.889  132.261 33.302 1.00 24.72 ? 61   ILE B N     1 
ATOM   1823 C CA    . ILE B 1 61  ? 15.840  130.883 32.825 1.00 25.61 ? 61   ILE B CA    1 
ATOM   1824 C C     . ILE B 1 61  ? 17.039  130.725 31.909 1.00 26.76 ? 61   ILE B C     1 
ATOM   1825 O O     . ILE B 1 61  ? 17.199  131.481 30.960 1.00 28.15 ? 61   ILE B O     1 
ATOM   1826 C CB    . ILE B 1 61  ? 14.572  130.597 31.993 1.00 25.76 ? 61   ILE B CB    1 
ATOM   1827 C CG1   . ILE B 1 61  ? 13.329  131.263 32.605 1.00 25.65 ? 61   ILE B CG1   1 
ATOM   1828 C CG2   . ILE B 1 61  ? 14.367  129.104 31.866 1.00 25.55 ? 61   ILE B CG2   1 
ATOM   1829 C CD1   . ILE B 1 61  ? 12.785  130.619 33.855 1.00 25.52 ? 61   ILE B CD1   1 
ATOM   1830 N N     . MET B 1 62  ? 17.870  129.729 32.166 1.00 27.65 ? 62   MET B N     1 
ATOM   1831 C CA    . MET B 1 62  ? 19.067  129.517 31.365 1.00 27.42 ? 62   MET B CA    1 
ATOM   1832 C C     . MET B 1 62  ? 19.157  128.022 31.075 1.00 26.73 ? 62   MET B C     1 
ATOM   1833 O O     . MET B 1 62  ? 18.800  127.207 31.915 1.00 26.41 ? 62   MET B O     1 
ATOM   1834 C CB    . MET B 1 62  ? 20.286  129.959 32.187 1.00 31.21 ? 62   MET B CB    1 
ATOM   1835 C CG    . MET B 1 62  ? 21.397  130.665 31.433 1.00 34.83 ? 62   MET B CG    1 
ATOM   1836 S SD    . MET B 1 62  ? 22.829  130.929 32.514 1.00 40.61 ? 62   MET B SD    1 
ATOM   1837 C CE    . MET B 1 62  ? 22.711  132.691 32.924 1.00 37.43 ? 62   MET B CE    1 
ATOM   1838 N N     . ARG B 1 63  ? 19.653  127.650 29.904 1.00 26.99 ? 63   ARG B N     1 
ATOM   1839 C CA    . ARG B 1 63  ? 19.771  126.236 29.557 1.00 26.74 ? 63   ARG B CA    1 
ATOM   1840 C C     . ARG B 1 63  ? 21.116  125.919 28.914 1.00 26.75 ? 63   ARG B C     1 
ATOM   1841 O O     . ARG B 1 63  ? 21.717  126.788 28.297 1.00 28.31 ? 63   ARG B O     1 
ATOM   1842 C CB    . ARG B 1 63  ? 18.648  125.849 28.601 1.00 24.59 ? 63   ARG B CB    1 
ATOM   1843 C CG    . ARG B 1 63  ? 17.281  126.158 29.135 1.00 25.86 ? 63   ARG B CG    1 
ATOM   1844 C CD    . ARG B 1 63  ? 16.222  125.677 28.171 1.00 27.73 ? 63   ARG B CD    1 
ATOM   1845 N NE    . ARG B 1 63  ? 14.891  125.545 28.779 1.00 28.75 ? 63   ARG B NE    1 
ATOM   1846 C CZ    . ARG B 1 63  ? 13.993  126.521 28.875 1.00 25.96 ? 63   ARG B CZ    1 
ATOM   1847 N NH1   . ARG B 1 63  ? 14.266  127.731 28.415 1.00 25.86 ? 63   ARG B NH1   1 
ATOM   1848 N NH2   . ARG B 1 63  ? 12.807  126.265 29.404 1.00 24.63 ? 63   ARG B NH2   1 
ATOM   1849 N N     . ILE B 1 64  ? 21.638  124.718 29.163 1.00 26.48 ? 64   ILE B N     1 
ATOM   1850 C CA    . ILE B 1 64  ? 22.893  124.268 28.551 1.00 25.17 ? 64   ILE B CA    1 
ATOM   1851 C C     . ILE B 1 64  ? 22.596  122.919 27.912 1.00 25.45 ? 64   ILE B C     1 
ATOM   1852 O O     . ILE B 1 64  ? 21.617  122.267 28.286 1.00 26.25 ? 64   ILE B O     1 
ATOM   1853 C CB    . ILE B 1 64  ? 24.106  124.162 29.541 1.00 24.32 ? 64   ILE B CB    1 
ATOM   1854 C CG1   . ILE B 1 64  ? 23.856  123.143 30.653 1.00 20.91 ? 64   ILE B CG1   1 
ATOM   1855 C CG2   . ILE B 1 64  ? 24.494  125.546 30.074 1.00 23.89 ? 64   ILE B CG2   1 
ATOM   1856 C CD1   . ILE B 1 64  ? 25.026  123.005 31.598 1.00 18.67 ? 64   ILE B CD1   1 
ATOM   1857 N N     . ARG B 1 65  ? 23.399  122.531 26.920 1.00 25.68 ? 65   ARG B N     1 
ATOM   1858 C CA    . ARG B 1 65  ? 23.210  121.271 26.193 1.00 25.90 ? 65   ARG B CA    1 
ATOM   1859 C C     . ARG B 1 65  ? 23.770  120.017 26.850 1.00 25.68 ? 65   ARG B C     1 
ATOM   1860 O O     . ARG B 1 65  ? 23.283  118.919 26.608 1.00 26.19 ? 65   ARG B O     1 
ATOM   1861 C CB    . ARG B 1 65  ? 23.828  121.355 24.797 1.00 27.07 ? 65   ARG B CB    1 
ATOM   1862 C CG    . ARG B 1 65  ? 23.131  122.252 23.814 1.00 27.63 ? 65   ARG B CG    1 
ATOM   1863 C CD    . ARG B 1 65  ? 23.789  122.132 22.444 1.00 28.76 ? 65   ARG B CD    1 
ATOM   1864 N NE    . ARG B 1 65  ? 23.607  120.808 21.840 1.00 28.45 ? 65   ARG B NE    1 
ATOM   1865 C CZ    . ARG B 1 65  ? 24.325  120.340 20.819 1.00 27.01 ? 65   ARG B CZ    1 
ATOM   1866 N NH1   . ARG B 1 65  ? 25.292  121.074 20.278 1.00 24.39 ? 65   ARG B NH1   1 
ATOM   1867 N NH2   . ARG B 1 65  ? 24.037  119.154 20.296 1.00 27.76 ? 65   ARG B NH2   1 
ATOM   1868 N N     . GLU B 1 66  ? 24.831  120.159 27.626 1.00 26.76 ? 66   GLU B N     1 
ATOM   1869 C CA    . GLU B 1 66  ? 25.439  119.002 28.257 1.00 28.48 ? 66   GLU B CA    1 
ATOM   1870 C C     . GLU B 1 66  ? 26.036  119.336 29.607 1.00 27.86 ? 66   GLU B C     1 
ATOM   1871 O O     . GLU B 1 66  ? 26.967  120.144 29.687 1.00 28.80 ? 66   GLU B O     1 
ATOM   1872 C CB    . GLU B 1 66  ? 26.534  118.424 27.357 1.00 31.31 ? 66   GLU B CB    1 
ATOM   1873 C CG    . GLU B 1 66  ? 26.019  117.694 26.119 1.00 36.46 ? 66   GLU B CG    1 
ATOM   1874 C CD    . GLU B 1 66  ? 25.204  116.447 26.450 1.00 39.36 ? 66   GLU B CD    1 
ATOM   1875 O OE1   . GLU B 1 66  ? 25.469  115.805 27.493 1.00 41.58 ? 66   GLU B OE1   1 
ATOM   1876 O OE2   . GLU B 1 66  ? 24.299  116.102 25.656 1.00 41.06 ? 66   GLU B OE2   1 
ATOM   1877 N N     . PRO B 1 67  ? 25.465  118.775 30.694 1.00 26.46 ? 67   PRO B N     1 
ATOM   1878 C CA    . PRO B 1 67  ? 24.303  117.870 30.673 1.00 24.84 ? 67   PRO B CA    1 
ATOM   1879 C C     . PRO B 1 67  ? 23.087  118.703 30.311 1.00 24.13 ? 67   PRO B C     1 
ATOM   1880 O O     . PRO B 1 67  ? 22.988  119.851 30.726 1.00 23.78 ? 67   PRO B O     1 
ATOM   1881 C CB    . PRO B 1 67  ? 24.211  117.398 32.122 1.00 23.57 ? 67   PRO B CB    1 
ATOM   1882 C CG    . PRO B 1 67  ? 25.622  117.552 32.621 1.00 24.23 ? 67   PRO B CG    1 
ATOM   1883 C CD    . PRO B 1 67  ? 26.028  118.857 32.049 1.00 24.35 ? 67   PRO B CD    1 
ATOM   1884 N N     . LYS B 1 68  ? 22.184  118.162 29.507 1.00 24.42 ? 68   LYS B N     1 
ATOM   1885 C CA    . LYS B 1 68  ? 21.012  118.929 29.111 1.00 24.93 ? 68   LYS B CA    1 
ATOM   1886 C C     . LYS B 1 68  ? 20.127  119.268 30.318 1.00 24.82 ? 68   LYS B C     1 
ATOM   1887 O O     . LYS B 1 68  ? 19.440  118.402 30.875 1.00 25.88 ? 68   LYS B O     1 
ATOM   1888 C CB    . LYS B 1 68  ? 20.232  118.167 28.049 1.00 26.26 ? 68   LYS B CB    1 
ATOM   1889 C CG    . LYS B 1 68  ? 19.040  118.909 27.477 1.00 29.14 ? 68   LYS B CG    1 
ATOM   1890 C CD    . LYS B 1 68  ? 18.169  117.936 26.727 1.00 33.95 ? 68   LYS B CD    1 
ATOM   1891 C CE    . LYS B 1 68  ? 16.741  118.454 26.584 1.00 40.06 ? 68   LYS B CE    1 
ATOM   1892 N NZ    . LYS B 1 68  ? 15.788  117.377 26.108 1.00 44.14 ? 68   LYS B NZ    1 
ATOM   1893 N N     . THR B 1 69  ? 20.166  120.523 30.739 1.00 23.19 ? 69   THR B N     1 
ATOM   1894 C CA    . THR B 1 69  ? 19.379  120.968 31.879 1.00 21.73 ? 69   THR B CA    1 
ATOM   1895 C C     . THR B 1 69  ? 18.898  122.405 31.718 1.00 21.60 ? 69   THR B C     1 
ATOM   1896 O O     . THR B 1 69  ? 19.301  123.099 30.781 1.00 22.62 ? 69   THR B O     1 
ATOM   1897 C CB    . THR B 1 69  ? 20.212  120.932 33.136 1.00 19.93 ? 69   THR B CB    1 
ATOM   1898 O OG1   . THR B 1 69  ? 21.378  121.730 32.938 1.00 19.49 ? 69   THR B OG1   1 
ATOM   1899 C CG2   . THR B 1 69  ? 20.621  119.527 33.456 1.00 19.02 ? 69   THR B CG2   1 
ATOM   1900 N N     . THR B 1 70  ? 18.056  122.843 32.653 1.00 20.38 ? 70   THR B N     1 
ATOM   1901 C CA    . THR B 1 70  ? 17.515  124.199 32.685 1.00 17.67 ? 70   THR B CA    1 
ATOM   1902 C C     . THR B 1 70  ? 17.780  124.664 34.118 1.00 17.21 ? 70   THR B C     1 
ATOM   1903 O O     . THR B 1 70  ? 17.621  123.893 35.057 1.00 17.02 ? 70   THR B O     1 
ATOM   1904 C CB    . THR B 1 70  ? 15.981  124.207 32.396 1.00 17.62 ? 70   THR B CB    1 
ATOM   1905 O OG1   . THR B 1 70  ? 15.737  123.827 31.039 1.00 18.13 ? 70   THR B OG1   1 
ATOM   1906 C CG2   . THR B 1 70  ? 15.372  125.583 32.615 1.00 17.69 ? 70   THR B CG2   1 
ATOM   1907 N N     . ALA B 1 71  ? 18.247  125.893 34.282 1.00 17.59 ? 71   ALA B N     1 
ATOM   1908 C CA    . ALA B 1 71  ? 18.518  126.447 35.602 1.00 18.31 ? 71   ALA B CA    1 
ATOM   1909 C C     . ALA B 1 71  ? 17.614  127.643 35.793 1.00 19.35 ? 71   ALA B C     1 
ATOM   1910 O O     . ALA B 1 71  ? 17.249  128.314 34.820 1.00 19.95 ? 71   ALA B O     1 
ATOM   1911 C CB    . ALA B 1 71  ? 19.963  126.907 35.696 1.00 19.13 ? 71   ALA B CB    1 
ATOM   1912 N N     . LEU B 1 72  ? 17.238  127.903 37.037 1.00 19.11 ? 72   LEU B N     1 
ATOM   1913 C CA    . LEU B 1 72  ? 16.414  129.052 37.359 1.00 18.36 ? 72   LEU B CA    1 
ATOM   1914 C C     . LEU B 1 72  ? 17.319  129.830 38.292 1.00 18.62 ? 72   LEU B C     1 
ATOM   1915 O O     . LEU B 1 72  ? 17.714  129.321 39.338 1.00 19.05 ? 72   LEU B O     1 
ATOM   1916 C CB    . LEU B 1 72  ? 15.132  128.620 38.068 1.00 18.23 ? 72   LEU B CB    1 
ATOM   1917 C CG    . LEU B 1 72  ? 14.261  127.560 37.378 1.00 17.56 ? 72   LEU B CG    1 
ATOM   1918 C CD1   . LEU B 1 72  ? 13.062  127.241 38.244 1.00 18.02 ? 72   LEU B CD1   1 
ATOM   1919 C CD2   . LEU B 1 72  ? 13.801  128.036 36.033 1.00 17.60 ? 72   LEU B CD2   1 
ATOM   1920 N N     . ILE B 1 73  ? 17.731  131.014 37.859 1.00 19.68 ? 73   ILE B N     1 
ATOM   1921 C CA    . ILE B 1 73  ? 18.631  131.868 38.628 1.00 20.57 ? 73   ILE B CA    1 
ATOM   1922 C C     . ILE B 1 73  ? 17.928  133.064 39.274 1.00 21.61 ? 73   ILE B C     1 
ATOM   1923 O O     . ILE B 1 73  ? 17.325  133.897 38.596 1.00 23.18 ? 73   ILE B O     1 
ATOM   1924 C CB    . ILE B 1 73  ? 19.803  132.334 37.743 1.00 20.66 ? 73   ILE B CB    1 
ATOM   1925 C CG1   . ILE B 1 73  ? 20.512  131.106 37.166 1.00 19.61 ? 73   ILE B CG1   1 
ATOM   1926 C CG2   . ILE B 1 73  ? 20.775  133.179 38.545 1.00 20.33 ? 73   ILE B CG2   1 
ATOM   1927 C CD1   . ILE B 1 73  ? 21.596  131.413 36.179 1.00 20.86 ? 73   ILE B CD1   1 
ATOM   1928 N N     . PHE B 1 74  ? 18.042  133.159 40.594 1.00 23.16 ? 74   PHE B N     1 
ATOM   1929 C CA    . PHE B 1 74  ? 17.392  134.215 41.357 1.00 23.83 ? 74   PHE B CA    1 
ATOM   1930 C C     . PHE B 1 74  ? 18.344  135.291 41.864 1.00 26.01 ? 74   PHE B C     1 
ATOM   1931 O O     . PHE B 1 74  ? 19.532  135.033 42.082 1.00 27.53 ? 74   PHE B O     1 
ATOM   1932 C CB    . PHE B 1 74  ? 16.640  133.575 42.525 1.00 22.28 ? 74   PHE B CB    1 
ATOM   1933 C CG    . PHE B 1 74  ? 15.639  132.529 42.092 1.00 18.81 ? 74   PHE B CG    1 
ATOM   1934 C CD1   . PHE B 1 74  ? 16.025  131.205 41.929 1.00 18.39 ? 74   PHE B CD1   1 
ATOM   1935 C CD2   . PHE B 1 74  ? 14.331  132.884 41.792 1.00 17.69 ? 74   PHE B CD2   1 
ATOM   1936 C CE1   . PHE B 1 74  ? 15.124  130.250 41.465 1.00 16.96 ? 74   PHE B CE1   1 
ATOM   1937 C CE2   . PHE B 1 74  ? 13.423  131.944 41.331 1.00 18.49 ? 74   PHE B CE2   1 
ATOM   1938 C CZ    . PHE B 1 74  ? 13.822  130.622 41.164 1.00 18.76 ? 74   PHE B CZ    1 
ATOM   1939 N N     . ALA B 1 75  ? 17.816  136.492 42.085 1.00 27.13 ? 75   ALA B N     1 
ATOM   1940 C CA    . ALA B 1 75  ? 18.622  137.615 42.575 1.00 29.06 ? 75   ALA B CA    1 
ATOM   1941 C C     . ALA B 1 75  ? 19.300  137.293 43.906 1.00 30.12 ? 75   ALA B C     1 
ATOM   1942 O O     . ALA B 1 75  ? 20.345  137.855 44.243 1.00 31.74 ? 75   ALA B O     1 
ATOM   1943 C CB    . ALA B 1 75  ? 17.758  138.854 42.719 1.00 27.52 ? 75   ALA B CB    1 
ATOM   1944 N N     . SER B 1 76  ? 18.693  136.383 44.656 1.00 30.73 ? 76   SER B N     1 
ATOM   1945 C CA    . SER B 1 76  ? 19.221  135.960 45.942 1.00 30.97 ? 76   SER B CA    1 
ATOM   1946 C C     . SER B 1 76  ? 20.540  135.198 45.794 1.00 32.16 ? 76   SER B C     1 
ATOM   1947 O O     . SER B 1 76  ? 21.285  135.028 46.768 1.00 33.70 ? 76   SER B O     1 
ATOM   1948 C CB    . SER B 1 76  ? 18.196  135.060 46.640 1.00 30.28 ? 76   SER B CB    1 
ATOM   1949 O OG    . SER B 1 76  ? 17.888  133.905 45.870 1.00 28.00 ? 76   SER B OG    1 
ATOM   1950 N N     . GLY B 1 77  ? 20.812  134.720 44.582 1.00 32.06 ? 77   GLY B N     1 
ATOM   1951 C CA    . GLY B 1 77  ? 22.018  133.939 44.343 1.00 31.64 ? 77   GLY B CA    1 
ATOM   1952 C C     . GLY B 1 77  ? 21.732  132.444 44.402 1.00 30.28 ? 77   GLY B C     1 
ATOM   1953 O O     . GLY B 1 77  ? 22.600  131.620 44.119 1.00 29.48 ? 77   GLY B O     1 
ATOM   1954 N N     . LYS B 1 78  ? 20.523  132.098 44.829 1.00 30.12 ? 78   LYS B N     1 
ATOM   1955 C CA    . LYS B 1 78  ? 20.084  130.712 44.909 1.00 29.97 ? 78   LYS B CA    1 
ATOM   1956 C C     . LYS B 1 78  ? 19.750  130.260 43.486 1.00 29.83 ? 78   LYS B C     1 
ATOM   1957 O O     . LYS B 1 78  ? 19.311  131.068 42.649 1.00 29.99 ? 78   LYS B O     1 
ATOM   1958 C CB    . LYS B 1 78  ? 18.828  130.622 45.768 1.00 30.36 ? 78   LYS B CB    1 
ATOM   1959 C CG    . LYS B 1 78  ? 18.988  131.212 47.147 1.00 32.06 ? 78   LYS B CG    1 
ATOM   1960 C CD    . LYS B 1 78  ? 19.207  130.144 48.199 1.00 33.50 ? 78   LYS B CD    1 
ATOM   1961 C CE    . LYS B 1 78  ? 19.302  130.761 49.602 1.00 35.63 ? 78   LYS B CE    1 
ATOM   1962 N NZ    . LYS B 1 78  ? 18.163  131.696 49.945 1.00 38.62 ? 78   LYS B NZ    1 
ATOM   1963 N N     . MET B 1 79  ? 19.929  128.975 43.207 1.00 27.77 ? 79   MET B N     1 
ATOM   1964 C CA    . MET B 1 79  ? 19.635  128.473 41.876 1.00 25.33 ? 79   MET B CA    1 
ATOM   1965 C C     . MET B 1 79  ? 19.013  127.080 41.887 1.00 22.34 ? 79   MET B C     1 
ATOM   1966 O O     . MET B 1 79  ? 19.348  126.251 42.727 1.00 21.46 ? 79   MET B O     1 
ATOM   1967 C CB    . MET B 1 79  ? 20.912  128.490 41.039 1.00 27.26 ? 79   MET B CB    1 
ATOM   1968 C CG    . MET B 1 79  ? 20.815  127.758 39.720 1.00 28.36 ? 79   MET B CG    1 
ATOM   1969 S SD    . MET B 1 79  ? 22.406  127.764 38.963 1.00 30.83 ? 79   MET B SD    1 
ATOM   1970 C CE    . MET B 1 79  ? 23.037  126.231 39.496 1.00 27.97 ? 79   MET B CE    1 
ATOM   1971 N N     . VAL B 1 80  ? 18.065  126.865 40.986 1.00 19.71 ? 80   VAL B N     1 
ATOM   1972 C CA    . VAL B 1 80  ? 17.396  125.585 40.842 1.00 19.26 ? 80   VAL B CA    1 
ATOM   1973 C C     . VAL B 1 80  ? 17.892  124.969 39.538 1.00 20.24 ? 80   VAL B C     1 
ATOM   1974 O O     . VAL B 1 80  ? 17.973  125.662 38.521 1.00 22.30 ? 80   VAL B O     1 
ATOM   1975 C CB    . VAL B 1 80  ? 15.855  125.749 40.780 1.00 19.16 ? 80   VAL B CB    1 
ATOM   1976 C CG1   . VAL B 1 80  ? 15.187  124.433 40.364 1.00 16.52 ? 80   VAL B CG1   1 
ATOM   1977 C CG2   . VAL B 1 80  ? 15.320  126.211 42.142 1.00 17.85 ? 80   VAL B CG2   1 
ATOM   1978 N N     . CYS B 1 81  ? 18.234  123.681 39.565 1.00 20.45 ? 81   CYS B N     1 
ATOM   1979 C CA    . CYS B 1 81  ? 18.735  122.982 38.384 1.00 19.55 ? 81   CYS B CA    1 
ATOM   1980 C C     . CYS B 1 81  ? 17.845  121.781 38.131 1.00 19.06 ? 81   CYS B C     1 
ATOM   1981 O O     . CYS B 1 81  ? 17.675  120.965 39.021 1.00 18.55 ? 81   CYS B O     1 
ATOM   1982 C CB    . CYS B 1 81  ? 20.175  122.542 38.602 1.00 18.60 ? 81   CYS B CB    1 
ATOM   1983 S SG    . CYS B 1 81  ? 20.878  121.837 37.137 1.00 21.40 ? 81   CYS B SG    1 
ATOM   1984 N N     . THR B 1 82  ? 17.248  121.703 36.936 1.00 19.29 ? 82   THR B N     1 
ATOM   1985 C CA    . THR B 1 82  ? 16.321  120.622 36.562 1.00 19.73 ? 82   THR B CA    1 
ATOM   1986 C C     . THR B 1 82  ? 16.674  119.951 35.238 1.00 18.54 ? 82   THR B C     1 
ATOM   1987 O O     . THR B 1 82  ? 17.341  120.554 34.409 1.00 19.28 ? 82   THR B O     1 
ATOM   1988 C CB    . THR B 1 82  ? 14.871  121.167 36.378 1.00 20.48 ? 82   THR B CB    1 
ATOM   1989 O OG1   . THR B 1 82  ? 14.914  122.535 35.961 1.00 22.92 ? 82   THR B OG1   1 
ATOM   1990 C CG2   . THR B 1 82  ? 14.081  121.068 37.634 1.00 21.34 ? 82   THR B CG2   1 
ATOM   1991 N N     . GLY B 1 83  ? 16.203  118.723 35.038 1.00 16.38 ? 83   GLY B N     1 
ATOM   1992 C CA    . GLY B 1 83  ? 16.442  118.038 33.784 1.00 15.36 ? 83   GLY B CA    1 
ATOM   1993 C C     . GLY B 1 83  ? 17.525  116.987 33.680 1.00 16.30 ? 83   GLY B C     1 
ATOM   1994 O O     . GLY B 1 83  ? 17.498  116.176 32.755 1.00 17.67 ? 83   GLY B O     1 
ATOM   1995 N N     . ALA B 1 84  ? 18.509  117.014 34.568 1.00 18.25 ? 84   ALA B N     1 
ATOM   1996 C CA    . ALA B 1 84  ? 19.584  116.023 34.514 1.00 17.93 ? 84   ALA B CA    1 
ATOM   1997 C C     . ALA B 1 84  ? 19.075  114.596 34.730 1.00 18.52 ? 84   ALA B C     1 
ATOM   1998 O O     . ALA B 1 84  ? 18.066  114.373 35.398 1.00 18.90 ? 84   ALA B O     1 
ATOM   1999 C CB    . ALA B 1 84  ? 20.663  116.363 35.518 1.00 18.44 ? 84   ALA B CB    1 
ATOM   2000 N N     . LYS B 1 85  ? 19.802  113.629 34.187 1.00 19.59 ? 85   LYS B N     1 
ATOM   2001 C CA    . LYS B 1 85  ? 19.428  112.231 34.302 1.00 21.26 ? 85   LYS B CA    1 
ATOM   2002 C C     . LYS B 1 85  ? 20.048  111.531 35.511 1.00 21.80 ? 85   LYS B C     1 
ATOM   2003 O O     . LYS B 1 85  ? 19.755  110.359 35.775 1.00 22.61 ? 85   LYS B O     1 
ATOM   2004 C CB    . LYS B 1 85  ? 19.773  111.487 33.014 1.00 23.16 ? 85   LYS B CB    1 
ATOM   2005 C CG    . LYS B 1 85  ? 18.915  111.868 31.833 1.00 25.12 ? 85   LYS B CG    1 
ATOM   2006 C CD    . LYS B 1 85  ? 17.497  111.372 32.007 1.00 28.33 ? 85   LYS B CD    1 
ATOM   2007 C CE    . LYS B 1 85  ? 16.708  111.512 30.701 1.00 31.02 ? 85   LYS B CE    1 
ATOM   2008 N NZ    . LYS B 1 85  ? 15.302  110.983 30.757 1.00 29.72 ? 85   LYS B NZ    1 
ATOM   2009 N N     . SER B 1 86  ? 20.935  112.219 36.222 1.00 21.58 ? 86   SER B N     1 
ATOM   2010 C CA    . SER B 1 86  ? 21.539  111.643 37.416 1.00 21.48 ? 86   SER B CA    1 
ATOM   2011 C C     . SER B 1 86  ? 22.026  112.755 38.317 1.00 21.49 ? 86   SER B C     1 
ATOM   2012 O O     . SER B 1 86  ? 22.113  113.912 37.903 1.00 21.40 ? 86   SER B O     1 
ATOM   2013 C CB    . SER B 1 86  ? 22.694  110.726 37.073 1.00 19.62 ? 86   SER B CB    1 
ATOM   2014 O OG    . SER B 1 86  ? 23.762  111.495 36.579 1.00 23.42 ? 86   SER B OG    1 
ATOM   2015 N N     . GLU B 1 87  ? 22.418  112.370 39.525 1.00 22.26 ? 87   GLU B N     1 
ATOM   2016 C CA    . GLU B 1 87  ? 22.884  113.286 40.542 1.00 21.43 ? 87   GLU B CA    1 
ATOM   2017 C C     . GLU B 1 87  ? 24.209  113.915 40.127 1.00 21.20 ? 87   GLU B C     1 
ATOM   2018 O O     . GLU B 1 87  ? 24.402  115.123 40.249 1.00 21.94 ? 87   GLU B O     1 
ATOM   2019 C CB    . GLU B 1 87  ? 23.020  112.542 41.881 1.00 23.54 ? 87   GLU B CB    1 
ATOM   2020 C CG    . GLU B 1 87  ? 21.729  111.872 42.406 1.00 24.22 ? 87   GLU B CG    1 
ATOM   2021 C CD    . GLU B 1 87  ? 21.551  110.417 41.957 1.00 25.89 ? 87   GLU B CD    1 
ATOM   2022 O OE1   . GLU B 1 87  ? 21.714  110.099 40.767 1.00 24.86 ? 87   GLU B OE1   1 
ATOM   2023 O OE2   . GLU B 1 87  ? 21.216  109.569 42.802 1.00 28.26 ? 87   GLU B OE2   1 
ATOM   2024 N N     . ASP B 1 88  ? 25.117  113.102 39.609 1.00 21.04 ? 88   ASP B N     1 
ATOM   2025 C CA    . ASP B 1 88  ? 26.410  113.609 39.186 1.00 20.71 ? 88   ASP B CA    1 
ATOM   2026 C C     . ASP B 1 88  ? 26.244  114.635 38.075 1.00 21.73 ? 88   ASP B C     1 
ATOM   2027 O O     . ASP B 1 88  ? 26.859  115.710 38.101 1.00 23.18 ? 88   ASP B O     1 
ATOM   2028 C CB    . ASP B 1 88  ? 27.305  112.459 38.739 1.00 20.41 ? 88   ASP B CB    1 
ATOM   2029 C CG    . ASP B 1 88  ? 27.849  111.664 39.908 1.00 20.03 ? 88   ASP B CG    1 
ATOM   2030 O OD1   . ASP B 1 88  ? 27.797  112.164 41.048 1.00 20.45 ? 88   ASP B OD1   1 
ATOM   2031 O OD2   . ASP B 1 88  ? 28.343  110.543 39.686 1.00 21.14 ? 88   ASP B OD2   1 
ATOM   2032 N N     . PHE B 1 89  ? 25.391  114.300 37.111 1.00 22.13 ? 89   PHE B N     1 
ATOM   2033 C CA    . PHE B 1 89  ? 25.081  115.175 35.989 1.00 21.41 ? 89   PHE B CA    1 
ATOM   2034 C C     . PHE B 1 89  ? 24.435  116.461 36.492 1.00 22.11 ? 89   PHE B C     1 
ATOM   2035 O O     . PHE B 1 89  ? 24.838  117.555 36.103 1.00 22.62 ? 89   PHE B O     1 
ATOM   2036 C CB    . PHE B 1 89  ? 24.147  114.465 35.026 1.00 18.43 ? 89   PHE B CB    1 
ATOM   2037 C CG    . PHE B 1 89  ? 24.837  113.474 34.152 1.00 18.78 ? 89   PHE B CG    1 
ATOM   2038 C CD1   . PHE B 1 89  ? 26.085  113.767 33.598 1.00 17.66 ? 89   PHE B CD1   1 
ATOM   2039 C CD2   . PHE B 1 89  ? 24.225  112.266 33.831 1.00 19.57 ? 89   PHE B CD2   1 
ATOM   2040 C CE1   . PHE B 1 89  ? 26.708  112.876 32.732 1.00 17.02 ? 89   PHE B CE1   1 
ATOM   2041 C CE2   . PHE B 1 89  ? 24.837  111.370 32.969 1.00 19.04 ? 89   PHE B CE2   1 
ATOM   2042 C CZ    . PHE B 1 89  ? 26.082  111.678 32.416 1.00 18.28 ? 89   PHE B CZ    1 
ATOM   2043 N N     . SER B 1 90  ? 23.452  116.333 37.375 1.00 22.23 ? 90   SER B N     1 
ATOM   2044 C CA    . SER B 1 90  ? 22.804  117.507 37.927 1.00 23.57 ? 90   SER B CA    1 
ATOM   2045 C C     . SER B 1 90  ? 23.832  118.407 38.640 1.00 24.86 ? 90   SER B C     1 
ATOM   2046 O O     . SER B 1 90  ? 23.771  119.634 38.537 1.00 26.58 ? 90   SER B O     1 
ATOM   2047 C CB    . SER B 1 90  ? 21.686  117.092 38.879 1.00 20.73 ? 90   SER B CB    1 
ATOM   2048 O OG    . SER B 1 90  ? 21.017  118.218 39.415 1.00 17.93 ? 90   SER B OG    1 
ATOM   2049 N N     . LYS B 1 91  ? 24.804  117.823 39.330 1.00 25.47 ? 91   LYS B N     1 
ATOM   2050 C CA    . LYS B 1 91  ? 25.792  118.661 40.010 1.00 26.76 ? 91   LYS B CA    1 
ATOM   2051 C C     . LYS B 1 91  ? 26.728  119.363 39.027 1.00 26.52 ? 91   LYS B C     1 
ATOM   2052 O O     . LYS B 1 91  ? 27.056  120.539 39.208 1.00 25.18 ? 91   LYS B O     1 
ATOM   2053 C CB    . LYS B 1 91  ? 26.602  117.858 41.021 1.00 27.39 ? 91   LYS B CB    1 
ATOM   2054 C CG    . LYS B 1 91  ? 27.524  118.733 41.850 1.00 30.01 ? 91   LYS B CG    1 
ATOM   2055 C CD    . LYS B 1 91  ? 28.082  117.979 43.033 1.00 32.15 ? 91   LYS B CD    1 
ATOM   2056 C CE    . LYS B 1 91  ? 28.790  118.928 43.974 1.00 35.86 ? 91   LYS B CE    1 
ATOM   2057 N NZ    . LYS B 1 91  ? 29.257  118.234 45.209 1.00 38.81 ? 91   LYS B NZ    1 
ATOM   2058 N N     . MET B 1 92  ? 27.140  118.633 37.987 1.00 27.03 ? 92   MET B N     1 
ATOM   2059 C CA    . MET B 1 92  ? 28.031  119.150 36.947 1.00 27.03 ? 92   MET B CA    1 
ATOM   2060 C C     . MET B 1 92  ? 27.366  120.309 36.230 1.00 26.74 ? 92   MET B C     1 
ATOM   2061 O O     . MET B 1 92  ? 27.989  121.344 36.000 1.00 27.62 ? 92   MET B O     1 
ATOM   2062 C CB    . MET B 1 92  ? 28.388  118.048 35.943 1.00 28.09 ? 92   MET B CB    1 
ATOM   2063 C CG    . MET B 1 92  ? 29.395  118.467 34.858 1.00 30.01 ? 92   MET B CG    1 
ATOM   2064 S SD    . MET B 1 92  ? 31.133  118.637 35.408 1.00 33.03 ? 92   MET B SD    1 
ATOM   2065 C CE    . MET B 1 92  ? 31.247  120.410 35.737 1.00 31.39 ? 92   MET B CE    1 
ATOM   2066 N N     . ALA B 1 93  ? 26.103  120.125 35.864 1.00 25.46 ? 93   ALA B N     1 
ATOM   2067 C CA    . ALA B 1 93  ? 25.338  121.169 35.203 1.00 25.18 ? 93   ALA B CA    1 
ATOM   2068 C C     . ALA B 1 93  ? 25.240  122.387 36.125 1.00 25.53 ? 93   ALA B C     1 
ATOM   2069 O O     . ALA B 1 93  ? 25.425  123.513 35.684 1.00 26.39 ? 93   ALA B O     1 
ATOM   2070 C CB    . ALA B 1 93  ? 23.946  120.660 34.840 1.00 23.03 ? 93   ALA B CB    1 
ATOM   2071 N N     . ALA B 1 94  ? 24.978  122.161 37.409 1.00 25.67 ? 94   ALA B N     1 
ATOM   2072 C CA    . ALA B 1 94  ? 24.872  123.255 38.367 1.00 27.70 ? 94   ALA B CA    1 
ATOM   2073 C C     . ALA B 1 94  ? 26.163  124.082 38.443 1.00 30.75 ? 94   ALA B C     1 
ATOM   2074 O O     . ALA B 1 94  ? 26.115  125.318 38.560 1.00 31.76 ? 94   ALA B O     1 
ATOM   2075 C CB    . ALA B 1 94  ? 24.509  122.720 39.736 1.00 25.68 ? 94   ALA B CB    1 
ATOM   2076 N N     . ARG B 1 95  ? 27.311  123.403 38.375 1.00 32.24 ? 95   ARG B N     1 
ATOM   2077 C CA    . ARG B 1 95  ? 28.608  124.071 38.431 1.00 33.64 ? 95   ARG B CA    1 
ATOM   2078 C C     . ARG B 1 95  ? 28.882  124.898 37.170 1.00 33.65 ? 95   ARG B C     1 
ATOM   2079 O O     . ARG B 1 95  ? 29.468  125.979 37.236 1.00 35.38 ? 95   ARG B O     1 
ATOM   2080 C CB    . ARG B 1 95  ? 29.730  123.062 38.676 1.00 36.17 ? 95   ARG B CB    1 
ATOM   2081 C CG    . ARG B 1 95  ? 29.845  122.585 40.116 1.00 39.92 ? 95   ARG B CG    1 
ATOM   2082 C CD    . ARG B 1 95  ? 30.958  121.548 40.277 1.00 44.51 ? 95   ARG B CD    1 
ATOM   2083 N NE    . ARG B 1 95  ? 30.937  120.899 41.592 1.00 48.90 ? 95   ARG B NE    1 
ATOM   2084 C CZ    . ARG B 1 95  ? 31.365  121.462 42.724 1.00 51.32 ? 95   ARG B CZ    1 
ATOM   2085 N NH1   . ARG B 1 95  ? 31.857  122.700 42.719 1.00 52.06 ? 95   ARG B NH1   1 
ATOM   2086 N NH2   . ARG B 1 95  ? 31.298  120.786 43.871 1.00 51.57 ? 95   ARG B NH2   1 
ATOM   2087 N N     . LYS B 1 96  ? 28.456  124.400 36.021 1.00 33.12 ? 96   LYS B N     1 
ATOM   2088 C CA    . LYS B 1 96  ? 28.642  125.139 34.784 1.00 32.73 ? 96   LYS B CA    1 
ATOM   2089 C C     . LYS B 1 96  ? 27.870  126.449 34.843 1.00 32.22 ? 96   LYS B C     1 
ATOM   2090 O O     . LYS B 1 96  ? 28.339  127.461 34.321 1.00 32.88 ? 96   LYS B O     1 
ATOM   2091 C CB    . LYS B 1 96  ? 28.163  124.322 33.598 1.00 34.12 ? 96   LYS B CB    1 
ATOM   2092 C CG    . LYS B 1 96  ? 29.064  123.175 33.284 1.00 35.81 ? 96   LYS B CG    1 
ATOM   2093 C CD    . LYS B 1 96  ? 28.247  121.956 32.988 1.00 39.60 ? 96   LYS B CD    1 
ATOM   2094 C CE    . LYS B 1 96  ? 28.923  121.119 31.938 1.00 41.19 ? 96   LYS B CE    1 
ATOM   2095 N NZ    . LYS B 1 96  ? 28.976  121.834 30.625 1.00 42.77 ? 96   LYS B NZ    1 
ATOM   2096 N N     . TYR B 1 97  ? 26.683  126.424 35.460 1.00 30.38 ? 97   TYR B N     1 
ATOM   2097 C CA    . TYR B 1 97  ? 25.862  127.626 35.603 1.00 27.89 ? 97   TYR B CA    1 
ATOM   2098 C C     . TYR B 1 97  ? 26.543  128.570 36.578 1.00 27.77 ? 97   TYR B C     1 
ATOM   2099 O O     . TYR B 1 97  ? 26.519  129.785 36.383 1.00 29.29 ? 97   TYR B O     1 
ATOM   2100 C CB    . TYR B 1 97  ? 24.452  127.302 36.101 1.00 25.79 ? 97   TYR B CB    1 
ATOM   2101 C CG    . TYR B 1 97  ? 23.582  126.583 35.106 1.00 23.78 ? 97   TYR B CG    1 
ATOM   2102 C CD1   . TYR B 1 97  ? 23.264  127.165 33.884 1.00 24.88 ? 97   TYR B CD1   1 
ATOM   2103 C CD2   . TYR B 1 97  ? 23.088  125.303 35.375 1.00 22.75 ? 97   TYR B CD2   1 
ATOM   2104 C CE1   . TYR B 1 97  ? 22.475  126.484 32.944 1.00 23.74 ? 97   TYR B CE1   1 
ATOM   2105 C CE2   . TYR B 1 97  ? 22.302  124.615 34.443 1.00 21.36 ? 97   TYR B CE2   1 
ATOM   2106 C CZ    . TYR B 1 97  ? 22.001  125.212 33.232 1.00 22.32 ? 97   TYR B CZ    1 
ATOM   2107 O OH    . TYR B 1 97  ? 21.232  124.543 32.305 1.00 22.56 ? 97   TYR B OH    1 
ATOM   2108 N N     . ALA B 1 98  ? 27.154  128.016 37.622 1.00 27.08 ? 98   ALA B N     1 
ATOM   2109 C CA    . ALA B 1 98  ? 27.867  128.836 38.598 1.00 27.73 ? 98   ALA B CA    1 
ATOM   2110 C C     . ALA B 1 98  ? 29.037  129.546 37.915 1.00 29.85 ? 98   ALA B C     1 
ATOM   2111 O O     . ALA B 1 98  ? 29.373  130.682 38.248 1.00 29.90 ? 98   ALA B O     1 
ATOM   2112 C CB    . ALA B 1 98  ? 28.369  127.982 39.722 1.00 26.35 ? 98   ALA B CB    1 
ATOM   2113 N N     . ARG B 1 99  ? 29.642  128.857 36.951 1.00 32.89 ? 99   ARG B N     1 
ATOM   2114 C CA    . ARG B 1 99  ? 30.776  129.357 36.169 1.00 34.94 ? 99   ARG B CA    1 
ATOM   2115 C C     . ARG B 1 99  ? 30.322  130.431 35.172 1.00 34.71 ? 99   ARG B C     1 
ATOM   2116 O O     . ARG B 1 99  ? 30.989  131.452 35.008 1.00 34.69 ? 99   ARG B O     1 
ATOM   2117 C CB    . ARG B 1 99  ? 31.444  128.180 35.436 1.00 38.54 ? 99   ARG B CB    1 
ATOM   2118 C CG    . ARG B 1 99  ? 32.751  128.500 34.715 1.00 42.89 ? 99   ARG B CG    1 
ATOM   2119 C CD    . ARG B 1 99  ? 33.424  127.223 34.172 1.00 48.18 ? 99   ARG B CD    1 
ATOM   2120 N NE    . ARG B 1 99  ? 32.690  126.576 33.074 1.00 52.55 ? 99   ARG B NE    1 
ATOM   2121 C CZ    . ARG B 1 99  ? 32.945  125.348 32.608 1.00 54.70 ? 99   ARG B CZ    1 
ATOM   2122 N NH1   . ARG B 1 99  ? 33.916  124.611 33.139 1.00 54.83 ? 99   ARG B NH1   1 
ATOM   2123 N NH2   . ARG B 1 99  ? 32.236  124.854 31.596 1.00 55.35 ? 99   ARG B NH2   1 
ATOM   2124 N N     . ILE B 1 100 ? 29.192  130.190 34.508 1.00 33.83 ? 100  ILE B N     1 
ATOM   2125 C CA    . ILE B 1 100 ? 28.623  131.137 33.547 1.00 33.74 ? 100  ILE B CA    1 
ATOM   2126 C C     . ILE B 1 100 ? 28.407  132.487 34.249 1.00 35.28 ? 100  ILE B C     1 
ATOM   2127 O O     . ILE B 1 100 ? 28.823  133.544 33.754 1.00 35.62 ? 100  ILE B O     1 
ATOM   2128 C CB    . ILE B 1 100 ? 27.241  130.637 33.011 1.00 32.64 ? 100  ILE B CB    1 
ATOM   2129 C CG1   . ILE B 1 100 ? 27.429  129.465 32.047 1.00 31.35 ? 100  ILE B CG1   1 
ATOM   2130 C CG2   . ILE B 1 100 ? 26.450  131.788 32.356 1.00 30.54 ? 100  ILE B CG2   1 
ATOM   2131 C CD1   . ILE B 1 100 ? 26.130  128.870 31.548 1.00 28.91 ? 100  ILE B CD1   1 
ATOM   2132 N N     . VAL B 1 101 ? 27.749  132.424 35.405 1.00 36.09 ? 101  VAL B N     1 
ATOM   2133 C CA    . VAL B 1 101 ? 27.441  133.595 36.219 1.00 35.85 ? 101  VAL B CA    1 
ATOM   2134 C C     . VAL B 1 101 ? 28.728  134.315 36.628 1.00 36.92 ? 101  VAL B C     1 
ATOM   2135 O O     . VAL B 1 101 ? 28.805  135.549 36.581 1.00 37.15 ? 101  VAL B O     1 
ATOM   2136 C CB    . VAL B 1 101 ? 26.592  133.178 37.441 1.00 34.50 ? 101  VAL B CB    1 
ATOM   2137 C CG1   . VAL B 1 101 ? 26.462  134.321 38.421 1.00 34.90 ? 101  VAL B CG1   1 
ATOM   2138 C CG2   . VAL B 1 101 ? 25.210  132.732 36.972 1.00 32.66 ? 101  VAL B CG2   1 
ATOM   2139 N N     . GLN B 1 102 ? 29.744  133.540 37.001 1.00 38.76 ? 102  GLN B N     1 
ATOM   2140 C CA    . GLN B 1 102 ? 31.041  134.100 37.367 1.00 40.33 ? 102  GLN B CA    1 
ATOM   2141 C C     . GLN B 1 102 ? 31.600  134.837 36.157 1.00 40.37 ? 102  GLN B C     1 
ATOM   2142 O O     . GLN B 1 102 ? 32.001  135.993 36.271 1.00 41.91 ? 102  GLN B O     1 
ATOM   2143 C CB    . GLN B 1 102 ? 32.011  133.006 37.797 1.00 40.93 ? 102  GLN B CB    1 
ATOM   2144 C CG    . GLN B 1 102 ? 31.729  132.452 39.172 1.00 43.84 ? 102  GLN B CG    1 
ATOM   2145 C CD    . GLN B 1 102 ? 32.580  131.243 39.490 1.00 46.75 ? 102  GLN B CD    1 
ATOM   2146 O OE1   . GLN B 1 102 ? 33.545  130.934 38.775 1.00 48.00 ? 102  GLN B OE1   1 
ATOM   2147 N NE2   . GLN B 1 102 ? 32.221  130.534 40.554 1.00 46.23 ? 102  GLN B NE2   1 
ATOM   2148 N N     . LYS B 1 103 ? 31.594  134.178 34.999 1.00 39.97 ? 103  LYS B N     1 
ATOM   2149 C CA    . LYS B 1 103 ? 32.074  134.784 33.765 1.00 40.53 ? 103  LYS B CA    1 
ATOM   2150 C C     . LYS B 1 103 ? 31.364  136.109 33.504 1.00 40.41 ? 103  LYS B C     1 
ATOM   2151 O O     . LYS B 1 103 ? 31.960  137.044 32.984 1.00 40.45 ? 103  LYS B O     1 
ATOM   2152 C CB    . LYS B 1 103 ? 31.838  133.855 32.581 1.00 42.22 ? 103  LYS B CB    1 
ATOM   2153 C CG    . LYS B 1 103 ? 33.071  133.111 32.106 1.00 43.85 ? 103  LYS B CG    1 
ATOM   2154 C CD    . LYS B 1 103 ? 33.517  132.077 33.118 1.00 45.71 ? 103  LYS B CD    1 
ATOM   2155 C CE    . LYS B 1 103 ? 34.549  131.124 32.508 1.00 47.82 ? 103  LYS B CE    1 
ATOM   2156 N NZ    . LYS B 1 103 ? 34.021  130.374 31.321 1.00 48.42 ? 103  LYS B NZ    1 
ATOM   2157 N N     . LEU B 1 104 ? 30.086  136.178 33.864 1.00 40.36 ? 104  LEU B N     1 
ATOM   2158 C CA    . LEU B 1 104 ? 29.300  137.392 33.685 1.00 39.89 ? 104  LEU B CA    1 
ATOM   2159 C C     . LEU B 1 104 ? 29.741  138.529 34.614 1.00 40.76 ? 104  LEU B C     1 
ATOM   2160 O O     . LEU B 1 104 ? 29.264  139.660 34.491 1.00 41.66 ? 104  LEU B O     1 
ATOM   2161 C CB    . LEU B 1 104 ? 27.814  137.100 33.886 1.00 38.43 ? 104  LEU B CB    1 
ATOM   2162 C CG    . LEU B 1 104 ? 27.117  136.309 32.780 1.00 38.27 ? 104  LEU B CG    1 
ATOM   2163 C CD1   . LEU B 1 104 ? 25.639  136.167 33.104 1.00 36.76 ? 104  LEU B CD1   1 
ATOM   2164 C CD2   . LEU B 1 104 ? 27.301  137.010 31.436 1.00 37.21 ? 104  LEU B CD2   1 
ATOM   2165 N N     . GLY B 1 105 ? 30.627  138.225 35.557 1.00 40.29 ? 105  GLY B N     1 
ATOM   2166 C CA    . GLY B 1 105 ? 31.118  139.240 36.465 1.00 39.50 ? 105  GLY B CA    1 
ATOM   2167 C C     . GLY B 1 105 ? 30.658  139.148 37.909 1.00 40.16 ? 105  GLY B C     1 
ATOM   2168 O O     . GLY B 1 105 ? 30.903  140.068 38.691 1.00 41.71 ? 105  GLY B O     1 
ATOM   2169 N N     . PHE B 1 106 ? 29.989  138.070 38.291 1.00 38.93 ? 106  PHE B N     1 
ATOM   2170 C CA    . PHE B 1 106 ? 29.546  137.959 39.673 1.00 38.13 ? 106  PHE B CA    1 
ATOM   2171 C C     . PHE B 1 106 ? 30.440  136.963 40.386 1.00 39.86 ? 106  PHE B C     1 
ATOM   2172 O O     . PHE B 1 106 ? 30.815  135.947 39.800 1.00 42.16 ? 106  PHE B O     1 
ATOM   2173 C CB    . PHE B 1 106 ? 28.089  137.529 39.720 1.00 35.86 ? 106  PHE B CB    1 
ATOM   2174 C CG    . PHE B 1 106 ? 27.167  138.481 39.021 1.00 33.73 ? 106  PHE B CG    1 
ATOM   2175 C CD1   . PHE B 1 106 ? 26.986  138.410 37.650 1.00 33.79 ? 106  PHE B CD1   1 
ATOM   2176 C CD2   . PHE B 1 106 ? 26.511  139.474 39.727 1.00 33.45 ? 106  PHE B CD2   1 
ATOM   2177 C CE1   . PHE B 1 106 ? 26.164  139.316 36.990 1.00 33.71 ? 106  PHE B CE1   1 
ATOM   2178 C CE2   . PHE B 1 106 ? 25.688  140.384 39.078 1.00 33.89 ? 106  PHE B CE2   1 
ATOM   2179 C CZ    . PHE B 1 106 ? 25.514  140.304 37.705 1.00 33.85 ? 106  PHE B CZ    1 
ATOM   2180 N N     . PRO B 1 107 ? 30.855  137.267 41.635 1.00 39.94 ? 107  PRO B N     1 
ATOM   2181 C CA    . PRO B 1 107 ? 31.727  136.367 42.414 1.00 39.93 ? 107  PRO B CA    1 
ATOM   2182 C C     . PRO B 1 107 ? 30.952  135.153 42.974 1.00 40.44 ? 107  PRO B C     1 
ATOM   2183 O O     . PRO B 1 107 ? 30.899  134.928 44.191 1.00 42.42 ? 107  PRO B O     1 
ATOM   2184 C CB    . PRO B 1 107 ? 32.244  137.288 43.527 1.00 38.82 ? 107  PRO B CB    1 
ATOM   2185 C CG    . PRO B 1 107 ? 31.062  138.175 43.789 1.00 38.06 ? 107  PRO B CG    1 
ATOM   2186 C CD    . PRO B 1 107 ? 30.570  138.507 42.385 1.00 38.26 ? 107  PRO B CD    1 
ATOM   2187 N N     . ALA B 1 108 ? 30.371  134.367 42.075 1.00 39.09 ? 108  ALA B N     1 
ATOM   2188 C CA    . ALA B 1 108 ? 29.576  133.222 42.462 1.00 37.96 ? 108  ALA B CA    1 
ATOM   2189 C C     . ALA B 1 108 ? 30.366  132.100 43.117 1.00 38.58 ? 108  ALA B C     1 
ATOM   2190 O O     . ALA B 1 108 ? 31.482  131.782 42.709 1.00 40.32 ? 108  ALA B O     1 
ATOM   2191 C CB    . ALA B 1 108 ? 28.815  132.702 41.265 1.00 36.02 ? 108  ALA B CB    1 
ATOM   2192 N N     . LYS B 1 109 ? 29.787  131.543 44.173 1.00 38.65 ? 109  LYS B N     1 
ATOM   2193 C CA    . LYS B 1 109 ? 30.357  130.421 44.909 1.00 37.74 ? 109  LYS B CA    1 
ATOM   2194 C C     . LYS B 1 109 ? 29.498  129.198 44.569 1.00 36.71 ? 109  LYS B C     1 
ATOM   2195 O O     . LYS B 1 109 ? 28.752  129.209 43.585 1.00 35.86 ? 109  LYS B O     1 
ATOM   2196 C CB    . LYS B 1 109 ? 30.322  130.688 46.415 1.00 39.07 ? 109  LYS B CB    1 
ATOM   2197 C CG    . LYS B 1 109 ? 31.217  131.830 46.870 1.00 41.44 ? 109  LYS B CG    1 
ATOM   2198 C CD    . LYS B 1 109 ? 32.661  131.562 46.473 1.00 43.16 ? 109  LYS B CD    1 
ATOM   2199 C CE    . LYS B 1 109 ? 33.633  132.458 47.226 1.00 45.66 ? 109  LYS B CE    1 
ATOM   2200 N NZ    . LYS B 1 109 ? 35.052  132.219 46.802 1.00 46.43 ? 109  LYS B NZ    1 
ATOM   2201 N N     . PHE B 1 110 ? 29.547  128.169 45.405 1.00 35.81 ? 110  PHE B N     1 
ATOM   2202 C CA    . PHE B 1 110 ? 28.785  126.954 45.129 1.00 34.72 ? 110  PHE B CA    1 
ATOM   2203 C C     . PHE B 1 110 ? 28.504  126.246 46.440 1.00 34.96 ? 110  PHE B C     1 
ATOM   2204 O O     . PHE B 1 110 ? 29.047  125.170 46.701 1.00 35.19 ? 110  PHE B O     1 
ATOM   2205 C CB    . PHE B 1 110 ? 29.608  126.039 44.213 1.00 33.49 ? 110  PHE B CB    1 
ATOM   2206 C CG    . PHE B 1 110 ? 28.817  124.940 43.575 1.00 33.24 ? 110  PHE B CG    1 
ATOM   2207 C CD1   . PHE B 1 110 ? 28.112  125.168 42.403 1.00 33.13 ? 110  PHE B CD1   1 
ATOM   2208 C CD2   . PHE B 1 110 ? 28.783  123.670 44.137 1.00 32.82 ? 110  PHE B CD2   1 
ATOM   2209 C CE1   . PHE B 1 110 ? 27.385  124.150 41.803 1.00 32.43 ? 110  PHE B CE1   1 
ATOM   2210 C CE2   . PHE B 1 110 ? 28.061  122.653 43.542 1.00 31.85 ? 110  PHE B CE2   1 
ATOM   2211 C CZ    . PHE B 1 110 ? 27.361  122.892 42.375 1.00 32.03 ? 110  PHE B CZ    1 
ATOM   2212 N N     . LYS B 1 111 ? 27.657  126.842 47.270 1.00 35.17 ? 111  LYS B N     1 
ATOM   2213 C CA    . LYS B 1 111 ? 27.366  126.236 48.553 1.00 36.05 ? 111  LYS B CA    1 
ATOM   2214 C C     . LYS B 1 111 ? 26.029  125.543 48.693 1.00 35.72 ? 111  LYS B C     1 
ATOM   2215 O O     . LYS B 1 111 ? 25.053  125.867 48.011 1.00 35.84 ? 111  LYS B O     1 
ATOM   2216 C CB    . LYS B 1 111 ? 27.514  127.242 49.694 1.00 38.10 ? 111  LYS B CB    1 
ATOM   2217 C CG    . LYS B 1 111 ? 26.501  128.354 49.679 1.00 39.90 ? 111  LYS B CG    1 
ATOM   2218 C CD    . LYS B 1 111 ? 26.101  128.777 51.081 1.00 41.26 ? 111  LYS B CD    1 
ATOM   2219 C CE    . LYS B 1 111 ? 27.277  129.157 51.956 1.00 41.64 ? 111  LYS B CE    1 
ATOM   2220 N NZ    . LYS B 1 111 ? 26.763  129.713 53.234 1.00 42.03 ? 111  LYS B NZ    1 
ATOM   2221 N N     . ASP B 1 112 ? 26.026  124.599 49.630 1.00 33.99 ? 112  ASP B N     1 
ATOM   2222 C CA    . ASP B 1 112 ? 24.884  123.797 50.006 1.00 31.71 ? 112  ASP B CA    1 
ATOM   2223 C C     . ASP B 1 112 ? 24.138  123.172 48.851 1.00 30.16 ? 112  ASP B C     1 
ATOM   2224 O O     . ASP B 1 112 ? 22.911  123.230 48.794 1.00 29.77 ? 112  ASP B O     1 
ATOM   2225 C CB    . ASP B 1 112 ? 23.943  124.617 50.883 1.00 34.56 ? 112  ASP B CB    1 
ATOM   2226 C CG    . ASP B 1 112 ? 24.679  125.359 51.987 1.00 37.82 ? 112  ASP B CG    1 
ATOM   2227 O OD1   . ASP B 1 112 ? 25.447  124.720 52.747 1.00 38.93 ? 112  ASP B OD1   1 
ATOM   2228 O OD2   . ASP B 1 112 ? 24.500  126.595 52.078 1.00 40.46 ? 112  ASP B OD2   1 
ATOM   2229 N N     . PHE B 1 113 ? 24.880  122.590 47.915 1.00 27.70 ? 113  PHE B N     1 
ATOM   2230 C CA    . PHE B 1 113 ? 24.252  121.928 46.789 1.00 26.78 ? 113  PHE B CA    1 
ATOM   2231 C C     . PHE B 1 113 ? 23.438  120.770 47.362 1.00 26.99 ? 113  PHE B C     1 
ATOM   2232 O O     . PHE B 1 113 ? 23.941  120.006 48.188 1.00 29.48 ? 113  PHE B O     1 
ATOM   2233 C CB    . PHE B 1 113 ? 25.300  121.389 45.822 1.00 23.58 ? 113  PHE B CB    1 
ATOM   2234 C CG    . PHE B 1 113 ? 24.738  120.455 44.801 1.00 21.91 ? 113  PHE B CG    1 
ATOM   2235 C CD1   . PHE B 1 113 ? 24.194  120.945 43.621 1.00 20.83 ? 113  PHE B CD1   1 
ATOM   2236 C CD2   . PHE B 1 113 ? 24.690  119.085 45.049 1.00 21.09 ? 113  PHE B CD2   1 
ATOM   2237 C CE1   . PHE B 1 113 ? 23.604  120.089 42.702 1.00 18.96 ? 113  PHE B CE1   1 
ATOM   2238 C CE2   . PHE B 1 113 ? 24.097  118.210 44.133 1.00 20.25 ? 113  PHE B CE2   1 
ATOM   2239 C CZ    . PHE B 1 113 ? 23.553  118.711 42.961 1.00 20.49 ? 113  PHE B CZ    1 
ATOM   2240 N N     . LYS B 1 114 ? 22.196  120.625 46.924 1.00 26.91 ? 114  LYS B N     1 
ATOM   2241 C CA    . LYS B 1 114 ? 21.357  119.552 47.430 1.00 24.99 ? 114  LYS B CA    1 
ATOM   2242 C C     . LYS B 1 114 ? 20.449  119.007 46.350 1.00 23.23 ? 114  LYS B C     1 
ATOM   2243 O O     . LYS B 1 114 ? 19.915  119.772 45.563 1.00 23.57 ? 114  LYS B O     1 
ATOM   2244 C CB    . LYS B 1 114 ? 20.512  120.072 48.592 1.00 26.78 ? 114  LYS B CB    1 
ATOM   2245 C CG    . LYS B 1 114 ? 19.661  119.007 49.267 1.00 32.15 ? 114  LYS B CG    1 
ATOM   2246 C CD    . LYS B 1 114 ? 19.105  119.488 50.603 1.00 35.81 ? 114  LYS B CD    1 
ATOM   2247 C CE    . LYS B 1 114 ? 18.207  118.433 51.282 1.00 39.10 ? 114  LYS B CE    1 
ATOM   2248 N NZ    . LYS B 1 114 ? 16.847  118.281 50.645 1.00 41.11 ? 114  LYS B NZ    1 
ATOM   2249 N N     . ILE B 1 115 ? 20.351  117.687 46.244 1.00 22.21 ? 115  ILE B N     1 
ATOM   2250 C CA    . ILE B 1 115 ? 19.438  117.060 45.285 1.00 20.72 ? 115  ILE B CA    1 
ATOM   2251 C C     . ILE B 1 115 ? 18.097  117.202 46.004 1.00 21.55 ? 115  ILE B C     1 
ATOM   2252 O O     . ILE B 1 115 ? 17.961  116.779 47.157 1.00 23.25 ? 115  ILE B O     1 
ATOM   2253 C CB    . ILE B 1 115 ? 19.753  115.552 45.080 1.00 19.95 ? 115  ILE B CB    1 
ATOM   2254 C CG1   . ILE B 1 115 ? 21.156  115.382 44.486 1.00 19.10 ? 115  ILE B CG1   1 
ATOM   2255 C CG2   . ILE B 1 115 ? 18.690  114.873 44.199 1.00 15.58 ? 115  ILE B CG2   1 
ATOM   2256 C CD1   . ILE B 1 115 ? 21.345  116.022 43.131 1.00 19.36 ? 115  ILE B CD1   1 
ATOM   2257 N N     . GLN B 1 116 ? 17.131  117.846 45.359 1.00 20.88 ? 116  GLN B N     1 
ATOM   2258 C CA    . GLN B 1 116 ? 15.831  118.065 45.977 1.00 18.36 ? 116  GLN B CA    1 
ATOM   2259 C C     . GLN B 1 116 ? 14.740  117.080 45.566 1.00 18.17 ? 116  GLN B C     1 
ATOM   2260 O O     . GLN B 1 116 ? 13.817  116.829 46.339 1.00 19.44 ? 116  GLN B O     1 
ATOM   2261 C CB    . GLN B 1 116 ? 15.374  119.498 45.697 1.00 17.91 ? 116  GLN B CB    1 
ATOM   2262 C CG    . GLN B 1 116 ? 16.351  120.568 46.181 1.00 16.20 ? 116  GLN B CG    1 
ATOM   2263 C CD    . GLN B 1 116 ? 16.312  120.781 47.680 1.00 17.48 ? 116  GLN B CD    1 
ATOM   2264 O OE1   . GLN B 1 116 ? 15.627  120.077 48.414 1.00 17.68 ? 116  GLN B OE1   1 
ATOM   2265 N NE2   . GLN B 1 116 ? 17.033  121.778 48.137 1.00 19.15 ? 116  GLN B NE2   1 
ATOM   2266 N N     . ASN B 1 117 ? 14.847  116.513 44.368 1.00 17.05 ? 117  ASN B N     1 
ATOM   2267 C CA    . ASN B 1 117 ? 13.837  115.579 43.870 1.00 17.63 ? 117  ASN B CA    1 
ATOM   2268 C C     . ASN B 1 117 ? 14.443  114.703 42.783 1.00 16.85 ? 117  ASN B C     1 
ATOM   2269 O O     . ASN B 1 117 ? 15.196  115.190 41.938 1.00 17.66 ? 117  ASN B O     1 
ATOM   2270 C CB    . ASN B 1 117 ? 12.638  116.368 43.290 1.00 16.71 ? 117  ASN B CB    1 
ATOM   2271 C CG    . ASN B 1 117 ? 11.481  115.471 42.847 1.00 16.20 ? 117  ASN B CG    1 
ATOM   2272 O OD1   . ASN B 1 117 ? 11.182  114.446 43.470 1.00 14.86 ? 117  ASN B OD1   1 
ATOM   2273 N ND2   . ASN B 1 117 ? 10.809  115.873 41.777 1.00 14.59 ? 117  ASN B ND2   1 
ATOM   2274 N N     . ILE B 1 118 ? 14.122  113.414 42.817 1.00 15.99 ? 118  ILE B N     1 
ATOM   2275 C CA    . ILE B 1 118 ? 14.612  112.455 41.834 1.00 14.20 ? 118  ILE B CA    1 
ATOM   2276 C C     . ILE B 1 118 ? 13.387  111.759 41.279 1.00 14.28 ? 118  ILE B C     1 
ATOM   2277 O O     . ILE B 1 118 ? 12.555  111.267 42.042 1.00 13.63 ? 118  ILE B O     1 
ATOM   2278 C CB    . ILE B 1 118 ? 15.475  111.359 42.485 1.00 14.81 ? 118  ILE B CB    1 
ATOM   2279 C CG1   . ILE B 1 118 ? 16.710  111.957 43.160 1.00 15.13 ? 118  ILE B CG1   1 
ATOM   2280 C CG2   . ILE B 1 118 ? 15.860  110.330 41.456 1.00 13.63 ? 118  ILE B CG2   1 
ATOM   2281 C CD1   . ILE B 1 118 ? 17.646  110.907 43.728 1.00 14.09 ? 118  ILE B CD1   1 
ATOM   2282 N N     . VAL B 1 119 ? 13.269  111.716 39.958 1.00 15.19 ? 119  VAL B N     1 
ATOM   2283 C CA    . VAL B 1 119 ? 12.127  111.076 39.316 1.00 12.88 ? 119  VAL B CA    1 
ATOM   2284 C C     . VAL B 1 119 ? 12.632  109.874 38.518 1.00 15.35 ? 119  VAL B C     1 
ATOM   2285 O O     . VAL B 1 119 ? 13.603  109.983 37.772 1.00 16.25 ? 119  VAL B O     1 
ATOM   2286 C CB    . VAL B 1 119 ? 11.398  112.053 38.363 1.00 9.83  ? 119  VAL B CB    1 
ATOM   2287 C CG1   . VAL B 1 119 ? 10.107  111.420 37.827 1.00 6.87  ? 119  VAL B CG1   1 
ATOM   2288 C CG2   . VAL B 1 119 ? 11.121  113.376 39.066 1.00 4.53  ? 119  VAL B CG2   1 
ATOM   2289 N N     . GLY B 1 120 ? 12.002  108.723 38.695 1.00 15.35 ? 120  GLY B N     1 
ATOM   2290 C CA    . GLY B 1 120 ? 12.420  107.559 37.951 1.00 17.37 ? 120  GLY B CA    1 
ATOM   2291 C C     . GLY B 1 120 ? 11.189  106.890 37.385 1.00 18.39 ? 120  GLY B C     1 
ATOM   2292 O O     . GLY B 1 120 ? 10.072  107.308 37.653 1.00 19.35 ? 120  GLY B O     1 
ATOM   2293 N N     . SER B 1 121 ? 11.391  105.865 36.580 1.00 18.84 ? 121  SER B N     1 
ATOM   2294 C CA    . SER B 1 121 ? 10.288  105.120 36.009 1.00 20.00 ? 121  SER B CA    1 
ATOM   2295 C C     . SER B 1 121 ? 10.766  103.711 35.697 1.00 20.44 ? 121  SER B C     1 
ATOM   2296 O O     . SER B 1 121 ? 11.963  103.457 35.639 1.00 21.36 ? 121  SER B O     1 
ATOM   2297 C CB    . SER B 1 121 ? 9.787   105.795 34.718 1.00 20.38 ? 121  SER B CB    1 
ATOM   2298 O OG    . SER B 1 121 ? 10.714  105.662 33.644 1.00 20.30 ? 121  SER B OG    1 
ATOM   2299 N N     . CYS B 1 122 ? 9.843   102.772 35.610 1.00 21.15 ? 122  CYS B N     1 
ATOM   2300 C CA    . CYS B 1 122 ? 10.210  101.434 35.209 1.00 22.83 ? 122  CYS B CA    1 
ATOM   2301 C C     . CYS B 1 122 ? 8.985   100.738 34.690 1.00 22.54 ? 122  CYS B C     1 
ATOM   2302 O O     . CYS B 1 122 ? 7.947   101.364 34.513 1.00 23.79 ? 122  CYS B O     1 
ATOM   2303 C CB    . CYS B 1 122 ? 10.906  100.653 36.305 1.00 25.18 ? 122  CYS B CB    1 
ATOM   2304 S SG    . CYS B 1 122 ? 9.933   100.481 37.708 1.00 33.50 ? 122  CYS B SG    1 
ATOM   2305 N N     . ASP B 1 123 ? 9.103   99.448  34.445 1.00 23.31 ? 123  ASP B N     1 
ATOM   2306 C CA    . ASP B 1 123 ? 8.028   98.672  33.874 1.00 24.33 ? 123  ASP B CA    1 
ATOM   2307 C C     . ASP B 1 123 ? 8.086   97.292  34.506 1.00 25.03 ? 123  ASP B C     1 
ATOM   2308 O O     . ASP B 1 123 ? 9.106   96.626  34.444 1.00 24.83 ? 123  ASP B O     1 
ATOM   2309 C CB    . ASP B 1 123 ? 8.291   98.599  32.365 1.00 25.14 ? 123  ASP B CB    1 
ATOM   2310 C CG    . ASP B 1 123 ? 7.234   97.843  31.600 1.00 27.35 ? 123  ASP B CG    1 
ATOM   2311 O OD1   . ASP B 1 123 ? 6.271   97.324  32.198 1.00 29.53 ? 123  ASP B OD1   1 
ATOM   2312 O OD2   . ASP B 1 123 ? 7.376   97.780  30.366 1.00 27.69 ? 123  ASP B OD2   1 
ATOM   2313 N N     . VAL B 1 124 ? 6.994   96.874  35.133 1.00 27.00 ? 124  VAL B N     1 
ATOM   2314 C CA    . VAL B 1 124 ? 6.946   95.561  35.778 1.00 28.70 ? 124  VAL B CA    1 
ATOM   2315 C C     . VAL B 1 124 ? 6.729   94.446  34.766 1.00 30.43 ? 124  VAL B C     1 
ATOM   2316 O O     . VAL B 1 124 ? 6.755   93.270  35.119 1.00 32.53 ? 124  VAL B O     1 
ATOM   2317 C CB    . VAL B 1 124 ? 5.847   95.475  36.867 1.00 28.02 ? 124  VAL B CB    1 
ATOM   2318 C CG1   . VAL B 1 124 ? 6.168   96.421  38.019 1.00 26.86 ? 124  VAL B CG1   1 
ATOM   2319 C CG2   . VAL B 1 124 ? 4.483   95.784  36.270 1.00 26.83 ? 124  VAL B CG2   1 
ATOM   2320 N N     . LYS B 1 125 ? 6.444   94.828  33.525 1.00 31.76 ? 125  LYS B N     1 
ATOM   2321 C CA    . LYS B 1 125 ? 6.234   93.881  32.436 1.00 33.27 ? 125  LYS B CA    1 
ATOM   2322 C C     . LYS B 1 125 ? 4.937   93.058  32.465 1.00 33.47 ? 125  LYS B C     1 
ATOM   2323 O O     . LYS B 1 125 ? 4.881   91.937  31.959 1.00 33.66 ? 125  LYS B O     1 
ATOM   2324 C CB    . LYS B 1 125 ? 7.457   92.976  32.300 1.00 35.25 ? 125  LYS B CB    1 
ATOM   2325 C CG    . LYS B 1 125 ? 8.713   93.725  31.899 1.00 39.06 ? 125  LYS B CG    1 
ATOM   2326 C CD    . LYS B 1 125 ? 8.610   94.223  30.472 1.00 42.89 ? 125  LYS B CD    1 
ATOM   2327 C CE    . LYS B 1 125 ? 9.865   94.981  30.059 1.00 47.47 ? 125  LYS B CE    1 
ATOM   2328 N NZ    . LYS B 1 125 ? 10.080  96.234  30.857 1.00 50.21 ? 125  LYS B NZ    1 
ATOM   2329 N N     . PHE B 1 126 ? 3.882   93.638  33.013 1.00 32.99 ? 126  PHE B N     1 
ATOM   2330 C CA    . PHE B 1 126 ? 2.593   92.976  33.063 1.00 32.26 ? 126  PHE B CA    1 
ATOM   2331 C C     . PHE B 1 126 ? 1.504   94.002  33.417 1.00 32.31 ? 126  PHE B C     1 
ATOM   2332 O O     . PHE B 1 126 ? 1.773   94.950  34.168 1.00 32.35 ? 126  PHE B O     1 
ATOM   2333 C CB    . PHE B 1 126 ? 2.615   91.774  34.035 1.00 30.55 ? 126  PHE B CB    1 
ATOM   2334 C CG    . PHE B 1 126 ? 2.848   92.129  35.492 1.00 30.81 ? 126  PHE B CG    1 
ATOM   2335 C CD1   . PHE B 1 126 ? 1.835   92.704  36.267 1.00 30.38 ? 126  PHE B CD1   1 
ATOM   2336 C CD2   . PHE B 1 126 ? 4.055   91.819  36.111 1.00 29.06 ? 126  PHE B CD2   1 
ATOM   2337 C CE1   . PHE B 1 126 ? 2.023   92.958  37.626 1.00 28.00 ? 126  PHE B CE1   1 
ATOM   2338 C CE2   . PHE B 1 126 ? 4.244   92.071  37.474 1.00 27.01 ? 126  PHE B CE2   1 
ATOM   2339 C CZ    . PHE B 1 126 ? 3.228   92.638  38.224 1.00 26.64 ? 126  PHE B CZ    1 
ATOM   2340 N N     . PRO B 1 127 ? 0.306   93.884  32.795 1.00 31.09 ? 127  PRO B N     1 
ATOM   2341 C CA    . PRO B 1 127 ? -0.844  94.767  33.009 1.00 30.42 ? 127  PRO B CA    1 
ATOM   2342 C C     . PRO B 1 127 ? -1.345  94.679  34.432 1.00 28.21 ? 127  PRO B C     1 
ATOM   2343 O O     . PRO B 1 127 ? -1.330  93.608  35.031 1.00 28.68 ? 127  PRO B O     1 
ATOM   2344 C CB    . PRO B 1 127 ? -1.870  94.239  32.007 1.00 30.09 ? 127  PRO B CB    1 
ATOM   2345 C CG    . PRO B 1 127 ? -1.526  92.820  31.888 1.00 31.07 ? 127  PRO B CG    1 
ATOM   2346 C CD    . PRO B 1 127 ? -0.029  92.876  31.777 1.00 31.42 ? 127  PRO B CD    1 
ATOM   2347 N N     . ILE B 1 128 ? -1.827  95.800  34.953 1.00 27.92 ? 128  ILE B N     1 
ATOM   2348 C CA    . ILE B 1 128 ? -2.288  95.881  36.337 1.00 27.12 ? 128  ILE B CA    1 
ATOM   2349 C C     . ILE B 1 128 ? -3.755  96.280  36.530 1.00 26.59 ? 128  ILE B C     1 
ATOM   2350 O O     . ILE B 1 128 ? -4.250  97.200  35.880 1.00 26.52 ? 128  ILE B O     1 
ATOM   2351 C CB    . ILE B 1 128 ? -1.393  96.878  37.139 1.00 24.88 ? 128  ILE B CB    1 
ATOM   2352 C CG1   . ILE B 1 128 ? 0.088   96.489  36.993 1.00 23.79 ? 128  ILE B CG1   1 
ATOM   2353 C CG2   . ILE B 1 128 ? -1.800  96.899  38.606 1.00 22.52 ? 128  ILE B CG2   1 
ATOM   2354 C CD1   . ILE B 1 128 ? 1.059   97.562  37.407 1.00 23.45 ? 128  ILE B CD1   1 
ATOM   2355 N N     . ARG B 1 129 ? -4.430  95.566  37.433 1.00 26.69 ? 129  ARG B N     1 
ATOM   2356 C CA    . ARG B 1 129 ? -5.818  95.822  37.788 1.00 26.45 ? 129  ARG B CA    1 
ATOM   2357 C C     . ARG B 1 129 ? -5.769  96.915  38.855 1.00 25.53 ? 129  ARG B C     1 
ATOM   2358 O O     . ARG B 1 129 ? -5.665  96.638  40.055 1.00 25.34 ? 129  ARG B O     1 
ATOM   2359 C CB    . ARG B 1 129 ? -6.473  94.557  38.352 1.00 27.74 ? 129  ARG B CB    1 
ATOM   2360 C CG    . ARG B 1 129 ? -6.426  93.376  37.396 1.00 29.73 ? 129  ARG B CG    1 
ATOM   2361 C CD    . ARG B 1 129 ? -7.208  92.163  37.913 1.00 33.03 ? 129  ARG B CD    1 
ATOM   2362 N NE    . ARG B 1 129 ? -6.520  91.418  38.971 1.00 34.87 ? 129  ARG B NE    1 
ATOM   2363 C CZ    . ARG B 1 129 ? -6.757  91.563  40.274 1.00 37.04 ? 129  ARG B CZ    1 
ATOM   2364 N NH1   . ARG B 1 129 ? -7.673  92.435  40.712 1.00 37.34 ? 129  ARG B NH1   1 
ATOM   2365 N NH2   . ARG B 1 129 ? -6.074  90.832  41.148 1.00 37.27 ? 129  ARG B NH2   1 
ATOM   2366 N N     . LEU B 1 130 ? -5.800  98.162  38.388 1.00 25.42 ? 130  LEU B N     1 
ATOM   2367 C CA    . LEU B 1 130 ? -5.729  99.347  39.237 1.00 24.11 ? 130  LEU B CA    1 
ATOM   2368 C C     . LEU B 1 130 ? -6.847  99.478  40.255 1.00 24.92 ? 130  LEU B C     1 
ATOM   2369 O O     . LEU B 1 130 ? -6.639  100.013 41.348 1.00 25.67 ? 130  LEU B O     1 
ATOM   2370 C CB    . LEU B 1 130 ? -5.672  100.604 38.362 1.00 22.60 ? 130  LEU B CB    1 
ATOM   2371 C CG    . LEU B 1 130 ? -4.460  100.770 37.444 1.00 20.62 ? 130  LEU B CG    1 
ATOM   2372 C CD1   . LEU B 1 130 ? -4.479  102.169 36.835 1.00 19.01 ? 130  LEU B CD1   1 
ATOM   2373 C CD2   . LEU B 1 130 ? -3.176  100.567 38.240 1.00 18.28 ? 130  LEU B CD2   1 
ATOM   2374 N N     . GLU B 1 131 ? -8.036  99.009  39.895 1.00 26.01 ? 131  GLU B N     1 
ATOM   2375 C CA    . GLU B 1 131 ? -9.188  99.070  40.793 1.00 27.49 ? 131  GLU B CA    1 
ATOM   2376 C C     . GLU B 1 131 ? -8.985  98.216  42.039 1.00 28.12 ? 131  GLU B C     1 
ATOM   2377 O O     . GLU B 1 131 ? -9.263  98.661  43.151 1.00 29.19 ? 131  GLU B O     1 
ATOM   2378 C CB    . GLU B 1 131 ? -10.438 98.620  40.064 1.00 29.19 ? 131  GLU B CB    1 
ATOM   2379 N N     . GLY B 1 132 ? -8.503  96.988  41.842 1.00 29.42 ? 132  GLY B N     1 
ATOM   2380 C CA    . GLY B 1 132 ? -8.264  96.064  42.943 1.00 29.73 ? 132  GLY B CA    1 
ATOM   2381 C C     . GLY B 1 132 ? -7.177  96.559  43.865 1.00 30.77 ? 132  GLY B C     1 
ATOM   2382 O O     . GLY B 1 132 ? -7.249  96.363  45.079 1.00 32.09 ? 132  GLY B O     1 
ATOM   2383 N N     . LEU B 1 133 ? -6.163  97.190  43.276 1.00 31.79 ? 133  LEU B N     1 
ATOM   2384 C CA    . LEU B 1 133 ? -5.045  97.761  44.021 1.00 32.17 ? 133  LEU B CA    1 
ATOM   2385 C C     . LEU B 1 133 ? -5.547  98.890  44.909 1.00 33.30 ? 133  LEU B C     1 
ATOM   2386 O O     . LEU B 1 133 ? -5.292  98.901  46.114 1.00 34.23 ? 133  LEU B O     1 
ATOM   2387 C CB    . LEU B 1 133 ? -3.980  98.293  43.057 1.00 31.88 ? 133  LEU B CB    1 
ATOM   2388 C CG    . LEU B 1 133 ? -2.766  99.031  43.638 1.00 32.56 ? 133  LEU B CG    1 
ATOM   2389 C CD1   . LEU B 1 133 ? -2.060  98.184  44.700 1.00 31.56 ? 133  LEU B CD1   1 
ATOM   2390 C CD2   . LEU B 1 133 ? -1.810  99.385  42.502 1.00 33.25 ? 133  LEU B CD2   1 
ATOM   2391 N N     . ALA B 1 134 ? -6.263  99.836  44.311 1.00 34.74 ? 134  ALA B N     1 
ATOM   2392 C CA    . ALA B 1 134 ? -6.812  100.962 45.058 1.00 36.23 ? 134  ALA B CA    1 
ATOM   2393 C C     . ALA B 1 134 ? -7.733  100.420 46.123 1.00 37.31 ? 134  ALA B C     1 
ATOM   2394 O O     . ALA B 1 134 ? -7.770  100.922 47.243 1.00 38.43 ? 134  ALA B O     1 
ATOM   2395 C CB    . ALA B 1 134 ? -7.579  101.886 44.135 1.00 35.51 ? 134  ALA B CB    1 
ATOM   2396 N N     . TYR B 1 135 ? -8.446  99.361  45.768 1.00 39.81 ? 135  TYR B N     1 
ATOM   2397 C CA    . TYR B 1 135 ? -9.389  98.718  46.665 1.00 42.45 ? 135  TYR B CA    1 
ATOM   2398 C C     . TYR B 1 135 ? -8.711  98.216  47.936 1.00 42.21 ? 135  TYR B C     1 
ATOM   2399 O O     . TYR B 1 135 ? -9.036  98.647  49.047 1.00 42.84 ? 135  TYR B O     1 
ATOM   2400 C CB    . TYR B 1 135 ? -10.094 97.557  45.947 1.00 45.06 ? 135  TYR B CB    1 
ATOM   2401 C CG    . TYR B 1 135 ? -11.263 97.013  46.726 1.00 47.28 ? 135  TYR B CG    1 
ATOM   2402 C CD1   . TYR B 1 135 ? -12.525 97.586  46.601 1.00 48.28 ? 135  TYR B CD1   1 
ATOM   2403 C CD2   . TYR B 1 135 ? -11.090 95.986  47.654 1.00 48.17 ? 135  TYR B CD2   1 
ATOM   2404 C CE1   . TYR B 1 135 ? -13.583 97.162  47.386 1.00 50.32 ? 135  TYR B CE1   1 
ATOM   2405 C CE2   . TYR B 1 135 ? -12.140 95.553  48.447 1.00 50.07 ? 135  TYR B CE2   1 
ATOM   2406 C CZ    . TYR B 1 135 ? -13.386 96.149  48.311 1.00 50.59 ? 135  TYR B CZ    1 
ATOM   2407 O OH    . TYR B 1 135 ? -14.431 95.754  49.120 1.00 52.69 ? 135  TYR B OH    1 
ATOM   2408 N N     . SER B 1 136 ? -7.752  97.318  47.764 1.00 42.50 ? 136  SER B N     1 
ATOM   2409 C CA    . SER B 1 136 ? -7.039  96.742  48.891 1.00 42.08 ? 136  SER B CA    1 
ATOM   2410 C C     . SER B 1 136 ? -6.083  97.720  49.566 1.00 41.36 ? 136  SER B C     1 
ATOM   2411 O O     . SER B 1 136 ? -5.611  97.461  50.667 1.00 42.80 ? 136  SER B O     1 
ATOM   2412 C CB    . SER B 1 136 ? -6.258  95.524  48.422 1.00 42.82 ? 136  SER B CB    1 
ATOM   2413 O OG    . SER B 1 136 ? -5.232  95.921  47.524 1.00 45.90 ? 136  SER B OG    1 
ATOM   2414 N N     . HIS B 1 137 ? -5.760  98.821  48.895 1.00 41.13 ? 137  HIS B N     1 
ATOM   2415 C CA    . HIS B 1 137 ? -4.843  99.811  49.454 1.00 40.34 ? 137  HIS B CA    1 
ATOM   2416 C C     . HIS B 1 137 ? -5.432  101.209 49.457 1.00 39.89 ? 137  HIS B C     1 
ATOM   2417 O O     . HIS B 1 137 ? -4.746  102.174 49.119 1.00 40.28 ? 137  HIS B O     1 
ATOM   2418 C CB    . HIS B 1 137 ? -3.535  99.832  48.662 1.00 41.25 ? 137  HIS B CB    1 
ATOM   2419 C CG    . HIS B 1 137 ? -2.658  98.649  48.909 1.00 40.73 ? 137  HIS B CG    1 
ATOM   2420 N ND1   . HIS B 1 137 ? -2.934  97.399  48.399 1.00 40.43 ? 137  HIS B ND1   1 
ATOM   2421 C CD2   . HIS B 1 137 ? -1.508  98.525  49.614 1.00 39.91 ? 137  HIS B CD2   1 
ATOM   2422 C CE1   . HIS B 1 137 ? -1.992  96.556  48.781 1.00 41.22 ? 137  HIS B CE1   1 
ATOM   2423 N NE2   . HIS B 1 137 ? -1.115  97.215  49.519 1.00 39.51 ? 137  HIS B NE2   1 
ATOM   2424 N N     . ALA B 1 138 ? -6.684  101.321 49.874 1.00 39.28 ? 138  ALA B N     1 
ATOM   2425 C CA    . ALA B 1 138 ? -7.377  102.601 49.909 1.00 38.94 ? 138  ALA B CA    1 
ATOM   2426 C C     . ALA B 1 138 ? -6.610  103.707 50.622 1.00 38.26 ? 138  ALA B C     1 
ATOM   2427 O O     . ALA B 1 138 ? -6.625  104.856 50.187 1.00 38.66 ? 138  ALA B O     1 
ATOM   2428 C CB    . ALA B 1 138 ? -8.762  102.432 50.532 1.00 39.88 ? 138  ALA B CB    1 
ATOM   2429 N N     . ALA B 1 139 ? -5.918  103.361 51.701 1.00 38.17 ? 139  ALA B N     1 
ATOM   2430 C CA    . ALA B 1 139 ? -5.161  104.351 52.471 1.00 37.37 ? 139  ALA B CA    1 
ATOM   2431 C C     . ALA B 1 139 ? -3.950  104.907 51.736 1.00 36.74 ? 139  ALA B C     1 
ATOM   2432 O O     . ALA B 1 139 ? -3.406  105.940 52.123 1.00 37.85 ? 139  ALA B O     1 
ATOM   2433 C CB    . ALA B 1 139 ? -4.719  103.756 53.789 1.00 37.32 ? 139  ALA B CB    1 
ATOM   2434 N N     . PHE B 1 140 ? -3.502  104.195 50.709 1.00 35.98 ? 140  PHE B N     1 
ATOM   2435 C CA    . PHE B 1 140 ? -2.332  104.608 49.936 1.00 34.74 ? 140  PHE B CA    1 
ATOM   2436 C C     . PHE B 1 140 ? -2.687  105.035 48.530 1.00 32.78 ? 140  PHE B C     1 
ATOM   2437 O O     . PHE B 1 140 ? -1.960  105.796 47.903 1.00 31.60 ? 140  PHE B O     1 
ATOM   2438 C CB    . PHE B 1 140 ? -1.342  103.453 49.835 1.00 34.90 ? 140  PHE B CB    1 
ATOM   2439 C CG    . PHE B 1 140 ? -0.833  102.993 51.146 1.00 36.07 ? 140  PHE B CG    1 
ATOM   2440 C CD1   . PHE B 1 140 ? 0.291   103.586 51.710 1.00 38.02 ? 140  PHE B CD1   1 
ATOM   2441 C CD2   . PHE B 1 140 ? -1.485  101.987 51.837 1.00 36.14 ? 140  PHE B CD2   1 
ATOM   2442 C CE1   . PHE B 1 140 ? 0.761   103.185 52.952 1.00 38.09 ? 140  PHE B CE1   1 
ATOM   2443 C CE2   . PHE B 1 140 ? -1.030  101.577 53.077 1.00 37.43 ? 140  PHE B CE2   1 
ATOM   2444 C CZ    . PHE B 1 140 ? 0.099   102.177 53.639 1.00 38.46 ? 140  PHE B CZ    1 
ATOM   2445 N N     . SER B 1 141 ? -3.824  104.563 48.054 1.00 30.98 ? 141  SER B N     1 
ATOM   2446 C CA    . SER B 1 141 ? -4.229  104.851 46.708 1.00 30.75 ? 141  SER B CA    1 
ATOM   2447 C C     . SER B 1 141 ? -5.196  106.004 46.530 1.00 31.14 ? 141  SER B C     1 
ATOM   2448 O O     . SER B 1 141 ? -5.794  106.509 47.478 1.00 32.99 ? 141  SER B O     1 
ATOM   2449 C CB    . SER B 1 141 ? -4.802  103.588 46.087 1.00 29.69 ? 141  SER B CB    1 
ATOM   2450 O OG    . SER B 1 141 ? -3.958  102.486 46.359 1.00 30.72 ? 141  SER B OG    1 
ATOM   2451 N N     . SER B 1 142 ? -5.277  106.443 45.286 1.00 30.31 ? 142  SER B N     1 
ATOM   2452 C CA    . SER B 1 142 ? -6.150  107.505 44.852 1.00 29.41 ? 142  SER B CA    1 
ATOM   2453 C C     . SER B 1 142 ? -6.196  107.241 43.369 1.00 28.91 ? 142  SER B C     1 
ATOM   2454 O O     . SER B 1 142 ? -5.223  107.483 42.653 1.00 30.07 ? 142  SER B O     1 
ATOM   2455 C CB    . SER B 1 142 ? -5.530  108.856 45.119 1.00 29.13 ? 142  SER B CB    1 
ATOM   2456 O OG    . SER B 1 142 ? -6.261  109.833 44.417 1.00 33.28 ? 142  SER B OG    1 
ATOM   2457 N N     . TYR B 1 143 ? -7.281  106.618 42.935 1.00 28.27 ? 143  TYR B N     1 
ATOM   2458 C CA    . TYR B 1 143 ? -7.450  106.266 41.541 1.00 27.20 ? 143  TYR B CA    1 
ATOM   2459 C C     . TYR B 1 143 ? -8.773  106.816 41.009 1.00 28.39 ? 143  TYR B C     1 
ATOM   2460 O O     . TYR B 1 143 ? -9.840  106.237 41.242 1.00 28.79 ? 143  TYR B O     1 
ATOM   2461 C CB    . TYR B 1 143 ? -7.401  104.739 41.403 1.00 24.53 ? 143  TYR B CB    1 
ATOM   2462 C CG    . TYR B 1 143 ? -7.600  104.224 39.995 1.00 23.68 ? 143  TYR B CG    1 
ATOM   2463 C CD1   . TYR B 1 143 ? -6.880  104.753 38.921 1.00 22.07 ? 143  TYR B CD1   1 
ATOM   2464 C CD2   . TYR B 1 143 ? -8.528  103.220 39.734 1.00 22.14 ? 143  TYR B CD2   1 
ATOM   2465 C CE1   . TYR B 1 143 ? -7.087  104.287 37.624 1.00 21.17 ? 143  TYR B CE1   1 
ATOM   2466 C CE2   . TYR B 1 143 ? -8.742  102.755 38.452 1.00 19.29 ? 143  TYR B CE2   1 
ATOM   2467 C CZ    . TYR B 1 143 ? -8.024  103.288 37.403 1.00 21.79 ? 143  TYR B CZ    1 
ATOM   2468 O OH    . TYR B 1 143 ? -8.266  102.826 36.124 1.00 23.55 ? 143  TYR B OH    1 
ATOM   2469 N N     . GLU B 1 144 ? -8.698  107.952 40.325 1.00 27.27 ? 144  GLU B N     1 
ATOM   2470 C CA    . GLU B 1 144 ? -9.870  108.577 39.732 1.00 27.64 ? 144  GLU B CA    1 
ATOM   2471 C C     . GLU B 1 144 ? -9.569  108.604 38.240 1.00 26.36 ? 144  GLU B C     1 
ATOM   2472 O O     . GLU B 1 144 ? -9.244  109.654 37.687 1.00 27.65 ? 144  GLU B O     1 
ATOM   2473 C CB    . GLU B 1 144 ? -10.034 109.997 40.269 1.00 28.24 ? 144  GLU B CB    1 
ATOM   2474 C CG    . GLU B 1 144 ? -10.092 110.093 41.787 1.00 31.32 ? 144  GLU B CG    1 
ATOM   2475 C CD    . GLU B 1 144 ? -11.150 109.186 42.441 1.00 35.09 ? 144  GLU B CD    1 
ATOM   2476 O OE1   . GLU B 1 144 ? -12.202 108.877 41.826 1.00 35.05 ? 144  GLU B OE1   1 
ATOM   2477 O OE2   . GLU B 1 144 ? -10.925 108.795 43.609 1.00 38.70 ? 144  GLU B OE2   1 
ATOM   2478 N N     . PRO B 1 145 ? -9.760  107.466 37.551 1.00 25.42 ? 145  PRO B N     1 
ATOM   2479 C CA    . PRO B 1 145 ? -9.485  107.349 36.114 1.00 25.57 ? 145  PRO B CA    1 
ATOM   2480 C C     . PRO B 1 145 ? -10.000 108.441 35.186 1.00 27.48 ? 145  PRO B C     1 
ATOM   2481 O O     . PRO B 1 145 ? -9.363  108.727 34.169 1.00 27.47 ? 145  PRO B O     1 
ATOM   2482 C CB    . PRO B 1 145 ? -10.024 105.959 35.763 1.00 23.56 ? 145  PRO B CB    1 
ATOM   2483 C CG    . PRO B 1 145 ? -11.087 105.738 36.747 1.00 23.22 ? 145  PRO B CG    1 
ATOM   2484 C CD    . PRO B 1 145 ? -10.519 106.297 38.029 1.00 24.40 ? 145  PRO B CD    1 
ATOM   2485 N N     . GLU B 1 146 ? -11.121 109.071 35.539 1.00 27.88 ? 146  GLU B N     1 
ATOM   2486 C CA    . GLU B 1 146 ? -11.692 110.129 34.710 1.00 27.12 ? 146  GLU B CA    1 
ATOM   2487 C C     . GLU B 1 146 ? -10.913 111.424 34.800 1.00 26.91 ? 146  GLU B C     1 
ATOM   2488 O O     . GLU B 1 146 ? -10.998 112.268 33.907 1.00 27.84 ? 146  GLU B O     1 
ATOM   2489 C CB    . GLU B 1 146 ? -13.138 110.374 35.092 1.00 26.90 ? 146  GLU B CB    1 
ATOM   2490 C CG    . GLU B 1 146 ? -14.011 109.190 34.805 1.00 27.59 ? 146  GLU B CG    1 
ATOM   2491 C CD    . GLU B 1 146 ? -15.362 109.310 35.454 1.00 29.46 ? 146  GLU B CD    1 
ATOM   2492 O OE1   . GLU B 1 146 ? -15.515 110.170 36.347 1.00 29.67 ? 146  GLU B OE1   1 
ATOM   2493 O OE2   . GLU B 1 146 ? -16.270 108.538 35.078 1.00 31.04 ? 146  GLU B OE2   1 
ATOM   2494 N N     . LEU B 1 147 ? -10.170 111.588 35.885 1.00 26.38 ? 147  LEU B N     1 
ATOM   2495 C CA    . LEU B 1 147 ? -9.364  112.781 36.079 1.00 26.09 ? 147  LEU B CA    1 
ATOM   2496 C C     . LEU B 1 147 ? -7.939  112.523 35.623 1.00 26.14 ? 147  LEU B C     1 
ATOM   2497 O O     . LEU B 1 147 ? -7.309  113.402 35.041 1.00 26.47 ? 147  LEU B O     1 
ATOM   2498 C CB    . LEU B 1 147 ? -9.387  113.201 37.549 1.00 27.33 ? 147  LEU B CB    1 
ATOM   2499 C CG    . LEU B 1 147 ? -10.803 113.299 38.140 1.00 28.72 ? 147  LEU B CG    1 
ATOM   2500 C CD1   . LEU B 1 147 ? -10.764 113.637 39.630 1.00 29.13 ? 147  LEU B CD1   1 
ATOM   2501 C CD2   . LEU B 1 147 ? -11.630 114.329 37.370 1.00 29.39 ? 147  LEU B CD2   1 
ATOM   2502 N N     . PHE B 1 148 ? -7.450  111.307 35.872 1.00 25.99 ? 148  PHE B N     1 
ATOM   2503 C CA    . PHE B 1 148 ? -6.096  110.897 35.509 1.00 24.76 ? 148  PHE B CA    1 
ATOM   2504 C C     . PHE B 1 148 ? -6.067  109.366 35.361 1.00 25.24 ? 148  PHE B C     1 
ATOM   2505 O O     . PHE B 1 148 ? -6.527  108.634 36.242 1.00 25.16 ? 148  PHE B O     1 
ATOM   2506 C CB    . PHE B 1 148 ? -5.087  111.367 36.586 1.00 24.90 ? 148  PHE B CB    1 
ATOM   2507 C CG    . PHE B 1 148 ? -3.630  111.125 36.217 1.00 25.56 ? 148  PHE B CG    1 
ATOM   2508 C CD1   . PHE B 1 148 ? -3.061  111.749 35.109 1.00 23.24 ? 148  PHE B CD1   1 
ATOM   2509 C CD2   . PHE B 1 148 ? -2.856  110.208 36.930 1.00 25.47 ? 148  PHE B CD2   1 
ATOM   2510 C CE1   . PHE B 1 148 ? -1.769  111.458 34.716 1.00 20.56 ? 148  PHE B CE1   1 
ATOM   2511 C CE2   . PHE B 1 148 ? -1.563  109.917 36.535 1.00 23.27 ? 148  PHE B CE2   1 
ATOM   2512 C CZ    . PHE B 1 148 ? -1.025  110.541 35.428 1.00 21.93 ? 148  PHE B CZ    1 
ATOM   2513 N N     . PRO B 1 149 ? -5.497  108.861 34.250 1.00 24.64 ? 149  PRO B N     1 
ATOM   2514 C CA    . PRO B 1 149 ? -5.394  107.426 33.959 1.00 24.42 ? 149  PRO B CA    1 
ATOM   2515 C C     . PRO B 1 149 ? -4.659  106.601 35.009 1.00 25.33 ? 149  PRO B C     1 
ATOM   2516 O O     . PRO B 1 149 ? -4.968  105.424 35.206 1.00 27.18 ? 149  PRO B O     1 
ATOM   2517 C CB    . PRO B 1 149 ? -4.590  107.390 32.656 1.00 23.71 ? 149  PRO B CB    1 
ATOM   2518 C CG    . PRO B 1 149 ? -4.823  108.701 32.047 1.00 24.62 ? 149  PRO B CG    1 
ATOM   2519 C CD    . PRO B 1 149 ? -4.826  109.652 33.202 1.00 23.87 ? 149  PRO B CD    1 
ATOM   2520 N N     . GLY B 1 150 ? -3.644  107.190 35.634 1.00 25.51 ? 150  GLY B N     1 
ATOM   2521 C CA    . GLY B 1 150 ? -2.853  106.457 36.606 1.00 24.15 ? 150  GLY B CA    1 
ATOM   2522 C C     . GLY B 1 150 ? -3.296  106.506 38.045 1.00 23.89 ? 150  GLY B C     1 
ATOM   2523 O O     . GLY B 1 150 ? -3.947  107.459 38.485 1.00 24.46 ? 150  GLY B O     1 
ATOM   2524 N N     . LEU B 1 151 ? -2.936  105.466 38.782 1.00 21.28 ? 151  LEU B N     1 
ATOM   2525 C CA    . LEU B 1 151 ? -3.272  105.390 40.184 1.00 21.02 ? 151  LEU B CA    1 
ATOM   2526 C C     . LEU B 1 151 ? -2.159  106.080 40.966 1.00 20.36 ? 151  LEU B C     1 
ATOM   2527 O O     . LEU B 1 151 ? -0.981  105.881 40.679 1.00 20.68 ? 151  LEU B O     1 
ATOM   2528 C CB    . LEU B 1 151 ? -3.411  103.920 40.595 1.00 20.88 ? 151  LEU B CB    1 
ATOM   2529 C CG    . LEU B 1 151 ? -3.918  103.558 41.991 1.00 20.90 ? 151  LEU B CG    1 
ATOM   2530 C CD1   . LEU B 1 151 ? -4.601  102.208 41.912 1.00 19.62 ? 151  LEU B CD1   1 
ATOM   2531 C CD2   . LEU B 1 151 ? -2.769  103.550 43.014 1.00 20.77 ? 151  LEU B CD2   1 
ATOM   2532 N N     . ILE B 1 152 ? -2.529  106.935 41.908 1.00 20.19 ? 152  ILE B N     1 
ATOM   2533 C CA    . ILE B 1 152 ? -1.543  107.640 42.712 1.00 20.40 ? 152  ILE B CA    1 
ATOM   2534 C C     . ILE B 1 152 ? -1.410  106.906 44.026 1.00 21.57 ? 152  ILE B C     1 
ATOM   2535 O O     . ILE B 1 152 ? -2.353  106.841 44.803 1.00 21.93 ? 152  ILE B O     1 
ATOM   2536 C CB    . ILE B 1 152 ? -1.934  109.119 42.928 1.00 21.03 ? 152  ILE B CB    1 
ATOM   2537 C CG1   . ILE B 1 152 ? -1.999  109.828 41.570 1.00 19.67 ? 152  ILE B CG1   1 
ATOM   2538 C CG2   . ILE B 1 152 ? -0.938  109.816 43.850 1.00 17.64 ? 152  ILE B CG2   1 
ATOM   2539 C CD1   . ILE B 1 152 ? -3.059  110.896 41.497 1.00 21.44 ? 152  ILE B CD1   1 
ATOM   2540 N N     . TYR B 1 153 ? -0.250  106.277 44.209 1.00 22.80 ? 153  TYR B N     1 
ATOM   2541 C CA    . TYR B 1 153 ? 0.068   105.500 45.393 1.00 22.69 ? 153  TYR B CA    1 
ATOM   2542 C C     . TYR B 1 153 ? 1.061   106.271 46.234 1.00 24.48 ? 153  TYR B C     1 
ATOM   2543 O O     . TYR B 1 153 ? 2.182   106.532 45.804 1.00 25.63 ? 153  TYR B O     1 
ATOM   2544 C CB    . TYR B 1 153 ? 0.665   104.151 44.988 1.00 21.21 ? 153  TYR B CB    1 
ATOM   2545 C CG    . TYR B 1 153 ? 0.792   103.192 46.140 1.00 21.12 ? 153  TYR B CG    1 
ATOM   2546 C CD1   . TYR B 1 153 ? 1.809   103.333 47.090 1.00 20.80 ? 153  TYR B CD1   1 
ATOM   2547 C CD2   . TYR B 1 153 ? -0.135  102.170 46.320 1.00 22.78 ? 153  TYR B CD2   1 
ATOM   2548 C CE1   . TYR B 1 153 ? 1.892   102.488 48.198 1.00 20.26 ? 153  TYR B CE1   1 
ATOM   2549 C CE2   . TYR B 1 153 ? -0.055  101.320 47.427 1.00 23.74 ? 153  TYR B CE2   1 
ATOM   2550 C CZ    . TYR B 1 153 ? 0.959   101.495 48.357 1.00 21.85 ? 153  TYR B CZ    1 
ATOM   2551 O OH    . TYR B 1 153 ? 0.997   100.695 49.463 1.00 24.65 ? 153  TYR B OH    1 
ATOM   2552 N N     . ARG B 1 154 ? 0.641   106.646 47.434 1.00 25.89 ? 154  ARG B N     1 
ATOM   2553 C CA    . ARG B 1 154 ? 1.487   107.401 48.331 1.00 26.38 ? 154  ARG B CA    1 
ATOM   2554 C C     . ARG B 1 154 ? 2.105   106.509 49.381 1.00 26.16 ? 154  ARG B C     1 
ATOM   2555 O O     . ARG B 1 154 ? 1.494   106.232 50.408 1.00 25.41 ? 154  ARG B O     1 
ATOM   2556 C CB    . ARG B 1 154 ? 0.693   108.539 48.969 1.00 27.12 ? 154  ARG B CB    1 
ATOM   2557 C CG    . ARG B 1 154 ? 0.283   109.576 47.947 1.00 28.39 ? 154  ARG B CG    1 
ATOM   2558 C CD    . ARG B 1 154 ? -0.254  110.834 48.580 1.00 29.78 ? 154  ARG B CD    1 
ATOM   2559 N NE    . ARG B 1 154 ? 0.238   112.016 47.876 1.00 30.82 ? 154  ARG B NE    1 
ATOM   2560 C CZ    . ARG B 1 154 ? -0.405  112.622 46.886 1.00 32.10 ? 154  ARG B CZ    1 
ATOM   2561 N NH1   . ARG B 1 154 ? -1.579  112.179 46.464 1.00 34.74 ? 154  ARG B NH1   1 
ATOM   2562 N NH2   . ARG B 1 154 ? 0.143   113.659 46.292 1.00 34.99 ? 154  ARG B NH2   1 
ATOM   2563 N N     . MET B 1 155 ? 3.304   106.021 49.086 1.00 26.41 ? 155  MET B N     1 
ATOM   2564 C CA    . MET B 1 155 ? 4.025   105.154 50.001 1.00 28.13 ? 155  MET B CA    1 
ATOM   2565 C C     . MET B 1 155 ? 4.559   105.969 51.183 1.00 30.59 ? 155  MET B C     1 
ATOM   2566 O O     . MET B 1 155 ? 5.066   107.084 51.007 1.00 32.93 ? 155  MET B O     1 
ATOM   2567 C CB    . MET B 1 155 ? 5.172   104.473 49.267 1.00 27.04 ? 155  MET B CB    1 
ATOM   2568 C CG    . MET B 1 155 ? 5.890   103.432 50.088 1.00 24.54 ? 155  MET B CG    1 
ATOM   2569 S SD    . MET B 1 155 ? 6.951   102.462 49.060 1.00 25.16 ? 155  MET B SD    1 
ATOM   2570 C CE    . MET B 1 155 ? 5.802   101.559 48.141 1.00 25.69 ? 155  MET B CE    1 
ATOM   2571 N N     . LYS B 1 156 ? 4.452   105.422 52.386 1.00 30.59 ? 156  LYS B N     1 
ATOM   2572 C CA    . LYS B 1 156 ? 4.924   106.146 53.555 1.00 31.42 ? 156  LYS B CA    1 
ATOM   2573 C C     . LYS B 1 156 ? 6.366   105.765 53.926 1.00 30.95 ? 156  LYS B C     1 
ATOM   2574 O O     . LYS B 1 156 ? 7.134   106.599 54.417 1.00 31.15 ? 156  LYS B O     1 
ATOM   2575 C CB    . LYS B 1 156 ? 3.960   105.938 54.730 1.00 33.87 ? 156  LYS B CB    1 
ATOM   2576 C CG    . LYS B 1 156 ? 2.505   106.339 54.439 1.00 35.60 ? 156  LYS B CG    1 
ATOM   2577 C CD    . LYS B 1 156 ? 1.626   106.127 55.673 1.00 39.68 ? 156  LYS B CD    1 
ATOM   2578 C CE    . LYS B 1 156 ? 0.127   106.387 55.413 1.00 43.01 ? 156  LYS B CE    1 
ATOM   2579 N NZ    . LYS B 1 156 ? -0.627  105.289 54.691 1.00 43.25 ? 156  LYS B NZ    1 
ATOM   2580 N N     . VAL B 1 157 ? 6.753   104.523 53.650 1.00 29.49 ? 157  VAL B N     1 
ATOM   2581 C CA    . VAL B 1 157 ? 8.109   104.068 53.955 1.00 27.97 ? 157  VAL B CA    1 
ATOM   2582 C C     . VAL B 1 157 ? 8.723   103.314 52.792 1.00 26.94 ? 157  VAL B C     1 
ATOM   2583 O O     . VAL B 1 157 ? 8.397   102.149 52.564 1.00 27.75 ? 157  VAL B O     1 
ATOM   2584 C CB    . VAL B 1 157 ? 8.157   103.146 55.200 1.00 29.05 ? 157  VAL B CB    1 
ATOM   2585 C CG1   . VAL B 1 157 ? 9.547   102.516 55.335 1.00 28.06 ? 157  VAL B CG1   1 
ATOM   2586 C CG2   . VAL B 1 157 ? 7.815   103.942 56.463 1.00 29.03 ? 157  VAL B CG2   1 
ATOM   2587 N N     . PRO B 1 158 ? 9.553   103.995 51.983 1.00 25.97 ? 158  PRO B N     1 
ATOM   2588 C CA    . PRO B 1 158 ? 9.900   105.412 52.136 1.00 24.86 ? 158  PRO B CA    1 
ATOM   2589 C C     . PRO B 1 158 ? 8.773   106.339 51.637 1.00 24.31 ? 158  PRO B C     1 
ATOM   2590 O O     . PRO B 1 158 ? 7.880   105.916 50.908 1.00 23.17 ? 158  PRO B O     1 
ATOM   2591 C CB    . PRO B 1 158 ? 11.170  105.536 51.295 1.00 23.68 ? 158  PRO B CB    1 
ATOM   2592 C CG    . PRO B 1 158 ? 10.957  104.537 50.216 1.00 24.69 ? 158  PRO B CG    1 
ATOM   2593 C CD    . PRO B 1 158 ? 10.393  103.356 50.953 1.00 24.68 ? 158  PRO B CD    1 
ATOM   2594 N N     . LYS B 1 159 ? 8.789   107.590 52.072 1.00 24.62 ? 159  LYS B N     1 
ATOM   2595 C CA    . LYS B 1 159 ? 7.751   108.524 51.666 1.00 24.31 ? 159  LYS B CA    1 
ATOM   2596 C C     . LYS B 1 159 ? 7.986   108.867 50.221 1.00 21.98 ? 159  LYS B C     1 
ATOM   2597 O O     . LYS B 1 159 ? 8.654   109.839 49.913 1.00 23.06 ? 159  LYS B O     1 
ATOM   2598 C CB    . LYS B 1 159 ? 7.796   109.789 52.519 1.00 25.44 ? 159  LYS B CB    1 
ATOM   2599 C CG    . LYS B 1 159 ? 6.442   110.229 53.018 1.00 27.04 ? 159  LYS B CG    1 
ATOM   2600 C CD    . LYS B 1 159 ? 6.580   111.467 53.858 1.00 28.84 ? 159  LYS B CD    1 
ATOM   2601 C CE    . LYS B 1 159 ? 6.636   112.697 52.994 1.00 32.28 ? 159  LYS B CE    1 
ATOM   2602 N NZ    . LYS B 1 159 ? 5.254   113.059 52.562 1.00 33.62 ? 159  LYS B NZ    1 
ATOM   2603 N N     . ILE B 1 160 ? 7.398   108.079 49.337 1.00 20.53 ? 160  ILE B N     1 
ATOM   2604 C CA    . ILE B 1 160 ? 7.573   108.255 47.902 1.00 18.35 ? 160  ILE B CA    1 
ATOM   2605 C C     . ILE B 1 160 ? 6.226   108.151 47.231 1.00 17.68 ? 160  ILE B C     1 
ATOM   2606 O O     . ILE B 1 160 ? 5.355   107.432 47.705 1.00 18.55 ? 160  ILE B O     1 
ATOM   2607 C CB    . ILE B 1 160 ? 8.509   107.123 47.331 1.00 18.42 ? 160  ILE B CB    1 
ATOM   2608 C CG1   . ILE B 1 160 ? 9.936   107.264 47.885 1.00 16.33 ? 160  ILE B CG1   1 
ATOM   2609 C CG2   . ILE B 1 160 ? 8.491   107.086 45.804 1.00 15.95 ? 160  ILE B CG2   1 
ATOM   2610 C CD1   . ILE B 1 160 ? 10.621  108.585 47.609 1.00 15.82 ? 160  ILE B CD1   1 
ATOM   2611 N N     . VAL B 1 161 ? 6.033   108.905 46.160 1.00 17.36 ? 161  VAL B N     1 
ATOM   2612 C CA    . VAL B 1 161 ? 4.783   108.824 45.423 1.00 17.96 ? 161  VAL B CA    1 
ATOM   2613 C C     . VAL B 1 161 ? 5.008   108.021 44.133 1.00 17.92 ? 161  VAL B C     1 
ATOM   2614 O O     . VAL B 1 161 ? 5.953   108.266 43.387 1.00 18.26 ? 161  VAL B O     1 
ATOM   2615 C CB    . VAL B 1 161 ? 4.204   110.218 45.093 1.00 17.39 ? 161  VAL B CB    1 
ATOM   2616 C CG1   . VAL B 1 161 ? 2.880   110.077 44.362 1.00 14.16 ? 161  VAL B CG1   1 
ATOM   2617 C CG2   . VAL B 1 161 ? 3.987   110.983 46.369 1.00 18.21 ? 161  VAL B CG2   1 
ATOM   2618 N N     . LEU B 1 162 ? 4.173   107.016 43.913 1.00 17.87 ? 162  LEU B N     1 
ATOM   2619 C CA    . LEU B 1 162 ? 4.283   106.199 42.725 1.00 17.74 ? 162  LEU B CA    1 
ATOM   2620 C C     . LEU B 1 162 ? 3.025   106.385 41.880 1.00 17.17 ? 162  LEU B C     1 
ATOM   2621 O O     . LEU B 1 162 ? 1.929   106.480 42.410 1.00 16.71 ? 162  LEU B O     1 
ATOM   2622 C CB    . LEU B 1 162 ? 4.463   104.719 43.118 1.00 18.69 ? 162  LEU B CB    1 
ATOM   2623 C CG    . LEU B 1 162 ? 5.695   104.309 43.953 1.00 17.84 ? 162  LEU B CG    1 
ATOM   2624 C CD1   . LEU B 1 162 ? 5.366   104.264 45.441 1.00 16.81 ? 162  LEU B CD1   1 
ATOM   2625 C CD2   . LEU B 1 162 ? 6.193   102.947 43.504 1.00 17.38 ? 162  LEU B CD2   1 
ATOM   2626 N N     . LEU B 1 163 ? 3.205   106.541 40.578 1.00 17.30 ? 163  LEU B N     1 
ATOM   2627 C CA    . LEU B 1 163 ? 2.096   106.685 39.647 1.00 18.68 ? 163  LEU B CA    1 
ATOM   2628 C C     . LEU B 1 163 ? 2.108   105.361 38.899 1.00 19.64 ? 163  LEU B C     1 
ATOM   2629 O O     . LEU B 1 163 ? 3.057   105.040 38.177 1.00 19.84 ? 163  LEU B O     1 
ATOM   2630 C CB    . LEU B 1 163 ? 2.317   107.853 38.683 1.00 18.17 ? 163  LEU B CB    1 
ATOM   2631 C CG    . LEU B 1 163 ? 2.674   109.231 39.270 1.00 19.72 ? 163  LEU B CG    1 
ATOM   2632 C CD1   . LEU B 1 163 ? 2.791   110.221 38.120 1.00 20.58 ? 163  LEU B CD1   1 
ATOM   2633 C CD2   . LEU B 1 163 ? 1.650   109.722 40.279 1.00 17.42 ? 163  LEU B CD2   1 
ATOM   2634 N N     . ILE B 1 164 ? 1.061   104.580 39.116 1.00 20.83 ? 164  ILE B N     1 
ATOM   2635 C CA    . ILE B 1 164 ? 0.936   103.247 38.542 1.00 20.94 ? 164  ILE B CA    1 
ATOM   2636 C C     . ILE B 1 164 ? -0.104  103.210 37.423 1.00 22.22 ? 164  ILE B C     1 
ATOM   2637 O O     . ILE B 1 164 ? -1.222  103.722 37.563 1.00 22.89 ? 164  ILE B O     1 
ATOM   2638 C CB    . ILE B 1 164 ? 0.614   102.232 39.681 1.00 18.98 ? 164  ILE B CB    1 
ATOM   2639 C CG1   . ILE B 1 164 ? 1.722   102.301 40.741 1.00 16.75 ? 164  ILE B CG1   1 
ATOM   2640 C CG2   . ILE B 1 164 ? 0.469   100.821 39.139 1.00 16.82 ? 164  ILE B CG2   1 
ATOM   2641 C CD1   . ILE B 1 164 ? 1.295   101.881 42.081 1.00 16.46 ? 164  ILE B CD1   1 
ATOM   2642 N N     . PHE B 1 165 ? 0.287   102.597 36.313 1.00 22.59 ? 165  PHE B N     1 
ATOM   2643 C CA    . PHE B 1 165 ? -0.558  102.500 35.144 1.00 23.26 ? 165  PHE B CA    1 
ATOM   2644 C C     . PHE B 1 165 ? -0.929  101.056 34.772 1.00 24.99 ? 165  PHE B C     1 
ATOM   2645 O O     . PHE B 1 165 ? -0.211  100.095 35.114 1.00 24.30 ? 165  PHE B O     1 
ATOM   2646 C CB    . PHE B 1 165 ? 0.139   103.224 33.984 1.00 22.50 ? 165  PHE B CB    1 
ATOM   2647 C CG    . PHE B 1 165 ? 0.472   104.671 34.293 1.00 21.51 ? 165  PHE B CG    1 
ATOM   2648 C CD1   . PHE B 1 165 ? -0.463  105.679 34.064 1.00 21.27 ? 165  PHE B CD1   1 
ATOM   2649 C CD2   . PHE B 1 165 ? 1.687   105.009 34.875 1.00 19.83 ? 165  PHE B CD2   1 
ATOM   2650 C CE1   . PHE B 1 165 ? -0.196  106.991 34.416 1.00 22.19 ? 165  PHE B CE1   1 
ATOM   2651 C CE2   . PHE B 1 165 ? 1.968   106.310 35.235 1.00 18.95 ? 165  PHE B CE2   1 
ATOM   2652 C CZ    . PHE B 1 165 ? 1.030   107.310 35.009 1.00 21.99 ? 165  PHE B CZ    1 
ATOM   2653 N N     . VAL B 1 166 ? -2.066  100.923 34.086 1.00 25.76 ? 166  VAL B N     1 
ATOM   2654 C CA    . VAL B 1 166 ? -2.592  99.635  33.634 1.00 26.85 ? 166  VAL B CA    1 
ATOM   2655 C C     . VAL B 1 166 ? -1.584  98.905  32.763 1.00 27.83 ? 166  VAL B C     1 
ATOM   2656 O O     . VAL B 1 166 ? -1.529  97.673  32.755 1.00 28.97 ? 166  VAL B O     1 
ATOM   2657 C CB    . VAL B 1 166 ? -3.877  99.817  32.806 1.00 26.04 ? 166  VAL B CB    1 
ATOM   2658 C CG1   . VAL B 1 166 ? -4.380  98.475  32.311 1.00 25.91 ? 166  VAL B CG1   1 
ATOM   2659 C CG2   . VAL B 1 166 ? -4.937  100.489 33.634 1.00 26.11 ? 166  VAL B CG2   1 
ATOM   2660 N N     . SER B 1 167 ? -0.831  99.674  31.986 1.00 27.79 ? 167  SER B N     1 
ATOM   2661 C CA    . SER B 1 167 ? 0.191   99.128  31.108 1.00 28.32 ? 167  SER B CA    1 
ATOM   2662 C C     . SER B 1 167 ? 1.256   98.367  31.894 1.00 27.99 ? 167  SER B C     1 
ATOM   2663 O O     . SER B 1 167 ? 1.804   97.372  31.425 1.00 29.09 ? 167  SER B O     1 
ATOM   2664 C CB    . SER B 1 167 ? 0.860   100.271 30.354 1.00 28.25 ? 167  SER B CB    1 
ATOM   2665 O OG    . SER B 1 167 ? 1.368   101.226 31.269 1.00 28.69 ? 167  SER B OG    1 
ATOM   2666 N N     . GLY B 1 168 ? 1.511   98.814  33.113 1.00 27.54 ? 168  GLY B N     1 
ATOM   2667 C CA    . GLY B 1 168 ? 2.537   98.179  33.905 1.00 27.48 ? 168  GLY B CA    1 
ATOM   2668 C C     . GLY B 1 168 ? 3.707   99.125  34.059 1.00 26.14 ? 168  GLY B C     1 
ATOM   2669 O O     . GLY B 1 168 ? 4.706   98.752  34.670 1.00 26.45 ? 168  GLY B O     1 
ATOM   2670 N N     . LYS B 1 169 ? 3.616   100.302 33.432 1.00 24.59 ? 169  LYS B N     1 
ATOM   2671 C CA    . LYS B 1 169 ? 4.638   101.343 33.537 1.00 25.37 ? 169  LYS B CA    1 
ATOM   2672 C C     . LYS B 1 169 ? 4.451   102.018 34.898 1.00 24.87 ? 169  LYS B C     1 
ATOM   2673 O O     . LYS B 1 169 ? 3.323   102.137 35.389 1.00 26.43 ? 169  LYS B O     1 
ATOM   2674 C CB    . LYS B 1 169 ? 4.447   102.395 32.457 1.00 26.51 ? 169  LYS B CB    1 
ATOM   2675 C CG    . LYS B 1 169 ? 4.484   101.851 31.073 1.00 28.60 ? 169  LYS B CG    1 
ATOM   2676 C CD    . LYS B 1 169 ? 5.867   101.476 30.680 1.00 30.75 ? 169  LYS B CD    1 
ATOM   2677 C CE    . LYS B 1 169 ? 5.851   100.823 29.314 1.00 34.40 ? 169  LYS B CE    1 
ATOM   2678 N NZ    . LYS B 1 169 ? 5.054   99.543  29.338 1.00 38.37 ? 169  LYS B NZ    1 
ATOM   2679 N N     . ILE B 1 170 ? 5.539   102.499 35.486 1.00 23.40 ? 170  ILE B N     1 
ATOM   2680 C CA    . ILE B 1 170 ? 5.479   103.124 36.803 1.00 21.24 ? 170  ILE B CA    1 
ATOM   2681 C C     . ILE B 1 170 ? 6.377   104.357 36.856 1.00 18.99 ? 170  ILE B C     1 
ATOM   2682 O O     . ILE B 1 170 ? 7.434   104.368 36.250 1.00 18.28 ? 170  ILE B O     1 
ATOM   2683 C CB    . ILE B 1 170 ? 5.992   102.132 37.896 1.00 21.21 ? 170  ILE B CB    1 
ATOM   2684 C CG1   . ILE B 1 170 ? 5.202   100.833 37.857 1.00 22.21 ? 170  ILE B CG1   1 
ATOM   2685 C CG2   . ILE B 1 170 ? 5.841   102.710 39.283 1.00 20.92 ? 170  ILE B CG2   1 
ATOM   2686 C CD1   . ILE B 1 170 ? 5.759   99.805  38.798 1.00 26.25 ? 170  ILE B CD1   1 
ATOM   2687 N N     . VAL B 1 171 ? 5.922   105.405 37.533 1.00 17.34 ? 171  VAL B N     1 
ATOM   2688 C CA    . VAL B 1 171 ? 6.729   106.599 37.730 1.00 17.00 ? 171  VAL B CA    1 
ATOM   2689 C C     . VAL B 1 171 ? 6.907   106.666 39.245 1.00 17.13 ? 171  VAL B C     1 
ATOM   2690 O O     . VAL B 1 171 ? 5.987   106.400 40.000 1.00 17.38 ? 171  VAL B O     1 
ATOM   2691 C CB    . VAL B 1 171 ? 6.060   107.884 37.205 1.00 16.51 ? 171  VAL B CB    1 
ATOM   2692 C CG1   . VAL B 1 171 ? 6.882   109.084 37.587 1.00 14.74 ? 171  VAL B CG1   1 
ATOM   2693 C CG2   . VAL B 1 171 ? 5.959   107.839 35.706 1.00 16.64 ? 171  VAL B CG2   1 
ATOM   2694 N N     . ILE B 1 172 ? 8.129   106.906 39.685 1.00 18.16 ? 172  ILE B N     1 
ATOM   2695 C CA    . ILE B 1 172 ? 8.439   106.977 41.106 1.00 18.12 ? 172  ILE B CA    1 
ATOM   2696 C C     . ILE B 1 172 ? 9.058   108.351 41.316 1.00 17.80 ? 172  ILE B C     1 
ATOM   2697 O O     . ILE B 1 172 ? 10.088  108.656 40.727 1.00 18.78 ? 172  ILE B O     1 
ATOM   2698 C CB    . ILE B 1 172 ? 9.495   105.902 41.482 1.00 17.98 ? 172  ILE B CB    1 
ATOM   2699 C CG1   . ILE B 1 172 ? 9.093   104.545 40.914 1.00 15.89 ? 172  ILE B CG1   1 
ATOM   2700 C CG2   . ILE B 1 172 ? 9.648   105.825 42.995 1.00 16.08 ? 172  ILE B CG2   1 
ATOM   2701 C CD1   . ILE B 1 172 ? 10.255  103.798 40.323 1.00 16.73 ? 172  ILE B CD1   1 
ATOM   2702 N N     . THR B 1 173 ? 8.467   109.173 42.164 1.00 18.83 ? 173  THR B N     1 
ATOM   2703 C CA    . THR B 1 173 ? 9.024   110.502 42.363 1.00 19.33 ? 173  THR B CA    1 
ATOM   2704 C C     . THR B 1 173 ? 9.001   110.970 43.819 1.00 20.30 ? 173  THR B C     1 
ATOM   2705 O O     . THR B 1 173 ? 8.314   110.388 44.666 1.00 17.88 ? 173  THR B O     1 
ATOM   2706 C CB    . THR B 1 173 ? 8.303   111.513 41.442 1.00 20.42 ? 173  THR B CB    1 
ATOM   2707 O OG1   . THR B 1 173 ? 8.934   112.796 41.542 1.00 21.16 ? 173  THR B OG1   1 
ATOM   2708 C CG2   . THR B 1 173 ? 6.819   111.613 41.800 1.00 20.40 ? 173  THR B CG2   1 
ATOM   2709 N N     . GLY B 1 174 ? 9.776   112.005 44.120 1.00 20.74 ? 174  GLY B N     1 
ATOM   2710 C CA    . GLY B 1 174 ? 9.802   112.501 45.484 1.00 22.72 ? 174  GLY B CA    1 
ATOM   2711 C C     . GLY B 1 174 ? 11.018  112.083 46.282 1.00 23.63 ? 174  GLY B C     1 
ATOM   2712 O O     . GLY B 1 174 ? 11.169  112.485 47.437 1.00 25.47 ? 174  GLY B O     1 
ATOM   2713 N N     . ALA B 1 175 ? 11.914  111.318 45.664 1.00 23.11 ? 175  ALA B N     1 
ATOM   2714 C CA    . ALA B 1 175 ? 13.124  110.858 46.340 1.00 21.76 ? 175  ALA B CA    1 
ATOM   2715 C C     . ALA B 1 175 ? 14.233  111.896 46.382 1.00 21.50 ? 175  ALA B C     1 
ATOM   2716 O O     . ALA B 1 175 ? 14.385  112.698 45.466 1.00 22.35 ? 175  ALA B O     1 
ATOM   2717 C CB    . ALA B 1 175 ? 13.642  109.581 45.690 1.00 20.73 ? 175  ALA B CB    1 
ATOM   2718 N N     . LYS B 1 176 ? 14.986  111.877 47.474 1.00 23.42 ? 176  LYS B N     1 
ATOM   2719 C CA    . LYS B 1 176 ? 16.133  112.762 47.685 1.00 24.11 ? 176  LYS B CA    1 
ATOM   2720 C C     . LYS B 1 176 ? 17.392  111.905 47.498 1.00 24.63 ? 176  LYS B C     1 
ATOM   2721 O O     . LYS B 1 176 ? 18.508  112.425 47.403 1.00 24.40 ? 176  LYS B O     1 
ATOM   2722 C CB    . LYS B 1 176 ? 16.139  113.301 49.120 1.00 24.31 ? 176  LYS B CB    1 
ATOM   2723 C CG    . LYS B 1 176 ? 14.955  114.147 49.522 1.00 23.62 ? 176  LYS B CG    1 
ATOM   2724 C CD    . LYS B 1 176 ? 15.127  115.583 49.108 1.00 24.64 ? 176  LYS B CD    1 
ATOM   2725 C CE    . LYS B 1 176 ? 13.956  116.414 49.609 1.00 26.98 ? 176  LYS B CE    1 
ATOM   2726 N NZ    . LYS B 1 176 ? 13.883  117.751 48.961 1.00 29.21 ? 176  LYS B NZ    1 
ATOM   2727 N N     . MET B 1 177 ? 17.205  110.587 47.478 1.00 23.93 ? 177  MET B N     1 
ATOM   2728 C CA    . MET B 1 177 ? 18.302  109.646 47.320 1.00 23.59 ? 177  MET B CA    1 
ATOM   2729 C C     . MET B 1 177 ? 17.776  108.582 46.410 1.00 22.72 ? 177  MET B C     1 
ATOM   2730 O O     . MET B 1 177 ? 16.658  108.121 46.618 1.00 23.44 ? 177  MET B O     1 
ATOM   2731 C CB    . MET B 1 177 ? 18.622  109.001 48.653 1.00 27.11 ? 177  MET B CB    1 
ATOM   2732 C CG    . MET B 1 177 ? 18.692  109.973 49.786 1.00 32.19 ? 177  MET B CG    1 
ATOM   2733 S SD    . MET B 1 177 ? 20.350  110.070 50.341 1.00 41.53 ? 177  MET B SD    1 
ATOM   2734 C CE    . MET B 1 177 ? 21.101  111.068 49.020 1.00 36.35 ? 177  MET B CE    1 
ATOM   2735 N N     . ARG B 1 178 ? 18.581  108.143 45.444 1.00 21.34 ? 178  ARG B N     1 
ATOM   2736 C CA    . ARG B 1 178 ? 18.138  107.121 44.500 1.00 20.92 ? 178  ARG B CA    1 
ATOM   2737 C C     . ARG B 1 178 ? 17.740  105.801 45.168 1.00 20.90 ? 178  ARG B C     1 
ATOM   2738 O O     . ARG B 1 178 ? 16.944  105.035 44.631 1.00 21.04 ? 178  ARG B O     1 
ATOM   2739 C CB    . ARG B 1 178 ? 19.195  106.883 43.438 1.00 19.81 ? 178  ARG B CB    1 
ATOM   2740 C CG    . ARG B 1 178 ? 20.444  106.236 43.968 1.00 20.28 ? 178  ARG B CG    1 
ATOM   2741 C CD    . ARG B 1 178 ? 21.245  105.676 42.837 1.00 20.99 ? 178  ARG B CD    1 
ATOM   2742 N NE    . ARG B 1 178 ? 21.661  106.717 41.905 1.00 21.97 ? 178  ARG B NE    1 
ATOM   2743 C CZ    . ARG B 1 178 ? 22.145  106.475 40.695 1.00 21.35 ? 178  ARG B CZ    1 
ATOM   2744 N NH1   . ARG B 1 178 ? 22.270  105.232 40.272 1.00 21.63 ? 178  ARG B NH1   1 
ATOM   2745 N NH2   . ARG B 1 178 ? 22.532  107.473 39.922 1.00 23.11 ? 178  ARG B NH2   1 
ATOM   2746 N N     . ASP B 1 179 ? 18.283  105.542 46.349 1.00 22.25 ? 179  ASP B N     1 
ATOM   2747 C CA    . ASP B 1 179 ? 17.963  104.334 47.086 1.00 23.16 ? 179  ASP B CA    1 
ATOM   2748 C C     . ASP B 1 179 ? 16.493  104.284 47.495 1.00 23.22 ? 179  ASP B C     1 
ATOM   2749 O O     . ASP B 1 179 ? 15.935  103.202 47.673 1.00 24.28 ? 179  ASP B O     1 
ATOM   2750 C CB    . ASP B 1 179 ? 18.844  104.220 48.325 1.00 24.31 ? 179  ASP B CB    1 
ATOM   2751 C CG    . ASP B 1 179 ? 20.236  103.705 48.014 1.00 28.44 ? 179  ASP B CG    1 
ATOM   2752 O OD1   . ASP B 1 179 ? 20.466  103.132 46.911 1.00 27.34 ? 179  ASP B OD1   1 
ATOM   2753 O OD2   . ASP B 1 179 ? 21.110  103.873 48.901 1.00 31.88 ? 179  ASP B OD2   1 
ATOM   2754 N N     . GLU B 1 180 ? 15.872  105.450 47.657 1.00 23.30 ? 180  GLU B N     1 
ATOM   2755 C CA    . GLU B 1 180 ? 14.454  105.522 48.034 1.00 21.95 ? 180  GLU B CA    1 
ATOM   2756 C C     . GLU B 1 180 ? 13.603  105.148 46.834 1.00 20.35 ? 180  GLU B C     1 
ATOM   2757 O O     . GLU B 1 180 ? 12.550  104.532 46.973 1.00 21.47 ? 180  GLU B O     1 
ATOM   2758 C CB    . GLU B 1 180 ? 14.099  106.916 48.520 1.00 22.49 ? 180  GLU B CB    1 
ATOM   2759 C CG    . GLU B 1 180 ? 14.793  107.324 49.788 1.00 24.15 ? 180  GLU B CG    1 
ATOM   2760 C CD    . GLU B 1 180 ? 14.609  108.806 50.079 1.00 28.27 ? 180  GLU B CD    1 
ATOM   2761 O OE1   . GLU B 1 180 ? 13.521  109.345 49.792 1.00 32.50 ? 180  GLU B OE1   1 
ATOM   2762 O OE2   . GLU B 1 180 ? 15.545  109.445 50.596 1.00 31.91 ? 180  GLU B OE2   1 
ATOM   2763 N N     . THR B 1 181 ? 14.102  105.506 45.654 1.00 20.81 ? 181  THR B N     1 
ATOM   2764 C CA    . THR B 1 181 ? 13.480  105.202 44.365 1.00 18.66 ? 181  THR B CA    1 
ATOM   2765 C C     . THR B 1 181 ? 13.465  103.682 44.221 1.00 19.52 ? 181  THR B C     1 
ATOM   2766 O O     . THR B 1 181 ? 12.469  103.076 43.821 1.00 19.04 ? 181  THR B O     1 
ATOM   2767 C CB    . THR B 1 181 ? 14.346  105.781 43.215 1.00 16.43 ? 181  THR B CB    1 
ATOM   2768 O OG1   . THR B 1 181 ? 14.418  107.201 43.346 1.00 16.79 ? 181  THR B OG1   1 
ATOM   2769 C CG2   . THR B 1 181 ? 13.778  105.432 41.865 1.00 14.32 ? 181  THR B CG2   1 
ATOM   2770 N N     . TYR B 1 182 ? 14.594  103.081 44.575 1.00 21.05 ? 182  TYR B N     1 
ATOM   2771 C CA    . TYR B 1 182 ? 14.785  101.643 44.499 1.00 21.41 ? 182  TYR B CA    1 
ATOM   2772 C C     . TYR B 1 182 ? 13.962  100.896 45.524 1.00 21.23 ? 182  TYR B C     1 
ATOM   2773 O O     . TYR B 1 182 ? 13.343  99.886  45.205 1.00 22.46 ? 182  TYR B O     1 
ATOM   2774 C CB    . TYR B 1 182 ? 16.267  101.314 44.677 1.00 22.02 ? 182  TYR B CB    1 
ATOM   2775 C CG    . TYR B 1 182 ? 17.155  101.857 43.586 1.00 22.10 ? 182  TYR B CG    1 
ATOM   2776 C CD1   . TYR B 1 182 ? 16.616  102.310 42.372 1.00 22.50 ? 182  TYR B CD1   1 
ATOM   2777 C CD2   . TYR B 1 182 ? 18.529  101.927 43.758 1.00 22.32 ? 182  TYR B CD2   1 
ATOM   2778 C CE1   . TYR B 1 182 ? 17.425  102.820 41.360 1.00 21.66 ? 182  TYR B CE1   1 
ATOM   2779 C CE2   . TYR B 1 182 ? 19.349  102.436 42.745 1.00 22.81 ? 182  TYR B CE2   1 
ATOM   2780 C CZ    . TYR B 1 182 ? 18.788  102.881 41.553 1.00 21.72 ? 182  TYR B CZ    1 
ATOM   2781 O OH    . TYR B 1 182 ? 19.607  103.378 40.571 1.00 22.33 ? 182  TYR B OH    1 
ATOM   2782 N N     . LYS B 1 183 ? 13.985  101.376 46.761 1.00 22.15 ? 183  LYS B N     1 
ATOM   2783 C CA    . LYS B 1 183 ? 13.228  100.758 47.843 1.00 24.00 ? 183  LYS B CA    1 
ATOM   2784 C C     . LYS B 1 183 ? 11.728  100.866 47.567 1.00 24.78 ? 183  LYS B C     1 
ATOM   2785 O O     . LYS B 1 183 ? 10.978  99.903  47.746 1.00 26.51 ? 183  LYS B O     1 
ATOM   2786 C CB    . LYS B 1 183 ? 13.558  101.438 49.173 1.00 23.80 ? 183  LYS B CB    1 
ATOM   2787 C CG    . LYS B 1 183 ? 12.915  100.794 50.380 1.00 24.77 ? 183  LYS B CG    1 
ATOM   2788 C CD    . LYS B 1 183 ? 13.377  99.369  50.509 1.00 29.16 ? 183  LYS B CD    1 
ATOM   2789 C CE    . LYS B 1 183 ? 12.763  98.707  51.722 1.00 34.08 ? 183  LYS B CE    1 
ATOM   2790 N NZ    . LYS B 1 183 ? 13.113  97.255  51.778 1.00 36.63 ? 183  LYS B NZ    1 
ATOM   2791 N N     . ALA B 1 184 ? 11.289  102.042 47.138 1.00 24.13 ? 184  ALA B N     1 
ATOM   2792 C CA    . ALA B 1 184 ? 9.880   102.250 46.836 1.00 23.51 ? 184  ALA B CA    1 
ATOM   2793 C C     . ALA B 1 184 ? 9.414   101.210 45.813 1.00 22.85 ? 184  ALA B C     1 
ATOM   2794 O O     . ALA B 1 184 ? 8.443   100.499 46.052 1.00 24.01 ? 184  ALA B O     1 
ATOM   2795 C CB    . ALA B 1 184 ? 9.663   103.666 46.316 1.00 24.20 ? 184  ALA B CB    1 
ATOM   2796 N N     . PHE B 1 185 ? 10.127  101.084 44.696 1.00 22.10 ? 185  PHE B N     1 
ATOM   2797 C CA    . PHE B 1 185 ? 9.755   100.102 43.686 1.00 21.32 ? 185  PHE B CA    1 
ATOM   2798 C C     . PHE B 1 185 ? 9.784   98.678  44.223 1.00 21.03 ? 185  PHE B C     1 
ATOM   2799 O O     . PHE B 1 185 ? 8.896   97.880  43.932 1.00 21.15 ? 185  PHE B O     1 
ATOM   2800 C CB    . PHE B 1 185 ? 10.673  100.171 42.469 1.00 20.44 ? 185  PHE B CB    1 
ATOM   2801 C CG    . PHE B 1 185 ? 10.423  99.058  41.471 1.00 21.23 ? 185  PHE B CG    1 
ATOM   2802 C CD1   . PHE B 1 185 ? 9.230   98.998  40.761 1.00 21.42 ? 185  PHE B CD1   1 
ATOM   2803 C CD2   . PHE B 1 185 ? 11.352  98.035  41.292 1.00 21.26 ? 185  PHE B CD2   1 
ATOM   2804 C CE1   . PHE B 1 185 ? 8.961   97.926  39.889 1.00 21.43 ? 185  PHE B CE1   1 
ATOM   2805 C CE2   . PHE B 1 185 ? 11.092  96.961  40.426 1.00 20.56 ? 185  PHE B CE2   1 
ATOM   2806 C CZ    . PHE B 1 185 ? 9.898   96.908  39.729 1.00 20.42 ? 185  PHE B CZ    1 
ATOM   2807 N N     . GLU B 1 186 ? 10.832  98.347  44.966 1.00 20.81 ? 186  GLU B N     1 
ATOM   2808 C CA    . GLU B 1 186 ? 10.978  97.008  45.509 1.00 21.32 ? 186  GLU B CA    1 
ATOM   2809 C C     . GLU B 1 186 ? 9.856   96.669  46.495 1.00 21.85 ? 186  GLU B C     1 
ATOM   2810 O O     . GLU B 1 186 ? 9.462   95.500  46.627 1.00 22.38 ? 186  GLU B O     1 
ATOM   2811 C CB    . GLU B 1 186 ? 12.372  96.835  46.127 1.00 20.71 ? 186  GLU B CB    1 
ATOM   2812 C CG    . GLU B 1 186 ? 13.503  96.854  45.104 1.00 20.09 ? 186  GLU B CG    1 
ATOM   2813 C CD    . GLU B 1 186 ? 13.410  95.734  44.070 1.00 20.86 ? 186  GLU B CD    1 
ATOM   2814 O OE1   . GLU B 1 186 ? 12.830  94.674  44.359 1.00 25.41 ? 186  GLU B OE1   1 
ATOM   2815 O OE2   . GLU B 1 186 ? 13.931  95.899  42.954 1.00 21.88 ? 186  GLU B OE2   1 
ATOM   2816 N N     . ASN B 1 187 ? 9.331   97.695  47.162 1.00 21.14 ? 187  ASN B N     1 
ATOM   2817 C CA    . ASN B 1 187 ? 8.219   97.530  48.088 1.00 20.71 ? 187  ASN B CA    1 
ATOM   2818 C C     . ASN B 1 187 ? 6.907   97.320  47.325 1.00 20.72 ? 187  ASN B C     1 
ATOM   2819 O O     . ASN B 1 187 ? 6.051   96.544  47.748 1.00 23.93 ? 187  ASN B O     1 
ATOM   2820 C CB    . ASN B 1 187 ? 8.045   98.771  48.960 1.00 21.36 ? 187  ASN B CB    1 
ATOM   2821 C CG    . ASN B 1 187 ? 9.146   98.940  49.969 1.00 21.63 ? 187  ASN B CG    1 
ATOM   2822 O OD1   . ASN B 1 187 ? 10.001  98.078  50.122 1.00 23.93 ? 187  ASN B OD1   1 
ATOM   2823 N ND2   . ASN B 1 187 ? 9.119   100.054 50.687 1.00 22.69 ? 187  ASN B ND2   1 
ATOM   2824 N N     . ILE B 1 188 ? 6.737   98.020  46.210 1.00 20.51 ? 188  ILE B N     1 
ATOM   2825 C CA    . ILE B 1 188 ? 5.506   97.928  45.440 1.00 20.39 ? 188  ILE B CA    1 
ATOM   2826 C C     . ILE B 1 188 ? 5.425   96.726  44.495 1.00 21.77 ? 188  ILE B C     1 
ATOM   2827 O O     . ILE B 1 188 ? 4.336   96.231  44.198 1.00 23.06 ? 188  ILE B O     1 
ATOM   2828 C CB    . ILE B 1 188 ? 5.258   99.247  44.651 1.00 19.48 ? 188  ILE B CB    1 
ATOM   2829 C CG1   . ILE B 1 188 ? 3.763   99.503  44.486 1.00 18.87 ? 188  ILE B CG1   1 
ATOM   2830 C CG2   . ILE B 1 188 ? 5.863   99.166  43.263 1.00 18.35 ? 188  ILE B CG2   1 
ATOM   2831 C CD1   . ILE B 1 188 ? 3.032   99.690  45.774 1.00 19.19 ? 188  ILE B CD1   1 
ATOM   2832 N N     . TYR B 1 189 ? 6.565   96.240  44.025 1.00 22.22 ? 189  TYR B N     1 
ATOM   2833 C CA    . TYR B 1 189 ? 6.566   95.113  43.098 1.00 22.66 ? 189  TYR B CA    1 
ATOM   2834 C C     . TYR B 1 189 ? 5.784   93.867  43.571 1.00 23.34 ? 189  TYR B C     1 
ATOM   2835 O O     . TYR B 1 189 ? 4.930   93.356  42.845 1.00 22.95 ? 189  TYR B O     1 
ATOM   2836 C CB    . TYR B 1 189 ? 8.000   94.769  42.714 1.00 22.06 ? 189  TYR B CB    1 
ATOM   2837 C CG    . TYR B 1 189 ? 8.119   93.739  41.625 1.00 22.01 ? 189  TYR B CG    1 
ATOM   2838 C CD1   . TYR B 1 189 ? 7.514   93.930  40.381 1.00 22.03 ? 189  TYR B CD1   1 
ATOM   2839 C CD2   . TYR B 1 189 ? 8.878   92.587  41.821 1.00 21.46 ? 189  TYR B CD2   1 
ATOM   2840 C CE1   . TYR B 1 189 ? 7.672   93.002  39.358 1.00 21.14 ? 189  TYR B CE1   1 
ATOM   2841 C CE2   . TYR B 1 189 ? 9.041   91.658  40.803 1.00 21.39 ? 189  TYR B CE2   1 
ATOM   2842 C CZ    . TYR B 1 189 ? 8.440   91.877  39.585 1.00 21.25 ? 189  TYR B CZ    1 
ATOM   2843 O OH    . TYR B 1 189 ? 8.645   90.981  38.584 1.00 24.37 ? 189  TYR B OH    1 
ATOM   2844 N N     . PRO B 1 190 ? 6.068   93.351  44.781 1.00 23.80 ? 190  PRO B N     1 
ATOM   2845 C CA    . PRO B 1 190 ? 5.309   92.175  45.210 1.00 24.71 ? 190  PRO B CA    1 
ATOM   2846 C C     . PRO B 1 190 ? 3.817   92.470  45.452 1.00 26.75 ? 190  PRO B C     1 
ATOM   2847 O O     . PRO B 1 190 ? 3.004   91.556  45.575 1.00 28.13 ? 190  PRO B O     1 
ATOM   2848 C CB    . PRO B 1 190 ? 6.041   91.752  46.484 1.00 23.00 ? 190  PRO B CB    1 
ATOM   2849 C CG    . PRO B 1 190 ? 6.583   93.021  47.003 1.00 22.59 ? 190  PRO B CG    1 
ATOM   2850 C CD    . PRO B 1 190 ? 7.120   93.665  45.762 1.00 22.47 ? 190  PRO B CD    1 
ATOM   2851 N N     . VAL B 1 191 ? 3.456   93.746  45.531 1.00 28.25 ? 191  VAL B N     1 
ATOM   2852 C CA    . VAL B 1 191 ? 2.058   94.131  45.727 1.00 27.21 ? 191  VAL B CA    1 
ATOM   2853 C C     . VAL B 1 191 ? 1.383   94.058  44.368 1.00 27.11 ? 191  VAL B C     1 
ATOM   2854 O O     . VAL B 1 191 ? 0.315   93.484  44.217 1.00 27.91 ? 191  VAL B O     1 
ATOM   2855 C CB    . VAL B 1 191 ? 1.921   95.603  46.245 1.00 27.91 ? 191  VAL B CB    1 
ATOM   2856 C CG1   . VAL B 1 191 ? 0.456   96.054  46.200 1.00 28.55 ? 191  VAL B CG1   1 
ATOM   2857 C CG2   . VAL B 1 191 ? 2.472   95.744  47.657 1.00 26.14 ? 191  VAL B CG2   1 
ATOM   2858 N N     . LEU B 1 192 ? 2.038   94.645  43.377 1.00 27.16 ? 192  LEU B N     1 
ATOM   2859 C CA    . LEU B 1 192 ? 1.526   94.707  42.017 1.00 25.81 ? 192  LEU B CA    1 
ATOM   2860 C C     . LEU B 1 192 ? 1.342   93.354  41.373 1.00 27.45 ? 192  LEU B C     1 
ATOM   2861 O O     . LEU B 1 192 ? 0.438   93.185  40.555 1.00 28.05 ? 192  LEU B O     1 
ATOM   2862 C CB    . LEU B 1 192 ? 2.440   95.573  41.144 1.00 23.44 ? 192  LEU B CB    1 
ATOM   2863 C CG    . LEU B 1 192 ? 2.651   97.017  41.604 1.00 21.20 ? 192  LEU B CG    1 
ATOM   2864 C CD1   . LEU B 1 192 ? 3.460   97.760  40.580 1.00 19.35 ? 192  LEU B CD1   1 
ATOM   2865 C CD2   . LEU B 1 192 ? 1.320   97.696  41.802 1.00 20.98 ? 192  LEU B CD2   1 
ATOM   2866 N N     . SER B 1 193 ? 2.214   92.401  41.689 1.00 28.49 ? 193  SER B N     1 
ATOM   2867 C CA    . SER B 1 193 ? 2.086   91.072  41.100 1.00 30.31 ? 193  SER B CA    1 
ATOM   2868 C C     . SER B 1 193 ? 0.798   90.414  41.580 1.00 30.68 ? 193  SER B C     1 
ATOM   2869 O O     . SER B 1 193 ? 0.270   89.513  40.927 1.00 31.83 ? 193  SER B O     1 
ATOM   2870 C CB    . SER B 1 193 ? 3.292   90.191  41.433 1.00 29.72 ? 193  SER B CB    1 
ATOM   2871 O OG    . SER B 1 193 ? 3.325   89.887  42.809 1.00 32.59 ? 193  SER B OG    1 
ATOM   2872 N N     . GLU B 1 194 ? 0.278   90.889  42.709 1.00 31.44 ? 194  GLU B N     1 
ATOM   2873 C CA    . GLU B 1 194 ? -0.954  90.357  43.260 1.00 31.87 ? 194  GLU B CA    1 
ATOM   2874 C C     . GLU B 1 194 ? -2.178  90.863  42.505 1.00 32.08 ? 194  GLU B C     1 
ATOM   2875 O O     . GLU B 1 194 ? -3.250  90.255  42.577 1.00 33.09 ? 194  GLU B O     1 
ATOM   2876 C CB    . GLU B 1 194 ? -1.074  90.710  44.727 1.00 34.02 ? 194  GLU B CB    1 
ATOM   2877 C CG    . GLU B 1 194 ? -2.188  89.955  45.425 1.00 39.67 ? 194  GLU B CG    1 
ATOM   2878 C CD    . GLU B 1 194 ? -2.292  90.310  46.889 1.00 42.62 ? 194  GLU B CD    1 
ATOM   2879 O OE1   . GLU B 1 194 ? -1.261  90.220  47.594 1.00 44.39 ? 194  GLU B OE1   1 
ATOM   2880 O OE2   . GLU B 1 194 ? -3.399  90.689  47.331 1.00 45.51 ? 194  GLU B OE2   1 
ATOM   2881 N N     . PHE B 1 195 ? -2.018  91.970  41.781 1.00 30.73 ? 195  PHE B N     1 
ATOM   2882 C CA    . PHE B 1 195 ? -3.103  92.554  41.002 1.00 29.19 ? 195  PHE B CA    1 
ATOM   2883 C C     . PHE B 1 195 ? -2.787  92.608  39.507 1.00 31.45 ? 195  PHE B C     1 
ATOM   2884 O O     . PHE B 1 195 ? -3.078  93.588  38.829 1.00 31.72 ? 195  PHE B O     1 
ATOM   2885 C CB    . PHE B 1 195 ? -3.444  93.936  41.537 1.00 25.82 ? 195  PHE B CB    1 
ATOM   2886 C CG    . PHE B 1 195 ? -3.758  93.941  42.991 1.00 23.07 ? 195  PHE B CG    1 
ATOM   2887 C CD1   . PHE B 1 195 ? -4.964  93.455  43.448 1.00 23.87 ? 195  PHE B CD1   1 
ATOM   2888 C CD2   . PHE B 1 195 ? -2.814  94.361  43.918 1.00 23.97 ? 195  PHE B CD2   1 
ATOM   2889 C CE1   . PHE B 1 195 ? -5.223  93.377  44.818 1.00 24.08 ? 195  PHE B CE1   1 
ATOM   2890 C CE2   . PHE B 1 195 ? -3.062  94.289  45.285 1.00 21.98 ? 195  PHE B CE2   1 
ATOM   2891 C CZ    . PHE B 1 195 ? -4.265  93.794  45.730 1.00 23.48 ? 195  PHE B CZ    1 
ATOM   2892 N N     . ARG B 1 196 ? -2.169  91.557  38.992 1.00 34.17 ? 196  ARG B N     1 
ATOM   2893 C CA    . ARG B 1 196 ? -1.866  91.512  37.577 1.00 38.21 ? 196  ARG B CA    1 
ATOM   2894 C C     . ARG B 1 196 ? -3.209  91.377  36.881 1.00 40.76 ? 196  ARG B C     1 
ATOM   2895 O O     . ARG B 1 196 ? -4.128  90.747  37.418 1.00 43.60 ? 196  ARG B O     1 
ATOM   2896 C CB    . ARG B 1 196 ? -1.001  90.302  37.242 1.00 39.53 ? 196  ARG B CB    1 
ATOM   2897 C CG    . ARG B 1 196 ? -0.593  90.254  35.788 1.00 41.26 ? 196  ARG B CG    1 
ATOM   2898 C CD    . ARG B 1 196 ? 0.224   89.020  35.461 1.00 42.81 ? 196  ARG B CD    1 
ATOM   2899 N NE    . ARG B 1 196 ? 0.769   89.114  34.108 1.00 45.31 ? 196  ARG B NE    1 
ATOM   2900 C CZ    . ARG B 1 196 ? 0.032   89.229  33.006 1.00 46.74 ? 196  ARG B CZ    1 
ATOM   2901 N NH1   . ARG B 1 196 ? -1.295  89.251  33.088 1.00 46.57 ? 196  ARG B NH1   1 
ATOM   2902 N NH2   . ARG B 1 196 ? 0.622   89.358  31.819 1.00 46.11 ? 196  ARG B NH2   1 
ATOM   2903 N N     . LYS B 1 197 ? -3.317  91.957  35.693 1.00 41.57 ? 197  LYS B N     1 
ATOM   2904 C CA    . LYS B 1 197 ? -4.545  91.925  34.913 1.00 41.78 ? 197  LYS B CA    1 
ATOM   2905 C C     . LYS B 1 197 ? -4.485  90.746  33.956 1.00 42.66 ? 197  LYS B C     1 
ATOM   2906 O O     . LYS B 1 197 ? -3.444  90.651  33.269 1.00 44.35 ? 197  LYS B O     1 
ATOM   2907 C CB    . LYS B 1 197 ? -4.692  93.230  34.129 1.00 40.87 ? 197  LYS B CB    1 
ATOM   2908 C CG    . LYS B 1 197 ? -6.050  93.443  33.533 1.00 42.17 ? 197  LYS B CG    1 
ATOM   2909 C CD    . LYS B 1 197 ? -6.140  94.782  32.829 1.00 43.67 ? 197  LYS B CD    1 
ATOM   2910 C CE    . LYS B 1 197 ? -5.263  94.814  31.596 1.00 45.47 ? 197  LYS B CE    1 
ATOM   2911 N NZ    . LYS B 1 197 ? -5.577  95.985  30.728 1.00 47.69 ? 197  LYS B NZ    1 
ATOM   2912 C "C4'" . DG  C 2 1   ? 9.125   56.599  59.401 1.00 58.97 ? 201  DG  C "C4'" 1 
ATOM   2913 O "O4'" . DG  C 2 1   ? 8.321   57.063  60.491 1.00 58.85 ? 201  DG  C "O4'" 1 
ATOM   2914 C "C3'" . DG  C 2 1   ? 8.796   57.568  58.284 1.00 59.63 ? 201  DG  C "C3'" 1 
ATOM   2915 O "O3'" . DG  C 2 1   ? 9.146   57.008  57.012 1.00 61.21 ? 201  DG  C "O3'" 1 
ATOM   2916 C "C2'" . DG  C 2 1   ? 7.288   57.699  58.497 1.00 57.80 ? 201  DG  C "C2'" 1 
ATOM   2917 C "C1'" . DG  C 2 1   ? 7.239   57.874  59.999 1.00 56.87 ? 201  DG  C "C1'" 1 
ATOM   2918 N N9    . DG  C 2 1   ? 7.420   59.297  60.367 1.00 54.89 ? 201  DG  C N9    1 
ATOM   2919 C C8    . DG  C 2 1   ? 8.463   59.888  61.036 1.00 53.89 ? 201  DG  C C8    1 
ATOM   2920 N N7    . DG  C 2 1   ? 8.321   61.172  61.211 1.00 53.69 ? 201  DG  C N7    1 
ATOM   2921 C C5    . DG  C 2 1   ? 7.097   61.460  60.616 1.00 53.42 ? 201  DG  C C5    1 
ATOM   2922 C C6    . DG  C 2 1   ? 6.415   62.699  60.493 1.00 52.32 ? 201  DG  C C6    1 
ATOM   2923 O O6    . DG  C 2 1   ? 6.772   63.807  60.885 1.00 51.76 ? 201  DG  C O6    1 
ATOM   2924 N N1    . DG  C 2 1   ? 5.209   62.556  59.825 1.00 51.55 ? 201  DG  C N1    1 
ATOM   2925 C C2    . DG  C 2 1   ? 4.716   61.368  59.333 1.00 52.51 ? 201  DG  C C2    1 
ATOM   2926 N N2    . DG  C 2 1   ? 3.537   61.422  58.720 1.00 52.75 ? 201  DG  C N2    1 
ATOM   2927 N N3    . DG  C 2 1   ? 5.355   60.197  59.444 1.00 53.11 ? 201  DG  C N3    1 
ATOM   2928 C C4    . DG  C 2 1   ? 6.537   60.319  60.096 1.00 53.81 ? 201  DG  C C4    1 
ATOM   2929 P P     . DC  C 2 2   ? 8.248   55.894  56.261 1.00 66.22 ? 202  DC  C P     1 
ATOM   2930 O OP1   . DC  C 2 2   ? 7.634   55.015  57.290 1.00 63.09 ? 202  DC  C OP1   1 
ATOM   2931 O OP2   . DC  C 2 2   ? 9.087   55.295  55.194 1.00 64.10 ? 202  DC  C OP2   1 
ATOM   2932 O "O5'" . DC  C 2 2   ? 7.076   56.797  55.548 1.00 63.01 ? 202  DC  C "O5'" 1 
ATOM   2933 C "C5'" . DC  C 2 2   ? 5.676   56.428  55.505 1.00 61.09 ? 202  DC  C "C5'" 1 
ATOM   2934 C "C4'" . DC  C 2 2   ? 4.717   57.649  55.456 1.00 59.06 ? 202  DC  C "C4'" 1 
ATOM   2935 O "O4'" . DC  C 2 2   ? 5.107   58.632  56.410 1.00 58.57 ? 202  DC  C "O4'" 1 
ATOM   2936 C "C3'" . DC  C 2 2   ? 4.761   58.375  54.114 1.00 58.23 ? 202  DC  C "C3'" 1 
ATOM   2937 O "O3'" . DC  C 2 2   ? 3.765   57.841  53.242 1.00 57.91 ? 202  DC  C "O3'" 1 
ATOM   2938 C "C2'" . DC  C 2 2   ? 4.407   59.826  54.455 1.00 57.18 ? 202  DC  C "C2'" 1 
ATOM   2939 C "C1'" . DC  C 2 2   ? 4.742   59.937  55.940 1.00 56.86 ? 202  DC  C "C1'" 1 
ATOM   2940 N N1    . DC  C 2 2   ? 5.816   60.925  56.252 1.00 54.63 ? 202  DC  C N1    1 
ATOM   2941 C C2    . DC  C 2 2   ? 5.491   62.274  56.257 1.00 53.70 ? 202  DC  C C2    1 
ATOM   2942 O O2    . DC  C 2 2   ? 4.364   62.654  55.948 1.00 53.95 ? 202  DC  C O2    1 
ATOM   2943 N N3    . DC  C 2 2   ? 6.451   63.168  56.611 1.00 53.12 ? 202  DC  C N3    1 
ATOM   2944 C C4    . DC  C 2 2   ? 7.685   62.765  56.946 1.00 54.04 ? 202  DC  C C4    1 
ATOM   2945 N N4    . DC  C 2 2   ? 8.593   63.672  57.311 1.00 54.86 ? 202  DC  C N4    1 
ATOM   2946 C C5    . DC  C 2 2   ? 8.040   61.379  56.937 1.00 54.02 ? 202  DC  C C5    1 
ATOM   2947 C C6    . DC  C 2 2   ? 7.073   60.505  56.584 1.00 54.19 ? 202  DC  C C6    1 
ATOM   2948 P P     . DT  C 2 3   ? 4.026   57.770  51.650 1.00 59.39 ? 203  DT  C P     1 
ATOM   2949 O OP1   . DT  C 2 3   ? 2.938   56.969  51.043 1.00 58.19 ? 203  DT  C OP1   1 
ATOM   2950 O OP2   . DT  C 2 3   ? 5.438   57.380  51.423 1.00 57.71 ? 203  DT  C OP2   1 
ATOM   2951 O "O5'" . DT  C 2 3   ? 3.855   59.307  51.185 1.00 55.71 ? 203  DT  C "O5'" 1 
ATOM   2952 C "C5'" . DT  C 2 3   ? 2.608   59.799  50.677 1.00 52.17 ? 203  DT  C "C5'" 1 
ATOM   2953 C "C4'" . DT  C 2 3   ? 2.603   61.316  50.607 1.00 47.82 ? 203  DT  C "C4'" 1 
ATOM   2954 O "O4'" . DT  C 2 3   ? 3.148   61.846  51.803 1.00 46.55 ? 203  DT  C "O4'" 1 
ATOM   2955 C "C3'" . DT  C 2 3   ? 3.560   61.804  49.562 1.00 46.66 ? 203  DT  C "C3'" 1 
ATOM   2956 O "O3'" . DT  C 2 3   ? 2.940   61.761  48.287 1.00 47.17 ? 203  DT  C "O3'" 1 
ATOM   2957 C "C2'" . DT  C 2 3   ? 3.796   63.230  50.003 1.00 44.47 ? 203  DT  C "C2'" 1 
ATOM   2958 C "C1'" . DT  C 2 3   ? 3.809   63.078  51.512 1.00 43.47 ? 203  DT  C "C1'" 1 
ATOM   2959 N N1    . DT  C 2 3   ? 5.158   63.030  52.101 1.00 41.71 ? 203  DT  C N1    1 
ATOM   2960 C C2    . DT  C 2 3   ? 5.623   64.166  52.739 1.00 40.52 ? 203  DT  C C2    1 
ATOM   2961 O O2    . DT  C 2 3   ? 5.002   65.227  52.791 1.00 39.82 ? 203  DT  C O2    1 
ATOM   2962 N N3    . DT  C 2 3   ? 6.859   64.049  53.319 1.00 39.25 ? 203  DT  C N3    1 
ATOM   2963 C C4    . DT  C 2 3   ? 7.664   62.944  53.329 1.00 38.88 ? 203  DT  C C4    1 
ATOM   2964 O O4    . DT  C 2 3   ? 8.747   62.985  53.906 1.00 38.59 ? 203  DT  C O4    1 
ATOM   2965 C C5    . DT  C 2 3   ? 7.106   61.812  52.637 1.00 39.48 ? 203  DT  C C5    1 
ATOM   2966 C C7    . DT  C 2 3   ? 7.888   60.514  52.557 1.00 41.53 ? 203  DT  C C7    1 
ATOM   2967 C C6    . DT  C 2 3   ? 5.902   61.886  52.059 1.00 40.41 ? 203  DT  C C6    1 
ATOM   2968 P P     . DA  C 2 4   ? 3.896   61.458  47.034 1.00 50.57 ? 204  DA  C P     1 
ATOM   2969 O OP1   . DA  C 2 4   ? 3.078   61.338  45.800 1.00 48.30 ? 204  DA  C OP1   1 
ATOM   2970 O OP2   . DA  C 2 4   ? 4.849   60.380  47.410 1.00 48.48 ? 204  DA  C OP2   1 
ATOM   2971 O "O5'" . DA  C 2 4   ? 4.695   62.851  46.984 1.00 46.23 ? 204  DA  C "O5'" 1 
ATOM   2972 C "C5'" . DA  C 2 4   ? 4.093   64.056  46.507 1.00 39.97 ? 204  DA  C "C5'" 1 
ATOM   2973 C "C4'" . DA  C 2 4   ? 5.184   65.028  46.137 1.00 35.37 ? 204  DA  C "C4'" 1 
ATOM   2974 O "O4'" . DA  C 2 4   ? 5.977   65.344  47.286 1.00 32.12 ? 204  DA  C "O4'" 1 
ATOM   2975 C "C3'" . DA  C 2 4   ? 6.106   64.316  45.167 1.00 33.43 ? 204  DA  C "C3'" 1 
ATOM   2976 O "O3'" . DA  C 2 4   ? 6.389   65.136  44.046 1.00 32.82 ? 204  DA  C "O3'" 1 
ATOM   2977 C "C2'" . DA  C 2 4   ? 7.346   63.984  45.989 1.00 31.84 ? 204  DA  C "C2'" 1 
ATOM   2978 C "C1'" . DA  C 2 4   ? 7.354   65.078  47.042 1.00 29.81 ? 204  DA  C "C1'" 1 
ATOM   2979 N N9    . DA  C 2 4   ? 7.983   64.604  48.296 1.00 27.82 ? 204  DA  C N9    1 
ATOM   2980 C C8    . DA  C 2 4   ? 7.630   63.542  49.079 1.00 27.02 ? 204  DA  C C8    1 
ATOM   2981 N N7    . DA  C 2 4   ? 8.370   63.395  50.140 1.00 26.01 ? 204  DA  C N7    1 
ATOM   2982 C C5    . DA  C 2 4   ? 9.281   64.432  50.057 1.00 25.28 ? 204  DA  C C5    1 
ATOM   2983 C C6    . DA  C 2 4   ? 10.332  64.836  50.884 1.00 25.21 ? 204  DA  C C6    1 
ATOM   2984 N N6    . DA  C 2 4   ? 10.667  64.207  52.012 1.00 25.75 ? 204  DA  C N6    1 
ATOM   2985 N N1    . DA  C 2 4   ? 11.026  65.915  50.504 1.00 25.08 ? 204  DA  C N1    1 
ATOM   2986 C C2    . DA  C 2 4   ? 10.700  66.540  49.391 1.00 24.29 ? 204  DA  C C2    1 
ATOM   2987 N N3    . DA  C 2 4   ? 9.741   66.263  48.532 1.00 25.72 ? 204  DA  C N3    1 
ATOM   2988 C C4    . DA  C 2 4   ? 9.056   65.175  48.936 1.00 26.20 ? 204  DA  C C4    1 
ATOM   2989 P P     . DT  C 2 5   ? 7.091   64.467  42.780 1.00 34.08 ? 205  DT  C P     1 
ATOM   2990 O OP1   . DT  C 2 5   ? 6.543   65.066  41.536 1.00 34.11 ? 205  DT  C OP1   1 
ATOM   2991 O OP2   . DT  C 2 5   ? 7.098   63.000  42.972 1.00 33.37 ? 205  DT  C OP2   1 
ATOM   2992 O "O5'" . DT  C 2 5   ? 8.584   64.994  42.955 1.00 31.85 ? 205  DT  C "O5'" 1 
ATOM   2993 C "C5'" . DT  C 2 5   ? 8.919   66.356  42.694 1.00 26.21 ? 205  DT  C "C5'" 1 
ATOM   2994 C "C4'" . DT  C 2 5   ? 10.381  66.541  42.959 1.00 23.41 ? 205  DT  C "C4'" 1 
ATOM   2995 O "O4'" . DT  C 2 5   ? 10.668  66.348  44.333 1.00 22.49 ? 205  DT  C "O4'" 1 
ATOM   2996 C "C3'" . DT  C 2 5   ? 11.087  65.377  42.331 1.00 22.78 ? 205  DT  C "C3'" 1 
ATOM   2997 O "O3'" . DT  C 2 5   ? 11.218  65.659  40.944 1.00 24.64 ? 205  DT  C "O3'" 1 
ATOM   2998 C "C2'" . DT  C 2 5   ? 12.410  65.330  43.095 1.00 22.03 ? 205  DT  C "C2'" 1 
ATOM   2999 C "C1'" . DT  C 2 5   ? 12.044  65.994  44.415 1.00 21.24 ? 205  DT  C "C1'" 1 
ATOM   3000 N N1    . DT  C 2 5   ? 12.253  65.167  45.615 1.00 20.22 ? 205  DT  C N1    1 
ATOM   3001 C C2    . DT  C 2 5   ? 13.160  65.636  46.533 1.00 19.96 ? 205  DT  C C2    1 
ATOM   3002 O O2    . DT  C 2 5   ? 13.849  66.633  46.340 1.00 19.35 ? 205  DT  C O2    1 
ATOM   3003 N N3    . DT  C 2 5   ? 13.292  64.898  47.684 1.00 20.94 ? 205  DT  C N3    1 
ATOM   3004 C C4    . DT  C 2 5   ? 12.620  63.744  48.003 1.00 20.81 ? 205  DT  C C4    1 
ATOM   3005 O O4    . DT  C 2 5   ? 12.817  63.195  49.090 1.00 20.85 ? 205  DT  C O4    1 
ATOM   3006 C C5    . DT  C 2 5   ? 11.702  63.317  46.981 1.00 20.73 ? 205  DT  C C5    1 
ATOM   3007 C C7    . DT  C 2 5   ? 10.900  62.046  47.190 1.00 21.71 ? 205  DT  C C7    1 
ATOM   3008 C C6    . DT  C 2 5   ? 11.546  64.022  45.844 1.00 20.59 ? 205  DT  C C6    1 
ATOM   3009 P P     . DA  C 2 6   ? 11.597  64.512  39.885 1.00 26.29 ? 206  DA  C P     1 
ATOM   3010 O OP1   . DA  C 2 6   ? 11.135  64.965  38.558 1.00 29.33 ? 206  DA  C OP1   1 
ATOM   3011 O OP2   . DA  C 2 6   ? 11.154  63.208  40.419 1.00 26.51 ? 206  DA  C OP2   1 
ATOM   3012 O "O5'" . DA  C 2 6   ? 13.193  64.500  39.868 1.00 24.23 ? 206  DA  C "O5'" 1 
ATOM   3013 C "C5'" . DA  C 2 6   ? 13.967  65.611  39.424 1.00 20.84 ? 206  DA  C "C5'" 1 
ATOM   3014 C "C4'" . DA  C 2 6   ? 15.367  65.451  39.932 1.00 18.69 ? 206  DA  C "C4'" 1 
ATOM   3015 O "O4'" . DA  C 2 6   ? 15.314  65.371  41.340 1.00 19.61 ? 206  DA  C "O4'" 1 
ATOM   3016 C "C3'" . DA  C 2 6   ? 15.871  64.090  39.516 1.00 20.08 ? 206  DA  C "C3'" 1 
ATOM   3017 O "O3'" . DA  C 2 6   ? 16.526  64.239  38.266 1.00 23.33 ? 206  DA  C "O3'" 1 
ATOM   3018 C "C2'" . DA  C 2 6   ? 16.849  63.708  40.615 1.00 17.46 ? 206  DA  C "C2'" 1 
ATOM   3019 C "C1'" . DA  C 2 6   ? 16.315  64.462  41.810 1.00 18.83 ? 206  DA  C "C1'" 1 
ATOM   3020 N N9    . DA  C 2 6   ? 15.741  63.583  42.846 1.00 16.96 ? 206  DA  C N9    1 
ATOM   3021 C C8    . DA  C 2 6   ? 14.785  62.609  42.734 1.00 16.46 ? 206  DA  C C8    1 
ATOM   3022 N N7    . DA  C 2 6   ? 14.487  62.038  43.869 1.00 17.50 ? 206  DA  C N7    1 
ATOM   3023 C C5    . DA  C 2 6   ? 15.305  62.679  44.799 1.00 16.92 ? 206  DA  C C5    1 
ATOM   3024 C C6    . DA  C 2 6   ? 15.471  62.535  46.178 1.00 16.79 ? 206  DA  C C6    1 
ATOM   3025 N N6    . DA  C 2 6   ? 14.794  61.648  46.898 1.00 19.78 ? 206  DA  C N6    1 
ATOM   3026 N N1    . DA  C 2 6   ? 16.360  63.329  46.787 1.00 16.95 ? 206  DA  C N1    1 
ATOM   3027 C C2    . DA  C 2 6   ? 17.037  64.209  46.072 1.00 16.70 ? 206  DA  C C2    1 
ATOM   3028 N N3    . DA  C 2 6   ? 16.975  64.441  44.774 1.00 17.76 ? 206  DA  C N3    1 
ATOM   3029 C C4    . DA  C 2 6   ? 16.070  63.623  44.186 1.00 17.09 ? 206  DA  C C4    1 
ATOM   3030 P P     . DT  C 2 7   ? 16.703  63.023  37.247 1.00 24.95 ? 207  DT  C P     1 
ATOM   3031 O OP1   . DT  C 2 7   ? 17.362  63.573  36.043 1.00 26.97 ? 207  DT  C OP1   1 
ATOM   3032 O OP2   . DT  C 2 7   ? 15.413  62.303  37.141 1.00 25.33 ? 207  DT  C OP2   1 
ATOM   3033 O "O5'" . DT  C 2 7   ? 17.748  62.042  37.973 1.00 25.18 ? 207  DT  C "O5'" 1 
ATOM   3034 C "C5'" . DT  C 2 7   ? 19.151  62.292  37.985 1.00 23.17 ? 207  DT  C "C5'" 1 
ATOM   3035 C "C4'" . DT  C 2 7   ? 19.823  61.359  38.970 1.00 24.65 ? 207  DT  C "C4'" 1 
ATOM   3036 O "O4'" . DT  C 2 7   ? 19.312  61.553  40.283 1.00 25.76 ? 207  DT  C "O4'" 1 
ATOM   3037 C "C3'" . DT  C 2 7   ? 19.435  59.915  38.696 1.00 25.24 ? 207  DT  C "C3'" 1 
ATOM   3038 O "O3'" . DT  C 2 7   ? 20.218  59.444  37.605 1.00 28.06 ? 207  DT  C "O3'" 1 
ATOM   3039 C "C2'" . DT  C 2 7   ? 19.877  59.263  40.006 1.00 24.09 ? 207  DT  C "C2'" 1 
ATOM   3040 C "C1'" . DT  C 2 7   ? 19.635  60.379  41.026 1.00 23.33 ? 207  DT  C "C1'" 1 
ATOM   3041 N N1    . DT  C 2 7   ? 18.537  60.054  41.939 1.00 22.58 ? 207  DT  C N1    1 
ATOM   3042 C C2    . DT  C 2 7   ? 18.752  60.285  43.275 1.00 23.32 ? 207  DT  C C2    1 
ATOM   3043 O O2    . DT  C 2 7   ? 19.788  60.792  43.700 1.00 25.70 ? 207  DT  C O2    1 
ATOM   3044 N N3    . DT  C 2 7   ? 17.722  59.942  44.119 1.00 22.77 ? 207  DT  C N3    1 
ATOM   3045 C C4    . DT  C 2 7   ? 16.509  59.400  43.753 1.00 22.91 ? 207  DT  C C4    1 
ATOM   3046 O O4    . DT  C 2 7   ? 15.682  59.110  44.617 1.00 23.49 ? 207  DT  C O4    1 
ATOM   3047 C C5    . DT  C 2 7   ? 16.365  59.202  42.324 1.00 22.63 ? 207  DT  C C5    1 
ATOM   3048 C C7    . DT  C 2 7   ? 15.068  58.638  41.750 1.00 21.43 ? 207  DT  C C7    1 
ATOM   3049 C C6    . DT  C 2 7   ? 17.363  59.526  41.484 1.00 22.28 ? 207  DT  C C6    1 
ATOM   3050 P P     . DA  C 2 8   ? 19.777  58.232  36.655 1.00 29.53 ? 208  DA  C P     1 
ATOM   3051 O OP1   . DA  C 2 8   ? 20.038  58.645  35.259 1.00 30.42 ? 208  DA  C OP1   1 
ATOM   3052 O OP2   . DA  C 2 8   ? 18.431  57.762  37.057 1.00 27.84 ? 208  DA  C OP2   1 
ATOM   3053 O "O5'" . DA  C 2 8   ? 20.841  57.112  37.065 1.00 29.03 ? 208  DA  C "O5'" 1 
ATOM   3054 C "C5'" . DA  C 2 8   ? 22.242  57.385  37.054 1.00 27.76 ? 208  DA  C "C5'" 1 
ATOM   3055 C "C4'" . DA  C 2 8   ? 22.941  56.591  38.147 1.00 26.21 ? 208  DA  C "C4'" 1 
ATOM   3056 O "O4'" . DA  C 2 8   ? 22.499  57.011  39.425 1.00 25.51 ? 208  DA  C "O4'" 1 
ATOM   3057 C "C3'" . DA  C 2 8   ? 22.558  55.130  38.047 1.00 26.68 ? 208  DA  C "C3'" 1 
ATOM   3058 O "O3'" . DA  C 2 8   ? 23.520  54.500  37.201 1.00 25.67 ? 208  DA  C "O3'" 1 
ATOM   3059 C "C2'" . DA  C 2 8   ? 22.695  54.664  39.496 1.00 25.03 ? 208  DA  C "C2'" 1 
ATOM   3060 C "C1'" . DA  C 2 8   ? 22.305  55.901  40.283 1.00 23.72 ? 208  DA  C "C1'" 1 
ATOM   3061 N N9    . DA  C 2 8   ? 20.906  55.900  40.736 1.00 24.11 ? 208  DA  C N9    1 
ATOM   3062 C C8    . DA  C 2 8   ? 19.747  55.673  40.025 1.00 23.96 ? 208  DA  C C8    1 
ATOM   3063 N N7    . DA  C 2 8   ? 18.657  55.765  40.745 1.00 24.10 ? 208  DA  C N7    1 
ATOM   3064 C C5    . DA  C 2 8   ? 19.129  56.073  42.019 1.00 24.01 ? 208  DA  C C5    1 
ATOM   3065 C C6    . DA  C 2 8   ? 18.479  56.308  43.239 1.00 24.32 ? 208  DA  C C6    1 
ATOM   3066 N N6    . DA  C 2 8   ? 17.153  56.242  43.383 1.00 24.48 ? 208  DA  C N6    1 
ATOM   3067 N N1    . DA  C 2 8   ? 19.255  56.599  44.297 1.00 23.70 ? 208  DA  C N1    1 
ATOM   3068 C C2    . DA  C 2 8   ? 20.570  56.649  44.151 1.00 22.43 ? 208  DA  C C2    1 
ATOM   3069 N N3    . DA  C 2 8   ? 21.298  56.446  43.068 1.00 23.37 ? 208  DA  C N3    1 
ATOM   3070 C C4    . DA  C 2 8   ? 20.498  56.158  42.021 1.00 23.61 ? 208  DA  C C4    1 
ATOM   3071 P P     . DA  C 2 9   ? 23.180  53.254  36.275 1.00 25.60 ? 209  DA  C P     1 
ATOM   3072 O OP1   . DA  C 2 9   ? 24.254  53.172  35.267 1.00 28.47 ? 209  DA  C OP1   1 
ATOM   3073 O OP2   . DA  C 2 9   ? 21.773  53.340  35.850 1.00 27.66 ? 209  DA  C OP2   1 
ATOM   3074 O "O5'" . DA  C 2 9   ? 23.310  51.990  37.250 1.00 26.40 ? 209  DA  C "O5'" 1 
ATOM   3075 C "C5'" . DA  C 2 9   ? 24.570  51.606  37.824 1.00 24.97 ? 209  DA  C "C5'" 1 
ATOM   3076 C "C4'" . DA  C 2 9   ? 24.385  50.887  39.158 1.00 25.95 ? 209  DA  C "C4'" 1 
ATOM   3077 O "O4'" . DA  C 2 9   ? 23.690  51.725  40.084 1.00 25.35 ? 209  DA  C "O4'" 1 
ATOM   3078 C "C3'" . DA  C 2 9   ? 23.523  49.644  38.981 1.00 26.23 ? 209  DA  C "C3'" 1 
ATOM   3079 O "O3'" . DA  C 2 9   ? 24.375  48.532  38.724 1.00 29.10 ? 209  DA  C "O3'" 1 
ATOM   3080 C "C2'" . DA  C 2 9   ? 22.873  49.498  40.350 1.00 24.81 ? 209  DA  C "C2'" 1 
ATOM   3081 C "C1'" . DA  C 2 9   ? 22.776  50.941  40.839 1.00 24.19 ? 209  DA  C "C1'" 1 
ATOM   3082 N N9    . DA  C 2 9   ? 21.411  51.451  40.698 1.00 23.97 ? 209  DA  C N9    1 
ATOM   3083 C C8    . DA  C 2 9   ? 20.618  51.516  39.584 1.00 23.79 ? 209  DA  C C8    1 
ATOM   3084 N N7    . DA  C 2 9   ? 19.426  51.988  39.814 1.00 24.40 ? 209  DA  C N7    1 
ATOM   3085 C C5    . DA  C 2 9   ? 19.435  52.254  41.181 1.00 22.83 ? 209  DA  C C5    1 
ATOM   3086 C C6    . DA  C 2 9   ? 18.467  52.763  42.061 1.00 22.26 ? 209  DA  C C6    1 
ATOM   3087 N N6    . DA  C 2 9   ? 17.232  53.116  41.696 1.00 19.75 ? 209  DA  C N6    1 
ATOM   3088 N N1    . DA  C 2 9   ? 18.831  52.884  43.341 1.00 22.16 ? 209  DA  C N1    1 
ATOM   3089 C C2    . DA  C 2 9   ? 20.044  52.535  43.723 1.00 21.31 ? 209  DA  C C2    1 
ATOM   3090 N N3    . DA  C 2 9   ? 21.029  52.048  43.000 1.00 23.22 ? 209  DA  C N3    1 
ATOM   3091 C C4    . DA  C 2 9   ? 20.646  51.932  41.719 1.00 22.64 ? 209  DA  C C4    1 
ATOM   3092 P P     . DG  C 2 10  ? 23.986  47.344  37.705 1.00 30.33 ? 210  DG  C P     1 
ATOM   3093 O OP1   . DG  C 2 10  ? 25.205  46.525  37.507 1.00 29.86 ? 210  DG  C OP1   1 
ATOM   3094 O OP2   . DG  C 2 10  ? 23.287  47.940  36.540 1.00 32.38 ? 210  DG  C OP2   1 
ATOM   3095 O "O5'" . DG  C 2 10  ? 22.904  46.454  38.505 1.00 31.02 ? 210  DG  C "O5'" 1 
ATOM   3096 C "C5'" . DG  C 2 10  ? 23.296  45.735  39.673 1.00 31.50 ? 210  DG  C "C5'" 1 
ATOM   3097 C "C4'" . DG  C 2 10  ? 22.114  45.107  40.414 1.00 32.61 ? 210  DG  C "C4'" 1 
ATOM   3098 O "O4'" . DG  C 2 10  ? 21.171  46.056  40.910 1.00 32.62 ? 210  DG  C "O4'" 1 
ATOM   3099 C "C3'" . DG  C 2 10  ? 21.340  44.162  39.520 1.00 33.47 ? 210  DG  C "C3'" 1 
ATOM   3100 O "O3'" . DG  C 2 10  ? 21.277  42.932  40.203 1.00 37.11 ? 210  DG  C "O3'" 1 
ATOM   3101 C "C2'" . DG  C 2 10  ? 19.952  44.782  39.444 1.00 32.33 ? 210  DG  C "C2'" 1 
ATOM   3102 C "C1'" . DG  C 2 10  ? 19.854  45.514  40.776 1.00 30.31 ? 210  DG  C "C1'" 1 
ATOM   3103 N N9    . DG  C 2 10  ? 18.862  46.616  40.687 1.00 29.24 ? 210  DG  C N9    1 
ATOM   3104 C C8    . DG  C 2 10  ? 17.774  46.879  41.489 1.00 28.86 ? 210  DG  C C8    1 
ATOM   3105 N N7    . DG  C 2 10  ? 17.084  47.928  41.125 1.00 27.28 ? 210  DG  C N7    1 
ATOM   3106 C C5    . DG  C 2 10  ? 17.761  48.392  40.007 1.00 27.09 ? 210  DG  C C5    1 
ATOM   3107 C C6    . DG  C 2 10  ? 17.481  49.494  39.189 1.00 27.14 ? 210  DG  C C6    1 
ATOM   3108 O O6    . DG  C 2 10  ? 16.557  50.292  39.302 1.00 28.86 ? 210  DG  C O6    1 
ATOM   3109 N N1    . DG  C 2 10  ? 18.406  49.626  38.163 1.00 28.01 ? 210  DG  C N1    1 
ATOM   3110 C C2    . DG  C 2 10  ? 19.482  48.791  37.950 1.00 27.95 ? 210  DG  C C2    1 
ATOM   3111 N N2    . DG  C 2 10  ? 20.289  49.069  36.918 1.00 27.83 ? 210  DG  C N2    1 
ATOM   3112 N N3    . DG  C 2 10  ? 19.744  47.745  38.727 1.00 27.99 ? 210  DG  C N3    1 
ATOM   3113 C C4    . DG  C 2 10  ? 18.847  47.606  39.731 1.00 27.75 ? 210  DG  C C4    1 
ATOM   3114 P P     . DG  C 2 11  ? 21.023  41.562  39.442 1.00 38.62 ? 211  DG  C P     1 
ATOM   3115 O OP1   . DG  C 2 11  ? 22.116  40.638  39.821 1.00 40.04 ? 211  DG  C OP1   1 
ATOM   3116 O OP2   . DG  C 2 11  ? 20.721  41.831  38.019 1.00 39.73 ? 211  DG  C OP2   1 
ATOM   3117 O "O5'" . DG  C 2 11  ? 19.685  41.096  40.151 1.00 37.86 ? 211  DG  C "O5'" 1 
ATOM   3118 C "C5'" . DG  C 2 11  ? 19.727  40.820  41.537 1.00 35.08 ? 211  DG  C "C5'" 1 
ATOM   3119 C "C4'" . DG  C 2 11  ? 18.339  40.690  42.081 1.00 36.18 ? 211  DG  C "C4'" 1 
ATOM   3120 O "O4'" . DG  C 2 11  ? 17.638  41.928  41.981 1.00 36.47 ? 211  DG  C "O4'" 1 
ATOM   3121 C "C3'" . DG  C 2 11  ? 17.546  39.671  41.288 1.00 37.06 ? 211  DG  C "C3'" 1 
ATOM   3122 O "O3'" . DG  C 2 11  ? 16.762  38.945  42.221 1.00 42.48 ? 211  DG  C "O3'" 1 
ATOM   3123 C "C2'" . DG  C 2 11  ? 16.683  40.540  40.368 1.00 35.94 ? 211  DG  C "C2'" 1 
ATOM   3124 C "C1'" . DG  C 2 11  ? 16.428  41.767  41.235 1.00 33.59 ? 211  DG  C "C1'" 1 
ATOM   3125 N N9    . DG  C 2 11  ? 16.256  42.971  40.410 1.00 29.84 ? 211  DG  C N9    1 
ATOM   3126 C C8    . DG  C 2 11  ? 16.999  43.370  39.340 1.00 29.89 ? 211  DG  C C8    1 
ATOM   3127 N N7    . DG  C 2 11  ? 16.634  44.508  38.830 1.00 28.78 ? 211  DG  C N7    1 
ATOM   3128 C C5    . DG  C 2 11  ? 15.566  44.892  39.623 1.00 26.79 ? 211  DG  C C5    1 
ATOM   3129 C C6    . DG  C 2 11  ? 14.763  46.047  39.548 1.00 25.68 ? 211  DG  C C6    1 
ATOM   3130 O O6    . DG  C 2 11  ? 14.847  46.974  38.756 1.00 25.59 ? 211  DG  C O6    1 
ATOM   3131 N N1    . DG  C 2 11  ? 13.794  46.056  40.521 1.00 25.49 ? 211  DG  C N1    1 
ATOM   3132 C C2    . DG  C 2 11  ? 13.614  45.069  41.463 1.00 27.41 ? 211  DG  C C2    1 
ATOM   3133 N N2    . DG  C 2 11  ? 12.610  45.232  42.322 1.00 28.06 ? 211  DG  C N2    1 
ATOM   3134 N N3    . DG  C 2 11  ? 14.374  43.973  41.543 1.00 28.11 ? 211  DG  C N3    1 
ATOM   3135 C C4    . DG  C 2 11  ? 15.327  43.955  40.591 1.00 27.96 ? 211  DG  C C4    1 
ATOM   3136 P P     . DG  C 2 12  ? 15.825  37.726  41.803 1.00 44.17 ? 212  DG  C P     1 
ATOM   3137 O OP1   . DG  C 2 12  ? 15.788  36.794  42.949 1.00 44.17 ? 212  DG  C OP1   1 
ATOM   3138 O OP2   . DG  C 2 12  ? 16.249  37.258  40.465 1.00 45.10 ? 212  DG  C OP2   1 
ATOM   3139 O "O5'" . DG  C 2 12  ? 14.373  38.426  41.662 1.00 44.04 ? 212  DG  C "O5'" 1 
ATOM   3140 C "C5'" . DG  C 2 12  ? 13.629  38.856  42.811 1.00 43.49 ? 212  DG  C "C5'" 1 
ATOM   3141 C "C4'" . DG  C 2 12  ? 12.299  39.520  42.431 1.00 43.80 ? 212  DG  C "C4'" 1 
ATOM   3142 O "O4'" . DG  C 2 12  ? 12.511  40.778  41.764 1.00 41.78 ? 212  DG  C "O4'" 1 
ATOM   3143 C "C3'" . DG  C 2 12  ? 11.536  38.634  41.431 1.00 45.27 ? 212  DG  C "C3'" 1 
ATOM   3144 O "O3'" . DG  C 2 12  ? 10.116  38.707  41.607 1.00 49.12 ? 212  DG  C "O3'" 1 
ATOM   3145 C "C2'" . DG  C 2 12  ? 11.912  39.289  40.112 1.00 42.56 ? 212  DG  C "C2'" 1 
ATOM   3146 C "C1'" . DG  C 2 12  ? 11.804  40.740  40.524 1.00 38.73 ? 212  DG  C "C1'" 1 
ATOM   3147 N N9    . DG  C 2 12  ? 12.395  41.608  39.493 1.00 34.30 ? 212  DG  C N9    1 
ATOM   3148 C C8    . DG  C 2 12  ? 13.467  41.383  38.668 1.00 34.19 ? 212  DG  C C8    1 
ATOM   3149 N N7    . DG  C 2 12  ? 13.707  42.360  37.835 1.00 33.45 ? 212  DG  C N7    1 
ATOM   3150 C C5    . DG  C 2 12  ? 12.722  43.297  38.135 1.00 31.77 ? 212  DG  C C5    1 
ATOM   3151 C C6    . DG  C 2 12  ? 12.463  44.563  37.555 1.00 31.57 ? 212  DG  C C6    1 
ATOM   3152 O O6    . DG  C 2 12  ? 13.074  45.129  36.650 1.00 32.81 ? 212  DG  C O6    1 
ATOM   3153 N N1    . DG  C 2 12  ? 11.372  45.176  38.143 1.00 30.25 ? 212  DG  C N1    1 
ATOM   3154 C C2    . DG  C 2 12  ? 10.623  44.639  39.162 1.00 29.93 ? 212  DG  C C2    1 
ATOM   3155 N N2    . DG  C 2 12  ? 9.610   45.364  39.613 1.00 29.75 ? 212  DG  C N2    1 
ATOM   3156 N N3    . DG  C 2 12  ? 10.864  43.451  39.707 1.00 30.20 ? 212  DG  C N3    1 
ATOM   3157 C C4    . DG  C 2 12  ? 11.922  42.841  39.146 1.00 32.04 ? 212  DG  C C4    1 
ATOM   3158 P P     . DC  C 2 13  ? 9.198   37.493  41.056 1.00 53.37 ? 213  DC  C P     1 
ATOM   3159 O OP1   . DC  C 2 13  ? 9.711   36.237  41.653 1.00 50.30 ? 213  DC  C OP1   1 
ATOM   3160 O OP2   . DC  C 2 13  ? 9.088   37.610  39.583 1.00 52.33 ? 213  DC  C OP2   1 
ATOM   3161 O "O5'" . DC  C 2 13  ? 7.748   37.811  41.694 1.00 51.40 ? 213  DC  C "O5'" 1 
ATOM   3162 C "C5'" . DC  C 2 13  ? 7.287   39.144  41.947 1.00 50.66 ? 213  DC  C "C5'" 1 
ATOM   3163 C "C4'" . DC  C 2 13  ? 6.940   39.962  40.684 1.00 49.65 ? 213  DC  C "C4'" 1 
ATOM   3164 O "O4'" . DC  C 2 13  ? 8.086   40.431  39.980 1.00 47.91 ? 213  DC  C "O4'" 1 
ATOM   3165 C "C3'" . DC  C 2 13  ? 6.140   39.154  39.663 1.00 48.35 ? 213  DC  C "C3'" 1 
ATOM   3166 O "O3'" . DC  C 2 13  ? 4.814   39.667  39.558 1.00 49.97 ? 213  DC  C "O3'" 1 
ATOM   3167 C "C2'" . DC  C 2 13  ? 6.883   39.410  38.355 1.00 46.44 ? 213  DC  C "C2'" 1 
ATOM   3168 C "C1'" . DC  C 2 13  ? 7.600   40.710  38.671 1.00 44.45 ? 213  DC  C "C1'" 1 
ATOM   3169 N N1    . DC  C 2 13  ? 8.713   40.951  37.730 1.00 41.47 ? 213  DC  C N1    1 
ATOM   3170 C C2    . DC  C 2 13  ? 8.782   42.184  37.104 1.00 40.10 ? 213  DC  C C2    1 
ATOM   3171 O O2    . DC  C 2 13  ? 7.942   43.055  37.312 1.00 39.39 ? 213  DC  C O2    1 
ATOM   3172 N N3    . DC  C 2 13  ? 9.806   42.404  36.245 1.00 40.38 ? 213  DC  C N3    1 
ATOM   3173 C C4    . DC  C 2 13  ? 10.723  41.460  36.005 1.00 40.41 ? 213  DC  C C4    1 
ATOM   3174 N N4    . DC  C 2 13  ? 11.710  41.716  35.153 1.00 40.93 ? 213  DC  C N4    1 
ATOM   3175 C C5    . DC  C 2 13  ? 10.661  40.186  36.645 1.00 40.62 ? 213  DC  C C5    1 
ATOM   3176 C C6    . DC  C 2 13  ? 9.639   39.982  37.496 1.00 40.51 ? 213  DC  C C6    1 
ATOM   3177 P P     . DA  C 2 14  ? 3.608   38.638  39.284 1.00 52.30 ? 214  DA  C P     1 
ATOM   3178 O OP1   . DA  C 2 14  ? 2.873   38.462  40.561 1.00 52.25 ? 214  DA  C OP1   1 
ATOM   3179 O OP2   . DA  C 2 14  ? 4.162   37.454  38.581 1.00 50.89 ? 214  DA  C OP2   1 
ATOM   3180 O "O5'" . DA  C 2 14  ? 2.656   39.433  38.240 1.00 49.10 ? 214  DA  C "O5'" 1 
ATOM   3181 C "C5'" . DA  C 2 14  ? 1.748   40.448  38.673 1.00 45.73 ? 214  DA  C "C5'" 1 
ATOM   3182 C "C4'" . DA  C 2 14  ? 1.927   41.752  37.888 1.00 44.42 ? 214  DA  C "C4'" 1 
ATOM   3183 O "O4'" . DA  C 2 14  ? 3.273   41.848  37.413 1.00 43.84 ? 214  DA  C "O4'" 1 
ATOM   3184 C "C3'" . DA  C 2 14  ? 1.067   41.836  36.619 1.00 44.57 ? 214  DA  C "C3'" 1 
ATOM   3185 O "O3'" . DA  C 2 14  ? 0.917   43.220  36.248 1.00 44.63 ? 214  DA  C "O3'" 1 
ATOM   3186 C "C2'" . DA  C 2 14  ? 1.992   41.128  35.636 1.00 42.68 ? 214  DA  C "C2'" 1 
ATOM   3187 C "C1'" . DA  C 2 14  ? 3.246   41.890  35.985 1.00 41.28 ? 214  DA  C "C1'" 1 
ATOM   3188 N N9    . DA  C 2 14  ? 4.476   41.310  35.448 1.00 38.69 ? 214  DA  C N9    1 
ATOM   3189 C C8    . DA  C 2 14  ? 4.958   40.026  35.516 1.00 38.20 ? 214  DA  C C8    1 
ATOM   3190 N N7    . DA  C 2 14  ? 6.131   39.876  34.963 1.00 36.53 ? 214  DA  C N7    1 
ATOM   3191 C C5    . DA  C 2 14  ? 6.434   41.152  34.499 1.00 35.80 ? 214  DA  C C5    1 
ATOM   3192 C C6    . DA  C 2 14  ? 7.542   41.672  33.827 1.00 35.05 ? 214  DA  C C6    1 
ATOM   3193 N N6    . DA  C 2 14  ? 8.593   40.929  33.486 1.00 34.86 ? 214  DA  C N6    1 
ATOM   3194 N N1    . DA  C 2 14  ? 7.518   42.976  33.531 1.00 34.38 ? 214  DA  C N1    1 
ATOM   3195 C C2    . DA  C 2 14  ? 6.466   43.704  33.878 1.00 35.46 ? 214  DA  C C2    1 
ATOM   3196 N N3    . DA  C 2 14  ? 5.365   43.342  34.509 1.00 35.67 ? 214  DA  C N3    1 
ATOM   3197 C C4    . DA  C 2 14  ? 5.426   42.025  34.792 1.00 36.57 ? 214  DA  C C4    1 
ATOM   3198 O "O5'" . DT  D 3 1   ? 9.967   45.241  26.020 1.00 60.55 ? 215  DT  D "O5'" 1 
ATOM   3199 C "C5'" . DT  D 3 1   ? 10.304  46.572  26.404 1.00 59.19 ? 215  DT  D "C5'" 1 
ATOM   3200 C "C4'" . DT  D 3 1   ? 9.071   47.402  26.758 1.00 59.54 ? 215  DT  D "C4'" 1 
ATOM   3201 O "O4'" . DT  D 3 1   ? 8.269   46.723  27.733 1.00 59.45 ? 215  DT  D "O4'" 1 
ATOM   3202 C "C3'" . DT  D 3 1   ? 9.451   48.700  27.451 1.00 58.71 ? 215  DT  D "C3'" 1 
ATOM   3203 O "O3'" . DT  D 3 1   ? 8.303   49.559  27.479 1.00 60.23 ? 215  DT  D "O3'" 1 
ATOM   3204 C "C2'" . DT  D 3 1   ? 9.795   48.146  28.840 1.00 58.42 ? 215  DT  D "C2'" 1 
ATOM   3205 C "C1'" . DT  D 3 1   ? 8.680   47.114  29.056 1.00 57.21 ? 215  DT  D "C1'" 1 
ATOM   3206 N N1    . DT  D 3 1   ? 9.151   45.913  29.803 1.00 56.12 ? 215  DT  D N1    1 
ATOM   3207 C C2    . DT  D 3 1   ? 8.370   45.467  30.858 1.00 55.10 ? 215  DT  D C2    1 
ATOM   3208 O O2    . DT  D 3 1   ? 7.341   46.043  31.209 1.00 54.81 ? 215  DT  D O2    1 
ATOM   3209 N N3    . DT  D 3 1   ? 8.819   44.328  31.507 1.00 53.85 ? 215  DT  D N3    1 
ATOM   3210 C C4    . DT  D 3 1   ? 9.958   43.606  31.206 1.00 53.67 ? 215  DT  D C4    1 
ATOM   3211 O O4    . DT  D 3 1   ? 10.254  42.598  31.846 1.00 53.83 ? 215  DT  D O4    1 
ATOM   3212 C C5    . DT  D 3 1   ? 10.711  44.144  30.099 1.00 54.21 ? 215  DT  D C5    1 
ATOM   3213 C C7    . DT  D 3 1   ? 11.994  43.446  29.656 1.00 54.09 ? 215  DT  D C7    1 
ATOM   3214 C C6    . DT  D 3 1   ? 10.300  45.248  29.449 1.00 54.85 ? 215  DT  D C6    1 
ATOM   3215 P P     . DG  D 3 2   ? 8.168   50.780  28.526 1.00 64.37 ? 216  DG  D P     1 
ATOM   3216 O OP1   . DG  D 3 2   ? 7.191   51.756  27.986 1.00 61.42 ? 216  DG  D OP1   1 
ATOM   3217 O OP2   . DG  D 3 2   ? 9.534   51.231  28.895 1.00 63.42 ? 216  DG  D OP2   1 
ATOM   3218 O "O5'" . DG  D 3 2   ? 7.509   50.056  29.820 1.00 60.81 ? 216  DG  D "O5'" 1 
ATOM   3219 C "C5'" . DG  D 3 2   ? 6.547   50.731  30.650 1.00 57.04 ? 216  DG  D "C5'" 1 
ATOM   3220 C "C4'" . DG  D 3 2   ? 6.937   50.721  32.135 1.00 53.95 ? 216  DG  D "C4'" 1 
ATOM   3221 O "O4'" . DG  D 3 2   ? 7.394   49.418  32.521 1.00 52.09 ? 216  DG  D "O4'" 1 
ATOM   3222 C "C3'" . DG  D 3 2   ? 8.100   51.689  32.443 1.00 52.74 ? 216  DG  D "C3'" 1 
ATOM   3223 O "O3'" . DG  D 3 2   ? 7.905   52.379  33.684 1.00 52.90 ? 216  DG  D "O3'" 1 
ATOM   3224 C "C2'" . DG  D 3 2   ? 9.276   50.728  32.582 1.00 50.08 ? 216  DG  D "C2'" 1 
ATOM   3225 C "C1'" . DG  D 3 2   ? 8.580   49.586  33.279 1.00 46.84 ? 216  DG  D "C1'" 1 
ATOM   3226 N N9    . DG  D 3 2   ? 9.378   48.365  33.261 1.00 42.91 ? 216  DG  D N9    1 
ATOM   3227 C C8    . DG  D 3 2   ? 10.497  48.072  32.537 1.00 42.24 ? 216  DG  D C8    1 
ATOM   3228 N N7    . DG  D 3 2   ? 10.992  46.891  32.789 1.00 42.61 ? 216  DG  D N7    1 
ATOM   3229 C C5    . DG  D 3 2   ? 10.134  46.366  33.751 1.00 41.09 ? 216  DG  D C5    1 
ATOM   3230 C C6    . DG  D 3 2   ? 10.170  45.118  34.422 1.00 39.00 ? 216  DG  D C6    1 
ATOM   3231 O O6    . DG  D 3 2   ? 10.989  44.216  34.295 1.00 38.76 ? 216  DG  D O6    1 
ATOM   3232 N N1    . DG  D 3 2   ? 9.132   44.988  35.322 1.00 37.72 ? 216  DG  D N1    1 
ATOM   3233 C C2    . DG  D 3 2   ? 8.166   45.941  35.557 1.00 38.90 ? 216  DG  D C2    1 
ATOM   3234 N N2    . DG  D 3 2   ? 7.234   45.644  36.462 1.00 37.68 ? 216  DG  D N2    1 
ATOM   3235 N N3    . DG  D 3 2   ? 8.128   47.118  34.930 1.00 40.16 ? 216  DG  D N3    1 
ATOM   3236 C C4    . DG  D 3 2   ? 9.141   47.262  34.043 1.00 41.65 ? 216  DG  D C4    1 
ATOM   3237 P P     . DC  D 3 3   ? 6.600   53.294  33.944 1.00 57.63 ? 217  DC  D P     1 
ATOM   3238 O OP1   . DC  D 3 3   ? 5.880   53.480  32.660 1.00 56.75 ? 217  DC  D OP1   1 
ATOM   3239 O OP2   . DC  D 3 3   ? 7.012   54.484  34.728 1.00 55.02 ? 217  DC  D OP2   1 
ATOM   3240 O "O5'" . DC  D 3 3   ? 5.708   52.333  34.887 1.00 54.16 ? 217  DC  D "O5'" 1 
ATOM   3241 C "C5'" . DC  D 3 3   ? 5.667   52.582  36.290 1.00 51.60 ? 217  DC  D "C5'" 1 
ATOM   3242 C "C4'" . DC  D 3 3   ? 6.330   51.487  37.118 1.00 49.27 ? 217  DC  D "C4'" 1 
ATOM   3243 O "O4'" . DC  D 3 3   ? 7.376   50.813  36.444 1.00 47.89 ? 217  DC  D "O4'" 1 
ATOM   3244 C "C3'" . DC  D 3 3   ? 7.088   52.119  38.269 1.00 48.67 ? 217  DC  D "C3'" 1 
ATOM   3245 O "O3'" . DC  D 3 3   ? 6.200   52.382  39.347 1.00 49.19 ? 217  DC  D "O3'" 1 
ATOM   3246 C "C2'" . DC  D 3 3   ? 8.111   51.049  38.644 1.00 47.49 ? 217  DC  D "C2'" 1 
ATOM   3247 C "C1'" . DC  D 3 3   ? 7.997   50.072  37.490 1.00 45.47 ? 217  DC  D "C1'" 1 
ATOM   3248 N N1    . DC  D 3 3   ? 9.313   49.551  37.089 1.00 43.44 ? 217  DC  D N1    1 
ATOM   3249 C C2    . DC  D 3 3   ? 9.673   48.317  37.580 1.00 42.65 ? 217  DC  D C2    1 
ATOM   3250 O O2    . DC  D 3 3   ? 8.937   47.732  38.365 1.00 43.15 ? 217  DC  D O2    1 
ATOM   3251 N N3    . DC  D 3 3   ? 10.861  47.787  37.195 1.00 41.49 ? 217  DC  D N3    1 
ATOM   3252 C C4    . DC  D 3 3   ? 11.665  48.452  36.361 1.00 41.78 ? 217  DC  D C4    1 
ATOM   3253 N N4    . DC  D 3 3   ? 12.816  47.902  35.992 1.00 43.25 ? 217  DC  D N4    1 
ATOM   3254 C C5    . DC  D 3 3   ? 11.309  49.737  35.850 1.00 42.24 ? 217  DC  D C5    1 
ATOM   3255 C C6    . DC  D 3 3   ? 10.123  50.242  36.244 1.00 43.11 ? 217  DC  D C6    1 
ATOM   3256 P P     . DC  D 3 4   ? 6.575   53.481  40.455 1.00 51.66 ? 218  DC  D P     1 
ATOM   3257 O OP1   . DC  D 3 4   ? 5.319   54.138  40.892 1.00 50.08 ? 218  DC  D OP1   1 
ATOM   3258 O OP2   . DC  D 3 4   ? 7.708   54.301  39.961 1.00 49.67 ? 218  DC  D OP2   1 
ATOM   3259 O "O5'" . DC  D 3 4   ? 7.137   52.545  41.646 1.00 50.21 ? 218  DC  D "O5'" 1 
ATOM   3260 C "C5'" . DC  D 3 4   ? 6.398   51.419  42.135 1.00 48.16 ? 218  DC  D "C5'" 1 
ATOM   3261 C "C4'" . DC  D 3 4   ? 7.291   50.381  42.823 1.00 46.23 ? 218  DC  D "C4'" 1 
ATOM   3262 O "O4'" . DC  D 3 4   ? 8.112   49.681  41.880 1.00 45.30 ? 218  DC  D "O4'" 1 
ATOM   3263 C "C3'" . DC  D 3 4   ? 8.234   51.065  43.815 1.00 46.20 ? 218  DC  D "C3'" 1 
ATOM   3264 O "O3'" . DC  D 3 4   ? 8.125   50.523  45.132 1.00 47.99 ? 218  DC  D "O3'" 1 
ATOM   3265 C "C2'" . DC  D 3 4   ? 9.610   50.751  43.265 1.00 44.80 ? 218  DC  D "C2'" 1 
ATOM   3266 C "C1'" . DC  D 3 4   ? 9.379   49.468  42.479 1.00 42.05 ? 218  DC  D "C1'" 1 
ATOM   3267 N N1    . DC  D 3 4   ? 10.446  49.392  41.472 1.00 39.88 ? 218  DC  D N1    1 
ATOM   3268 C C2    . DC  D 3 4   ? 11.219  48.253  41.428 1.00 38.54 ? 218  DC  D C2    1 
ATOM   3269 O O2    . DC  D 3 4   ? 10.967  47.314  42.178 1.00 38.15 ? 218  DC  D O2    1 
ATOM   3270 N N3    . DC  D 3 4   ? 12.249  48.212  40.534 1.00 37.38 ? 218  DC  D N3    1 
ATOM   3271 C C4    . DC  D 3 4   ? 12.500  49.250  39.717 1.00 36.80 ? 218  DC  D C4    1 
ATOM   3272 N N4    . DC  D 3 4   ? 13.520  49.200  38.868 1.00 36.04 ? 218  DC  D N4    1 
ATOM   3273 C C5    . DC  D 3 4   ? 11.697  50.428  39.753 1.00 37.46 ? 218  DC  D C5    1 
ATOM   3274 C C6    . DC  D 3 4   ? 10.687  50.450  40.642 1.00 38.83 ? 218  DC  D C6    1 
ATOM   3275 P P     . DC  D 3 5   ? 8.989   51.154  46.336 1.00 47.51 ? 219  DC  D P     1 
ATOM   3276 O OP1   . DC  D 3 5   ? 8.147   51.110  47.546 1.00 50.56 ? 219  DC  D OP1   1 
ATOM   3277 O OP2   . DC  D 3 5   ? 9.555   52.444  45.877 1.00 48.65 ? 219  DC  D OP2   1 
ATOM   3278 O "O5'" . DC  D 3 5   ? 10.204  50.131  46.558 1.00 45.71 ? 219  DC  D "O5'" 1 
ATOM   3279 C "C5'" . DC  D 3 5   ? 9.955   48.830  47.076 1.00 42.68 ? 219  DC  D "C5'" 1 
ATOM   3280 C "C4'" . DC  D 3 5   ? 11.139  47.940  46.793 1.00 43.26 ? 219  DC  D "C4'" 1 
ATOM   3281 O "O4'" . DC  D 3 5   ? 11.470  47.985  45.411 1.00 43.93 ? 219  DC  D "O4'" 1 
ATOM   3282 C "C3'" . DC  D 3 5   ? 12.372  48.508  47.448 1.00 43.01 ? 219  DC  D "C3'" 1 
ATOM   3283 O "O3'" . DC  D 3 5   ? 12.395  48.081  48.811 1.00 42.84 ? 219  DC  D "O3'" 1 
ATOM   3284 C "C2'" . DC  D 3 5   ? 13.481  47.823  46.641 1.00 43.76 ? 219  DC  D "C2'" 1 
ATOM   3285 C "C1'" . DC  D 3 5   ? 12.856  47.684  45.256 1.00 41.92 ? 219  DC  D "C1'" 1 
ATOM   3286 N N1    . DC  D 3 5   ? 13.446  48.603  44.265 1.00 41.20 ? 219  DC  D N1    1 
ATOM   3287 C C2    . DC  D 3 5   ? 14.579  48.186  43.587 1.00 41.06 ? 219  DC  D C2    1 
ATOM   3288 O O2    . DC  D 3 5   ? 15.098  47.100  43.843 1.00 39.98 ? 219  DC  D O2    1 
ATOM   3289 N N3    . DC  D 3 5   ? 15.098  49.022  42.642 1.00 41.65 ? 219  DC  D N3    1 
ATOM   3290 C C4    . DC  D 3 5   ? 14.536  50.213  42.376 1.00 41.13 ? 219  DC  D C4    1 
ATOM   3291 N N4    . DC  D 3 5   ? 15.067  50.998  41.439 1.00 41.43 ? 219  DC  D N4    1 
ATOM   3292 C C5    . DC  D 3 5   ? 13.369  50.651  43.077 1.00 40.39 ? 219  DC  D C5    1 
ATOM   3293 C C6    . DC  D 3 5   ? 12.866  49.814  44.007 1.00 40.34 ? 219  DC  D C6    1 
ATOM   3294 P P     . DT  D 3 6   ? 12.586  49.128  50.013 1.00 41.80 ? 220  DT  D P     1 
ATOM   3295 O OP1   . DT  D 3 6   ? 12.362  48.403  51.284 1.00 41.92 ? 220  DT  D OP1   1 
ATOM   3296 O OP2   . DT  D 3 6   ? 11.832  50.367  49.707 1.00 40.23 ? 220  DT  D OP2   1 
ATOM   3297 O "O5'" . DT  D 3 6   ? 14.135  49.455  49.874 1.00 37.60 ? 220  DT  D "O5'" 1 
ATOM   3298 C "C5'" . DT  D 3 6   ? 15.131  48.454  49.995 1.00 32.56 ? 220  DT  D "C5'" 1 
ATOM   3299 C "C4'" . DT  D 3 6   ? 16.448  49.131  49.830 1.00 31.82 ? 220  DT  D "C4'" 1 
ATOM   3300 O "O4'" . DT  D 3 6   ? 16.523  49.650  48.508 1.00 32.30 ? 220  DT  D "O4'" 1 
ATOM   3301 C "C3'" . DT  D 3 6   ? 16.491  50.349  50.749 1.00 30.16 ? 220  DT  D "C3'" 1 
ATOM   3302 O "O3'" . DT  D 3 6   ? 17.615  50.249  51.608 1.00 30.89 ? 220  DT  D "O3'" 1 
ATOM   3303 C "C2'" . DT  D 3 6   ? 16.575  51.566  49.816 1.00 30.48 ? 220  DT  D "C2'" 1 
ATOM   3304 C "C1'" . DT  D 3 6   ? 17.098  50.959  48.522 1.00 30.66 ? 220  DT  D "C1'" 1 
ATOM   3305 N N1    . DT  D 3 6   ? 16.599  51.687  47.333 1.00 29.52 ? 220  DT  D N1    1 
ATOM   3306 C C2    . DT  D 3 6   ? 17.512  52.164  46.401 1.00 28.15 ? 220  DT  D C2    1 
ATOM   3307 O O2    . DT  D 3 6   ? 18.727  52.059  46.521 1.00 26.82 ? 220  DT  D O2    1 
ATOM   3308 N N3    . DT  D 3 6   ? 16.978  52.800  45.307 1.00 27.52 ? 220  DT  D N3    1 
ATOM   3309 C C4    . DT  D 3 6   ? 15.649  53.012  45.051 1.00 28.20 ? 220  DT  D C4    1 
ATOM   3310 O O4    . DT  D 3 6   ? 15.307  53.583  44.019 1.00 30.29 ? 220  DT  D O4    1 
ATOM   3311 C C5    . DT  D 3 6   ? 14.768  52.492  46.073 1.00 29.31 ? 220  DT  D C5    1 
ATOM   3312 C C7    . DT  D 3 6   ? 13.257  52.677  45.954 1.00 29.24 ? 220  DT  D C7    1 
ATOM   3313 C C6    . DT  D 3 6   ? 15.257  51.860  47.152 1.00 29.65 ? 220  DT  D C6    1 
ATOM   3314 P P     . DT  D 3 7   ? 17.709  51.162  52.922 1.00 31.13 ? 221  DT  D P     1 
ATOM   3315 O OP1   . DT  D 3 7   ? 18.396  50.374  53.965 1.00 32.49 ? 221  DT  D OP1   1 
ATOM   3316 O OP2   . DT  D 3 7   ? 16.372  51.751  53.177 1.00 31.90 ? 221  DT  D OP2   1 
ATOM   3317 O "O5'" . DT  D 3 7   ? 18.682  52.363  52.482 1.00 28.89 ? 221  DT  D "O5'" 1 
ATOM   3318 C "C5'" . DT  D 3 7   ? 20.090  52.207  52.335 1.00 25.87 ? 221  DT  D "C5'" 1 
ATOM   3319 C "C4'" . DT  D 3 7   ? 20.643  53.422  51.627 1.00 26.05 ? 221  DT  D "C4'" 1 
ATOM   3320 O "O4'" . DT  D 3 7   ? 20.017  53.554  50.364 1.00 25.29 ? 221  DT  D "O4'" 1 
ATOM   3321 C "C3'" . DT  D 3 7   ? 20.189  54.682  52.338 1.00 25.61 ? 221  DT  D "C3'" 1 
ATOM   3322 O "O3'" . DT  D 3 7   ? 21.126  55.035  53.362 1.00 26.88 ? 221  DT  D "O3'" 1 
ATOM   3323 C "C2'" . DT  D 3 7   ? 20.130  55.730  51.212 1.00 25.67 ? 221  DT  D "C2'" 1 
ATOM   3324 C "C1'" . DT  D 3 7   ? 20.200  54.897  49.938 1.00 23.57 ? 221  DT  D "C1'" 1 
ATOM   3325 N N1    . DT  D 3 7   ? 19.132  55.227  48.977 1.00 23.15 ? 221  DT  D N1    1 
ATOM   3326 C C2    . DT  D 3 7   ? 19.509  55.618  47.711 1.00 23.02 ? 221  DT  D C2    1 
ATOM   3327 O O2    . DT  D 3 7   ? 20.686  55.756  47.382 1.00 24.05 ? 221  DT  D O2    1 
ATOM   3328 N N3    . DT  D 3 7   ? 18.479  55.863  46.821 1.00 22.36 ? 221  DT  D N3    1 
ATOM   3329 C C4    . DT  D 3 7   ? 17.132  55.755  47.082 1.00 22.51 ? 221  DT  D C4    1 
ATOM   3330 O O4    . DT  D 3 7   ? 16.308  55.967  46.197 1.00 23.45 ? 221  DT  D O4    1 
ATOM   3331 C C5    . DT  D 3 7   ? 16.834  55.349  48.431 1.00 21.97 ? 221  DT  D C5    1 
ATOM   3332 C C7    . DT  D 3 7   ? 15.393  55.191  48.866 1.00 20.61 ? 221  DT  D C7    1 
ATOM   3333 C C6    . DT  D 3 7   ? 17.816  55.105  49.315 1.00 23.19 ? 221  DT  D C6    1 
ATOM   3334 P P     . DA  D 3 8   ? 20.731  56.100  54.502 1.00 27.13 ? 222  DA  D P     1 
ATOM   3335 O OP1   . DA  D 3 8   ? 21.619  55.875  55.664 1.00 29.56 ? 222  DA  D OP1   1 
ATOM   3336 O OP2   . DA  D 3 8   ? 19.268  56.052  54.670 1.00 29.61 ? 222  DA  D OP2   1 
ATOM   3337 O "O5'" . DA  D 3 8   ? 21.082  57.529  53.864 1.00 25.73 ? 222  DA  D "O5'" 1 
ATOM   3338 C "C5'" . DA  D 3 8   ? 22.419  57.933  53.561 1.00 23.48 ? 222  DA  D "C5'" 1 
ATOM   3339 C "C4'" . DA  D 3 8   ? 22.394  59.135  52.648 1.00 22.59 ? 222  DA  D "C4'" 1 
ATOM   3340 O "O4'" . DA  D 3 8   ? 21.626  58.838  51.503 1.00 23.02 ? 222  DA  D "O4'" 1 
ATOM   3341 C "C3'" . DA  D 3 8   ? 21.642  60.256  53.323 1.00 24.51 ? 222  DA  D "C3'" 1 
ATOM   3342 O "O3'" . DA  D 3 8   ? 22.599  61.108  53.957 1.00 27.29 ? 222  DA  D "O3'" 1 
ATOM   3343 C "C2'" . DA  D 3 8   ? 20.889  60.972  52.189 1.00 22.98 ? 222  DA  D "C2'" 1 
ATOM   3344 C "C1'" . DA  D 3 8   ? 21.046  60.038  51.003 1.00 20.97 ? 222  DA  D "C1'" 1 
ATOM   3345 N N9    . DA  D 3 8   ? 19.753  59.696  50.406 1.00 19.56 ? 222  DA  D N9    1 
ATOM   3346 C C8    . DA  D 3 8   ? 18.636  59.176  51.008 1.00 19.21 ? 222  DA  D C8    1 
ATOM   3347 N N7    . DA  D 3 8   ? 17.649  58.953  50.192 1.00 17.97 ? 222  DA  D N7    1 
ATOM   3348 C C5    . DA  D 3 8   ? 18.140  59.352  48.964 1.00 18.35 ? 222  DA  D C5    1 
ATOM   3349 C C6    . DA  D 3 8   ? 17.578  59.358  47.689 1.00 18.60 ? 222  DA  D C6    1 
ATOM   3350 N N6    . DA  D 3 8   ? 16.337  58.943  47.436 1.00 19.09 ? 222  DA  D N6    1 
ATOM   3351 N N1    . DA  D 3 8   ? 18.348  59.809  46.694 1.00 18.94 ? 222  DA  D N1    1 
ATOM   3352 C C2    . DA  D 3 8   ? 19.583  60.222  46.948 1.00 19.97 ? 222  DA  D C2    1 
ATOM   3353 N N3    . DA  D 3 8   ? 20.228  60.268  48.102 1.00 20.05 ? 222  DA  D N3    1 
ATOM   3354 C C4    . DA  D 3 8   ? 19.426  59.808  49.084 1.00 19.10 ? 222  DA  D C4    1 
ATOM   3355 P P     . DT  D 3 9   ? 22.243  62.025  55.230 1.00 28.98 ? 223  DT  D P     1 
ATOM   3356 O OP1   . DT  D 3 9   ? 23.524  62.530  55.785 1.00 29.63 ? 223  DT  D OP1   1 
ATOM   3357 O OP2   . DT  D 3 9   ? 21.290  61.300  56.102 1.00 27.15 ? 223  DT  D OP2   1 
ATOM   3358 O "O5'" . DT  D 3 9   ? 21.451  63.246  54.572 1.00 26.44 ? 223  DT  D "O5'" 1 
ATOM   3359 C "C5'" . DT  D 3 9   ? 22.144  64.268  53.864 1.00 24.21 ? 223  DT  D "C5'" 1 
ATOM   3360 C "C4'" . DT  D 3 9   ? 21.168  65.053  53.018 1.00 23.24 ? 223  DT  D "C4'" 1 
ATOM   3361 O "O4'" . DT  D 3 9   ? 20.525  64.202  52.087 1.00 22.74 ? 223  DT  D "O4'" 1 
ATOM   3362 C "C3'" . DT  D 3 9   ? 19.999  65.520  53.858 1.00 22.75 ? 223  DT  D "C3'" 1 
ATOM   3363 O "O3'" . DT  D 3 9   ? 20.400  66.688  54.583 1.00 25.64 ? 223  DT  D "O3'" 1 
ATOM   3364 C "C2'" . DT  D 3 9   ? 18.977  65.831  52.760 1.00 21.58 ? 223  DT  D "C2'" 1 
ATOM   3365 C "C1'" . DT  D 3 9   ? 19.411  64.927  51.607 1.00 19.87 ? 223  DT  D "C1'" 1 
ATOM   3366 N N1    . DT  D 3 9   ? 18.361  63.987  51.164 1.00 19.50 ? 223  DT  D N1    1 
ATOM   3367 C C2    . DT  D 3 9   ? 18.105  63.923  49.801 1.00 19.45 ? 223  DT  D C2    1 
ATOM   3368 O O2    . DT  D 3 9   ? 18.710  64.598  48.972 1.00 22.51 ? 223  DT  D O2    1 
ATOM   3369 N N3    . DT  D 3 9   ? 17.122  63.048  49.405 1.00 18.47 ? 223  DT  D N3    1 
ATOM   3370 C C4    . DT  D 3 9   ? 16.380  62.241  50.234 1.00 18.68 ? 223  DT  D C4    1 
ATOM   3371 O O4    . DT  D 3 9   ? 15.527  61.503  49.757 1.00 20.55 ? 223  DT  D O4    1 
ATOM   3372 C C5    . DT  D 3 9   ? 16.704  62.363  51.637 1.00 18.40 ? 223  DT  D C5    1 
ATOM   3373 C C7    . DT  D 3 9   ? 15.943  61.524  52.648 1.00 17.22 ? 223  DT  D C7    1 
ATOM   3374 C C6    . DT  D 3 9   ? 17.662  63.212  52.055 1.00 18.40 ? 223  DT  D C6    1 
ATOM   3375 P P     . DA  D 3 10  ? 19.642  67.186  55.908 1.00 27.15 ? 224  DA  D P     1 
ATOM   3376 O OP1   . DA  D 3 10  ? 20.649  67.690  56.858 1.00 28.75 ? 224  DA  D OP1   1 
ATOM   3377 O OP2   . DA  D 3 10  ? 18.679  66.141  56.326 1.00 27.02 ? 224  DA  D OP2   1 
ATOM   3378 O "O5'" . DA  D 3 10  ? 18.827  68.448  55.384 1.00 27.82 ? 224  DA  D "O5'" 1 
ATOM   3379 C "C5'" . DA  D 3 10  ? 19.507  69.637  54.971 1.00 25.81 ? 224  DA  D "C5'" 1 
ATOM   3380 C "C4'" . DA  D 3 10  ? 18.773  70.300  53.811 1.00 23.56 ? 224  DA  D "C4'" 1 
ATOM   3381 O "O4'" . DA  D 3 10  ? 18.642  69.382  52.727 1.00 22.60 ? 224  DA  D "O4'" 1 
ATOM   3382 C "C3'" . DA  D 3 10  ? 17.356  70.657  54.205 1.00 23.31 ? 224  DA  D "C3'" 1 
ATOM   3383 O "O3'" . DA  D 3 10  ? 17.354  71.953  54.812 1.00 25.87 ? 224  DA  D "O3'" 1 
ATOM   3384 C "C2'" . DA  D 3 10  ? 16.680  70.684  52.832 1.00 20.80 ? 224  DA  D "C2'" 1 
ATOM   3385 C "C1'" . DA  D 3 10  ? 17.353  69.518  52.129 1.00 19.07 ? 224  DA  D "C1'" 1 
ATOM   3386 N N9    . DA  D 3 10  ? 16.589  68.272  52.267 1.00 17.35 ? 224  DA  D N9    1 
ATOM   3387 C C8    . DA  D 3 10  ? 16.193  67.607  53.399 1.00 15.79 ? 224  DA  D C8    1 
ATOM   3388 N N7    . DA  D 3 10  ? 15.514  66.520  53.157 1.00 16.32 ? 224  DA  D N7    1 
ATOM   3389 C C5    . DA  D 3 10  ? 15.456  66.465  51.772 1.00 16.17 ? 224  DA  D C5    1 
ATOM   3390 C C6    . DA  D 3 10  ? 14.867  65.565  50.881 1.00 17.17 ? 224  DA  D C6    1 
ATOM   3391 N N6    . DA  D 3 10  ? 14.177  64.496  51.270 1.00 19.30 ? 224  DA  D N6    1 
ATOM   3392 N N1    . DA  D 3 10  ? 14.999  65.818  49.572 1.00 16.25 ? 224  DA  D N1    1 
ATOM   3393 C C2    . DA  D 3 10  ? 15.664  66.885  49.176 1.00 15.63 ? 224  DA  D C2    1 
ATOM   3394 N N3    . DA  D 3 10  ? 16.257  67.803  49.912 1.00 17.46 ? 224  DA  D N3    1 
ATOM   3395 C C4    . DA  D 3 10  ? 16.111  67.527  51.223 1.00 16.41 ? 224  DA  D C4    1 
ATOM   3396 P P     . DT  D 3 11  ? 16.332  72.366  55.994 1.00 27.28 ? 225  DT  D P     1 
ATOM   3397 O OP1   . DT  D 3 11  ? 16.710  73.719  56.449 1.00 30.34 ? 225  DT  D OP1   1 
ATOM   3398 O OP2   . DT  D 3 11  ? 16.260  71.252  56.960 1.00 27.19 ? 225  DT  D OP2   1 
ATOM   3399 O "O5'" . DT  D 3 11  ? 14.908  72.475  55.281 1.00 26.65 ? 225  DT  D "O5'" 1 
ATOM   3400 C "C5'" . DT  D 3 11  ? 14.654  73.449  54.273 1.00 26.31 ? 225  DT  D "C5'" 1 
ATOM   3401 C "C4'" . DT  D 3 11  ? 13.424  73.056  53.496 1.00 25.83 ? 225  DT  D "C4'" 1 
ATOM   3402 O "O4'" . DT  D 3 11  ? 13.602  71.746  52.980 1.00 27.02 ? 225  DT  D "O4'" 1 
ATOM   3403 C "C3'" . DT  D 3 11  ? 12.245  72.896  54.439 1.00 25.86 ? 225  DT  D "C3'" 1 
ATOM   3404 O "O3'" . DT  D 3 11  ? 11.655  74.181  54.670 1.00 26.93 ? 225  DT  D "O3'" 1 
ATOM   3405 C "C2'" . DT  D 3 11  ? 11.323  71.970  53.642 1.00 25.90 ? 225  DT  D "C2'" 1 
ATOM   3406 C "C1'" . DT  D 3 11  ? 12.310  71.168  52.767 1.00 26.42 ? 225  DT  D "C1'" 1 
ATOM   3407 N N1    . DT  D 3 11  ? 12.334  69.735  53.122 1.00 25.40 ? 225  DT  D N1    1 
ATOM   3408 C C2    . DT  D 3 11  ? 11.983  68.814  52.149 1.00 24.56 ? 225  DT  D C2    1 
ATOM   3409 O O2    . DT  D 3 11  ? 11.714  69.129  50.996 1.00 24.91 ? 225  DT  D O2    1 
ATOM   3410 N N3    . DT  D 3 11  ? 12.003  67.489  52.536 1.00 25.08 ? 225  DT  D N3    1 
ATOM   3411 C C4    . DT  D 3 11  ? 12.344  67.004  53.792 1.00 26.01 ? 225  DT  D C4    1 
ATOM   3412 O O4    . DT  D 3 11  ? 12.296  65.796  54.025 1.00 28.11 ? 225  DT  D O4    1 
ATOM   3413 C C5    . DT  D 3 11  ? 12.709  68.035  54.738 1.00 25.76 ? 225  DT  D C5    1 
ATOM   3414 C C7    . DT  D 3 11  ? 13.142  67.659  56.143 1.00 25.09 ? 225  DT  D C7    1 
ATOM   3415 C C6    . DT  D 3 11  ? 12.690  69.335  54.387 1.00 25.96 ? 225  DT  D C6    1 
ATOM   3416 P P     . DA  D 3 12  ? 10.912  74.530  56.050 1.00 27.36 ? 226  DA  D P     1 
ATOM   3417 O OP1   . DA  D 3 12  ? 10.527  75.954  56.066 1.00 29.32 ? 226  DA  D OP1   1 
ATOM   3418 O OP2   . DA  D 3 12  ? 11.693  73.968  57.172 1.00 27.59 ? 226  DA  D OP2   1 
ATOM   3419 O "O5'" . DA  D 3 12  ? 9.602   73.694  55.839 1.00 28.16 ? 226  DA  D "O5'" 1 
ATOM   3420 C "C5'" . DA  D 3 12  ? 8.591   74.191  54.978 1.00 29.74 ? 226  DA  D "C5'" 1 
ATOM   3421 C "C4'" . DA  D 3 12  ? 7.386   73.295  55.036 1.00 32.45 ? 226  DA  D "C4'" 1 
ATOM   3422 O "O4'" . DA  D 3 12  ? 7.774   71.968  54.683 1.00 32.80 ? 226  DA  D "O4'" 1 
ATOM   3423 C "C3'" . DA  D 3 12  ? 6.858   73.218  56.471 1.00 34.87 ? 226  DA  D "C3'" 1 
ATOM   3424 O "O3'" . DA  D 3 12  ? 5.436   73.164  56.483 1.00 41.11 ? 226  DA  D "O3'" 1 
ATOM   3425 C "C2'" . DA  D 3 12  ? 7.441   71.910  56.976 1.00 32.88 ? 226  DA  D "C2'" 1 
ATOM   3426 C "C1'" . DA  D 3 12  ? 7.333   71.094  55.710 1.00 31.67 ? 226  DA  D "C1'" 1 
ATOM   3427 N N9    . DA  D 3 12  ? 8.182   69.904  55.741 1.00 30.02 ? 226  DA  D N9    1 
ATOM   3428 C C8    . DA  D 3 12  ? 9.373   69.678  56.380 1.00 29.54 ? 226  DA  D C8    1 
ATOM   3429 N N7    . DA  D 3 12  ? 9.846   68.472  56.192 1.00 30.10 ? 226  DA  D N7    1 
ATOM   3430 C C5    . DA  D 3 12  ? 8.898   67.871  55.373 1.00 28.49 ? 226  DA  D C5    1 
ATOM   3431 C C6    . DA  D 3 12  ? 8.810   66.607  54.800 1.00 28.50 ? 226  DA  D C6    1 
ATOM   3432 N N6    . DA  D 3 12  ? 9.711   65.640  54.980 1.00 29.79 ? 226  DA  D N6    1 
ATOM   3433 N N1    . DA  D 3 12  ? 7.746   66.375  54.038 1.00 28.16 ? 226  DA  D N1    1 
ATOM   3434 C C2    . DA  D 3 12  ? 6.834   67.312  53.853 1.00 28.35 ? 226  DA  D C2    1 
ATOM   3435 N N3    . DA  D 3 12  ? 6.800   68.531  54.333 1.00 28.23 ? 226  DA  D N3    1 
ATOM   3436 C C4    . DA  D 3 12  ? 7.885   68.742  55.097 1.00 28.92 ? 226  DA  D C4    1 
ATOM   3437 P P     . DG  D 3 13  ? 4.665   74.140  57.502 1.00 46.92 ? 227  DG  D P     1 
ATOM   3438 O OP1   . DG  D 3 13  ? 4.663   75.505  56.922 1.00 45.07 ? 227  DG  D OP1   1 
ATOM   3439 O OP2   . DG  D 3 13  ? 5.226   73.918  58.858 1.00 45.14 ? 227  DG  D OP2   1 
ATOM   3440 O "O5'" . DG  D 3 13  ? 3.160   73.556  57.473 1.00 44.63 ? 227  DG  D "O5'" 1 
ATOM   3441 C "C5'" . DG  D 3 13  ? 2.405   73.476  56.265 1.00 45.01 ? 227  DG  D "C5'" 1 
ATOM   3442 C "C4'" . DG  D 3 13  ? 1.774   72.095  56.097 1.00 46.56 ? 227  DG  D "C4'" 1 
ATOM   3443 O "O4'" . DG  D 3 13  ? 2.795   71.099  55.910 1.00 45.59 ? 227  DG  D "O4'" 1 
ATOM   3444 C "C3'" . DG  D 3 13  ? 0.980   71.676  57.356 1.00 47.71 ? 227  DG  D "C3'" 1 
ATOM   3445 O "O3'" . DG  D 3 13  ? -0.226  70.971  57.010 1.00 51.04 ? 227  DG  D "O3'" 1 
ATOM   3446 C "C2'" . DG  D 3 13  ? 1.963   70.718  58.018 1.00 45.18 ? 227  DG  D "C2'" 1 
ATOM   3447 C "C1'" . DG  D 3 13  ? 2.523   70.018  56.793 1.00 42.20 ? 227  DG  D "C1'" 1 
ATOM   3448 N N9    . DG  D 3 13  ? 3.737   69.267  57.153 1.00 39.09 ? 227  DG  D N9    1 
ATOM   3449 C C8    . DG  D 3 13  ? 4.803   69.654  57.931 1.00 37.70 ? 227  DG  D C8    1 
ATOM   3450 N N7    . DG  D 3 13  ? 5.692   68.712  58.100 1.00 37.64 ? 227  DG  D N7    1 
ATOM   3451 C C5    . DG  D 3 13  ? 5.179   67.628  57.384 1.00 36.66 ? 227  DG  D C5    1 
ATOM   3452 C C6    . DG  D 3 13  ? 5.690   66.309  57.221 1.00 36.18 ? 227  DG  D C6    1 
ATOM   3453 O O6    . DG  D 3 13  ? 6.710   65.811  57.688 1.00 37.45 ? 227  DG  D O6    1 
ATOM   3454 N N1    . DG  D 3 13  ? 4.855   65.535  56.449 1.00 35.17 ? 227  DG  D N1    1 
ATOM   3455 C C2    . DG  D 3 13  ? 3.670   65.959  55.896 1.00 35.61 ? 227  DG  D C2    1 
ATOM   3456 N N2    . DG  D 3 13  ? 2.999   65.067  55.174 1.00 35.97 ? 227  DG  D N2    1 
ATOM   3457 N N3    . DG  D 3 13  ? 3.181   67.190  56.046 1.00 36.15 ? 227  DG  D N3    1 
ATOM   3458 C C4    . DG  D 3 13  ? 3.988   67.966  56.801 1.00 37.17 ? 227  DG  D C4    1 
ATOM   3459 P P     . DC  D 3 14  ? -1.462  70.856  58.048 1.00 52.76 ? 228  DC  D P     1 
ATOM   3460 O OP1   . DC  D 3 14  ? -2.685  70.528  57.275 1.00 53.59 ? 228  DC  D OP1   1 
ATOM   3461 O OP2   . DC  D 3 14  ? -1.449  72.059  58.912 1.00 51.49 ? 228  DC  D OP2   1 
ATOM   3462 O "O5'" . DC  D 3 14  ? -1.047  69.570  58.945 1.00 49.26 ? 228  DC  D "O5'" 1 
ATOM   3463 C "C5'" . DC  D 3 14  ? -1.700  68.302  58.809 1.00 47.82 ? 228  DC  D "C5'" 1 
ATOM   3464 C "C4'" . DC  D 3 14  ? -1.042  67.445  57.738 1.00 47.64 ? 228  DC  D "C4'" 1 
ATOM   3465 O "O4'" . DC  D 3 14  ? 0.366   67.414  57.969 1.00 47.52 ? 228  DC  D "O4'" 1 
ATOM   3466 C "C3'" . DC  D 3 14  ? -1.466  65.966  57.803 1.00 48.71 ? 228  DC  D "C3'" 1 
ATOM   3467 O "O3'" . DC  D 3 14  ? -1.224  65.337  56.528 1.00 49.86 ? 228  DC  D "O3'" 1 
ATOM   3468 C "C2'" . DC  D 3 14  ? -0.468  65.446  58.843 1.00 46.81 ? 228  DC  D "C2'" 1 
ATOM   3469 C "C1'" . DC  D 3 14  ? 0.768   66.069  58.254 1.00 43.95 ? 228  DC  D "C1'" 1 
ATOM   3470 N N1    . DC  D 3 14  ? 1.960   66.081  59.115 1.00 41.50 ? 228  DC  D N1    1 
ATOM   3471 C C2    . DC  D 3 14  ? 2.748   64.948  59.134 1.00 40.68 ? 228  DC  D C2    1 
ATOM   3472 O O2    . DC  D 3 14  ? 2.403   63.939  58.522 1.00 40.17 ? 228  DC  D O2    1 
ATOM   3473 N N3    . DC  D 3 14  ? 3.898   64.983  59.857 1.00 40.37 ? 228  DC  D N3    1 
ATOM   3474 C C4    . DC  D 3 14  ? 4.252   66.086  60.536 1.00 40.90 ? 228  DC  D C4    1 
ATOM   3475 N N4    . DC  D 3 14  ? 5.394   66.097  61.217 1.00 41.95 ? 228  DC  D N4    1 
ATOM   3476 C C5    . DC  D 3 14  ? 3.438   67.259  60.532 1.00 40.54 ? 228  DC  D C5    1 
ATOM   3477 C C6    . DC  D 3 14  ? 2.305   67.206  59.808 1.00 40.89 ? 228  DC  D C6    1 
ATOM   3478 O "O5'" . DG  E 2 1   ? 1.188   121.165 25.941 1.00 59.76 ? 201  DG  E "O5'" 1 
ATOM   3479 C "C5'" . DG  E 2 1   ? 0.380   122.242 25.468 1.00 56.35 ? 201  DG  E "C5'" 1 
ATOM   3480 C "C4'" . DG  E 2 1   ? -1.015  121.767 25.087 1.00 56.53 ? 201  DG  E "C4'" 1 
ATOM   3481 O "O4'" . DG  E 2 1   ? -0.963  120.607 24.259 1.00 55.61 ? 201  DG  E "O4'" 1 
ATOM   3482 C "C3'" . DG  E 2 1   ? -1.762  121.219 26.280 1.00 57.41 ? 201  DG  E "C3'" 1 
ATOM   3483 O "O3'" . DG  E 2 1   ? -2.193  122.268 27.139 1.00 60.06 ? 201  DG  E "O3'" 1 
ATOM   3484 C "C2'" . DG  E 2 1   ? -2.942  120.571 25.574 1.00 55.42 ? 201  DG  E "C2'" 1 
ATOM   3485 C "C1'" . DG  E 2 1   ? -2.263  119.990 24.331 1.00 53.35 ? 201  DG  E "C1'" 1 
ATOM   3486 N N9    . DG  E 2 1   ? -2.157  118.506 24.335 1.00 49.98 ? 201  DG  E N9    1 
ATOM   3487 C C8    . DG  E 2 1   ? -1.157  117.733 23.802 1.00 49.45 ? 201  DG  E C8    1 
ATOM   3488 N N7    . DG  E 2 1   ? -1.370  116.450 23.882 1.00 47.85 ? 201  DG  E N7    1 
ATOM   3489 C C5    . DG  E 2 1   ? -2.599  116.359 24.517 1.00 46.51 ? 201  DG  E C5    1 
ATOM   3490 C C6    . DG  E 2 1   ? -3.349  115.210 24.868 1.00 45.81 ? 201  DG  E C6    1 
ATOM   3491 O O6    . DG  E 2 1   ? -3.068  114.033 24.660 1.00 45.19 ? 201  DG  E O6    1 
ATOM   3492 N N1    . DG  E 2 1   ? -4.539  115.551 25.495 1.00 45.09 ? 201  DG  E N1    1 
ATOM   3493 C C2    . DG  E 2 1   ? -4.958  116.838 25.752 1.00 45.34 ? 201  DG  E C2    1 
ATOM   3494 N N2    . DG  E 2 1   ? -6.124  116.987 26.378 1.00 44.44 ? 201  DG  E N2    1 
ATOM   3495 N N3    . DG  E 2 1   ? -4.251  117.919 25.415 1.00 46.48 ? 201  DG  E N3    1 
ATOM   3496 C C4    . DG  E 2 1   ? -3.089  117.608 24.804 1.00 47.86 ? 201  DG  E C4    1 
ATOM   3497 P P     . DC  E 2 2   ? -1.633  122.300 28.647 1.00 64.52 ? 202  DC  E P     1 
ATOM   3498 O OP1   . DC  E 2 2   ? -0.510  123.272 28.698 1.00 62.31 ? 202  DC  E OP1   1 
ATOM   3499 O OP2   . DC  E 2 2   ? -1.407  120.904 29.088 1.00 63.23 ? 202  DC  E OP2   1 
ATOM   3500 O "O5'" . DC  E 2 2   ? -2.883  122.907 29.495 1.00 61.91 ? 202  DC  E "O5'" 1 
ATOM   3501 C "C5'" . DC  E 2 2   ? -4.258  122.736 29.103 1.00 58.85 ? 202  DC  E "C5'" 1 
ATOM   3502 C "C4'" . DC  E 2 2   ? -4.800  121.311 29.295 1.00 55.70 ? 202  DC  E "C4'" 1 
ATOM   3503 O "O4'" . DC  E 2 2   ? -4.107  120.365 28.492 1.00 55.15 ? 202  DC  E "O4'" 1 
ATOM   3504 C "C3'" . DC  E 2 2   ? -4.523  120.759 30.679 1.00 54.88 ? 202  DC  E "C3'" 1 
ATOM   3505 O "O3'" . DC  E 2 2   ? -5.407  121.308 31.662 1.00 53.58 ? 202  DC  E "O3'" 1 
ATOM   3506 C "C2'" . DC  E 2 2   ? -4.838  119.278 30.459 1.00 54.30 ? 202  DC  E "C2'" 1 
ATOM   3507 C "C1'" . DC  E 2 2   ? -4.530  119.083 28.973 1.00 53.69 ? 202  DC  E "C1'" 1 
ATOM   3508 N N1    . DC  E 2 2   ? -3.515  118.020 28.740 1.00 52.11 ? 202  DC  E N1    1 
ATOM   3509 C C2    . DC  E 2 2   ? -3.911  116.697 28.901 1.00 51.71 ? 202  DC  E C2    1 
ATOM   3510 O O2    . DC  E 2 2   ? -5.052  116.420 29.268 1.00 52.40 ? 202  DC  E O2    1 
ATOM   3511 N N3    . DC  E 2 2   ? -3.005  115.714 28.646 1.00 50.00 ? 202  DC  E N3    1 
ATOM   3512 C C4    . DC  E 2 2   ? -1.764  116.007 28.253 1.00 49.85 ? 202  DC  E C4    1 
ATOM   3513 N N4    . DC  E 2 2   ? -0.918  115.012 28.001 1.00 50.05 ? 202  DC  E N4    1 
ATOM   3514 C C5    . DC  E 2 2   ? -1.337  117.365 28.087 1.00 50.34 ? 202  DC  E C5    1 
ATOM   3515 C C6    . DC  E 2 2   ? -2.246  118.328 28.342 1.00 51.14 ? 202  DC  E C6    1 
ATOM   3516 P P     . DT  E 2 3   ? -4.965  121.285 33.211 1.00 52.65 ? 203  DT  E P     1 
ATOM   3517 O OP1   . DT  E 2 3   ? -5.863  122.182 33.972 1.00 52.66 ? 203  DT  E OP1   1 
ATOM   3518 O OP2   . DT  E 2 3   ? -3.497  121.494 33.262 1.00 51.07 ? 203  DT  E OP2   1 
ATOM   3519 O "O5'" . DT  E 2 3   ? -5.292  119.771 33.646 1.00 48.99 ? 203  DT  E "O5'" 1 
ATOM   3520 C "C5'" . DT  E 2 3   ? -6.605  119.366 34.050 1.00 45.65 ? 203  DT  E "C5'" 1 
ATOM   3521 C "C4'" . DT  E 2 3   ? -6.674  117.853 34.272 1.00 42.78 ? 203  DT  E "C4'" 1 
ATOM   3522 O "O4'" . DT  E 2 3   ? -6.237  117.162 33.101 1.00 42.44 ? 203  DT  E "O4'" 1 
ATOM   3523 C "C3'" . DT  E 2 3   ? -5.674  117.409 35.318 1.00 41.50 ? 203  DT  E "C3'" 1 
ATOM   3524 O "O3'" . DT  E 2 3   ? -6.173  117.603 36.635 1.00 40.37 ? 203  DT  E "O3'" 1 
ATOM   3525 C "C2'" . DT  E 2 3   ? -5.559  115.937 34.985 1.00 39.98 ? 203  DT  E "C2'" 1 
ATOM   3526 C "C1'" . DT  E 2 3   ? -5.482  116.000 33.472 1.00 39.70 ? 203  DT  E "C1'" 1 
ATOM   3527 N N1    . DT  E 2 3   ? -4.101  116.101 32.944 1.00 37.81 ? 203  DT  E N1    1 
ATOM   3528 C C2    . DT  E 2 3   ? -3.573  114.991 32.329 1.00 36.49 ? 203  DT  E C2    1 
ATOM   3529 O O2    . DT  E 2 3   ? -4.165  113.921 32.247 1.00 36.59 ? 203  DT  E O2    1 
ATOM   3530 N N3    . DT  E 2 3   ? -2.321  115.136 31.801 1.00 36.44 ? 203  DT  E N3    1 
ATOM   3531 C C4    . DT  E 2 3   ? -1.546  116.266 31.824 1.00 37.53 ? 203  DT  E C4    1 
ATOM   3532 O O4    . DT  E 2 3   ? -0.442  116.269 31.282 1.00 37.44 ? 203  DT  E O4    1 
ATOM   3533 C C5    . DT  E 2 3   ? -2.169  117.376 32.493 1.00 37.91 ? 203  DT  E C5    1 
ATOM   3534 C C7    . DT  E 2 3   ? -1.435  118.701 32.609 1.00 40.17 ? 203  DT  E C7    1 
ATOM   3535 C C6    . DT  E 2 3   ? -3.394  117.263 33.018 1.00 37.77 ? 203  DT  E C6    1 
ATOM   3536 P P     . DA  E 2 4   ? -5.129  117.886 37.830 1.00 42.99 ? 204  DA  E P     1 
ATOM   3537 O OP1   . DA  E 2 4   ? -5.891  117.995 39.099 1.00 42.72 ? 204  DA  E OP1   1 
ATOM   3538 O OP2   . DA  E 2 4   ? -4.191  118.965 37.428 1.00 38.86 ? 204  DA  E OP2   1 
ATOM   3539 O "O5'" . DA  E 2 4   ? -4.336  116.495 37.846 1.00 39.13 ? 204  DA  E "O5'" 1 
ATOM   3540 C "C5'" . DA  E 2 4   ? -4.941  115.321 38.385 1.00 34.67 ? 204  DA  E "C5'" 1 
ATOM   3541 C "C4'" . DA  E 2 4   ? -3.867  114.367 38.801 1.00 31.25 ? 204  DA  E "C4'" 1 
ATOM   3542 O "O4'" . DA  E 2 4   ? -3.064  114.032 37.672 1.00 30.85 ? 204  DA  E "O4'" 1 
ATOM   3543 C "C3'" . DA  E 2 4   ? -2.966  115.086 39.777 1.00 29.47 ? 204  DA  E "C3'" 1 
ATOM   3544 O "O3'" . DA  E 2 4   ? -2.730  114.290 40.915 1.00 30.25 ? 204  DA  E "O3'" 1 
ATOM   3545 C "C2'" . DA  E 2 4   ? -1.689  115.345 39.003 1.00 30.20 ? 204  DA  E "C2'" 1 
ATOM   3546 C "C1'" . DA  E 2 4   ? -1.690  114.229 37.983 1.00 30.55 ? 204  DA  E "C1'" 1 
ATOM   3547 N N9    . DA  E 2 4   ? -0.982  114.640 36.755 1.00 30.23 ? 204  DA  E N9    1 
ATOM   3548 C C8    . DA  E 2 4   ? -1.315  115.639 35.878 1.00 31.39 ? 204  DA  E C8    1 
ATOM   3549 N N7    . DA  E 2 4   ? -0.526  115.723 34.844 1.00 30.96 ? 204  DA  E N7    1 
ATOM   3550 C C5    . DA  E 2 4   ? 0.400   114.705 35.052 1.00 29.40 ? 204  DA  E C5    1 
ATOM   3551 C C6    . DA  E 2 4   ? 1.488   114.256 34.297 1.00 28.47 ? 204  DA  E C6    1 
ATOM   3552 N N6    . DA  E 2 4   ? 1.842   114.793 33.129 1.00 27.33 ? 204  DA  E N6    1 
ATOM   3553 N N1    . DA  E 2 4   ? 2.176   113.221 34.785 1.00 28.71 ? 204  DA  E N1    1 
ATOM   3554 C C2    . DA  E 2 4   ? 1.807   112.677 35.936 1.00 28.53 ? 204  DA  E C2    1 
ATOM   3555 N N3    . DA  E 2 4   ? 0.810   113.001 36.735 1.00 27.98 ? 204  DA  E N3    1 
ATOM   3556 C C4    . DA  E 2 4   ? 0.133   114.044 36.218 1.00 29.41 ? 204  DA  E C4    1 
ATOM   3557 P P     . DT  E 2 5   ? -1.936  114.916 42.143 1.00 32.18 ? 205  DT  E P     1 
ATOM   3558 O OP1   . DT  E 2 5   ? -2.458  114.322 43.394 1.00 32.54 ? 205  DT  E OP1   1 
ATOM   3559 O OP2   . DT  E 2 5   ? -1.876  116.385 41.973 1.00 31.45 ? 205  DT  E OP2   1 
ATOM   3560 O "O5'" . DT  E 2 5   ? -0.465  114.345 41.880 1.00 30.54 ? 205  DT  E "O5'" 1 
ATOM   3561 C "C5'" . DT  E 2 5   ? -0.011  113.125 42.454 1.00 27.24 ? 205  DT  E "C5'" 1 
ATOM   3562 C "C4'" . DT  E 2 5   ? 1.488   113.030 42.292 1.00 25.49 ? 205  DT  E "C4'" 1 
ATOM   3563 O "O4'" . DT  E 2 5   ? 1.830   113.097 40.923 1.00 23.62 ? 205  DT  E "O4'" 1 
ATOM   3564 C "C3'" . DT  E 2 5   ? 2.119   114.272 42.863 1.00 24.30 ? 205  DT  E "C3'" 1 
ATOM   3565 O "O3'" . DT  E 2 5   ? 2.312   114.074 44.267 1.00 25.65 ? 205  DT  E "O3'" 1 
ATOM   3566 C "C2'" . DT  E 2 5   ? 3.433   114.378 42.099 1.00 23.17 ? 205  DT  E "C2'" 1 
ATOM   3567 C "C1'" . DT  E 2 5   ? 3.166   113.563 40.843 1.00 23.26 ? 205  DT  E "C1'" 1 
ATOM   3568 N N1    . DT  E 2 5   ? 3.303   114.329 39.595 1.00 23.63 ? 205  DT  E N1    1 
ATOM   3569 C C2    . DT  E 2 5   ? 4.281   113.918 38.710 1.00 23.12 ? 205  DT  E C2    1 
ATOM   3570 O O2    . DT  E 2 5   ? 5.050   112.994 38.957 1.00 23.02 ? 205  DT  E O2    1 
ATOM   3571 N N3    . DT  E 2 5   ? 4.356   114.621 37.527 1.00 24.03 ? 205  DT  E N3    1 
ATOM   3572 C C4    . DT  E 2 5   ? 3.556   115.686 37.151 1.00 24.22 ? 205  DT  E C4    1 
ATOM   3573 O O4    . DT  E 2 5   ? 3.707   116.221 36.054 1.00 25.29 ? 205  DT  E O4    1 
ATOM   3574 C C5    . DT  E 2 5   ? 2.568   116.052 38.138 1.00 24.15 ? 205  DT  E C5    1 
ATOM   3575 C C7    . DT  E 2 5   ? 1.632   117.216 37.855 1.00 23.90 ? 205  DT  E C7    1 
ATOM   3576 C C6    . DT  E 2 5   ? 2.469   115.381 39.303 1.00 23.77 ? 205  DT  E C6    1 
ATOM   3577 P P     . DA  E 2 6   ? 2.678   115.310 45.205 1.00 26.27 ? 206  DA  E P     1 
ATOM   3578 O OP1   . DA  E 2 6   ? 2.157   115.045 46.560 1.00 29.43 ? 206  DA  E OP1   1 
ATOM   3579 O OP2   . DA  E 2 6   ? 2.291   116.545 44.491 1.00 28.27 ? 206  DA  E OP2   1 
ATOM   3580 O "O5'" . DA  E 2 6   ? 4.270   115.282 45.278 1.00 25.24 ? 206  DA  E "O5'" 1 
ATOM   3581 C "C5'" . DA  E 2 6   ? 5.003   114.161 45.767 1.00 23.60 ? 206  DA  E "C5'" 1 
ATOM   3582 C "C4'" . DA  E 2 6   ? 6.397   114.214 45.206 1.00 22.34 ? 206  DA  E "C4'" 1 
ATOM   3583 O "O4'" . DA  E 2 6   ? 6.312   114.227 43.796 1.00 24.66 ? 206  DA  E "O4'" 1 
ATOM   3584 C "C3'" . DA  E 2 6   ? 6.982   115.561 45.536 1.00 23.32 ? 206  DA  E "C3'" 1 
ATOM   3585 O "O3'" . DA  E 2 6   ? 7.682   115.409 46.751 1.00 26.54 ? 206  DA  E "O3'" 1 
ATOM   3586 C "C2'" . DA  E 2 6   ? 7.943   115.845 44.397 1.00 21.37 ? 206  DA  E "C2'" 1 
ATOM   3587 C "C1'" . DA  E 2 6   ? 7.310   115.092 43.253 1.00 21.76 ? 206  DA  E "C1'" 1 
ATOM   3588 N N9    . DA  E 2 6   ? 6.719   115.955 42.210 1.00 20.77 ? 206  DA  E N9    1 
ATOM   3589 C C8    . DA  E 2 6   ? 5.737   116.912 42.296 1.00 19.48 ? 206  DA  E C8    1 
ATOM   3590 N N7    . DA  E 2 6   ? 5.440   117.462 41.148 1.00 19.18 ? 206  DA  E N7    1 
ATOM   3591 C C5    . DA  E 2 6   ? 6.285   116.826 40.245 1.00 19.31 ? 206  DA  E C5    1 
ATOM   3592 C C6    . DA  E 2 6   ? 6.465   116.943 38.869 1.00 18.92 ? 206  DA  E C6    1 
ATOM   3593 N N6    . DA  E 2 6   ? 5.796   117.796 38.103 1.00 19.99 ? 206  DA  E N6    1 
ATOM   3594 N N1    . DA  E 2 6   ? 7.376   116.146 38.309 1.00 19.67 ? 206  DA  E N1    1 
ATOM   3595 C C2    . DA  E 2 6   ? 8.062   115.298 39.048 1.00 17.70 ? 206  DA  E C2    1 
ATOM   3596 N N3    . DA  E 2 6   ? 7.990   115.094 40.339 1.00 19.11 ? 206  DA  E N3    1 
ATOM   3597 C C4    . DA  E 2 6   ? 7.064   115.908 40.885 1.00 19.72 ? 206  DA  E C4    1 
ATOM   3598 P P     . DT  E 2 7   ? 7.723   116.561 47.834 1.00 27.80 ? 207  DT  E P     1 
ATOM   3599 O OP1   . DT  E 2 7   ? 8.342   115.979 49.046 1.00 31.35 ? 207  DT  E OP1   1 
ATOM   3600 O OP2   . DT  E 2 7   ? 6.387   117.191 47.894 1.00 28.46 ? 207  DT  E OP2   1 
ATOM   3601 O "O5'" . DT  E 2 7   ? 8.734   117.631 47.230 1.00 26.08 ? 207  DT  E "O5'" 1 
ATOM   3602 C "C5'" . DT  E 2 7   ? 10.129  117.376 47.167 1.00 23.70 ? 207  DT  E "C5'" 1 
ATOM   3603 C "C4'" . DT  E 2 7   ? 10.760  118.330 46.196 1.00 22.90 ? 207  DT  E "C4'" 1 
ATOM   3604 O "O4'" . DT  E 2 7   ? 10.210  118.131 44.913 1.00 23.28 ? 207  DT  E "O4'" 1 
ATOM   3605 C "C3'" . DT  E 2 7   ? 10.307  119.736 46.499 1.00 24.19 ? 207  DT  E "C3'" 1 
ATOM   3606 O "O3'" . DT  E 2 7   ? 11.067  120.227 47.607 1.00 28.33 ? 207  DT  E "O3'" 1 
ATOM   3607 C "C2'" . DT  E 2 7   ? 10.680  120.422 45.189 1.00 23.96 ? 207  DT  E "C2'" 1 
ATOM   3608 C "C1'" . DT  E 2 7   ? 10.482  119.302 44.163 1.00 21.47 ? 207  DT  E "C1'" 1 
ATOM   3609 N N1    . DT  E 2 7   ? 9.388   119.580 43.214 1.00 20.51 ? 207  DT  E N1    1 
ATOM   3610 C C2    . DT  E 2 7   ? 9.666   119.389 41.886 1.00 20.04 ? 207  DT  E C2    1 
ATOM   3611 O O2    . DT  E 2 7   ? 10.749  118.968 41.495 1.00 22.27 ? 207  DT  E O2    1 
ATOM   3612 N N3    . DT  E 2 7   ? 8.661   119.686 41.001 1.00 20.08 ? 207  DT  E N3    1 
ATOM   3613 C C4    . DT  E 2 7   ? 7.412   120.151 41.317 1.00 20.68 ? 207  DT  E C4    1 
ATOM   3614 O O4    . DT  E 2 7   ? 6.605   120.393 40.421 1.00 21.19 ? 207  DT  E O4    1 
ATOM   3615 C C5    . DT  E 2 7   ? 7.198   120.319 42.738 1.00 20.84 ? 207  DT  E C5    1 
ATOM   3616 C C7    . DT  E 2 7   ? 5.852   120.823 43.243 1.00 20.51 ? 207  DT  E C7    1 
ATOM   3617 C C6    . DT  E 2 7   ? 8.168   120.036 43.622 1.00 20.04 ? 207  DT  E C6    1 
ATOM   3618 P P     . DA  E 2 8   ? 10.632  121.519 48.456 1.00 28.66 ? 208  DA  E P     1 
ATOM   3619 O OP1   . DA  E 2 8   ? 10.981  121.285 49.875 1.00 30.08 ? 208  DA  E OP1   1 
ATOM   3620 O OP2   . DA  E 2 8   ? 9.248   121.868 48.068 1.00 29.41 ? 208  DA  E OP2   1 
ATOM   3621 O "O5'" . DA  E 2 8   ? 11.606  122.652 47.893 1.00 27.16 ? 208  DA  E "O5'" 1 
ATOM   3622 C "C5'" . DA  E 2 8   ? 12.999  122.559 48.134 1.00 26.94 ? 208  DA  E "C5'" 1 
ATOM   3623 C "C4'" . DA  E 2 8   ? 13.786  123.208 47.010 1.00 24.87 ? 208  DA  E "C4'" 1 
ATOM   3624 O "O4'" . DA  E 2 8   ? 13.387  122.666 45.764 1.00 24.53 ? 208  DA  E "O4'" 1 
ATOM   3625 C "C3'" . DA  E 2 8   ? 13.507  124.685 46.956 1.00 23.51 ? 208  DA  E "C3'" 1 
ATOM   3626 O "O3'" . DA  E 2 8   ? 14.516  125.323 47.729 1.00 24.14 ? 208  DA  E "O3'" 1 
ATOM   3627 C "C2'" . DA  E 2 8   ? 13.672  124.987 45.478 1.00 21.64 ? 208  DA  E "C2'" 1 
ATOM   3628 C "C1'" . DA  E 2 8   ? 13.215  123.698 44.820 1.00 20.83 ? 208  DA  E "C1'" 1 
ATOM   3629 N N9    . DA  E 2 8   ? 11.810  123.727 44.407 1.00 19.70 ? 208  DA  E N9    1 
ATOM   3630 C C8    . DA  E 2 8   ? 10.688  123.998 45.140 1.00 18.19 ? 208  DA  E C8    1 
ATOM   3631 N N7    . DA  E 2 8   ? 9.595   123.959 44.444 1.00 19.75 ? 208  DA  E N7    1 
ATOM   3632 C C5    . DA  E 2 8   ? 10.026  123.638 43.159 1.00 20.16 ? 208  DA  E C5    1 
ATOM   3633 C C6    . DA  E 2 8   ? 9.351   123.457 41.935 1.00 21.27 ? 208  DA  E C6    1 
ATOM   3634 N N6    . DA  E 2 8   ? 8.025   123.574 41.786 1.00 22.64 ? 208  DA  E N6    1 
ATOM   3635 N N1    . DA  E 2 8   ? 10.100  123.158 40.868 1.00 20.40 ? 208  DA  E N1    1 
ATOM   3636 C C2    . DA  E 2 8   ? 11.410  123.047 41.002 1.00 20.42 ? 208  DA  E C2    1 
ATOM   3637 N N3    . DA  E 2 8   ? 12.153  123.192 42.080 1.00 20.98 ? 208  DA  E N3    1 
ATOM   3638 C C4    . DA  E 2 8   ? 11.378  123.494 43.140 1.00 19.52 ? 208  DA  E C4    1 
ATOM   3639 P P     . DA  E 2 9   ? 14.164  126.549 48.682 1.00 27.79 ? 209  DA  E P     1 
ATOM   3640 O OP1   . DA  E 2 9   ? 15.226  126.614 49.708 1.00 31.49 ? 209  DA  E OP1   1 
ATOM   3641 O OP2   . DA  E 2 9   ? 12.748  126.449 49.080 1.00 28.65 ? 209  DA  E OP2   1 
ATOM   3642 O "O5'" . DA  E 2 9   ? 14.307  127.829 47.743 1.00 27.55 ? 209  DA  E "O5'" 1 
ATOM   3643 C "C5'" . DA  E 2 9   ? 15.555  128.141 47.111 1.00 26.73 ? 209  DA  E "C5'" 1 
ATOM   3644 C "C4'" . DA  E 2 9   ? 15.322  128.831 45.772 1.00 25.93 ? 209  DA  E "C4'" 1 
ATOM   3645 O "O4'" . DA  E 2 9   ? 14.560  127.984 44.921 1.00 24.88 ? 209  DA  E "O4'" 1 
ATOM   3646 C "C3'" . DA  E 2 9   ? 14.470  130.070 45.976 1.00 26.13 ? 209  DA  E "C3'" 1 
ATOM   3647 O "O3'" . DA  E 2 9   ? 15.339  131.185 46.213 1.00 29.19 ? 209  DA  E "O3'" 1 
ATOM   3648 C "C2'" . DA  E 2 9   ? 13.753  130.198 44.644 1.00 23.30 ? 209  DA  E "C2'" 1 
ATOM   3649 C "C1'" . DA  E 2 9   ? 13.646  128.759 44.170 1.00 23.09 ? 209  DA  E "C1'" 1 
ATOM   3650 N N9    . DA  E 2 9   ? 12.275  128.236 44.285 1.00 22.73 ? 209  DA  E N9    1 
ATOM   3651 C C8    . DA  E 2 9   ? 11.452  128.164 45.381 1.00 22.69 ? 209  DA  E C8    1 
ATOM   3652 N N7    . DA  E 2 9   ? 10.269  127.672 45.120 1.00 23.23 ? 209  DA  E N7    1 
ATOM   3653 C C5    . DA  E 2 9   ? 10.313  127.401 43.755 1.00 22.10 ? 209  DA  E C5    1 
ATOM   3654 C C6    . DA  E 2 9   ? 9.381   126.855 42.864 1.00 22.03 ? 209  DA  E C6    1 
ATOM   3655 N N6    . DA  E 2 9   ? 8.146   126.501 43.212 1.00 22.73 ? 209  DA  E N6    1 
ATOM   3656 N N1    . DA  E 2 9   ? 9.766   126.706 41.596 1.00 20.91 ? 209  DA  E N1    1 
ATOM   3657 C C2    . DA  E 2 9   ? 10.984  127.076 41.240 1.00 21.54 ? 209  DA  E C2    1 
ATOM   3658 N N3    . DA  E 2 9   ? 11.947  127.601 41.971 1.00 21.40 ? 209  DA  E N3    1 
ATOM   3659 C C4    . DA  E 2 9   ? 11.533  127.738 43.243 1.00 22.14 ? 209  DA  E C4    1 
ATOM   3660 P P     . DG  E 2 10  ? 15.006  132.339 47.302 1.00 32.52 ? 210  DG  E P     1 
ATOM   3661 O OP1   . DG  E 2 10  ? 16.283  132.817 47.875 1.00 34.56 ? 210  DG  E OP1   1 
ATOM   3662 O OP2   . DG  E 2 10  ? 13.935  131.852 48.198 1.00 34.48 ? 210  DG  E OP2   1 
ATOM   3663 O "O5'" . DG  E 2 10  ? 14.408  133.526 46.416 1.00 32.84 ? 210  DG  E "O5'" 1 
ATOM   3664 C "C5'" . DG  E 2 10  ? 13.196  133.308 45.730 1.00 34.60 ? 210  DG  E "C5'" 1 
ATOM   3665 C "C4'" . DG  E 2 10  ? 12.852  134.434 44.809 1.00 36.31 ? 210  DG  E "C4'" 1 
ATOM   3666 O "O4'" . DG  E 2 10  ? 11.906  133.984 43.828 1.00 37.82 ? 210  DG  E "O4'" 1 
ATOM   3667 C "C3'" . DG  E 2 10  ? 12.142  135.522 45.585 1.00 38.22 ? 210  DG  E "C3'" 1 
ATOM   3668 O "O3'" . DG  E 2 10  ? 12.189  136.727 44.835 1.00 40.67 ? 210  DG  E "O3'" 1 
ATOM   3669 C "C2'" . DG  E 2 10  ? 10.727  134.956 45.620 1.00 37.19 ? 210  DG  E "C2'" 1 
ATOM   3670 C "C1'" . DG  E 2 10  ? 10.585  134.390 44.197 1.00 36.85 ? 210  DG  E "C1'" 1 
ATOM   3671 N N9    . DG  E 2 10  ? 9.630   133.248 44.156 1.00 34.65 ? 210  DG  E N9    1 
ATOM   3672 C C8    . DG  E 2 10  ? 8.593   133.025 43.274 1.00 34.81 ? 210  DG  E C8    1 
ATOM   3673 N N7    . DG  E 2 10  ? 7.890   131.956 43.536 1.00 33.88 ? 210  DG  E N7    1 
ATOM   3674 C C5    . DG  E 2 10  ? 8.503   131.430 44.668 1.00 32.35 ? 210  DG  E C5    1 
ATOM   3675 C C6    . DG  E 2 10  ? 8.178   130.275 45.415 1.00 31.87 ? 210  DG  E C6    1 
ATOM   3676 O O6    . DG  E 2 10  ? 7.260   129.482 45.233 1.00 30.87 ? 210  DG  E O6    1 
ATOM   3677 N N1    . DG  E 2 10  ? 9.049   130.100 46.479 1.00 32.15 ? 210  DG  E N1    1 
ATOM   3678 C C2    . DG  E 2 10  ? 10.104  130.934 46.789 1.00 32.05 ? 210  DG  E C2    1 
ATOM   3679 N N2    . DG  E 2 10  ? 10.865  130.606 47.838 1.00 33.52 ? 210  DG  E N2    1 
ATOM   3680 N N3    . DG  E 2 10  ? 10.403  132.020 46.089 1.00 31.66 ? 210  DG  E N3    1 
ATOM   3681 C C4    . DG  E 2 10  ? 9.567   132.208 45.049 1.00 32.90 ? 210  DG  E C4    1 
ATOM   3682 P P     . DG  E 2 11  ? 11.847  138.146 45.496 1.00 41.42 ? 211  DG  E P     1 
ATOM   3683 O OP1   . DG  E 2 11  ? 12.847  139.120 45.001 1.00 40.71 ? 211  DG  E OP1   1 
ATOM   3684 O OP2   . DG  E 2 11  ? 11.627  137.973 46.953 1.00 42.49 ? 211  DG  E OP2   1 
ATOM   3685 O "O5'" . DG  E 2 11  ? 10.440  138.461 44.816 1.00 39.70 ? 211  DG  E "O5'" 1 
ATOM   3686 C "C5'" . DG  E 2 11  ? 10.403  138.846 43.448 1.00 39.58 ? 211  DG  E "C5'" 1 
ATOM   3687 C "C4'" . DG  E 2 11  ? 8.982   138.917 42.945 1.00 41.26 ? 211  DG  E "C4'" 1 
ATOM   3688 O "O4'" . DG  E 2 11  ? 8.338   137.646 43.091 1.00 41.19 ? 211  DG  E "O4'" 1 
ATOM   3689 C "C3'" . DG  E 2 11  ? 8.129   139.907 43.747 1.00 43.35 ? 211  DG  E "C3'" 1 
ATOM   3690 O "O3'" . DG  E 2 11  ? 7.109   140.376 42.867 1.00 47.59 ? 211  DG  E "O3'" 1 
ATOM   3691 C "C2'" . DG  E 2 11  ? 7.530   138.976 44.802 1.00 41.72 ? 211  DG  E "C2'" 1 
ATOM   3692 C "C1'" . DG  E 2 11  ? 7.181   137.779 43.926 1.00 38.22 ? 211  DG  E "C1'" 1 
ATOM   3693 N N9    . DG  E 2 11  ? 7.007   136.546 44.712 1.00 34.27 ? 211  DG  E N9    1 
ATOM   3694 C C8    . DG  E 2 11  ? 7.703   136.139 45.811 1.00 32.84 ? 211  DG  E C8    1 
ATOM   3695 N N7    . DG  E 2 11  ? 7.345   134.973 46.263 1.00 32.42 ? 211  DG  E N7    1 
ATOM   3696 C C5    . DG  E 2 11  ? 6.332   134.575 45.399 1.00 30.48 ? 211  DG  E C5    1 
ATOM   3697 C C6    . DG  E 2 11  ? 5.566   133.382 45.392 1.00 29.54 ? 211  DG  E C6    1 
ATOM   3698 O O6    . DG  E 2 11  ? 5.640   132.425 46.157 1.00 28.58 ? 211  DG  E O6    1 
ATOM   3699 N N1    . DG  E 2 11  ? 4.652   133.375 44.354 1.00 29.20 ? 211  DG  E N1    1 
ATOM   3700 C C2    . DG  E 2 11  ? 4.494   134.392 43.432 1.00 30.08 ? 211  DG  E C2    1 
ATOM   3701 N N2    . DG  E 2 11  ? 3.549   134.224 42.507 1.00 29.64 ? 211  DG  E N2    1 
ATOM   3702 N N3    . DG  E 2 11  ? 5.220   135.515 43.438 1.00 30.51 ? 211  DG  E N3    1 
ATOM   3703 C C4    . DG  E 2 11  ? 6.115   135.535 44.447 1.00 31.23 ? 211  DG  E C4    1 
ATOM   3704 P P     . DG  E 2 12  ? 6.142   141.622 43.170 1.00 50.22 ? 212  DG  E P     1 
ATOM   3705 O OP1   . DG  E 2 12  ? 6.736   142.803 42.503 1.00 49.46 ? 212  DG  E OP1   1 
ATOM   3706 O OP2   . DG  E 2 12  ? 5.815   141.651 44.617 1.00 49.10 ? 212  DG  E OP2   1 
ATOM   3707 O "O5'" . DG  E 2 12  ? 4.828   141.169 42.358 1.00 47.98 ? 212  DG  E "O5'" 1 
ATOM   3708 C "C5'" . DG  E 2 12  ? 4.490   139.785 42.351 1.00 46.46 ? 212  DG  E "C5'" 1 
ATOM   3709 C "C4'" . DG  E 2 12  ? 2.997   139.553 42.362 1.00 47.20 ? 212  DG  E "C4'" 1 
ATOM   3710 O "O4'" . DG  E 2 12  ? 2.730   138.289 42.992 1.00 45.56 ? 212  DG  E "O4'" 1 
ATOM   3711 C "C3'" . DG  E 2 12  ? 2.283   140.588 43.229 1.00 47.99 ? 212  DG  E "C3'" 1 
ATOM   3712 O "O3'" . DG  E 2 12  ? 0.866   140.551 42.988 1.00 51.65 ? 212  DG  E "O3'" 1 
ATOM   3713 C "C2'" . DG  E 2 12  ? 2.609   139.997 44.595 1.00 46.42 ? 212  DG  E "C2'" 1 
ATOM   3714 C "C1'" . DG  E 2 12  ? 2.285   138.531 44.329 1.00 43.20 ? 212  DG  E "C1'" 1 
ATOM   3715 N N9    . DG  E 2 12  ? 2.942   137.651 45.323 1.00 39.14 ? 212  DG  E N9    1 
ATOM   3716 C C8    . DG  E 2 12  ? 4.059   137.873 46.096 1.00 37.57 ? 212  DG  E C8    1 
ATOM   3717 N N7    . DG  E 2 12  ? 4.336   136.891 46.909 1.00 36.41 ? 212  DG  E N7    1 
ATOM   3718 C C5    . DG  E 2 12  ? 3.335   135.954 46.656 1.00 35.20 ? 212  DG  E C5    1 
ATOM   3719 C C6    . DG  E 2 12  ? 3.107   134.685 47.238 1.00 34.48 ? 212  DG  E C6    1 
ATOM   3720 O O6    . DG  E 2 12  ? 3.757   134.123 48.113 1.00 36.05 ? 212  DG  E O6    1 
ATOM   3721 N N1    . DG  E 2 12  ? 1.992   134.065 46.700 1.00 33.79 ? 212  DG  E N1    1 
ATOM   3722 C C2    . DG  E 2 12  ? 1.187   134.601 45.719 1.00 33.09 ? 212  DG  E C2    1 
ATOM   3723 N N2    . DG  E 2 12  ? 0.154   133.870 45.312 1.00 32.08 ? 212  DG  E N2    1 
ATOM   3724 N N3    . DG  E 2 12  ? 1.399   135.796 45.172 1.00 34.31 ? 212  DG  E N3    1 
ATOM   3725 C C4    . DG  E 2 12  ? 2.486   136.412 45.688 1.00 36.12 ? 212  DG  E C4    1 
ATOM   3726 P P     . DC  E 2 13  ? -0.079  141.852 43.180 1.00 52.93 ? 213  DC  E P     1 
ATOM   3727 O OP1   . DC  E 2 13  ? -0.378  142.396 41.835 1.00 52.63 ? 213  DC  E OP1   1 
ATOM   3728 O OP2   . DC  E 2 13  ? 0.510   142.723 44.228 1.00 52.20 ? 213  DC  E OP2   1 
ATOM   3729 O "O5'" . DC  E 2 13  ? -1.423  141.219 43.771 1.00 51.57 ? 213  DC  E "O5'" 1 
ATOM   3730 C "C5'" . DC  E 2 13  ? -2.078  140.164 43.069 1.00 50.82 ? 213  DC  E "C5'" 1 
ATOM   3731 C "C4'" . DC  E 2 13  ? -2.627  139.135 44.037 1.00 50.06 ? 213  DC  E "C4'" 1 
ATOM   3732 O "O4'" . DC  E 2 13  ? -1.566  138.486 44.744 1.00 47.94 ? 213  DC  E "O4'" 1 
ATOM   3733 C "C3'" . DC  E 2 13  ? -3.478  139.844 45.097 1.00 50.61 ? 213  DC  E "C3'" 1 
ATOM   3734 O "O3'" . DC  E 2 13  ? -4.799  139.297 45.179 1.00 53.88 ? 213  DC  E "O3'" 1 
ATOM   3735 C "C2'" . DC  E 2 13  ? -2.712  139.585 46.382 1.00 48.24 ? 213  DC  E "C2'" 1 
ATOM   3736 C "C1'" . DC  E 2 13  ? -2.041  138.262 46.065 1.00 46.13 ? 213  DC  E "C1'" 1 
ATOM   3737 N N1    . DC  E 2 13  ? -0.935  138.038 47.014 1.00 43.33 ? 213  DC  E N1    1 
ATOM   3738 C C2    . DC  E 2 13  ? -0.896  136.837 47.705 1.00 41.99 ? 213  DC  E C2    1 
ATOM   3739 O O2    . DC  E 2 13  ? -1.749  135.972 47.513 1.00 40.56 ? 213  DC  E O2    1 
ATOM   3740 N N3    . DC  E 2 13  ? 0.110   136.647 48.599 1.00 40.97 ? 213  DC  E N3    1 
ATOM   3741 C C4    . DC  E 2 13  ? 1.036   137.596 48.803 1.00 42.07 ? 213  DC  E C4    1 
ATOM   3742 N N4    . DC  E 2 13  ? 2.011   137.384 49.684 1.00 43.10 ? 213  DC  E N4    1 
ATOM   3743 C C5    . DC  E 2 13  ? 1.007   138.837 48.095 1.00 41.87 ? 213  DC  E C5    1 
ATOM   3744 C C6    . DC  E 2 13  ? 0.005   139.009 47.214 1.00 42.78 ? 213  DC  E C6    1 
ATOM   3745 P P     . DA  E 2 14  ? -6.005  140.251 45.664 1.00 55.35 ? 214  DA  E P     1 
ATOM   3746 O OP1   . DA  E 2 14  ? -6.061  141.412 44.741 1.00 54.48 ? 214  DA  E OP1   1 
ATOM   3747 O OP2   . DA  E 2 14  ? -5.863  140.469 47.124 1.00 54.09 ? 214  DA  E OP2   1 
ATOM   3748 O "O5'" . DA  E 2 14  ? -7.317  139.349 45.419 1.00 53.90 ? 214  DA  E "O5'" 1 
ATOM   3749 C "C5'" . DA  E 2 14  ? -8.067  138.866 46.540 1.00 52.91 ? 214  DA  E "C5'" 1 
ATOM   3750 C "C4'" . DA  E 2 14  ? -7.503  137.559 47.079 1.00 51.20 ? 214  DA  E "C4'" 1 
ATOM   3751 O "O4'" . DA  E 2 14  ? -6.147  137.737 47.505 1.00 49.69 ? 214  DA  E "O4'" 1 
ATOM   3752 C "C3'" . DA  E 2 14  ? -8.261  137.095 48.334 1.00 50.95 ? 214  DA  E "C3'" 1 
ATOM   3753 O "O3'" . DA  E 2 14  ? -8.276  135.657 48.377 1.00 52.08 ? 214  DA  E "O3'" 1 
ATOM   3754 C "C2'" . DA  E 2 14  ? -7.327  137.635 49.419 1.00 49.60 ? 214  DA  E "C2'" 1 
ATOM   3755 C "C1'" . DA  E 2 14  ? -6.054  137.147 48.795 1.00 47.11 ? 214  DA  E "C1'" 1 
ATOM   3756 N N9    . DA  E 2 14  ? -4.808  137.509 49.486 1.00 43.97 ? 214  DA  E N9    1 
ATOM   3757 C C8    . DA  E 2 14  ? -4.093  138.681 49.456 1.00 42.70 ? 214  DA  E C8    1 
ATOM   3758 N N7    . DA  E 2 14  ? -2.972  138.625 50.125 1.00 41.92 ? 214  DA  E N7    1 
ATOM   3759 C C5    . DA  E 2 14  ? -2.946  137.327 50.634 1.00 41.30 ? 214  DA  E C5    1 
ATOM   3760 C C6    . DA  E 2 14  ? -2.018  136.638 51.432 1.00 40.53 ? 214  DA  E C6    1 
ATOM   3761 N N6    . DA  E 2 14  ? -0.889  137.198 51.850 1.00 40.44 ? 214  DA  E N6    1 
ATOM   3762 N N1    . DA  E 2 14  ? -2.300  135.361 51.764 1.00 39.70 ? 214  DA  E N1    1 
ATOM   3763 C C2    . DA  E 2 14  ? -3.435  134.819 51.320 1.00 40.37 ? 214  DA  E C2    1 
ATOM   3764 N N3    . DA  E 2 14  ? -4.389  135.356 50.564 1.00 40.75 ? 214  DA  E N3    1 
ATOM   3765 C C4    . DA  E 2 14  ? -4.067  136.639 50.254 1.00 42.14 ? 214  DA  E C4    1 
ATOM   3766 O "O5'" . DT  F 3 1   ? -0.620  130.699 59.758 1.00 61.33 ? 215  DT  F "O5'" 1 
ATOM   3767 C "C5'" . DT  F 3 1   ? 0.034   129.763 58.895 1.00 59.41 ? 215  DT  F "C5'" 1 
ATOM   3768 C "C4'" . DT  F 3 1   ? -0.798  129.445 57.656 1.00 58.39 ? 215  DT  F "C4'" 1 
ATOM   3769 O "O4'" . DT  F 3 1   ? -1.167  130.670 56.992 1.00 57.18 ? 215  DT  F "O4'" 1 
ATOM   3770 C "C3'" . DT  F 3 1   ? 0.057   128.635 56.662 1.00 58.29 ? 215  DT  F "C3'" 1 
ATOM   3771 O "O3'" . DT  F 3 1   ? -0.686  127.818 55.731 1.00 59.45 ? 215  DT  F "O3'" 1 
ATOM   3772 C "C2'" . DT  F 3 1   ? 0.659   129.803 55.876 1.00 57.37 ? 215  DT  F "C2'" 1 
ATOM   3773 C "C1'" . DT  F 3 1   ? -0.602  130.651 55.678 1.00 56.45 ? 215  DT  F "C1'" 1 
ATOM   3774 N N1    . DT  F 3 1   ? -0.312  132.014 55.149 1.00 54.61 ? 215  DT  F N1    1 
ATOM   3775 C C2    . DT  F 3 1   ? -1.175  132.533 54.188 1.00 54.00 ? 215  DT  F C2    1 
ATOM   3776 O O2    . DT  F 3 1   ? -2.158  131.922 53.780 1.00 53.61 ? 215  DT  F O2    1 
ATOM   3777 N N3    . DT  F 3 1   ? -0.863  133.793 53.699 1.00 53.91 ? 215  DT  F N3    1 
ATOM   3778 C C4    . DT  F 3 1   ? 0.222   134.567 54.085 1.00 53.90 ? 215  DT  F C4    1 
ATOM   3779 O O4    . DT  F 3 1   ? 0.420   135.673 53.585 1.00 53.98 ? 215  DT  F O4    1 
ATOM   3780 C C5    . DT  F 3 1   ? 1.058   133.947 55.088 1.00 53.82 ? 215  DT  F C5    1 
ATOM   3781 C C7    . DT  F 3 1   ? 2.282   134.696 55.600 1.00 53.66 ? 215  DT  F C7    1 
ATOM   3782 C C6    . DT  F 3 1   ? 0.777   132.725 55.578 1.00 53.91 ? 215  DT  F C6    1 
ATOM   3783 P P     . DG  F 3 2   ? -1.856  126.717 56.039 1.00 62.38 ? 216  DG  F P     1 
ATOM   3784 O OP1   . DG  F 3 2   ? -2.394  126.939 57.400 1.00 60.65 ? 216  DG  F OP1   1 
ATOM   3785 O OP2   . DG  F 3 2   ? -1.358  125.376 55.655 1.00 59.76 ? 216  DG  F OP2   1 
ATOM   3786 O "O5'" . DG  F 3 2   ? -2.985  127.150 54.953 1.00 58.92 ? 216  DG  F "O5'" 1 
ATOM   3787 C "C5'" . DG  F 3 2   ? -2.888  128.399 54.245 1.00 56.62 ? 216  DG  F "C5'" 1 
ATOM   3788 C "C4'" . DG  F 3 2   ? -2.347  128.259 52.812 1.00 54.85 ? 216  DG  F "C4'" 1 
ATOM   3789 O "O4'" . DG  F 3 2   ? -1.995  129.557 52.306 1.00 53.26 ? 216  DG  F "O4'" 1 
ATOM   3790 C "C3'" . DG  F 3 2   ? -1.055  127.411 52.757 1.00 55.36 ? 216  DG  F "C3'" 1 
ATOM   3791 O "O3'" . DG  F 3 2   ? -0.904  126.569 51.602 1.00 56.99 ? 216  DG  F "O3'" 1 
ATOM   3792 C "C2'" . DG  F 3 2   ? 0.000   128.494 52.653 1.00 53.43 ? 216  DG  F "C2'" 1 
ATOM   3793 C "C1'" . DG  F 3 2   ? -0.701  129.461 51.719 1.00 50.69 ? 216  DG  F "C1'" 1 
ATOM   3794 N N9    . DG  F 3 2   ? 0.028   130.743 51.689 1.00 47.58 ? 216  DG  F N9    1 
ATOM   3795 C C8    . DG  F 3 2   ? 1.114   131.110 52.434 1.00 46.95 ? 216  DG  F C8    1 
ATOM   3796 N N7    . DG  F 3 2   ? 1.561   132.301 52.165 1.00 46.72 ? 216  DG  F N7    1 
ATOM   3797 C C5    . DG  F 3 2   ? 0.713   132.765 51.168 1.00 44.94 ? 216  DG  F C5    1 
ATOM   3798 C C6    . DG  F 3 2   ? 0.723   133.999 50.476 1.00 43.72 ? 216  DG  F C6    1 
ATOM   3799 O O6    . DG  F 3 2   ? 1.496   134.938 50.617 1.00 43.82 ? 216  DG  F O6    1 
ATOM   3800 N N1    . DG  F 3 2   ? -0.285  134.073 49.541 1.00 42.47 ? 216  DG  F N1    1 
ATOM   3801 C C2    . DG  F 3 2   ? -1.199  133.079 49.295 1.00 43.03 ? 216  DG  F C2    1 
ATOM   3802 N N2    . DG  F 3 2   ? -2.100  133.325 48.346 1.00 43.08 ? 216  DG  F N2    1 
ATOM   3803 N N3    . DG  F 3 2   ? -1.215  131.911 49.945 1.00 44.38 ? 216  DG  F N3    1 
ATOM   3804 C C4    . DG  F 3 2   ? -0.232  131.821 50.867 1.00 45.87 ? 216  DG  F C4    1 
ATOM   3805 P P     . DC  F 3 3   ? -2.112  125.859 50.807 1.00 61.41 ? 217  DC  F P     1 
ATOM   3806 O OP1   . DC  F 3 3   ? -3.180  125.514 51.776 1.00 58.43 ? 217  DC  F OP1   1 
ATOM   3807 O OP2   . DC  F 3 3   ? -1.528  124.810 49.933 1.00 59.29 ? 217  DC  F OP2   1 
ATOM   3808 O "O5'" . DC  F 3 3   ? -2.614  127.087 49.875 1.00 58.87 ? 217  DC  F "O5'" 1 
ATOM   3809 C "C5'" . DC  F 3 3   ? -3.580  126.961 48.820 1.00 55.76 ? 217  DC  F "C5'" 1 
ATOM   3810 C "C4'" . DC  F 3 3   ? -3.170  127.719 47.537 1.00 52.91 ? 217  DC  F "C4'" 1 
ATOM   3811 O "O4'" . DC  F 3 3   ? -2.354  128.876 47.828 1.00 51.37 ? 217  DC  F "O4'" 1 
ATOM   3812 C "C3'" . DC  F 3 3   ? -2.322  126.832 46.624 1.00 52.62 ? 217  DC  F "C3'" 1 
ATOM   3813 O "O3'" . DC  F 3 3   ? -2.556  127.137 45.236 1.00 54.75 ? 217  DC  F "O3'" 1 
ATOM   3814 C "C2'" . DC  F 3 3   ? -0.930  127.271 47.040 1.00 49.50 ? 217  DC  F "C2'" 1 
ATOM   3815 C "C1'" . DC  F 3 3   ? -1.156  128.769 47.063 1.00 47.82 ? 217  DC  F "C1'" 1 
ATOM   3816 N N1    . DC  F 3 3   ? 0.016   129.486 47.632 1.00 44.65 ? 217  DC  F N1    1 
ATOM   3817 C C2    . DC  F 3 3   ? 0.251   130.785 47.202 1.00 42.92 ? 217  DC  F C2    1 
ATOM   3818 O O2    . DC  F 3 3   ? -0.514  131.333 46.416 1.00 42.81 ? 217  DC  F O2    1 
ATOM   3819 N N3    . DC  F 3 3   ? 1.347   131.436 47.668 1.00 42.14 ? 217  DC  F N3    1 
ATOM   3820 C C4    . DC  F 3 3   ? 2.186   130.842 48.526 1.00 42.71 ? 217  DC  F C4    1 
ATOM   3821 N N4    . DC  F 3 3   ? 3.258   131.506 48.956 1.00 42.31 ? 217  DC  F N4    1 
ATOM   3822 C C5    . DC  F 3 3   ? 1.955   129.504 48.984 1.00 43.47 ? 217  DC  F C5    1 
ATOM   3823 C C6    . DC  F 3 3   ? 0.860   128.873 48.509 1.00 43.99 ? 217  DC  F C6    1 
ATOM   3824 P P     . DC  F 3 4   ? -1.916  126.185 44.084 1.00 59.64 ? 218  DC  F P     1 
ATOM   3825 O OP1   . DC  F 3 4   ? -2.388  124.800 44.327 1.00 58.14 ? 218  DC  F OP1   1 
ATOM   3826 O OP2   . DC  F 3 4   ? -0.460  126.453 44.020 1.00 58.78 ? 218  DC  F OP2   1 
ATOM   3827 O "O5'" . DC  F 3 4   ? -2.577  126.688 42.691 1.00 55.04 ? 218  DC  F "O5'" 1 
ATOM   3828 C "C5'" . DC  F 3 4   ? -3.079  128.017 42.483 1.00 51.39 ? 218  DC  F "C5'" 1 
ATOM   3829 C "C4'" . DC  F 3 4   ? -1.996  129.020 42.058 1.00 48.81 ? 218  DC  F "C4'" 1 
ATOM   3830 O "O4'" . DC  F 3 4   ? -1.182  129.418 43.163 1.00 46.58 ? 218  DC  F "O4'" 1 
ATOM   3831 C "C3'" . DC  F 3 4   ? -1.028  128.386 41.060 1.00 47.58 ? 218  DC  F "C3'" 1 
ATOM   3832 O "O3'" . DC  F 3 4   ? -1.268  128.784 39.701 1.00 47.02 ? 218  DC  F "O3'" 1 
ATOM   3833 C "C2'" . DC  F 3 4   ? 0.343   128.891 41.525 1.00 47.27 ? 218  DC  F "C2'" 1 
ATOM   3834 C "C1'" . DC  F 3 4   ? 0.007   129.935 42.581 1.00 44.02 ? 218  DC  F "C1'" 1 
ATOM   3835 N N1    . DC  F 3 4   ? 1.134   129.978 43.530 1.00 41.03 ? 218  DC  F N1    1 
ATOM   3836 C C2    . DC  F 3 4   ? 1.915   131.122 43.558 1.00 39.87 ? 218  DC  F C2    1 
ATOM   3837 O O2    . DC  F 3 4   ? 1.657   132.075 42.825 1.00 38.49 ? 218  DC  F O2    1 
ATOM   3838 N N3    . DC  F 3 4   ? 2.974   131.153 44.414 1.00 39.24 ? 218  DC  F N3    1 
ATOM   3839 C C4    . DC  F 3 4   ? 3.255   130.110 45.208 1.00 38.64 ? 218  DC  F C4    1 
ATOM   3840 N N4    . DC  F 3 4   ? 4.303   130.178 46.025 1.00 37.98 ? 218  DC  F N4    1 
ATOM   3841 C C5    . DC  F 3 4   ? 2.451   128.924 45.187 1.00 39.14 ? 218  DC  F C5    1 
ATOM   3842 C C6    . DC  F 3 4   ? 1.407   128.908 44.335 1.00 39.70 ? 218  DC  F C6    1 
ATOM   3843 P P     . DC  F 3 5   ? -0.235  128.296 38.540 1.00 47.83 ? 219  DC  F P     1 
ATOM   3844 O OP1   . DC  F 3 5   ? -0.905  128.404 37.222 1.00 48.02 ? 219  DC  F OP1   1 
ATOM   3845 O OP2   . DC  F 3 5   ? 0.346   126.999 38.971 1.00 46.98 ? 219  DC  F OP2   1 
ATOM   3846 O "O5'" . DC  F 3 5   ? 0.932   129.402 38.575 1.00 44.90 ? 219  DC  F "O5'" 1 
ATOM   3847 C "C5'" . DC  F 3 5   ? 0.781   130.664 37.930 1.00 41.73 ? 219  DC  F "C5'" 1 
ATOM   3848 C "C4'" . DC  F 3 5   ? 2.049   131.489 38.082 1.00 40.78 ? 219  DC  F "C4'" 1 
ATOM   3849 O "O4'" . DC  F 3 5   ? 2.429   131.609 39.448 1.00 40.67 ? 219  DC  F "O4'" 1 
ATOM   3850 C "C3'" . DC  F 3 5   ? 3.207   130.767 37.439 1.00 39.89 ? 219  DC  F "C3'" 1 
ATOM   3851 O "O3'" . DC  F 3 5   ? 3.146   131.085 36.051 1.00 40.64 ? 219  DC  F "O3'" 1 
ATOM   3852 C "C2'" . DC  F 3 5   ? 4.404   131.434 38.135 1.00 38.46 ? 219  DC  F "C2'" 1 
ATOM   3853 C "C1'" . DC  F 3 5   ? 3.849   131.758 39.531 1.00 37.63 ? 219  DC  F "C1'" 1 
ATOM   3854 N N1    . DC  F 3 5   ? 4.324   130.854 40.599 1.00 35.71 ? 219  DC  F N1    1 
ATOM   3855 C C2    . DC  F 3 5   ? 5.396   131.252 41.394 1.00 35.20 ? 219  DC  F C2    1 
ATOM   3856 O O2    . DC  F 3 5   ? 5.974   132.324 41.206 1.00 34.65 ? 219  DC  F O2    1 
ATOM   3857 N N3    . DC  F 3 5   ? 5.786   130.415 42.392 1.00 34.90 ? 219  DC  F N3    1 
ATOM   3858 C C4    . DC  F 3 5   ? 5.165   129.247 42.608 1.00 34.96 ? 219  DC  F C4    1 
ATOM   3859 N N4    . DC  F 3 5   ? 5.571   128.460 43.606 1.00 35.83 ? 219  DC  F N4    1 
ATOM   3860 C C5    . DC  F 3 5   ? 4.065   128.831 41.794 1.00 35.37 ? 219  DC  F C5    1 
ATOM   3861 C C6    . DC  F 3 5   ? 3.687   129.667 40.809 1.00 35.30 ? 219  DC  F C6    1 
ATOM   3862 P P     . DT  F 3 6   ? 3.303   130.004 34.867 1.00 39.93 ? 220  DT  F P     1 
ATOM   3863 O OP1   . DT  F 3 6   ? 3.100   130.705 33.579 1.00 40.82 ? 220  DT  F OP1   1 
ATOM   3864 O OP2   . DT  F 3 6   ? 2.504   128.800 35.192 1.00 39.29 ? 220  DT  F OP2   1 
ATOM   3865 O "O5'" . DT  F 3 6   ? 4.867   129.653 35.001 1.00 37.14 ? 220  DT  F "O5'" 1 
ATOM   3866 C "C5'" . DT  F 3 6   ? 5.834   130.681 34.799 1.00 30.32 ? 220  DT  F "C5'" 1 
ATOM   3867 C "C4'" . DT  F 3 6   ? 7.228   130.133 34.883 1.00 28.47 ? 220  DT  F "C4'" 1 
ATOM   3868 O "O4'" . DT  F 3 6   ? 7.571   129.737 36.204 1.00 27.65 ? 220  DT  F "O4'" 1 
ATOM   3869 C "C3'" . DT  F 3 6   ? 7.322   128.895 34.030 1.00 28.24 ? 220  DT  F "C3'" 1 
ATOM   3870 O "O3'" . DT  F 3 6   ? 8.537   128.975 33.326 1.00 31.97 ? 220  DT  F "O3'" 1 
ATOM   3871 C "C2'" . DT  F 3 6   ? 7.344   127.749 35.028 1.00 26.81 ? 220  DT  F "C2'" 1 
ATOM   3872 C "C1'" . DT  F 3 6   ? 8.023   128.385 36.225 1.00 25.60 ? 220  DT  F "C1'" 1 
ATOM   3873 N N1    . DT  F 3 6   ? 7.547   127.758 37.472 1.00 25.16 ? 220  DT  F N1    1 
ATOM   3874 C C2    . DT  F 3 6   ? 8.473   127.405 38.438 1.00 24.88 ? 220  DT  F C2    1 
ATOM   3875 O O2    . DT  F 3 6   ? 9.683   127.552 38.297 1.00 27.13 ? 220  DT  F O2    1 
ATOM   3876 N N3    . DT  F 3 6   ? 7.966   126.839 39.584 1.00 22.93 ? 220  DT  F N3    1 
ATOM   3877 C C4    . DT  F 3 6   ? 6.650   126.591 39.848 1.00 22.02 ? 220  DT  F C4    1 
ATOM   3878 O O4    . DT  F 3 6   ? 6.346   126.070 40.910 1.00 22.59 ? 220  DT  F O4    1 
ATOM   3879 C C5    . DT  F 3 6   ? 5.748   126.984 38.788 1.00 22.55 ? 220  DT  F C5    1 
ATOM   3880 C C7    . DT  F 3 6   ? 4.254   126.747 38.898 1.00 21.80 ? 220  DT  F C7    1 
ATOM   3881 C C6    . DT  F 3 6   ? 6.215   127.543 37.665 1.00 24.06 ? 220  DT  F C6    1 
ATOM   3882 P P     . DT  F 3 7   ? 8.731   128.192 31.959 1.00 32.98 ? 221  DT  F P     1 
ATOM   3883 O OP1   . DT  F 3 7   ? 9.515   129.065 31.061 1.00 35.12 ? 221  DT  F OP1   1 
ATOM   3884 O OP2   . DT  F 3 7   ? 7.424   127.644 31.528 1.00 30.63 ? 221  DT  F OP2   1 
ATOM   3885 O "O5'" . DT  F 3 7   ? 9.666   126.985 32.433 1.00 29.35 ? 221  DT  F "O5'" 1 
ATOM   3886 C "C5'" . DT  F 3 7   ? 11.046  127.171 32.707 1.00 25.42 ? 221  DT  F "C5'" 1 
ATOM   3887 C "C4'" . DT  F 3 7   ? 11.573  125.955 33.444 1.00 26.15 ? 221  DT  F "C4'" 1 
ATOM   3888 O "O4'" . DT  F 3 7   ? 10.966  125.863 34.707 1.00 25.06 ? 221  DT  F "O4'" 1 
ATOM   3889 C "C3'" . DT  F 3 7   ? 11.087  124.683 32.780 1.00 25.74 ? 221  DT  F "C3'" 1 
ATOM   3890 O "O3'" . DT  F 3 7   ? 11.986  124.379 31.719 1.00 28.32 ? 221  DT  F "O3'" 1 
ATOM   3891 C "C2'" . DT  F 3 7   ? 11.152  123.654 33.914 1.00 24.89 ? 221  DT  F "C2'" 1 
ATOM   3892 C "C1'" . DT  F 3 7   ? 11.166  124.525 35.162 1.00 24.48 ? 221  DT  F "C1'" 1 
ATOM   3893 N N1    . DT  F 3 7   ? 10.084  124.200 36.116 1.00 24.54 ? 221  DT  F N1    1 
ATOM   3894 C C2    . DT  F 3 7   ? 10.449  123.894 37.419 1.00 23.64 ? 221  DT  F C2    1 
ATOM   3895 O O2    . DT  F 3 7   ? 11.621  123.850 37.794 1.00 24.66 ? 221  DT  F O2    1 
ATOM   3896 N N3    . DT  F 3 7   ? 9.404   123.639 38.288 1.00 22.60 ? 221  DT  F N3    1 
ATOM   3897 C C4    . DT  F 3 7   ? 8.060   123.661 37.981 1.00 21.87 ? 221  DT  F C4    1 
ATOM   3898 O O4    . DT  F 3 7   ? 7.229   123.432 38.857 1.00 22.36 ? 221  DT  F O4    1 
ATOM   3899 C C5    . DT  F 3 7   ? 7.780   123.985 36.602 1.00 21.11 ? 221  DT  F C5    1 
ATOM   3900 C C7    . DT  F 3 7   ? 6.351   124.043 36.111 1.00 21.46 ? 221  DT  F C7    1 
ATOM   3901 C C6    . DT  F 3 7   ? 8.769   124.238 35.734 1.00 22.04 ? 221  DT  F C6    1 
ATOM   3902 P P     . DA  F 3 8   ? 11.629  123.343 30.560 1.00 29.09 ? 222  DA  F P     1 
ATOM   3903 O OP1   . DA  F 3 8   ? 12.532  123.614 29.419 1.00 29.03 ? 222  DA  F OP1   1 
ATOM   3904 O OP2   . DA  F 3 8   ? 10.164  123.349 30.365 1.00 32.15 ? 222  DA  F OP2   1 
ATOM   3905 O "O5'" . DA  F 3 8   ? 12.026  121.931 31.213 1.00 28.31 ? 222  DA  F "O5'" 1 
ATOM   3906 C "C5'" . DA  F 3 8   ? 13.379  121.585 31.558 1.00 25.49 ? 222  DA  F "C5'" 1 
ATOM   3907 C "C4'" . DA  F 3 8   ? 13.419  120.365 32.472 1.00 22.92 ? 222  DA  F "C4'" 1 
ATOM   3908 O "O4'" . DA  F 3 8   ? 12.690  120.636 33.648 1.00 22.59 ? 222  DA  F "O4'" 1 
ATOM   3909 C "C3'" . DA  F 3 8   ? 12.706  119.197 31.826 1.00 23.70 ? 222  DA  F "C3'" 1 
ATOM   3910 O "O3'" . DA  F 3 8   ? 13.679  118.351 31.226 1.00 25.48 ? 222  DA  F "O3'" 1 
ATOM   3911 C "C2'" . DA  F 3 8   ? 11.995  118.471 32.960 1.00 21.17 ? 222  DA  F "C2'" 1 
ATOM   3912 C "C1'" . DA  F 3 8   ? 12.087  119.437 34.116 1.00 20.39 ? 222  DA  F "C1'" 1 
ATOM   3913 N N9    . DA  F 3 8   ? 10.765  119.766 34.663 1.00 18.71 ? 222  DA  F N9    1 
ATOM   3914 C C8    . DA  F 3 8   ? 9.629   120.169 34.016 1.00 16.93 ? 222  DA  F C8    1 
ATOM   3915 N N7    . DA  F 3 8   ? 8.627   120.387 34.817 1.00 17.63 ? 222  DA  F N7    1 
ATOM   3916 C C5    . DA  F 3 8   ? 9.138   120.109 36.082 1.00 18.56 ? 222  DA  F C5    1 
ATOM   3917 C C6    . DA  F 3 8   ? 8.587   120.153 37.367 1.00 18.99 ? 222  DA  F C6    1 
ATOM   3918 N N6    . DA  F 3 8   ? 7.328   120.490 37.612 1.00 21.79 ? 222  DA  F N6    1 
ATOM   3919 N N1    . DA  F 3 8   ? 9.375   119.828 38.391 1.00 18.71 ? 222  DA  F N1    1 
ATOM   3920 C C2    . DA  F 3 8   ? 10.622  119.481 38.157 1.00 18.65 ? 222  DA  F C2    1 
ATOM   3921 N N3    . DA  F 3 8   ? 11.262  119.396 37.006 1.00 19.30 ? 222  DA  F N3    1 
ATOM   3922 C C4    . DA  F 3 8   ? 10.441  119.731 35.993 1.00 18.69 ? 222  DA  F C4    1 
ATOM   3923 P P     . DT  F 3 9   ? 13.259  117.416 30.004 1.00 28.89 ? 223  DT  F P     1 
ATOM   3924 O OP1   . DT  F 3 9   ? 14.509  116.949 29.356 1.00 29.36 ? 223  DT  F OP1   1 
ATOM   3925 O OP2   . DT  F 3 9   ? 12.230  118.128 29.214 1.00 25.23 ? 223  DT  F OP2   1 
ATOM   3926 O "O5'" . DT  F 3 9   ? 12.537  116.158 30.714 1.00 26.30 ? 223  DT  F "O5'" 1 
ATOM   3927 C "C5'" . DT  F 3 9   ? 13.241  115.075 31.335 1.00 22.26 ? 223  DT  F "C5'" 1 
ATOM   3928 C "C4'" . DT  F 3 9   ? 12.298  114.252 32.210 1.00 20.08 ? 223  DT  F "C4'" 1 
ATOM   3929 O "O4'" . DT  F 3 9   ? 11.681  115.090 33.172 1.00 20.84 ? 223  DT  F "O4'" 1 
ATOM   3930 C "C3'" . DT  F 3 9   ? 11.102  113.775 31.427 1.00 21.11 ? 223  DT  F "C3'" 1 
ATOM   3931 O "O3'" . DT  F 3 9   ? 11.453  112.591 30.705 1.00 25.31 ? 223  DT  F "O3'" 1 
ATOM   3932 C "C2'" . DT  F 3 9   ? 10.096  113.481 32.545 1.00 19.78 ? 223  DT  F "C2'" 1 
ATOM   3933 C "C1'" . DT  F 3 9   ? 10.530  114.425 33.660 1.00 18.85 ? 223  DT  F "C1'" 1 
ATOM   3934 N N1    . DT  F 3 9   ? 9.487   115.400 34.047 1.00 18.94 ? 223  DT  F N1    1 
ATOM   3935 C C2    . DT  F 3 9   ? 9.179   115.497 35.391 1.00 20.19 ? 223  DT  F C2    1 
ATOM   3936 O O2    . DT  F 3 9   ? 9.766   114.865 36.264 1.00 22.27 ? 223  DT  F O2    1 
ATOM   3937 N N3    . DT  F 3 9   ? 8.175   116.376 35.726 1.00 20.37 ? 223  DT  F N3    1 
ATOM   3938 C C4    . DT  F 3 9   ? 7.457   117.165 34.864 1.00 20.26 ? 223  DT  F C4    1 
ATOM   3939 O O4    . DT  F 3 9   ? 6.566   117.891 35.298 1.00 22.67 ? 223  DT  F O4    1 
ATOM   3940 C C5    . DT  F 3 9   ? 7.843   117.017 33.484 1.00 19.77 ? 223  DT  F C5    1 
ATOM   3941 C C7    . DT  F 3 9   ? 7.143   117.862 32.421 1.00 18.25 ? 223  DT  F C7    1 
ATOM   3942 C C6    . DT  F 3 9   ? 8.823   116.157 33.123 1.00 18.90 ? 223  DT  F C6    1 
ATOM   3943 P P     . DA  F 3 10  ? 10.619  112.091 29.421 1.00 26.52 ? 224  DA  F P     1 
ATOM   3944 O OP1   . DA  F 3 10  ? 11.570  111.800 28.332 1.00 27.50 ? 224  DA  F OP1   1 
ATOM   3945 O OP2   . DA  F 3 10  ? 9.521   113.052 29.196 1.00 28.50 ? 224  DA  F OP2   1 
ATOM   3946 O "O5'" . DA  F 3 10  ? 9.969   110.706 29.887 1.00 25.11 ? 224  DA  F "O5'" 1 
ATOM   3947 C "C5'" . DA  F 3 10  ? 10.731  109.613 30.386 1.00 24.04 ? 224  DA  F "C5'" 1 
ATOM   3948 C "C4'" . DA  F 3 10  ? 10.015  108.985 31.566 1.00 25.13 ? 224  DA  F "C4'" 1 
ATOM   3949 O "O4'" . DA  F 3 10  ? 9.834   109.979 32.583 1.00 27.05 ? 224  DA  F "O4'" 1 
ATOM   3950 C "C3'" . DA  F 3 10  ? 8.600   108.563 31.185 1.00 25.98 ? 224  DA  F "C3'" 1 
ATOM   3951 O "O3'" . DA  F 3 10  ? 8.607   107.245 30.605 1.00 27.28 ? 224  DA  F "O3'" 1 
ATOM   3952 C "C2'" . DA  F 3 10  ? 7.931   108.578 32.571 1.00 26.39 ? 224  DA  F "C2'" 1 
ATOM   3953 C "C1'" . DA  F 3 10  ? 8.544   109.829 33.216 1.00 25.38 ? 224  DA  F "C1'" 1 
ATOM   3954 N N9    . DA  F 3 10  ? 7.722   111.070 33.042 1.00 23.86 ? 224  DA  F N9    1 
ATOM   3955 C C8    . DA  F 3 10  ? 7.345   111.709 31.881 1.00 23.71 ? 224  DA  F C8    1 
ATOM   3956 N N7    . DA  F 3 10  ? 6.641   112.796 32.073 1.00 23.74 ? 224  DA  F N7    1 
ATOM   3957 C C5    . DA  F 3 10  ? 6.539   112.885 33.457 1.00 22.61 ? 224  DA  F C5    1 
ATOM   3958 C C6    . DA  F 3 10  ? 5.916   113.818 34.305 1.00 21.93 ? 224  DA  F C6    1 
ATOM   3959 N N6    . DA  F 3 10  ? 5.235   114.872 33.867 1.00 20.84 ? 224  DA  F N6    1 
ATOM   3960 N N1    . DA  F 3 10  ? 6.014   113.614 35.619 1.00 21.53 ? 224  DA  F N1    1 
ATOM   3961 C C2    . DA  F 3 10  ? 6.679   112.560 36.062 1.00 22.43 ? 224  DA  F C2    1 
ATOM   3962 N N3    . DA  F 3 10  ? 7.304   111.614 35.379 1.00 23.53 ? 224  DA  F N3    1 
ATOM   3963 C C4    . DA  F 3 10  ? 7.193   111.842 34.055 1.00 23.10 ? 224  DA  F C4    1 
ATOM   3964 P P     . DT  F 3 11  ? 7.522   106.782 29.488 1.00 28.32 ? 225  DT  F P     1 
ATOM   3965 O OP1   . DT  F 3 11  ? 7.818   105.390 29.077 1.00 28.04 ? 225  DT  F OP1   1 
ATOM   3966 O OP2   . DT  F 3 11  ? 7.408   107.861 28.484 1.00 25.40 ? 225  DT  F OP2   1 
ATOM   3967 O "O5'" . DT  F 3 11  ? 6.182   106.723 30.307 1.00 27.47 ? 225  DT  F "O5'" 1 
ATOM   3968 C "C5'" . DT  F 3 11  ? 5.968   105.678 31.255 1.00 27.56 ? 225  DT  F "C5'" 1 
ATOM   3969 C "C4'" . DT  F 3 11  ? 4.732   106.017 32.053 1.00 27.04 ? 225  DT  F "C4'" 1 
ATOM   3970 O "O4'" . DT  F 3 11  ? 4.873   107.338 32.567 1.00 26.94 ? 225  DT  F "O4'" 1 
ATOM   3971 C "C3'" . DT  F 3 11  ? 3.566   106.135 31.083 1.00 27.28 ? 225  DT  F "C3'" 1 
ATOM   3972 O "O3'" . DT  F 3 11  ? 2.984   104.835 30.862 1.00 28.00 ? 225  DT  F "O3'" 1 
ATOM   3973 C "C2'" . DT  F 3 11  ? 2.629   107.089 31.808 1.00 26.20 ? 225  DT  F "C2'" 1 
ATOM   3974 C "C1'" . DT  F 3 11  ? 3.584   107.912 32.693 1.00 25.68 ? 225  DT  F "C1'" 1 
ATOM   3975 N N1    . DT  F 3 11  ? 3.603   109.323 32.292 1.00 23.60 ? 225  DT  F N1    1 
ATOM   3976 C C2    . DT  F 3 11  ? 3.132   110.250 33.199 1.00 22.72 ? 225  DT  F C2    1 
ATOM   3977 O O2    . DT  F 3 11  ? 2.764   109.949 34.329 1.00 21.39 ? 225  DT  F O2    1 
ATOM   3978 N N3    . DT  F 3 11  ? 3.122   111.556 32.771 1.00 23.80 ? 225  DT  F N3    1 
ATOM   3979 C C4    . DT  F 3 11  ? 3.543   112.006 31.533 1.00 24.79 ? 225  DT  F C4    1 
ATOM   3980 O O4    . DT  F 3 11  ? 3.490   113.200 31.254 1.00 27.08 ? 225  DT  F O4    1 
ATOM   3981 C C5    . DT  F 3 11  ? 4.024   110.965 30.662 1.00 24.11 ? 225  DT  F C5    1 
ATOM   3982 C C7    . DT  F 3 11  ? 4.531   111.320 29.280 1.00 24.84 ? 225  DT  F C7    1 
ATOM   3983 C C6    . DT  F 3 11  ? 4.039   109.688 31.054 1.00 23.63 ? 225  DT  F C6    1 
ATOM   3984 P P     . DA  F 3 12  ? 2.321   104.466 29.446 1.00 28.34 ? 226  DA  F P     1 
ATOM   3985 O OP1   . DA  F 3 12  ? 1.981   103.029 29.435 1.00 29.01 ? 226  DA  F OP1   1 
ATOM   3986 O OP2   . DA  F 3 12  ? 3.147   105.034 28.368 1.00 26.92 ? 226  DA  F OP2   1 
ATOM   3987 O "O5'" . DA  F 3 12  ? 0.971   105.303 29.560 1.00 27.98 ? 226  DA  F "O5'" 1 
ATOM   3988 C "C5'" . DA  F 3 12  ? -0.081  104.839 30.406 1.00 28.63 ? 226  DA  F "C5'" 1 
ATOM   3989 C "C4'" . DA  F 3 12  ? -1.320  105.700 30.278 1.00 31.01 ? 226  DA  F "C4'" 1 
ATOM   3990 O "O4'" . DA  F 3 12  ? -1.037  107.043 30.689 1.00 30.86 ? 226  DA  F "O4'" 1 
ATOM   3991 C "C3'" . DA  F 3 12  ? -1.768  105.792 28.804 1.00 32.82 ? 226  DA  F "C3'" 1 
ATOM   3992 O "O3'" . DA  F 3 12  ? -3.185  105.869 28.719 1.00 37.32 ? 226  DA  F "O3'" 1 
ATOM   3993 C "C2'" . DA  F 3 12  ? -1.180  107.120 28.368 1.00 30.67 ? 226  DA  F "C2'" 1 
ATOM   3994 C "C1'" . DA  F 3 12  ? -1.447  107.911 29.631 1.00 29.24 ? 226  DA  F "C1'" 1 
ATOM   3995 N N9    . DA  F 3 12  ? -0.695  109.167 29.653 1.00 27.27 ? 226  DA  F N9    1 
ATOM   3996 C C8    . DA  F 3 12  ? 0.530   109.476 29.118 1.00 26.03 ? 226  DA  F C8    1 
ATOM   3997 N N7    . DA  F 3 12  ? 0.882   110.718 29.322 1.00 26.50 ? 226  DA  F N7    1 
ATOM   3998 C C5    . DA  F 3 12  ? -0.181  111.254 30.039 1.00 25.10 ? 226  DA  F C5    1 
ATOM   3999 C C6    . DA  F 3 12  ? -0.429  112.521 30.565 1.00 25.54 ? 226  DA  F C6    1 
ATOM   4000 N N6    . DA  F 3 12  ? 0.408   113.550 30.453 1.00 26.35 ? 226  DA  F N6    1 
ATOM   4001 N N1    . DA  F 3 12  ? -1.580  112.689 31.215 1.00 25.42 ? 226  DA  F N1    1 
ATOM   4002 C C2    . DA  F 3 12  ? -2.424  111.682 31.337 1.00 25.53 ? 226  DA  F C2    1 
ATOM   4003 N N3    . DA  F 3 12  ? -2.309  110.451 30.890 1.00 26.09 ? 226  DA  F N3    1 
ATOM   4004 C C4    . DA  F 3 12  ? -1.141  110.310 30.240 1.00 25.71 ? 226  DA  F C4    1 
ATOM   4005 P P     . DG  F 3 13  ? -3.990  104.836 27.794 1.00 40.10 ? 227  DG  F P     1 
ATOM   4006 O OP1   . DG  F 3 13  ? -3.977  103.499 28.434 1.00 41.25 ? 227  DG  F OP1   1 
ATOM   4007 O OP2   . DG  F 3 13  ? -3.532  105.005 26.399 1.00 37.99 ? 227  DG  F OP2   1 
ATOM   4008 O "O5'" . DG  F 3 13  ? -5.463  105.417 27.920 1.00 41.76 ? 227  DG  F "O5'" 1 
ATOM   4009 C "C5'" . DG  F 3 13  ? -6.138  105.431 29.174 1.00 39.86 ? 227  DG  F "C5'" 1 
ATOM   4010 C "C4'" . DG  F 3 13  ? -7.015  106.652 29.259 1.00 40.33 ? 227  DG  F "C4'" 1 
ATOM   4011 O "O4'" . DG  F 3 13  ? -6.204  107.823 29.371 1.00 39.68 ? 227  DG  F "O4'" 1 
ATOM   4012 C "C3'" . DG  F 3 13  ? -7.814  106.801 27.967 1.00 42.19 ? 227  DG  F "C3'" 1 
ATOM   4013 O "O3'" . DG  F 3 13  ? -9.173  107.097 28.291 1.00 46.36 ? 227  DG  F "O3'" 1 
ATOM   4014 C "C2'" . DG  F 3 13  ? -7.092  107.947 27.236 1.00 40.12 ? 227  DG  F "C2'" 1 
ATOM   4015 C "C1'" . DG  F 3 13  ? -6.550  108.784 28.383 1.00 37.50 ? 227  DG  F "C1'" 1 
ATOM   4016 N N9    . DG  F 3 13  ? -5.330  109.503 27.978 1.00 35.84 ? 227  DG  F N9    1 
ATOM   4017 C C8    . DG  F 3 13  ? -4.279  109.046 27.225 1.00 35.93 ? 227  DG  F C8    1 
ATOM   4018 N N7    . DG  F 3 13  ? -3.332  109.925 27.044 1.00 34.97 ? 227  DG  F N7    1 
ATOM   4019 C C5    . DG  F 3 13  ? -3.785  111.046 27.724 1.00 34.22 ? 227  DG  F C5    1 
ATOM   4020 C C6    . DG  F 3 13  ? -3.180  112.318 27.872 1.00 34.17 ? 227  DG  F C6    1 
ATOM   4021 O O6    . DG  F 3 13  ? -2.100  112.710 27.437 1.00 34.78 ? 227  DG  F O6    1 
ATOM   4022 N N1    . DG  F 3 13  ? -3.968  113.167 28.621 1.00 33.71 ? 227  DG  F N1    1 
ATOM   4023 C C2    . DG  F 3 13  ? -5.187  112.841 29.167 1.00 34.07 ? 227  DG  F C2    1 
ATOM   4024 N N2    . DG  F 3 13  ? -5.792  113.799 29.866 1.00 34.92 ? 227  DG  F N2    1 
ATOM   4025 N N3    . DG  F 3 13  ? -5.765  111.641 29.032 1.00 34.37 ? 227  DG  F N3    1 
ATOM   4026 C C4    . DG  F 3 13  ? -5.006  110.797 28.299 1.00 34.71 ? 227  DG  F C4    1 
ATOM   4027 P P     . DC  F 3 14  ? -10.246 107.623 27.214 1.00 49.13 ? 228  DC  F P     1 
ATOM   4028 O OP1   . DC  F 3 14  ? -11.591 107.491 27.821 1.00 49.83 ? 228  DC  F OP1   1 
ATOM   4029 O OP2   . DC  F 3 14  ? -9.954  106.983 25.909 1.00 47.63 ? 228  DC  F OP2   1 
ATOM   4030 O "O5'" . DC  F 3 14  ? -9.899  109.185 27.106 1.00 45.61 ? 228  DC  F "O5'" 1 
ATOM   4031 C "C5'" . DC  F 3 14  ? -10.929 110.144 26.901 1.00 45.12 ? 228  DC  F "C5'" 1 
ATOM   4032 C "C4'" . DC  F 3 14  ? -10.672 111.381 27.737 1.00 46.59 ? 228  DC  F "C4'" 1 
ATOM   4033 O "O4'" . DC  F 3 14  ? -9.265  111.642 27.781 1.00 45.83 ? 228  DC  F "O4'" 1 
ATOM   4034 C "C3'" . DC  F 3 14  ? -11.247 112.635 27.071 1.00 47.81 ? 228  DC  F "C3'" 1 
ATOM   4035 O "O3'" . DC  F 3 14  ? -11.200 113.742 27.988 1.00 50.44 ? 228  DC  F "O3'" 1 
ATOM   4036 C "C2'" . DC  F 3 14  ? -10.200 112.820 25.973 1.00 46.63 ? 228  DC  F "C2'" 1 
ATOM   4037 C "C1'" . DC  F 3 14  ? -8.952  112.670 26.825 1.00 43.55 ? 228  DC  F "C1'" 1 
ATOM   4038 N N1    . DC  F 3 14  ? -7.747  112.324 26.049 1.00 39.91 ? 228  DC  F N1    1 
ATOM   4039 C C2    . DC  F 3 14  ? -6.788  113.300 25.947 1.00 37.95 ? 228  DC  F C2    1 
ATOM   4040 O O2    . DC  F 3 14  ? -6.974  114.405 26.440 1.00 36.67 ? 228  DC  F O2    1 
ATOM   4041 N N3    . DC  F 3 14  ? -5.645  113.015 25.284 1.00 37.75 ? 228  DC  F N3    1 
ATOM   4042 C C4    . DC  F 3 14  ? -5.447  111.814 24.735 1.00 38.45 ? 228  DC  F C4    1 
ATOM   4043 N N4    . DC  F 3 14  ? -4.297  111.580 24.105 1.00 38.23 ? 228  DC  F N4    1 
ATOM   4044 C C5    . DC  F 3 14  ? -6.441  110.786 24.826 1.00 38.65 ? 228  DC  F C5    1 
ATOM   4045 C C6    . DC  F 3 14  ? -7.573  111.091 25.493 1.00 38.87 ? 228  DC  F C6    1 
HETATM 4046 O O     . HOH G 4 .   ? 26.954  79.839  38.577 1.00 52.03 ? 2001 HOH A O     1 
HETATM 4047 O O     . HOH G 4 .   ? 23.433  81.331  43.475 1.00 34.11 ? 2002 HOH A O     1 
HETATM 4048 O O     . HOH G 4 .   ? 20.753  89.114  49.285 1.00 48.36 ? 2003 HOH A O     1 
HETATM 4049 O O     . HOH G 4 .   ? 24.942  82.573  51.411 1.00 43.94 ? 2004 HOH A O     1 
HETATM 4050 O O     . HOH G 4 .   ? 27.996  74.157  50.093 1.00 44.85 ? 2005 HOH A O     1 
HETATM 4051 O O     . HOH G 4 .   ? 27.901  71.421  52.245 1.00 54.26 ? 2006 HOH A O     1 
HETATM 4052 O O     . HOH G 4 .   ? 32.535  65.469  55.136 1.00 40.35 ? 2007 HOH A O     1 
HETATM 4053 O O     . HOH G 4 .   ? 27.397  36.471  46.887 1.00 43.40 ? 2008 HOH A O     1 
HETATM 4054 O O     . HOH G 4 .   ? 14.878  83.027  33.933 1.00 46.10 ? 2009 HOH A O     1 
HETATM 4055 O O     . HOH G 4 .   ? 27.137  38.274  44.873 1.00 26.58 ? 2010 HOH A O     1 
HETATM 4056 O O     . HOH G 4 .   ? 34.524  71.245  43.415 1.00 39.27 ? 2011 HOH A O     1 
HETATM 4057 O O     . HOH G 4 .   ? 35.557  72.770  47.053 1.00 57.60 ? 2012 HOH A O     1 
HETATM 4058 O O     . HOH G 4 .   ? 23.296  42.250  56.779 1.00 35.04 ? 2013 HOH A O     1 
HETATM 4059 O O     . HOH G 4 .   ? 16.296  41.130  45.017 1.00 37.35 ? 2014 HOH A O     1 
HETATM 4060 O O     . HOH G 4 .   ? 19.946  39.440  44.829 1.00 48.43 ? 2015 HOH A O     1 
HETATM 4061 O O     . HOH G 4 .   ? 12.740  44.189  46.334 1.00 46.08 ? 2016 HOH A O     1 
HETATM 4062 O O     . HOH G 4 .   ? 17.328  44.785  43.998 1.00 36.00 ? 2017 HOH A O     1 
HETATM 4063 O O     . HOH G 4 .   ? 20.716  44.678  50.748 1.00 37.01 ? 2018 HOH A O     1 
HETATM 4064 O O     . HOH G 4 .   ? 25.927  49.788  56.705 1.00 53.21 ? 2019 HOH A O     1 
HETATM 4065 O O     . HOH G 4 .   ? 34.822  62.965  65.321 1.00 43.96 ? 2020 HOH A O     1 
HETATM 4066 O O     . HOH G 4 .   ? 33.778  54.186  59.788 1.00 42.77 ? 2021 HOH A O     1 
HETATM 4067 O O     . HOH G 4 .   ? 36.022  60.860  63.357 1.00 53.90 ? 2022 HOH A O     1 
HETATM 4068 O O     . HOH G 4 .   ? 35.859  57.562  57.840 1.00 41.61 ? 2023 HOH A O     1 
HETATM 4069 O O     . HOH G 4 .   ? 2.572   68.273  44.987 1.00 42.36 ? 2024 HOH A O     1 
HETATM 4070 O O     . HOH G 4 .   ? 31.545  63.910  57.214 1.00 33.89 ? 2025 HOH A O     1 
HETATM 4071 O O     . HOH G 4 .   ? 25.632  60.659  54.836 1.00 21.38 ? 2026 HOH A O     1 
HETATM 4072 O O     . HOH G 4 .   ? 28.635  63.872  54.308 1.00 31.68 ? 2027 HOH A O     1 
HETATM 4073 O O     . HOH G 4 .   ? 27.582  57.336  57.208 1.00 25.42 ? 2028 HOH A O     1 
HETATM 4074 O O     . HOH G 4 .   ? 14.398  67.318  35.873 1.00 43.56 ? 2029 HOH A O     1 
HETATM 4075 O O     . HOH G 4 .   ? 25.414  58.076  55.512 1.00 27.08 ? 2030 HOH A O     1 
HETATM 4076 O O     . HOH G 4 .   ? 13.835  80.730  34.916 1.00 44.83 ? 2031 HOH A O     1 
HETATM 4077 O O     . HOH G 4 .   ? 24.147  43.017  42.815 1.00 29.86 ? 2032 HOH A O     1 
HETATM 4078 O O     . HOH G 4 .   ? 28.836  39.013  39.711 1.00 36.80 ? 2033 HOH A O     1 
HETATM 4079 O O     . HOH G 4 .   ? 25.096  43.294  40.135 1.00 51.40 ? 2034 HOH A O     1 
HETATM 4080 O O     . HOH G 4 .   ? 25.517  64.102  54.783 1.00 50.74 ? 2035 HOH A O     1 
HETATM 4081 O O     . HOH G 4 .   ? 30.558  65.043  53.079 1.00 24.37 ? 2036 HOH A O     1 
HETATM 4082 O O     . HOH G 4 .   ? 29.836  71.792  49.807 1.00 43.54 ? 2037 HOH A O     1 
HETATM 4083 O O     . HOH G 4 .   ? 29.961  70.370  39.971 1.00 24.42 ? 2038 HOH A O     1 
HETATM 4084 O O     . HOH G 4 .   ? 33.929  69.629  45.488 1.00 27.60 ? 2039 HOH A O     1 
HETATM 4085 O O     . HOH G 4 .   ? 37.779  70.965  47.448 1.00 23.78 ? 2040 HOH A O     1 
HETATM 4086 O O     . HOH G 4 .   ? 28.286  61.010  48.038 1.00 21.11 ? 2041 HOH A O     1 
HETATM 4087 O O     . HOH G 4 .   ? 39.455  52.684  53.093 1.00 39.00 ? 2042 HOH A O     1 
HETATM 4088 O O     . HOH G 4 .   ? 41.297  60.912  53.841 1.00 51.15 ? 2043 HOH A O     1 
HETATM 4089 O O     . HOH G 4 .   ? 40.865  56.058  37.418 1.00 48.83 ? 2044 HOH A O     1 
HETATM 4090 O O     . HOH G 4 .   ? 29.675  55.603  36.922 1.00 27.80 ? 2045 HOH A O     1 
HETATM 4091 O O     . HOH G 4 .   ? 37.866  56.181  34.288 1.00 46.81 ? 2046 HOH A O     1 
HETATM 4092 O O     . HOH G 4 .   ? 36.905  57.481  38.038 1.00 43.75 ? 2047 HOH A O     1 
HETATM 4093 O O     . HOH G 4 .   ? 30.745  63.792  36.811 1.00 52.51 ? 2048 HOH A O     1 
HETATM 4094 O O     . HOH G 4 .   ? 26.004  56.691  34.541 1.00 52.22 ? 2049 HOH A O     1 
HETATM 4095 O O     . HOH G 4 .   ? 18.642  75.832  54.148 1.00 38.84 ? 2050 HOH A O     1 
HETATM 4096 O O     . HOH G 4 .   ? 21.417  79.714  52.266 1.00 46.47 ? 2051 HOH A O     1 
HETATM 4097 O O     . HOH G 4 .   ? 16.808  87.711  50.227 1.00 46.35 ? 2052 HOH A O     1 
HETATM 4098 O O     . HOH G 4 .   ? 3.255   88.946  46.290 1.00 24.96 ? 2053 HOH A O     1 
HETATM 4099 O O     . HOH G 4 .   ? -0.901  86.451  41.507 1.00 33.29 ? 2054 HOH A O     1 
HETATM 4100 O O     . HOH G 4 .   ? -0.142  81.038  48.279 1.00 46.32 ? 2055 HOH A O     1 
HETATM 4101 O O     . HOH G 4 .   ? -0.495  84.858  39.286 1.00 48.75 ? 2056 HOH A O     1 
HETATM 4102 O O     . HOH G 4 .   ? 5.970   85.858  36.767 1.00 51.94 ? 2057 HOH A O     1 
HETATM 4103 O O     . HOH G 4 .   ? 5.437   71.418  35.434 1.00 46.35 ? 2058 HOH A O     1 
HETATM 4104 O O     . HOH G 4 .   ? 6.331   70.920  38.115 1.00 43.20 ? 2059 HOH A O     1 
HETATM 4105 O O     . HOH G 4 .   ? 1.840   75.116  50.848 1.00 38.64 ? 2060 HOH A O     1 
HETATM 4106 O O     . HOH G 4 .   ? 0.344   73.123  53.046 1.00 50.93 ? 2061 HOH A O     1 
HETATM 4107 O O     . HOH G 4 .   ? 2.466   70.685  46.240 1.00 20.09 ? 2062 HOH A O     1 
HETATM 4108 O O     . HOH G 4 .   ? 5.624   75.575  51.959 1.00 36.15 ? 2063 HOH A O     1 
HETATM 4109 O O     . HOH G 4 .   ? 9.078   72.032  32.931 1.00 39.48 ? 2064 HOH A O     1 
HETATM 4110 O O     . HOH G 4 .   ? 13.118  70.272  35.158 1.00 29.80 ? 2065 HOH A O     1 
HETATM 4111 O O     . HOH G 4 .   ? 14.191  71.385  29.356 1.00 49.82 ? 2066 HOH A O     1 
HETATM 4112 O O     . HOH G 4 .   ? 15.387  79.020  32.587 1.00 43.59 ? 2067 HOH A O     1 
HETATM 4113 O O     . HOH G 4 .   ? 19.201  67.335  33.725 1.00 43.90 ? 2068 HOH A O     1 
HETATM 4114 O O     . HOH G 4 .   ? 16.723  67.994  37.144 1.00 27.21 ? 2069 HOH A O     1 
HETATM 4115 O O     . HOH G 4 .   ? 6.903   76.883  54.636 1.00 46.02 ? 2070 HOH A O     1 
HETATM 4116 O O     . HOH G 4 .   ? 12.995  81.129  56.058 1.00 27.16 ? 2071 HOH A O     1 
HETATM 4117 O O     . HOH G 4 .   ? 29.703  67.541  39.305 1.00 22.92 ? 2072 HOH A O     1 
HETATM 4118 O O     . HOH G 4 .   ? 29.372  73.768  35.640 1.00 51.77 ? 2073 HOH A O     1 
HETATM 4119 O O     . HOH G 4 .   ? 30.276  73.524  38.136 1.00 36.00 ? 2074 HOH A O     1 
HETATM 4120 O O     . HOH G 4 .   ? 21.174  68.694  35.169 1.00 41.61 ? 2075 HOH A O     1 
HETATM 4121 O O     . HOH G 4 .   ? 21.056  70.995  42.775 1.00 19.94 ? 2076 HOH A O     1 
HETATM 4122 O O     . HOH G 4 .   ? 27.557  75.719  47.609 1.00 29.68 ? 2077 HOH A O     1 
HETATM 4123 O O     . HOH G 4 .   ? 11.014  89.816  39.364 1.00 32.77 ? 2078 HOH A O     1 
HETATM 4124 O O     . HOH G 4 .   ? 12.758  90.290  48.040 1.00 27.30 ? 2079 HOH A O     1 
HETATM 4125 O O     . HOH G 4 .   ? 10.169  91.196  46.721 1.00 19.71 ? 2080 HOH A O     1 
HETATM 4126 O O     . HOH G 4 .   ? 4.694   88.413  55.433 1.00 48.05 ? 2081 HOH A O     1 
HETATM 4127 O O     . HOH G 4 .   ? 1.381   81.179  50.537 1.00 49.24 ? 2082 HOH A O     1 
HETATM 4128 O O     . HOH G 4 .   ? 2.066   89.150  49.305 1.00 37.63 ? 2083 HOH A O     1 
HETATM 4129 O O     . HOH H 4 .   ? 17.500  100.788 50.318 1.00 38.48 ? 2001 HOH B O     1 
HETATM 4130 O O     . HOH H 4 .   ? 15.381  96.232  48.612 1.00 46.76 ? 2002 HOH B O     1 
HETATM 4131 O O     . HOH H 4 .   ? 21.952  100.450 41.777 1.00 51.76 ? 2003 HOH B O     1 
HETATM 4132 O O     . HOH H 4 .   ? 16.162  97.032  34.778 1.00 36.05 ? 2004 HOH B O     1 
HETATM 4133 O O     . HOH H 4 .   ? 18.898  103.707 37.870 1.00 19.00 ? 2005 HOH B O     1 
HETATM 4134 O O     . HOH H 4 .   ? 18.739  107.861 32.777 1.00 39.04 ? 2006 HOH B O     1 
HETATM 4135 O O     . HOH H 4 .   ? 19.063  105.424 35.808 1.00 38.38 ? 2007 HOH B O     1 
HETATM 4136 O O     . HOH H 4 .   ? 13.603  105.376 29.503 1.00 36.89 ? 2008 HOH B O     1 
HETATM 4137 O O     . HOH H 4 .   ? 20.459  125.437 25.073 1.00 57.53 ? 2009 HOH B O     1 
HETATM 4138 O O     . HOH H 4 .   ? 28.223  141.972 42.417 1.00 44.12 ? 2010 HOH B O     1 
HETATM 4139 O O     . HOH H 4 .   ? 19.223  118.695 37.367 1.00 18.13 ? 2011 HOH B O     1 
HETATM 4140 O O     . HOH H 4 .   ? 9.994   133.378 32.127 1.00 46.54 ? 2012 HOH B O     1 
HETATM 4141 O O     . HOH H 4 .   ? 6.199   136.832 40.040 1.00 33.99 ? 2013 HOH B O     1 
HETATM 4142 O O     . HOH H 4 .   ? 19.328  122.939 25.283 1.00 46.67 ? 2014 HOH B O     1 
HETATM 4143 O O     . HOH H 4 .   ? 27.182  140.416 44.382 1.00 52.74 ? 2015 HOH B O     1 
HETATM 4144 O O     . HOH H 4 .   ? 22.519  111.933 30.944 1.00 38.83 ? 2016 HOH B O     1 
HETATM 4145 O O     . HOH H 4 .   ? 20.173  141.358 43.691 1.00 44.91 ? 2017 HOH B O     1 
HETATM 4146 O O     . HOH H 4 .   ? 18.127  142.888 38.520 1.00 46.94 ? 2018 HOH B O     1 
HETATM 4147 O O     . HOH H 4 .   ? 22.694  108.420 46.948 1.00 43.32 ? 2019 HOH B O     1 
HETATM 4148 O O     . HOH H 4 .   ? 20.991  135.260 23.044 1.00 53.07 ? 2020 HOH B O     1 
HETATM 4149 O O     . HOH H 4 .   ? 17.994  131.351 23.888 1.00 54.67 ? 2021 HOH B O     1 
HETATM 4150 O O     . HOH H 4 .   ? 23.755  129.577 28.485 1.00 52.57 ? 2022 HOH B O     1 
HETATM 4151 O O     . HOH H 4 .   ? 11.377  134.960 34.383 1.00 37.92 ? 2023 HOH B O     1 
HETATM 4152 O O     . HOH H 4 .   ? 7.973   134.898 40.781 1.00 39.54 ? 2024 HOH B O     1 
HETATM 4153 O O     . HOH H 4 .   ? 15.019  136.614 41.770 1.00 29.38 ? 2025 HOH B O     1 
HETATM 4154 O O     . HOH H 4 .   ? 14.834  124.065 25.772 1.00 44.61 ? 2026 HOH B O     1 
HETATM 4155 O O     . HOH H 4 .   ? 18.732  122.511 27.856 1.00 26.03 ? 2027 HOH B O     1 
HETATM 4156 O O     . HOH H 4 .   ? 25.860  124.132 26.373 1.00 49.76 ? 2028 HOH B O     1 
HETATM 4157 O O     . HOH H 4 .   ? 26.232  123.428 21.901 1.00 42.61 ? 2029 HOH B O     1 
HETATM 4158 O O     . HOH H 4 .   ? 22.791  115.313 28.403 1.00 35.30 ? 2030 HOH B O     1 
HETATM 4159 O O     . HOH H 4 .   ? 26.907  114.832 29.795 1.00 48.27 ? 2031 HOH B O     1 
HETATM 4160 O O     . HOH H 4 .   ? 24.136  113.882 30.206 1.00 46.18 ? 2032 HOH B O     1 
HETATM 4161 O O     . HOH H 4 .   ? 16.652  118.827 30.359 1.00 19.88 ? 2033 HOH B O     1 
HETATM 4162 O O     . HOH H 4 .   ? 19.727  115.688 30.836 1.00 21.78 ? 2034 HOH B O     1 
HETATM 4163 O O     . HOH H 4 .   ? -6.540  111.051 40.619 1.00 29.40 ? 2035 HOH B O     1 
HETATM 4164 O O     . HOH H 4 .   ? 4.868   99.338  50.758 1.00 40.30 ? 2036 HOH B O     1 
HETATM 4165 O O     . HOH H 4 .   ? 2.403   109.586 53.327 1.00 46.08 ? 2037 HOH B O     1 
HETATM 4166 O O     . HOH H 4 .   ? 16.374  121.416 29.731 1.00 32.46 ? 2038 HOH B O     1 
HETATM 4167 O O     . HOH H 4 .   ? 21.682  114.346 32.350 1.00 24.19 ? 2039 HOH B O     1 
HETATM 4168 O O     . HOH H 4 .   ? 21.002  107.771 35.735 1.00 33.72 ? 2040 HOH B O     1 
HETATM 4169 O O     . HOH H 4 .   ? 14.259  112.660 28.790 1.00 40.74 ? 2041 HOH B O     1 
HETATM 4170 O O     . HOH H 4 .   ? 20.951  109.705 45.287 1.00 23.68 ? 2042 HOH B O     1 
HETATM 4171 O O     . HOH H 4 .   ? 25.404  114.698 44.040 1.00 37.28 ? 2043 HOH B O     1 
HETATM 4172 O O     . HOH H 4 .   ? 24.888  110.035 39.778 1.00 28.20 ? 2044 HOH B O     1 
HETATM 4173 O O     . HOH H 4 .   ? 29.044  108.869 37.828 1.00 26.94 ? 2045 HOH B O     1 
HETATM 4174 O O     . HOH H 4 .   ? 29.145  115.448 34.662 1.00 38.63 ? 2046 HOH B O     1 
HETATM 4175 O O     . HOH H 4 .   ? 30.813  118.352 39.815 1.00 37.39 ? 2047 HOH B O     1 
HETATM 4176 O O     . HOH H 4 .   ? 29.790  126.764 32.146 1.00 42.77 ? 2048 HOH B O     1 
HETATM 4177 O O     . HOH H 4 .   ? 27.796  122.705 47.477 1.00 32.54 ? 2049 HOH B O     1 
HETATM 4178 O O     . HOH H 4 .   ? 28.969  123.607 51.158 1.00 36.41 ? 2050 HOH B O     1 
HETATM 4179 O O     . HOH H 4 .   ? 20.691  124.132 48.046 1.00 32.58 ? 2051 HOH B O     1 
HETATM 4180 O O     . HOH H 4 .   ? 22.890  120.741 51.581 1.00 44.60 ? 2052 HOH B O     1 
HETATM 4181 O O     . HOH H 4 .   ? 21.727  116.152 48.170 1.00 30.79 ? 2053 HOH B O     1 
HETATM 4182 O O     . HOH H 4 .   ? 14.635  121.919 51.653 1.00 49.55 ? 2054 HOH B O     1 
HETATM 4183 O O     . HOH H 4 .   ? 12.206  108.724 42.733 1.00 21.85 ? 2055 HOH B O     1 
HETATM 4184 O O     . HOH H 4 .   ? 10.428  103.603 31.771 1.00 45.26 ? 2056 HOH B O     1 
HETATM 4185 O O     . HOH H 4 .   ? 12.176  99.113  33.454 1.00 45.26 ? 2057 HOH B O     1 
HETATM 4186 O O     . HOH H 4 .   ? 6.729   95.711  28.301 1.00 52.19 ? 2058 HOH B O     1 
HETATM 4187 O O     . HOH H 4 .   ? 11.585  96.449  33.230 1.00 45.01 ? 2059 HOH B O     1 
HETATM 4188 O O     . HOH H 4 .   ? 4.270   94.103  29.085 1.00 44.98 ? 2060 HOH B O     1 
HETATM 4189 O O     . HOH H 4 .   ? -7.642  98.169  34.920 1.00 39.12 ? 2061 HOH B O     1 
HETATM 4190 O O     . HOH H 4 .   ? -8.900  98.262  37.351 1.00 57.11 ? 2062 HOH B O     1 
HETATM 4191 O O     . HOH H 4 .   ? -3.237  93.665  48.909 1.00 54.17 ? 2063 HOH B O     1 
HETATM 4192 O O     . HOH H 4 .   ? -5.839  100.803 53.002 1.00 50.54 ? 2064 HOH B O     1 
HETATM 4193 O O     . HOH H 4 .   ? -2.745  108.550 47.239 1.00 30.29 ? 2065 HOH B O     1 
HETATM 4194 O O     . HOH H 4 .   ? -7.148  103.996 34.206 1.00 24.45 ? 2066 HOH B O     1 
HETATM 4195 O O     . HOH H 4 .   ? -8.225  107.783 32.006 1.00 33.77 ? 2067 HOH B O     1 
HETATM 4196 O O     . HOH H 4 .   ? -10.875 111.505 31.154 1.00 48.67 ? 2068 HOH B O     1 
HETATM 4197 O O     . HOH H 4 .   ? -8.754  115.334 33.438 1.00 43.25 ? 2069 HOH B O     1 
HETATM 4198 O O     . HOH H 4 .   ? -3.534  103.393 33.806 1.00 30.77 ? 2070 HOH B O     1 
HETATM 4199 O O     . HOH H 4 .   ? -6.322  108.753 39.099 1.00 33.90 ? 2071 HOH B O     1 
HETATM 4200 O O     . HOH H 4 .   ? 2.905   101.003 51.480 1.00 48.08 ? 2072 HOH B O     1 
HETATM 4201 O O     . HOH H 4 .   ? 0.178   108.164 52.662 1.00 53.28 ? 2073 HOH B O     1 
HETATM 4202 O O     . HOH H 4 .   ? -3.797  110.848 46.204 1.00 30.13 ? 2074 HOH B O     1 
HETATM 4203 O O     . HOH H 4 .   ? 3.919   109.644 50.465 1.00 30.20 ? 2075 HOH B O     1 
HETATM 4204 O O     . HOH H 4 .   ? 4.078   102.774 53.249 1.00 31.21 ? 2076 HOH B O     1 
HETATM 4205 O O     . HOH H 4 .   ? 6.116   100.931 52.900 1.00 44.43 ? 2077 HOH B O     1 
HETATM 4206 O O     . HOH H 4 .   ? 4.936   112.232 49.255 1.00 36.54 ? 2078 HOH B O     1 
HETATM 4207 O O     . HOH H 4 .   ? 7.474   112.141 48.541 1.00 37.71 ? 2079 HOH B O     1 
HETATM 4208 O O     . HOH H 4 .   ? 0.668   95.468  29.339 1.00 53.67 ? 2080 HOH B O     1 
HETATM 4209 O O     . HOH H 4 .   ? -1.742  102.295 30.638 1.00 37.33 ? 2081 HOH B O     1 
HETATM 4210 O O     . HOH H 4 .   ? 11.975  115.013 47.743 1.00 46.44 ? 2082 HOH B O     1 
HETATM 4211 O O     . HOH H 4 .   ? 21.039  112.195 46.205 1.00 30.86 ? 2083 HOH B O     1 
HETATM 4212 O O     . HOH H 4 .   ? 21.079  106.560 47.863 1.00 30.88 ? 2084 HOH B O     1 
HETATM 4213 O O     . HOH H 4 .   ? 15.433  104.306 51.291 1.00 34.61 ? 2085 HOH B O     1 
HETATM 4214 O O     . HOH H 4 .   ? 12.042  111.647 50.172 1.00 30.62 ? 2086 HOH B O     1 
HETATM 4215 O O     . HOH H 4 .   ? 10.695  93.379  45.169 1.00 17.32 ? 2087 HOH B O     1 
HETATM 4216 O O     . HOH H 4 .   ? 14.708  98.340  41.946 1.00 27.26 ? 2088 HOH B O     1 
HETATM 4217 O O     . HOH H 4 .   ? 6.149   96.743  51.213 1.00 43.87 ? 2089 HOH B O     1 
HETATM 4218 O O     . HOH H 4 .   ? 8.319   91.398  36.104 1.00 22.69 ? 2090 HOH B O     1 
HETATM 4219 O O     . HOH H 4 .   ? -3.638  87.673  43.385 1.00 52.39 ? 2091 HOH B O     1 
HETATM 4220 O O     . HOH I 4 .   ? 29.765  53.105  36.293 1.00 35.33 ? 2001 HOH C O     1 
HETATM 4221 O O     . HOH I 4 .   ? 4.125   57.196  48.451 1.00 39.38 ? 2002 HOH C O     1 
HETATM 4222 O O     . HOH I 4 .   ? 12.147  60.800  49.972 1.00 42.77 ? 2003 HOH C O     1 
HETATM 4223 O O     . HOH I 4 .   ? 9.330   61.791  43.927 1.00 55.76 ? 2004 HOH C O     1 
HETATM 4224 O O     . HOH I 4 .   ? 13.029  59.565  45.814 1.00 34.23 ? 2005 HOH C O     1 
HETATM 4225 O O     . HOH I 4 .   ? 12.242  60.652  43.562 1.00 30.42 ? 2006 HOH C O     1 
HETATM 4226 O O     . HOH I 4 .   ? 12.919  63.668  35.409 1.00 44.28 ? 2007 HOH C O     1 
HETATM 4227 O O     . HOH I 4 .   ? 13.926  60.958  38.914 1.00 32.93 ? 2008 HOH C O     1 
HETATM 4228 O O     . HOH I 4 .   ? 18.085  54.262  37.069 1.00 42.26 ? 2009 HOH C O     1 
HETATM 4229 O O     . HOH I 4 .   ? 15.733  55.985  40.290 1.00 35.48 ? 2010 HOH C O     1 
HETATM 4230 O O     . HOH I 4 .   ? 16.495  58.269  39.025 1.00 54.42 ? 2011 HOH C O     1 
HETATM 4231 O O     . HOH I 4 .   ? 27.444  54.118  35.479 1.00 48.56 ? 2012 HOH C O     1 
HETATM 4232 O O     . HOH I 4 .   ? 16.384  53.232  39.023 1.00 35.43 ? 2013 HOH C O     1 
HETATM 4233 O O     . HOH I 4 .   ? 18.012  51.803  35.899 1.00 50.02 ? 2014 HOH C O     1 
HETATM 4234 O O     . HOH I 4 .   ? 26.731  45.907  35.028 1.00 47.69 ? 2015 HOH C O     1 
HETATM 4235 O O     . HOH I 4 .   ? 14.301  42.763  44.533 1.00 34.53 ? 2016 HOH C O     1 
HETATM 4236 O O     . HOH I 4 .   ? 23.697  40.464  42.303 1.00 51.96 ? 2017 HOH C O     1 
HETATM 4237 O O     . HOH I 4 .   ? 14.664  45.141  33.716 1.00 43.06 ? 2018 HOH C O     1 
HETATM 4238 O O     . HOH I 4 .   ? 8.122   42.897  41.758 1.00 45.11 ? 2019 HOH C O     1 
HETATM 4239 O O     . HOH J 4 .   ? 11.901  55.280  47.855 1.00 49.29 ? 2001 HOH D O     1 
HETATM 4240 O O     . HOH J 4 .   ? 13.991  52.093  37.700 1.00 48.35 ? 2002 HOH D O     1 
HETATM 4241 O O     . HOH J 4 .   ? 9.218   45.779  44.449 1.00 48.96 ? 2003 HOH D O     1 
HETATM 4242 O O     . HOH J 4 .   ? 13.695  54.094  41.059 1.00 48.96 ? 2004 HOH D O     1 
HETATM 4243 O O     . HOH J 4 .   ? 13.343  56.892  45.878 1.00 32.96 ? 2005 HOH D O     1 
HETATM 4244 O O     . HOH J 4 .   ? 14.156  58.624  49.376 1.00 45.80 ? 2006 HOH D O     1 
HETATM 4245 O O     . HOH J 4 .   ? 23.194  57.568  56.891 1.00 33.62 ? 2007 HOH D O     1 
HETATM 4246 O O     . HOH J 4 .   ? 18.101  59.120  54.351 1.00 24.14 ? 2008 HOH D O     1 
HETATM 4247 O O     . HOH J 4 .   ? 21.082  59.469  58.967 1.00 35.32 ? 2009 HOH D O     1 
HETATM 4248 O O     . HOH J 4 .   ? 18.948  61.259  55.458 1.00 27.61 ? 2010 HOH D O     1 
HETATM 4249 O O     . HOH J 4 .   ? 21.196  65.178  58.875 1.00 44.60 ? 2011 HOH D O     1 
HETATM 4250 O O     . HOH J 4 .   ? 17.043  63.585  55.449 1.00 46.83 ? 2012 HOH D O     1 
HETATM 4251 O O     . HOH J 4 .   ? 12.278  62.683  54.684 1.00 51.50 ? 2013 HOH D O     1 
HETATM 4252 O O     . HOH J 4 .   ? 14.558  64.013  54.353 1.00 48.60 ? 2014 HOH D O     1 
HETATM 4253 O O     . HOH J 4 .   ? 14.533  74.777  58.409 1.00 48.41 ? 2015 HOH D O     1 
HETATM 4254 O O     . HOH J 4 .   ? 11.072  77.594  57.904 1.00 44.34 ? 2016 HOH D O     1 
HETATM 4255 O O     . HOH J 4 .   ? 8.127   76.613  57.651 1.00 54.79 ? 2017 HOH D O     1 
HETATM 4256 O O     . HOH J 4 .   ? 11.483  71.289  57.935 1.00 43.03 ? 2018 HOH D O     1 
HETATM 4257 O O     . HOH J 4 .   ? 0.663   68.387  53.959 1.00 48.73 ? 2019 HOH D O     1 
HETATM 4258 O O     . HOH J 4 .   ? 4.551   75.260  54.433 1.00 46.19 ? 2020 HOH D O     1 
HETATM 4259 O O     . HOH K 4 .   ? 2.117   121.046 42.748 1.00 42.93 ? 2001 HOH E O     1 
HETATM 4260 O O     . HOH K 4 .   ? 20.766  126.529 49.282 1.00 43.13 ? 2002 HOH E O     1 
HETATM 4261 O O     . HOH K 4 .   ? -0.224  119.910 22.148 1.00 58.18 ? 2003 HOH E O     1 
HETATM 4262 O O     . HOH K 4 .   ? 1.190   121.847 31.359 1.00 54.01 ? 2004 HOH E O     1 
HETATM 4263 O O     . HOH K 4 .   ? 3.327   118.580 34.368 1.00 29.90 ? 2005 HOH E O     1 
HETATM 4264 O O     . HOH K 4 .   ? 0.785   117.663 41.114 1.00 52.80 ? 2006 HOH E O     1 
HETATM 4265 O O     . HOH K 4 .   ? 3.934   118.689 44.766 1.00 43.25 ? 2007 HOH E O     1 
HETATM 4266 O O     . HOH K 4 .   ? 3.029   119.093 40.953 1.00 38.04 ? 2008 HOH E O     1 
HETATM 4267 O O     . HOH K 4 .   ? 4.033   115.794 49.323 1.00 48.57 ? 2009 HOH E O     1 
HETATM 4268 O O     . HOH K 4 .   ? 5.925   119.161 46.356 1.00 32.18 ? 2010 HOH E O     1 
HETATM 4269 O O     . HOH K 4 .   ? 6.772   123.723 44.700 1.00 36.91 ? 2011 HOH E O     1 
HETATM 4270 O O     . HOH K 4 .   ? 9.013   125.158 47.755 1.00 45.74 ? 2012 HOH E O     1 
HETATM 4271 O O     . HOH K 4 .   ? 7.204   121.657 46.418 1.00 24.70 ? 2013 HOH E O     1 
HETATM 4272 O O     . HOH K 4 .   ? 11.615  118.834 50.487 1.00 30.63 ? 2014 HOH E O     1 
HETATM 4273 O O     . HOH K 4 .   ? 7.280   126.403 45.869 1.00 46.53 ? 2015 HOH E O     1 
HETATM 4274 O O     . HOH K 4 .   ? 18.068  126.418 49.031 1.00 48.83 ? 2016 HOH E O     1 
HETATM 4275 O O     . HOH K 4 .   ? -0.604  136.199 42.362 1.00 51.22 ? 2017 HOH E O     1 
HETATM 4276 O O     . HOH K 4 .   ? -0.623  139.735 50.763 1.00 42.34 ? 2018 HOH E O     1 
HETATM 4277 O O     . HOH K 4 .   ? -3.509  142.059 47.959 1.00 47.19 ? 2019 HOH E O     1 
HETATM 4278 O O     . HOH L 4 .   ? 3.210   123.099 41.345 1.00 45.30 ? 2001 HOH F O     1 
HETATM 4279 O O     . HOH L 4 .   ? 9.810   127.935 27.483 1.00 44.96 ? 2002 HOH F O     1 
HETATM 4280 O O     . HOH L 4 .   ? 10.320  121.141 27.059 1.00 50.81 ? 2003 HOH F O     1 
HETATM 4281 O O     . HOH L 4 .   ? 0.902   107.292 25.478 1.00 52.04 ? 2004 HOH F O     1 
HETATM 4282 O O     . HOH L 4 .   ? 4.352   131.768 52.959 1.00 56.16 ? 2005 HOH F O     1 
HETATM 4283 O O     . HOH L 4 .   ? 4.964   127.876 47.668 1.00 43.17 ? 2006 HOH F O     1 
HETATM 4284 O O     . HOH L 4 .   ? 0.062   133.422 41.196 1.00 44.51 ? 2007 HOH F O     1 
HETATM 4285 O O     . HOH L 4 .   ? 2.159   125.713 45.746 1.00 54.53 ? 2008 HOH F O     1 
HETATM 4286 O O     . HOH L 4 .   ? 6.095   125.676 32.486 1.00 42.73 ? 2009 HOH F O     1 
HETATM 4287 O O     . HOH L 4 .   ? 11.543  128.585 29.468 1.00 45.01 ? 2010 HOH F O     1 
HETATM 4288 O O     . HOH L 4 .   ? 4.752   122.611 39.124 1.00 31.89 ? 2011 HOH F O     1 
HETATM 4289 O O     . HOH L 4 .   ? 7.461   123.411 32.730 1.00 48.21 ? 2012 HOH F O     1 
HETATM 4290 O O     . HOH L 4 .   ? 9.198   120.521 30.528 1.00 22.51 ? 2013 HOH F O     1 
HETATM 4291 O O     . HOH L 4 .   ? 14.348  121.737 28.174 1.00 35.76 ? 2014 HOH F O     1 
HETATM 4292 O O     . HOH L 4 .   ? 6.318   121.205 33.601 1.00 54.02 ? 2015 HOH F O     1 
HETATM 4293 O O     . HOH L 4 .   ? 4.902   120.185 35.772 1.00 41.13 ? 2016 HOH F O     1 
HETATM 4294 O O     . HOH L 4 .   ? 9.737   118.083 29.544 1.00 36.63 ? 2017 HOH F O     1 
HETATM 4295 O O     . HOH L 4 .   ? 12.783  119.881 27.580 1.00 38.22 ? 2018 HOH F O     1 
HETATM 4296 O O     . HOH L 4 .   ? 16.251  114.800 29.995 1.00 51.97 ? 2019 HOH F O     1 
HETATM 4297 O O     . HOH L 4 .   ? 9.899   109.746 26.190 1.00 53.43 ? 2020 HOH F O     1 
HETATM 4298 O O     . HOH L 4 .   ? 8.597   115.581 29.591 1.00 32.71 ? 2021 HOH F O     1 
HETATM 4299 O O     . HOH L 4 .   ? 7.552   112.731 26.998 1.00 43.99 ? 2022 HOH F O     1 
HETATM 4300 O O     . HOH L 4 .   ? 6.389   107.192 25.090 1.00 52.00 ? 2023 HOH F O     1 
HETATM 4301 O O     . HOH L 4 .   ? 5.459   115.298 30.447 1.00 38.15 ? 2024 HOH F O     1 
HETATM 4302 O O     . HOH L 4 .   ? 2.868   101.136 27.842 1.00 44.02 ? 2025 HOH F O     1 
HETATM 4303 O O     . HOH L 4 .   ? 2.205   111.709 26.453 1.00 55.02 ? 2026 HOH F O     1 
HETATM 4304 O O     . HOH L 4 .   ? 2.758   107.859 27.439 1.00 38.58 ? 2027 HOH F O     1 
HETATM 4305 O O     . HOH L 4 .   ? 5.565   104.173 27.662 1.00 50.30 ? 2028 HOH F O     1 
HETATM 4306 O O     . HOH L 4 .   ? -8.295  110.676 31.245 1.00 34.90 ? 2029 HOH F O     1 
HETATM 4307 O O     . HOH L 4 .   ? -0.899  109.266 25.918 1.00 45.71 ? 2030 HOH F O     1 
HETATM 4308 O O     . HOH L 4 .   ? -8.663  115.337 28.081 1.00 48.10 ? 2031 HOH F O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   THR 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   ?   ?   ?   A . n 
A 1 4   GLN 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   ?   ?   ?   A . n 
A 1 6   LEU 6   6   ?   ?   ?   A . n 
A 1 7   GLU 7   7   ?   ?   ?   A . n 
A 1 8   GLY 8   8   ?   ?   ?   A . n 
A 1 9   SER 9   9   ?   ?   ?   A . n 
A 1 10  ASN 10  10  ?   ?   ?   A . n 
A 1 11  PRO 11  11  ?   ?   ?   A . n 
A 1 12  VAL 12  12  ?   ?   ?   A . n 
A 1 13  ASP 13  13  13  ASP ASP A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  HIS 17  17  17  HIS HIS A . n 
A 1 18  PRO 18  18  18  PRO PRO A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ILE 21  21  21  ILE ILE A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  PRO 23  23  23  PRO PRO A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  GLN 26  26  26  GLN GLN A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  ILE 28  28  28  ILE ILE A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  THR 31  31  31  THR THR A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  ASN 33  33  33  ASN ASN A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  CYS 36  36  36  CYS CYS A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  ILE 43  43  43  ILE ILE A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  GLN 46  46  46  GLN GLN A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  ARG 48  48  48  ARG ARG A . n 
A 1 49  ASN 49  49  49  ASN ASN A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  TYR 52  52  52  TYR TYR A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  PHE 57  57  57  PHE PHE A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  MET 62  62  62  MET MET A . n 
A 1 63  ARG 63  63  63  ARG ARG A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  ARG 65  65  65  ARG ARG A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  PRO 67  67  67  PRO PRO A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  PHE 74  74  74  PHE PHE A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  MET 79  79  79  MET MET A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  CYS 81  81  81  CYS CYS A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  LYS 85  85  85  LYS LYS A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  MET 92  92  92  MET MET A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  ARG 95  95  95  ARG ARG A . n 
A 1 96  LYS 96  96  96  LYS LYS A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 GLN 102 102 102 GLN GLN A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 GLY 105 105 105 GLY GLY A . n 
A 1 106 PHE 106 106 106 PHE PHE A . n 
A 1 107 PRO 107 107 107 PRO PRO A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 PHE 110 110 110 PHE PHE A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 PHE 113 113 113 PHE PHE A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 GLN 116 116 116 GLN GLN A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 CYS 122 122 122 CYS CYS A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 PHE 126 126 126 PHE PHE A . n 
A 1 127 PRO 127 127 127 PRO PRO A . n 
A 1 128 ILE 128 128 128 ILE ILE A . n 
A 1 129 ARG 129 129 129 ARG ARG A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 TYR 135 135 135 TYR TYR A . n 
A 1 136 SER 136 136 136 SER SER A . n 
A 1 137 HIS 137 137 137 HIS HIS A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 PHE 140 140 140 PHE PHE A . n 
A 1 141 SER 141 141 141 SER SER A . n 
A 1 142 SER 142 142 142 SER SER A . n 
A 1 143 TYR 143 143 143 TYR TYR A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 GLU 146 146 146 GLU GLU A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 PHE 148 148 148 PHE PHE A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 TYR 153 153 153 TYR TYR A . n 
A 1 154 ARG 154 154 154 ARG ARG A . n 
A 1 155 MET 155 155 155 MET MET A . n 
A 1 156 LYS 156 156 156 LYS LYS A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 LYS 159 159 159 LYS LYS A . n 
A 1 160 ILE 160 160 160 ILE ILE A . n 
A 1 161 VAL 161 161 161 VAL VAL A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 ILE 164 164 164 ILE ILE A . n 
A 1 165 PHE 165 165 165 PHE PHE A . n 
A 1 166 VAL 166 166 166 VAL VAL A . n 
A 1 167 SER 167 167 167 SER SER A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 ILE 170 170 170 ILE ILE A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 THR 173 173 173 THR THR A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 ALA 175 175 175 ALA ALA A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 MET 177 177 177 MET MET A . n 
A 1 178 ARG 178 178 178 ARG ARG A . n 
A 1 179 ASP 179 179 179 ASP ASP A . n 
A 1 180 GLU 180 180 180 GLU GLU A . n 
A 1 181 THR 181 181 181 THR THR A . n 
A 1 182 TYR 182 182 182 TYR TYR A . n 
A 1 183 LYS 183 183 183 LYS LYS A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 ASN 187 187 187 ASN ASN A . n 
A 1 188 ILE 188 188 188 ILE ILE A . n 
A 1 189 TYR 189 189 189 TYR TYR A . n 
A 1 190 PRO 190 190 190 PRO PRO A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 SER 193 193 193 SER SER A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 PHE 195 195 195 PHE PHE A . n 
A 1 196 ARG 196 196 196 ARG ARG A . n 
A 1 197 LYS 197 197 197 LYS LYS A . n 
A 1 198 ILE 198 198 198 ILE ILE A . n 
A 1 199 GLN 199 199 ?   ?   ?   A . n 
A 1 200 GLN 200 200 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   THR 2   2   ?   ?   ?   B . n 
B 1 3   ASP 3   3   ?   ?   ?   B . n 
B 1 4   GLN 4   4   ?   ?   ?   B . n 
B 1 5   GLY 5   5   ?   ?   ?   B . n 
B 1 6   LEU 6   6   ?   ?   ?   B . n 
B 1 7   GLU 7   7   ?   ?   ?   B . n 
B 1 8   GLY 8   8   ?   ?   ?   B . n 
B 1 9   SER 9   9   ?   ?   ?   B . n 
B 1 10  ASN 10  10  ?   ?   ?   B . n 
B 1 11  PRO 11  11  ?   ?   ?   B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  ASP 13  13  13  ASP ASP B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  SER 15  15  15  SER SER B . n 
B 1 16  LYS 16  16  16  LYS LYS B . n 
B 1 17  HIS 17  17  17  HIS HIS B . n 
B 1 18  PRO 18  18  18  PRO PRO B . n 
B 1 19  SER 19  19  19  SER SER B . n 
B 1 20  GLY 20  20  20  GLY GLY B . n 
B 1 21  ILE 21  21  21  ILE ILE B . n 
B 1 22  VAL 22  22  22  VAL VAL B . n 
B 1 23  PRO 23  23  23  PRO PRO B . n 
B 1 24  THR 24  24  24  THR THR B . n 
B 1 25  LEU 25  25  25  LEU LEU B . n 
B 1 26  GLN 26  26  26  GLN GLN B . n 
B 1 27  ASN 27  27  27  ASN ASN B . n 
B 1 28  ILE 28  28  28  ILE ILE B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  THR 31  31  31  THR THR B . n 
B 1 32  VAL 32  32  32  VAL VAL B . n 
B 1 33  ASN 33  33  33  ASN ASN B . n 
B 1 34  LEU 34  34  34  LEU LEU B . n 
B 1 35  ASP 35  35  35  ASP ASP B . n 
B 1 36  CYS 36  36  36  CYS CYS B . n 
B 1 37  LYS 37  37  37  LYS LYS B . n 
B 1 38  LEU 38  38  38  LEU LEU B . n 
B 1 39  ASP 39  39  39  ASP ASP B . n 
B 1 40  LEU 40  40  40  LEU LEU B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  ALA 42  42  42  ALA ALA B . n 
B 1 43  ILE 43  43  43  ILE ILE B . n 
B 1 44  ALA 44  44  44  ALA ALA B . n 
B 1 45  LEU 45  45  45  LEU LEU B . n 
B 1 46  GLN 46  46  46  GLN GLN B . n 
B 1 47  ALA 47  47  47  ALA ALA B . n 
B 1 48  ARG 48  48  48  ARG ARG B . n 
B 1 49  ASN 49  49  49  ASN ASN B . n 
B 1 50  ALA 50  50  50  ALA ALA B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  TYR 52  52  52  TYR TYR B . n 
B 1 53  ASN 53  53  53  ASN ASN B . n 
B 1 54  PRO 54  54  54  PRO PRO B . n 
B 1 55  LYS 55  55  55  LYS LYS B . n 
B 1 56  ARG 56  56  56  ARG ARG B . n 
B 1 57  PHE 57  57  57  PHE PHE B . n 
B 1 58  ALA 58  58  58  ALA ALA B . n 
B 1 59  ALA 59  59  59  ALA ALA B . n 
B 1 60  VAL 60  60  60  VAL VAL B . n 
B 1 61  ILE 61  61  61  ILE ILE B . n 
B 1 62  MET 62  62  62  MET MET B . n 
B 1 63  ARG 63  63  63  ARG ARG B . n 
B 1 64  ILE 64  64  64  ILE ILE B . n 
B 1 65  ARG 65  65  65  ARG ARG B . n 
B 1 66  GLU 66  66  66  GLU GLU B . n 
B 1 67  PRO 67  67  67  PRO PRO B . n 
B 1 68  LYS 68  68  68  LYS LYS B . n 
B 1 69  THR 69  69  69  THR THR B . n 
B 1 70  THR 70  70  70  THR THR B . n 
B 1 71  ALA 71  71  71  ALA ALA B . n 
B 1 72  LEU 72  72  72  LEU LEU B . n 
B 1 73  ILE 73  73  73  ILE ILE B . n 
B 1 74  PHE 74  74  74  PHE PHE B . n 
B 1 75  ALA 75  75  75  ALA ALA B . n 
B 1 76  SER 76  76  76  SER SER B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  LYS 78  78  78  LYS LYS B . n 
B 1 79  MET 79  79  79  MET MET B . n 
B 1 80  VAL 80  80  80  VAL VAL B . n 
B 1 81  CYS 81  81  81  CYS CYS B . n 
B 1 82  THR 82  82  82  THR THR B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  ALA 84  84  84  ALA ALA B . n 
B 1 85  LYS 85  85  85  LYS LYS B . n 
B 1 86  SER 86  86  86  SER SER B . n 
B 1 87  GLU 87  87  87  GLU GLU B . n 
B 1 88  ASP 88  88  88  ASP ASP B . n 
B 1 89  PHE 89  89  89  PHE PHE B . n 
B 1 90  SER 90  90  90  SER SER B . n 
B 1 91  LYS 91  91  91  LYS LYS B . n 
B 1 92  MET 92  92  92  MET MET B . n 
B 1 93  ALA 93  93  93  ALA ALA B . n 
B 1 94  ALA 94  94  94  ALA ALA B . n 
B 1 95  ARG 95  95  95  ARG ARG B . n 
B 1 96  LYS 96  96  96  LYS LYS B . n 
B 1 97  TYR 97  97  97  TYR TYR B . n 
B 1 98  ALA 98  98  98  ALA ALA B . n 
B 1 99  ARG 99  99  99  ARG ARG B . n 
B 1 100 ILE 100 100 100 ILE ILE B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 GLN 102 102 102 GLN GLN B . n 
B 1 103 LYS 103 103 103 LYS LYS B . n 
B 1 104 LEU 104 104 104 LEU LEU B . n 
B 1 105 GLY 105 105 105 GLY GLY B . n 
B 1 106 PHE 106 106 106 PHE PHE B . n 
B 1 107 PRO 107 107 107 PRO PRO B . n 
B 1 108 ALA 108 108 108 ALA ALA B . n 
B 1 109 LYS 109 109 109 LYS LYS B . n 
B 1 110 PHE 110 110 110 PHE PHE B . n 
B 1 111 LYS 111 111 111 LYS LYS B . n 
B 1 112 ASP 112 112 112 ASP ASP B . n 
B 1 113 PHE 113 113 113 PHE PHE B . n 
B 1 114 LYS 114 114 114 LYS LYS B . n 
B 1 115 ILE 115 115 115 ILE ILE B . n 
B 1 116 GLN 116 116 116 GLN GLN B . n 
B 1 117 ASN 117 117 117 ASN ASN B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 VAL 119 119 119 VAL VAL B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 SER 121 121 121 SER SER B . n 
B 1 122 CYS 122 122 122 CYS CYS B . n 
B 1 123 ASP 123 123 123 ASP ASP B . n 
B 1 124 VAL 124 124 124 VAL VAL B . n 
B 1 125 LYS 125 125 125 LYS LYS B . n 
B 1 126 PHE 126 126 126 PHE PHE B . n 
B 1 127 PRO 127 127 127 PRO PRO B . n 
B 1 128 ILE 128 128 128 ILE ILE B . n 
B 1 129 ARG 129 129 129 ARG ARG B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 GLU 131 131 131 GLU GLU B . n 
B 1 132 GLY 132 132 132 GLY GLY B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 ALA 134 134 134 ALA ALA B . n 
B 1 135 TYR 135 135 135 TYR TYR B . n 
B 1 136 SER 136 136 136 SER SER B . n 
B 1 137 HIS 137 137 137 HIS HIS B . n 
B 1 138 ALA 138 138 138 ALA ALA B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 PHE 140 140 140 PHE PHE B . n 
B 1 141 SER 141 141 141 SER SER B . n 
B 1 142 SER 142 142 142 SER SER B . n 
B 1 143 TYR 143 143 143 TYR TYR B . n 
B 1 144 GLU 144 144 144 GLU GLU B . n 
B 1 145 PRO 145 145 145 PRO PRO B . n 
B 1 146 GLU 146 146 146 GLU GLU B . n 
B 1 147 LEU 147 147 147 LEU LEU B . n 
B 1 148 PHE 148 148 148 PHE PHE B . n 
B 1 149 PRO 149 149 149 PRO PRO B . n 
B 1 150 GLY 150 150 150 GLY GLY B . n 
B 1 151 LEU 151 151 151 LEU LEU B . n 
B 1 152 ILE 152 152 152 ILE ILE B . n 
B 1 153 TYR 153 153 153 TYR TYR B . n 
B 1 154 ARG 154 154 154 ARG ARG B . n 
B 1 155 MET 155 155 155 MET MET B . n 
B 1 156 LYS 156 156 156 LYS LYS B . n 
B 1 157 VAL 157 157 157 VAL VAL B . n 
B 1 158 PRO 158 158 158 PRO PRO B . n 
B 1 159 LYS 159 159 159 LYS LYS B . n 
B 1 160 ILE 160 160 160 ILE ILE B . n 
B 1 161 VAL 161 161 161 VAL VAL B . n 
B 1 162 LEU 162 162 162 LEU LEU B . n 
B 1 163 LEU 163 163 163 LEU LEU B . n 
B 1 164 ILE 164 164 164 ILE ILE B . n 
B 1 165 PHE 165 165 165 PHE PHE B . n 
B 1 166 VAL 166 166 166 VAL VAL B . n 
B 1 167 SER 167 167 167 SER SER B . n 
B 1 168 GLY 168 168 168 GLY GLY B . n 
B 1 169 LYS 169 169 169 LYS LYS B . n 
B 1 170 ILE 170 170 170 ILE ILE B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 ILE 172 172 172 ILE ILE B . n 
B 1 173 THR 173 173 173 THR THR B . n 
B 1 174 GLY 174 174 174 GLY GLY B . n 
B 1 175 ALA 175 175 175 ALA ALA B . n 
B 1 176 LYS 176 176 176 LYS LYS B . n 
B 1 177 MET 177 177 177 MET MET B . n 
B 1 178 ARG 178 178 178 ARG ARG B . n 
B 1 179 ASP 179 179 179 ASP ASP B . n 
B 1 180 GLU 180 180 180 GLU GLU B . n 
B 1 181 THR 181 181 181 THR THR B . n 
B 1 182 TYR 182 182 182 TYR TYR B . n 
B 1 183 LYS 183 183 183 LYS LYS B . n 
B 1 184 ALA 184 184 184 ALA ALA B . n 
B 1 185 PHE 185 185 185 PHE PHE B . n 
B 1 186 GLU 186 186 186 GLU GLU B . n 
B 1 187 ASN 187 187 187 ASN ASN B . n 
B 1 188 ILE 188 188 188 ILE ILE B . n 
B 1 189 TYR 189 189 189 TYR TYR B . n 
B 1 190 PRO 190 190 190 PRO PRO B . n 
B 1 191 VAL 191 191 191 VAL VAL B . n 
B 1 192 LEU 192 192 192 LEU LEU B . n 
B 1 193 SER 193 193 193 SER SER B . n 
B 1 194 GLU 194 194 194 GLU GLU B . n 
B 1 195 PHE 195 195 195 PHE PHE B . n 
B 1 196 ARG 196 196 196 ARG ARG B . n 
B 1 197 LYS 197 197 197 LYS LYS B . n 
B 1 198 ILE 198 198 ?   ?   ?   B . n 
B 1 199 GLN 199 199 ?   ?   ?   B . n 
B 1 200 GLN 200 200 ?   ?   ?   B . n 
C 2 1   DG  1   201 201 DG  DG  C . n 
C 2 2   DC  2   202 202 DC  DC  C . n 
C 2 3   DT  3   203 203 DT  DT  C . n 
C 2 4   DA  4   204 204 DA  DA  C . n 
C 2 5   DT  5   205 205 DT  DT  C . n 
C 2 6   DA  6   206 206 DA  DA  C . n 
C 2 7   DT  7   207 207 DT  DT  C . n 
C 2 8   DA  8   208 208 DA  DA  C . n 
C 2 9   DA  9   209 209 DA  DA  C . n 
C 2 10  DG  10  210 210 DG  DG  C . n 
C 2 11  DG  11  211 211 DG  DG  C . n 
C 2 12  DG  12  212 212 DG  DG  C . n 
C 2 13  DC  13  213 213 DC  DC  C . n 
C 2 14  DA  14  214 214 DA  DA  C . n 
D 3 1   DT  1   215 215 DT  DT  D . n 
D 3 2   DG  2   216 216 DG  DG  D . n 
D 3 3   DC  3   217 217 DC  DC  D . n 
D 3 4   DC  4   218 218 DC  DC  D . n 
D 3 5   DC  5   219 219 DC  DC  D . n 
D 3 6   DT  6   220 220 DT  DT  D . n 
D 3 7   DT  7   221 221 DT  DT  D . n 
D 3 8   DA  8   222 222 DA  DA  D . n 
D 3 9   DT  9   223 223 DT  DT  D . n 
D 3 10  DA  10  224 224 DA  DA  D . n 
D 3 11  DT  11  225 225 DT  DT  D . n 
D 3 12  DA  12  226 226 DA  DA  D . n 
D 3 13  DG  13  227 227 DG  DG  D . n 
D 3 14  DC  14  228 228 DC  DC  D . n 
E 2 1   DG  1   201 201 DG  DG  E . n 
E 2 2   DC  2   202 202 DC  DC  E . n 
E 2 3   DT  3   203 203 DT  DT  E . n 
E 2 4   DA  4   204 204 DA  DA  E . n 
E 2 5   DT  5   205 205 DT  DT  E . n 
E 2 6   DA  6   206 206 DA  DA  E . n 
E 2 7   DT  7   207 207 DT  DT  E . n 
E 2 8   DA  8   208 208 DA  DA  E . n 
E 2 9   DA  9   209 209 DA  DA  E . n 
E 2 10  DG  10  210 210 DG  DG  E . n 
E 2 11  DG  11  211 211 DG  DG  E . n 
E 2 12  DG  12  212 212 DG  DG  E . n 
E 2 13  DC  13  213 213 DC  DC  E . n 
E 2 14  DA  14  214 214 DA  DA  E . n 
F 3 1   DT  1   215 215 DT  DT  F . n 
F 3 2   DG  2   216 216 DG  DG  F . n 
F 3 3   DC  3   217 217 DC  DC  F . n 
F 3 4   DC  4   218 218 DC  DC  F . n 
F 3 5   DC  5   219 219 DC  DC  F . n 
F 3 6   DT  6   220 220 DT  DT  F . n 
F 3 7   DT  7   221 221 DT  DT  F . n 
F 3 8   DA  8   222 222 DA  DA  F . n 
F 3 9   DT  9   223 223 DT  DT  F . n 
F 3 10  DA  10  224 224 DA  DA  F . n 
F 3 11  DT  11  225 225 DT  DT  F . n 
F 3 12  DA  12  226 226 DA  DA  F . n 
F 3 13  DG  13  227 227 DG  DG  F . n 
F 3 14  DC  14  228 228 DC  DC  F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 HOH 1  2001 2001 HOH HOH A . 
G 4 HOH 2  2002 2002 HOH HOH A . 
G 4 HOH 3  2003 2003 HOH HOH A . 
G 4 HOH 4  2004 2004 HOH HOH A . 
G 4 HOH 5  2005 2005 HOH HOH A . 
G 4 HOH 6  2006 2006 HOH HOH A . 
G 4 HOH 7  2007 2007 HOH HOH A . 
G 4 HOH 8  2008 2008 HOH HOH A . 
G 4 HOH 9  2009 2009 HOH HOH A . 
G 4 HOH 10 2010 2010 HOH HOH A . 
G 4 HOH 11 2011 2011 HOH HOH A . 
G 4 HOH 12 2012 2012 HOH HOH A . 
G 4 HOH 13 2013 2013 HOH HOH A . 
G 4 HOH 14 2014 2014 HOH HOH A . 
G 4 HOH 15 2015 2015 HOH HOH A . 
G 4 HOH 16 2016 2016 HOH HOH A . 
G 4 HOH 17 2017 2017 HOH HOH A . 
G 4 HOH 18 2018 2018 HOH HOH A . 
G 4 HOH 19 2019 2019 HOH HOH A . 
G 4 HOH 20 2020 2020 HOH HOH A . 
G 4 HOH 21 2021 2021 HOH HOH A . 
G 4 HOH 22 2022 2022 HOH HOH A . 
G 4 HOH 23 2023 2023 HOH HOH A . 
G 4 HOH 24 2024 2024 HOH HOH A . 
G 4 HOH 25 2025 2025 HOH HOH A . 
G 4 HOH 26 2026 2026 HOH HOH A . 
G 4 HOH 27 2027 2027 HOH HOH A . 
G 4 HOH 28 2028 2028 HOH HOH A . 
G 4 HOH 29 2029 2029 HOH HOH A . 
G 4 HOH 30 2030 2030 HOH HOH A . 
G 4 HOH 31 2031 2031 HOH HOH A . 
G 4 HOH 32 2032 2032 HOH HOH A . 
G 4 HOH 33 2033 2033 HOH HOH A . 
G 4 HOH 34 2034 2034 HOH HOH A . 
G 4 HOH 35 2035 2035 HOH HOH A . 
G 4 HOH 36 2036 2036 HOH HOH A . 
G 4 HOH 37 2037 2037 HOH HOH A . 
G 4 HOH 38 2038 2038 HOH HOH A . 
G 4 HOH 39 2039 2039 HOH HOH A . 
G 4 HOH 40 2040 2040 HOH HOH A . 
G 4 HOH 41 2041 2041 HOH HOH A . 
G 4 HOH 42 2042 2042 HOH HOH A . 
G 4 HOH 43 2043 2043 HOH HOH A . 
G 4 HOH 44 2044 2044 HOH HOH A . 
G 4 HOH 45 2045 2045 HOH HOH A . 
G 4 HOH 46 2046 2046 HOH HOH A . 
G 4 HOH 47 2047 2047 HOH HOH A . 
G 4 HOH 48 2048 2048 HOH HOH A . 
G 4 HOH 49 2049 2049 HOH HOH A . 
G 4 HOH 50 2050 2050 HOH HOH A . 
G 4 HOH 51 2051 2051 HOH HOH A . 
G 4 HOH 52 2052 2052 HOH HOH A . 
G 4 HOH 53 2053 2053 HOH HOH A . 
G 4 HOH 54 2054 2054 HOH HOH A . 
G 4 HOH 55 2055 2055 HOH HOH A . 
G 4 HOH 56 2056 2056 HOH HOH A . 
G 4 HOH 57 2057 2057 HOH HOH A . 
G 4 HOH 58 2058 2058 HOH HOH A . 
G 4 HOH 59 2059 2059 HOH HOH A . 
G 4 HOH 60 2060 2060 HOH HOH A . 
G 4 HOH 61 2061 2061 HOH HOH A . 
G 4 HOH 62 2062 2062 HOH HOH A . 
G 4 HOH 63 2063 2063 HOH HOH A . 
G 4 HOH 64 2064 2064 HOH HOH A . 
G 4 HOH 65 2065 2065 HOH HOH A . 
G 4 HOH 66 2066 2066 HOH HOH A . 
G 4 HOH 67 2067 2067 HOH HOH A . 
G 4 HOH 68 2068 2068 HOH HOH A . 
G 4 HOH 69 2069 2069 HOH HOH A . 
G 4 HOH 70 2070 2070 HOH HOH A . 
G 4 HOH 71 2071 2071 HOH HOH A . 
G 4 HOH 72 2072 2072 HOH HOH A . 
G 4 HOH 73 2073 2073 HOH HOH A . 
G 4 HOH 74 2074 2074 HOH HOH A . 
G 4 HOH 75 2075 2075 HOH HOH A . 
G 4 HOH 76 2076 2076 HOH HOH A . 
G 4 HOH 77 2077 2077 HOH HOH A . 
G 4 HOH 78 2078 2078 HOH HOH A . 
G 4 HOH 79 2079 2079 HOH HOH A . 
G 4 HOH 80 2080 2080 HOH HOH A . 
G 4 HOH 81 2081 2081 HOH HOH A . 
G 4 HOH 82 2082 2082 HOH HOH A . 
G 4 HOH 83 2083 2083 HOH HOH A . 
H 4 HOH 1  2001 2001 HOH HOH B . 
H 4 HOH 2  2002 2002 HOH HOH B . 
H 4 HOH 3  2003 2003 HOH HOH B . 
H 4 HOH 4  2004 2004 HOH HOH B . 
H 4 HOH 5  2005 2005 HOH HOH B . 
H 4 HOH 6  2006 2006 HOH HOH B . 
H 4 HOH 7  2007 2007 HOH HOH B . 
H 4 HOH 8  2008 2008 HOH HOH B . 
H 4 HOH 9  2009 2009 HOH HOH B . 
H 4 HOH 10 2010 2010 HOH HOH B . 
H 4 HOH 11 2011 2011 HOH HOH B . 
H 4 HOH 12 2012 2012 HOH HOH B . 
H 4 HOH 13 2013 2013 HOH HOH B . 
H 4 HOH 14 2014 2014 HOH HOH B . 
H 4 HOH 15 2015 2015 HOH HOH B . 
H 4 HOH 16 2016 2016 HOH HOH B . 
H 4 HOH 17 2017 2017 HOH HOH B . 
H 4 HOH 18 2018 2018 HOH HOH B . 
H 4 HOH 19 2019 2019 HOH HOH B . 
H 4 HOH 20 2020 2020 HOH HOH B . 
H 4 HOH 21 2021 2021 HOH HOH B . 
H 4 HOH 22 2022 2022 HOH HOH B . 
H 4 HOH 23 2023 2023 HOH HOH B . 
H 4 HOH 24 2024 2024 HOH HOH B . 
H 4 HOH 25 2025 2025 HOH HOH B . 
H 4 HOH 26 2026 2026 HOH HOH B . 
H 4 HOH 27 2027 2027 HOH HOH B . 
H 4 HOH 28 2028 2028 HOH HOH B . 
H 4 HOH 29 2029 2029 HOH HOH B . 
H 4 HOH 30 2030 2030 HOH HOH B . 
H 4 HOH 31 2031 2031 HOH HOH B . 
H 4 HOH 32 2032 2032 HOH HOH B . 
H 4 HOH 33 2033 2033 HOH HOH B . 
H 4 HOH 34 2034 2034 HOH HOH B . 
H 4 HOH 35 2035 2035 HOH HOH B . 
H 4 HOH 36 2036 2036 HOH HOH B . 
H 4 HOH 37 2037 2037 HOH HOH B . 
H 4 HOH 38 2038 2038 HOH HOH B . 
H 4 HOH 39 2039 2039 HOH HOH B . 
H 4 HOH 40 2040 2040 HOH HOH B . 
H 4 HOH 41 2041 2041 HOH HOH B . 
H 4 HOH 42 2042 2042 HOH HOH B . 
H 4 HOH 43 2043 2043 HOH HOH B . 
H 4 HOH 44 2044 2044 HOH HOH B . 
H 4 HOH 45 2045 2045 HOH HOH B . 
H 4 HOH 46 2046 2046 HOH HOH B . 
H 4 HOH 47 2047 2047 HOH HOH B . 
H 4 HOH 48 2048 2048 HOH HOH B . 
H 4 HOH 49 2049 2049 HOH HOH B . 
H 4 HOH 50 2050 2050 HOH HOH B . 
H 4 HOH 51 2051 2051 HOH HOH B . 
H 4 HOH 52 2052 2052 HOH HOH B . 
H 4 HOH 53 2053 2053 HOH HOH B . 
H 4 HOH 54 2054 2054 HOH HOH B . 
H 4 HOH 55 2055 2055 HOH HOH B . 
H 4 HOH 56 2056 2056 HOH HOH B . 
H 4 HOH 57 2057 2057 HOH HOH B . 
H 4 HOH 58 2058 2058 HOH HOH B . 
H 4 HOH 59 2059 2059 HOH HOH B . 
H 4 HOH 60 2060 2060 HOH HOH B . 
H 4 HOH 61 2061 2061 HOH HOH B . 
H 4 HOH 62 2062 2062 HOH HOH B . 
H 4 HOH 63 2063 2063 HOH HOH B . 
H 4 HOH 64 2064 2064 HOH HOH B . 
H 4 HOH 65 2065 2065 HOH HOH B . 
H 4 HOH 66 2066 2066 HOH HOH B . 
H 4 HOH 67 2067 2067 HOH HOH B . 
H 4 HOH 68 2068 2068 HOH HOH B . 
H 4 HOH 69 2069 2069 HOH HOH B . 
H 4 HOH 70 2070 2070 HOH HOH B . 
H 4 HOH 71 2071 2071 HOH HOH B . 
H 4 HOH 72 2072 2072 HOH HOH B . 
H 4 HOH 73 2073 2073 HOH HOH B . 
H 4 HOH 74 2074 2074 HOH HOH B . 
H 4 HOH 75 2075 2075 HOH HOH B . 
H 4 HOH 76 2076 2076 HOH HOH B . 
H 4 HOH 77 2077 2077 HOH HOH B . 
H 4 HOH 78 2078 2078 HOH HOH B . 
H 4 HOH 79 2079 2079 HOH HOH B . 
H 4 HOH 80 2080 2080 HOH HOH B . 
H 4 HOH 81 2081 2081 HOH HOH B . 
H 4 HOH 82 2082 2082 HOH HOH B . 
H 4 HOH 83 2083 2083 HOH HOH B . 
H 4 HOH 84 2084 2084 HOH HOH B . 
H 4 HOH 85 2085 2085 HOH HOH B . 
H 4 HOH 86 2086 2086 HOH HOH B . 
H 4 HOH 87 2087 2087 HOH HOH B . 
H 4 HOH 88 2088 2088 HOH HOH B . 
H 4 HOH 89 2089 2089 HOH HOH B . 
H 4 HOH 90 2090 2090 HOH HOH B . 
H 4 HOH 91 2091 2091 HOH HOH B . 
I 4 HOH 1  2001 2001 HOH HOH C . 
I 4 HOH 2  2002 2002 HOH HOH C . 
I 4 HOH 3  2003 2003 HOH HOH C . 
I 4 HOH 4  2004 2004 HOH HOH C . 
I 4 HOH 5  2005 2005 HOH HOH C . 
I 4 HOH 6  2006 2006 HOH HOH C . 
I 4 HOH 7  2007 2007 HOH HOH C . 
I 4 HOH 8  2008 2008 HOH HOH C . 
I 4 HOH 9  2009 2009 HOH HOH C . 
I 4 HOH 10 2010 2010 HOH HOH C . 
I 4 HOH 11 2011 2011 HOH HOH C . 
I 4 HOH 12 2012 2012 HOH HOH C . 
I 4 HOH 13 2013 2013 HOH HOH C . 
I 4 HOH 14 2014 2014 HOH HOH C . 
I 4 HOH 15 2015 2015 HOH HOH C . 
I 4 HOH 16 2016 2016 HOH HOH C . 
I 4 HOH 17 2017 2017 HOH HOH C . 
I 4 HOH 18 2018 2018 HOH HOH C . 
I 4 HOH 19 2019 2019 HOH HOH C . 
J 4 HOH 1  2001 2001 HOH HOH D . 
J 4 HOH 2  2002 2002 HOH HOH D . 
J 4 HOH 3  2003 2003 HOH HOH D . 
J 4 HOH 4  2004 2004 HOH HOH D . 
J 4 HOH 5  2005 2005 HOH HOH D . 
J 4 HOH 6  2006 2006 HOH HOH D . 
J 4 HOH 7  2007 2007 HOH HOH D . 
J 4 HOH 8  2008 2008 HOH HOH D . 
J 4 HOH 9  2009 2009 HOH HOH D . 
J 4 HOH 10 2010 2010 HOH HOH D . 
J 4 HOH 11 2011 2011 HOH HOH D . 
J 4 HOH 12 2012 2012 HOH HOH D . 
J 4 HOH 13 2013 2013 HOH HOH D . 
J 4 HOH 14 2014 2014 HOH HOH D . 
J 4 HOH 15 2015 2015 HOH HOH D . 
J 4 HOH 16 2016 2016 HOH HOH D . 
J 4 HOH 17 2017 2017 HOH HOH D . 
J 4 HOH 18 2018 2018 HOH HOH D . 
J 4 HOH 19 2019 2019 HOH HOH D . 
J 4 HOH 20 2020 2020 HOH HOH D . 
K 4 HOH 1  2001 2001 HOH HOH E . 
K 4 HOH 2  2002 2002 HOH HOH E . 
K 4 HOH 3  2003 2003 HOH HOH E . 
K 4 HOH 4  2004 2004 HOH HOH E . 
K 4 HOH 5  2005 2005 HOH HOH E . 
K 4 HOH 6  2006 2006 HOH HOH E . 
K 4 HOH 7  2007 2007 HOH HOH E . 
K 4 HOH 8  2008 2008 HOH HOH E . 
K 4 HOH 9  2009 2009 HOH HOH E . 
K 4 HOH 10 2010 2010 HOH HOH E . 
K 4 HOH 11 2011 2011 HOH HOH E . 
K 4 HOH 12 2012 2012 HOH HOH E . 
K 4 HOH 13 2013 2013 HOH HOH E . 
K 4 HOH 14 2014 2014 HOH HOH E . 
K 4 HOH 15 2015 2015 HOH HOH E . 
K 4 HOH 16 2016 2016 HOH HOH E . 
K 4 HOH 17 2017 2017 HOH HOH E . 
K 4 HOH 18 2018 2018 HOH HOH E . 
K 4 HOH 19 2019 2019 HOH HOH E . 
L 4 HOH 1  2001 2001 HOH HOH F . 
L 4 HOH 2  2002 2002 HOH HOH F . 
L 4 HOH 3  2003 2003 HOH HOH F . 
L 4 HOH 4  2004 2004 HOH HOH F . 
L 4 HOH 5  2005 2005 HOH HOH F . 
L 4 HOH 6  2006 2006 HOH HOH F . 
L 4 HOH 7  2007 2007 HOH HOH F . 
L 4 HOH 8  2008 2008 HOH HOH F . 
L 4 HOH 9  2009 2009 HOH HOH F . 
L 4 HOH 10 2010 2010 HOH HOH F . 
L 4 HOH 11 2011 2011 HOH HOH F . 
L 4 HOH 12 2012 2012 HOH HOH F . 
L 4 HOH 13 2013 2013 HOH HOH F . 
L 4 HOH 14 2014 2014 HOH HOH F . 
L 4 HOH 15 2015 2015 HOH HOH F . 
L 4 HOH 16 2016 2016 HOH HOH F . 
L 4 HOH 17 2017 2017 HOH HOH F . 
L 4 HOH 18 2018 2018 HOH HOH F . 
L 4 HOH 19 2019 2019 HOH HOH F . 
L 4 HOH 20 2020 2020 HOH HOH F . 
L 4 HOH 21 2021 2021 HOH HOH F . 
L 4 HOH 22 2022 2022 HOH HOH F . 
L 4 HOH 23 2023 2023 HOH HOH F . 
L 4 HOH 24 2024 2024 HOH HOH F . 
L 4 HOH 25 2025 2025 HOH HOH F . 
L 4 HOH 26 2026 2026 HOH HOH F . 
L 4 HOH 27 2027 2027 HOH HOH F . 
L 4 HOH 28 2028 2028 HOH HOH F . 
L 4 HOH 29 2029 2029 HOH HOH F . 
L 4 HOH 30 2030 2030 HOH HOH F . 
L 4 HOH 31 2031 2031 HOH HOH F . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 software_defined_assembly PQS trimeric 3 
2 software_defined_assembly PQS trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G,I,J 
2 1 B,E,F,H,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4780  ? 
1 MORE         -9.2  ? 
1 'SSA (A^2)'  15170 ? 
2 'ABSA (A^2)' 4810  ? 
2 MORE         -10.7 ? 
2 'SSA (A^2)'  14900 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-02-07 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    refinement       . ? 1 
DENZO     'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
X-PLOR    phasing          . ? 4 
# 
_pdbx_entry_details.entry_id             1QN7 
_pdbx_entry_details.compound_details     
;DNA MOLECULES BOUND WITHIN THE SERIES

        CHAIN C, E        CHAIN D, F
  1QN3 GCTATAAACGGGCA   TGCCCGTTTATAGC
  1QN4 GCTATAAAATGGCA   TGCCATTTTATAGC
  1QN5 GCTATAAGAGGGCA   TGCCCTCTTATAGC
  1QN6 GCTATAATAGGGCA   TGCCCTATTATAGC
  1QN7 GCTATATAAGGGCA   TGCCCTTATATAGC
  1QN8 GCTATTAAAGGGCA   TGCCCTTTAATAGC
  1QN9 GCTACAAAAGGGCA   TGCCCTTTTGTAGC
  1QNA GCTTTAAAAGGGCA   TGCCCTTTTAAAGC
  1QNB GCTATAAATGGGCA   TGCCCATTTATAGC
  1QNC GCAATAAAAGGGCA   TGCCCTTTTATTGC
  1QNE GCTATAAAAGGGCA   TGCCCTTTTATAGC
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 NZ  A LYS 159 ? ? 1_555 OE1 B GLN 46  ? ? 2_646 2.10 
2 1 NH1 B ARG 65  ? ? 1_555 O6  C DG  211 ? ? 2_656 2.14 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" C DG 201 ? ? "C1'" C DG 201 ? ? N9    C DG 201 ? ? 111.39 108.30 3.09  0.30 N 
2  1 "O4'" C DC 202 ? ? "C1'" C DC 202 ? ? N1    C DC 202 ? ? 110.53 108.30 2.23  0.30 N 
3  1 C6    C DT 203 ? ? C5    C DT 203 ? ? C7    C DT 203 ? ? 119.24 122.90 -3.66 0.60 N 
4  1 "O4'" C DT 205 ? ? "C4'" C DT 205 ? ? "C3'" C DT 205 ? ? 101.83 104.50 -2.67 0.40 N 
5  1 "O4'" C DT 207 ? ? "C4'" C DT 207 ? ? "C3'" C DT 207 ? ? 101.79 104.50 -2.71 0.40 N 
6  1 C6    C DT 207 ? ? C5    C DT 207 ? ? C7    C DT 207 ? ? 119.01 122.90 -3.89 0.60 N 
7  1 "O4'" C DA 209 ? ? "C1'" C DA 209 ? ? N9    C DA 209 ? ? 110.87 108.30 2.57  0.30 N 
8  1 "O4'" C DG 212 ? ? "C1'" C DG 212 ? ? N9    C DG 212 ? ? 113.19 108.30 4.89  0.30 N 
9  1 "O4'" C DC 213 ? ? "C1'" C DC 213 ? ? "C2'" C DC 213 ? ? 100.65 105.90 -5.25 0.80 N 
10 1 "O4'" C DC 213 ? ? "C1'" C DC 213 ? ? N1    C DC 213 ? ? 111.12 108.30 2.82  0.30 N 
11 1 "C3'" C DA 214 ? ? "C2'" C DA 214 ? ? "C1'" C DA 214 ? ? 96.93  102.40 -5.47 0.80 N 
12 1 "O4'" D DG 216 ? ? "C1'" D DG 216 ? ? N9    D DG 216 ? ? 110.60 108.30 2.30  0.30 N 
13 1 "O4'" D DC 217 ? ? "C4'" D DC 217 ? ? "C3'" D DC 217 ? ? 100.99 104.50 -3.51 0.40 N 
14 1 "C1'" D DC 217 ? ? "O4'" D DC 217 ? ? "C4'" D DC 217 ? ? 102.72 110.10 -7.38 1.00 N 
15 1 "O4'" D DC 217 ? ? "C1'" D DC 217 ? ? N1    D DC 217 ? ? 111.97 108.30 3.67  0.30 N 
16 1 "O4'" D DC 218 ? ? "C1'" D DC 218 ? ? N1    D DC 218 ? ? 111.55 108.30 3.25  0.30 N 
17 1 C6    D DT 220 ? ? C5    D DT 220 ? ? C7    D DT 220 ? ? 118.69 122.90 -4.21 0.60 N 
18 1 "O4'" D DT 221 ? ? "C4'" D DT 221 ? ? "C3'" D DT 221 ? ? 102.03 104.50 -2.47 0.40 N 
19 1 C6    D DT 221 ? ? C5    D DT 221 ? ? C7    D DT 221 ? ? 119.20 122.90 -3.70 0.60 N 
20 1 "O4'" D DT 223 ? ? "C4'" D DT 223 ? ? "C3'" D DT 223 ? ? 101.52 104.50 -2.98 0.40 N 
21 1 "O4'" D DA 224 ? ? "C1'" D DA 224 ? ? N9    D DA 224 ? ? 110.47 108.30 2.17  0.30 N 
22 1 C6    D DT 225 ? ? C5    D DT 225 ? ? C7    D DT 225 ? ? 118.98 122.90 -3.92 0.60 N 
23 1 "O4'" D DG 227 ? ? "C1'" D DG 227 ? ? N9    D DG 227 ? ? 112.45 108.30 4.15  0.30 N 
24 1 "C3'" D DC 228 ? ? "C2'" D DC 228 ? ? "C1'" D DC 228 ? ? 97.40  102.40 -5.00 0.80 N 
25 1 "O4'" E DG 201 ? ? "C4'" E DG 201 ? ? "C3'" E DG 201 ? ? 100.46 104.50 -4.04 0.40 N 
26 1 "O4'" E DG 201 ? ? "C1'" E DG 201 ? ? N9    E DG 201 ? ? 111.28 108.30 2.98  0.30 N 
27 1 "O4'" E DC 202 ? ? "C4'" E DC 202 ? ? "C3'" E DC 202 ? ? 100.63 104.50 -3.87 0.40 N 
28 1 "O4'" E DC 202 ? ? "C1'" E DC 202 ? ? N1    E DC 202 ? ? 112.65 108.30 4.35  0.30 N 
29 1 C6    E DT 203 ? ? C5    E DT 203 ? ? C7    E DT 203 ? ? 119.09 122.90 -3.81 0.60 N 
30 1 "O4'" E DT 207 ? ? "C4'" E DT 207 ? ? "C3'" E DT 207 ? ? 101.38 104.50 -3.12 0.40 N 
31 1 "O4'" E DT 207 ? ? "C1'" E DT 207 ? ? N1    E DT 207 ? ? 110.73 108.30 2.43  0.30 N 
32 1 "O4'" E DA 209 ? ? "C1'" E DA 209 ? ? N9    E DA 209 ? ? 111.46 108.30 3.16  0.30 N 
33 1 "O4'" E DG 210 ? ? "C1'" E DG 210 ? ? N9    E DG 210 ? ? 111.56 108.30 3.26  0.30 N 
34 1 "O4'" E DG 212 ? ? "C1'" E DG 212 ? ? N9    E DG 212 ? ? 112.89 108.30 4.59  0.30 N 
35 1 "O4'" E DC 213 ? ? "C1'" E DC 213 ? ? N1    E DC 213 ? ? 111.80 108.30 3.50  0.30 N 
36 1 "C3'" E DA 214 ? ? "C2'" E DA 214 ? ? "C1'" E DA 214 ? ? 96.22  102.40 -6.18 0.80 N 
37 1 "O4'" E DA 214 ? ? "C1'" E DA 214 ? ? "C2'" E DA 214 ? ? 100.78 105.90 -5.12 0.80 N 
38 1 "O4'" E DA 214 ? ? "C1'" E DA 214 ? ? N9    E DA 214 ? ? 112.32 108.30 4.02  0.30 N 
39 1 "O4'" F DT 215 ? ? "C1'" F DT 215 ? ? N1    F DT 215 ? ? 113.00 108.30 4.70  0.30 N 
40 1 "C3'" F DT 215 ? ? "O3'" F DT 215 ? ? P     F DG 216 ? ? 128.85 119.70 9.15  1.20 Y 
41 1 "O4'" F DG 216 ? ? "C1'" F DG 216 ? ? N9    F DG 216 ? ? 113.51 108.30 5.21  0.30 N 
42 1 "O4'" F DC 217 ? ? "C1'" F DC 217 ? ? N1    F DC 217 ? ? 114.89 108.30 6.59  0.30 N 
43 1 "O4'" F DC 218 ? ? "C1'" F DC 218 ? ? N1    F DC 218 ? ? 112.75 108.30 4.45  0.30 N 
44 1 C6    F DT 220 ? ? C5    F DT 220 ? ? C7    F DT 220 ? ? 118.02 122.90 -4.88 0.60 N 
45 1 "O4'" F DT 221 ? ? "C4'" F DT 221 ? ? "C3'" F DT 221 ? ? 101.57 104.50 -2.93 0.40 N 
46 1 C6    F DT 221 ? ? C5    F DT 221 ? ? C7    F DT 221 ? ? 118.68 122.90 -4.22 0.60 N 
47 1 "O4'" F DT 223 ? ? "C4'" F DT 223 ? ? "C3'" F DT 223 ? ? 101.21 104.50 -3.29 0.40 N 
48 1 "O4'" F DT 223 ? ? "C1'" F DT 223 ? ? N1    F DT 223 ? ? 110.72 108.30 2.42  0.30 N 
49 1 "O4'" F DA 224 ? ? "C1'" F DA 224 ? ? N9    F DA 224 ? ? 110.66 108.30 2.36  0.30 N 
50 1 "O4'" F DT 225 ? ? "C1'" F DT 225 ? ? N1    F DT 225 ? ? 110.71 108.30 2.41  0.30 N 
51 1 C6    F DT 225 ? ? C5    F DT 225 ? ? C7    F DT 225 ? ? 119.22 122.90 -3.68 0.60 N 
52 1 "O4'" F DA 226 ? ? "C1'" F DA 226 ? ? N9    F DA 226 ? ? 111.27 108.30 2.97  0.30 N 
53 1 "O4'" F DC 228 ? ? "C1'" F DC 228 ? ? N1    F DC 228 ? ? 111.10 108.30 2.80  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 49  ? ? -79.70  49.84   
2 1 LYS A 109 ? ? -109.36 -166.14 
3 1 CYS B 36  ? ? -177.07 140.59  
4 1 ALA B 58  ? ? -74.92  24.79   
5 1 LYS B 109 ? ? -107.96 -159.75 
6 1 PHE B 110 ? ? -154.57 68.98   
7 1 LYS B 125 ? ? 71.54   31.08   
8 1 SER B 142 ? ? -160.68 100.94  
9 1 GLU B 144 ? ? -119.12 79.68   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 13  ? CG    ? A ASP 13  CG    
2  1 Y 1 A ASP 13  ? OD1   ? A ASP 13  OD1   
3  1 Y 1 A ASP 13  ? OD2   ? A ASP 13  OD2   
4  1 Y 1 A ARG 48  ? CG    ? A ARG 48  CG    
5  1 Y 1 A ARG 48  ? CD    ? A ARG 48  CD    
6  1 Y 1 A ARG 48  ? NE    ? A ARG 48  NE    
7  1 Y 1 A ARG 48  ? CZ    ? A ARG 48  CZ    
8  1 Y 1 A ARG 48  ? NH1   ? A ARG 48  NH1   
9  1 Y 1 A ARG 48  ? NH2   ? A ARG 48  NH2   
10 1 Y 1 A ASN 49  ? CG    ? A ASN 49  CG    
11 1 Y 1 A ASN 49  ? OD1   ? A ASN 49  OD1   
12 1 Y 1 A ASN 49  ? ND2   ? A ASN 49  ND2   
13 1 Y 1 B LYS 41  ? CG    ? B LYS 41  CG    
14 1 Y 1 B LYS 41  ? CD    ? B LYS 41  CD    
15 1 Y 1 B LYS 41  ? CE    ? B LYS 41  CE    
16 1 Y 1 B LYS 41  ? NZ    ? B LYS 41  NZ    
17 1 Y 1 B ARG 48  ? CG    ? B ARG 48  CG    
18 1 Y 1 B ARG 48  ? CD    ? B ARG 48  CD    
19 1 Y 1 B ARG 48  ? NE    ? B ARG 48  NE    
20 1 Y 1 B ARG 48  ? CZ    ? B ARG 48  CZ    
21 1 Y 1 B ARG 48  ? NH1   ? B ARG 48  NH1   
22 1 Y 1 B ARG 48  ? NH2   ? B ARG 48  NH2   
23 1 Y 1 B GLU 131 ? CG    ? B GLU 131 CG    
24 1 Y 1 B GLU 131 ? CD    ? B GLU 131 CD    
25 1 Y 1 B GLU 131 ? OE1   ? B GLU 131 OE1   
26 1 Y 1 B GLU 131 ? OE2   ? B GLU 131 OE2   
27 1 Y 1 C DG  201 ? "O5'" ? C DG  1   "O5'" 
28 1 Y 1 C DG  201 ? "C5'" ? C DG  1   "C5'" 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A THR 2   ? A THR 2   
3  1 Y 1 A ASP 3   ? A ASP 3   
4  1 Y 1 A GLN 4   ? A GLN 4   
5  1 Y 1 A GLY 5   ? A GLY 5   
6  1 Y 1 A LEU 6   ? A LEU 6   
7  1 Y 1 A GLU 7   ? A GLU 7   
8  1 Y 1 A GLY 8   ? A GLY 8   
9  1 Y 1 A SER 9   ? A SER 9   
10 1 Y 1 A ASN 10  ? A ASN 10  
11 1 Y 1 A PRO 11  ? A PRO 11  
12 1 Y 1 A VAL 12  ? A VAL 12  
13 1 Y 1 A GLN 199 ? A GLN 199 
14 1 Y 1 A GLN 200 ? A GLN 200 
15 1 Y 1 B MET 1   ? B MET 1   
16 1 Y 1 B THR 2   ? B THR 2   
17 1 Y 1 B ASP 3   ? B ASP 3   
18 1 Y 1 B GLN 4   ? B GLN 4   
19 1 Y 1 B GLY 5   ? B GLY 5   
20 1 Y 1 B LEU 6   ? B LEU 6   
21 1 Y 1 B GLU 7   ? B GLU 7   
22 1 Y 1 B GLY 8   ? B GLY 8   
23 1 Y 1 B SER 9   ? B SER 9   
24 1 Y 1 B ASN 10  ? B ASN 10  
25 1 Y 1 B PRO 11  ? B PRO 11  
26 1 Y 1 B ILE 198 ? B ILE 198 
27 1 Y 1 B GLN 199 ? B GLN 199 
28 1 Y 1 B GLN 200 ? B GLN 200 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1QN7 'double helix'        
1QN7 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 1  1_555 D DC 14 1_555 -0.436 -0.369 0.042  -5.250  -9.209  -3.376 1  C_DG201:DC228_D C 201 ? D 228 ? 19 1 
1 C DC 2  1_555 D DG 13 1_555 1.057  -0.508 0.333  -12.522 -14.645 -2.044 2  C_DC202:DG227_D C 202 ? D 227 ? 19 1 
1 C DT 3  1_555 D DA 12 1_555 0.067  -0.352 -0.451 -3.572  -3.453  11.295 3  C_DT203:DA226_D C 203 ? D 226 ? 20 1 
1 C DA 4  1_555 D DT 11 1_555 -0.158 -0.082 -0.093 -36.981 9.863   7.734  4  C_DA204:DT225_D C 204 ? D 225 ? 20 1 
1 C DT 5  1_555 D DA 10 1_555 -0.186 -0.201 0.024  -22.366 -11.223 4.287  5  C_DT205:DA224_D C 205 ? D 224 ? 20 1 
1 C DA 6  1_555 D DT 9  1_555 -0.001 -0.211 -0.412 -2.726  -3.860  3.554  6  C_DA206:DT223_D C 206 ? D 223 ? 20 1 
1 C DT 7  1_555 D DA 8  1_555 -0.102 -0.262 -0.497 14.629  -0.266  4.578  7  C_DT207:DA222_D C 207 ? D 222 ? 20 1 
1 C DA 8  1_555 D DT 7  1_555 0.080  -0.154 -0.080 28.100  -8.485  5.396  8  C_DA208:DT221_D C 208 ? D 221 ? 20 1 
1 C DA 9  1_555 D DT 6  1_555 -0.053 -0.020 0.621  41.639  -9.510  8.247  9  C_DA209:DT220_D C 209 ? D 220 ? 20 1 
1 C DG 10 1_555 D DC 5  1_555 0.756  -3.394 -0.816 7.670   7.532   73.303 10 C_DG210:DC219_D C 210 ? D 219 ? ?  3 
1 C DG 11 1_555 D DC 4  1_555 -0.136 -0.421 0.005  -2.401  -5.763  -3.016 11 C_DG211:DC218_D C 211 ? D 218 ? 19 1 
1 C DG 12 1_555 D DC 3  1_555 -0.257 -0.245 0.304  2.314   -10.870 -0.848 12 C_DG212:DC217_D C 212 ? D 217 ? 19 1 
1 C DC 13 1_555 D DG 2  1_555 0.974  -0.530 -0.149 3.370   0.154   -3.282 13 C_DC213:DG216_D C 213 ? D 216 ? 19 1 
1 C DA 14 1_555 D DT 1  1_555 0.588  -0.166 0.081  22.276  -12.438 0.772  14 C_DA214:DT215_D C 214 ? D 215 ? 20 1 
1 E DG 1  1_555 F DC 14 1_555 -1.135 -0.626 0.164  -12.298 -12.470 -1.275 15 E_DG201:DC228_F E 201 ? F 228 ? 19 1 
1 E DC 2  1_555 F DG 13 1_555 0.152  -0.326 0.396  -18.293 -13.803 -3.893 16 E_DC202:DG227_F E 202 ? F 227 ? 19 1 
1 E DT 3  1_555 F DA 12 1_555 0.382  -0.394 -0.463 -0.143  -3.008  8.533  17 E_DT203:DA226_F E 203 ? F 226 ? 20 1 
1 E DA 4  1_555 F DT 11 1_555 -0.198 -0.162 0.163  -34.466 11.580  5.697  18 E_DA204:DT225_F E 204 ? F 225 ? 20 1 
1 E DT 5  1_555 F DA 10 1_555 -0.155 -0.115 0.239  -25.204 -6.100  5.499  19 E_DT205:DA224_F E 205 ? F 224 ? 20 1 
1 E DA 6  1_555 F DT 9  1_555 -0.021 -0.257 -0.380 -1.950  -2.757  4.648  20 E_DA206:DT223_F E 206 ? F 223 ? 20 1 
1 E DT 7  1_555 F DA 8  1_555 -0.109 -0.225 -0.451 9.169   -1.538  3.831  21 E_DT207:DA222_F E 207 ? F 222 ? 20 1 
1 E DA 8  1_555 F DT 7  1_555 0.143  -0.135 0.089  23.350  -13.315 7.846  22 E_DA208:DT221_F E 208 ? F 221 ? 20 1 
1 E DA 9  1_555 F DT 6  1_555 0.055  -0.071 0.378  37.919  -8.522  5.969  23 E_DA209:DT220_F E 209 ? F 220 ? 20 1 
1 E DG 10 1_555 F DC 5  1_555 0.211  -2.886 -0.349 3.239   5.083   72.989 24 E_DG210:DC219_F E 210 ? F 219 ? ?  ? 
1 E DG 11 1_555 F DC 4  1_555 -0.155 -0.306 -0.080 2.336   -8.736  -4.806 25 E_DG211:DC218_F E 211 ? F 218 ? 19 1 
1 E DG 12 1_555 F DC 3  1_555 -0.048 -0.165 -0.068 -3.832  -4.351  -2.549 26 E_DG212:DC217_F E 212 ? F 217 ? 19 1 
1 E DC 13 1_555 F DG 2  1_555 0.783  -0.507 0.072  1.002   2.860   -4.221 27 E_DC213:DG216_F E 213 ? F 216 ? 19 1 
1 E DA 14 1_555 F DT 1  1_555 0.559  -0.104 -0.028 9.365   -0.651  -9.385 28 E_DA214:DT215_F E 214 ? F 215 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 1  1_555 D DC 14 1_555 C DC 2  1_555 D DG 13 1_555 -0.549 -1.261 3.654  -1.152   -7.188   38.928   -0.890 0.655  3.832  
-10.671 1.711   39.577   1  CC_DG201DC202:DG227DC228_DD C 201 ? D 228 ? C 202 ? D 227 ? 
1 C DC 2  1_555 D DG 13 1_555 C DT 3  1_555 D DA 12 1_555 0.848  0.184  3.131  8.620    3.537    33.972   -0.218 -0.127 3.246  
5.917   -14.420 35.190   2  CC_DC202DT203:DA226DG227_DD C 202 ? D 227 ? C 203 ? D 226 ? 
1 C DT 3  1_555 D DA 12 1_555 C DA 4  1_555 D DT 11 1_555 0.077  -0.110 4.475  -6.598   50.548   15.255   -4.773 -0.693 1.216  
73.815  9.636   53.064   3  CC_DT203DA204:DT225DA226_DD C 203 ? D 226 ? C 204 ? D 225 ? 
1 C DA 4  1_555 D DT 11 1_555 C DT 5  1_555 D DA 10 1_555 -1.229 -0.381 3.371  0.589    16.235   19.979   -5.386 2.928  2.363  
39.421  -1.431  25.698   4  CC_DA204DT205:DA224DT225_DD C 204 ? D 225 ? C 205 ? D 224 ? 
1 C DT 5  1_555 D DA 10 1_555 C DA 6  1_555 D DT 9  1_555 0.074  1.944  3.127  0.823    12.281   24.285   0.743  0.070  3.666  
27.079  -1.815  27.184   5  CC_DT205DA206:DT223DA224_DD C 205 ? D 224 ? C 206 ? D 223 ? 
1 C DA 6  1_555 D DT 9  1_555 C DT 7  1_555 D DA 8  1_555 0.227  0.739  3.217  0.789    23.964   8.821    -6.249 -0.253 1.819  
70.054  -2.305  25.526   6  CC_DA206DT207:DA222DT223_DD C 206 ? D 223 ? C 207 ? D 222 ? 
1 C DT 7  1_555 D DA 8  1_555 C DA 8  1_555 D DT 7  1_555 -0.158 1.700  3.458  0.673    19.016   20.162   -2.314 0.537  3.686  
43.728  -1.547  27.656   7  CC_DT207DA208:DT221DA222_DD C 207 ? D 222 ? C 208 ? D 221 ? 
1 C DA 8  1_555 D DT 7  1_555 C DA 9  1_555 D DT 6  1_555 0.542  0.717  3.230  -1.257   15.787   23.381   -2.423 -1.423 3.061  
34.359  2.736   28.177   8  CC_DA208DA209:DT220DT221_DD C 208 ? D 221 ? C 209 ? D 220 ? 
1 C DA 9  1_555 D DT 6  1_555 C DG 10 1_555 D DC 5  1_555 -1.583 5.199  -0.416 134.246  -15.078  -136.885 -2.626 -0.806 0.348  
7.698   68.543  -163.864 9  CC_DA209DG210:DC219DT220_DD C 209 ? D 220 ? C 210 ? D 219 ? 
1 C DG 10 1_555 D DC 5  1_555 C DG 11 1_555 D DC 4  1_555 -0.523 4.622  -0.468 -135.789 110.803  -110.466 -2.040 0.072  -2.281 
-55.669 -68.222 -177.297 10 CC_DG210DG211:DC218DC219_DD C 210 ? D 219 ? C 211 ? D 218 ? 
1 C DG 11 1_555 D DC 4  1_555 C DG 12 1_555 D DC 3  1_555 0.269  -0.428 3.210  -2.492   6.436    29.848   -2.038 -0.985 3.022  
12.289  4.758   30.618   11 CC_DG211DG212:DC217DC218_DD C 211 ? D 218 ? C 212 ? D 217 ? 
1 C DG 12 1_555 D DC 3  1_555 C DC 13 1_555 D DG 2  1_555 0.042  0.255  3.411  3.469    -2.006   36.693   0.686  0.422  3.383  
-3.174  -5.490  36.904   12 CC_DG212DC213:DG216DC217_DD C 212 ? D 217 ? C 213 ? D 216 ? 
1 C DC 13 1_555 D DG 2  1_555 C DA 14 1_555 D DT 1  1_555 -0.322 0.458  2.933  1.902    4.354    30.449   0.095  0.942  2.943  
8.227   -3.595  30.809   13 CC_DC213DA214:DT215DG216_DD C 213 ? D 216 ? C 214 ? D 215 ? 
1 E DG 1  1_555 F DC 14 1_555 E DC 2  1_555 F DG 13 1_555 -0.340 -0.504 3.642  0.482    -4.126   43.215   -0.233 0.512  3.669  
-5.587  -0.653  43.405   14 EE_DG201DC202:DG227DC228_FF E 201 ? F 228 ? E 202 ? F 227 ? 
1 E DC 2  1_555 F DG 13 1_555 E DT 3  1_555 F DA 12 1_555 0.991  0.403  2.939  8.355    1.199    41.973   0.441  -0.582 3.082  
1.654   -11.524 42.775   15 EE_DC202DT203:DA226DG227_FF E 202 ? F 227 ? E 203 ? F 226 ? 
1 E DT 3  1_555 F DA 12 1_555 E DA 4  1_555 F DT 11 1_555 0.182  -0.641 4.662  -6.745   51.794   12.345   -5.140 -0.778 0.472  
76.980  10.026  53.571   16 EE_DT203DA204:DT225DA226_FF E 203 ? F 226 ? E 204 ? F 225 ? 
1 E DA 4  1_555 F DT 11 1_555 E DT 5  1_555 F DA 10 1_555 -1.000 -0.433 3.515  0.797    17.468   22.620   -4.993 2.217  2.510  
38.063  -1.736  28.521   17 EE_DA204DT205:DA224DT225_FF E 204 ? F 225 ? E 205 ? F 224 ? 
1 E DT 5  1_555 F DA 10 1_555 E DA 6  1_555 F DT 9  1_555 -0.036 1.794  3.053  1.466    9.455    24.073   1.284  0.502  3.487  
21.608  -3.350  25.879   18 EE_DT205DA206:DT223DA224_FF E 205 ? F 224 ? E 206 ? F 223 ? 
1 E DA 6  1_555 F DT 9  1_555 E DT 7  1_555 F DA 8  1_555 0.140  0.747  3.399  0.757    26.692   9.061    -6.108 -0.070 1.813  
71.563  -2.030  28.172   19 EE_DA206DT207:DA222DT223_FF E 206 ? F 223 ? E 207 ? F 222 ? 
1 E DT 7  1_555 F DA 8  1_555 E DA 8  1_555 F DT 7  1_555 -0.118 1.833  3.452  0.274    16.170   21.339   -1.288 0.344  3.862  
37.497  -0.636  26.718   20 EE_DT207DA208:DT221DA222_FF E 207 ? F 222 ? E 208 ? F 221 ? 
1 E DA 8  1_555 F DT 7  1_555 E DA 9  1_555 F DT 6  1_555 0.339  0.700  3.186  0.899    15.868   22.981   -2.517 -0.479 3.039  
34.964  -1.982  27.881   21 EE_DA208DA209:DT220DT221_FF E 208 ? F 221 ? E 209 ? F 220 ? 
1 E DA 9  1_555 F DT 6  1_555 E DG 10 1_555 F DC 5  1_555 -1.273 5.166  -0.714 131.746  -22.205  -134.368 -2.623 -0.701 0.096  
11.376  67.493  -162.427 22 EE_DA209DG210:DC219DT220_FF E 209 ? F 220 ? E 210 ? F 219 ? 
1 E DG 10 1_555 F DC 5  1_555 E DG 11 1_555 F DC 4  1_555 -0.273 -3.836 -2.126 132.234  -113.444 179.688  -1.920 0.134  -2.120 
-56.722 -66.117 179.984  23 EE_DG210DG211:DC218DC219_FF E 210 ? F 219 ? E 211 ? F 218 ? 
1 E DG 11 1_555 F DC 4  1_555 E DG 12 1_555 F DC 3  1_555 0.093  -0.556 3.425  -0.962   6.530    32.071   -2.149 -0.336 3.248  
11.666  1.718   32.726   24 EE_DG211DG212:DC217DC218_FF E 211 ? F 218 ? E 212 ? F 217 ? 
1 E DG 12 1_555 F DC 3  1_555 E DC 13 1_555 F DG 2  1_555 0.066  0.098  3.352  -0.828   -2.327   35.832   0.500  -0.228 3.337  
-3.776  1.344   35.914   25 EE_DG212DC213:DG216DC217_FF E 212 ? F 217 ? E 213 ? F 216 ? 
1 E DC 13 1_555 F DG 2  1_555 E DA 14 1_555 F DT 1  1_555 -0.847 -0.394 3.117  4.910    3.108    24.535   -1.740 3.265  2.825  
7.186   -11.350 25.204   26 EE_DC213DA214:DT215DG216_FF E 213 ? F 216 ? E 214 ? F 215 ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#