data_1QNC
# 
_entry.id   1QNC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QNC         
PDBE  EBI-4271     
WWPDB D_1290004271 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1QN3 unspecified 
;CRYSTAL STRUCTURE OF THE C(-25) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QN4 unspecified 
;CRYSTAL STRUCTURE OF THE T(-24) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QN5 unspecified 
;CRYSTAL STRUCTURE OF THE G(-26) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QN6 unspecified 
;CRYSTAL STRUCTURE OF THE T(-26) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QN7 unspecified 
;CRYSTAL STRUCTURE OF THE T(-27) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QN8 unspecified 
;CRYSTAL STRUCTURE OF THE T(-28) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QN9 unspecified 
;CRYSTAL STRUCTURE OF THE C(-29) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QNA unspecified 
;CRYSTAL STRUCTURE OF THE T(-30) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QNB unspecified 
;CRYSTAL STRUCTURE OF THE T(-25) ADENOVIRUS MAJOR LATE PROMOTER TATA BOX VARIANT BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2). TATA ELEMENT RECOGNITION BY THE TATA BOX-BINDING PROTEIN HAS BEEN CONSERVED THROUGHOUT EVOLUTION.
;
PDB 1QNE unspecified 
'CRYSTAL STRUCTURE OF THE ADENOVIRUS MAJOR LATE PROMOTER TATA BOX BOUND TO WILD-TYPE TBP (ARABIDOPSIS THALIANA TBP ISOFORM 2).' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QNC 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   1999-10-14 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Patikoglou, G.A.' 1 
'Kim, J.L.'        2 
'Sun, L.'          3 
'Yang, S.-H.'      4 
'Kodadek, T.'      5 
'Burley, S.K.'     6 
# 
_citation.id                        primary 
_citation.title                     
'TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution' 
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_volume            13 
_citation.page_first                3217 
_citation.page_last                 ? 
_citation.year                      1999 
_citation.journal_id_ASTM           GEDEEP 
_citation.country                   US 
_citation.journal_id_ISSN           0890-9369 
_citation.journal_id_CSD            2056 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10617571 
_citation.pdbx_database_id_DOI      10.1101/GAD.13.24.3217 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Patikoglou, G.A.' 1 
primary 'Kim, J.L.'        2 
primary 'Sun, L.'          3 
primary 'Yang, S.-H.'      4 
primary 'Kodadek, T.'      5 
primary 'Burley, S.K.'     6 
# 
_cell.entry_id           1QNC 
_cell.length_a           42.000 
_cell.length_b           57.000 
_cell.length_c           147.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         96.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QNC 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'TRANSCRIPTION INITIATION FACTOR TFIID-1'                  22400.354 2   ? ? ? ? 
2 polymer syn 
;DNA (5'-D(*GP*CP*AP*AP*TP*AP*AP*AP*AP*GP*GP*GP*CP*A)-3')
;
4346.870  2   ? ? ? ? 
3 polymer syn 
;DNA (5'-D(*TP*GP*CP*CP*CP*TP*TP*TP*TP*AP*TP*TP*GP*C)-3')
;
4212.737  2   ? ? ? ? 
4 water   nat water                                                      18.015    269 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TATA-BOX FACTOR 1, TATA SEQUENCE-BINDING PROTEIN 1, TBP1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MTDQGLEGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMV
CTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKI
VLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKIQQ
;
;MTDQGLEGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMV
CTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKI
VLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKIQQ
;
A,B ? 
2 polydeoxyribonucleotide no no '(DG)(DC)(DA)(DA)(DT)(DA)(DA)(DA)(DA)(DG)(DG)(DG)(DC)(DA)' GCAATAAAAGGGCA C,E ? 
3 polydeoxyribonucleotide no no '(DT)(DG)(DC)(DC)(DC)(DT)(DT)(DT)(DT)(DA)(DT)(DT)(DG)(DC)' TGCCCTTTTATTGC D,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   ASP n 
1 4   GLN n 
1 5   GLY n 
1 6   LEU n 
1 7   GLU n 
1 8   GLY n 
1 9   SER n 
1 10  ASN n 
1 11  PRO n 
1 12  VAL n 
1 13  ASP n 
1 14  LEU n 
1 15  SER n 
1 16  LYS n 
1 17  HIS n 
1 18  PRO n 
1 19  SER n 
1 20  GLY n 
1 21  ILE n 
1 22  VAL n 
1 23  PRO n 
1 24  THR n 
1 25  LEU n 
1 26  GLN n 
1 27  ASN n 
1 28  ILE n 
1 29  VAL n 
1 30  SER n 
1 31  THR n 
1 32  VAL n 
1 33  ASN n 
1 34  LEU n 
1 35  ASP n 
1 36  CYS n 
1 37  LYS n 
1 38  LEU n 
1 39  ASP n 
1 40  LEU n 
1 41  LYS n 
1 42  ALA n 
1 43  ILE n 
1 44  ALA n 
1 45  LEU n 
1 46  GLN n 
1 47  ALA n 
1 48  ARG n 
1 49  ASN n 
1 50  ALA n 
1 51  GLU n 
1 52  TYR n 
1 53  ASN n 
1 54  PRO n 
1 55  LYS n 
1 56  ARG n 
1 57  PHE n 
1 58  ALA n 
1 59  ALA n 
1 60  VAL n 
1 61  ILE n 
1 62  MET n 
1 63  ARG n 
1 64  ILE n 
1 65  ARG n 
1 66  GLU n 
1 67  PRO n 
1 68  LYS n 
1 69  THR n 
1 70  THR n 
1 71  ALA n 
1 72  LEU n 
1 73  ILE n 
1 74  PHE n 
1 75  ALA n 
1 76  SER n 
1 77  GLY n 
1 78  LYS n 
1 79  MET n 
1 80  VAL n 
1 81  CYS n 
1 82  THR n 
1 83  GLY n 
1 84  ALA n 
1 85  LYS n 
1 86  SER n 
1 87  GLU n 
1 88  ASP n 
1 89  PHE n 
1 90  SER n 
1 91  LYS n 
1 92  MET n 
1 93  ALA n 
1 94  ALA n 
1 95  ARG n 
1 96  LYS n 
1 97  TYR n 
1 98  ALA n 
1 99  ARG n 
1 100 ILE n 
1 101 VAL n 
1 102 GLN n 
1 103 LYS n 
1 104 LEU n 
1 105 GLY n 
1 106 PHE n 
1 107 PRO n 
1 108 ALA n 
1 109 LYS n 
1 110 PHE n 
1 111 LYS n 
1 112 ASP n 
1 113 PHE n 
1 114 LYS n 
1 115 ILE n 
1 116 GLN n 
1 117 ASN n 
1 118 ILE n 
1 119 VAL n 
1 120 GLY n 
1 121 SER n 
1 122 CYS n 
1 123 ASP n 
1 124 VAL n 
1 125 LYS n 
1 126 PHE n 
1 127 PRO n 
1 128 ILE n 
1 129 ARG n 
1 130 LEU n 
1 131 GLU n 
1 132 GLY n 
1 133 LEU n 
1 134 ALA n 
1 135 TYR n 
1 136 SER n 
1 137 HIS n 
1 138 ALA n 
1 139 ALA n 
1 140 PHE n 
1 141 SER n 
1 142 SER n 
1 143 TYR n 
1 144 GLU n 
1 145 PRO n 
1 146 GLU n 
1 147 LEU n 
1 148 PHE n 
1 149 PRO n 
1 150 GLY n 
1 151 LEU n 
1 152 ILE n 
1 153 TYR n 
1 154 ARG n 
1 155 MET n 
1 156 LYS n 
1 157 VAL n 
1 158 PRO n 
1 159 LYS n 
1 160 ILE n 
1 161 VAL n 
1 162 LEU n 
1 163 LEU n 
1 164 ILE n 
1 165 PHE n 
1 166 VAL n 
1 167 SER n 
1 168 GLY n 
1 169 LYS n 
1 170 ILE n 
1 171 VAL n 
1 172 ILE n 
1 173 THR n 
1 174 GLY n 
1 175 ALA n 
1 176 LYS n 
1 177 MET n 
1 178 ARG n 
1 179 ASP n 
1 180 GLU n 
1 181 THR n 
1 182 TYR n 
1 183 LYS n 
1 184 ALA n 
1 185 PHE n 
1 186 GLU n 
1 187 ASN n 
1 188 ILE n 
1 189 TYR n 
1 190 PRO n 
1 191 VAL n 
1 192 LEU n 
1 193 SER n 
1 194 GLU n 
1 195 PHE n 
1 196 ARG n 
1 197 LYS n 
1 198 ILE n 
1 199 GLN n 
1 200 GLN n 
2 1   DG  n 
2 2   DC  n 
2 3   DA  n 
2 4   DA  n 
2 5   DT  n 
2 6   DA  n 
2 7   DA  n 
2 8   DA  n 
2 9   DA  n 
2 10  DG  n 
2 11  DG  n 
2 12  DG  n 
2 13  DC  n 
2 14  DA  n 
3 1   DT  n 
3 2   DG  n 
3 3   DC  n 
3 4   DC  n 
3 5   DC  n 
3 6   DT  n 
3 7   DT  n 
3 8   DT  n 
3 9   DT  n 
3 10  DA  n 
3 11  DT  n 
3 12  DT  n 
3 13  DG  n 
3 14  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'MOUSE-EAR CRESS' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'ARABIDOPSIS THALIANA' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     3702 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP TF21_ARATH 1 ? ? P28147 ? 
2 PDB 1QNC       2 ? ? 1QNC   ? 
3 PDB 1QNC       3 ? ? 1QNC   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1QNC A 1 ? 200 ? P28147 1   ? 200 ? 1   200 
2 1 1QNC B 1 ? 200 ? P28147 1   ? 200 ? 1   200 
3 2 1QNC C 1 ? 14  ? 1QNC   201 ? 214 ? 201 214 
4 3 1QNC D 1 ? 14  ? 1QNC   215 ? 228 ? 215 228 
5 2 1QNC E 1 ? 14  ? 1QNC   201 ? 214 ? 201 214 
6 3 1QNC F 1 ? 14  ? 1QNC   215 ? 228 ? 215 228 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1QNC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.83 
_exptl_crystal.density_percent_sol   56.48 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 6.00' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9200 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
_diffrn_source.pdbx_wavelength             0.9200 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1QNC 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             15.000 
_reflns.d_resolution_high            2.290 
_reflns.number_obs                   30957 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         90.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.05700 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.400 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1QNC 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     25909 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6 
_refine.ls_d_res_high                            2.3 
_refine.ls_percent_reflns_obs                    90.9 
_refine.ls_R_factor_obs                          .182 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       .182 
_refine.ls_R_factor_R_free                       .257 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  2569 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'TBP-TATA ELEMENT' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2919 
_refine_hist.pdbx_number_atoms_nucleic_acid   1134 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             269 
_refine_hist.number_atoms_total               4322 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        6 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                .009 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.5  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?    ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?    ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.999990 
_struct_ncs_oper.matrix[1][2]   0.001720 
_struct_ncs_oper.matrix[1][3]   -0.002890 
_struct_ncs_oper.matrix[2][1]   0.001760 
_struct_ncs_oper.matrix[2][2]   -0.999890 
_struct_ncs_oper.matrix[2][3]   0.014620 
_struct_ncs_oper.matrix[3][1]   -0.002870 
_struct_ncs_oper.matrix[3][2]   -0.014630 
_struct_ncs_oper.matrix[3][3]   -0.999890 
_struct_ncs_oper.vector[1]      8.99841 
_struct_ncs_oper.vector[2]      -88.32040 
_struct_ncs_oper.vector[3]      217.52924 
# 
_struct.entry_id                  1QNC 
_struct.title                     
;Crystal structure of the A(-31) Adenovirus major late promoter TATA box variant bound to wild-type TBP (Arabidopsis thaliana TBP isoform 2). TATA element recognition by the TATA box-binding protein has been conserved throughout evolution.
;
_struct.pdbx_descriptor           'TRANSCRIPTION INITIATION FACTOR TFIID-1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QNC 
_struct_keywords.pdbx_keywords   'TATA BOX-BINDING PROTEIN (TBP)' 
_struct_keywords.text            
;TATA BOX-BINDING PROTEIN (TBP), ADENOVIRUS MAJOR LATE PROMOTER (ADMLP) TATA BOX, TBP-TATA ELEMENT COMPLEXES, A (- 31) TATA BOX VARIANT
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 39  ? ALA A 47  ? ASP A 39  ALA A 47  1 ? 9  
HELX_P HELX_P2 2 SER A 86  ? LEU A 104 ? SER A 86  LEU A 104 1 ? 19 
HELX_P HELX_P3 3 ARG A 129 ? HIS A 137 ? ARG A 129 HIS A 137 1 ? 9  
HELX_P HELX_P4 4 MET A 177 ? PHE A 195 ? MET A 177 PHE A 195 1 ? 19 
HELX_P HELX_P5 5 ASP B 39  ? ALA B 47  ? ASP B 39  ALA B 47  1 ? 9  
HELX_P HELX_P6 6 SER B 86  ? LEU B 104 ? SER B 86  LEU B 104 1 ? 19 
HELX_P HELX_P7 7 ARG B 129 ? HIS B 137 ? ARG B 129 HIS B 137 1 ? 9  
HELX_P HELX_P8 8 MET B 177 ? SER B 193 ? MET B 177 SER B 193 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? C DG 1  N1 ? ? ? 1_555 D DC 14 N3 ? ? C DG 201 D DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? C DG 1  N2 ? ? ? 1_555 D DC 14 O2 ? ? C DG 201 D DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? C DG 1  O6 ? ? ? 1_555 D DC 14 N4 ? ? C DG 201 D DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? C DC 2  N3 ? ? ? 1_555 D DG 13 N1 ? ? C DC 202 D DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? C DC 2  N4 ? ? ? 1_555 D DG 13 O6 ? ? C DC 202 D DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? C DC 2  O2 ? ? ? 1_555 D DG 13 N2 ? ? C DC 202 D DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? C DA 3  N1 ? ? ? 1_555 D DT 12 N3 ? ? C DA 203 D DT 226 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? C DA 3  N6 ? ? ? 1_555 D DT 12 O4 ? ? C DA 203 D DT 226 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? C DA 4  N1 ? ? ? 1_555 D DT 11 N3 ? ? C DA 204 D DT 225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? C DA 4  N6 ? ? ? 1_555 D DT 11 O4 ? ? C DA 204 D DT 225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? C DT 5  N3 ? ? ? 1_555 D DA 10 N1 ? ? C DT 205 D DA 224 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? C DT 5  O4 ? ? ? 1_555 D DA 10 N6 ? ? C DT 205 D DA 224 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? C DA 6  N1 ? ? ? 1_555 D DT 9  N3 ? ? C DA 206 D DT 223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? C DA 6  N6 ? ? ? 1_555 D DT 9  O4 ? ? C DA 206 D DT 223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? C DA 7  N1 ? ? ? 1_555 D DT 8  N3 ? ? C DA 207 D DT 222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? C DA 7  N6 ? ? ? 1_555 D DT 8  O4 ? ? C DA 207 D DT 222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? C DA 8  N1 ? ? ? 1_555 D DT 7  N3 ? ? C DA 208 D DT 221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? C DA 8  N6 ? ? ? 1_555 D DT 7  O4 ? ? C DA 208 D DT 221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? C DA 9  N1 ? ? ? 1_555 D DT 6  N3 ? ? C DA 209 D DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? C DA 9  N6 ? ? ? 1_555 D DT 6  O4 ? ? C DA 209 D DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? C DG 10 O6 ? ? ? 1_555 D DC 5  N4 ? ? C DG 210 D DC 219 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog22 hydrog ? ? C DG 11 N1 ? ? ? 1_555 D DC 4  N3 ? ? C DG 211 D DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? C DG 11 N2 ? ? ? 1_555 D DC 4  O2 ? ? C DG 211 D DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? C DG 11 O6 ? ? ? 1_555 D DC 4  N4 ? ? C DG 211 D DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? C DG 12 N1 ? ? ? 1_555 D DC 3  N3 ? ? C DG 212 D DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? C DG 12 N2 ? ? ? 1_555 D DC 3  O2 ? ? C DG 212 D DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? C DG 12 O6 ? ? ? 1_555 D DC 3  N4 ? ? C DG 212 D DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? C DC 13 N3 ? ? ? 1_555 D DG 2  N1 ? ? C DC 213 D DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? C DC 13 N4 ? ? ? 1_555 D DG 2  O6 ? ? C DC 213 D DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? C DC 13 O2 ? ? ? 1_555 D DG 2  N2 ? ? C DC 213 D DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? C DA 14 N1 ? ? ? 1_555 D DT 1  N3 ? ? C DA 214 D DT 215 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? C DA 14 N6 ? ? ? 1_555 D DT 1  O4 ? ? C DA 214 D DT 215 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? E DG 1  N1 ? ? ? 1_555 F DC 14 N3 ? ? E DG 201 F DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? E DG 1  N2 ? ? ? 1_555 F DC 14 O2 ? ? E DG 201 F DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? E DG 1  O6 ? ? ? 1_555 F DC 14 N4 ? ? E DG 201 F DC 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? E DC 2  N3 ? ? ? 1_555 F DG 13 N1 ? ? E DC 202 F DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? E DC 2  N4 ? ? ? 1_555 F DG 13 O6 ? ? E DC 202 F DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? E DC 2  O2 ? ? ? 1_555 F DG 13 N2 ? ? E DC 202 F DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? E DA 3  N1 ? ? ? 1_555 F DT 12 N3 ? ? E DA 203 F DT 226 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? E DA 3  N6 ? ? ? 1_555 F DT 12 O4 ? ? E DA 203 F DT 226 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? E DA 4  N1 ? ? ? 1_555 F DT 11 N3 ? ? E DA 204 F DT 225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? E DA 4  N6 ? ? ? 1_555 F DT 11 O4 ? ? E DA 204 F DT 225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? E DT 5  N3 ? ? ? 1_555 F DA 10 N1 ? ? E DT 205 F DA 224 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? E DT 5  O4 ? ? ? 1_555 F DA 10 N6 ? ? E DT 205 F DA 224 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? E DA 6  N1 ? ? ? 1_555 F DT 9  N3 ? ? E DA 206 F DT 223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? E DA 6  N6 ? ? ? 1_555 F DT 9  O4 ? ? E DA 206 F DT 223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? E DA 7  N1 ? ? ? 1_555 F DT 8  N3 ? ? E DA 207 F DT 222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? E DA 7  N6 ? ? ? 1_555 F DT 8  O4 ? ? E DA 207 F DT 222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? E DA 8  N1 ? ? ? 1_555 F DT 7  N3 ? ? E DA 208 F DT 221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50 hydrog ? ? E DA 8  N6 ? ? ? 1_555 F DT 7  O4 ? ? E DA 208 F DT 221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51 hydrog ? ? E DA 9  N1 ? ? ? 1_555 F DT 6  N3 ? ? E DA 209 F DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52 hydrog ? ? E DA 9  N6 ? ? ? 1_555 F DT 6  O4 ? ? E DA 209 F DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53 hydrog ? ? E DG 10 O6 ? ? ? 1_555 F DC 5  N4 ? ? E DG 210 F DC 219 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog54 hydrog ? ? E DG 11 N1 ? ? ? 1_555 F DC 4  N3 ? ? E DG 211 F DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55 hydrog ? ? E DG 11 N2 ? ? ? 1_555 F DC 4  O2 ? ? E DG 211 F DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56 hydrog ? ? E DG 11 O6 ? ? ? 1_555 F DC 4  N4 ? ? E DG 211 F DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57 hydrog ? ? E DG 12 N1 ? ? ? 1_555 F DC 3  N3 ? ? E DG 212 F DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58 hydrog ? ? E DG 12 N2 ? ? ? 1_555 F DC 3  O2 ? ? E DG 212 F DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59 hydrog ? ? E DG 12 O6 ? ? ? 1_555 F DC 3  N4 ? ? E DG 212 F DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60 hydrog ? ? E DC 13 N3 ? ? ? 1_555 F DG 2  N1 ? ? E DC 213 F DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61 hydrog ? ? E DC 13 N4 ? ? ? 1_555 F DG 2  O6 ? ? E DC 213 F DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62 hydrog ? ? E DC 13 O2 ? ? ? 1_555 F DG 2  N2 ? ? E DC 213 F DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63 hydrog ? ? E DA 14 N1 ? ? ? 1_555 F DT 1  N3 ? ? E DA 214 F DT 215 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64 hydrog ? ? E DA 14 N6 ? ? ? 1_555 F DT 1  O4 ? ? E DA 214 F DT 215 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 66  A . ? GLU 66  A PRO 67  A ? PRO 67  A 1 -0.49 
2 VAL 157 A . ? VAL 157 A PRO 158 A ? PRO 158 A 1 -0.26 
3 GLU 66  B . ? GLU 66  B PRO 67  B ? PRO 67  B 1 -0.54 
4 VAL 157 B . ? VAL 157 B PRO 158 B ? PRO 158 B 1 -0.46 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 9 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
B 8 9 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 151 ? MET A 155 ? LEU A 151 MET A 155 
A 2 ILE A 160 ? ILE A 164 ? ILE A 160 ILE A 164 
A 3 LYS A 169 ? ALA A 175 ? LYS A 169 ALA A 175 
A 4 ASN A 117 ? ASP A 123 ? ASN A 117 ASP A 123 
A 5 THR A 24  ? ASN A 33  ? THR A 24  ASN A 33  
A 6 LYS A 78  ? ALA A 84  ? LYS A 78  ALA A 84  
A 7 THR A 69  ? PHE A 74  ? THR A 69  PHE A 74  
A 8 PHE A 57  ? ILE A 64  ? PHE A 57  ILE A 64  
A 9 ALA A 50  ? ASN A 53  ? ALA A 50  ASN A 53  
B 1 ALA B 50  ? TYR B 52  ? ALA B 50  TYR B 52  
B 2 ALA B 59  ? ILE B 64  ? ALA B 59  ILE B 64  
B 3 THR B 69  ? PHE B 74  ? THR B 69  PHE B 74  
B 4 LYS B 78  ? ALA B 84  ? LYS B 78  ALA B 84  
B 5 THR B 24  ? ASN B 33  ? THR B 24  ASN B 33  
B 6 ASN B 117 ? ASP B 123 ? ASN B 117 ASP B 123 
B 7 LYS B 169 ? THR B 173 ? LYS B 169 THR B 173 
B 8 ILE B 160 ? ILE B 164 ? ILE B 160 ILE B 164 
B 9 LEU B 151 ? MET B 155 ? LEU B 151 MET B 155 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 151 ? O LEU A 151 N ILE A 164 ? N ILE A 164 
A 2 3 O VAL A 161 ? O VAL A 161 N THR A 173 ? N THR A 173 
A 3 4 O ILE A 170 ? O ILE A 170 N CYS A 122 ? N CYS A 122 
A 4 5 O ASN A 117 ? O ASN A 117 N VAL A 29  ? N VAL A 29  
A 5 6 O ILE A 28  ? O ILE A 28  N ALA A 84  ? N ALA A 84  
A 6 7 O VAL A 80  ? O VAL A 80  N LEU A 72  ? N LEU A 72  
A 7 8 O THR A 69  ? O THR A 69  N ILE A 64  ? N ILE A 64  
A 8 9 O PHE A 57  ? O PHE A 57  N ASN A 53  ? N ASN A 53  
B 1 2 O GLU B 51  ? O GLU B 51  N ILE B 61  ? N ILE B 61  
B 2 3 O VAL B 60  ? O VAL B 60  N ILE B 73  ? N ILE B 73  
B 3 4 O THR B 70  ? O THR B 70  N THR B 82  ? N THR B 82  
B 4 5 O MET B 79  ? O MET B 79  N VAL B 32  ? N VAL B 32  
B 5 6 O THR B 24  ? O THR B 24  N SER B 121 ? N SER B 121 
B 6 7 O GLY B 120 ? O GLY B 120 N ILE B 172 ? N ILE B 172 
B 7 8 O VAL B 171 ? O VAL B 171 N LEU B 163 ? N LEU B 163 
B 8 9 O ILE B 160 ? O ILE B 160 N MET B 155 ? N MET B 155 
# 
_database_PDB_matrix.entry_id          1QNC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QNC 
_atom_sites.fract_transf_matrix[1][1]   0.023809 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002502 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017544 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006840 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . LYS A 1 16  ? 37.668 -41.061 103.305 1.00 48.98 ? 16   LYS A N     1 
ATOM   2    C CA    . LYS A 1 16  ? 36.456 -40.238 102.974 1.00 48.31 ? 16   LYS A CA    1 
ATOM   3    C C     . LYS A 1 16  ? 35.227 -41.144 102.989 1.00 47.25 ? 16   LYS A C     1 
ATOM   4    O O     . LYS A 1 16  ? 34.339 -41.024 102.141 1.00 47.38 ? 16   LYS A O     1 
ATOM   5    C CB    . LYS A 1 16  ? 36.612 -39.591 101.585 1.00 49.28 ? 16   LYS A CB    1 
ATOM   6    C CG    . LYS A 1 16  ? 37.820 -38.655 101.451 1.00 49.87 ? 16   LYS A CG    1 
ATOM   7    C CD    . LYS A 1 16  ? 37.912 -37.993 100.075 1.00 49.44 ? 16   LYS A CD    1 
ATOM   8    C CE    . LYS A 1 16  ? 38.440 -38.948 99.017  1.00 50.42 ? 16   LYS A CE    1 
ATOM   9    N NZ    . LYS A 1 16  ? 37.568 -40.144 98.827  1.00 50.51 ? 16   LYS A NZ    1 
ATOM   10   N N     . HIS A 1 17  ? 35.191 -42.060 103.954 1.00 45.53 ? 17   HIS A N     1 
ATOM   11   C CA    . HIS A 1 17  ? 34.091 -43.012 104.070 1.00 43.82 ? 17   HIS A CA    1 
ATOM   12   C C     . HIS A 1 17  ? 33.550 -43.183 105.491 1.00 42.66 ? 17   HIS A C     1 
ATOM   13   O O     . HIS A 1 17  ? 33.705 -44.246 106.091 1.00 42.43 ? 17   HIS A O     1 
ATOM   14   C CB    . HIS A 1 17  ? 34.543 -44.356 103.496 1.00 42.78 ? 17   HIS A CB    1 
ATOM   15   C CG    . HIS A 1 17  ? 35.252 -44.220 102.187 1.00 43.04 ? 17   HIS A CG    1 
ATOM   16   N ND1   . HIS A 1 17  ? 34.585 -44.029 100.996 1.00 43.06 ? 17   HIS A ND1   1 
ATOM   17   C CD2   . HIS A 1 17  ? 36.572 -44.140 101.894 1.00 43.03 ? 17   HIS A CD2   1 
ATOM   18   C CE1   . HIS A 1 17  ? 35.460 -43.833 100.028 1.00 42.83 ? 17   HIS A CE1   1 
ATOM   19   N NE2   . HIS A 1 17  ? 36.673 -43.896 100.546 1.00 44.27 ? 17   HIS A NE2   1 
ATOM   20   N N     . PRO A 1 18  ? 32.877 -42.146 106.032 1.00 42.05 ? 18   PRO A N     1 
ATOM   21   C CA    . PRO A 1 18  ? 32.297 -42.160 107.384 1.00 40.96 ? 18   PRO A CA    1 
ATOM   22   C C     . PRO A 1 18  ? 31.349 -43.327 107.627 1.00 40.73 ? 18   PRO A C     1 
ATOM   23   O O     . PRO A 1 18  ? 31.184 -43.771 108.767 1.00 40.68 ? 18   PRO A O     1 
ATOM   24   C CB    . PRO A 1 18  ? 31.547 -40.833 107.444 1.00 41.46 ? 18   PRO A CB    1 
ATOM   25   C CG    . PRO A 1 18  ? 32.395 -39.945 106.609 1.00 41.75 ? 18   PRO A CG    1 
ATOM   26   C CD    . PRO A 1 18  ? 32.712 -40.817 105.414 1.00 40.78 ? 18   PRO A CD    1 
ATOM   27   N N     . SER A 1 19  ? 30.718 -43.808 106.556 1.00 40.13 ? 19   SER A N     1 
ATOM   28   C CA    . SER A 1 19  ? 29.778 -44.936 106.627 1.00 39.56 ? 19   SER A CA    1 
ATOM   29   C C     . SER A 1 19  ? 30.475 -46.261 106.869 1.00 38.42 ? 19   SER A C     1 
ATOM   30   O O     . SER A 1 19  ? 29.855 -47.209 107.342 1.00 39.09 ? 19   SER A O     1 
ATOM   31   C CB    . SER A 1 19  ? 28.991 -45.052 105.325 1.00 39.68 ? 19   SER A CB    1 
ATOM   32   O OG    . SER A 1 19  ? 29.878 -45.245 104.237 1.00 41.07 ? 19   SER A OG    1 
ATOM   33   N N     . GLY A 1 20  ? 31.748 -46.332 106.485 1.00 37.87 ? 20   GLY A N     1 
ATOM   34   C CA    . GLY A 1 20  ? 32.521 -47.551 106.653 1.00 36.69 ? 20   GLY A CA    1 
ATOM   35   C C     . GLY A 1 20  ? 32.329 -48.511 105.494 1.00 35.95 ? 20   GLY A C     1 
ATOM   36   O O     . GLY A 1 20  ? 32.766 -49.662 105.545 1.00 36.03 ? 20   GLY A O     1 
ATOM   37   N N     . ILE A 1 21  ? 31.661 -48.028 104.449 1.00 34.99 ? 21   ILE A N     1 
ATOM   38   C CA    . ILE A 1 21  ? 31.385 -48.813 103.253 1.00 32.75 ? 21   ILE A CA    1 
ATOM   39   C C     . ILE A 1 21  ? 31.919 -48.046 102.049 1.00 31.52 ? 21   ILE A C     1 
ATOM   40   O O     . ILE A 1 21  ? 31.747 -46.834 101.952 1.00 32.42 ? 21   ILE A O     1 
ATOM   41   C CB    . ILE A 1 21  ? 29.881 -49.013 103.072 1.00 32.73 ? 21   ILE A CB    1 
ATOM   42   C CG1   . ILE A 1 21  ? 29.264 -49.475 104.392 1.00 33.66 ? 21   ILE A CG1   1 
ATOM   43   C CG2   . ILE A 1 21  ? 29.619 -50.024 101.975 1.00 31.86 ? 21   ILE A CG2   1 
ATOM   44   C CD1   . ILE A 1 21  ? 27.752 -49.580 104.377 1.00 34.83 ? 21   ILE A CD1   1 
ATOM   45   N N     . VAL A 1 22  ? 32.645 -48.727 101.176 1.00 29.94 ? 22   VAL A N     1 
ATOM   46   C CA    . VAL A 1 22  ? 33.170 -48.065 100.000 1.00 28.60 ? 22   VAL A CA    1 
ATOM   47   C C     . VAL A 1 22  ? 32.524 -48.703 98.796  1.00 27.33 ? 22   VAL A C     1 
ATOM   48   O O     . VAL A 1 22  ? 32.621 -49.916 98.596  1.00 27.02 ? 22   VAL A O     1 
ATOM   49   C CB    . VAL A 1 22  ? 34.700 -48.197 99.871  1.00 29.46 ? 22   VAL A CB    1 
ATOM   50   C CG1   . VAL A 1 22  ? 35.176 -47.529 98.579  1.00 29.46 ? 22   VAL A CG1   1 
ATOM   51   C CG2   . VAL A 1 22  ? 35.379 -47.558 101.058 1.00 29.97 ? 22   VAL A CG2   1 
ATOM   52   N N     . PRO A 1 23  ? 31.796 -47.901 98.014  1.00 25.87 ? 23   PRO A N     1 
ATOM   53   C CA    . PRO A 1 23  ? 31.124 -48.399 96.815  1.00 24.50 ? 23   PRO A CA    1 
ATOM   54   C C     . PRO A 1 23  ? 32.170 -49.036 95.897  1.00 24.22 ? 23   PRO A C     1 
ATOM   55   O O     . PRO A 1 23  ? 33.301 -48.537 95.805  1.00 25.17 ? 23   PRO A O     1 
ATOM   56   C CB    . PRO A 1 23  ? 30.567 -47.118 96.189  1.00 24.57 ? 23   PRO A CB    1 
ATOM   57   C CG    . PRO A 1 23  ? 30.353 -46.220 97.364  1.00 24.04 ? 23   PRO A CG    1 
ATOM   58   C CD    . PRO A 1 23  ? 31.583 -46.452 98.186  1.00 24.79 ? 23   PRO A CD    1 
ATOM   59   N N     . THR A 1 24  ? 31.827 -50.170 95.293  1.00 22.39 ? 24   THR A N     1 
ATOM   60   C CA    . THR A 1 24  ? 32.723 -50.855 94.368  1.00 20.71 ? 24   THR A CA    1 
ATOM   61   C C     . THR A 1 24  ? 32.487 -50.290 92.977  1.00 19.82 ? 24   THR A C     1 
ATOM   62   O O     . THR A 1 24  ? 31.343 -50.082 92.591  1.00 20.31 ? 24   THR A O     1 
ATOM   63   C CB    . THR A 1 24  ? 32.441 -52.365 94.359  1.00 20.66 ? 24   THR A CB    1 
ATOM   64   O OG1   . THR A 1 24  ? 32.887 -52.932 95.594  1.00 21.96 ? 24   THR A OG1   1 
ATOM   65   C CG2   . THR A 1 24  ? 33.145 -53.047 93.205  1.00 19.60 ? 24   THR A CG2   1 
ATOM   66   N N     . LEU A 1 25  ? 33.558 -49.961 92.258  1.00 18.72 ? 25   LEU A N     1 
ATOM   67   C CA    . LEU A 1 25  ? 33.412 -49.428 90.912  1.00 17.49 ? 25   LEU A CA    1 
ATOM   68   C C     . LEU A 1 25  ? 33.148 -50.624 90.011  1.00 18.46 ? 25   LEU A C     1 
ATOM   69   O O     . LEU A 1 25  ? 33.886 -51.611 90.049  1.00 19.83 ? 25   LEU A O     1 
ATOM   70   C CB    . LEU A 1 25  ? 34.665 -48.668 90.485  1.00 16.57 ? 25   LEU A CB    1 
ATOM   71   C CG    . LEU A 1 25  ? 35.088 -47.513 91.392  1.00 15.87 ? 25   LEU A CG    1 
ATOM   72   C CD1   . LEU A 1 25  ? 36.150 -46.713 90.688  1.00 16.13 ? 25   LEU A CD1   1 
ATOM   73   C CD2   . LEU A 1 25  ? 33.900 -46.623 91.734  1.00 16.46 ? 25   LEU A CD2   1 
ATOM   74   N N     . GLN A 1 26  ? 32.084 -50.544 89.221  1.00 18.33 ? 26   GLN A N     1 
ATOM   75   C CA    . GLN A 1 26  ? 31.664 -51.644 88.358  1.00 17.07 ? 26   GLN A CA    1 
ATOM   76   C C     . GLN A 1 26  ? 31.845 -51.460 86.874  1.00 16.67 ? 26   GLN A C     1 
ATOM   77   O O     . GLN A 1 26  ? 31.990 -52.436 86.150  1.00 17.86 ? 26   GLN A O     1 
ATOM   78   C CB    . GLN A 1 26  ? 30.190 -51.944 88.600  1.00 17.15 ? 26   GLN A CB    1 
ATOM   79   C CG    . GLN A 1 26  ? 29.847 -52.267 90.035  1.00 17.45 ? 26   GLN A CG    1 
ATOM   80   C CD    . GLN A 1 26  ? 30.331 -53.636 90.471  1.00 17.87 ? 26   GLN A CD    1 
ATOM   81   O OE1   . GLN A 1 26  ? 30.860 -54.419 89.681  1.00 20.65 ? 26   GLN A OE1   1 
ATOM   82   N NE2   . GLN A 1 26  ? 30.120 -53.942 91.726  1.00 18.54 ? 26   GLN A NE2   1 
ATOM   83   N N     . ASN A 1 27  ? 31.791 -50.220 86.413  1.00 17.10 ? 27   ASN A N     1 
ATOM   84   C CA    . ASN A 1 27  ? 31.909 -49.933 84.990  1.00 15.71 ? 27   ASN A CA    1 
ATOM   85   C C     . ASN A 1 27  ? 32.438 -48.529 84.825  1.00 15.64 ? 27   ASN A C     1 
ATOM   86   O O     . ASN A 1 27  ? 32.085 -47.627 85.580  1.00 14.71 ? 27   ASN A O     1 
ATOM   87   C CB    . ASN A 1 27  ? 30.519 -50.045 84.340  1.00 15.90 ? 27   ASN A CB    1 
ATOM   88   C CG    . ASN A 1 27  ? 30.516 -49.744 82.847  1.00 16.99 ? 27   ASN A CG    1 
ATOM   89   O OD1   . ASN A 1 27  ? 31.455 -50.068 82.121  1.00 18.51 ? 27   ASN A OD1   1 
ATOM   90   N ND2   . ASN A 1 27  ? 29.427 -49.159 82.377  1.00 16.38 ? 27   ASN A ND2   1 
ATOM   91   N N     . ILE A 1 28  ? 33.305 -48.354 83.846  1.00 16.17 ? 28   ILE A N     1 
ATOM   92   C CA    . ILE A 1 28  ? 33.878 -47.057 83.563  1.00 16.89 ? 28   ILE A CA    1 
ATOM   93   C C     . ILE A 1 28  ? 33.671 -46.860 82.060  1.00 18.36 ? 28   ILE A C     1 
ATOM   94   O O     . ILE A 1 28  ? 33.776 -47.818 81.288  1.00 19.58 ? 28   ILE A O     1 
ATOM   95   C CB    . ILE A 1 28  ? 35.420 -47.011 83.902  1.00 16.67 ? 28   ILE A CB    1 
ATOM   96   C CG1   . ILE A 1 28  ? 35.686 -47.391 85.376  1.00 16.34 ? 28   ILE A CG1   1 
ATOM   97   C CG2   . ILE A 1 28  ? 36.005 -45.637 83.579  1.00 13.42 ? 28   ILE A CG2   1 
ATOM   98   C CD1   . ILE A 1 28  ? 35.427 -46.312 86.373  1.00 12.95 ? 28   ILE A CD1   1 
ATOM   99   N N     . VAL A 1 29  ? 33.271 -45.654 81.665  1.00 17.97 ? 29   VAL A N     1 
ATOM   100  C CA    . VAL A 1 29  ? 33.073 -45.319 80.260  1.00 17.07 ? 29   VAL A CA    1 
ATOM   101  C C     . VAL A 1 29  ? 34.055 -44.182 80.003  1.00 18.51 ? 29   VAL A C     1 
ATOM   102  O O     . VAL A 1 29  ? 34.085 -43.208 80.768  1.00 18.43 ? 29   VAL A O     1 
ATOM   103  C CB    . VAL A 1 29  ? 31.636 -44.834 79.986  1.00 15.83 ? 29   VAL A CB    1 
ATOM   104  C CG1   . VAL A 1 29  ? 31.482 -44.367 78.535  1.00 13.06 ? 29   VAL A CG1   1 
ATOM   105  C CG2   . VAL A 1 29  ? 30.660 -45.943 80.298  1.00 14.64 ? 29   VAL A CG2   1 
ATOM   106  N N     . SER A 1 30  ? 34.898 -44.330 78.985  1.00 17.89 ? 30   SER A N     1 
ATOM   107  C CA    . SER A 1 30  ? 35.869 -43.297 78.660  1.00 18.44 ? 30   SER A CA    1 
ATOM   108  C C     . SER A 1 30  ? 35.951 -43.097 77.161  1.00 18.98 ? 30   SER A C     1 
ATOM   109  O O     . SER A 1 30  ? 35.465 -43.922 76.402  1.00 18.14 ? 30   SER A O     1 
ATOM   110  C CB    . SER A 1 30  ? 37.245 -43.654 79.214  1.00 19.28 ? 30   SER A CB    1 
ATOM   111  O OG    . SER A 1 30  ? 37.707 -44.891 78.706  1.00 21.40 ? 30   SER A OG    1 
ATOM   112  N N     . THR A 1 31  ? 36.529 -41.976 76.750  1.00 19.64 ? 31   THR A N     1 
ATOM   113  C CA    . THR A 1 31  ? 36.677 -41.645 75.348  1.00 21.29 ? 31   THR A CA    1 
ATOM   114  C C     . THR A 1 31  ? 38.074 -41.126 75.144  1.00 22.69 ? 31   THR A C     1 
ATOM   115  O O     . THR A 1 31  ? 38.706 -40.612 76.075  1.00 23.33 ? 31   THR A O     1 
ATOM   116  C CB    . THR A 1 31  ? 35.736 -40.492 74.905  1.00 22.92 ? 31   THR A CB    1 
ATOM   117  O OG1   . THR A 1 31  ? 35.902 -39.370 75.789  1.00 24.96 ? 31   THR A OG1   1 
ATOM   118  C CG2   . THR A 1 31  ? 34.280 -40.929 74.902  1.00 22.41 ? 31   THR A CG2   1 
ATOM   119  N N     . VAL A 1 32  ? 38.555 -41.263 73.921  1.00 23.06 ? 32   VAL A N     1 
ATOM   120  C CA    . VAL A 1 32  ? 39.862 -40.767 73.567  1.00 24.10 ? 32   VAL A CA    1 
ATOM   121  C C     . VAL A 1 32  ? 39.783 -40.476 72.090  1.00 24.90 ? 32   VAL A C     1 
ATOM   122  O O     . VAL A 1 32  ? 38.893 -40.963 71.392  1.00 24.60 ? 32   VAL A O     1 
ATOM   123  C CB    . VAL A 1 32  ? 40.984 -41.778 73.861  1.00 24.20 ? 32   VAL A CB    1 
ATOM   124  C CG1   . VAL A 1 32  ? 40.942 -42.942 72.885  1.00 23.89 ? 32   VAL A CG1   1 
ATOM   125  C CG2   . VAL A 1 32  ? 42.316 -41.089 73.792  1.00 24.12 ? 32   VAL A CG2   1 
ATOM   126  N N     . ASN A 1 33  ? 40.714 -39.671 71.618  1.00 27.22 ? 33   ASN A N     1 
ATOM   127  C CA    . ASN A 1 33  ? 40.757 -39.283 70.223  1.00 27.83 ? 33   ASN A CA    1 
ATOM   128  C C     . ASN A 1 33  ? 42.013 -39.883 69.614  1.00 27.99 ? 33   ASN A C     1 
ATOM   129  O O     . ASN A 1 33  ? 43.125 -39.500 69.976  1.00 28.13 ? 33   ASN A O     1 
ATOM   130  C CB    . ASN A 1 33  ? 40.802 -37.765 70.134  1.00 26.94 ? 33   ASN A CB    1 
ATOM   131  C CG    . ASN A 1 33  ? 40.526 -37.264 68.752  1.00 28.04 ? 33   ASN A CG    1 
ATOM   132  O OD1   . ASN A 1 33  ? 40.731 -37.967 67.764  1.00 27.84 ? 33   ASN A OD1   1 
ATOM   133  N ND2   . ASN A 1 33  ? 40.043 -36.038 68.667  1.00 29.24 ? 33   ASN A ND2   1 
ATOM   134  N N     . LEU A 1 34  ? 41.840 -40.860 68.732  1.00 28.90 ? 34   LEU A N     1 
ATOM   135  C CA    . LEU A 1 34  ? 42.986 -41.498 68.095  1.00 30.65 ? 34   LEU A CA    1 
ATOM   136  C C     . LEU A 1 34  ? 43.640 -40.479 67.184  1.00 31.73 ? 34   LEU A C     1 
ATOM   137  O O     . LEU A 1 34  ? 44.771 -40.639 66.750  1.00 32.90 ? 34   LEU A O     1 
ATOM   138  C CB    . LEU A 1 34  ? 42.561 -42.763 67.346  1.00 29.77 ? 34   LEU A CB    1 
ATOM   139  C CG    . LEU A 1 34  ? 41.996 -43.830 68.293  1.00 30.37 ? 34   LEU A CG    1 
ATOM   140  C CD1   . LEU A 1 34  ? 41.674 -45.099 67.530  1.00 29.65 ? 34   LEU A CD1   1 
ATOM   141  C CD2   . LEU A 1 34  ? 42.999 -44.113 69.423  1.00 29.70 ? 34   LEU A CD2   1 
ATOM   142  N N     . ASP A 1 35  ? 42.889 -39.429 66.890  1.00 34.20 ? 35   ASP A N     1 
ATOM   143  C CA    . ASP A 1 35  ? 43.362 -38.318 66.092  1.00 35.66 ? 35   ASP A CA    1 
ATOM   144  C C     . ASP A 1 35  ? 43.658 -38.609 64.638  1.00 35.92 ? 35   ASP A C     1 
ATOM   145  O O     . ASP A 1 35  ? 44.545 -37.993 64.062  1.00 36.82 ? 35   ASP A O     1 
ATOM   146  C CB    . ASP A 1 35  ? 44.587 -37.693 66.762  1.00 37.68 ? 35   ASP A CB    1 
ATOM   147  C CG    . ASP A 1 35  ? 44.654 -36.202 66.572  1.00 39.72 ? 35   ASP A CG    1 
ATOM   148  O OD1   . ASP A 1 35  ? 43.756 -35.629 65.916  1.00 42.05 ? 35   ASP A OD1   1 
ATOM   149  O OD2   . ASP A 1 35  ? 45.608 -35.594 67.093  1.00 42.88 ? 35   ASP A OD2   1 
ATOM   150  N N     . CYS A 1 36  ? 42.919 -39.531 64.038  1.00 35.77 ? 36   CYS A N     1 
ATOM   151  C CA    . CYS A 1 36  ? 43.114 -39.845 62.631  1.00 35.99 ? 36   CYS A CA    1 
ATOM   152  C C     . CYS A 1 36  ? 41.868 -40.525 62.083  1.00 35.94 ? 36   CYS A C     1 
ATOM   153  O O     . CYS A 1 36  ? 41.146 -41.195 62.820  1.00 36.50 ? 36   CYS A O     1 
ATOM   154  C CB    . CYS A 1 36  ? 44.361 -40.719 62.417  1.00 35.76 ? 36   CYS A CB    1 
ATOM   155  S SG    . CYS A 1 36  ? 44.175 -42.456 62.779  1.00 37.17 ? 36   CYS A SG    1 
ATOM   156  N N     . LYS A 1 37  ? 41.555 -40.262 60.821  1.00 35.95 ? 37   LYS A N     1 
ATOM   157  C CA    . LYS A 1 37  ? 40.395 -40.872 60.202  1.00 36.41 ? 37   LYS A CA    1 
ATOM   158  C C     . LYS A 1 37  ? 40.683 -42.357 60.063  1.00 35.35 ? 37   LYS A C     1 
ATOM   159  O O     . LYS A 1 37  ? 41.832 -42.736 59.824  1.00 37.19 ? 37   LYS A O     1 
ATOM   160  C CB    . LYS A 1 37  ? 40.139 -40.230 58.846  1.00 38.85 ? 37   LYS A CB    1 
ATOM   161  C CG    . LYS A 1 37  ? 39.518 -38.857 58.968  1.00 42.47 ? 37   LYS A CG    1 
ATOM   162  C CD    . LYS A 1 37  ? 38.147 -38.945 59.641  1.00 45.55 ? 37   LYS A CD    1 
ATOM   163  C CE    . LYS A 1 37  ? 37.556 -37.554 59.890  1.00 47.38 ? 37   LYS A CE    1 
ATOM   164  N NZ    . LYS A 1 37  ? 36.181 -37.606 60.485  1.00 47.95 ? 37   LYS A NZ    1 
ATOM   165  N N     . LEU A 1 38  ? 39.665 -43.200 60.229  1.00 32.86 ? 38   LEU A N     1 
ATOM   166  C CA    . LEU A 1 38  ? 39.863 -44.648 60.134  1.00 30.90 ? 38   LEU A CA    1 
ATOM   167  C C     . LEU A 1 38  ? 38.967 -45.302 59.090  1.00 30.27 ? 38   LEU A C     1 
ATOM   168  O O     . LEU A 1 38  ? 37.858 -44.839 58.844  1.00 30.62 ? 38   LEU A O     1 
ATOM   169  C CB    . LEU A 1 38  ? 39.598 -45.297 61.496  1.00 27.70 ? 38   LEU A CB    1 
ATOM   170  C CG    . LEU A 1 38  ? 40.327 -44.717 62.705  1.00 25.36 ? 38   LEU A CG    1 
ATOM   171  C CD1   . LEU A 1 38  ? 39.803 -45.408 63.946  1.00 26.94 ? 38   LEU A CD1   1 
ATOM   172  C CD2   . LEU A 1 38  ? 41.843 -44.898 62.586  1.00 24.76 ? 38   LEU A CD2   1 
ATOM   173  N N     . ASP A 1 39  ? 39.457 -46.361 58.453  1.00 30.29 ? 39   ASP A N     1 
ATOM   174  C CA    . ASP A 1 39  ? 38.654 -47.087 57.469  1.00 30.24 ? 39   ASP A CA    1 
ATOM   175  C C     . ASP A 1 39  ? 38.054 -48.229 58.270  1.00 29.47 ? 39   ASP A C     1 
ATOM   176  O O     . ASP A 1 39  ? 38.718 -49.234 58.515  1.00 29.44 ? 39   ASP A O     1 
ATOM   177  C CB    . ASP A 1 39  ? 39.528 -47.637 56.343  1.00 33.21 ? 39   ASP A CB    1 
ATOM   178  C CG    . ASP A 1 39  ? 38.729 -48.421 55.292  1.00 36.06 ? 39   ASP A CG    1 
ATOM   179  O OD1   . ASP A 1 39  ? 37.500 -48.613 55.455  1.00 37.77 ? 39   ASP A OD1   1 
ATOM   180  O OD2   . ASP A 1 39  ? 39.340 -48.845 54.285  1.00 37.50 ? 39   ASP A OD2   1 
ATOM   181  N N     . LEU A 1 40  ? 36.789 -48.083 58.652  1.00 28.29 ? 40   LEU A N     1 
ATOM   182  C CA    . LEU A 1 40  ? 36.132 -49.080 59.484  1.00 28.05 ? 40   LEU A CA    1 
ATOM   183  C C     . LEU A 1 40  ? 35.985 -50.459 58.869  1.00 29.85 ? 40   LEU A C     1 
ATOM   184  O O     . LEU A 1 40  ? 36.061 -51.474 59.574  1.00 28.56 ? 40   LEU A O     1 
ATOM   185  C CB    . LEU A 1 40  ? 34.803 -48.550 60.035  1.00 24.17 ? 40   LEU A CB    1 
ATOM   186  C CG    . LEU A 1 40  ? 34.887 -47.317 60.947  1.00 23.20 ? 40   LEU A CG    1 
ATOM   187  C CD1   . LEU A 1 40  ? 33.559 -47.093 61.647  1.00 20.20 ? 40   LEU A CD1   1 
ATOM   188  C CD2   . LEU A 1 40  ? 35.999 -47.469 61.988  1.00 20.35 ? 40   LEU A CD2   1 
ATOM   189  N N     . LYS A 1 41  ? 35.812 -50.508 57.552  1.00 32.79 ? 41   LYS A N     1 
ATOM   190  C CA    . LYS A 1 41  ? 35.675 -51.796 56.877  1.00 34.83 ? 41   LYS A CA    1 
ATOM   191  C C     . LYS A 1 41  ? 37.022 -52.518 56.857  1.00 33.49 ? 41   LYS A C     1 
ATOM   192  O O     . LYS A 1 41  ? 37.081 -53.721 57.077  1.00 35.14 ? 41   LYS A O     1 
ATOM   193  C CB    . LYS A 1 41  ? 35.128 -51.629 55.457  1.00 36.89 ? 41   LYS A CB    1 
ATOM   194  C CG    . LYS A 1 41  ? 34.370 -52.863 54.960  1.00 41.02 ? 41   LYS A CG    1 
ATOM   195  C CD    . LYS A 1 41  ? 33.145 -53.113 55.836  1.00 45.42 ? 41   LYS A CD    1 
ATOM   196  C CE    . LYS A 1 41  ? 32.330 -54.329 55.397  1.00 47.92 ? 41   LYS A CE    1 
ATOM   197  N NZ    . LYS A 1 41  ? 31.001 -54.414 56.103  1.00 48.15 ? 41   LYS A NZ    1 
ATOM   198  N N     . ALA A 1 42  ? 38.102 -51.768 56.659  1.00 32.14 ? 42   ALA A N     1 
ATOM   199  C CA    . ALA A 1 42  ? 39.439 -52.339 56.631  1.00 31.31 ? 42   ALA A CA    1 
ATOM   200  C C     . ALA A 1 42  ? 39.779 -52.888 58.009  1.00 31.98 ? 42   ALA A C     1 
ATOM   201  O O     . ALA A 1 42  ? 40.399 -53.948 58.131  1.00 33.95 ? 42   ALA A O     1 
ATOM   202  C CB    . ALA A 1 42  ? 40.455 -51.290 56.215  1.00 31.05 ? 42   ALA A CB    1 
ATOM   203  N N     . ILE A 1 43  ? 39.362 -52.177 59.053  1.00 31.17 ? 43   ILE A N     1 
ATOM   204  C CA    . ILE A 1 43  ? 39.611 -52.626 60.421  1.00 29.56 ? 43   ILE A CA    1 
ATOM   205  C C     . ILE A 1 43  ? 38.798 -53.890 60.720  1.00 28.95 ? 43   ILE A C     1 
ATOM   206  O O     . ILE A 1 43  ? 39.335 -54.866 61.218  1.00 27.96 ? 43   ILE A O     1 
ATOM   207  C CB    . ILE A 1 43  ? 39.264 -51.525 61.464  1.00 28.80 ? 43   ILE A CB    1 
ATOM   208  C CG1   . ILE A 1 43  ? 40.169 -50.306 61.262  1.00 27.02 ? 43   ILE A CG1   1 
ATOM   209  C CG2   . ILE A 1 43  ? 39.401 -52.076 62.884  1.00 28.36 ? 43   ILE A CG2   1 
ATOM   210  C CD1   . ILE A 1 43  ? 39.953 -49.202 62.255  1.00 25.31 ? 43   ILE A CD1   1 
ATOM   211  N N     . ALA A 1 44  ? 37.515 -53.874 60.374  1.00 28.50 ? 44   ALA A N     1 
ATOM   212  C CA    . ALA A 1 44  ? 36.624 -55.008 60.610  1.00 29.42 ? 44   ALA A CA    1 
ATOM   213  C C     . ALA A 1 44  ? 37.019 -56.263 59.823  1.00 30.45 ? 44   ALA A C     1 
ATOM   214  O O     . ALA A 1 44  ? 36.633 -57.385 60.173  1.00 30.66 ? 44   ALA A O     1 
ATOM   215  C CB    . ALA A 1 44  ? 35.202 -54.611 60.288  1.00 28.51 ? 44   ALA A CB    1 
ATOM   216  N N     . LEU A 1 45  ? 37.761 -56.066 58.741  1.00 31.78 ? 45   LEU A N     1 
ATOM   217  C CA    . LEU A 1 45  ? 38.215 -57.178 57.928  1.00 32.43 ? 45   LEU A CA    1 
ATOM   218  C C     . LEU A 1 45  ? 39.582 -57.677 58.401  1.00 33.46 ? 45   LEU A C     1 
ATOM   219  O O     . LEU A 1 45  ? 39.801 -58.881 58.527  1.00 31.78 ? 45   LEU A O     1 
ATOM   220  C CB    . LEU A 1 45  ? 38.230 -56.776 56.449  1.00 33.14 ? 45   LEU A CB    1 
ATOM   221  C CG    . LEU A 1 45  ? 36.840 -56.322 55.940  1.00 35.44 ? 45   LEU A CG    1 
ATOM   222  C CD1   . LEU A 1 45  ? 36.920 -55.807 54.501  1.00 35.12 ? 45   LEU A CD1   1 
ATOM   223  C CD2   . LEU A 1 45  ? 35.806 -57.451 56.055  1.00 35.44 ? 45   LEU A CD2   1 
ATOM   224  N N     . GLN A 1 46  ? 40.481 -56.747 58.716  1.00 34.64 ? 46   GLN A N     1 
ATOM   225  C CA    . GLN A 1 46  ? 41.816 -57.107 59.175  1.00 36.42 ? 46   GLN A CA    1 
ATOM   226  C C     . GLN A 1 46  ? 41.796 -57.696 60.580  1.00 36.87 ? 46   GLN A C     1 
ATOM   227  O O     . GLN A 1 46  ? 42.637 -58.523 60.927  1.00 37.21 ? 46   GLN A O     1 
ATOM   228  C CB    . GLN A 1 46  ? 42.759 -55.895 59.149  1.00 38.29 ? 46   GLN A CB    1 
ATOM   229  C CG    . GLN A 1 46  ? 43.178 -55.401 57.763  1.00 40.81 ? 46   GLN A CG    1 
ATOM   230  C CD    . GLN A 1 46  ? 44.288 -54.329 57.814  1.00 44.04 ? 46   GLN A CD    1 
ATOM   231  O OE1   . GLN A 1 46  ? 44.155 -53.232 57.250  1.00 44.28 ? 46   GLN A OE1   1 
ATOM   232  N NE2   . GLN A 1 46  ? 45.395 -54.661 58.468  1.00 46.31 ? 46   GLN A NE2   1 
ATOM   233  N N     . ALA A 1 47  ? 40.866 -57.240 61.405  1.00 38.07 ? 47   ALA A N     1 
ATOM   234  C CA    . ALA A 1 47  ? 40.776 -57.725 62.780  1.00 39.47 ? 47   ALA A CA    1 
ATOM   235  C C     . ALA A 1 47  ? 39.832 -58.899 62.891  1.00 41.76 ? 47   ALA A C     1 
ATOM   236  O O     . ALA A 1 47  ? 38.787 -58.932 62.240  1.00 43.36 ? 47   ALA A O     1 
ATOM   237  C CB    . ALA A 1 47  ? 40.313 -56.613 63.710  1.00 36.78 ? 47   ALA A CB    1 
ATOM   238  N N     . ARG A 1 48  ? 40.216 -59.885 63.690  1.00 43.88 ? 48   ARG A N     1 
ATOM   239  C CA    . ARG A 1 48  ? 39.350 -61.035 63.904  1.00 45.59 ? 48   ARG A CA    1 
ATOM   240  C C     . ARG A 1 48  ? 38.421 -60.641 65.051  1.00 46.12 ? 48   ARG A C     1 
ATOM   241  O O     . ARG A 1 48  ? 37.203 -60.799 64.974  1.00 46.34 ? 48   ARG A O     1 
ATOM   242  C CB    . ARG A 1 48  ? 40.156 -62.303 64.233  1.00 46.30 ? 48   ARG A CB    1 
ATOM   243  C CG    . ARG A 1 48  ? 41.456 -62.072 64.975  1.00 46.84 ? 48   ARG A CG    1 
ATOM   244  C CD    . ARG A 1 48  ? 41.684 -63.160 65.995  1.00 48.18 ? 48   ARG A CD    1 
ATOM   245  N NE    . ARG A 1 48  ? 40.707 -63.059 67.074  1.00 50.92 ? 48   ARG A NE    1 
ATOM   246  C CZ    . ARG A 1 48  ? 41.009 -63.110 68.368  1.00 51.14 ? 48   ARG A CZ    1 
ATOM   247  N NH1   . ARG A 1 48  ? 42.272 -63.267 68.755  1.00 50.96 ? 48   ARG A NH1   1 
ATOM   248  N NH2   . ARG A 1 48  ? 40.044 -62.999 69.276  1.00 51.24 ? 48   ARG A NH2   1 
ATOM   249  N N     . ASN A 1 49  ? 38.987 -60.005 66.066  1.00 46.08 ? 49   ASN A N     1 
ATOM   250  C CA    . ASN A 1 49  ? 38.193 -59.580 67.210  1.00 47.36 ? 49   ASN A CA    1 
ATOM   251  C C     . ASN A 1 49  ? 37.385 -58.285 66.983  1.00 47.38 ? 49   ASN A C     1 
ATOM   252  O O     . ASN A 1 49  ? 37.320 -57.434 67.883  1.00 47.94 ? 49   ASN A O     1 
ATOM   253  C CB    . ASN A 1 49  ? 39.092 -59.437 68.452  1.00 48.62 ? 49   ASN A CB    1 
ATOM   254  C CG    . ASN A 1 49  ? 40.260 -58.480 68.237  1.00 48.62 ? 49   ASN A CG    1 
ATOM   255  O OD1   . ASN A 1 49  ? 40.826 -58.403 67.140  1.00 49.11 ? 49   ASN A OD1   1 
ATOM   256  N ND2   . ASN A 1 49  ? 40.648 -57.773 69.295  1.00 48.04 ? 49   ASN A ND2   1 
ATOM   257  N N     . ALA A 1 50  ? 36.713 -58.158 65.833  1.00 45.90 ? 50   ALA A N     1 
ATOM   258  C CA    . ALA A 1 50  ? 35.948 -56.938 65.551  1.00 44.15 ? 50   ALA A CA    1 
ATOM   259  C C     . ALA A 1 50  ? 34.629 -57.126 64.803  1.00 43.41 ? 50   ALA A C     1 
ATOM   260  O O     . ALA A 1 50  ? 34.590 -57.763 63.755  1.00 44.25 ? 50   ALA A O     1 
ATOM   261  C CB    . ALA A 1 50  ? 36.825 -55.930 64.813  1.00 42.99 ? 50   ALA A CB    1 
ATOM   262  N N     . GLU A 1 51  ? 33.563 -56.521 65.329  1.00 41.91 ? 51   GLU A N     1 
ATOM   263  C CA    . GLU A 1 51  ? 32.227 -56.590 64.733  1.00 40.60 ? 51   GLU A CA    1 
ATOM   264  C C     . GLU A 1 51  ? 31.802 -55.260 64.114  1.00 38.67 ? 51   GLU A C     1 
ATOM   265  O O     . GLU A 1 51  ? 31.981 -54.203 64.704  1.00 37.85 ? 51   GLU A O     1 
ATOM   266  C CB    . GLU A 1 51  ? 31.205 -57.039 65.768  1.00 41.61 ? 51   GLU A CB    1 
ATOM   267  C CG    . GLU A 1 51  ? 31.553 -58.387 66.370  1.00 45.74 ? 51   GLU A CG    1 
ATOM   268  C CD    . GLU A 1 51  ? 30.434 -58.954 67.208  1.00 48.35 ? 51   GLU A CD    1 
ATOM   269  O OE1   . GLU A 1 51  ? 29.950 -58.233 68.112  1.00 49.95 ? 51   GLU A OE1   1 
ATOM   270  O OE2   . GLU A 1 51  ? 30.032 -60.115 66.955  1.00 50.16 ? 51   GLU A OE2   1 
ATOM   271  N N     . TYR A 1 52  ? 31.228 -55.322 62.921  1.00 37.02 ? 52   TYR A N     1 
ATOM   272  C CA    . TYR A 1 52  ? 30.812 -54.124 62.227  1.00 35.55 ? 52   TYR A CA    1 
ATOM   273  C C     . TYR A 1 52  ? 29.676 -54.316 61.229  1.00 37.11 ? 52   TYR A C     1 
ATOM   274  O O     . TYR A 1 52  ? 29.671 -55.259 60.435  1.00 39.05 ? 52   TYR A O     1 
ATOM   275  C CB    . TYR A 1 52  ? 32.004 -53.539 61.482  1.00 31.71 ? 52   TYR A CB    1 
ATOM   276  C CG    . TYR A 1 52  ? 31.688 -52.290 60.689  1.00 29.65 ? 52   TYR A CG    1 
ATOM   277  C CD1   . TYR A 1 52  ? 31.076 -51.187 61.298  1.00 28.33 ? 52   TYR A CD1   1 
ATOM   278  C CD2   . TYR A 1 52  ? 32.066 -52.179 59.351  1.00 27.89 ? 52   TYR A CD2   1 
ATOM   279  C CE1   . TYR A 1 52  ? 30.865 -50.001 60.596  1.00 28.63 ? 52   TYR A CE1   1 
ATOM   280  C CE2   . TYR A 1 52  ? 31.858 -50.995 58.640  1.00 28.70 ? 52   TYR A CE2   1 
ATOM   281  C CZ    . TYR A 1 52  ? 31.261 -49.908 59.269  1.00 29.01 ? 52   TYR A CZ    1 
ATOM   282  O OH    . TYR A 1 52  ? 31.088 -48.729 58.582  1.00 27.67 ? 52   TYR A OH    1 
ATOM   283  N N     . ASN A 1 53  ? 28.689 -53.436 61.316  1.00 37.75 ? 53   ASN A N     1 
ATOM   284  C CA    . ASN A 1 53  ? 27.570 -53.404 60.385  1.00 38.08 ? 53   ASN A CA    1 
ATOM   285  C C     . ASN A 1 53  ? 26.917 -52.042 60.559  1.00 36.61 ? 53   ASN A C     1 
ATOM   286  O O     . ASN A 1 53  ? 26.112 -51.812 61.461  1.00 34.67 ? 53   ASN A O     1 
ATOM   287  C CB    . ASN A 1 53  ? 26.608 -54.588 60.534  1.00 41.56 ? 53   ASN A CB    1 
ATOM   288  C CG    . ASN A 1 53  ? 25.820 -54.555 61.801  1.00 44.06 ? 53   ASN A CG    1 
ATOM   289  O OD1   . ASN A 1 53  ? 24.608 -54.792 61.787  1.00 46.55 ? 53   ASN A OD1   1 
ATOM   290  N ND2   . ASN A 1 53  ? 26.490 -54.288 62.916  1.00 45.55 ? 53   ASN A ND2   1 
ATOM   291  N N     . PRO A 1 54  ? 27.359 -51.079 59.734  1.00 36.22 ? 54   PRO A N     1 
ATOM   292  C CA    . PRO A 1 54  ? 26.884 -49.699 59.733  1.00 36.07 ? 54   PRO A CA    1 
ATOM   293  C C     . PRO A 1 54  ? 25.374 -49.541 59.580  1.00 36.54 ? 54   PRO A C     1 
ATOM   294  O O     . PRO A 1 54  ? 24.825 -48.491 59.894  1.00 37.54 ? 54   PRO A O     1 
ATOM   295  C CB    . PRO A 1 54  ? 27.692 -49.064 58.600  1.00 36.01 ? 54   PRO A CB    1 
ATOM   296  C CG    . PRO A 1 54  ? 28.004 -50.206 57.700  1.00 35.77 ? 54   PRO A CG    1 
ATOM   297  C CD    . PRO A 1 54  ? 28.329 -51.303 58.645  1.00 35.25 ? 54   PRO A CD    1 
ATOM   298  N N     . LYS A 1 55  ? 24.696 -50.595 59.139  1.00 36.79 ? 55   LYS A N     1 
ATOM   299  C CA    . LYS A 1 55  ? 23.248 -50.546 58.998  1.00 36.82 ? 55   LYS A CA    1 
ATOM   300  C C     . LYS A 1 55  ? 22.621 -50.511 60.373  1.00 35.89 ? 55   LYS A C     1 
ATOM   301  O O     . LYS A 1 55  ? 21.524 -50.001 60.552  1.00 37.03 ? 55   LYS A O     1 
ATOM   302  C CB    . LYS A 1 55  ? 22.741 -51.765 58.234  1.00 38.03 ? 55   LYS A CB    1 
ATOM   303  C CG    . LYS A 1 55  ? 22.915 -51.655 56.731  1.00 40.17 ? 55   LYS A CG    1 
ATOM   304  C CD    . LYS A 1 55  ? 22.538 -52.957 56.066  1.00 43.37 ? 55   LYS A CD    1 
ATOM   305  C CE    . LYS A 1 55  ? 22.208 -52.749 54.597  1.00 46.60 ? 55   LYS A CE    1 
ATOM   306  N NZ    . LYS A 1 55  ? 20.972 -51.909 54.417  1.00 48.07 ? 55   LYS A NZ    1 
ATOM   307  N N     . ARG A 1 56  ? 23.330 -51.068 61.341  1.00 35.81 ? 56   ARG A N     1 
ATOM   308  C CA    . ARG A 1 56  ? 22.868 -51.118 62.715  1.00 35.59 ? 56   ARG A CA    1 
ATOM   309  C C     . ARG A 1 56  ? 23.514 -50.014 63.571  1.00 33.62 ? 56   ARG A C     1 
ATOM   310  O O     . ARG A 1 56  ? 22.815 -49.283 64.276  1.00 34.03 ? 56   ARG A O     1 
ATOM   311  C CB    . ARG A 1 56  ? 23.184 -52.500 63.292  1.00 39.03 ? 56   ARG A CB    1 
ATOM   312  C CG    . ARG A 1 56  ? 22.568 -52.809 64.643  1.00 44.31 ? 56   ARG A CG    1 
ATOM   313  C CD    . ARG A 1 56  ? 22.961 -54.215 65.114  1.00 48.26 ? 56   ARG A CD    1 
ATOM   314  N NE    . ARG A 1 56  ? 22.219 -54.596 66.314  1.00 52.59 ? 56   ARG A NE    1 
ATOM   315  C CZ    . ARG A 1 56  ? 22.731 -54.628 67.543  1.00 54.88 ? 56   ARG A CZ    1 
ATOM   316  N NH1   . ARG A 1 56  ? 24.007 -54.311 67.744  1.00 55.91 ? 56   ARG A NH1   1 
ATOM   317  N NH2   . ARG A 1 56  ? 21.949 -54.923 68.579  1.00 55.19 ? 56   ARG A NH2   1 
ATOM   318  N N     . PHE A 1 57  ? 24.837 -49.872 63.483  1.00 30.64 ? 57   PHE A N     1 
ATOM   319  C CA    . PHE A 1 57  ? 25.549 -48.868 64.272  1.00 26.74 ? 57   PHE A CA    1 
ATOM   320  C C     . PHE A 1 57  ? 26.798 -48.409 63.534  1.00 25.25 ? 57   PHE A C     1 
ATOM   321  O O     . PHE A 1 57  ? 27.495 -49.209 62.915  1.00 25.59 ? 57   PHE A O     1 
ATOM   322  C CB    . PHE A 1 57  ? 25.926 -49.452 65.648  1.00 25.16 ? 57   PHE A CB    1 
ATOM   323  C CG    . PHE A 1 57  ? 26.345 -48.417 66.664  1.00 22.98 ? 57   PHE A CG    1 
ATOM   324  C CD1   . PHE A 1 57  ? 25.504 -47.368 66.998  1.00 22.61 ? 57   PHE A CD1   1 
ATOM   325  C CD2   . PHE A 1 57  ? 27.584 -48.489 67.272  1.00 21.39 ? 57   PHE A CD2   1 
ATOM   326  C CE1   . PHE A 1 57  ? 25.901 -46.409 67.919  1.00 22.90 ? 57   PHE A CE1   1 
ATOM   327  C CE2   . PHE A 1 57  ? 27.985 -47.532 68.193  1.00 20.98 ? 57   PHE A CE2   1 
ATOM   328  C CZ    . PHE A 1 57  ? 27.147 -46.493 68.514  1.00 20.85 ? 57   PHE A CZ    1 
ATOM   329  N N     . ALA A 1 58  ? 27.109 -47.129 63.662  1.00 23.83 ? 58   ALA A N     1 
ATOM   330  C CA    . ALA A 1 58  ? 28.253 -46.529 62.998  1.00 23.98 ? 58   ALA A CA    1 
ATOM   331  C C     . ALA A 1 58  ? 29.639 -46.856 63.539  1.00 25.14 ? 58   ALA A C     1 
ATOM   332  O O     . ALA A 1 58  ? 30.598 -46.215 63.145  1.00 27.77 ? 58   ALA A O     1 
ATOM   333  C CB    . ALA A 1 58  ? 28.081 -45.024 62.951  1.00 22.14 ? 58   ALA A CB    1 
ATOM   334  N N     . ALA A 1 59  ? 29.787 -47.847 64.403  1.00 25.00 ? 59   ALA A N     1 
ATOM   335  C CA    . ALA A 1 59  ? 31.117 -48.127 64.933  1.00 23.80 ? 59   ALA A CA    1 
ATOM   336  C C     . ALA A 1 59  ? 31.517 -49.573 64.805  1.00 23.47 ? 59   ALA A C     1 
ATOM   337  O O     . ALA A 1 59  ? 30.674 -50.449 64.570  1.00 24.21 ? 59   ALA A O     1 
ATOM   338  C CB    . ALA A 1 59  ? 31.200 -47.717 66.401  1.00 21.10 ? 59   ALA A CB    1 
ATOM   339  N N     . VAL A 1 60  ? 32.823 -49.799 64.915  1.00 22.51 ? 60   VAL A N     1 
ATOM   340  C CA    . VAL A 1 60  ? 33.383 -51.136 64.910  1.00 21.95 ? 60   VAL A CA    1 
ATOM   341  C C     . VAL A 1 60  ? 33.349 -51.437 66.396  1.00 21.43 ? 60   VAL A C     1 
ATOM   342  O O     . VAL A 1 60  ? 33.730 -50.595 67.211  1.00 20.69 ? 60   VAL A O     1 
ATOM   343  C CB    . VAL A 1 60  ? 34.875 -51.164 64.472  1.00 21.79 ? 60   VAL A CB    1 
ATOM   344  C CG1   . VAL A 1 60  ? 35.466 -52.554 64.714  1.00 21.15 ? 60   VAL A CG1   1 
ATOM   345  C CG2   . VAL A 1 60  ? 35.012 -50.780 63.021  1.00 22.21 ? 60   VAL A CG2   1 
ATOM   346  N N     . ILE A 1 61  ? 32.836 -52.597 66.759  1.00 21.93 ? 61   ILE A N     1 
ATOM   347  C CA    . ILE A 1 61  ? 32.777 -52.982 68.152  1.00 23.18 ? 61   ILE A CA    1 
ATOM   348  C C     . ILE A 1 61  ? 33.906 -53.988 68.336  1.00 23.43 ? 61   ILE A C     1 
ATOM   349  O O     . ILE A 1 61  ? 34.000 -54.971 67.600  1.00 23.13 ? 61   ILE A O     1 
ATOM   350  C CB    . ILE A 1 61  ? 31.392 -53.564 68.484  1.00 24.05 ? 61   ILE A CB    1 
ATOM   351  C CG1   . ILE A 1 61  ? 30.336 -52.474 68.259  1.00 24.05 ? 61   ILE A CG1   1 
ATOM   352  C CG2   . ILE A 1 61  ? 31.335 -54.042 69.936  1.00 23.32 ? 61   ILE A CG2   1 
ATOM   353  C CD1   . ILE A 1 61  ? 28.974 -53.014 67.973  1.00 24.95 ? 61   ILE A CD1   1 
ATOM   354  N N     . MET A 1 62  ? 34.822 -53.683 69.248  1.00 23.76 ? 62   MET A N     1 
ATOM   355  C CA    . MET A 1 62  ? 35.962 -54.551 69.483  1.00 24.24 ? 62   MET A CA    1 
ATOM   356  C C     . MET A 1 62  ? 36.012 -54.860 70.957  1.00 23.39 ? 62   MET A C     1 
ATOM   357  O O     . MET A 1 62  ? 35.475 -54.112 71.754  1.00 22.12 ? 62   MET A O     1 
ATOM   358  C CB    . MET A 1 62  ? 37.241 -53.836 69.054  1.00 27.06 ? 62   MET A CB    1 
ATOM   359  C CG    . MET A 1 62  ? 38.357 -54.759 68.551  1.00 30.44 ? 62   MET A CG    1 
ATOM   360  S SD    . MET A 1 62  ? 39.791 -53.839 67.941  1.00 33.86 ? 62   MET A SD    1 
ATOM   361  C CE    . MET A 1 62  ? 39.318 -53.517 66.225  1.00 30.50 ? 62   MET A CE    1 
ATOM   362  N N     . ARG A 1 63  ? 36.637 -55.968 71.327  1.00 22.65 ? 63   ARG A N     1 
ATOM   363  C CA    . ARG A 1 63  ? 36.737 -56.335 72.739  1.00 23.28 ? 63   ARG A CA    1 
ATOM   364  C C     . ARG A 1 63  ? 38.091 -56.977 73.013  1.00 23.11 ? 63   ARG A C     1 
ATOM   365  O O     . ARG A 1 63  ? 38.600 -57.704 72.154  1.00 23.42 ? 63   ARG A O     1 
ATOM   366  C CB    . ARG A 1 63  ? 35.656 -57.365 73.119  1.00 20.65 ? 63   ARG A CB    1 
ATOM   367  C CG    . ARG A 1 63  ? 34.234 -56.998 72.761  1.00 20.43 ? 63   ARG A CG    1 
ATOM   368  C CD    . ARG A 1 63  ? 33.256 -57.945 73.448  1.00 21.38 ? 63   ARG A CD    1 
ATOM   369  N NE    . ARG A 1 63  ? 31.871 -57.458 73.454  1.00 22.64 ? 63   ARG A NE    1 
ATOM   370  C CZ    . ARG A 1 63  ? 31.082 -57.408 72.383  1.00 22.05 ? 63   ARG A CZ    1 
ATOM   371  N NH1   . ARG A 1 63  ? 31.530 -57.814 71.207  1.00 22.93 ? 63   ARG A NH1   1 
ATOM   372  N NH2   . ARG A 1 63  ? 29.845 -56.941 72.483  1.00 21.41 ? 63   ARG A NH2   1 
ATOM   373  N N     . ILE A 1 64  ? 38.715 -56.640 74.142  1.00 22.86 ? 64   ILE A N     1 
ATOM   374  C CA    . ILE A 1 64  ? 39.964 -57.300 74.530  1.00 22.87 ? 64   ILE A CA    1 
ATOM   375  C C     . ILE A 1 64  ? 39.665 -58.017 75.834  1.00 23.35 ? 64   ILE A C     1 
ATOM   376  O O     . ILE A 1 64  ? 38.706 -57.680 76.529  1.00 23.69 ? 64   ILE A O     1 
ATOM   377  C CB    . ILE A 1 64  ? 41.169 -56.369 74.699  1.00 21.77 ? 64   ILE A CB    1 
ATOM   378  C CG1   . ILE A 1 64  ? 40.882 -55.292 75.733  1.00 21.97 ? 64   ILE A CG1   1 
ATOM   379  C CG2   . ILE A 1 64  ? 41.580 -55.793 73.356  1.00 22.13 ? 64   ILE A CG2   1 
ATOM   380  C CD1   . ILE A 1 64  ? 42.057 -54.379 75.948  1.00 20.80 ? 64   ILE A CD1   1 
ATOM   381  N N     . ARG A 1 65  ? 40.460 -59.022 76.162  1.00 24.21 ? 65   ARG A N     1 
ATOM   382  C CA    . ARG A 1 65  ? 40.222 -59.800 77.369  1.00 24.37 ? 65   ARG A CA    1 
ATOM   383  C C     . ARG A 1 65  ? 40.740 -59.204 78.683  1.00 25.03 ? 65   ARG A C     1 
ATOM   384  O O     . ARG A 1 65  ? 40.169 -59.435 79.749  1.00 24.79 ? 65   ARG A O     1 
ATOM   385  C CB    . ARG A 1 65  ? 40.790 -61.197 77.176  1.00 23.62 ? 65   ARG A CB    1 
ATOM   386  C CG    . ARG A 1 65  ? 40.269 -62.165 78.162  1.00 24.02 ? 65   ARG A CG    1 
ATOM   387  C CD    . ARG A 1 65  ? 40.755 -63.551 77.892  1.00 24.11 ? 65   ARG A CD    1 
ATOM   388  N NE    . ARG A 1 65  ? 40.397 -64.373 79.037  1.00 25.29 ? 65   ARG A NE    1 
ATOM   389  C CZ    . ARG A 1 65  ? 41.088 -65.420 79.459  1.00 25.03 ? 65   ARG A CZ    1 
ATOM   390  N NH1   . ARG A 1 65  ? 42.191 -65.802 78.815  1.00 25.06 ? 65   ARG A NH1   1 
ATOM   391  N NH2   . ARG A 1 65  ? 40.698 -66.044 80.564  1.00 25.36 ? 65   ARG A NH2   1 
ATOM   392  N N     . GLU A 1 66  ? 41.816 -58.440 78.617  1.00 25.17 ? 66   GLU A N     1 
ATOM   393  C CA    . GLU A 1 66  ? 42.376 -57.875 79.815  1.00 27.18 ? 66   GLU A CA    1 
ATOM   394  C C     . GLU A 1 66  ? 42.978 -56.526 79.509  1.00 27.04 ? 66   GLU A C     1 
ATOM   395  O O     . GLU A 1 66  ? 43.895 -56.442 78.691  1.00 29.14 ? 66   GLU A O     1 
ATOM   396  C CB    . GLU A 1 66  ? 43.485 -58.779 80.351  1.00 31.82 ? 66   GLU A CB    1 
ATOM   397  C CG    . GLU A 1 66  ? 43.025 -60.158 80.808  1.00 38.86 ? 66   GLU A CG    1 
ATOM   398  C CD    . GLU A 1 66  ? 42.046 -60.115 81.980  1.00 42.07 ? 66   GLU A CD    1 
ATOM   399  O OE1   . GLU A 1 66  ? 42.125 -59.153 82.785  1.00 44.47 ? 66   GLU A OE1   1 
ATOM   400  O OE2   . GLU A 1 66  ? 41.208 -61.050 82.095  1.00 43.07 ? 66   GLU A OE2   1 
ATOM   401  N N     . PRO A 1 67  ? 42.443 -55.443 80.115  1.00 25.51 ? 67   PRO A N     1 
ATOM   402  C CA    . PRO A 1 67  ? 41.307 -55.448 81.051  1.00 23.52 ? 67   PRO A CA    1 
ATOM   403  C C     . PRO A 1 67  ? 40.089 -55.794 80.225  1.00 22.15 ? 67   PRO A C     1 
ATOM   404  O O     . PRO A 1 67  ? 40.033 -55.418 79.064  1.00 22.10 ? 67   PRO A O     1 
ATOM   405  C CB    . PRO A 1 67  ? 41.247 -53.992 81.514  1.00 24.32 ? 67   PRO A CB    1 
ATOM   406  C CG    . PRO A 1 67  ? 42.689 -53.519 81.358  1.00 24.37 ? 67   PRO A CG    1 
ATOM   407  C CD    . PRO A 1 67  ? 43.060 -54.104 80.041  1.00 23.98 ? 67   PRO A CD    1 
ATOM   408  N N     . LYS A 1 68  ? 39.146 -56.547 80.774  1.00 22.61 ? 68   LYS A N     1 
ATOM   409  C CA    . LYS A 1 68  ? 37.953 -56.924 79.999  1.00 22.68 ? 68   LYS A CA    1 
ATOM   410  C C     . LYS A 1 68  ? 37.088 -55.707 79.687  1.00 22.51 ? 68   LYS A C     1 
ATOM   411  O O     . LYS A 1 68  ? 36.413 -55.156 80.571  1.00 21.97 ? 68   LYS A O     1 
ATOM   412  C CB    . LYS A 1 68  ? 37.133 -57.981 80.729  1.00 22.78 ? 68   LYS A CB    1 
ATOM   413  C CG    . LYS A 1 68  ? 35.843 -58.359 80.038  1.00 24.76 ? 68   LYS A CG    1 
ATOM   414  C CD    . LYS A 1 68  ? 35.035 -59.251 80.951  1.00 28.31 ? 68   LYS A CD    1 
ATOM   415  C CE    . LYS A 1 68  ? 33.559 -59.170 80.636  1.00 31.71 ? 68   LYS A CE    1 
ATOM   416  N NZ    . LYS A 1 68  ? 33.283 -59.681 79.264  1.00 36.00 ? 68   LYS A NZ    1 
ATOM   417  N N     . THR A 1 69  ? 37.097 -55.313 78.417  1.00 21.09 ? 69   THR A N     1 
ATOM   418  C CA    . THR A 1 69  ? 36.360 -54.150 77.962  1.00 20.27 ? 69   THR A CA    1 
ATOM   419  C C     . THR A 1 69  ? 35.842 -54.324 76.546  1.00 20.73 ? 69   THR A C     1 
ATOM   420  O O     . THR A 1 69  ? 36.175 -55.304 75.863  1.00 22.17 ? 69   THR A O     1 
ATOM   421  C CB    . THR A 1 69  ? 37.279 -52.944 77.916  1.00 18.46 ? 69   THR A CB    1 
ATOM   422  O OG1   . THR A 1 69  ? 38.431 -53.281 77.138  1.00 15.84 ? 69   THR A OG1   1 
ATOM   423  C CG2   . THR A 1 69  ? 37.703 -52.541 79.306  1.00 18.55 ? 69   THR A CG2   1 
ATOM   424  N N     . THR A 1 70  ? 35.076 -53.326 76.108  1.00 18.99 ? 70   THR A N     1 
ATOM   425  C CA    . THR A 1 70  ? 34.500 -53.257 74.775  1.00 16.23 ? 70   THR A CA    1 
ATOM   426  C C     . THR A 1 70  ? 34.743 -51.820 74.290  1.00 16.83 ? 70   THR A C     1 
ATOM   427  O O     . THR A 1 70  ? 34.499 -50.866 75.029  1.00 16.85 ? 70   THR A O     1 
ATOM   428  C CB    . THR A 1 70  ? 32.985 -53.500 74.801  1.00 15.65 ? 70   THR A CB    1 
ATOM   429  O OG1   . THR A 1 70  ? 32.698 -54.822 75.282  1.00 15.22 ? 70   THR A OG1   1 
ATOM   430  C CG2   . THR A 1 70  ? 32.419 -53.341 73.415  1.00 15.64 ? 70   THR A CG2   1 
ATOM   431  N N     . ALA A 1 71  ? 35.276 -51.668 73.079  1.00 16.93 ? 71   ALA A N     1 
ATOM   432  C CA    . ALA A 1 71  ? 35.538 -50.349 72.506  1.00 16.32 ? 71   ALA A CA    1 
ATOM   433  C C     . ALA A 1 71  ? 34.567 -50.144 71.380  1.00 16.88 ? 71   ALA A C     1 
ATOM   434  O O     . ALA A 1 71  ? 34.088 -51.110 70.782  1.00 17.55 ? 71   ALA A O     1 
ATOM   435  C CB    . ALA A 1 71  ? 36.949 -50.259 71.956  1.00 12.28 ? 71   ALA A CB    1 
ATOM   436  N N     . LEU A 1 72  ? 34.246 -48.884 71.125  1.00 17.52 ? 72   LEU A N     1 
ATOM   437  C CA    . LEU A 1 72  ? 33.372 -48.513 70.026  1.00 17.40 ? 72   LEU A CA    1 
ATOM   438  C C     . LEU A 1 72  ? 34.301 -47.606 69.238  1.00 17.74 ? 72   LEU A C     1 
ATOM   439  O O     . LEU A 1 72  ? 34.709 -46.561 69.737  1.00 18.91 ? 72   LEU A O     1 
ATOM   440  C CB    . LEU A 1 72  ? 32.152 -47.740 70.535  1.00 18.16 ? 72   LEU A CB    1 
ATOM   441  C CG    . LEU A 1 72  ? 31.223 -48.487 71.495  1.00 18.01 ? 72   LEU A CG    1 
ATOM   442  C CD1   . LEU A 1 72  ? 30.113 -47.565 71.973  1.00 15.52 ? 72   LEU A CD1   1 
ATOM   443  C CD2   . LEU A 1 72  ? 30.652 -49.708 70.802  1.00 18.73 ? 72   LEU A CD2   1 
ATOM   444  N N     . ILE A 1 73  ? 34.724 -48.059 68.065  1.00 18.38 ? 73   ILE A N     1 
ATOM   445  C CA    . ILE A 1 73  ? 35.656 -47.303 67.232  1.00 18.35 ? 73   ILE A CA    1 
ATOM   446  C C     . ILE A 1 73  ? 34.900 -46.710 66.044  1.00 18.68 ? 73   ILE A C     1 
ATOM   447  O O     . ILE A 1 73  ? 34.256 -47.441 65.288  1.00 19.68 ? 73   ILE A O     1 
ATOM   448  C CB    . ILE A 1 73  ? 36.842 -48.220 66.763  1.00 18.03 ? 73   ILE A CB    1 
ATOM   449  C CG1   . ILE A 1 73  ? 37.444 -48.953 67.966  1.00 18.32 ? 73   ILE A CG1   1 
ATOM   450  C CG2   . ILE A 1 73  ? 37.962 -47.392 66.156  1.00 19.44 ? 73   ILE A CG2   1 
ATOM   451  C CD1   . ILE A 1 73  ? 38.675 -49.775 67.663  1.00 16.67 ? 73   ILE A CD1   1 
ATOM   452  N N     . PHE A 1 74  ? 34.970 -45.385 65.899  1.00 19.67 ? 74   PHE A N     1 
ATOM   453  C CA    . PHE A 1 74  ? 34.275 -44.653 64.832  1.00 18.82 ? 74   PHE A CA    1 
ATOM   454  C C     . PHE A 1 74  ? 35.222 -44.165 63.747  1.00 19.88 ? 74   PHE A C     1 
ATOM   455  O O     . PHE A 1 74  ? 36.416 -44.013 63.975  1.00 22.01 ? 74   PHE A O     1 
ATOM   456  C CB    . PHE A 1 74  ? 33.519 -43.471 65.445  1.00 17.62 ? 74   PHE A CB    1 
ATOM   457  C CG    . PHE A 1 74  ? 32.585 -43.868 66.569  1.00 16.33 ? 74   PHE A CG    1 
ATOM   458  C CD1   . PHE A 1 74  ? 33.076 -44.071 67.861  1.00 14.23 ? 74   PHE A CD1   1 
ATOM   459  C CD2   . PHE A 1 74  ? 31.232 -44.090 66.323  1.00 14.82 ? 74   PHE A CD2   1 
ATOM   460  C CE1   . PHE A 1 74  ? 32.246 -44.494 68.890  1.00 12.92 ? 74   PHE A CE1   1 
ATOM   461  C CE2   . PHE A 1 74  ? 30.388 -44.514 67.348  1.00 14.57 ? 74   PHE A CE2   1 
ATOM   462  C CZ    . PHE A 1 74  ? 30.903 -44.719 68.640  1.00 13.47 ? 74   PHE A CZ    1 
ATOM   463  N N     . ALA A 1 75  ? 34.691 -43.897 62.566  1.00 21.73 ? 75   ALA A N     1 
ATOM   464  C CA    . ALA A 1 75  ? 35.503 -43.439 61.436  1.00 23.56 ? 75   ALA A CA    1 
ATOM   465  C C     . ALA A 1 75  ? 36.264 -42.151 61.712  1.00 24.34 ? 75   ALA A C     1 
ATOM   466  O O     . ALA A 1 75  ? 37.314 -41.886 61.117  1.00 24.86 ? 75   ALA A O     1 
ATOM   467  C CB    . ALA A 1 75  ? 34.624 -43.267 60.209  1.00 23.57 ? 75   ALA A CB    1 
ATOM   468  N N     . SER A 1 76  ? 35.717 -41.338 62.601  1.00 25.67 ? 76   SER A N     1 
ATOM   469  C CA    . SER A 1 76  ? 36.332 -40.071 62.948  1.00 26.59 ? 76   SER A CA    1 
ATOM   470  C C     . SER A 1 76  ? 37.633 -40.246 63.733  1.00 27.27 ? 76   SER A C     1 
ATOM   471  O O     . SER A 1 76  ? 38.373 -39.274 63.950  1.00 28.61 ? 76   SER A O     1 
ATOM   472  C CB    . SER A 1 76  ? 35.347 -39.243 63.765  1.00 25.33 ? 76   SER A CB    1 
ATOM   473  O OG    . SER A 1 76  ? 34.966 -39.955 64.931  1.00 25.72 ? 76   SER A OG    1 
ATOM   474  N N     . GLY A 1 77  ? 37.929 -41.476 64.146  1.00 25.65 ? 77   GLY A N     1 
ATOM   475  C CA    . GLY A 1 77  ? 39.131 -41.688 64.929  1.00 23.84 ? 77   GLY A CA    1 
ATOM   476  C C     . GLY A 1 77  ? 38.832 -41.593 66.416  1.00 22.67 ? 77   GLY A C     1 
ATOM   477  O O     . GLY A 1 77  ? 39.692 -41.857 67.246  1.00 23.62 ? 77   GLY A O     1 
ATOM   478  N N     . LYS A 1 78  ? 37.629 -41.163 66.765  1.00 22.13 ? 78   LYS A N     1 
ATOM   479  C CA    . LYS A 1 78  ? 37.234 -41.092 68.165  1.00 22.33 ? 78   LYS A CA    1 
ATOM   480  C C     . LYS A 1 78  ? 36.873 -42.500 68.652  1.00 22.03 ? 78   LYS A C     1 
ATOM   481  O O     . LYS A 1 78  ? 36.399 -43.342 67.881  1.00 20.24 ? 78   LYS A O     1 
ATOM   482  C CB    . LYS A 1 78  ? 36.043 -40.148 68.332  1.00 23.07 ? 78   LYS A CB    1 
ATOM   483  C CG    . LYS A 1 78  ? 36.440 -38.689 68.351  1.00 23.12 ? 78   LYS A CG    1 
ATOM   484  C CD    . LYS A 1 78  ? 35.254 -37.812 68.142  1.00 25.58 ? 78   LYS A CD    1 
ATOM   485  C CE    . LYS A 1 78  ? 35.676 -36.357 68.119  1.00 27.03 ? 78   LYS A CE    1 
ATOM   486  N NZ    . LYS A 1 78  ? 35.898 -35.843 69.498  1.00 32.39 ? 78   LYS A NZ    1 
ATOM   487  N N     . MET A 1 79  ? 37.069 -42.755 69.935  1.00 21.58 ? 79   MET A N     1 
ATOM   488  C CA    . MET A 1 79  ? 36.768 -44.073 70.463  1.00 22.28 ? 79   MET A CA    1 
ATOM   489  C C     . MET A 1 79  ? 36.185 -44.052 71.880  1.00 21.23 ? 79   MET A C     1 
ATOM   490  O O     . MET A 1 79  ? 36.583 -43.231 72.710  1.00 21.58 ? 79   MET A O     1 
ATOM   491  C CB    . MET A 1 79  ? 38.050 -44.920 70.410  1.00 23.84 ? 79   MET A CB    1 
ATOM   492  C CG    . MET A 1 79  ? 38.001 -46.223 71.181  1.00 25.96 ? 79   MET A CG    1 
ATOM   493  S SD    . MET A 1 79  ? 39.608 -47.034 71.194  1.00 31.93 ? 79   MET A SD    1 
ATOM   494  C CE    . MET A 1 79  ? 40.376 -46.298 72.630  1.00 28.72 ? 79   MET A CE    1 
ATOM   495  N N     . VAL A 1 80  ? 35.219 -44.932 72.134  1.00 19.39 ? 80   VAL A N     1 
ATOM   496  C CA    . VAL A 1 80  ? 34.598 -45.067 73.454  1.00 17.51 ? 80   VAL A CA    1 
ATOM   497  C C     . VAL A 1 80  ? 35.034 -46.410 74.060  1.00 19.01 ? 80   VAL A C     1 
ATOM   498  O O     . VAL A 1 80  ? 35.002 -47.452 73.382  1.00 17.80 ? 80   VAL A O     1 
ATOM   499  C CB    . VAL A 1 80  ? 33.054 -45.062 73.367  1.00 16.74 ? 80   VAL A CB    1 
ATOM   500  C CG1   . VAL A 1 80  ? 32.438 -45.317 74.732  1.00 14.61 ? 80   VAL A CG1   1 
ATOM   501  C CG2   . VAL A 1 80  ? 32.564 -43.768 72.813  1.00 13.03 ? 80   VAL A CG2   1 
ATOM   502  N N     . CYS A 1 81  ? 35.481 -46.386 75.315  1.00 19.96 ? 81   CYS A N     1 
ATOM   503  C CA    . CYS A 1 81  ? 35.889 -47.612 76.009  1.00 20.93 ? 81   CYS A CA    1 
ATOM   504  C C     . CYS A 1 81  ? 34.914 -47.901 77.170  1.00 19.57 ? 81   CYS A C     1 
ATOM   505  O O     . CYS A 1 81  ? 34.662 -47.030 78.003  1.00 19.05 ? 81   CYS A O     1 
ATOM   506  C CB    . CYS A 1 81  ? 37.329 -47.497 76.505  1.00 21.96 ? 81   CYS A CB    1 
ATOM   507  S SG    . CYS A 1 81  ? 37.871 -48.998 77.289  1.00 23.97 ? 81   CYS A SG    1 
ATOM   508  N N     . THR A 1 82  ? 34.357 -49.109 77.208  1.00 18.03 ? 82   THR A N     1 
ATOM   509  C CA    . THR A 1 82  ? 33.373 -49.469 78.222  1.00 18.33 ? 82   THR A CA    1 
ATOM   510  C C     . THR A 1 82  ? 33.726 -50.757 78.953  1.00 18.22 ? 82   THR A C     1 
ATOM   511  O O     . THR A 1 82  ? 34.492 -51.565 78.442  1.00 18.18 ? 82   THR A O     1 
ATOM   512  C CB    . THR A 1 82  ? 31.976 -49.689 77.569  1.00 19.93 ? 82   THR A CB    1 
ATOM   513  O OG1   . THR A 1 82  ? 32.056 -50.756 76.614  1.00 23.47 ? 82   THR A OG1   1 
ATOM   514  C CG2   . THR A 1 82  ? 31.487 -48.440 76.833  1.00 20.19 ? 82   THR A CG2   1 
ATOM   515  N N     . GLY A 1 83  ? 33.213 -50.918 80.170  1.00 18.05 ? 83   GLY A N     1 
ATOM   516  C CA    . GLY A 1 83  ? 33.441 -52.146 80.905  1.00 18.52 ? 83   GLY A CA    1 
ATOM   517  C C     . GLY A 1 83  ? 34.582 -52.272 81.890  1.00 21.33 ? 83   GLY A C     1 
ATOM   518  O O     . GLY A 1 83  ? 34.620 -53.261 82.635  1.00 23.02 ? 83   GLY A O     1 
ATOM   519  N N     . ALA A 1 84  ? 35.502 -51.309 81.931  1.00 20.40 ? 84   ALA A N     1 
ATOM   520  C CA    . ALA A 1 84  ? 36.619 -51.392 82.869  1.00 19.35 ? 84   ALA A CA    1 
ATOM   521  C C     . ALA A 1 84  ? 36.177 -51.206 84.323  1.00 19.61 ? 84   ALA A C     1 
ATOM   522  O O     . ALA A 1 84  ? 35.172 -50.551 84.598  1.00 19.02 ? 84   ALA A O     1 
ATOM   523  C CB    . ALA A 1 84  ? 37.670 -50.386 82.513  1.00 18.98 ? 84   ALA A CB    1 
ATOM   524  N N     . LYS A 1 85  ? 36.936 -51.787 85.248  1.00 20.23 ? 85   LYS A N     1 
ATOM   525  C CA    . LYS A 1 85  ? 36.636 -51.690 86.673  1.00 21.06 ? 85   LYS A CA    1 
ATOM   526  C C     . LYS A 1 85  ? 37.317 -50.506 87.375  1.00 21.65 ? 85   LYS A C     1 
ATOM   527  O O     . LYS A 1 85  ? 37.129 -50.313 88.579  1.00 23.26 ? 85   LYS A O     1 
ATOM   528  C CB    . LYS A 1 85  ? 37.013 -52.980 87.408  1.00 20.53 ? 85   LYS A CB    1 
ATOM   529  C CG    . LYS A 1 85  ? 36.206 -54.201 87.022  1.00 20.41 ? 85   LYS A CG    1 
ATOM   530  C CD    . LYS A 1 85  ? 34.732 -54.010 87.292  1.00 20.44 ? 85   LYS A CD    1 
ATOM   531  C CE    . LYS A 1 85  ? 33.973 -55.308 87.095  1.00 20.33 ? 85   LYS A CE    1 
ATOM   532  N NZ    . LYS A 1 85  ? 32.502 -55.072 87.170  1.00 25.12 ? 85   LYS A NZ    1 
ATOM   533  N N     . SER A 1 86  ? 38.133 -49.740 86.660  1.00 20.70 ? 86   SER A N     1 
ATOM   534  C CA    . SER A 1 86  ? 38.780 -48.579 87.269  1.00 21.19 ? 86   SER A CA    1 
ATOM   535  C C     . SER A 1 86  ? 39.154 -47.601 86.174  1.00 20.78 ? 86   SER A C     1 
ATOM   536  O O     . SER A 1 86  ? 39.124 -47.941 84.995  1.00 21.60 ? 86   SER A O     1 
ATOM   537  C CB    . SER A 1 86  ? 40.026 -48.979 88.054  1.00 20.31 ? 86   SER A CB    1 
ATOM   538  O OG    . SER A 1 86  ? 41.111 -49.179 87.172  1.00 22.93 ? 86   SER A OG    1 
ATOM   539  N N     . GLU A 1 87  ? 39.543 -46.399 86.562  1.00 20.87 ? 87   GLU A N     1 
ATOM   540  C CA    . GLU A 1 87  ? 39.909 -45.382 85.595  1.00 21.83 ? 87   GLU A CA    1 
ATOM   541  C C     . GLU A 1 87  ? 41.205 -45.799 84.911  1.00 22.04 ? 87   GLU A C     1 
ATOM   542  O O     . GLU A 1 87  ? 41.334 -45.690 83.699  1.00 23.56 ? 87   GLU A O     1 
ATOM   543  C CB    . GLU A 1 87  ? 40.072 -44.030 86.291  1.00 22.68 ? 87   GLU A CB    1 
ATOM   544  C CG    . GLU A 1 87  ? 38.817 -43.549 87.024  1.00 23.22 ? 87   GLU A CG    1 
ATOM   545  C CD    . GLU A 1 87  ? 38.794 -43.922 88.497  1.00 24.60 ? 87   GLU A CD    1 
ATOM   546  O OE1   . GLU A 1 87  ? 39.155 -45.065 88.848  1.00 24.70 ? 87   GLU A OE1   1 
ATOM   547  O OE2   . GLU A 1 87  ? 38.408 -43.063 89.316  1.00 25.98 ? 87   GLU A OE2   1 
ATOM   548  N N     . ASP A 1 88  ? 42.142 -46.328 85.690  1.00 21.80 ? 88   ASP A N     1 
ATOM   549  C CA    . ASP A 1 88  ? 43.420 -46.761 85.146  1.00 21.25 ? 88   ASP A CA    1 
ATOM   550  C C     . ASP A 1 88  ? 43.211 -47.877 84.145  1.00 19.14 ? 88   ASP A C     1 
ATOM   551  O O     . ASP A 1 88  ? 43.708 -47.795 83.034  1.00 18.13 ? 88   ASP A O     1 
ATOM   552  C CB    . ASP A 1 88  ? 44.379 -47.187 86.263  1.00 23.09 ? 88   ASP A CB    1 
ATOM   553  C CG    . ASP A 1 88  ? 44.995 -45.994 86.995  1.00 25.39 ? 88   ASP A CG    1 
ATOM   554  O OD1   . ASP A 1 88  ? 45.091 -44.900 86.398  1.00 25.13 ? 88   ASP A OD1   1 
ATOM   555  O OD2   . ASP A 1 88  ? 45.389 -46.152 88.173  1.00 28.19 ? 88   ASP A OD2   1 
ATOM   556  N N     . PHE A 1 89  ? 42.460 -48.903 84.534  1.00 19.20 ? 89   PHE A N     1 
ATOM   557  C CA    . PHE A 1 89  ? 42.140 -50.028 83.641  1.00 19.83 ? 89   PHE A CA    1 
ATOM   558  C C     . PHE A 1 89  ? 41.476 -49.572 82.349  1.00 19.81 ? 89   PHE A C     1 
ATOM   559  O O     . PHE A 1 89  ? 41.649 -50.199 81.319  1.00 22.60 ? 89   PHE A O     1 
ATOM   560  C CB    . PHE A 1 89  ? 41.182 -51.005 84.315  1.00 18.63 ? 89   PHE A CB    1 
ATOM   561  C CG    . PHE A 1 89  ? 41.818 -51.851 85.366  1.00 18.48 ? 89   PHE A CG    1 
ATOM   562  C CD1   . PHE A 1 89  ? 43.062 -52.436 85.143  1.00 17.51 ? 89   PHE A CD1   1 
ATOM   563  C CD2   . PHE A 1 89  ? 41.161 -52.092 86.564  1.00 17.22 ? 89   PHE A CD2   1 
ATOM   564  C CE1   . PHE A 1 89  ? 43.639 -53.248 86.096  1.00 19.20 ? 89   PHE A CE1   1 
ATOM   565  C CE2   . PHE A 1 89  ? 41.729 -52.903 87.529  1.00 17.54 ? 89   PHE A CE2   1 
ATOM   566  C CZ    . PHE A 1 89  ? 42.970 -53.485 87.300  1.00 18.32 ? 89   PHE A CZ    1 
ATOM   567  N N     . SER A 1 90  ? 40.675 -48.514 82.413  1.00 21.18 ? 90   SER A N     1 
ATOM   568  C CA    . SER A 1 90  ? 39.996 -47.993 81.231  1.00 20.99 ? 90   SER A CA    1 
ATOM   569  C C     . SER A 1 90  ? 41.046 -47.333 80.329  1.00 22.51 ? 90   SER A C     1 
ATOM   570  O O     . SER A 1 90  ? 41.048 -47.545 79.113  1.00 22.74 ? 90   SER A O     1 
ATOM   571  C CB    . SER A 1 90  ? 38.898 -47.004 81.646  1.00 19.12 ? 90   SER A CB    1 
ATOM   572  O OG    . SER A 1 90  ? 38.081 -46.623 80.556  1.00 15.92 ? 90   SER A OG    1 
ATOM   573  N N     . LYS A 1 91  ? 41.997 -46.617 80.932  1.00 23.85 ? 91   LYS A N     1 
ATOM   574  C CA    . LYS A 1 91  ? 43.063 -45.961 80.164  1.00 24.83 ? 91   LYS A CA    1 
ATOM   575  C C     . LYS A 1 91  ? 43.991 -46.967 79.500  1.00 24.38 ? 91   LYS A C     1 
ATOM   576  O O     . LYS A 1 91  ? 44.447 -46.735 78.386  1.00 24.89 ? 91   LYS A O     1 
ATOM   577  C CB    . LYS A 1 91  ? 43.891 -44.997 81.026  1.00 25.26 ? 91   LYS A CB    1 
ATOM   578  C CG    . LYS A 1 91  ? 44.744 -44.080 80.172  1.00 26.42 ? 91   LYS A CG    1 
ATOM   579  C CD    . LYS A 1 91  ? 45.355 -42.923 80.937  1.00 28.13 ? 91   LYS A CD    1 
ATOM   580  C CE    . LYS A 1 91  ? 46.120 -42.014 79.965  1.00 30.97 ? 91   LYS A CE    1 
ATOM   581  N NZ    . LYS A 1 91  ? 46.802 -40.844 80.608  1.00 33.32 ? 91   LYS A NZ    1 
ATOM   582  N N     . MET A 1 92  ? 44.289 -48.060 80.205  1.00 24.68 ? 92   MET A N     1 
ATOM   583  C CA    . MET A 1 92  ? 45.141 -49.140 79.696  1.00 24.24 ? 92   MET A CA    1 
ATOM   584  C C     . MET A 1 92  ? 44.466 -49.858 78.542  1.00 22.79 ? 92   MET A C     1 
ATOM   585  O O     . MET A 1 92  ? 45.123 -50.185 77.554  1.00 22.94 ? 92   MET A O     1 
ATOM   586  C CB    . MET A 1 92  ? 45.417 -50.175 80.786  1.00 27.73 ? 92   MET A CB    1 
ATOM   587  C CG    . MET A 1 92  ? 46.319 -49.698 81.914  1.00 33.00 ? 92   MET A CG    1 
ATOM   588  S SD    . MET A 1 92  ? 46.487 -50.945 83.223  1.00 38.94 ? 92   MET A SD    1 
ATOM   589  C CE    . MET A 1 92  ? 45.910 -49.995 84.618  1.00 36.74 ? 92   MET A CE    1 
ATOM   590  N N     . ALA A 1 93  ? 43.171 -50.156 78.707  1.00 20.58 ? 93   ALA A N     1 
ATOM   591  C CA    . ALA A 1 93  ? 42.369 -50.839 77.685  1.00 18.88 ? 93   ALA A CA    1 
ATOM   592  C C     . ALA A 1 93  ? 42.345 -49.961 76.443  1.00 19.00 ? 93   ALA A C     1 
ATOM   593  O O     . ALA A 1 93  ? 42.631 -50.413 75.342  1.00 19.62 ? 93   ALA A O     1 
ATOM   594  C CB    . ALA A 1 93  ? 40.957 -51.076 78.196  1.00 15.87 ? 93   ALA A CB    1 
ATOM   595  N N     . ALA A 1 94  ? 42.063 -48.680 76.639  1.00 19.69 ? 94   ALA A N     1 
ATOM   596  C CA    . ALA A 1 94  ? 42.035 -47.728 75.543  1.00 20.85 ? 94   ALA A CA    1 
ATOM   597  C C     . ALA A 1 94  ? 43.389 -47.693 74.795  1.00 22.99 ? 94   ALA A C     1 
ATOM   598  O O     . ALA A 1 94  ? 43.417 -47.632 73.551  1.00 22.98 ? 94   ALA A O     1 
ATOM   599  C CB    . ALA A 1 94  ? 41.675 -46.353 76.073  1.00 18.64 ? 94   ALA A CB    1 
ATOM   600  N N     . ARG A 1 95  ? 44.500 -47.716 75.541  1.00 23.30 ? 95   ARG A N     1 
ATOM   601  C CA    . ARG A 1 95  ? 45.832 -47.700 74.930  1.00 24.64 ? 95   ARG A CA    1 
ATOM   602  C C     . ARG A 1 95  ? 46.023 -48.977 74.107  1.00 24.66 ? 95   ARG A C     1 
ATOM   603  O O     . ARG A 1 95  ? 46.679 -48.950 73.062  1.00 26.57 ? 95   ARG A O     1 
ATOM   604  C CB    . ARG A 1 95  ? 46.946 -47.591 75.976  1.00 25.96 ? 95   ARG A CB    1 
ATOM   605  C CG    . ARG A 1 95  ? 46.968 -46.322 76.801  1.00 30.26 ? 95   ARG A CG    1 
ATOM   606  C CD    . ARG A 1 95  ? 48.209 -46.285 77.719  1.00 35.40 ? 95   ARG A CD    1 
ATOM   607  N NE    . ARG A 1 95  ? 47.983 -45.568 78.986  1.00 40.21 ? 95   ARG A NE    1 
ATOM   608  C CZ    . ARG A 1 95  ? 48.006 -46.135 80.197  1.00 40.72 ? 95   ARG A CZ    1 
ATOM   609  N NH1   . ARG A 1 95  ? 48.246 -47.434 80.330  1.00 41.52 ? 95   ARG A NH1   1 
ATOM   610  N NH2   . ARG A 1 95  ? 47.788 -45.402 81.281  1.00 39.71 ? 95   ARG A NH2   1 
ATOM   611  N N     . LYS A 1 96  ? 45.482 -50.098 74.583  1.00 22.91 ? 96   LYS A N     1 
ATOM   612  C CA    . LYS A 1 96  ? 45.583 -51.343 73.838  1.00 22.75 ? 96   LYS A CA    1 
ATOM   613  C C     . LYS A 1 96  ? 44.838 -51.286 72.506  1.00 21.85 ? 96   LYS A C     1 
ATOM   614  O O     . LYS A 1 96  ? 45.346 -51.731 71.492  1.00 21.77 ? 96   LYS A O     1 
ATOM   615  C CB    . LYS A 1 96  ? 45.062 -52.503 74.661  1.00 24.79 ? 96   LYS A CB    1 
ATOM   616  C CG    . LYS A 1 96  ? 45.990 -52.898 75.767  1.00 26.74 ? 96   LYS A CG    1 
ATOM   617  C CD    . LYS A 1 96  ? 45.611 -54.253 76.299  1.00 30.39 ? 96   LYS A CD    1 
ATOM   618  C CE    . LYS A 1 96  ? 46.712 -54.813 77.139  1.00 31.92 ? 96   LYS A CE    1 
ATOM   619  N NZ    . LYS A 1 96  ? 47.963 -54.962 76.325  1.00 36.20 ? 96   LYS A NZ    1 
ATOM   620  N N     . TYR A 1 97  ? 43.622 -50.751 72.505  1.00 21.73 ? 97   TYR A N     1 
ATOM   621  C CA    . TYR A 1 97  ? 42.858 -50.642 71.266  1.00 21.65 ? 97   TYR A CA    1 
ATOM   622  C C     . TYR A 1 97  ? 43.571 -49.717 70.287  1.00 21.82 ? 97   TYR A C     1 
ATOM   623  O O     . TYR A 1 97  ? 43.622 -50.001 69.096  1.00 22.76 ? 97   TYR A O     1 
ATOM   624  C CB    . TYR A 1 97  ? 41.432 -50.124 71.519  1.00 19.56 ? 97   TYR A CB    1 
ATOM   625  C CG    . TYR A 1 97  ? 40.557 -51.066 72.312  1.00 18.90 ? 97   TYR A CG    1 
ATOM   626  C CD1   . TYR A 1 97  ? 40.111 -52.274 71.757  1.00 17.53 ? 97   TYR A CD1   1 
ATOM   627  C CD2   . TYR A 1 97  ? 40.164 -50.747 73.622  1.00 17.83 ? 97   TYR A CD2   1 
ATOM   628  C CE1   . TYR A 1 97  ? 39.285 -53.143 72.488  1.00 17.38 ? 97   TYR A CE1   1 
ATOM   629  C CE2   . TYR A 1 97  ? 39.344 -51.607 74.365  1.00 16.88 ? 97   TYR A CE2   1 
ATOM   630  C CZ    . TYR A 1 97  ? 38.908 -52.801 73.790  1.00 17.51 ? 97   TYR A CZ    1 
ATOM   631  O OH    . TYR A 1 97  ? 38.093 -53.641 74.508  1.00 17.10 ? 97   TYR A OH    1 
ATOM   632  N N     . ALA A 1 98  ? 44.115 -48.610 70.787  1.00 22.65 ? 98   ALA A N     1 
ATOM   633  C CA    . ALA A 1 98  ? 44.815 -47.649 69.932  1.00 23.90 ? 98   ALA A CA    1 
ATOM   634  C C     . ALA A 1 98  ? 46.037 -48.292 69.282  1.00 25.17 ? 98   ALA A C     1 
ATOM   635  O O     . ALA A 1 98  ? 46.399 -47.936 68.166  1.00 25.84 ? 98   ALA A O     1 
ATOM   636  C CB    . ALA A 1 98  ? 45.220 -46.419 70.728  1.00 22.76 ? 98   ALA A CB    1 
ATOM   637  N N     . ARG A 1 99  ? 46.654 -49.241 69.985  1.00 26.07 ? 99   ARG A N     1 
ATOM   638  C CA    . ARG A 1 99  ? 47.822 -49.970 69.491  1.00 27.32 ? 99   ARG A CA    1 
ATOM   639  C C     . ARG A 1 99  ? 47.364 -51.039 68.510  1.00 26.32 ? 99   ARG A C     1 
ATOM   640  O O     . ARG A 1 99  ? 48.081 -51.359 67.565  1.00 26.44 ? 99   ARG A O     1 
ATOM   641  C CB    . ARG A 1 99  ? 48.599 -50.601 70.654  1.00 30.01 ? 99   ARG A CB    1 
ATOM   642  C CG    . ARG A 1 99  ? 49.862 -51.340 70.241  1.00 35.22 ? 99   ARG A CG    1 
ATOM   643  C CD    . ARG A 1 99  ? 51.061 -50.915 71.076  1.00 41.03 ? 99   ARG A CD    1 
ATOM   644  N NE    . ARG A 1 99  ? 51.520 -49.559 70.747  1.00 45.83 ? 99   ARG A NE    1 
ATOM   645  C CZ    . ARG A 1 99  ? 52.697 -49.048 71.120  1.00 47.10 ? 99   ARG A CZ    1 
ATOM   646  N NH1   . ARG A 1 99  ? 53.549 -49.775 71.847  1.00 46.60 ? 99   ARG A NH1   1 
ATOM   647  N NH2   . ARG A 1 99  ? 53.042 -47.821 70.734  1.00 46.74 ? 99   ARG A NH2   1 
ATOM   648  N N     . ILE A 1 100 ? 46.175 -51.600 68.742  1.00 26.05 ? 100  ILE A N     1 
ATOM   649  C CA    . ILE A 1 100 ? 45.604 -52.596 67.833  1.00 25.71 ? 100  ILE A CA    1 
ATOM   650  C C     . ILE A 1 100 ? 45.367 -51.857 66.524  1.00 27.23 ? 100  ILE A C     1 
ATOM   651  O O     . ILE A 1 100 ? 45.760 -52.325 65.458  1.00 28.77 ? 100  ILE A O     1 
ATOM   652  C CB    . ILE A 1 100 ? 44.243 -53.172 68.340  1.00 23.88 ? 100  ILE A CB    1 
ATOM   653  C CG1   . ILE A 1 100 ? 44.479 -54.263 69.376  1.00 22.32 ? 100  ILE A CG1   1 
ATOM   654  C CG2   . ILE A 1 100 ? 43.446 -53.768 67.202  1.00 21.10 ? 100  ILE A CG2   1 
ATOM   655  C CD1   . ILE A 1 100 ? 43.215 -54.816 69.937  1.00 21.78 ? 100  ILE A CD1   1 
ATOM   656  N N     . VAL A 1 101 ? 44.774 -50.672 66.627  1.00 27.67 ? 101  VAL A N     1 
ATOM   657  C CA    . VAL A 1 101 ? 44.487 -49.837 65.472  1.00 28.32 ? 101  VAL A CA    1 
ATOM   658  C C     . VAL A 1 101 ? 45.767 -49.455 64.734  1.00 29.44 ? 101  VAL A C     1 
ATOM   659  O O     . VAL A 1 101 ? 45.786 -49.421 63.500  1.00 29.84 ? 101  VAL A O     1 
ATOM   660  C CB    . VAL A 1 101 ? 43.672 -48.592 65.891  1.00 27.59 ? 101  VAL A CB    1 
ATOM   661  C CG1   . VAL A 1 101 ? 43.634 -47.558 64.771  1.00 27.23 ? 101  VAL A CG1   1 
ATOM   662  C CG2   . VAL A 1 101 ? 42.244 -49.021 66.249  1.00 27.65 ? 101  VAL A CG2   1 
ATOM   663  N N     . GLN A 1 102 ? 46.834 -49.180 65.478  1.00 30.81 ? 102  GLN A N     1 
ATOM   664  C CA    . GLN A 1 102 ? 48.119 -48.844 64.867  1.00 32.17 ? 102  GLN A CA    1 
ATOM   665  C C     . GLN A 1 102 ? 48.703 -50.060 64.170  1.00 32.17 ? 102  GLN A C     1 
ATOM   666  O O     . GLN A 1 102 ? 49.209 -49.950 63.063  1.00 34.19 ? 102  GLN A O     1 
ATOM   667  C CB    . GLN A 1 102 ? 49.121 -48.379 65.903  1.00 33.92 ? 102  GLN A CB    1 
ATOM   668  C CG    . GLN A 1 102 ? 48.837 -47.046 66.516  1.00 36.72 ? 102  GLN A CG    1 
ATOM   669  C CD    . GLN A 1 102 ? 49.759 -46.771 67.686  1.00 39.33 ? 102  GLN A CD    1 
ATOM   670  O OE1   . GLN A 1 102 ? 50.565 -47.633 68.090  1.00 39.69 ? 102  GLN A OE1   1 
ATOM   671  N NE2   . GLN A 1 102 ? 49.640 -45.578 68.254  1.00 39.57 ? 102  GLN A NE2   1 
ATOM   672  N N     . LYS A 1 103 ? 48.653 -51.219 64.810  1.00 32.26 ? 103  LYS A N     1 
ATOM   673  C CA    . LYS A 1 103 ? 49.187 -52.421 64.181  1.00 34.49 ? 103  LYS A CA    1 
ATOM   674  C C     . LYS A 1 103 ? 48.361 -52.801 62.937  1.00 34.81 ? 103  LYS A C     1 
ATOM   675  O O     . LYS A 1 103 ? 48.766 -53.644 62.128  1.00 36.51 ? 103  LYS A O     1 
ATOM   676  C CB    . LYS A 1 103 ? 49.242 -53.584 65.183  1.00 36.21 ? 103  LYS A CB    1 
ATOM   677  C CG    . LYS A 1 103 ? 50.069 -53.272 66.421  1.00 38.76 ? 103  LYS A CG    1 
ATOM   678  C CD    . LYS A 1 103 ? 51.448 -52.729 66.034  1.00 42.60 ? 103  LYS A CD    1 
ATOM   679  C CE    . LYS A 1 103 ? 52.156 -51.974 67.194  1.00 45.93 ? 103  LYS A CE    1 
ATOM   680  N NZ    . LYS A 1 103 ? 51.562 -50.626 67.524  1.00 46.60 ? 103  LYS A NZ    1 
ATOM   681  N N     . LEU A 1 104 ? 47.196 -52.181 62.790  1.00 33.43 ? 104  LEU A N     1 
ATOM   682  C CA    . LEU A 1 104 ? 46.342 -52.447 61.648  1.00 31.85 ? 104  LEU A CA    1 
ATOM   683  C C     . LEU A 1 104 ? 46.715 -51.498 60.510  1.00 32.45 ? 104  LEU A C     1 
ATOM   684  O O     . LEU A 1 104 ? 46.173 -51.601 59.408  1.00 33.89 ? 104  LEU A O     1 
ATOM   685  C CB    . LEU A 1 104 ? 44.881 -52.291 62.042  1.00 30.27 ? 104  LEU A CB    1 
ATOM   686  C CG    . LEU A 1 104 ? 43.974 -53.484 61.772  1.00 28.81 ? 104  LEU A CG    1 
ATOM   687  C CD1   . LEU A 1 104 ? 44.705 -54.778 62.016  1.00 28.67 ? 104  LEU A CD1   1 
ATOM   688  C CD2   . LEU A 1 104 ? 42.752 -53.374 62.648  1.00 26.61 ? 104  LEU A CD2   1 
ATOM   689  N N     . GLY A 1 105 ? 47.622 -50.562 60.784  1.00 31.56 ? 105  GLY A N     1 
ATOM   690  C CA    . GLY A 1 105 ? 48.062 -49.645 59.755  1.00 31.50 ? 105  GLY A CA    1 
ATOM   691  C C     . GLY A 1 105 ? 47.659 -48.187 59.845  1.00 33.00 ? 105  GLY A C     1 
ATOM   692  O O     . GLY A 1 105 ? 47.994 -47.408 58.952  1.00 35.11 ? 105  GLY A O     1 
ATOM   693  N N     . PHE A 1 106 ? 46.968 -47.776 60.899  1.00 32.76 ? 106  PHE A N     1 
ATOM   694  C CA    . PHE A 1 106 ? 46.571 -46.375 60.998  1.00 31.49 ? 106  PHE A CA    1 
ATOM   695  C C     . PHE A 1 106 ? 47.469 -45.646 61.975  1.00 32.17 ? 106  PHE A C     1 
ATOM   696  O O     . PHE A 1 106 ? 47.737 -46.151 63.054  1.00 33.34 ? 106  PHE A O     1 
ATOM   697  C CB    . PHE A 1 106 ? 45.119 -46.291 61.421  1.00 31.41 ? 106  PHE A CB    1 
ATOM   698  C CG    . PHE A 1 106 ? 44.190 -47.017 60.496  1.00 31.10 ? 106  PHE A CG    1 
ATOM   699  C CD1   . PHE A 1 106 ? 44.005 -48.390 60.615  1.00 31.16 ? 106  PHE A CD1   1 
ATOM   700  C CD2   . PHE A 1 106 ? 43.507 -46.328 59.493  1.00 30.88 ? 106  PHE A CD2   1 
ATOM   701  C CE1   . PHE A 1 106 ? 43.144 -49.077 59.744  1.00 31.68 ? 106  PHE A CE1   1 
ATOM   702  C CE2   . PHE A 1 106 ? 42.647 -46.995 58.621  1.00 30.69 ? 106  PHE A CE2   1 
ATOM   703  C CZ    . PHE A 1 106 ? 42.463 -48.378 58.746  1.00 31.07 ? 106  PHE A CZ    1 
ATOM   704  N N     . PRO A 1 107 ? 47.917 -44.430 61.631  1.00 33.84 ? 107  PRO A N     1 
ATOM   705  C CA    . PRO A 1 107 ? 48.804 -43.627 62.492  1.00 35.66 ? 107  PRO A CA    1 
ATOM   706  C C     . PRO A 1 107 ? 48.112 -43.055 63.741  1.00 36.72 ? 107  PRO A C     1 
ATOM   707  O O     . PRO A 1 107 ? 48.172 -41.846 64.005  1.00 38.50 ? 107  PRO A O     1 
ATOM   708  C CB    . PRO A 1 107 ? 49.260 -42.513 61.546  1.00 34.45 ? 107  PRO A CB    1 
ATOM   709  C CG    . PRO A 1 107 ? 48.021 -42.244 60.743  1.00 33.63 ? 107  PRO A CG    1 
ATOM   710  C CD    . PRO A 1 107 ? 47.509 -43.658 60.436  1.00 34.61 ? 107  PRO A CD    1 
ATOM   711  N N     . ALA A 1 108 ? 47.501 -43.934 64.528  1.00 36.79 ? 108  ALA A N     1 
ATOM   712  C CA    . ALA A 1 108 ? 46.771 -43.522 65.711  1.00 34.84 ? 108  ALA A CA    1 
ATOM   713  C C     . ALA A 1 108 ? 47.646 -42.920 66.792  1.00 34.61 ? 108  ALA A C     1 
ATOM   714  O O     . ALA A 1 108 ? 48.752 -43.385 67.052  1.00 34.43 ? 108  ALA A O     1 
ATOM   715  C CB    . ALA A 1 108 ? 45.964 -44.695 66.263  1.00 34.57 ? 108  ALA A CB    1 
ATOM   716  N N     . LYS A 1 109 ? 47.136 -41.838 67.362  1.00 34.98 ? 109  LYS A N     1 
ATOM   717  C CA    . LYS A 1 109 ? 47.751 -41.095 68.453  1.00 35.67 ? 109  LYS A CA    1 
ATOM   718  C C     . LYS A 1 109 ? 46.826 -41.387 69.644  1.00 34.94 ? 109  LYS A C     1 
ATOM   719  O O     . LYS A 1 109 ? 45.908 -42.204 69.533  1.00 35.72 ? 109  LYS A O     1 
ATOM   720  C CB    . LYS A 1 109 ? 47.732 -39.597 68.136  1.00 37.32 ? 109  LYS A CB    1 
ATOM   721  C CG    . LYS A 1 109 ? 48.353 -39.244 66.790  1.00 39.61 ? 109  LYS A CG    1 
ATOM   722  C CD    . LYS A 1 109 ? 49.843 -38.971 66.916  1.00 41.48 ? 109  LYS A CD    1 
ATOM   723  C CE    . LYS A 1 109 ? 50.647 -39.597 65.785  1.00 42.17 ? 109  LYS A CE    1 
ATOM   724  N NZ    . LYS A 1 109 ? 50.853 -41.061 66.014  1.00 43.34 ? 109  LYS A NZ    1 
ATOM   725  N N     . PHE A 1 110 ? 47.022 -40.709 70.766  1.00 33.66 ? 110  PHE A N     1 
ATOM   726  C CA    . PHE A 1 110 ? 46.183 -40.967 71.928  1.00 31.76 ? 110  PHE A CA    1 
ATOM   727  C C     . PHE A 1 110 ? 45.879 -39.660 72.618  1.00 32.04 ? 110  PHE A C     1 
ATOM   728  O O     . PHE A 1 110 ? 46.483 -39.344 73.636  1.00 33.37 ? 110  PHE A O     1 
ATOM   729  C CB    . PHE A 1 110 ? 46.924 -41.890 72.890  1.00 28.86 ? 110  PHE A CB    1 
ATOM   730  C CG    . PHE A 1 110 ? 46.034 -42.572 73.880  1.00 27.96 ? 110  PHE A CG    1 
ATOM   731  C CD1   . PHE A 1 110 ? 45.227 -43.627 73.490  1.00 25.91 ? 110  PHE A CD1   1 
ATOM   732  C CD2   . PHE A 1 110 ? 46.021 -42.178 75.210  1.00 27.05 ? 110  PHE A CD2   1 
ATOM   733  C CE1   . PHE A 1 110 ? 44.428 -44.279 74.404  1.00 26.65 ? 110  PHE A CE1   1 
ATOM   734  C CE2   . PHE A 1 110 ? 45.219 -42.830 76.134  1.00 26.25 ? 110  PHE A CE2   1 
ATOM   735  C CZ    . PHE A 1 110 ? 44.420 -43.884 75.728  1.00 25.85 ? 110  PHE A CZ    1 
ATOM   736  N N     . LYS A 1 111 ? 44.921 -38.905 72.102  1.00 32.74 ? 111  LYS A N     1 
ATOM   737  C CA    . LYS A 1 111 ? 44.630 -37.625 72.716  1.00 33.54 ? 111  LYS A CA    1 
ATOM   738  C C     . LYS A 1 111 ? 43.262 -37.419 73.361  1.00 33.48 ? 111  LYS A C     1 
ATOM   739  O O     . LYS A 1 111 ? 42.292 -38.102 73.052  1.00 32.20 ? 111  LYS A O     1 
ATOM   740  C CB    . LYS A 1 111 ? 44.926 -36.493 71.734  1.00 35.90 ? 111  LYS A CB    1 
ATOM   741  C CG    . LYS A 1 111 ? 43.796 -36.100 70.814  1.00 39.26 ? 111  LYS A CG    1 
ATOM   742  C CD    . LYS A 1 111 ? 44.062 -34.697 70.293  1.00 41.79 ? 111  LYS A CD    1 
ATOM   743  C CE    . LYS A 1 111 ? 42.950 -34.176 69.411  1.00 43.28 ? 111  LYS A CE    1 
ATOM   744  N NZ    . LYS A 1 111 ? 43.352 -32.840 68.882  1.00 44.36 ? 111  LYS A NZ    1 
ATOM   745  N N     . ASP A 1 112 ? 43.222 -36.455 74.274  1.00 32.90 ? 112  ASP A N     1 
ATOM   746  C CA    . ASP A 1 112 ? 42.023 -36.073 75.001  1.00 31.48 ? 112  ASP A CA    1 
ATOM   747  C C     . ASP A 1 112 ? 41.367 -37.227 75.726  1.00 30.11 ? 112  ASP A C     1 
ATOM   748  O O     . ASP A 1 112 ? 40.141 -37.332 75.730  1.00 30.48 ? 112  ASP A O     1 
ATOM   749  C CB    . ASP A 1 112 ? 41.012 -35.402 74.067  1.00 33.05 ? 112  ASP A CB    1 
ATOM   750  C CG    . ASP A 1 112 ? 41.600 -34.225 73.309  1.00 35.87 ? 112  ASP A CG    1 
ATOM   751  O OD1   . ASP A 1 112 ? 42.510 -33.565 73.863  1.00 37.45 ? 112  ASP A OD1   1 
ATOM   752  O OD2   . ASP A 1 112 ? 41.153 -33.961 72.157  1.00 37.35 ? 112  ASP A OD2   1 
ATOM   753  N N     . PHE A 1 113 ? 42.166 -38.110 76.319  1.00 28.00 ? 113  PHE A N     1 
ATOM   754  C CA    . PHE A 1 113 ? 41.590 -39.223 77.068  1.00 25.57 ? 113  PHE A CA    1 
ATOM   755  C C     . PHE A 1 113 ? 40.816 -38.630 78.252  1.00 25.66 ? 113  PHE A C     1 
ATOM   756  O O     . PHE A 1 113 ? 41.391 -37.929 79.089  1.00 26.74 ? 113  PHE A O     1 
ATOM   757  C CB    . PHE A 1 113 ? 42.663 -40.189 77.586  1.00 22.72 ? 113  PHE A CB    1 
ATOM   758  C CG    . PHE A 1 113 ? 42.094 -41.290 78.429  1.00 19.94 ? 113  PHE A CG    1 
ATOM   759  C CD1   . PHE A 1 113 ? 41.884 -41.100 79.792  1.00 18.60 ? 113  PHE A CD1   1 
ATOM   760  C CD2   . PHE A 1 113 ? 41.637 -42.456 77.845  1.00 17.48 ? 113  PHE A CD2   1 
ATOM   761  C CE1   . PHE A 1 113 ? 41.211 -42.055 80.551  1.00 17.47 ? 113  PHE A CE1   1 
ATOM   762  C CE2   . PHE A 1 113 ? 40.970 -43.403 78.594  1.00 16.15 ? 113  PHE A CE2   1 
ATOM   763  C CZ    . PHE A 1 113 ? 40.753 -43.202 79.949  1.00 14.51 ? 113  PHE A CZ    1 
ATOM   764  N N     . LYS A 1 114 ? 39.537 -38.976 78.359  1.00 24.90 ? 114  LYS A N     1 
ATOM   765  C CA    . LYS A 1 114 ? 38.686 -38.456 79.409  1.00 23.41 ? 114  LYS A CA    1 
ATOM   766  C C     . LYS A 1 114 ? 37.733 -39.501 79.970  1.00 22.27 ? 114  LYS A C     1 
ATOM   767  O O     . LYS A 1 114 ? 37.172 -40.284 79.217  1.00 23.21 ? 114  LYS A O     1 
ATOM   768  C CB    . LYS A 1 114 ? 37.885 -37.286 78.829  1.00 25.07 ? 114  LYS A CB    1 
ATOM   769  C CG    . LYS A 1 114 ? 36.826 -36.713 79.742  1.00 29.21 ? 114  LYS A CG    1 
ATOM   770  C CD    . LYS A 1 114 ? 36.190 -35.460 79.146  1.00 32.74 ? 114  LYS A CD    1 
ATOM   771  C CE    . LYS A 1 114 ? 35.134 -34.876 80.088  1.00 35.32 ? 114  LYS A CE    1 
ATOM   772  N NZ    . LYS A 1 114 ? 34.580 -33.568 79.607  1.00 38.79 ? 114  LYS A NZ    1 
ATOM   773  N N     . ILE A 1 115 ? 37.591 -39.546 81.292  1.00 21.11 ? 115  ILE A N     1 
ATOM   774  C CA    . ILE A 1 115 ? 36.644 -40.462 81.935  1.00 20.75 ? 115  ILE A CA    1 
ATOM   775  C C     . ILE A 1 115 ? 35.271 -39.784 81.817  1.00 20.93 ? 115  ILE A C     1 
ATOM   776  O O     . ILE A 1 115 ? 35.073 -38.664 82.301  1.00 20.96 ? 115  ILE A O     1 
ATOM   777  C CB    . ILE A 1 115 ? 36.989 -40.696 83.424  1.00 20.51 ? 115  ILE A CB    1 
ATOM   778  C CG1   . ILE A 1 115 ? 38.401 -41.287 83.532  1.00 20.86 ? 115  ILE A CG1   1 
ATOM   779  C CG2   . ILE A 1 115 ? 35.949 -41.623 84.105  1.00 15.30 ? 115  ILE A CG2   1 
ATOM   780  C CD1   . ILE A 1 115 ? 38.600 -42.553 82.720  1.00 21.59 ? 115  ILE A CD1   1 
ATOM   781  N N     . GLN A 1 116 ? 34.344 -40.455 81.141  1.00 20.41 ? 116  GLN A N     1 
ATOM   782  C CA    . GLN A 1 116 ? 33.001 -39.924 80.898  1.00 19.13 ? 116  GLN A CA    1 
ATOM   783  C C     . GLN A 1 116 ? 31.898 -40.333 81.879  1.00 17.64 ? 116  GLN A C     1 
ATOM   784  O O     . GLN A 1 116 ? 30.942 -39.593 82.065  1.00 16.82 ? 116  GLN A O     1 
ATOM   785  C CB    . GLN A 1 116 ? 32.577 -40.273 79.467  1.00 18.95 ? 116  GLN A CB    1 
ATOM   786  C CG    . GLN A 1 116 ? 33.521 -39.723 78.389  1.00 18.39 ? 116  GLN A CG    1 
ATOM   787  C CD    . GLN A 1 116 ? 33.407 -38.218 78.207  1.00 19.04 ? 116  GLN A CD    1 
ATOM   788  O OE1   . GLN A 1 116 ? 32.679 -37.535 78.940  1.00 18.10 ? 116  GLN A OE1   1 
ATOM   789  N NE2   . GLN A 1 116 ? 34.119 -37.694 77.219  1.00 17.07 ? 116  GLN A NE2   1 
ATOM   790  N N     . ASN A 1 117 ? 31.987 -41.534 82.441  1.00 17.16 ? 117  ASN A N     1 
ATOM   791  C CA    . ASN A 1 117 ? 30.994 -42.004 83.401  1.00 16.77 ? 117  ASN A CA    1 
ATOM   792  C C     . ASN A 1 117 ? 31.580 -43.118 84.254  1.00 16.84 ? 117  ASN A C     1 
ATOM   793  O O     . ASN A 1 117 ? 32.389 -43.926 83.782  1.00 17.38 ? 117  ASN A O     1 
ATOM   794  C CB    . ASN A 1 117 ? 29.719 -42.491 82.698  1.00 16.92 ? 117  ASN A CB    1 
ATOM   795  C CG    . ASN A 1 117 ? 28.599 -42.855 83.687  1.00 17.57 ? 117  ASN A CG    1 
ATOM   796  O OD1   . ASN A 1 117 ? 28.547 -42.338 84.799  1.00 19.28 ? 117  ASN A OD1   1 
ATOM   797  N ND2   . ASN A 1 117 ? 27.706 -43.750 83.281  1.00 17.94 ? 117  ASN A ND2   1 
ATOM   798  N N     . ILE A 1 118 ? 31.190 -43.140 85.520  1.00 16.75 ? 118  ILE A N     1 
ATOM   799  C CA    . ILE A 1 118 ? 31.659 -44.148 86.453  1.00 16.66 ? 118  ILE A CA    1 
ATOM   800  C C     . ILE A 1 118 ? 30.430 -44.691 87.163  1.00 17.28 ? 118  ILE A C     1 
ATOM   801  O O     . ILE A 1 118 ? 29.592 -43.922 87.624  1.00 17.44 ? 118  ILE A O     1 
ATOM   802  C CB    . ILE A 1 118 ? 32.613 -43.529 87.492  1.00 17.46 ? 118  ILE A CB    1 
ATOM   803  C CG1   . ILE A 1 118 ? 33.873 -42.997 86.791  1.00 16.42 ? 118  ILE A CG1   1 
ATOM   804  C CG2   . ILE A 1 118 ? 32.937 -44.547 88.590  1.00 16.25 ? 118  ILE A CG2   1 
ATOM   805  C CD1   . ILE A 1 118 ? 34.679 -42.037 87.613  1.00 13.43 ? 118  ILE A CD1   1 
ATOM   806  N N     . VAL A 1 119 ? 30.296 -46.015 87.182  1.00 18.52 ? 119  VAL A N     1 
ATOM   807  C CA    . VAL A 1 119 ? 29.165 -46.692 87.826  1.00 17.20 ? 119  VAL A CA    1 
ATOM   808  C C     . VAL A 1 119 ? 29.740 -47.500 88.985  1.00 16.80 ? 119  VAL A C     1 
ATOM   809  O O     . VAL A 1 119 ? 30.686 -48.254 88.801  1.00 16.34 ? 119  VAL A O     1 
ATOM   810  C CB    . VAL A 1 119 ? 28.425 -47.646 86.841  1.00 15.35 ? 119  VAL A CB    1 
ATOM   811  C CG1   . VAL A 1 119 ? 27.268 -48.325 87.518  1.00 14.79 ? 119  VAL A CG1   1 
ATOM   812  C CG2   . VAL A 1 119 ? 27.918 -46.876 85.658  1.00 15.33 ? 119  VAL A CG2   1 
ATOM   813  N N     . GLY A 1 120 ? 29.229 -47.263 90.186  1.00 16.29 ? 120  GLY A N     1 
ATOM   814  C CA    . GLY A 1 120 ? 29.694 -47.983 91.350  1.00 17.76 ? 120  GLY A CA    1 
ATOM   815  C C     . GLY A 1 120 ? 28.477 -48.558 92.031  1.00 19.34 ? 120  GLY A C     1 
ATOM   816  O O     . GLY A 1 120 ? 27.374 -48.070 91.819  1.00 19.63 ? 120  GLY A O     1 
ATOM   817  N N     . SER A 1 121 ? 28.646 -49.604 92.818  1.00 20.09 ? 121  SER A N     1 
ATOM   818  C CA    . SER A 1 121 ? 27.507 -50.177 93.508  1.00 22.04 ? 121  SER A CA    1 
ATOM   819  C C     . SER A 1 121 ? 27.933 -50.585 94.900  1.00 23.66 ? 121  SER A C     1 
ATOM   820  O O     . SER A 1 121 ? 29.121 -50.805 95.137  1.00 25.33 ? 121  SER A O     1 
ATOM   821  C CB    . SER A 1 121 ? 27.010 -51.413 92.766  1.00 21.46 ? 121  SER A CB    1 
ATOM   822  O OG    . SER A 1 121 ? 27.936 -52.479 92.891  1.00 22.46 ? 121  SER A OG    1 
ATOM   823  N N     . CYS A 1 122 ? 26.985 -50.673 95.826  1.00 24.71 ? 122  CYS A N     1 
ATOM   824  C CA    . CYS A 1 122 ? 27.307 -51.129 97.171  1.00 26.67 ? 122  CYS A CA    1 
ATOM   825  C C     . CYS A 1 122 ? 26.095 -51.728 97.853  1.00 26.57 ? 122  CYS A C     1 
ATOM   826  O O     . CYS A 1 122 ? 25.002 -51.729 97.296  1.00 27.72 ? 122  CYS A O     1 
ATOM   827  C CB    . CYS A 1 122 ? 27.927 -50.025 98.009  1.00 27.56 ? 122  CYS A CB    1 
ATOM   828  S SG    . CYS A 1 122 ? 26.864 -48.684 98.214  1.00 33.06 ? 122  CYS A SG    1 
ATOM   829  N N     . ASP A 1 123 ? 26.287 -52.211 99.070  1.00 27.90 ? 123  ASP A N     1 
ATOM   830  C CA    . ASP A 1 123 ? 25.232 -52.866 99.821  1.00 28.60 ? 123  ASP A CA    1 
ATOM   831  C C     . ASP A 1 123 ? 25.270 -52.382 101.276 1.00 28.79 ? 123  ASP A C     1 
ATOM   832  O O     . ASP A 1 123 ? 26.253 -52.604 101.972 1.00 29.83 ? 123  ASP A O     1 
ATOM   833  C CB    . ASP A 1 123 ? 25.484 -54.383 99.723  1.00 29.09 ? 123  ASP A CB    1 
ATOM   834  C CG    . ASP A 1 123 ? 24.385 -55.230 100.350 1.00 31.43 ? 123  ASP A CG    1 
ATOM   835  O OD1   . ASP A 1 123 ? 23.285 -54.719 100.669 1.00 32.55 ? 123  ASP A OD1   1 
ATOM   836  O OD2   . ASP A 1 123 ? 24.634 -56.445 100.504 1.00 32.92 ? 123  ASP A OD2   1 
ATOM   837  N N     . VAL A 1 124 ? 24.230 -51.672 101.715 1.00 28.33 ? 124  VAL A N     1 
ATOM   838  C CA    . VAL A 1 124 ? 24.184 -51.196 103.093 1.00 28.35 ? 124  VAL A CA    1 
ATOM   839  C C     . VAL A 1 124 ? 23.781 -52.329 104.013 1.00 29.07 ? 124  VAL A C     1 
ATOM   840  O O     . VAL A 1 124 ? 23.911 -52.236 105.231 1.00 29.57 ? 124  VAL A O     1 
ATOM   841  C CB    . VAL A 1 124 ? 23.257 -49.989 103.286 1.00 27.96 ? 124  VAL A CB    1 
ATOM   842  C CG1   . VAL A 1 124 ? 23.830 -48.790 102.547 1.00 27.86 ? 124  VAL A CG1   1 
ATOM   843  C CG2   . VAL A 1 124 ? 21.840 -50.304 102.840 1.00 24.16 ? 124  VAL A CG2   1 
ATOM   844  N N     . LYS A 1 125 ? 23.271 -53.395 103.413 1.00 30.27 ? 125  LYS A N     1 
ATOM   845  C CA    . LYS A 1 125 ? 22.890 -54.601 104.138 1.00 30.50 ? 125  LYS A CA    1 
ATOM   846  C C     . LYS A 1 125 ? 21.708 -54.541 105.106 1.00 29.69 ? 125  LYS A C     1 
ATOM   847  O O     . LYS A 1 125 ? 21.717 -55.201 106.143 1.00 30.38 ? 125  LYS A O     1 
ATOM   848  C CB    . LYS A 1 125 ? 24.118 -55.182 104.835 1.00 33.17 ? 125  LYS A CB    1 
ATOM   849  C CG    . LYS A 1 125 ? 25.212 -55.599 103.887 1.00 35.79 ? 125  LYS A CG    1 
ATOM   850  C CD    . LYS A 1 125 ? 26.420 -56.036 104.662 1.00 40.44 ? 125  LYS A CD    1 
ATOM   851  C CE    . LYS A 1 125 ? 27.463 -56.643 103.752 1.00 43.77 ? 125  LYS A CE    1 
ATOM   852  N NZ    . LYS A 1 125 ? 28.586 -57.214 104.561 1.00 48.08 ? 125  LYS A NZ    1 
ATOM   853  N N     . PHE A 1 126 ? 20.705 -53.741 104.773 1.00 27.44 ? 126  PHE A N     1 
ATOM   854  C CA    . PHE A 1 126 ? 19.496 -53.641 105.570 1.00 24.31 ? 126  PHE A CA    1 
ATOM   855  C C     . PHE A 1 126 ? 18.434 -53.170 104.604 1.00 23.95 ? 126  PHE A C     1 
ATOM   856  O O     . PHE A 1 126 ? 18.762 -52.501 103.621 1.00 25.19 ? 126  PHE A O     1 
ATOM   857  C CB    . PHE A 1 126 ? 19.651 -52.696 106.779 1.00 21.43 ? 126  PHE A CB    1 
ATOM   858  C CG    . PHE A 1 126 ? 20.046 -51.273 106.442 1.00 20.88 ? 126  PHE A CG    1 
ATOM   859  C CD1   . PHE A 1 126 ? 19.147 -50.394 105.842 1.00 21.47 ? 126  PHE A CD1   1 
ATOM   860  C CD2   . PHE A 1 126 ? 21.288 -50.783 106.824 1.00 20.94 ? 126  PHE A CD2   1 
ATOM   861  C CE1   . PHE A 1 126 ? 19.478 -49.051 105.639 1.00 21.86 ? 126  PHE A CE1   1 
ATOM   862  C CE2   . PHE A 1 126 ? 21.630 -49.437 106.625 1.00 20.90 ? 126  PHE A CE2   1 
ATOM   863  C CZ    . PHE A 1 126 ? 20.721 -48.572 106.034 1.00 20.73 ? 126  PHE A CZ    1 
ATOM   864  N N     . PRO A 1 127 ? 17.182 -53.621 104.788 1.00 22.68 ? 127  PRO A N     1 
ATOM   865  C CA    . PRO A 1 127 ? 16.016 -53.284 103.965 1.00 22.03 ? 127  PRO A CA    1 
ATOM   866  C C     . PRO A 1 127 ? 15.696 -51.794 104.000 1.00 21.64 ? 127  PRO A C     1 
ATOM   867  O O     . PRO A 1 127 ? 15.905 -51.141 105.017 1.00 22.14 ? 127  PRO A O     1 
ATOM   868  C CB    . PRO A 1 127 ? 14.904 -54.098 104.618 1.00 21.57 ? 127  PRO A CB    1 
ATOM   869  C CG    . PRO A 1 127 ? 15.627 -55.278 105.124 1.00 21.94 ? 127  PRO A CG    1 
ATOM   870  C CD    . PRO A 1 127 ? 16.826 -54.657 105.767 1.00 21.72 ? 127  PRO A CD    1 
ATOM   871  N N     . ILE A 1 128 ? 15.151 -51.272 102.904 1.00 21.57 ? 128  ILE A N     1 
ATOM   872  C CA    . ILE A 1 128 ? 14.822 -49.854 102.806 1.00 21.03 ? 128  ILE A CA    1 
ATOM   873  C C     . ILE A 1 128 ? 13.352 -49.691 102.464 1.00 21.20 ? 128  ILE A C     1 
ATOM   874  O O     . ILE A 1 128 ? 12.813 -50.451 101.670 1.00 21.67 ? 128  ILE A O     1 
ATOM   875  C CB    . ILE A 1 128 ? 15.617 -49.160 101.677 1.00 19.79 ? 128  ILE A CB    1 
ATOM   876  C CG1   . ILE A 1 128 ? 17.117 -49.437 101.802 1.00 19.31 ? 128  ILE A CG1   1 
ATOM   877  C CG2   . ILE A 1 128 ? 15.353 -47.659 101.687 1.00 20.38 ? 128  ILE A CG2   1 
ATOM   878  C CD1   . ILE A 1 128 ? 17.748 -48.857 103.013 1.00 19.88 ? 128  ILE A CD1   1 
ATOM   879  N N     . ARG A 1 129 ? 12.706 -48.710 103.077 1.00 21.24 ? 129  ARG A N     1 
ATOM   880  C CA    . ARG A 1 129 ? 11.308 -48.418 102.813 1.00 22.50 ? 129  ARG A CA    1 
ATOM   881  C C     . ARG A 1 129 ? 11.362 -47.378 101.721 1.00 23.18 ? 129  ARG A C     1 
ATOM   882  O O     . ARG A 1 129 ? 11.505 -46.192 101.999 1.00 25.02 ? 129  ARG A O     1 
ATOM   883  C CB    . ARG A 1 129 ? 10.618 -47.838 104.052 1.00 22.37 ? 129  ARG A CB    1 
ATOM   884  C CG    . ARG A 1 129 ? 10.281 -48.892 105.084 1.00 25.02 ? 129  ARG A CG    1 
ATOM   885  C CD    . ARG A 1 129 ? 9.541  -48.333 106.280 1.00 25.96 ? 129  ARG A CD    1 
ATOM   886  N NE    . ARG A 1 129 ? 10.448 -47.626 107.165 1.00 28.66 ? 129  ARG A NE    1 
ATOM   887  C CZ    . ARG A 1 129 ? 10.350 -46.334 107.436 1.00 28.78 ? 129  ARG A CZ    1 
ATOM   888  N NH1   . ARG A 1 129 ? 9.370  -45.619 106.896 1.00 27.56 ? 129  ARG A NH1   1 
ATOM   889  N NH2   . ARG A 1 129 ? 11.276 -45.753 108.185 1.00 28.67 ? 129  ARG A NH2   1 
ATOM   890  N N     . LEU A 1 130 ? 11.277 -47.832 100.475 1.00 24.11 ? 130  LEU A N     1 
ATOM   891  C CA    . LEU A 1 130 ? 11.351 -46.954 99.316  1.00 23.57 ? 130  LEU A CA    1 
ATOM   892  C C     . LEU A 1 130 ? 10.230 -45.929 99.189  1.00 24.18 ? 130  LEU A C     1 
ATOM   893  O O     . LEU A 1 130 ? 10.453 -44.813 98.730  1.00 22.79 ? 130  LEU A O     1 
ATOM   894  C CB    . LEU A 1 130 ? 11.428 -47.794 98.041  1.00 23.49 ? 130  LEU A CB    1 
ATOM   895  C CG    . LEU A 1 130 ? 12.604 -48.776 97.899  1.00 24.13 ? 130  LEU A CG    1 
ATOM   896  C CD1   . LEU A 1 130 ? 12.580 -49.342 96.487  1.00 22.71 ? 130  LEU A CD1   1 
ATOM   897  C CD2   . LEU A 1 130 ? 13.948 -48.080 98.161  1.00 22.34 ? 130  LEU A CD2   1 
ATOM   898  N N     . GLU A 1 131 ? 9.026  -46.288 99.604  1.00 26.15 ? 131  GLU A N     1 
ATOM   899  C CA    . GLU A 1 131 ? 7.917  -45.361 99.470  1.00 28.66 ? 131  GLU A CA    1 
ATOM   900  C C     . GLU A 1 131 ? 8.064  -44.173 100.400 1.00 27.96 ? 131  GLU A C     1 
ATOM   901  O O     . GLU A 1 131 ? 7.891  -43.036 99.991  1.00 28.54 ? 131  GLU A O     1 
ATOM   902  C CB    . GLU A 1 131 ? 6.578  -46.068 99.698  1.00 32.70 ? 131  GLU A CB    1 
ATOM   903  C CG    . GLU A 1 131 ? 5.394  -45.321 99.082  1.00 39.06 ? 131  GLU A CG    1 
ATOM   904  C CD    . GLU A 1 131 ? 4.057  -45.987 99.357  1.00 44.18 ? 131  GLU A CD    1 
ATOM   905  O OE1   . GLU A 1 131 ? 3.991  -47.242 99.361  1.00 48.45 ? 131  GLU A OE1   1 
ATOM   906  O OE2   . GLU A 1 131 ? 3.061  -45.256 99.570  1.00 47.27 ? 131  GLU A OE2   1 
ATOM   907  N N     . GLY A 1 132 ? 8.417  -44.436 101.648 1.00 28.13 ? 132  GLY A N     1 
ATOM   908  C CA    . GLY A 1 132 ? 8.579  -43.359 102.603 1.00 27.70 ? 132  GLY A CA    1 
ATOM   909  C C     . GLY A 1 132 ? 9.704  -42.442 102.205 1.00 28.15 ? 132  GLY A C     1 
ATOM   910  O O     . GLY A 1 132 ? 9.579  -41.211 102.271 1.00 28.96 ? 132  GLY A O     1 
ATOM   911  N N     . LEU A 1 133 ? 10.820 -43.036 101.807 1.00 27.92 ? 133  LEU A N     1 
ATOM   912  C CA    . LEU A 1 133 ? 11.968 -42.247 101.383 1.00 29.15 ? 133  LEU A CA    1 
ATOM   913  C C     . LEU A 1 133 ? 11.611 -41.367 100.180 1.00 29.29 ? 133  LEU A C     1 
ATOM   914  O O     . LEU A 1 133 ? 11.893 -40.166 100.182 1.00 29.20 ? 133  LEU A O     1 
ATOM   915  C CB    . LEU A 1 133 ? 13.153 -43.176 101.088 1.00 29.31 ? 133  LEU A CB    1 
ATOM   916  C CG    . LEU A 1 133 ? 14.406 -42.819 100.282 1.00 28.43 ? 133  LEU A CG    1 
ATOM   917  C CD1   . LEU A 1 133 ? 14.856 -41.395 100.446 1.00 28.00 ? 133  LEU A CD1   1 
ATOM   918  C CD2   . LEU A 1 133 ? 15.490 -43.786 100.727 1.00 29.31 ? 133  LEU A CD2   1 
ATOM   919  N N     . ALA A 1 134 ? 10.928 -41.951 99.198  1.00 29.21 ? 134  ALA A N     1 
ATOM   920  C CA    . ALA A 1 134 ? 10.527 -41.231 97.992  1.00 29.24 ? 134  ALA A CA    1 
ATOM   921  C C     . ALA A 1 134 ? 9.667  -40.050 98.352  1.00 29.17 ? 134  ALA A C     1 
ATOM   922  O O     . ALA A 1 134 ? 9.899  -38.940 97.897  1.00 29.33 ? 134  ALA A O     1 
ATOM   923  C CB    . ALA A 1 134 ? 9.764  -42.157 97.057  1.00 28.29 ? 134  ALA A CB    1 
ATOM   924  N N     . TYR A 1 135 ? 8.696  -40.306 99.214  1.00 31.42 ? 135  TYR A N     1 
ATOM   925  C CA    . TYR A 1 135 ? 7.746  -39.301 99.673  1.00 34.86 ? 135  TYR A CA    1 
ATOM   926  C C     . TYR A 1 135 ? 8.427  -38.150 100.414 1.00 33.97 ? 135  TYR A C     1 
ATOM   927  O O     . TYR A 1 135 ? 8.148  -36.986 100.150 1.00 35.01 ? 135  TYR A O     1 
ATOM   928  C CB    . TYR A 1 135 ? 6.686  -39.985 100.544 1.00 38.00 ? 135  TYR A CB    1 
ATOM   929  C CG    . TYR A 1 135 ? 5.610  -39.084 101.094 1.00 42.47 ? 135  TYR A CG    1 
ATOM   930  C CD1   . TYR A 1 135 ? 4.919  -38.198 100.272 1.00 45.29 ? 135  TYR A CD1   1 
ATOM   931  C CD2   . TYR A 1 135 ? 5.268  -39.133 102.444 1.00 43.63 ? 135  TYR A CD2   1 
ATOM   932  C CE1   . TYR A 1 135 ? 3.907  -37.378 100.791 1.00 47.40 ? 135  TYR A CE1   1 
ATOM   933  C CE2   . TYR A 1 135 ? 4.266  -38.328 102.969 1.00 44.99 ? 135  TYR A CE2   1 
ATOM   934  C CZ    . TYR A 1 135 ? 3.590  -37.452 102.146 1.00 46.67 ? 135  TYR A CZ    1 
ATOM   935  O OH    . TYR A 1 135 ? 2.607  -36.640 102.680 1.00 48.52 ? 135  TYR A OH    1 
ATOM   936  N N     . SER A 1 136 ? 9.355  -38.477 101.302 1.00 33.51 ? 136  SER A N     1 
ATOM   937  C CA    . SER A 1 136 ? 10.074 -37.464 102.062 1.00 32.76 ? 136  SER A CA    1 
ATOM   938  C C     . SER A 1 136 ? 11.080 -36.685 101.211 1.00 32.92 ? 136  SER A C     1 
ATOM   939  O O     . SER A 1 136 ? 11.615 -35.663 101.662 1.00 31.83 ? 136  SER A O     1 
ATOM   940  C CB    . SER A 1 136 ? 10.819 -38.126 103.210 1.00 33.65 ? 136  SER A CB    1 
ATOM   941  O OG    . SER A 1 136 ? 11.795 -39.019 102.701 1.00 35.85 ? 136  SER A OG    1 
ATOM   942  N N     . HIS A 1 137 ? 11.407 -37.226 100.032 1.00 33.14 ? 137  HIS A N     1 
ATOM   943  C CA    . HIS A 1 137 ? 12.365 -36.614 99.091  1.00 32.40 ? 137  HIS A CA    1 
ATOM   944  C C     . HIS A 1 137 ? 11.786 -36.540 97.683  1.00 33.27 ? 137  HIS A C     1 
ATOM   945  O O     . HIS A 1 137 ? 12.427 -36.953 96.712  1.00 34.08 ? 137  HIS A O     1 
ATOM   946  C CB    . HIS A 1 137 ? 13.673 -37.408 99.055  1.00 29.72 ? 137  HIS A CB    1 
ATOM   947  C CG    . HIS A 1 137 ? 14.423 -37.373 100.345 1.00 28.76 ? 137  HIS A CG    1 
ATOM   948  N ND1   . HIS A 1 137 ? 15.539 -36.589 100.535 1.00 27.94 ? 137  HIS A ND1   1 
ATOM   949  C CD2   . HIS A 1 137 ? 14.176 -37.973 101.533 1.00 27.53 ? 137  HIS A CD2   1 
ATOM   950  C CE1   . HIS A 1 137 ? 15.944 -36.700 101.787 1.00 26.97 ? 137  HIS A CE1   1 
ATOM   951  N NE2   . HIS A 1 137 ? 15.133 -37.533 102.414 1.00 28.44 ? 137  HIS A NE2   1 
ATOM   952  N N     . ALA A 1 138 ? 10.585 -35.984 97.583  1.00 33.20 ? 138  ALA A N     1 
ATOM   953  C CA    . ALA A 1 138 ? 9.889  -35.853 96.320  1.00 33.40 ? 138  ALA A CA    1 
ATOM   954  C C     . ALA A 1 138 ? 10.666 -35.049 95.289  1.00 33.47 ? 138  ALA A C     1 
ATOM   955  O O     . ALA A 1 138 ? 10.640 -35.359 94.101  1.00 35.02 ? 138  ALA A O     1 
ATOM   956  C CB    . ALA A 1 138 ? 8.545  -35.223 96.557  1.00 33.78 ? 138  ALA A CB    1 
ATOM   957  N N     . ALA A 1 139 ? 11.374 -34.026 95.742  1.00 33.21 ? 139  ALA A N     1 
ATOM   958  C CA    . ALA A 1 139 ? 12.137 -33.189 94.833  1.00 32.81 ? 139  ALA A CA    1 
ATOM   959  C C     . ALA A 1 139 ? 13.216 -33.944 94.075  1.00 32.61 ? 139  ALA A C     1 
ATOM   960  O O     . ALA A 1 139 ? 13.618 -33.519 92.995  1.00 33.46 ? 139  ALA A O     1 
ATOM   961  C CB    . ALA A 1 139 ? 12.756 -32.030 95.582  1.00 34.05 ? 139  ALA A CB    1 
ATOM   962  N N     . PHE A 1 140 ? 13.690 -35.053 94.636  1.00 32.06 ? 140  PHE A N     1 
ATOM   963  C CA    . PHE A 1 140 ? 14.751 -35.839 93.996  1.00 32.15 ? 140  PHE A CA    1 
ATOM   964  C C     . PHE A 1 140 ? 14.342 -37.251 93.606  1.00 30.33 ? 140  PHE A C     1 
ATOM   965  O O     . PHE A 1 140 ? 15.044 -37.902 92.836  1.00 29.77 ? 140  PHE A O     1 
ATOM   966  C CB    . PHE A 1 140 ? 15.957 -36.006 94.937  1.00 33.79 ? 140  PHE A CB    1 
ATOM   967  C CG    . PHE A 1 140 ? 16.318 -34.774 95.709  1.00 36.30 ? 140  PHE A CG    1 
ATOM   968  C CD1   . PHE A 1 140 ? 17.179 -33.826 95.165  1.00 36.43 ? 140  PHE A CD1   1 
ATOM   969  C CD2   . PHE A 1 140 ? 15.811 -34.574 96.990  1.00 36.95 ? 140  PHE A CD2   1 
ATOM   970  C CE1   . PHE A 1 140 ? 17.530 -32.698 95.882  1.00 36.89 ? 140  PHE A CE1   1 
ATOM   971  C CE2   . PHE A 1 140 ? 16.156 -33.450 97.719  1.00 37.31 ? 140  PHE A CE2   1 
ATOM   972  C CZ    . PHE A 1 140 ? 17.017 -32.507 97.168  1.00 36.85 ? 140  PHE A CZ    1 
ATOM   973  N N     . SER A 1 141 ? 13.220 -37.724 94.130  1.00 28.19 ? 141  SER A N     1 
ATOM   974  C CA    . SER A 1 141 ? 12.825 -39.095 93.895  1.00 28.21 ? 141  SER A CA    1 
ATOM   975  C C     . SER A 1 141 ? 11.806 -39.414 92.829  1.00 28.16 ? 141  SER A C     1 
ATOM   976  O O     . SER A 1 141 ? 10.881 -38.639 92.584  1.00 29.93 ? 141  SER A O     1 
ATOM   977  C CB    . SER A 1 141 ? 12.348 -39.718 95.211  1.00 28.89 ? 141  SER A CB    1 
ATOM   978  O OG    . SER A 1 141 ? 13.291 -39.547 96.257  1.00 30.52 ? 141  SER A OG    1 
ATOM   979  N N     . SER A 1 142 ? 11.988 -40.587 92.220  1.00 25.83 ? 142  SER A N     1 
ATOM   980  C CA    . SER A 1 142 ? 11.073 -41.131 91.230  1.00 24.35 ? 142  SER A CA    1 
ATOM   981  C C     . SER A 1 142 ? 10.896 -42.588 91.612  1.00 22.97 ? 142  SER A C     1 
ATOM   982  O O     . SER A 1 142 ? 11.826 -43.376 91.534  1.00 24.02 ? 142  SER A O     1 
ATOM   983  C CB    . SER A 1 142 ? 11.624 -41.036 89.808  1.00 23.98 ? 142  SER A CB    1 
ATOM   984  O OG    . SER A 1 142 ? 11.624 -39.704 89.358  1.00 26.67 ? 142  SER A OG    1 
ATOM   985  N N     . TYR A 1 143 ? 9.716  -42.937 92.084  1.00 22.49 ? 143  TYR A N     1 
ATOM   986  C CA    . TYR A 1 143 ? 9.452  -44.306 92.470  1.00 22.90 ? 143  TYR A CA    1 
ATOM   987  C C     . TYR A 1 143 ? 8.143  -44.805 91.850  1.00 25.42 ? 143  TYR A C     1 
ATOM   988  O O     . TYR A 1 143 ? 7.044  -44.422 92.254  1.00 25.55 ? 143  TYR A O     1 
ATOM   989  C CB    . TYR A 1 143 ? 9.418  -44.419 93.986  1.00 21.06 ? 143  TYR A CB    1 
ATOM   990  C CG    . TYR A 1 143 ? 9.274  -45.820 94.452  1.00 18.95 ? 143  TYR A CG    1 
ATOM   991  C CD1   . TYR A 1 143 ? 10.062 -46.826 93.918  1.00 18.62 ? 143  TYR A CD1   1 
ATOM   992  C CD2   . TYR A 1 143 ? 8.326  -46.153 95.407  1.00 19.46 ? 143  TYR A CD2   1 
ATOM   993  C CE1   . TYR A 1 143 ? 9.909  -48.138 94.327  1.00 19.91 ? 143  TYR A CE1   1 
ATOM   994  C CE2   . TYR A 1 143 ? 8.161  -47.454 95.824  1.00 18.64 ? 143  TYR A CE2   1 
ATOM   995  C CZ    . TYR A 1 143 ? 8.957  -48.445 95.282  1.00 20.46 ? 143  TYR A CZ    1 
ATOM   996  O OH    . TYR A 1 143 ? 8.813  -49.734 95.719  1.00 20.69 ? 143  TYR A OH    1 
ATOM   997  N N     . GLU A 1 144 ? 8.288  -45.634 90.829  1.00 27.07 ? 144  GLU A N     1 
ATOM   998  C CA    . GLU A 1 144 ? 7.179  -46.214 90.103  1.00 28.02 ? 144  GLU A CA    1 
ATOM   999  C C     . GLU A 1 144 ? 7.612  -47.660 89.953  1.00 27.61 ? 144  GLU A C     1 
ATOM   1000 O O     . GLU A 1 144 ? 8.106  -48.068 88.904  1.00 28.83 ? 144  GLU A O     1 
ATOM   1001 C CB    . GLU A 1 144 ? 7.060  -45.500 88.762  1.00 30.59 ? 144  GLU A CB    1 
ATOM   1002 C CG    . GLU A 1 144 ? 6.584  -44.068 88.958  1.00 37.80 ? 144  GLU A CG    1 
ATOM   1003 C CD    . GLU A 1 144 ? 6.719  -43.188 87.731  1.00 43.88 ? 144  GLU A CD    1 
ATOM   1004 O OE1   . GLU A 1 144 ? 7.175  -43.678 86.669  1.00 48.02 ? 144  GLU A OE1   1 
ATOM   1005 O OE2   . GLU A 1 144 ? 6.360  -41.990 87.834  1.00 46.46 ? 144  GLU A OE2   1 
ATOM   1006 N N     . PRO A 1 145 ? 7.411  -48.464 91.010  1.00 26.49 ? 145  PRO A N     1 
ATOM   1007 C CA    . PRO A 1 145 ? 7.775  -49.874 91.072  1.00 26.56 ? 145  PRO A CA    1 
ATOM   1008 C C     . PRO A 1 145 ? 7.283  -50.765 89.957  1.00 27.70 ? 145  PRO A C     1 
ATOM   1009 O O     . PRO A 1 145 ? 7.923  -51.766 89.658  1.00 29.84 ? 145  PRO A O     1 
ATOM   1010 C CB    . PRO A 1 145 ? 7.237  -50.307 92.432  1.00 25.60 ? 145  PRO A CB    1 
ATOM   1011 C CG    . PRO A 1 145 ? 6.060  -49.435 92.617  1.00 25.20 ? 145  PRO A CG    1 
ATOM   1012 C CD    . PRO A 1 145 ? 6.582  -48.103 92.174  1.00 26.40 ? 145  PRO A CD    1 
ATOM   1013 N N     . GLU A 1 146 ? 6.176  -50.408 89.320  1.00 28.07 ? 146  GLU A N     1 
ATOM   1014 C CA    . GLU A 1 146 ? 5.640  -51.237 88.246  1.00 28.62 ? 146  GLU A CA    1 
ATOM   1015 C C     . GLU A 1 146 ? 6.449  -51.100 86.976  1.00 26.87 ? 146  GLU A C     1 
ATOM   1016 O O     . GLU A 1 146 ? 6.408  -51.968 86.108  1.00 26.53 ? 146  GLU A O     1 
ATOM   1017 C CB    . GLU A 1 146 ? 4.172  -50.910 87.996  1.00 31.13 ? 146  GLU A CB    1 
ATOM   1018 C CG    . GLU A 1 146 ? 3.290  -51.292 89.164  1.00 35.13 ? 146  GLU A CG    1 
ATOM   1019 C CD    . GLU A 1 146 ? 2.021  -50.465 89.221  1.00 38.52 ? 146  GLU A CD    1 
ATOM   1020 O OE1   . GLU A 1 146 ? 2.026  -49.336 88.681  1.00 40.48 ? 146  GLU A OE1   1 
ATOM   1021 O OE2   . GLU A 1 146 ? 1.020  -50.934 89.812  1.00 40.26 ? 146  GLU A OE2   1 
ATOM   1022 N N     . LEU A 1 147 ? 7.149  -49.984 86.854  1.00 26.28 ? 147  LEU A N     1 
ATOM   1023 C CA    . LEU A 1 147 ? 7.998  -49.738 85.703  1.00 26.35 ? 147  LEU A CA    1 
ATOM   1024 C C     . LEU A 1 147 ? 9.403  -50.258 86.058  1.00 25.35 ? 147  LEU A C     1 
ATOM   1025 O O     . LEU A 1 147 ? 9.996  -51.072 85.337  1.00 25.27 ? 147  LEU A O     1 
ATOM   1026 C CB    . LEU A 1 147 ? 8.029  -48.236 85.387  1.00 25.99 ? 147  LEU A CB    1 
ATOM   1027 C CG    . LEU A 1 147 ? 9.055  -47.780 84.340  1.00 27.02 ? 147  LEU A CG    1 
ATOM   1028 C CD1   . LEU A 1 147 ? 8.745  -48.410 82.987  1.00 26.70 ? 147  LEU A CD1   1 
ATOM   1029 C CD2   . LEU A 1 147 ? 9.064  -46.259 84.238  1.00 24.78 ? 147  LEU A CD2   1 
ATOM   1030 N N     . PHE A 1 148 ? 9.916  -49.792 87.192  1.00 23.57 ? 148  PHE A N     1 
ATOM   1031 C CA    . PHE A 1 148 ? 11.228 -50.191 87.668  1.00 20.86 ? 148  PHE A CA    1 
ATOM   1032 C C     . PHE A 1 148 ? 11.132 -50.265 89.189  1.00 20.06 ? 148  PHE A C     1 
ATOM   1033 O O     . PHE A 1 148 ? 10.750 -49.305 89.854  1.00 17.33 ? 148  PHE A O     1 
ATOM   1034 C CB    . PHE A 1 148 ? 12.321 -49.194 87.211  1.00 20.47 ? 148  PHE A CB    1 
ATOM   1035 C CG    . PHE A 1 148 ? 13.731 -49.718 87.393  1.00 20.03 ? 148  PHE A CG    1 
ATOM   1036 C CD1   . PHE A 1 148 ? 14.152 -50.870 86.725  1.00 19.73 ? 148  PHE A CD1   1 
ATOM   1037 C CD2   . PHE A 1 148 ? 14.588 -49.142 88.318  1.00 19.45 ? 148  PHE A CD2   1 
ATOM   1038 C CE1   . PHE A 1 148 ? 15.406 -51.453 86.988  1.00 19.67 ? 148  PHE A CE1   1 
ATOM   1039 C CE2   . PHE A 1 148 ? 15.834 -49.716 88.585  1.00 19.94 ? 148  PHE A CE2   1 
ATOM   1040 C CZ    . PHE A 1 148 ? 16.241 -50.879 87.919  1.00 18.11 ? 148  PHE A CZ    1 
ATOM   1041 N N     . PRO A 1 149 ? 11.479 -51.419 89.758  1.00 20.33 ? 149  PRO A N     1 
ATOM   1042 C CA    . PRO A 1 149 ? 11.437 -51.654 91.200  1.00 21.71 ? 149  PRO A CA    1 
ATOM   1043 C C     . PRO A 1 149 ? 12.461 -50.898 92.040  1.00 21.12 ? 149  PRO A C     1 
ATOM   1044 O O     . PRO A 1 149 ? 12.514 -51.082 93.249  1.00 22.07 ? 149  PRO A O     1 
ATOM   1045 C CB    . PRO A 1 149 ? 11.634 -53.162 91.300  1.00 22.45 ? 149  PRO A CB    1 
ATOM   1046 C CG    . PRO A 1 149 ? 12.565 -53.431 90.170  1.00 25.54 ? 149  PRO A CG    1 
ATOM   1047 C CD    . PRO A 1 149 ? 11.969 -52.611 89.047  1.00 23.08 ? 149  PRO A CD    1 
ATOM   1048 N N     . GLY A 1 150 ? 13.262 -50.045 91.419  1.00 21.44 ? 150  GLY A N     1 
ATOM   1049 C CA    . GLY A 1 150 ? 14.247 -49.288 92.169  1.00 20.15 ? 150  GLY A CA    1 
ATOM   1050 C C     . GLY A 1 150 ? 13.860 -47.827 92.194  1.00 20.48 ? 150  GLY A C     1 
ATOM   1051 O O     . GLY A 1 150 ? 13.302 -47.323 91.223  1.00 20.49 ? 150  GLY A O     1 
ATOM   1052 N N     . LEU A 1 151 ? 14.076 -47.165 93.324  1.00 19.96 ? 151  LEU A N     1 
ATOM   1053 C CA    . LEU A 1 151 ? 13.777 -45.744 93.445  1.00 19.05 ? 151  LEU A CA    1 
ATOM   1054 C C     . LEU A 1 151 ? 14.920 -44.994 92.763  1.00 19.24 ? 151  LEU A C     1 
ATOM   1055 O O     . LEU A 1 151 ? 16.097 -45.307 92.976  1.00 18.62 ? 151  LEU A O     1 
ATOM   1056 C CB    . LEU A 1 151 ? 13.694 -45.355 94.920  1.00 18.81 ? 151  LEU A CB    1 
ATOM   1057 C CG    . LEU A 1 151 ? 13.336 -43.942 95.383  1.00 18.60 ? 151  LEU A CG    1 
ATOM   1058 C CD1   . LEU A 1 151 ? 12.919 -44.038 96.832  1.00 18.44 ? 151  LEU A CD1   1 
ATOM   1059 C CD2   . LEU A 1 151 ? 14.503 -42.983 95.241  1.00 16.39 ? 151  LEU A CD2   1 
ATOM   1060 N N     . ILE A 1 152 ? 14.577 -44.043 91.904  1.00 18.86 ? 152  ILE A N     1 
ATOM   1061 C CA    . ILE A 1 152 ? 15.585 -43.267 91.209  1.00 18.68 ? 152  ILE A CA    1 
ATOM   1062 C C     . ILE A 1 152 ? 15.795 -41.982 91.989  1.00 19.41 ? 152  ILE A C     1 
ATOM   1063 O O     . ILE A 1 152 ? 14.905 -41.140 92.078  1.00 20.60 ? 152  ILE A O     1 
ATOM   1064 C CB    . ILE A 1 152 ? 15.140 -42.891 89.791  1.00 19.59 ? 152  ILE A CB    1 
ATOM   1065 C CG1   . ILE A 1 152 ? 14.468 -44.081 89.076  1.00 18.38 ? 152  ILE A CG1   1 
ATOM   1066 C CG2   . ILE A 1 152 ? 16.330 -42.330 89.024  1.00 21.11 ? 152  ILE A CG2   1 
ATOM   1067 C CD1   . ILE A 1 152 ? 15.310 -45.349 88.981  1.00 19.68 ? 152  ILE A CD1   1 
ATOM   1068 N N     . TYR A 1 153 ? 16.964 -41.843 92.585  1.00 19.83 ? 153  TYR A N     1 
ATOM   1069 C CA    . TYR A 1 153 ? 17.274 -40.661 93.356  1.00 19.43 ? 153  TYR A CA    1 
ATOM   1070 C C     . TYR A 1 153 ? 18.246 -39.752 92.593  1.00 20.87 ? 153  TYR A C     1 
ATOM   1071 O O     . TYR A 1 153 ? 19.436 -40.046 92.474  1.00 19.66 ? 153  TYR A O     1 
ATOM   1072 C CB    . TYR A 1 153 ? 17.857 -41.073 94.700  1.00 17.86 ? 153  TYR A CB    1 
ATOM   1073 C CG    . TYR A 1 153 ? 17.899 -39.940 95.678  1.00 18.88 ? 153  TYR A CG    1 
ATOM   1074 C CD1   . TYR A 1 153 ? 18.848 -38.923 95.554  1.00 19.36 ? 153  TYR A CD1   1 
ATOM   1075 C CD2   . TYR A 1 153 ? 16.998 -39.874 96.727  1.00 18.52 ? 153  TYR A CD2   1 
ATOM   1076 C CE1   . TYR A 1 153 ? 18.895 -37.870 96.455  1.00 19.79 ? 153  TYR A CE1   1 
ATOM   1077 C CE2   . TYR A 1 153 ? 17.039 -38.828 97.633  1.00 19.71 ? 153  TYR A CE2   1 
ATOM   1078 C CZ    . TYR A 1 153 ? 17.988 -37.833 97.490  1.00 19.79 ? 153  TYR A CZ    1 
ATOM   1079 O OH    . TYR A 1 153 ? 18.033 -36.797 98.385  1.00 22.21 ? 153  TYR A OH    1 
ATOM   1080 N N     . ARG A 1 154 ? 17.736 -38.639 92.078  1.00 22.17 ? 154  ARG A N     1 
ATOM   1081 C CA    . ARG A 1 154 ? 18.569 -37.708 91.332  1.00 22.47 ? 154  ARG A CA    1 
ATOM   1082 C C     . ARG A 1 154 ? 19.105 -36.630 92.263  1.00 22.86 ? 154  ARG A C     1 
ATOM   1083 O O     . ARG A 1 154 ? 18.415 -35.663 92.589  1.00 21.30 ? 154  ARG A O     1 
ATOM   1084 C CB    . ARG A 1 154 ? 17.792 -37.139 90.143  1.00 21.09 ? 154  ARG A CB    1 
ATOM   1085 C CG    . ARG A 1 154 ? 17.366 -38.243 89.152  1.00 22.48 ? 154  ARG A CG    1 
ATOM   1086 C CD    . ARG A 1 154 ? 16.842 -37.693 87.823  1.00 24.39 ? 154  ARG A CD    1 
ATOM   1087 N NE    . ARG A 1 154 ? 16.694 -38.724 86.787  1.00 27.67 ? 154  ARG A NE    1 
ATOM   1088 C CZ    . ARG A 1 154 ? 15.642 -39.536 86.685  1.00 29.74 ? 154  ARG A CZ    1 
ATOM   1089 N NH1   . ARG A 1 154 ? 14.644 -39.441 87.562  1.00 31.81 ? 154  ARG A NH1   1 
ATOM   1090 N NH2   . ARG A 1 154 ? 15.566 -40.422 85.697  1.00 26.93 ? 154  ARG A NH2   1 
ATOM   1091 N N     . MET A 1 155 ? 20.310 -36.885 92.770  1.00 23.93 ? 155  MET A N     1 
ATOM   1092 C CA    . MET A 1 155 ? 20.991 -35.991 93.692  1.00 25.93 ? 155  MET A CA    1 
ATOM   1093 C C     . MET A 1 155 ? 21.573 -34.787 92.938  1.00 28.23 ? 155  MET A C     1 
ATOM   1094 O O     . MET A 1 155 ? 22.069 -34.918 91.809  1.00 28.78 ? 155  MET A O     1 
ATOM   1095 C CB    . MET A 1 155 ? 22.088 -36.769 94.423  1.00 25.94 ? 155  MET A CB    1 
ATOM   1096 C CG    . MET A 1 155 ? 22.622 -36.104 95.708  1.00 25.80 ? 155  MET A CG    1 
ATOM   1097 S SD    . MET A 1 155 ? 23.846 -37.115 96.590  1.00 24.43 ? 155  MET A SD    1 
ATOM   1098 C CE    . MET A 1 155 ? 22.819 -38.198 97.568  1.00 23.29 ? 155  MET A CE    1 
ATOM   1099 N N     . LYS A 1 156 ? 21.495 -33.611 93.550  1.00 29.70 ? 156  LYS A N     1 
ATOM   1100 C CA    . LYS A 1 156 ? 22.000 -32.409 92.902  1.00 31.92 ? 156  LYS A CA    1 
ATOM   1101 C C     . LYS A 1 156 ? 23.431 -32.040 93.236  1.00 31.10 ? 156  LYS A C     1 
ATOM   1102 O O     . LYS A 1 156 ? 24.128 -31.471 92.401  1.00 32.34 ? 156  LYS A O     1 
ATOM   1103 C CB    . LYS A 1 156 ? 21.055 -31.215 93.107  1.00 34.95 ? 156  LYS A CB    1 
ATOM   1104 C CG    . LYS A 1 156 ? 19.859 -31.250 92.156  1.00 39.41 ? 156  LYS A CG    1 
ATOM   1105 C CD    . LYS A 1 156 ? 20.335 -31.558 90.720  1.00 43.29 ? 156  LYS A CD    1 
ATOM   1106 C CE    . LYS A 1 156 ? 19.254 -32.248 89.867  1.00 45.79 ? 156  LYS A CE    1 
ATOM   1107 N NZ    . LYS A 1 156 ? 19.832 -33.060 88.740  1.00 45.00 ? 156  LYS A NZ    1 
ATOM   1108 N N     . VAL A 1 157 ? 23.882 -32.358 94.441  1.00 29.47 ? 157  VAL A N     1 
ATOM   1109 C CA    . VAL A 1 157 ? 25.255 -32.052 94.815  1.00 27.72 ? 157  VAL A CA    1 
ATOM   1110 C C     . VAL A 1 157 ? 25.809 -33.234 95.573  1.00 26.28 ? 157  VAL A C     1 
ATOM   1111 O O     . VAL A 1 157 ? 25.370 -33.529 96.675  1.00 27.27 ? 157  VAL A O     1 
ATOM   1112 C CB    . VAL A 1 157 ? 25.365 -30.782 95.687  1.00 28.67 ? 157  VAL A CB    1 
ATOM   1113 C CG1   . VAL A 1 157 ? 26.818 -30.477 95.982  1.00 29.17 ? 157  VAL A CG1   1 
ATOM   1114 C CG2   . VAL A 1 157 ? 24.730 -29.599 94.984  1.00 28.18 ? 157  VAL A CG2   1 
ATOM   1115 N N     . PRO A 1 158 ? 26.673 -34.017 94.924  1.00 25.44 ? 158  PRO A N     1 
ATOM   1116 C CA    . PRO A 1 158 ? 27.107 -33.805 93.536  1.00 25.52 ? 158  PRO A CA    1 
ATOM   1117 C C     . PRO A 1 158 ? 25.966 -34.254 92.614  1.00 26.19 ? 158  PRO A C     1 
ATOM   1118 O O     . PRO A 1 158 ? 25.012 -34.878 93.088  1.00 26.46 ? 158  PRO A O     1 
ATOM   1119 C CB    . PRO A 1 158 ? 28.322 -34.721 93.432  1.00 24.72 ? 158  PRO A CB    1 
ATOM   1120 C CG    . PRO A 1 158 ? 27.929 -35.884 94.305  1.00 24.62 ? 158  PRO A CG    1 
ATOM   1121 C CD    . PRO A 1 158 ? 27.289 -35.221 95.507  1.00 23.80 ? 158  PRO A CD    1 
ATOM   1122 N N     . LYS A 1 159 ? 26.011 -33.902 91.332  1.00 25.91 ? 159  LYS A N     1 
ATOM   1123 C CA    . LYS A 1 159 ? 24.946 -34.322 90.423  1.00 25.80 ? 159  LYS A CA    1 
ATOM   1124 C C     . LYS A 1 159 ? 25.158 -35.800 90.071  1.00 24.73 ? 159  LYS A C     1 
ATOM   1125 O O     . LYS A 1 159 ? 25.870 -36.144 89.121  1.00 24.21 ? 159  LYS A O     1 
ATOM   1126 C CB    . LYS A 1 159 ? 24.924 -33.457 89.160  1.00 28.24 ? 159  LYS A CB    1 
ATOM   1127 C CG    . LYS A 1 159 ? 23.527 -33.350 88.530  1.00 33.07 ? 159  LYS A CG    1 
ATOM   1128 C CD    . LYS A 1 159 ? 23.549 -32.675 87.165  1.00 36.45 ? 159  LYS A CD    1 
ATOM   1129 C CE    . LYS A 1 159 ? 24.408 -33.483 86.190  1.00 41.34 ? 159  LYS A CE    1 
ATOM   1130 N NZ    . LYS A 1 159 ? 24.303 -33.036 84.761  1.00 44.77 ? 159  LYS A NZ    1 
ATOM   1131 N N     . ILE A 1 160 ? 24.551 -36.672 90.864  1.00 23.21 ? 160  ILE A N     1 
ATOM   1132 C CA    . ILE A 1 160 ? 24.689 -38.118 90.688  1.00 22.06 ? 160  ILE A CA    1 
ATOM   1133 C C     . ILE A 1 160 ? 23.304 -38.758 90.773  1.00 21.35 ? 160  ILE A C     1 
ATOM   1134 O O     . ILE A 1 160 ? 22.396 -38.212 91.406  1.00 20.99 ? 160  ILE A O     1 
ATOM   1135 C CB    . ILE A 1 160 ? 25.598 -38.729 91.820  1.00 20.47 ? 160  ILE A CB    1 
ATOM   1136 C CG1   . ILE A 1 160 ? 27.019 -38.214 91.694  1.00 20.65 ? 160  ILE A CG1   1 
ATOM   1137 C CG2   . ILE A 1 160 ? 25.717 -40.205 91.680  1.00 19.17 ? 160  ILE A CG2   1 
ATOM   1138 C CD1   . ILE A 1 160 ? 27.708 -38.692 90.451  1.00 20.76 ? 160  ILE A CD1   1 
ATOM   1139 N N     . VAL A 1 161 ? 23.140 -39.896 90.111  1.00 18.71 ? 161  VAL A N     1 
ATOM   1140 C CA    . VAL A 1 161 ? 21.886 -40.609 90.157  1.00 18.02 ? 161  VAL A CA    1 
ATOM   1141 C C     . VAL A 1 161 ? 22.112 -41.945 90.879  1.00 18.29 ? 161  VAL A C     1 
ATOM   1142 O O     . VAL A 1 161 ? 23.025 -42.704 90.550  1.00 18.79 ? 161  VAL A O     1 
ATOM   1143 C CB    . VAL A 1 161 ? 21.324 -40.827 88.753  1.00 18.18 ? 161  VAL A CB    1 
ATOM   1144 C CG1   . VAL A 1 161 ? 20.013 -41.598 88.813  1.00 16.74 ? 161  VAL A CG1   1 
ATOM   1145 C CG2   . VAL A 1 161 ? 21.114 -39.483 88.093  1.00 16.33 ? 161  VAL A CG2   1 
ATOM   1146 N N     . LEU A 1 162 ? 21.312 -42.192 91.905  1.00 17.18 ? 162  LEU A N     1 
ATOM   1147 C CA    . LEU A 1 162 ? 21.416 -43.412 92.669  1.00 15.94 ? 162  LEU A CA    1 
ATOM   1148 C C     . LEU A 1 162 ? 20.134 -44.217 92.521  1.00 15.49 ? 162  LEU A C     1 
ATOM   1149 O O     . LEU A 1 162 ? 19.048 -43.662 92.541  1.00 14.49 ? 162  LEU A O     1 
ATOM   1150 C CB    . LEU A 1 162 ? 21.661 -43.097 94.154  1.00 15.98 ? 162  LEU A CB    1 
ATOM   1151 C CG    . LEU A 1 162 ? 22.841 -42.206 94.582  1.00 14.44 ? 162  LEU A CG    1 
ATOM   1152 C CD1   . LEU A 1 162 ? 22.474 -40.732 94.542  1.00 13.35 ? 162  LEU A CD1   1 
ATOM   1153 C CD2   . LEU A 1 162 ? 23.242 -42.595 96.001  1.00 15.00 ? 162  LEU A CD2   1 
ATOM   1154 N N     . LEU A 1 163 ? 20.284 -45.523 92.320  1.00 16.54 ? 163  LEU A N     1 
ATOM   1155 C CA    . LEU A 1 163 ? 19.173 -46.456 92.199  1.00 16.76 ? 163  LEU A CA    1 
ATOM   1156 C C     . LEU A 1 163 ? 19.157 -47.135 93.560  1.00 17.37 ? 163  LEU A C     1 
ATOM   1157 O O     . LEU A 1 163 ? 20.134 -47.783 93.936  1.00 17.85 ? 163  LEU A O     1 
ATOM   1158 C CB    . LEU A 1 163 ? 19.458 -47.503 91.127  1.00 15.75 ? 163  LEU A CB    1 
ATOM   1159 C CG    . LEU A 1 163 ? 19.927 -47.044 89.754  1.00 16.71 ? 163  LEU A CG    1 
ATOM   1160 C CD1   . LEU A 1 163 ? 20.112 -48.292 88.918  1.00 18.46 ? 163  LEU A CD1   1 
ATOM   1161 C CD2   . LEU A 1 163 ? 18.932 -46.081 89.099  1.00 16.26 ? 163  LEU A CD2   1 
ATOM   1162 N N     . ILE A 1 164 ? 18.066 -46.977 94.300  1.00 17.40 ? 164  ILE A N     1 
ATOM   1163 C CA    . ILE A 1 164 ? 17.960 -47.544 95.637  1.00 17.71 ? 164  ILE A CA    1 
ATOM   1164 C C     . ILE A 1 164 ? 16.932 -48.669 95.659  1.00 18.28 ? 164  ILE A C     1 
ATOM   1165 O O     . ILE A 1 164 ? 15.784 -48.477 95.294  1.00 19.04 ? 164  ILE A O     1 
ATOM   1166 C CB    . ILE A 1 164 ? 17.591 -46.424 96.646  1.00 17.84 ? 164  ILE A CB    1 
ATOM   1167 C CG1   . ILE A 1 164 ? 18.657 -45.332 96.608  1.00 15.54 ? 164  ILE A CG1   1 
ATOM   1168 C CG2   . ILE A 1 164 ? 17.444 -46.975 98.048  1.00 17.55 ? 164  ILE A CG2   1 
ATOM   1169 C CD1   . ILE A 1 164 ? 18.289 -44.112 97.395  1.00 16.71 ? 164  ILE A CD1   1 
ATOM   1170 N N     . PHE A 1 165 ? 17.347 -49.845 96.093  1.00 18.21 ? 165  PHE A N     1 
ATOM   1171 C CA    . PHE A 1 165 ? 16.454 -50.993 96.121  1.00 19.14 ? 165  PHE A CA    1 
ATOM   1172 C C     . PHE A 1 165 ? 16.072 -51.406 97.542  1.00 20.26 ? 165  PHE A C     1 
ATOM   1173 O O     . PHE A 1 165 ? 16.812 -51.122 98.487  1.00 19.75 ? 165  PHE A O     1 
ATOM   1174 C CB    . PHE A 1 165 ? 17.135 -52.152 95.373  1.00 18.39 ? 165  PHE A CB    1 
ATOM   1175 C CG    . PHE A 1 165 ? 17.478 -51.815 93.949  1.00 16.30 ? 165  PHE A CG    1 
ATOM   1176 C CD1   . PHE A 1 165 ? 18.658 -51.160 93.644  1.00 16.26 ? 165  PHE A CD1   1 
ATOM   1177 C CD2   . PHE A 1 165 ? 16.579 -52.067 92.931  1.00 14.89 ? 165  PHE A CD2   1 
ATOM   1178 C CE1   . PHE A 1 165 ? 18.933 -50.748 92.342  1.00 16.40 ? 165  PHE A CE1   1 
ATOM   1179 C CE2   . PHE A 1 165 ? 16.843 -51.661 91.634  1.00 16.10 ? 165  PHE A CE2   1 
ATOM   1180 C CZ    . PHE A 1 165 ? 18.023 -50.994 91.337  1.00 14.60 ? 165  PHE A CZ    1 
ATOM   1181 N N     . VAL A 1 166 ? 14.931 -52.087 97.691  1.00 21.22 ? 166  VAL A N     1 
ATOM   1182 C CA    . VAL A 1 166 ? 14.464 -52.553 99.004  1.00 22.64 ? 166  VAL A CA    1 
ATOM   1183 C C     . VAL A 1 166 ? 15.508 -53.393 99.739  1.00 22.87 ? 166  VAL A C     1 
ATOM   1184 O O     . VAL A 1 166 ? 15.618 -53.341 100.959 1.00 23.48 ? 166  VAL A O     1 
ATOM   1185 C CB    . VAL A 1 166 ? 13.185 -53.422 98.898  1.00 21.92 ? 166  VAL A CB    1 
ATOM   1186 C CG1   . VAL A 1 166 ? 12.025 -52.578 98.464  1.00 23.91 ? 166  VAL A CG1   1 
ATOM   1187 C CG2   . VAL A 1 166 ? 13.402 -54.564 97.920  1.00 21.27 ? 166  VAL A CG2   1 
ATOM   1188 N N     . SER A 1 167 ? 16.270 -54.161 98.975  1.00 23.06 ? 167  SER A N     1 
ATOM   1189 C CA    . SER A 1 167 ? 17.278 -55.033 99.524  1.00 23.52 ? 167  SER A CA    1 
ATOM   1190 C C     . SER A 1 167 ? 18.427 -54.311 100.215 1.00 24.20 ? 167  SER A C     1 
ATOM   1191 O O     . SER A 1 167 ? 19.140 -54.913 101.007 1.00 26.80 ? 167  SER A O     1 
ATOM   1192 C CB    . SER A 1 167 ? 17.832 -55.924 98.412  1.00 23.14 ? 167  SER A CB    1 
ATOM   1193 O OG    . SER A 1 167 ? 18.374 -55.141 97.358  1.00 22.74 ? 167  SER A OG    1 
ATOM   1194 N N     . GLY A 1 168 ? 18.611 -53.029 99.946  1.00 22.93 ? 168  GLY A N     1 
ATOM   1195 C CA    . GLY A 1 168 ? 19.733 -52.355 100.559 1.00 21.69 ? 168  GLY A CA    1 
ATOM   1196 C C     . GLY A 1 168 ? 20.890 -52.273 99.581  1.00 21.66 ? 168  GLY A C     1 
ATOM   1197 O O     . GLY A 1 168 ? 21.982 -51.827 99.931  1.00 21.47 ? 168  GLY A O     1 
ATOM   1198 N N     . LYS A 1 169 ? 20.682 -52.755 98.362  1.00 21.04 ? 169  LYS A N     1 
ATOM   1199 C CA    . LYS A 1 169 ? 21.712 -52.671 97.333  1.00 21.02 ? 169  LYS A CA    1 
ATOM   1200 C C     . LYS A 1 169 ? 21.537 -51.302 96.664  1.00 20.63 ? 169  LYS A C     1 
ATOM   1201 O O     . LYS A 1 169 ? 20.417 -50.878 96.416  1.00 21.55 ? 169  LYS A O     1 
ATOM   1202 C CB    . LYS A 1 169 ? 21.541 -53.788 96.320  1.00 20.94 ? 169  LYS A CB    1 
ATOM   1203 C CG    . LYS A 1 169 ? 22.558 -54.892 96.470  1.00 22.09 ? 169  LYS A CG    1 
ATOM   1204 C CD    . LYS A 1 169 ? 21.941 -56.129 97.053  1.00 24.53 ? 169  LYS A CD    1 
ATOM   1205 C CE    . LYS A 1 169 ? 22.948 -57.264 97.087  1.00 25.22 ? 169  LYS A CE    1 
ATOM   1206 N NZ    . LYS A 1 169 ? 23.535 -57.445 95.734  1.00 27.06 ? 169  LYS A NZ    1 
ATOM   1207 N N     . ILE A 1 170 ? 22.629 -50.601 96.393  1.00 20.14 ? 170  ILE A N     1 
ATOM   1208 C CA    . ILE A 1 170 ? 22.544 -49.267 95.799  1.00 18.76 ? 170  ILE A CA    1 
ATOM   1209 C C     . ILE A 1 170 ? 23.414 -49.157 94.551  1.00 18.45 ? 170  ILE A C     1 
ATOM   1210 O O     . ILE A 1 170 ? 24.515 -49.696 94.523  1.00 19.21 ? 170  ILE A O     1 
ATOM   1211 C CB    . ILE A 1 170 ? 23.057 -48.188 96.796  1.00 18.13 ? 170  ILE A CB    1 
ATOM   1212 C CG1   . ILE A 1 170 ? 22.448 -48.378 98.194  1.00 18.63 ? 170  ILE A CG1   1 
ATOM   1213 C CG2   . ILE A 1 170 ? 22.761 -46.805 96.267  1.00 18.17 ? 170  ILE A CG2   1 
ATOM   1214 C CD1   . ILE A 1 170 ? 20.924 -48.228 98.273  1.00 16.81 ? 170  ILE A CD1   1 
ATOM   1215 N N     . VAL A 1 171 ? 22.922 -48.465 93.527  1.00 17.62 ? 171  VAL A N     1 
ATOM   1216 C CA    . VAL A 1 171 ? 23.678 -48.253 92.301  1.00 17.17 ? 171  VAL A CA    1 
ATOM   1217 C C     . VAL A 1 171 ? 23.891 -46.738 92.186  1.00 17.38 ? 171  VAL A C     1 
ATOM   1218 O O     . VAL A 1 171 ? 22.952 -45.961 92.296  1.00 16.03 ? 171  VAL A O     1 
ATOM   1219 C CB    . VAL A 1 171 ? 22.947 -48.812 91.048  1.00 18.20 ? 171  VAL A CB    1 
ATOM   1220 C CG1   . VAL A 1 171 ? 23.686 -48.390 89.763  1.00 17.79 ? 171  VAL A CG1   1 
ATOM   1221 C CG2   . VAL A 1 171 ? 22.880 -50.340 91.117  1.00 17.94 ? 171  VAL A CG2   1 
ATOM   1222 N N     . ILE A 1 172 ? 25.141 -46.330 92.005  1.00 17.31 ? 172  ILE A N     1 
ATOM   1223 C CA    . ILE A 1 172 ? 25.496 -44.922 91.912  1.00 17.36 ? 172  ILE A CA    1 
ATOM   1224 C C     . ILE A 1 172 ? 26.110 -44.669 90.539  1.00 16.76 ? 172  ILE A C     1 
ATOM   1225 O O     . ILE A 1 172 ? 27.171 -45.190 90.219  1.00 14.78 ? 172  ILE A O     1 
ATOM   1226 C CB    . ILE A 1 172 ? 26.510 -44.533 93.041  1.00 17.99 ? 172  ILE A CB    1 
ATOM   1227 C CG1   . ILE A 1 172 ? 25.959 -44.932 94.424  1.00 16.29 ? 172  ILE A CG1   1 
ATOM   1228 C CG2   . ILE A 1 172 ? 26.755 -43.016 93.023  1.00 17.68 ? 172  ILE A CG2   1 
ATOM   1229 C CD1   . ILE A 1 172 ? 26.899 -45.777 95.253  1.00 15.45 ? 172  ILE A CD1   1 
ATOM   1230 N N     . THR A 1 173 ? 25.461 -43.830 89.746  1.00 17.56 ? 173  THR A N     1 
ATOM   1231 C CA    . THR A 1 173 ? 25.940 -43.561 88.406  1.00 16.85 ? 173  THR A CA    1 
ATOM   1232 C C     . THR A 1 173 ? 25.924 -42.072 87.997  1.00 17.81 ? 173  THR A C     1 
ATOM   1233 O O     . THR A 1 173 ? 25.278 -41.238 88.649  1.00 16.15 ? 173  THR A O     1 
ATOM   1234 C CB    . THR A 1 173 ? 25.161 -44.443 87.398  1.00 15.13 ? 173  THR A CB    1 
ATOM   1235 O OG1   . THR A 1 173 ? 25.743 -44.320 86.098  1.00 15.82 ? 173  THR A OG1   1 
ATOM   1236 C CG2   . THR A 1 173 ? 23.687 -44.080 87.376  1.00 12.31 ? 173  THR A CG2   1 
ATOM   1237 N N     . GLY A 1 174 ? 26.725 -41.752 86.977  1.00 18.11 ? 174  GLY A N     1 
ATOM   1238 C CA    . GLY A 1 174 ? 26.819 -40.403 86.455  1.00 18.89 ? 174  GLY A CA    1 
ATOM   1239 C C     . GLY A 1 174 ? 28.055 -39.609 86.849  1.00 21.08 ? 174  GLY A C     1 
ATOM   1240 O O     . GLY A 1 174 ? 28.181 -38.457 86.444  1.00 23.74 ? 174  GLY A O     1 
ATOM   1241 N N     . ALA A 1 175 ? 28.985 -40.211 87.586  1.00 20.88 ? 175  ALA A N     1 
ATOM   1242 C CA    . ALA A 1 175 ? 30.182 -39.506 88.052  1.00 20.16 ? 175  ALA A CA    1 
ATOM   1243 C C     . ALA A 1 175 ? 31.334 -39.511 87.077  1.00 22.01 ? 175  ALA A C     1 
ATOM   1244 O O     . ALA A 1 175 ? 31.562 -40.494 86.371  1.00 23.13 ? 175  ALA A O     1 
ATOM   1245 C CB    . ALA A 1 175 ? 30.647 -40.089 89.354  1.00 18.20 ? 175  ALA A CB    1 
ATOM   1246 N N     . LYS A 1 176 ? 32.079 -38.411 87.063  1.00 23.76 ? 176  LYS A N     1 
ATOM   1247 C CA    . LYS A 1 176 ? 33.244 -38.277 86.205  1.00 24.34 ? 176  LYS A CA    1 
ATOM   1248 C C     . LYS A 1 176 ? 34.483 -38.491 87.059  1.00 25.71 ? 176  LYS A C     1 
ATOM   1249 O O     . LYS A 1 176 ? 35.589 -38.592 86.537  1.00 26.99 ? 176  LYS A O     1 
ATOM   1250 C CB    . LYS A 1 176 ? 33.295 -36.888 85.604  1.00 24.20 ? 176  LYS A CB    1 
ATOM   1251 C CG    . LYS A 1 176 ? 32.141 -36.564 84.690  1.00 23.75 ? 176  LYS A CG    1 
ATOM   1252 C CD    . LYS A 1 176 ? 32.219 -37.399 83.453  1.00 23.26 ? 176  LYS A CD    1 
ATOM   1253 C CE    . LYS A 1 176 ? 32.096 -36.545 82.212  1.00 24.59 ? 176  LYS A CE    1 
ATOM   1254 N NZ    . LYS A 1 176 ? 30.788 -35.864 82.140  1.00 24.42 ? 176  LYS A NZ    1 
ATOM   1255 N N     . MET A 1 177 ? 34.298 -38.547 88.375  1.00 27.17 ? 177  MET A N     1 
ATOM   1256 C CA    . MET A 1 177 ? 35.402 -38.747 89.304  1.00 29.58 ? 177  MET A CA    1 
ATOM   1257 C C     . MET A 1 177 ? 34.893 -39.668 90.386  1.00 29.40 ? 177  MET A C     1 
ATOM   1258 O O     . MET A 1 177 ? 33.763 -39.506 90.849  1.00 29.32 ? 177  MET A O     1 
ATOM   1259 C CB    . MET A 1 177 ? 35.802 -37.423 89.947  1.00 34.88 ? 177  MET A CB    1 
ATOM   1260 C CG    . MET A 1 177 ? 35.579 -36.217 89.067  1.00 42.19 ? 177  MET A CG    1 
ATOM   1261 S SD    . MET A 1 177 ? 36.904 -35.044 89.255  1.00 51.07 ? 177  MET A SD    1 
ATOM   1262 C CE    . MET A 1 177 ? 38.340 -36.172 88.956  1.00 48.41 ? 177  MET A CE    1 
ATOM   1263 N N     . ARG A 1 178 ? 35.720 -40.603 90.832  1.00 28.28 ? 178  ARG A N     1 
ATOM   1264 C CA    . ARG A 1 178 ? 35.280 -41.535 91.861  1.00 29.51 ? 178  ARG A CA    1 
ATOM   1265 C C     . ARG A 1 178 ? 34.862 -40.865 93.180  1.00 29.36 ? 178  ARG A C     1 
ATOM   1266 O O     . ARG A 1 178 ? 34.076 -41.425 93.950  1.00 29.39 ? 178  ARG A O     1 
ATOM   1267 C CB    . ARG A 1 178 ? 36.334 -42.617 92.107  1.00 29.04 ? 178  ARG A CB    1 
ATOM   1268 C CG    . ARG A 1 178 ? 37.618 -42.140 92.734  1.00 26.82 ? 178  ARG A CG    1 
ATOM   1269 C CD    . ARG A 1 178 ? 38.395 -43.340 93.269  1.00 28.42 ? 178  ARG A CD    1 
ATOM   1270 N NE    . ARG A 1 178 ? 38.765 -44.285 92.220  1.00 26.94 ? 178  ARG A NE    1 
ATOM   1271 C CZ    . ARG A 1 178 ? 39.197 -45.522 92.441  1.00 27.20 ? 178  ARG A CZ    1 
ATOM   1272 N NH1   . ARG A 1 178 ? 39.315 -45.981 93.679  1.00 28.52 ? 178  ARG A NH1   1 
ATOM   1273 N NH2   . ARG A 1 178 ? 39.537 -46.300 91.422  1.00 26.29 ? 178  ARG A NH2   1 
ATOM   1274 N N     . ASP A 1 179 ? 35.373 -39.667 93.435  1.00 29.52 ? 179  ASP A N     1 
ATOM   1275 C CA    . ASP A 1 179 ? 35.028 -38.943 94.648  1.00 29.65 ? 179  ASP A CA    1 
ATOM   1276 C C     . ASP A 1 179 ? 33.587 -38.469 94.641  1.00 28.33 ? 179  ASP A C     1 
ATOM   1277 O O     . ASP A 1 179 ? 32.973 -38.347 95.689  1.00 30.15 ? 179  ASP A O     1 
ATOM   1278 C CB    . ASP A 1 179 ? 35.984 -37.778 94.878  1.00 32.12 ? 179  ASP A CB    1 
ATOM   1279 C CG    . ASP A 1 179 ? 37.312 -38.229 95.457  1.00 35.65 ? 179  ASP A CG    1 
ATOM   1280 O OD1   . ASP A 1 179 ? 37.432 -39.416 95.850  1.00 37.75 ? 179  ASP A OD1   1 
ATOM   1281 O OD2   . ASP A 1 179 ? 38.241 -37.395 95.522  1.00 38.72 ? 179  ASP A OD2   1 
ATOM   1282 N N     . GLU A 1 180 ? 33.029 -38.236 93.462  1.00 26.42 ? 180  GLU A N     1 
ATOM   1283 C CA    . GLU A 1 180 ? 31.644 -37.825 93.384  1.00 23.97 ? 180  GLU A CA    1 
ATOM   1284 C C     . GLU A 1 180 ? 30.797 -39.028 93.738  1.00 22.73 ? 180  GLU A C     1 
ATOM   1285 O O     . GLU A 1 180 ? 29.789 -38.888 94.411  1.00 22.92 ? 180  GLU A O     1 
ATOM   1286 C CB    . GLU A 1 180 ? 31.322 -37.323 92.000  1.00 24.78 ? 180  GLU A CB    1 
ATOM   1287 C CG    . GLU A 1 180 ? 32.189 -36.161 91.598  1.00 27.71 ? 180  GLU A CG    1 
ATOM   1288 C CD    . GLU A 1 180 ? 32.003 -35.780 90.152  1.00 32.27 ? 180  GLU A CD    1 
ATOM   1289 O OE1   . GLU A 1 180 ? 31.379 -36.575 89.412  1.00 33.88 ? 180  GLU A OE1   1 
ATOM   1290 O OE2   . GLU A 1 180 ? 32.487 -34.689 89.752  1.00 35.34 ? 180  GLU A OE2   1 
ATOM   1291 N N     . THR A 1 181 ? 31.257 -40.213 93.337  1.00 22.31 ? 181  THR A N     1 
ATOM   1292 C CA    . THR A 1 181 ? 30.576 -41.483 93.619  1.00 21.62 ? 181  THR A CA    1 
ATOM   1293 C C     . THR A 1 181 ? 30.528 -41.696 95.128  1.00 21.34 ? 181  THR A C     1 
ATOM   1294 O O     . THR A 1 181 ? 29.471 -41.934 95.706  1.00 20.84 ? 181  THR A O     1 
ATOM   1295 C CB    . THR A 1 181 ? 31.352 -42.689 92.997  1.00 20.68 ? 181  THR A CB    1 
ATOM   1296 O OG1   . THR A 1 181 ? 31.456 -42.514 91.578  1.00 20.68 ? 181  THR A OG1   1 
ATOM   1297 C CG2   . THR A 1 181 ? 30.646 -44.026 93.302  1.00 19.71 ? 181  THR A CG2   1 
ATOM   1298 N N     . TYR A 1 182 ? 31.687 -41.554 95.757  1.00 21.70 ? 182  TYR A N     1 
ATOM   1299 C CA    . TYR A 1 182 ? 31.844 -41.738 97.194  1.00 22.85 ? 182  TYR A CA    1 
ATOM   1300 C C     . TYR A 1 182 ? 31.045 -40.732 98.021  1.00 23.59 ? 182  TYR A C     1 
ATOM   1301 O O     . TYR A 1 182 ? 30.459 -41.088 99.050  1.00 24.82 ? 182  TYR A O     1 
ATOM   1302 C CB    . TYR A 1 182 ? 33.322 -41.645 97.549  1.00 21.70 ? 182  TYR A CB    1 
ATOM   1303 C CG    . TYR A 1 182 ? 34.195 -42.726 96.946  1.00 20.97 ? 182  TYR A CG    1 
ATOM   1304 C CD1   . TYR A 1 182 ? 33.683 -43.995 96.670  1.00 19.40 ? 182  TYR A CD1   1 
ATOM   1305 C CD2   . TYR A 1 182 ? 35.556 -42.495 96.700  1.00 21.23 ? 182  TYR A CD2   1 
ATOM   1306 C CE1   . TYR A 1 182 ? 34.504 -45.010 96.171  1.00 19.40 ? 182  TYR A CE1   1 
ATOM   1307 C CE2   . TYR A 1 182 ? 36.381 -43.507 96.201  1.00 19.99 ? 182  TYR A CE2   1 
ATOM   1308 C CZ    . TYR A 1 182 ? 35.851 -44.763 95.944  1.00 20.28 ? 182  TYR A CZ    1 
ATOM   1309 O OH    . TYR A 1 182 ? 36.676 -45.787 95.527  1.00 19.22 ? 182  TYR A OH    1 
ATOM   1310 N N     . LYS A 1 183 ? 31.018 -39.483 97.565  1.00 24.18 ? 183  LYS A N     1 
ATOM   1311 C CA    . LYS A 1 183 ? 30.283 -38.424 98.243  1.00 25.20 ? 183  LYS A CA    1 
ATOM   1312 C C     . LYS A 1 183 ? 28.774 -38.644 98.127  1.00 25.86 ? 183  LYS A C     1 
ATOM   1313 O O     . LYS A 1 183 ? 28.034 -38.396 99.079  1.00 27.84 ? 183  LYS A O     1 
ATOM   1314 C CB    . LYS A 1 183 ? 30.630 -37.065 97.645  1.00 26.92 ? 183  LYS A CB    1 
ATOM   1315 C CG    . LYS A 1 183 ? 30.162 -35.891 98.489  1.00 29.45 ? 183  LYS A CG    1 
ATOM   1316 C CD    . LYS A 1 183 ? 31.101 -35.692 99.652  1.00 34.01 ? 183  LYS A CD    1 
ATOM   1317 C CE    . LYS A 1 183 ? 30.665 -34.546 100.566 1.00 37.13 ? 183  LYS A CE    1 
ATOM   1318 N NZ    . LYS A 1 183 ? 29.599 -34.949 101.536 1.00 39.35 ? 183  LYS A NZ    1 
ATOM   1319 N N     . ALA A 1 184 ? 28.307 -39.083 96.960  1.00 24.35 ? 184  ALA A N     1 
ATOM   1320 C CA    . ALA A 1 184 ? 26.882 -39.325 96.761  1.00 23.10 ? 184  ALA A CA    1 
ATOM   1321 C C     . ALA A 1 184 ? 26.443 -40.394 97.725  1.00 22.58 ? 184  ALA A C     1 
ATOM   1322 O O     . ALA A 1 184 ? 25.396 -40.274 98.356  1.00 23.58 ? 184  ALA A O     1 
ATOM   1323 C CB    . ALA A 1 184 ? 26.602 -39.768 95.345  1.00 23.26 ? 184  ALA A CB    1 
ATOM   1324 N N     . PHE A 1 185 ? 27.255 -41.436 97.861  1.00 22.17 ? 185  PHE A N     1 
ATOM   1325 C CA    . PHE A 1 185 ? 26.921 -42.506 98.784  1.00 22.35 ? 185  PHE A CA    1 
ATOM   1326 C C     . PHE A 1 185 ? 26.881 -42.033 100.229 1.00 23.39 ? 185  PHE A C     1 
ATOM   1327 O O     . PHE A 1 185 ? 26.016 -42.445 101.004 1.00 23.71 ? 185  PHE A O     1 
ATOM   1328 C CB    . PHE A 1 185 ? 27.890 -43.662 98.696  1.00 19.69 ? 185  PHE A CB    1 
ATOM   1329 C CG    . PHE A 1 185 ? 27.558 -44.756 99.653  1.00 20.92 ? 185  PHE A CG    1 
ATOM   1330 C CD1   . PHE A 1 185 ? 26.371 -45.473 99.507  1.00 20.20 ? 185  PHE A CD1   1 
ATOM   1331 C CD2   . PHE A 1 185 ? 28.398 -45.045 100.729 1.00 20.24 ? 185  PHE A CD2   1 
ATOM   1332 C CE1   . PHE A 1 185 ? 26.018 -46.468 100.426 1.00 20.69 ? 185  PHE A CE1   1 
ATOM   1333 C CE2   . PHE A 1 185 ? 28.063 -46.037 101.655 1.00 20.28 ? 185  PHE A CE2   1 
ATOM   1334 C CZ    . PHE A 1 185 ? 26.868 -46.751 101.504 1.00 21.90 ? 185  PHE A CZ    1 
ATOM   1335 N N     . GLU A 1 186 ? 27.862 -41.225 100.608 1.00 24.54 ? 186  GLU A N     1 
ATOM   1336 C CA    . GLU A 1 186 ? 27.912 -40.714 101.967 1.00 26.00 ? 186  GLU A CA    1 
ATOM   1337 C C     . GLU A 1 186 ? 26.713 -39.796 102.262 1.00 24.41 ? 186  GLU A C     1 
ATOM   1338 O O     . GLU A 1 186 ? 26.127 -39.848 103.349 1.00 24.48 ? 186  GLU A O     1 
ATOM   1339 C CB    . GLU A 1 186 ? 29.250 -40.005 102.220 1.00 28.24 ? 186  GLU A CB    1 
ATOM   1340 C CG    . GLU A 1 186 ? 30.462 -40.941 102.211 1.00 31.07 ? 186  GLU A CG    1 
ATOM   1341 C CD    . GLU A 1 186 ? 30.420 -42.022 103.296 1.00 33.47 ? 186  GLU A CD    1 
ATOM   1342 O OE1   . GLU A 1 186 ? 29.967 -41.746 104.430 1.00 34.68 ? 186  GLU A OE1   1 
ATOM   1343 O OE2   . GLU A 1 186 ? 30.878 -43.154 103.023 1.00 34.24 ? 186  GLU A OE2   1 
ATOM   1344 N N     . ASN A 1 187 ? 26.312 -39.014 101.270 1.00 22.14 ? 187  ASN A N     1 
ATOM   1345 C CA    . ASN A 1 187 ? 25.187 -38.114 101.428 1.00 22.24 ? 187  ASN A CA    1 
ATOM   1346 C C     . ASN A 1 187 ? 23.873 -38.872 101.644 1.00 23.47 ? 187  ASN A C     1 
ATOM   1347 O O     . ASN A 1 187 ? 23.024 -38.440 102.425 1.00 24.96 ? 187  ASN A O     1 
ATOM   1348 C CB    . ASN A 1 187 ? 25.057 -37.210 100.197 1.00 20.82 ? 187  ASN A CB    1 
ATOM   1349 C CG    . ASN A 1 187 ? 26.131 -36.139 100.133 1.00 21.02 ? 187  ASN A CG    1 
ATOM   1350 O OD1   . ASN A 1 187 ? 26.890 -35.942 101.080 1.00 22.63 ? 187  ASN A OD1   1 
ATOM   1351 N ND2   . ASN A 1 187 ? 26.200 -35.438 99.011  1.00 20.82 ? 187  ASN A ND2   1 
ATOM   1352 N N     . ILE A 1 188 ? 23.709 -40.003 100.954 1.00 23.95 ? 188  ILE A N     1 
ATOM   1353 C CA    . ILE A 1 188 ? 22.480 -40.807 101.034 1.00 22.53 ? 188  ILE A CA    1 
ATOM   1354 C C     . ILE A 1 188 ? 22.402 -41.771 102.214 1.00 22.94 ? 188  ILE A C     1 
ATOM   1355 O O     . ILE A 1 188 ? 21.306 -42.141 102.643 1.00 23.33 ? 188  ILE A O     1 
ATOM   1356 C CB    . ILE A 1 188 ? 22.230 -41.598 99.702  1.00 21.40 ? 188  ILE A CB    1 
ATOM   1357 C CG1   . ILE A 1 188 ? 20.735 -41.715 99.434  1.00 20.31 ? 188  ILE A CG1   1 
ATOM   1358 C CG2   . ILE A 1 188 ? 22.883 -42.982 99.726  1.00 19.16 ? 188  ILE A CG2   1 
ATOM   1359 C CD1   . ILE A 1 188 ? 20.100 -40.409 99.081  1.00 21.48 ? 188  ILE A CD1   1 
ATOM   1360 N N     . TYR A 1 189 ? 23.555 -42.170 102.745 1.00 22.76 ? 189  TYR A N     1 
ATOM   1361 C CA    . TYR A 1 189 ? 23.599 -43.109 103.859 1.00 21.90 ? 189  TYR A CA    1 
ATOM   1362 C C     . TYR A 1 189 ? 22.686 -42.725 105.030 1.00 23.01 ? 189  TYR A C     1 
ATOM   1363 O O     . TYR A 1 189 ? 21.869 -43.538 105.487 1.00 23.55 ? 189  TYR A O     1 
ATOM   1364 C CB    . TYR A 1 189 ? 25.033 -43.324 104.338 1.00 20.24 ? 189  TYR A CB    1 
ATOM   1365 C CG    . TYR A 1 189 ? 25.149 -44.561 105.169 1.00 19.91 ? 189  TYR A CG    1 
ATOM   1366 C CD1   . TYR A 1 189 ? 24.973 -45.806 104.590 1.00 20.62 ? 189  TYR A CD1   1 
ATOM   1367 C CD2   . TYR A 1 189 ? 25.354 -44.499 106.543 1.00 20.38 ? 189  TYR A CD2   1 
ATOM   1368 C CE1   . TYR A 1 189 ? 24.983 -46.960 105.344 1.00 21.40 ? 189  TYR A CE1   1 
ATOM   1369 C CE2   . TYR A 1 189 ? 25.365 -45.663 107.316 1.00 20.46 ? 189  TYR A CE2   1 
ATOM   1370 C CZ    . TYR A 1 189 ? 25.172 -46.891 106.702 1.00 21.50 ? 189  TYR A CZ    1 
ATOM   1371 O OH    . TYR A 1 189 ? 25.129 -48.066 107.419 1.00 22.67 ? 189  TYR A OH    1 
ATOM   1372 N N     . PRO A 1 190 ? 22.791 -41.481 105.520 1.00 23.63 ? 190  PRO A N     1 
ATOM   1373 C CA    . PRO A 1 190 ? 21.936 -41.067 106.637 1.00 23.89 ? 190  PRO A CA    1 
ATOM   1374 C C     . PRO A 1 190 ? 20.471 -41.240 106.270 1.00 24.42 ? 190  PRO A C     1 
ATOM   1375 O O     . PRO A 1 190 ? 19.652 -41.655 107.100 1.00 24.22 ? 190  PRO A O     1 
ATOM   1376 C CB    . PRO A 1 190 ? 22.265 -39.586 106.776 1.00 24.17 ? 190  PRO A CB    1 
ATOM   1377 C CG    . PRO A 1 190 ? 23.677 -39.526 106.378 1.00 24.67 ? 190  PRO A CG    1 
ATOM   1378 C CD    . PRO A 1 190 ? 23.720 -40.399 105.157 1.00 23.25 ? 190  PRO A CD    1 
ATOM   1379 N N     . VAL A 1 191 ? 20.164 -40.944 105.008 1.00 23.84 ? 191  VAL A N     1 
ATOM   1380 C CA    . VAL A 1 191 ? 18.804 -41.037 104.491 1.00 23.44 ? 191  VAL A CA    1 
ATOM   1381 C C     . VAL A 1 191 ? 18.321 -42.485 104.445 1.00 23.93 ? 191  VAL A C     1 
ATOM   1382 O O     . VAL A 1 191 ? 17.210 -42.787 104.880 1.00 25.28 ? 191  VAL A O     1 
ATOM   1383 C CB    . VAL A 1 191 ? 18.698 -40.397 103.076 1.00 22.43 ? 191  VAL A CB    1 
ATOM   1384 C CG1   . VAL A 1 191 ? 17.253 -40.324 102.627 1.00 21.27 ? 191  VAL A CG1   1 
ATOM   1385 C CG2   . VAL A 1 191 ? 19.313 -39.019 103.079 1.00 21.25 ? 191  VAL A CG2   1 
ATOM   1386 N N     . LEU A 1 192 ? 19.160 -43.379 103.932 1.00 24.53 ? 192  LEU A N     1 
ATOM   1387 C CA    . LEU A 1 192 ? 18.798 -44.790 103.829 1.00 25.02 ? 192  LEU A CA    1 
ATOM   1388 C C     . LEU A 1 192 ? 18.547 -45.363 105.215 1.00 25.44 ? 192  LEU A C     1 
ATOM   1389 O O     . LEU A 1 192 ? 17.589 -46.097 105.417 1.00 25.35 ? 192  LEU A O     1 
ATOM   1390 C CB    . LEU A 1 192 ? 19.899 -45.597 103.123 1.00 23.89 ? 192  LEU A CB    1 
ATOM   1391 C CG    . LEU A 1 192 ? 20.394 -45.187 101.725 1.00 22.92 ? 192  LEU A CG    1 
ATOM   1392 C CD1   . LEU A 1 192 ? 21.540 -46.094 101.323 1.00 20.80 ? 192  LEU A CD1   1 
ATOM   1393 C CD2   . LEU A 1 192 ? 19.278 -45.255 100.699 1.00 20.85 ? 192  LEU A CD2   1 
ATOM   1394 N N     . SER A 1 193 ? 19.422 -45.037 106.164 1.00 25.84 ? 193  SER A N     1 
ATOM   1395 C CA    . SER A 1 193 ? 19.284 -45.514 107.538 1.00 26.95 ? 193  SER A CA    1 
ATOM   1396 C C     . SER A 1 193 ? 17.939 -45.082 108.131 1.00 26.81 ? 193  SER A C     1 
ATOM   1397 O O     . SER A 1 193 ? 17.245 -45.855 108.782 1.00 26.32 ? 193  SER A O     1 
ATOM   1398 C CB    . SER A 1 193 ? 20.402 -44.937 108.396 1.00 27.49 ? 193  SER A CB    1 
ATOM   1399 O OG    . SER A 1 193 ? 21.664 -45.225 107.834 1.00 30.56 ? 193  SER A OG    1 
ATOM   1400 N N     . GLU A 1 194 ? 17.593 -43.825 107.904 1.00 26.70 ? 194  GLU A N     1 
ATOM   1401 C CA    . GLU A 1 194 ? 16.356 -43.265 108.391 1.00 27.26 ? 194  GLU A CA    1 
ATOM   1402 C C     . GLU A 1 194 ? 15.129 -44.020 107.904 1.00 28.00 ? 194  GLU A C     1 
ATOM   1403 O O     . GLU A 1 194 ? 14.118 -44.080 108.607 1.00 28.78 ? 194  GLU A O     1 
ATOM   1404 C CB    . GLU A 1 194 ? 16.258 -41.826 107.949 1.00 27.25 ? 194  GLU A CB    1 
ATOM   1405 C CG    . GLU A 1 194 ? 14.985 -41.179 108.374 1.00 30.30 ? 194  GLU A CG    1 
ATOM   1406 C CD    . GLU A 1 194 ? 14.923 -39.738 107.981 1.00 31.95 ? 194  GLU A CD    1 
ATOM   1407 O OE1   . GLU A 1 194 ? 15.667 -39.327 107.067 1.00 33.01 ? 194  GLU A OE1   1 
ATOM   1408 O OE2   . GLU A 1 194 ? 14.112 -39.014 108.586 1.00 36.27 ? 194  GLU A OE2   1 
ATOM   1409 N N     . PHE A 1 195 ? 15.204 -44.566 106.692 1.00 27.27 ? 195  PHE A N     1 
ATOM   1410 C CA    . PHE A 1 195 ? 14.086 -45.306 106.120 1.00 25.36 ? 195  PHE A CA    1 
ATOM   1411 C C     . PHE A 1 195 ? 14.351 -46.774 106.066 1.00 25.43 ? 195  PHE A C     1 
ATOM   1412 O O     . PHE A 1 195 ? 13.911 -47.440 105.151 1.00 26.30 ? 195  PHE A O     1 
ATOM   1413 C CB    . PHE A 1 195 ? 13.700 -44.754 104.739 1.00 23.12 ? 195  PHE A CB    1 
ATOM   1414 C CG    . PHE A 1 195 ? 13.192 -43.349 104.807 1.00 22.75 ? 195  PHE A CG    1 
ATOM   1415 C CD1   . PHE A 1 195 ? 11.941 -43.084 105.357 1.00 22.88 ? 195  PHE A CD1   1 
ATOM   1416 C CD2   . PHE A 1 195 ? 14.018 -42.278 104.488 1.00 23.25 ? 195  PHE A CD2   1 
ATOM   1417 C CE1   . PHE A 1 195 ? 11.530 -41.779 105.603 1.00 21.68 ? 195  PHE A CE1   1 
ATOM   1418 C CE2   . PHE A 1 195 ? 13.613 -40.963 104.729 1.00 22.59 ? 195  PHE A CE2   1 
ATOM   1419 C CZ    . PHE A 1 195 ? 12.366 -40.718 105.292 1.00 22.18 ? 195  PHE A CZ    1 
ATOM   1420 N N     . ARG A 1 196 ? 15.088 -47.280 107.046 1.00 26.99 ? 196  ARG A N     1 
ATOM   1421 C CA    . ARG A 1 196 ? 15.377 -48.704 107.116 1.00 28.02 ? 196  ARG A CA    1 
ATOM   1422 C C     . ARG A 1 196 ? 14.048 -49.409 107.391 1.00 29.92 ? 196  ARG A C     1 
ATOM   1423 O O     . ARG A 1 196 ? 13.209 -48.901 108.142 1.00 30.33 ? 196  ARG A O     1 
ATOM   1424 C CB    . ARG A 1 196 ? 16.398 -48.987 108.220 1.00 27.20 ? 196  ARG A CB    1 
ATOM   1425 C CG    . ARG A 1 196 ? 16.639 -50.457 108.468 1.00 28.65 ? 196  ARG A CG    1 
ATOM   1426 C CD    . ARG A 1 196 ? 17.888 -50.735 109.311 1.00 31.95 ? 196  ARG A CD    1 
ATOM   1427 N NE    . ARG A 1 196 ? 17.851 -50.195 110.670 1.00 34.33 ? 196  ARG A NE    1 
ATOM   1428 C CZ    . ARG A 1 196 ? 17.021 -50.601 111.631 1.00 36.43 ? 196  ARG A CZ    1 
ATOM   1429 N NH1   . ARG A 1 196 ? 16.131 -51.560 111.388 1.00 37.20 ? 196  ARG A NH1   1 
ATOM   1430 N NH2   . ARG A 1 196 ? 17.096 -50.062 112.848 1.00 35.35 ? 196  ARG A NH2   1 
ATOM   1431 N N     . LYS A 1 197 ? 13.813 -50.529 106.721 1.00 31.24 ? 197  LYS A N     1 
ATOM   1432 C CA    . LYS A 1 197 ? 12.575 -51.261 106.915 1.00 33.84 ? 197  LYS A CA    1 
ATOM   1433 C C     . LYS A 1 197 ? 12.738 -52.213 108.073 1.00 36.44 ? 197  LYS A C     1 
ATOM   1434 O O     . LYS A 1 197 ? 13.613 -53.082 108.037 1.00 38.94 ? 197  LYS A O     1 
ATOM   1435 C CB    . LYS A 1 197 ? 12.199 -52.025 105.650 1.00 33.23 ? 197  LYS A CB    1 
ATOM   1436 C CG    . LYS A 1 197 ? 11.288 -53.196 105.894 1.00 34.23 ? 197  LYS A CG    1 
ATOM   1437 C CD    . LYS A 1 197 ? 10.534 -53.617 104.660 1.00 36.83 ? 197  LYS A CD    1 
ATOM   1438 C CE    . LYS A 1 197 ? 11.450 -53.846 103.480 1.00 39.18 ? 197  LYS A CE    1 
ATOM   1439 N NZ    . LYS A 1 197 ? 11.714 -52.579 102.726 1.00 40.58 ? 197  LYS A NZ    1 
ATOM   1440 N N     . ILE A 1 198 ? 11.900 -52.063 109.100 1.00 39.05 ? 198  ILE A N     1 
ATOM   1441 C CA    . ILE A 1 198 ? 11.986 -52.938 110.272 1.00 39.83 ? 198  ILE A CA    1 
ATOM   1442 C C     . ILE A 1 198 ? 10.910 -54.027 110.325 1.00 39.73 ? 198  ILE A C     1 
ATOM   1443 O O     . ILE A 1 198 ? 9.752  -53.678 110.634 1.00 40.25 ? 198  ILE A O     1 
ATOM   1444 C CB    . ILE A 1 198 ? 11.986 -52.132 111.587 1.00 40.58 ? 198  ILE A CB    1 
ATOM   1445 C CG1   . ILE A 1 198 ? 13.062 -51.042 111.541 1.00 40.64 ? 198  ILE A CG1   1 
ATOM   1446 C CG2   . ILE A 1 198 ? 12.295 -53.063 112.749 1.00 42.20 ? 198  ILE A CG2   1 
ATOM   1447 C CD1   . ILE A 1 198 ? 13.253 -50.314 112.858 1.00 41.67 ? 198  ILE A CD1   1 
ATOM   1448 N N     . VAL B 1 12  ? 30.445 -36.980 111.890 1.00 42.42 ? 12   VAL B N     1 
ATOM   1449 C CA    . VAL B 1 12  ? 29.796 -38.103 112.624 1.00 41.13 ? 12   VAL B CA    1 
ATOM   1450 C C     . VAL B 1 12  ? 30.235 -39.438 112.033 1.00 41.58 ? 12   VAL B C     1 
ATOM   1451 O O     . VAL B 1 12  ? 30.233 -39.626 110.815 1.00 42.95 ? 12   VAL B O     1 
ATOM   1452 C CB    . VAL B 1 12  ? 28.238 -37.984 112.577 1.00 40.69 ? 12   VAL B CB    1 
ATOM   1453 C CG1   . VAL B 1 12  ? 27.576 -39.280 113.038 1.00 38.53 ? 12   VAL B CG1   1 
ATOM   1454 C CG2   . VAL B 1 12  ? 27.772 -36.821 113.452 1.00 39.28 ? 12   VAL B CG2   1 
ATOM   1455 N N     . ASP B 1 13  ? 30.640 -40.357 112.902 1.00 41.52 ? 13   ASP B N     1 
ATOM   1456 C CA    . ASP B 1 13  ? 31.052 -41.682 112.468 1.00 40.24 ? 13   ASP B CA    1 
ATOM   1457 C C     . ASP B 1 13  ? 29.790 -42.442 112.094 1.00 39.44 ? 13   ASP B C     1 
ATOM   1458 O O     . ASP B 1 13  ? 29.165 -43.080 112.947 1.00 39.33 ? 13   ASP B O     1 
ATOM   1459 C CB    . ASP B 1 13  ? 31.770 -42.412 113.598 1.00 40.75 ? 13   ASP B CB    1 
ATOM   1460 C CG    . ASP B 1 13  ? 32.353 -43.731 113.160 1.00 41.49 ? 13   ASP B CG    1 
ATOM   1461 O OD1   . ASP B 1 13  ? 32.409 -43.992 111.937 1.00 43.31 ? 13   ASP B OD1   1 
ATOM   1462 O OD2   . ASP B 1 13  ? 32.769 -44.507 114.045 1.00 43.18 ? 13   ASP B OD2   1 
ATOM   1463 N N     . LEU B 1 14  ? 29.418 -42.363 110.822 1.00 38.28 ? 14   LEU B N     1 
ATOM   1464 C CA    . LEU B 1 14  ? 28.219 -43.026 110.318 1.00 37.00 ? 14   LEU B CA    1 
ATOM   1465 C C     . LEU B 1 14  ? 28.236 -44.525 110.575 1.00 36.03 ? 14   LEU B C     1 
ATOM   1466 O O     . LEU B 1 14  ? 27.197 -45.153 110.729 1.00 36.31 ? 14   LEU B O     1 
ATOM   1467 C CB    . LEU B 1 14  ? 28.035 -42.730 108.827 1.00 36.17 ? 14   LEU B CB    1 
ATOM   1468 C CG    . LEU B 1 14  ? 27.642 -41.295 108.460 1.00 34.97 ? 14   LEU B CG    1 
ATOM   1469 C CD1   . LEU B 1 14  ? 27.684 -41.120 106.947 1.00 34.94 ? 14   LEU B CD1   1 
ATOM   1470 C CD2   . LEU B 1 14  ? 26.250 -40.984 109.006 1.00 33.63 ? 14   LEU B CD2   1 
ATOM   1471 N N     . SER B 1 15  ? 29.424 -45.093 110.648 1.00 36.01 ? 15   SER B N     1 
ATOM   1472 C CA    . SER B 1 15  ? 29.558 -46.511 110.917 1.00 35.90 ? 15   SER B CA    1 
ATOM   1473 C C     . SER B 1 15  ? 28.958 -46.827 112.303 1.00 34.85 ? 15   SER B C     1 
ATOM   1474 O O     . SER B 1 15  ? 28.410 -47.906 112.518 1.00 35.09 ? 15   SER B O     1 
ATOM   1475 C CB    . SER B 1 15  ? 31.046 -46.888 110.847 1.00 37.73 ? 15   SER B CB    1 
ATOM   1476 O OG    . SER B 1 15  ? 31.243 -48.293 110.833 1.00 42.63 ? 15   SER B OG    1 
ATOM   1477 N N     . LYS B 1 16  ? 29.040 -45.868 113.224 1.00 33.69 ? 16   LYS B N     1 
ATOM   1478 C CA    . LYS B 1 16  ? 28.522 -46.023 114.586 1.00 33.67 ? 16   LYS B CA    1 
ATOM   1479 C C     . LYS B 1 16  ? 27.138 -45.422 114.720 1.00 31.94 ? 16   LYS B C     1 
ATOM   1480 O O     . LYS B 1 16  ? 26.331 -45.827 115.560 1.00 31.30 ? 16   LYS B O     1 
ATOM   1481 C CB    . LYS B 1 16  ? 29.421 -45.287 115.576 1.00 36.54 ? 16   LYS B CB    1 
ATOM   1482 C CG    . LYS B 1 16  ? 30.487 -46.126 116.238 1.00 41.52 ? 16   LYS B CG    1 
ATOM   1483 C CD    . LYS B 1 16  ? 31.329 -45.267 117.199 1.00 45.98 ? 16   LYS B CD    1 
ATOM   1484 C CE    . LYS B 1 16  ? 30.490 -44.661 118.340 1.00 47.85 ? 16   LYS B CE    1 
ATOM   1485 N NZ    . LYS B 1 16  ? 30.052 -45.676 119.360 1.00 49.57 ? 16   LYS B NZ    1 
ATOM   1486 N N     . HIS B 1 17  ? 26.901 -44.386 113.934 1.00 30.23 ? 17   HIS B N     1 
ATOM   1487 C CA    . HIS B 1 17  ? 25.642 -43.670 113.968 1.00 28.18 ? 17   HIS B CA    1 
ATOM   1488 C C     . HIS B 1 17  ? 25.116 -43.518 112.554 1.00 26.49 ? 17   HIS B C     1 
ATOM   1489 O O     . HIS B 1 17  ? 25.203 -42.438 111.970 1.00 25.81 ? 17   HIS B O     1 
ATOM   1490 C CB    . HIS B 1 17  ? 25.868 -42.286 114.592 1.00 28.71 ? 17   HIS B CB    1 
ATOM   1491 C CG    . HIS B 1 17  ? 26.709 -42.316 115.831 1.00 28.26 ? 17   HIS B CG    1 
ATOM   1492 N ND1   . HIS B 1 17  ? 26.186 -42.569 117.080 1.00 26.96 ? 17   HIS B ND1   1 
ATOM   1493 C CD2   . HIS B 1 17  ? 28.042 -42.158 116.005 1.00 28.16 ? 17   HIS B CD2   1 
ATOM   1494 C CE1   . HIS B 1 17  ? 27.160 -42.568 117.971 1.00 26.87 ? 17   HIS B CE1   1 
ATOM   1495 N NE2   . HIS B 1 17  ? 28.295 -42.321 117.343 1.00 28.52 ? 17   HIS B NE2   1 
ATOM   1496 N N     . PRO B 1 18  ? 24.530 -44.592 112.001 1.00 25.08 ? 18   PRO B N     1 
ATOM   1497 C CA    . PRO B 1 18  ? 23.968 -44.636 110.650 1.00 24.83 ? 18   PRO B CA    1 
ATOM   1498 C C     . PRO B 1 18  ? 23.073 -43.443 110.361 1.00 25.85 ? 18   PRO B C     1 
ATOM   1499 O O     . PRO B 1 18  ? 23.093 -42.894 109.268 1.00 25.15 ? 18   PRO B O     1 
ATOM   1500 C CB    . PRO B 1 18  ? 23.159 -45.926 110.672 1.00 25.58 ? 18   PRO B CB    1 
ATOM   1501 C CG    . PRO B 1 18  ? 23.937 -46.802 111.600 1.00 25.14 ? 18   PRO B CG    1 
ATOM   1502 C CD    . PRO B 1 18  ? 24.293 -45.862 112.712 1.00 25.42 ? 18   PRO B CD    1 
ATOM   1503 N N     . SER B 1 19  ? 22.291 -43.047 111.364 1.00 27.53 ? 19   SER B N     1 
ATOM   1504 C CA    . SER B 1 19  ? 21.362 -41.917 111.260 1.00 28.08 ? 19   SER B CA    1 
ATOM   1505 C C     . SER B 1 19  ? 22.080 -40.593 111.071 1.00 27.43 ? 19   SER B C     1 
ATOM   1506 O O     . SER B 1 19  ? 21.479 -39.612 110.626 1.00 28.36 ? 19   SER B O     1 
ATOM   1507 C CB    . SER B 1 19  ? 20.489 -41.824 112.520 1.00 28.17 ? 19   SER B CB    1 
ATOM   1508 O OG    . SER B 1 19  ? 21.268 -41.536 113.670 1.00 28.53 ? 19   SER B OG    1 
ATOM   1509 N N     . GLY B 1 20  ? 23.350 -40.564 111.464 1.00 27.68 ? 20   GLY B N     1 
ATOM   1510 C CA    . GLY B 1 20  ? 24.155 -39.360 111.357 1.00 26.67 ? 20   GLY B CA    1 
ATOM   1511 C C     . GLY B 1 20  ? 23.880 -38.405 112.501 1.00 26.54 ? 20   GLY B C     1 
ATOM   1512 O O     . GLY B 1 20  ? 24.332 -37.263 112.479 1.00 28.01 ? 20   GLY B O     1 
ATOM   1513 N N     . ILE B 1 21  ? 23.159 -38.876 113.516 1.00 25.82 ? 21   ILE B N     1 
ATOM   1514 C CA    . ILE B 1 21  ? 22.818 -38.050 114.668 1.00 24.62 ? 21   ILE B CA    1 
ATOM   1515 C C     . ILE B 1 21  ? 23.358 -38.757 115.908 1.00 24.02 ? 21   ILE B C     1 
ATOM   1516 O O     . ILE B 1 21  ? 23.248 -39.975 116.025 1.00 24.63 ? 21   ILE B O     1 
ATOM   1517 C CB    . ILE B 1 21  ? 21.265 -37.872 114.799 1.00 24.41 ? 21   ILE B CB    1 
ATOM   1518 C CG1   . ILE B 1 21  ? 20.671 -37.318 113.500 1.00 23.14 ? 21   ILE B CG1   1 
ATOM   1519 C CG2   . ILE B 1 21  ? 20.908 -36.966 115.992 1.00 23.20 ? 21   ILE B CG2   1 
ATOM   1520 C CD1   . ILE B 1 21  ? 19.172 -37.515 113.388 1.00 19.50 ? 21   ILE B CD1   1 
ATOM   1521 N N     . VAL B 1 22  ? 23.983 -37.998 116.804 1.00 24.11 ? 22   VAL B N     1 
ATOM   1522 C CA    . VAL B 1 22  ? 24.529 -38.555 118.037 1.00 23.52 ? 22   VAL B CA    1 
ATOM   1523 C C     . VAL B 1 22  ? 23.921 -37.875 119.261 1.00 22.93 ? 22   VAL B C     1 
ATOM   1524 O O     . VAL B 1 22  ? 24.042 -36.654 119.440 1.00 21.90 ? 22   VAL B O     1 
ATOM   1525 C CB    . VAL B 1 22  ? 26.053 -38.382 118.129 1.00 24.15 ? 22   VAL B CB    1 
ATOM   1526 C CG1   . VAL B 1 22  ? 26.595 -39.158 119.337 1.00 22.39 ? 22   VAL B CG1   1 
ATOM   1527 C CG2   . VAL B 1 22  ? 26.720 -38.828 116.826 1.00 26.12 ? 22   VAL B CG2   1 
ATOM   1528 N N     . PRO B 1 23  ? 23.203 -38.650 120.086 1.00 22.57 ? 23   PRO B N     1 
ATOM   1529 C CA    . PRO B 1 23  ? 22.574 -38.126 121.304 1.00 22.46 ? 23   PRO B CA    1 
ATOM   1530 C C     . PRO B 1 23  ? 23.632 -37.432 122.162 1.00 22.89 ? 23   PRO B C     1 
ATOM   1531 O O     . PRO B 1 23  ? 24.791 -37.876 122.227 1.00 22.41 ? 23   PRO B O     1 
ATOM   1532 C CB    . PRO B 1 23  ? 22.084 -39.393 121.995 1.00 21.60 ? 23   PRO B CB    1 
ATOM   1533 C CG    . PRO B 1 23  ? 21.747 -40.285 120.842 1.00 21.38 ? 23   PRO B CG    1 
ATOM   1534 C CD    . PRO B 1 23  ? 22.879 -40.076 119.889 1.00 21.52 ? 23   PRO B CD    1 
ATOM   1535 N N     . THR B 1 24  ? 23.241 -36.322 122.774 1.00 22.73 ? 24   THR B N     1 
ATOM   1536 C CA    . THR B 1 24  ? 24.120 -35.546 123.638 1.00 21.87 ? 24   THR B CA    1 
ATOM   1537 C C     . THR B 1 24  ? 23.912 -36.020 125.071 1.00 19.67 ? 24   THR B C     1 
ATOM   1538 O O     . THR B 1 24  ? 22.779 -36.124 125.510 1.00 19.97 ? 24   THR B O     1 
ATOM   1539 C CB    . THR B 1 24  ? 23.766 -34.038 123.536 1.00 23.31 ? 24   THR B CB    1 
ATOM   1540 O OG1   . THR B 1 24  ? 23.920 -33.602 122.176 1.00 24.56 ? 24   THR B OG1   1 
ATOM   1541 C CG2   . THR B 1 24  ? 24.660 -33.196 124.440 1.00 21.07 ? 24   THR B CG2   1 
ATOM   1542 N N     . LEU B 1 25  ? 24.985 -36.368 125.772 1.00 17.96 ? 25   LEU B N     1 
ATOM   1543 C CA    . LEU B 1 25  ? 24.860 -36.804 127.160 1.00 17.99 ? 25   LEU B CA    1 
ATOM   1544 C C     . LEU B 1 25  ? 24.574 -35.579 128.037 1.00 18.35 ? 25   LEU B C     1 
ATOM   1545 O O     . LEU B 1 25  ? 25.303 -34.578 128.015 1.00 18.58 ? 25   LEU B O     1 
ATOM   1546 C CB    . LEU B 1 25  ? 26.111 -37.562 127.640 1.00 16.56 ? 25   LEU B CB    1 
ATOM   1547 C CG    . LEU B 1 25  ? 26.493 -38.831 126.858 1.00 16.37 ? 25   LEU B CG    1 
ATOM   1548 C CD1   . LEU B 1 25  ? 27.560 -39.608 127.611 1.00 14.99 ? 25   LEU B CD1   1 
ATOM   1549 C CD2   . LEU B 1 25  ? 25.268 -39.716 126.602 1.00 15.91 ? 25   LEU B CD2   1 
ATOM   1550 N N     . GLN B 1 26  ? 23.506 -35.675 128.815 1.00 18.09 ? 26   GLN B N     1 
ATOM   1551 C CA    . GLN B 1 26  ? 23.063 -34.573 129.650 1.00 17.86 ? 26   GLN B CA    1 
ATOM   1552 C C     . GLN B 1 26  ? 23.227 -34.733 131.138 1.00 17.67 ? 26   GLN B C     1 
ATOM   1553 O O     . GLN B 1 26  ? 23.278 -33.741 131.864 1.00 19.34 ? 26   GLN B O     1 
ATOM   1554 C CB    . GLN B 1 26  ? 21.589 -34.300 129.366 1.00 17.32 ? 26   GLN B CB    1 
ATOM   1555 C CG    . GLN B 1 26  ? 21.291 -34.102 127.905 1.00 18.23 ? 26   GLN B CG    1 
ATOM   1556 C CD    . GLN B 1 26  ? 21.752 -32.748 127.368 1.00 20.96 ? 26   GLN B CD    1 
ATOM   1557 O OE1   . GLN B 1 26  ? 22.445 -31.980 128.047 1.00 19.86 ? 26   GLN B OE1   1 
ATOM   1558 N NE2   . GLN B 1 26  ? 21.338 -32.442 126.148 1.00 21.92 ? 26   GLN B NE2   1 
ATOM   1559 N N     . ASN B 1 27  ? 23.316 -35.969 131.602 1.00 17.85 ? 27   ASN B N     1 
ATOM   1560 C CA    . ASN B 1 27  ? 23.417 -36.220 133.033 1.00 16.63 ? 27   ASN B CA    1 
ATOM   1561 C C     . ASN B 1 27  ? 23.940 -37.614 133.276 1.00 15.27 ? 27   ASN B C     1 
ATOM   1562 O O     . ASN B 1 27  ? 23.566 -38.546 132.576 1.00 15.91 ? 27   ASN B O     1 
ATOM   1563 C CB    . ASN B 1 27  ? 22.017 -36.083 133.651 1.00 15.95 ? 27   ASN B CB    1 
ATOM   1564 C CG    . ASN B 1 27  ? 21.980 -36.410 135.121 1.00 15.72 ? 27   ASN B CG    1 
ATOM   1565 O OD1   . ASN B 1 27  ? 22.829 -35.974 135.890 1.00 16.19 ? 27   ASN B OD1   1 
ATOM   1566 N ND2   . ASN B 1 27  ? 20.969 -37.161 135.527 1.00 15.39 ? 27   ASN B ND2   1 
ATOM   1567 N N     . ILE B 1 28  ? 24.852 -37.746 134.223 1.00 15.07 ? 28   ILE B N     1 
ATOM   1568 C CA    . ILE B 1 28  ? 25.399 -39.047 134.558 1.00 15.53 ? 28   ILE B CA    1 
ATOM   1569 C C     . ILE B 1 28  ? 25.186 -39.285 136.048 1.00 15.76 ? 28   ILE B C     1 
ATOM   1570 O O     . ILE B 1 28  ? 25.404 -38.388 136.849 1.00 18.00 ? 28   ILE B O     1 
ATOM   1571 C CB    . ILE B 1 28  ? 26.926 -39.133 134.280 1.00 14.55 ? 28   ILE B CB    1 
ATOM   1572 C CG1   . ILE B 1 28  ? 27.246 -38.737 132.839 1.00 12.40 ? 28   ILE B CG1   1 
ATOM   1573 C CG2   . ILE B 1 28  ? 27.433 -40.534 134.579 1.00 12.49 ? 28   ILE B CG2   1 
ATOM   1574 C CD1   . ILE B 1 28  ? 26.701 -39.640 131.800 1.00 10.41 ? 28   ILE B CD1   1 
ATOM   1575 N N     . VAL B 1 29  ? 24.714 -40.472 136.408 1.00 16.20 ? 29   VAL B N     1 
ATOM   1576 C CA    . VAL B 1 29  ? 24.520 -40.838 137.800 1.00 15.86 ? 29   VAL B CA    1 
ATOM   1577 C C     . VAL B 1 29  ? 25.475 -41.988 138.044 1.00 17.34 ? 29   VAL B C     1 
ATOM   1578 O O     . VAL B 1 29  ? 25.475 -42.961 137.291 1.00 16.59 ? 29   VAL B O     1 
ATOM   1579 C CB    . VAL B 1 29  ? 23.080 -41.321 138.088 1.00 14.92 ? 29   VAL B CB    1 
ATOM   1580 C CG1   . VAL B 1 29  ? 22.962 -41.816 139.527 1.00 14.00 ? 29   VAL B CG1   1 
ATOM   1581 C CG2   . VAL B 1 29  ? 22.103 -40.176 137.850 1.00 16.02 ? 29   VAL B CG2   1 
ATOM   1582 N N     . SER B 1 30  ? 26.308 -41.862 139.069 1.00 18.57 ? 30   SER B N     1 
ATOM   1583 C CA    . SER B 1 30  ? 27.246 -42.911 139.408 1.00 19.34 ? 30   SER B CA    1 
ATOM   1584 C C     . SER B 1 30  ? 27.331 -43.074 140.916 1.00 20.03 ? 30   SER B C     1 
ATOM   1585 O O     . SER B 1 30  ? 26.816 -42.254 141.667 1.00 19.50 ? 30   SER B O     1 
ATOM   1586 C CB    . SER B 1 30  ? 28.626 -42.593 138.831 1.00 20.85 ? 30   SER B CB    1 
ATOM   1587 O OG    . SER B 1 30  ? 29.110 -41.347 139.295 1.00 21.66 ? 30   SER B OG    1 
ATOM   1588 N N     . THR B 1 31  ? 27.956 -44.161 141.349 1.00 21.43 ? 31   THR B N     1 
ATOM   1589 C CA    . THR B 1 31  ? 28.134 -44.450 142.762 1.00 21.98 ? 31   THR B CA    1 
ATOM   1590 C C     . THR B 1 31  ? 29.574 -44.898 142.969 1.00 22.23 ? 31   THR B C     1 
ATOM   1591 O O     . THR B 1 31  ? 30.256 -45.329 142.027 1.00 22.14 ? 31   THR B O     1 
ATOM   1592 C CB    . THR B 1 31  ? 27.185 -45.590 143.248 1.00 22.69 ? 31   THR B CB    1 
ATOM   1593 O OG1   . THR B 1 31  ? 27.420 -46.780 142.479 1.00 25.19 ? 31   THR B OG1   1 
ATOM   1594 C CG2   . THR B 1 31  ? 25.733 -45.201 143.091 1.00 21.49 ? 31   THR B CG2   1 
ATOM   1595 N N     . VAL B 1 32  ? 30.048 -44.768 144.197 1.00 22.19 ? 32   VAL B N     1 
ATOM   1596 C CA    . VAL B 1 32  ? 31.392 -45.186 144.535 1.00 22.00 ? 32   VAL B CA    1 
ATOM   1597 C C     . VAL B 1 32  ? 31.350 -45.539 146.002 1.00 24.71 ? 32   VAL B C     1 
ATOM   1598 O O     . VAL B 1 32  ? 30.505 -45.039 146.754 1.00 25.04 ? 32   VAL B O     1 
ATOM   1599 C CB    . VAL B 1 32  ? 32.416 -44.080 144.286 1.00 20.78 ? 32   VAL B CB    1 
ATOM   1600 C CG1   . VAL B 1 32  ? 32.197 -42.921 145.227 1.00 20.23 ? 32   VAL B CG1   1 
ATOM   1601 C CG2   . VAL B 1 32  ? 33.802 -44.624 144.435 1.00 20.53 ? 32   VAL B CG2   1 
ATOM   1602 N N     . ASN B 1 33  ? 32.237 -46.432 146.405 1.00 27.15 ? 33   ASN B N     1 
ATOM   1603 C CA    . ASN B 1 33  ? 32.287 -46.872 147.783 1.00 28.43 ? 33   ASN B CA    1 
ATOM   1604 C C     . ASN B 1 33  ? 33.533 -46.293 148.426 1.00 28.86 ? 33   ASN B C     1 
ATOM   1605 O O     . ASN B 1 33  ? 34.645 -46.737 148.151 1.00 28.86 ? 33   ASN B O     1 
ATOM   1606 C CB    . ASN B 1 33  ? 32.314 -48.396 147.829 1.00 30.02 ? 33   ASN B CB    1 
ATOM   1607 C CG    . ASN B 1 33  ? 31.982 -48.939 149.196 1.00 32.18 ? 33   ASN B CG    1 
ATOM   1608 O OD1   . ASN B 1 33  ? 32.327 -48.345 150.217 1.00 33.11 ? 33   ASN B OD1   1 
ATOM   1609 N ND2   . ASN B 1 33  ? 31.302 -50.078 149.227 1.00 34.00 ? 33   ASN B ND2   1 
ATOM   1610 N N     . LEU B 1 34  ? 33.348 -45.271 149.252 1.00 29.14 ? 34   LEU B N     1 
ATOM   1611 C CA    . LEU B 1 34  ? 34.470 -44.640 149.922 1.00 31.47 ? 34   LEU B CA    1 
ATOM   1612 C C     . LEU B 1 34  ? 35.070 -45.610 150.921 1.00 33.79 ? 34   LEU B C     1 
ATOM   1613 O O     . LEU B 1 34  ? 36.093 -45.336 151.535 1.00 35.52 ? 34   LEU B O     1 
ATOM   1614 C CB    . LEU B 1 34  ? 34.037 -43.344 150.596 1.00 29.25 ? 34   LEU B CB    1 
ATOM   1615 C CG    . LEU B 1 34  ? 33.479 -42.328 149.600 1.00 28.28 ? 34   LEU B CG    1 
ATOM   1616 C CD1   . LEU B 1 34  ? 33.178 -41.012 150.324 1.00 26.53 ? 34   LEU B CD1   1 
ATOM   1617 C CD2   . LEU B 1 34  ? 34.476 -42.129 148.447 1.00 23.95 ? 34   LEU B CD2   1 
ATOM   1618 N N     . ASP B 1 35  ? 34.372 -46.719 151.120 1.00 36.86 ? 35   ASP B N     1 
ATOM   1619 C CA    . ASP B 1 35  ? 34.803 -47.790 151.987 1.00 37.85 ? 35   ASP B CA    1 
ATOM   1620 C C     . ASP B 1 35  ? 35.325 -47.353 153.347 1.00 37.80 ? 35   ASP B C     1 
ATOM   1621 O O     . ASP B 1 35  ? 36.469 -47.623 153.697 1.00 37.34 ? 35   ASP B O     1 
ATOM   1622 C CB    . ASP B 1 35  ? 35.841 -48.620 151.242 1.00 41.79 ? 35   ASP B CB    1 
ATOM   1623 C CG    . ASP B 1 35  ? 36.191 -49.887 151.959 1.00 45.20 ? 35   ASP B CG    1 
ATOM   1624 O OD1   . ASP B 1 35  ? 35.279 -50.473 152.593 1.00 47.68 ? 35   ASP B OD1   1 
ATOM   1625 O OD2   . ASP B 1 35  ? 37.382 -50.287 151.889 1.00 47.39 ? 35   ASP B OD2   1 
ATOM   1626 N N     . CYS B 1 36  ? 34.477 -46.664 154.100 1.00 37.72 ? 36   CYS B N     1 
ATOM   1627 C CA    . CYS B 1 36  ? 34.809 -46.202 155.448 1.00 37.73 ? 36   CYS B CA    1 
ATOM   1628 C C     . CYS B 1 36  ? 33.593 -45.464 155.978 1.00 37.28 ? 36   CYS B C     1 
ATOM   1629 O O     . CYS B 1 36  ? 32.966 -44.711 155.243 1.00 37.55 ? 36   CYS B O     1 
ATOM   1630 C CB    . CYS B 1 36  ? 36.079 -45.325 155.456 1.00 38.72 ? 36   CYS B CB    1 
ATOM   1631 S SG    . CYS B 1 36  ? 35.890 -43.535 155.523 1.00 40.15 ? 36   CYS B SG    1 
ATOM   1632 N N     . LYS B 1 37  ? 33.184 -45.781 157.204 1.00 37.24 ? 37   LYS B N     1 
ATOM   1633 C CA    . LYS B 1 37  ? 32.012 -45.143 157.806 1.00 37.28 ? 37   LYS B CA    1 
ATOM   1634 C C     . LYS B 1 37  ? 32.274 -43.662 157.964 1.00 36.06 ? 37   LYS B C     1 
ATOM   1635 O O     . LYS B 1 37  ? 33.382 -43.263 158.291 1.00 38.04 ? 37   LYS B O     1 
ATOM   1636 C CB    . LYS B 1 37  ? 31.690 -45.762 159.163 1.00 39.01 ? 37   LYS B CB    1 
ATOM   1637 C CG    . LYS B 1 37  ? 31.198 -47.198 159.104 1.00 41.64 ? 37   LYS B CG    1 
ATOM   1638 C CD    . LYS B 1 37  ? 30.656 -47.579 160.460 1.00 44.63 ? 37   LYS B CD    1 
ATOM   1639 C CE    . LYS B 1 37  ? 30.084 -48.981 160.504 1.00 45.39 ? 37   LYS B CE    1 
ATOM   1640 N NZ    . LYS B 1 37  ? 29.542 -49.237 161.881 1.00 46.84 ? 37   LYS B NZ    1 
ATOM   1641 N N     . LEU B 1 38  ? 31.261 -42.841 157.754 1.00 33.70 ? 38   LEU B N     1 
ATOM   1642 C CA    . LEU B 1 38  ? 31.454 -41.406 157.848 1.00 32.28 ? 38   LEU B CA    1 
ATOM   1643 C C     . LEU B 1 38  ? 30.583 -40.768 158.916 1.00 32.37 ? 38   LEU B C     1 
ATOM   1644 O O     . LEU B 1 38  ? 29.506 -41.268 159.234 1.00 32.65 ? 38   LEU B O     1 
ATOM   1645 C CB    . LEU B 1 38  ? 31.153 -40.764 156.493 1.00 30.27 ? 38   LEU B CB    1 
ATOM   1646 C CG    . LEU B 1 38  ? 32.166 -40.707 155.341 1.00 29.51 ? 38   LEU B CG    1 
ATOM   1647 C CD1   . LEU B 1 38  ? 33.276 -41.719 155.448 1.00 27.11 ? 38   LEU B CD1   1 
ATOM   1648 C CD2   . LEU B 1 38  ? 31.413 -40.852 154.029 1.00 29.05 ? 38   LEU B CD2   1 
ATOM   1649 N N     . ASP B 1 39  ? 31.054 -39.660 159.471 1.00 31.70 ? 39   ASP B N     1 
ATOM   1650 C CA    . ASP B 1 39  ? 30.296 -38.942 160.479 1.00 32.49 ? 39   ASP B CA    1 
ATOM   1651 C C     . ASP B 1 39  ? 29.649 -37.837 159.663 1.00 32.21 ? 39   ASP B C     1 
ATOM   1652 O O     . ASP B 1 39  ? 30.330 -36.904 159.248 1.00 32.19 ? 39   ASP B O     1 
ATOM   1653 C CB    . ASP B 1 39  ? 31.255 -38.359 161.517 1.00 35.34 ? 39   ASP B CB    1 
ATOM   1654 C CG    . ASP B 1 39  ? 30.544 -37.819 162.749 1.00 36.34 ? 39   ASP B CG    1 
ATOM   1655 O OD1   . ASP B 1 39  ? 29.487 -37.165 162.610 1.00 35.50 ? 39   ASP B OD1   1 
ATOM   1656 O OD2   . ASP B 1 39  ? 31.073 -38.034 163.860 1.00 37.66 ? 39   ASP B OD2   1 
ATOM   1657 N N     . LEU B 1 40  ? 28.345 -37.940 159.425 1.00 31.72 ? 40   LEU B N     1 
ATOM   1658 C CA    . LEU B 1 40  ? 27.656 -36.955 158.602 1.00 31.71 ? 40   LEU B CA    1 
ATOM   1659 C C     . LEU B 1 40  ? 27.427 -35.599 159.248 1.00 33.33 ? 40   LEU B C     1 
ATOM   1660 O O     . LEU B 1 40  ? 27.396 -34.575 158.554 1.00 34.11 ? 40   LEU B O     1 
ATOM   1661 C CB    . LEU B 1 40  ? 26.355 -37.525 158.022 1.00 30.29 ? 40   LEU B CB    1 
ATOM   1662 C CG    . LEU B 1 40  ? 26.435 -38.774 157.115 1.00 30.04 ? 40   LEU B CG    1 
ATOM   1663 C CD1   . LEU B 1 40  ? 25.087 -39.023 156.470 1.00 26.81 ? 40   LEU B CD1   1 
ATOM   1664 C CD2   . LEU B 1 40  ? 27.507 -38.632 156.027 1.00 27.42 ? 40   LEU B CD2   1 
ATOM   1665 N N     . LYS B 1 41  ? 27.262 -35.572 160.565 1.00 34.52 ? 41   LYS B N     1 
ATOM   1666 C CA    . LYS B 1 41  ? 27.065 -34.293 161.261 1.00 35.21 ? 41   LYS B CA    1 
ATOM   1667 C C     . LYS B 1 41  ? 28.403 -33.545 161.235 1.00 34.69 ? 41   LYS B C     1 
ATOM   1668 O O     . LYS B 1 41  ? 28.450 -32.339 161.026 1.00 34.98 ? 41   LYS B O     1 
ATOM   1669 C CB    . LYS B 1 41  ? 26.586 -34.508 162.711 1.00 36.65 ? 41   LYS B CB    1 
ATOM   1670 C CG    . LYS B 1 41  ? 25.148 -35.048 162.863 1.00 40.47 ? 41   LYS B CG    1 
ATOM   1671 C CD    . LYS B 1 41  ? 24.916 -36.416 162.142 1.00 43.75 ? 41   LYS B CD    1 
ATOM   1672 C CE    . LYS B 1 41  ? 23.528 -37.073 162.438 1.00 44.16 ? 41   LYS B CE    1 
ATOM   1673 N NZ    . LYS B 1 41  ? 22.311 -36.275 162.055 1.00 42.69 ? 41   LYS B NZ    1 
ATOM   1674 N N     . ALA B 1 42  ? 29.495 -34.285 161.397 1.00 33.89 ? 42   ALA B N     1 
ATOM   1675 C CA    . ALA B 1 42  ? 30.823 -33.697 161.382 1.00 33.78 ? 42   ALA B CA    1 
ATOM   1676 C C     . ALA B 1 42  ? 31.063 -33.116 159.996 1.00 33.66 ? 42   ALA B C     1 
ATOM   1677 O O     . ALA B 1 42  ? 31.291 -31.916 159.853 1.00 34.76 ? 42   ALA B O     1 
ATOM   1678 C CB    . ALA B 1 42  ? 31.872 -34.751 161.714 1.00 33.07 ? 42   ALA B CB    1 
ATOM   1679 N N     . ILE B 1 43  ? 30.952 -33.958 158.973 1.00 31.71 ? 43   ILE B N     1 
ATOM   1680 C CA    . ILE B 1 43  ? 31.140 -33.519 157.593 1.00 30.71 ? 43   ILE B CA    1 
ATOM   1681 C C     . ILE B 1 43  ? 30.306 -32.268 157.272 1.00 30.39 ? 43   ILE B C     1 
ATOM   1682 O O     . ILE B 1 43  ? 30.852 -31.259 156.839 1.00 30.51 ? 43   ILE B O     1 
ATOM   1683 C CB    . ILE B 1 43  ? 30.793 -34.656 156.577 1.00 29.61 ? 43   ILE B CB    1 
ATOM   1684 C CG1   . ILE B 1 43  ? 31.808 -35.792 156.674 1.00 27.83 ? 43   ILE B CG1   1 
ATOM   1685 C CG2   . ILE B 1 43  ? 30.774 -34.123 155.150 1.00 30.66 ? 43   ILE B CG2   1 
ATOM   1686 C CD1   . ILE B 1 43  ? 31.540 -36.915 155.709 1.00 26.13 ? 43   ILE B CD1   1 
ATOM   1687 N N     . ALA B 1 44  ? 29.004 -32.327 157.525 1.00 29.91 ? 44   ALA B N     1 
ATOM   1688 C CA    . ALA B 1 44  ? 28.105 -31.214 157.253 1.00 31.72 ? 44   ALA B CA    1 
ATOM   1689 C C     . ALA B 1 44  ? 28.516 -29.900 157.929 1.00 34.63 ? 44   ALA B C     1 
ATOM   1690 O O     . ALA B 1 44  ? 28.112 -28.809 157.494 1.00 34.97 ? 44   ALA B O     1 
ATOM   1691 C CB    . ALA B 1 44  ? 26.701 -31.587 157.672 1.00 30.41 ? 44   ALA B CB    1 
ATOM   1692 N N     . LEU B 1 45  ? 29.274 -30.009 159.018 1.00 36.72 ? 45   LEU B N     1 
ATOM   1693 C CA    . LEU B 1 45  ? 29.731 -28.842 159.758 1.00 38.44 ? 45   LEU B CA    1 
ATOM   1694 C C     . LEU B 1 45  ? 31.124 -28.369 159.332 1.00 39.27 ? 45   LEU B C     1 
ATOM   1695 O O     . LEU B 1 45  ? 31.409 -27.178 159.378 1.00 38.41 ? 45   LEU B O     1 
ATOM   1696 C CB    . LEU B 1 45  ? 29.703 -29.128 161.263 1.00 40.89 ? 45   LEU B CB    1 
ATOM   1697 C CG    . LEU B 1 45  ? 28.334 -29.386 161.923 1.00 43.05 ? 45   LEU B CG    1 
ATOM   1698 C CD1   . LEU B 1 45  ? 28.546 -29.941 163.328 1.00 42.83 ? 45   LEU B CD1   1 
ATOM   1699 C CD2   . LEU B 1 45  ? 27.472 -28.108 161.966 1.00 42.71 ? 45   LEU B CD2   1 
ATOM   1700 N N     . GLN B 1 46  ? 31.991 -29.290 158.930 1.00 40.27 ? 46   GLN B N     1 
ATOM   1701 C CA    . GLN B 1 46  ? 33.333 -28.908 158.510 1.00 43.03 ? 46   GLN B CA    1 
ATOM   1702 C C     . GLN B 1 46  ? 33.350 -28.403 157.075 1.00 43.97 ? 46   GLN B C     1 
ATOM   1703 O O     . GLN B 1 46  ? 34.013 -27.415 156.777 1.00 45.29 ? 46   GLN B O     1 
ATOM   1704 C CB    . GLN B 1 46  ? 34.341 -30.066 158.617 1.00 45.73 ? 46   GLN B CB    1 
ATOM   1705 C CG    . GLN B 1 46  ? 33.987 -31.225 159.535 1.00 50.87 ? 46   GLN B CG    1 
ATOM   1706 C CD    . GLN B 1 46  ? 33.853 -30.818 160.988 1.00 54.23 ? 46   GLN B CD    1 
ATOM   1707 O OE1   . GLN B 1 46  ? 32.836 -30.253 161.403 1.00 55.81 ? 46   GLN B OE1   1 
ATOM   1708 N NE2   . GLN B 1 46  ? 34.873 -31.128 161.780 1.00 56.58 ? 46   GLN B NE2   1 
ATOM   1709 N N     . ALA B 1 47  ? 32.670 -29.105 156.173 1.00 44.56 ? 47   ALA B N     1 
ATOM   1710 C CA    . ALA B 1 47  ? 32.650 -28.720 154.763 1.00 45.96 ? 47   ALA B CA    1 
ATOM   1711 C C     . ALA B 1 47  ? 31.647 -27.609 154.514 1.00 47.66 ? 47   ALA B C     1 
ATOM   1712 O O     . ALA B 1 47  ? 30.471 -27.763 154.843 1.00 50.26 ? 47   ALA B O     1 
ATOM   1713 C CB    . ALA B 1 47  ? 32.319 -29.918 153.903 1.00 44.18 ? 47   ALA B CB    1 
ATOM   1714 N N     . ARG B 1 48  ? 32.083 -26.515 153.890 1.00 48.49 ? 48   ARG B N     1 
ATOM   1715 C CA    . ARG B 1 48  ? 31.169 -25.393 153.628 1.00 49.03 ? 48   ARG B CA    1 
ATOM   1716 C C     . ARG B 1 48  ? 30.186 -25.723 152.518 1.00 48.92 ? 48   ARG B C     1 
ATOM   1717 O O     . ARG B 1 48  ? 29.047 -25.261 152.512 1.00 48.67 ? 48   ARG B O     1 
ATOM   1718 C CB    . ARG B 1 48  ? 31.935 -24.101 153.303 1.00 50.31 ? 48   ARG B CB    1 
ATOM   1719 C CG    . ARG B 1 48  ? 32.830 -24.172 152.081 1.00 51.99 ? 48   ARG B CG    1 
ATOM   1720 C CD    . ARG B 1 48  ? 33.483 -22.825 151.828 1.00 53.35 ? 48   ARG B CD    1 
ATOM   1721 N NE    . ARG B 1 48  ? 34.361 -22.852 150.664 1.00 55.41 ? 48   ARG B NE    1 
ATOM   1722 C CZ    . ARG B 1 48  ? 35.642 -22.485 150.679 1.00 57.78 ? 48   ARG B CZ    1 
ATOM   1723 N NH1   . ARG B 1 48  ? 36.210 -22.056 151.806 1.00 58.01 ? 48   ARG B NH1   1 
ATOM   1724 N NH2   . ARG B 1 48  ? 36.368 -22.558 149.567 1.00 57.98 ? 48   ARG B NH2   1 
ATOM   1725 N N     . ASN B 1 49  ? 30.629 -26.569 151.602 1.00 48.11 ? 49   ASN B N     1 
ATOM   1726 C CA    . ASN B 1 49  ? 29.809 -26.997 150.477 1.00 47.99 ? 49   ASN B CA    1 
ATOM   1727 C C     . ASN B 1 49  ? 28.753 -28.069 150.814 1.00 46.90 ? 49   ASN B C     1 
ATOM   1728 O O     . ASN B 1 49  ? 28.213 -28.689 149.890 1.00 47.09 ? 49   ASN B O     1 
ATOM   1729 C CB    . ASN B 1 49  ? 30.728 -27.527 149.365 1.00 49.58 ? 49   ASN B CB    1 
ATOM   1730 C CG    . ASN B 1 49  ? 31.808 -28.479 149.888 1.00 51.15 ? 49   ASN B CG    1 
ATOM   1731 O OD1   . ASN B 1 49  ? 32.855 -28.643 149.266 1.00 51.79 ? 49   ASN B OD1   1 
ATOM   1732 N ND2   . ASN B 1 49  ? 31.563 -29.093 151.045 1.00 52.62 ? 49   ASN B ND2   1 
ATOM   1733 N N     . ALA B 1 50  ? 28.405 -28.232 152.097 1.00 44.24 ? 50   ALA B N     1 
ATOM   1734 C CA    . ALA B 1 50  ? 27.465 -29.277 152.515 1.00 42.27 ? 50   ALA B CA    1 
ATOM   1735 C C     . ALA B 1 50  ? 26.135 -28.873 153.159 1.00 41.86 ? 50   ALA B C     1 
ATOM   1736 O O     . ALA B 1 50  ? 26.076 -27.927 153.936 1.00 43.16 ? 50   ALA B O     1 
ATOM   1737 C CB    . ALA B 1 50  ? 28.185 -30.252 153.417 1.00 40.64 ? 50   ALA B CB    1 
ATOM   1738 N N     . GLU B 1 51  ? 25.080 -29.638 152.862 1.00 41.53 ? 51   GLU B N     1 
ATOM   1739 C CA    . GLU B 1 51  ? 23.730 -29.425 153.407 1.00 39.71 ? 51   GLU B CA    1 
ATOM   1740 C C     . GLU B 1 51  ? 23.291 -30.752 154.004 1.00 37.47 ? 51   GLU B C     1 
ATOM   1741 O O     . GLU B 1 51  ? 23.347 -31.777 153.332 1.00 36.40 ? 51   GLU B O     1 
ATOM   1742 C CB    . GLU B 1 51  ? 22.734 -29.076 152.303 1.00 42.69 ? 51   GLU B CB    1 
ATOM   1743 C CG    . GLU B 1 51  ? 23.145 -27.950 151.371 1.00 47.90 ? 51   GLU B CG    1 
ATOM   1744 C CD    . GLU B 1 51  ? 22.167 -27.765 150.211 1.00 51.43 ? 51   GLU B CD    1 
ATOM   1745 O OE1   . GLU B 1 51  ? 21.382 -28.705 149.924 1.00 51.99 ? 51   GLU B OE1   1 
ATOM   1746 O OE2   . GLU B 1 51  ? 22.185 -26.678 149.584 1.00 53.88 ? 51   GLU B OE2   1 
ATOM   1747 N N     . TYR B 1 52  ? 22.809 -30.740 155.237 1.00 36.09 ? 52   TYR B N     1 
ATOM   1748 C CA    . TYR B 1 52  ? 22.391 -31.980 155.874 1.00 34.88 ? 52   TYR B CA    1 
ATOM   1749 C C     . TYR B 1 52  ? 21.164 -31.865 156.775 1.00 35.62 ? 52   TYR B C     1 
ATOM   1750 O O     . TYR B 1 52  ? 21.145 -31.080 157.726 1.00 35.18 ? 52   TYR B O     1 
ATOM   1751 C CB    . TYR B 1 52  ? 23.559 -32.571 156.656 1.00 31.85 ? 52   TYR B CB    1 
ATOM   1752 C CG    . TYR B 1 52  ? 23.261 -33.873 157.376 1.00 30.45 ? 52   TYR B CG    1 
ATOM   1753 C CD1   . TYR B 1 52  ? 22.612 -34.927 156.731 1.00 28.23 ? 52   TYR B CD1   1 
ATOM   1754 C CD2   . TYR B 1 52  ? 23.690 -34.068 158.690 1.00 29.81 ? 52   TYR B CD2   1 
ATOM   1755 C CE1   . TYR B 1 52  ? 22.410 -36.132 157.372 1.00 28.80 ? 52   TYR B CE1   1 
ATOM   1756 C CE2   . TYR B 1 52  ? 23.496 -35.267 159.336 1.00 29.49 ? 52   TYR B CE2   1 
ATOM   1757 C CZ    . TYR B 1 52  ? 22.861 -36.296 158.677 1.00 31.12 ? 52   TYR B CZ    1 
ATOM   1758 O OH    . TYR B 1 52  ? 22.705 -37.499 159.326 1.00 33.13 ? 52   TYR B OH    1 
ATOM   1759 N N     . ASN B 1 53  ? 20.151 -32.674 156.471 1.00 36.53 ? 53   ASN B N     1 
ATOM   1760 C CA    . ASN B 1 53  ? 18.912 -32.717 157.232 1.00 37.98 ? 53   ASN B CA    1 
ATOM   1761 C C     . ASN B 1 53  ? 18.416 -34.163 157.212 1.00 37.43 ? 53   ASN B C     1 
ATOM   1762 O O     . ASN B 1 53  ? 17.640 -34.547 156.341 1.00 36.35 ? 53   ASN B O     1 
ATOM   1763 C CB    . ASN B 1 53  ? 17.853 -31.802 156.604 1.00 41.89 ? 53   ASN B CB    1 
ATOM   1764 C CG    . ASN B 1 53  ? 18.393 -30.408 156.264 1.00 47.33 ? 53   ASN B CG    1 
ATOM   1765 O OD1   . ASN B 1 53  ? 18.215 -29.919 155.140 1.00 50.52 ? 53   ASN B OD1   1 
ATOM   1766 N ND2   . ASN B 1 53  ? 19.055 -29.761 157.232 1.00 49.17 ? 53   ASN B ND2   1 
ATOM   1767 N N     . PRO B 1 54  ? 18.864 -34.987 158.175 1.00 37.65 ? 54   PRO B N     1 
ATOM   1768 C CA    . PRO B 1 54  ? 18.475 -36.397 158.277 1.00 37.71 ? 54   PRO B CA    1 
ATOM   1769 C C     . PRO B 1 54  ? 16.976 -36.668 158.435 1.00 38.70 ? 54   PRO B C     1 
ATOM   1770 O O     . PRO B 1 54  ? 16.523 -37.796 158.233 1.00 39.19 ? 54   PRO B O     1 
ATOM   1771 C CB    . PRO B 1 54  ? 19.299 -36.902 159.470 1.00 38.12 ? 54   PRO B CB    1 
ATOM   1772 C CG    . PRO B 1 54  ? 19.557 -35.685 160.275 1.00 38.41 ? 54   PRO B CG    1 
ATOM   1773 C CD    . PRO B 1 54  ? 19.845 -34.650 159.221 1.00 38.47 ? 54   PRO B CD    1 
ATOM   1774 N N     . LYS B 1 55  ? 16.207 -35.651 158.815 1.00 39.17 ? 55   LYS B N     1 
ATOM   1775 C CA    . LYS B 1 55  ? 14.761 -35.816 158.935 1.00 39.51 ? 55   LYS B CA    1 
ATOM   1776 C C     . LYS B 1 55  ? 14.168 -35.823 157.533 1.00 38.12 ? 55   LYS B C     1 
ATOM   1777 O O     . LYS B 1 55  ? 13.114 -36.393 157.288 1.00 39.66 ? 55   LYS B O     1 
ATOM   1778 C CB    . LYS B 1 55  ? 14.141 -34.671 159.742 1.00 42.00 ? 55   LYS B CB    1 
ATOM   1779 C CG    . LYS B 1 55  ? 14.284 -34.842 161.247 1.00 46.26 ? 55   LYS B CG    1 
ATOM   1780 C CD    . LYS B 1 55  ? 13.106 -34.224 161.990 1.00 49.51 ? 55   LYS B CD    1 
ATOM   1781 C CE    . LYS B 1 55  ? 13.093 -32.705 161.847 1.00 51.99 ? 55   LYS B CE    1 
ATOM   1782 N NZ    . LYS B 1 55  ? 14.314 -32.093 162.454 1.00 53.39 ? 55   LYS B NZ    1 
ATOM   1783 N N     . ARG B 1 56  ? 14.872 -35.178 156.616 1.00 36.32 ? 56   ARG B N     1 
ATOM   1784 C CA    . ARG B 1 56  ? 14.464 -35.062 155.232 1.00 33.96 ? 56   ARG B CA    1 
ATOM   1785 C C     . ARG B 1 56  ? 15.038 -36.204 154.388 1.00 30.18 ? 56   ARG B C     1 
ATOM   1786 O O     . ARG B 1 56  ? 14.307 -36.853 153.649 1.00 29.74 ? 56   ARG B O     1 
ATOM   1787 C CB    . ARG B 1 56  ? 14.935 -33.689 154.721 1.00 38.35 ? 56   ARG B CB    1 
ATOM   1788 C CG    . ARG B 1 56  ? 14.625 -33.320 153.269 1.00 40.74 ? 56   ARG B CG    1 
ATOM   1789 C CD    . ARG B 1 56  ? 15.182 -31.917 152.949 1.00 41.87 ? 56   ARG B CD    1 
ATOM   1790 N NE    . ARG B 1 56  ? 15.096 -31.609 151.524 1.00 43.69 ? 56   ARG B NE    1 
ATOM   1791 C CZ    . ARG B 1 56  ? 13.962 -31.330 150.882 1.00 44.71 ? 56   ARG B CZ    1 
ATOM   1792 N NH1   . ARG B 1 56  ? 12.808 -31.299 151.535 1.00 44.54 ? 56   ARG B NH1   1 
ATOM   1793 N NH2   . ARG B 1 56  ? 13.970 -31.163 149.565 1.00 46.16 ? 56   ARG B NH2   1 
ATOM   1794 N N     . PHE B 1 57  ? 16.336 -36.457 154.516 1.00 26.36 ? 57   PHE B N     1 
ATOM   1795 C CA    . PHE B 1 57  ? 17.009 -37.503 153.748 1.00 23.91 ? 57   PHE B CA    1 
ATOM   1796 C C     . PHE B 1 57  ? 18.278 -37.894 154.502 1.00 22.68 ? 57   PHE B C     1 
ATOM   1797 O O     . PHE B 1 57  ? 18.911 -37.052 155.141 1.00 23.58 ? 57   PHE B O     1 
ATOM   1798 C CB    . PHE B 1 57  ? 17.355 -36.977 152.333 1.00 22.87 ? 57   PHE B CB    1 
ATOM   1799 C CG    . PHE B 1 57  ? 17.764 -38.059 151.346 1.00 23.21 ? 57   PHE B CG    1 
ATOM   1800 C CD1   . PHE B 1 57  ? 16.995 -39.210 151.184 1.00 22.39 ? 57   PHE B CD1   1 
ATOM   1801 C CD2   . PHE B 1 57  ? 18.944 -37.949 150.623 1.00 23.57 ? 57   PHE B CD2   1 
ATOM   1802 C CE1   . PHE B 1 57  ? 17.404 -40.235 150.321 1.00 23.52 ? 57   PHE B CE1   1 
ATOM   1803 C CE2   . PHE B 1 57  ? 19.359 -38.970 149.758 1.00 24.42 ? 57   PHE B CE2   1 
ATOM   1804 C CZ    . PHE B 1 57  ? 18.584 -40.115 149.611 1.00 23.02 ? 57   PHE B CZ    1 
ATOM   1805 N N     . ALA B 1 58  ? 18.656 -39.161 154.438 1.00 21.68 ? 58   ALA B N     1 
ATOM   1806 C CA    . ALA B 1 58  ? 19.852 -39.648 155.139 1.00 22.86 ? 58   ALA B CA    1 
ATOM   1807 C C     . ALA B 1 58  ? 21.208 -39.290 154.508 1.00 23.48 ? 58   ALA B C     1 
ATOM   1808 O O     . ALA B 1 58  ? 22.214 -39.935 154.786 1.00 24.69 ? 58   ALA B O     1 
ATOM   1809 C CB    . ALA B 1 58  ? 19.763 -41.157 155.305 1.00 22.14 ? 58   ALA B CB    1 
ATOM   1810 N N     . ALA B 1 59  ? 21.274 -38.237 153.718 1.00 23.68 ? 59   ALA B N     1 
ATOM   1811 C CA    . ALA B 1 59  ? 22.531 -37.930 153.078 1.00 23.43 ? 59   ALA B CA    1 
ATOM   1812 C C     . ALA B 1 59  ? 22.951 -36.480 153.204 1.00 24.44 ? 59   ALA B C     1 
ATOM   1813 O O     . ALA B 1 59  ? 22.116 -35.576 153.349 1.00 24.55 ? 59   ALA B O     1 
ATOM   1814 C CB    . ALA B 1 59  ? 22.444 -38.303 151.615 1.00 21.49 ? 59   ALA B CB    1 
ATOM   1815 N N     . VAL B 1 60  ? 24.262 -36.281 153.179 1.00 24.33 ? 60   VAL B N     1 
ATOM   1816 C CA    . VAL B 1 60  ? 24.849 -34.957 153.204 1.00 23.58 ? 60   VAL B CA    1 
ATOM   1817 C C     . VAL B 1 60  ? 24.896 -34.641 151.719 1.00 23.76 ? 60   VAL B C     1 
ATOM   1818 O O     . VAL B 1 60  ? 25.437 -35.435 150.942 1.00 22.79 ? 60   VAL B O     1 
ATOM   1819 C CB    . VAL B 1 60  ? 26.301 -34.996 153.754 1.00 24.28 ? 60   VAL B CB    1 
ATOM   1820 C CG1   . VAL B 1 60  ? 27.096 -33.789 153.274 1.00 24.22 ? 60   VAL B CG1   1 
ATOM   1821 C CG2   . VAL B 1 60  ? 26.285 -35.042 155.275 1.00 24.10 ? 60   VAL B CG2   1 
ATOM   1822 N N     . ILE B 1 61  ? 24.210 -33.571 151.322 1.00 24.30 ? 61   ILE B N     1 
ATOM   1823 C CA    . ILE B 1 61  ? 24.176 -33.121 149.935 1.00 24.13 ? 61   ILE B CA    1 
ATOM   1824 C C     . ILE B 1 61  ? 25.299 -32.096 149.772 1.00 24.46 ? 61   ILE B C     1 
ATOM   1825 O O     . ILE B 1 61  ? 25.325 -31.095 150.483 1.00 23.82 ? 61   ILE B O     1 
ATOM   1826 C CB    . ILE B 1 61  ? 22.812 -32.480 149.588 1.00 24.88 ? 61   ILE B CB    1 
ATOM   1827 C CG1   . ILE B 1 61  ? 21.758 -33.563 149.324 1.00 25.35 ? 61   ILE B CG1   1 
ATOM   1828 C CG2   . ILE B 1 61  ? 22.925 -31.614 148.356 1.00 25.01 ? 61   ILE B CG2   1 
ATOM   1829 C CD1   . ILE B 1 61  ? 21.313 -34.329 150.532 1.00 24.52 ? 61   ILE B CD1   1 
ATOM   1830 N N     . MET B 1 62  ? 26.230 -32.366 148.855 1.00 24.89 ? 62   MET B N     1 
ATOM   1831 C CA    . MET B 1 62  ? 27.379 -31.496 148.606 1.00 24.56 ? 62   MET B CA    1 
ATOM   1832 C C     . MET B 1 62  ? 27.489 -31.194 147.120 1.00 24.42 ? 62   MET B C     1 
ATOM   1833 O O     . MET B 1 62  ? 27.053 -31.992 146.298 1.00 23.77 ? 62   MET B O     1 
ATOM   1834 C CB    . MET B 1 62  ? 28.653 -32.182 149.078 1.00 26.11 ? 62   MET B CB    1 
ATOM   1835 C CG    . MET B 1 62  ? 29.805 -31.234 149.340 1.00 29.16 ? 62   MET B CG    1 
ATOM   1836 S SD    . MET B 1 62  ? 31.291 -32.100 149.928 1.00 34.36 ? 62   MET B SD    1 
ATOM   1837 C CE    . MET B 1 62  ? 30.857 -32.540 151.647 1.00 30.08 ? 62   MET B CE    1 
ATOM   1838 N N     . ARG B 1 63  ? 28.101 -30.064 146.771 1.00 24.32 ? 63   ARG B N     1 
ATOM   1839 C CA    . ARG B 1 63  ? 28.240 -29.659 145.365 1.00 23.68 ? 63   ARG B CA    1 
ATOM   1840 C C     . ARG B 1 63  ? 29.586 -29.007 145.021 1.00 23.74 ? 63   ARG B C     1 
ATOM   1841 O O     . ARG B 1 63  ? 30.200 -28.346 145.857 1.00 24.42 ? 63   ARG B O     1 
ATOM   1842 C CB    . ARG B 1 63  ? 27.136 -28.656 144.990 1.00 20.11 ? 63   ARG B CB    1 
ATOM   1843 C CG    . ARG B 1 63  ? 25.736 -29.198 145.037 1.00 19.82 ? 63   ARG B CG    1 
ATOM   1844 C CD    . ARG B 1 63  ? 24.716 -28.126 144.741 1.00 19.05 ? 63   ARG B CD    1 
ATOM   1845 N NE    . ARG B 1 63  ? 23.357 -28.661 144.616 1.00 20.69 ? 63   ARG B NE    1 
ATOM   1846 C CZ    . ARG B 1 63  ? 22.545 -28.922 145.638 1.00 20.61 ? 63   ARG B CZ    1 
ATOM   1847 N NH1   . ARG B 1 63  ? 22.940 -28.700 146.886 1.00 22.27 ? 63   ARG B NH1   1 
ATOM   1848 N NH2   . ARG B 1 63  ? 21.337 -29.412 145.411 1.00 19.96 ? 63   ARG B NH2   1 
ATOM   1849 N N     . ILE B 1 64  ? 30.044 -29.219 143.792 1.00 23.59 ? 64   ILE B N     1 
ATOM   1850 C CA    . ILE B 1 64  ? 31.267 -28.590 143.316 1.00 23.06 ? 64   ILE B CA    1 
ATOM   1851 C C     . ILE B 1 64  ? 30.935 -27.900 142.001 1.00 23.78 ? 64   ILE B C     1 
ATOM   1852 O O     . ILE B 1 64  ? 29.937 -28.210 141.334 1.00 23.17 ? 64   ILE B O     1 
ATOM   1853 C CB    . ILE B 1 64  ? 32.470 -29.552 143.121 1.00 22.76 ? 64   ILE B CB    1 
ATOM   1854 C CG1   . ILE B 1 64  ? 32.148 -30.647 142.115 1.00 22.09 ? 64   ILE B CG1   1 
ATOM   1855 C CG2   . ILE B 1 64  ? 32.925 -30.118 144.446 1.00 22.80 ? 64   ILE B CG2   1 
ATOM   1856 C CD1   . ILE B 1 64  ? 33.316 -31.582 141.861 1.00 22.14 ? 64   ILE B CD1   1 
ATOM   1857 N N     . ARG B 1 65  ? 31.754 -26.923 141.669 1.00 24.22 ? 65   ARG B N     1 
ATOM   1858 C CA    . ARG B 1 65  ? 31.579 -26.137 140.475 1.00 25.09 ? 65   ARG B CA    1 
ATOM   1859 C C     . ARG B 1 65  ? 32.094 -26.805 139.201 1.00 25.37 ? 65   ARG B C     1 
ATOM   1860 O O     . ARG B 1 65  ? 31.542 -26.588 138.129 1.00 25.11 ? 65   ARG B O     1 
ATOM   1861 C CB    . ARG B 1 65  ? 32.269 -24.794 140.682 1.00 24.65 ? 65   ARG B CB    1 
ATOM   1862 C CG    . ARG B 1 65  ? 31.766 -23.743 139.774 1.00 25.44 ? 65   ARG B CG    1 
ATOM   1863 C CD    . ARG B 1 65  ? 32.542 -22.463 139.884 1.00 25.33 ? 65   ARG B CD    1 
ATOM   1864 N NE    . ARG B 1 65  ? 32.085 -21.604 138.802 1.00 27.15 ? 65   ARG B NE    1 
ATOM   1865 C CZ    . ARG B 1 65  ? 32.691 -20.503 138.393 1.00 26.80 ? 65   ARG B CZ    1 
ATOM   1866 N NH1   . ARG B 1 65  ? 33.809 -20.093 138.976 1.00 27.87 ? 65   ARG B NH1   1 
ATOM   1867 N NH2   . ARG B 1 65  ? 32.153 -19.813 137.401 1.00 26.30 ? 65   ARG B NH2   1 
ATOM   1868 N N     . GLU B 1 66  ? 33.179 -27.563 139.304 1.00 26.45 ? 66   GLU B N     1 
ATOM   1869 C CA    . GLU B 1 66  ? 33.744 -28.241 138.146 1.00 29.69 ? 66   GLU B CA    1 
ATOM   1870 C C     . GLU B 1 66  ? 34.290 -29.599 138.534 1.00 29.40 ? 66   GLU B C     1 
ATOM   1871 O O     . GLU B 1 66  ? 35.123 -29.686 139.426 1.00 32.56 ? 66   GLU B O     1 
ATOM   1872 C CB    . GLU B 1 66  ? 34.887 -27.425 137.523 1.00 33.43 ? 66   GLU B CB    1 
ATOM   1873 C CG    . GLU B 1 66  ? 34.491 -26.056 136.942 1.00 40.39 ? 66   GLU B CG    1 
ATOM   1874 C CD    . GLU B 1 66  ? 33.324 -26.114 135.942 1.00 43.59 ? 66   GLU B CD    1 
ATOM   1875 O OE1   . GLU B 1 66  ? 33.208 -27.129 135.211 1.00 44.49 ? 66   GLU B OE1   1 
ATOM   1876 O OE2   . GLU B 1 66  ? 32.523 -25.141 135.897 1.00 44.39 ? 66   GLU B OE2   1 
ATOM   1877 N N     . PRO B 1 67  ? 33.751 -30.688 137.961 1.00 28.61 ? 67   PRO B N     1 
ATOM   1878 C CA    . PRO B 1 67  ? 32.655 -30.736 136.980 1.00 27.55 ? 67   PRO B CA    1 
ATOM   1879 C C     . PRO B 1 67  ? 31.411 -30.373 137.769 1.00 26.86 ? 67   PRO B C     1 
ATOM   1880 O O     . PRO B 1 67  ? 31.312 -30.722 138.947 1.00 26.47 ? 67   PRO B O     1 
ATOM   1881 C CB    . PRO B 1 67  ? 32.616 -32.217 136.586 1.00 25.68 ? 67   PRO B CB    1 
ATOM   1882 C CG    . PRO B 1 67  ? 34.023 -32.658 136.779 1.00 26.13 ? 67   PRO B CG    1 
ATOM   1883 C CD    . PRO B 1 67  ? 34.394 -32.008 138.086 1.00 27.53 ? 67   PRO B CD    1 
ATOM   1884 N N     . LYS B 1 68  ? 30.478 -29.656 137.162 1.00 26.07 ? 68   LYS B N     1 
ATOM   1885 C CA    . LYS B 1 68  ? 29.283 -29.264 137.898 1.00 24.78 ? 68   LYS B CA    1 
ATOM   1886 C C     . LYS B 1 68  ? 28.495 -30.499 138.327 1.00 24.43 ? 68   LYS B C     1 
ATOM   1887 O O     . LYS B 1 68  ? 27.840 -31.129 137.501 1.00 24.17 ? 68   LYS B O     1 
ATOM   1888 C CB    . LYS B 1 68  ? 28.402 -28.348 137.052 1.00 25.60 ? 68   LYS B CB    1 
ATOM   1889 C CG    . LYS B 1 68  ? 27.288 -27.705 137.850 1.00 27.18 ? 68   LYS B CG    1 
ATOM   1890 C CD    . LYS B 1 68  ? 26.215 -27.145 136.969 1.00 29.84 ? 68   LYS B CD    1 
ATOM   1891 C CE    . LYS B 1 68  ? 25.072 -26.663 137.831 1.00 33.94 ? 68   LYS B CE    1 
ATOM   1892 N NZ    . LYS B 1 68  ? 23.863 -26.326 137.028 1.00 36.90 ? 68   LYS B NZ    1 
ATOM   1893 N N     . THR B 1 69  ? 28.549 -30.837 139.612 1.00 23.32 ? 69   THR B N     1 
ATOM   1894 C CA    . THR B 1 69  ? 27.833 -32.007 140.119 1.00 23.71 ? 69   THR B CA    1 
ATOM   1895 C C     . THR B 1 69  ? 27.281 -31.803 141.528 1.00 23.56 ? 69   THR B C     1 
ATOM   1896 O O     . THR B 1 69  ? 27.521 -30.771 142.160 1.00 24.24 ? 69   THR B O     1 
ATOM   1897 C CB    . THR B 1 69  ? 28.768 -33.240 140.203 1.00 23.64 ? 69   THR B CB    1 
ATOM   1898 O OG1   . THR B 1 69  ? 29.975 -32.866 140.876 1.00 24.46 ? 69   THR B OG1   1 
ATOM   1899 C CG2   . THR B 1 69  ? 29.096 -33.794 138.827 1.00 23.45 ? 69   THR B CG2   1 
ATOM   1900 N N     . THR B 1 70  ? 26.569 -32.820 142.013 1.00 22.18 ? 70   THR B N     1 
ATOM   1901 C CA    . THR B 1 70  ? 26.003 -32.851 143.358 1.00 20.75 ? 70   THR B CA    1 
ATOM   1902 C C     . THR B 1 70  ? 26.292 -34.281 143.812 1.00 20.59 ? 70   THR B C     1 
ATOM   1903 O O     . THR B 1 70  ? 26.168 -35.206 143.015 1.00 22.34 ? 70   THR B O     1 
ATOM   1904 C CB    . THR B 1 70  ? 24.457 -32.610 143.364 1.00 20.15 ? 70   THR B CB    1 
ATOM   1905 O OG1   . THR B 1 70  ? 24.159 -31.288 142.909 1.00 20.06 ? 70   THR B OG1   1 
ATOM   1906 C CG2   . THR B 1 70  ? 23.893 -32.764 144.758 1.00 18.25 ? 70   THR B CG2   1 
ATOM   1907 N N     . ALA B 1 71  ? 26.749 -34.450 145.052 1.00 20.75 ? 71   ALA B N     1 
ATOM   1908 C CA    . ALA B 1 71  ? 27.054 -35.763 145.624 1.00 19.12 ? 71   ALA B CA    1 
ATOM   1909 C C     . ALA B 1 71  ? 26.121 -36.012 146.789 1.00 20.13 ? 71   ALA B C     1 
ATOM   1910 O O     . ALA B 1 71  ? 25.764 -35.086 147.516 1.00 19.37 ? 71   ALA B O     1 
ATOM   1911 C CB    . ALA B 1 71  ? 28.479 -35.819 146.123 1.00 16.30 ? 71   ALA B CB    1 
ATOM   1912 N N     . LEU B 1 72  ? 25.690 -37.257 146.932 1.00 20.47 ? 72   LEU B N     1 
ATOM   1913 C CA    . LEU B 1 72  ? 24.834 -37.655 148.038 1.00 20.07 ? 72   LEU B CA    1 
ATOM   1914 C C     . LEU B 1 72  ? 25.791 -38.553 148.788 1.00 19.29 ? 72   LEU B C     1 
ATOM   1915 O O     . LEU B 1 72  ? 26.235 -39.568 148.262 1.00 19.20 ? 72   LEU B O     1 
ATOM   1916 C CB    . LEU B 1 72  ? 23.609 -38.440 147.545 1.00 21.14 ? 72   LEU B CB    1 
ATOM   1917 C CG    . LEU B 1 72  ? 22.677 -37.769 146.528 1.00 20.21 ? 72   LEU B CG    1 
ATOM   1918 C CD1   . LEU B 1 72  ? 21.481 -38.653 146.267 1.00 20.40 ? 72   LEU B CD1   1 
ATOM   1919 C CD2   . LEU B 1 72  ? 22.219 -36.437 147.052 1.00 21.05 ? 72   LEU B CD2   1 
ATOM   1920 N N     . ILE B 1 73  ? 26.207 -38.108 149.964 1.00 20.02 ? 73   ILE B N     1 
ATOM   1921 C CA    . ILE B 1 73  ? 27.170 -38.853 150.774 1.00 18.79 ? 73   ILE B CA    1 
ATOM   1922 C C     . ILE B 1 73  ? 26.456 -39.445 151.976 1.00 19.07 ? 73   ILE B C     1 
ATOM   1923 O O     . ILE B 1 73  ? 25.800 -38.726 152.738 1.00 20.61 ? 73   ILE B O     1 
ATOM   1924 C CB    . ILE B 1 73  ? 28.360 -37.923 151.177 1.00 17.22 ? 73   ILE B CB    1 
ATOM   1925 C CG1   . ILE B 1 73  ? 29.097 -37.482 149.912 1.00 14.41 ? 73   ILE B CG1   1 
ATOM   1926 C CG2   . ILE B 1 73  ? 29.336 -38.637 152.069 1.00 18.26 ? 73   ILE B CG2   1 
ATOM   1927 C CD1   . ILE B 1 73  ? 29.844 -36.191 150.047 1.00 15.44 ? 73   ILE B CD1   1 
ATOM   1928 N N     . PHE B 1 74  ? 26.556 -40.761 152.118 1.00 18.43 ? 74   PHE B N     1 
ATOM   1929 C CA    . PHE B 1 74  ? 25.886 -41.474 153.191 1.00 16.84 ? 74   PHE B CA    1 
ATOM   1930 C C     . PHE B 1 74  ? 26.861 -41.928 154.272 1.00 17.72 ? 74   PHE B C     1 
ATOM   1931 O O     . PHE B 1 74  ? 28.059 -42.033 154.027 1.00 19.40 ? 74   PHE B O     1 
ATOM   1932 C CB    . PHE B 1 74  ? 25.132 -42.660 152.582 1.00 15.16 ? 74   PHE B CB    1 
ATOM   1933 C CG    . PHE B 1 74  ? 24.145 -42.260 151.498 1.00 13.14 ? 74   PHE B CG    1 
ATOM   1934 C CD1   . PHE B 1 74  ? 24.579 -41.971 150.213 1.00 12.31 ? 74   PHE B CD1   1 
ATOM   1935 C CD2   . PHE B 1 74  ? 22.796 -42.105 151.786 1.00 12.85 ? 74   PHE B CD2   1 
ATOM   1936 C CE1   . PHE B 1 74  ? 23.696 -41.528 149.235 1.00 9.98  ? 74   PHE B CE1   1 
ATOM   1937 C CE2   . PHE B 1 74  ? 21.908 -41.662 150.814 1.00 11.93 ? 74   PHE B CE2   1 
ATOM   1938 C CZ    . PHE B 1 74  ? 22.366 -41.371 149.536 1.00 10.25 ? 74   PHE B CZ    1 
ATOM   1939 N N     . ALA B 1 75  ? 26.346 -42.168 155.470 1.00 18.21 ? 75   ALA B N     1 
ATOM   1940 C CA    . ALA B 1 75  ? 27.132 -42.615 156.620 1.00 19.51 ? 75   ALA B CA    1 
ATOM   1941 C C     . ALA B 1 75  ? 27.869 -43.943 156.406 1.00 21.07 ? 75   ALA B C     1 
ATOM   1942 O O     . ALA B 1 75  ? 28.905 -44.209 157.032 1.00 22.50 ? 75   ALA B O     1 
ATOM   1943 C CB    . ALA B 1 75  ? 26.228 -42.729 157.827 1.00 18.77 ? 75   ALA B CB    1 
ATOM   1944 N N     . SER B 1 76  ? 27.299 -44.800 155.569 1.00 22.30 ? 76   SER B N     1 
ATOM   1945 C CA    . SER B 1 76  ? 27.881 -46.096 155.249 1.00 22.48 ? 76   SER B CA    1 
ATOM   1946 C C     . SER B 1 76  ? 29.175 -45.988 154.433 1.00 23.78 ? 76   SER B C     1 
ATOM   1947 O O     . SER B 1 76  ? 29.897 -46.977 154.260 1.00 25.25 ? 76   SER B O     1 
ATOM   1948 C CB    . SER B 1 76  ? 26.871 -46.893 154.440 1.00 22.23 ? 76   SER B CB    1 
ATOM   1949 O OG    . SER B 1 76  ? 26.619 -46.250 153.204 1.00 21.50 ? 76   SER B OG    1 
ATOM   1950 N N     . GLY B 1 77  ? 29.467 -44.797 153.923 1.00 24.34 ? 77   GLY B N     1 
ATOM   1951 C CA    . GLY B 1 77  ? 30.654 -44.633 153.110 1.00 24.07 ? 77   GLY B CA    1 
ATOM   1952 C C     . GLY B 1 77  ? 30.313 -44.682 151.629 1.00 24.96 ? 77   GLY B C     1 
ATOM   1953 O O     . GLY B 1 77  ? 31.177 -44.491 150.776 1.00 26.74 ? 77   GLY B O     1 
ATOM   1954 N N     . LYS B 1 78  ? 29.066 -44.983 151.301 1.00 24.75 ? 78   LYS B N     1 
ATOM   1955 C CA    . LYS B 1 78  ? 28.666 -45.017 149.906 1.00 25.80 ? 78   LYS B CA    1 
ATOM   1956 C C     . LYS B 1 78  ? 28.311 -43.600 149.471 1.00 24.87 ? 78   LYS B C     1 
ATOM   1957 O O     . LYS B 1 78  ? 27.842 -42.786 150.271 1.00 24.35 ? 78   LYS B O     1 
ATOM   1958 C CB    . LYS B 1 78  ? 27.475 -45.956 149.700 1.00 28.12 ? 78   LYS B CB    1 
ATOM   1959 C CG    . LYS B 1 78  ? 27.831 -47.436 149.769 1.00 30.86 ? 78   LYS B CG    1 
ATOM   1960 C CD    . LYS B 1 78  ? 26.863 -48.164 150.689 1.00 35.66 ? 78   LYS B CD    1 
ATOM   1961 C CE    . LYS B 1 78  ? 27.206 -49.660 150.862 1.00 37.58 ? 78   LYS B CE    1 
ATOM   1962 N NZ    . LYS B 1 78  ? 26.422 -50.265 152.003 1.00 36.17 ? 78   LYS B NZ    1 
ATOM   1963 N N     . MET B 1 79  ? 28.532 -43.306 148.199 1.00 24.31 ? 79   MET B N     1 
ATOM   1964 C CA    . MET B 1 79  ? 28.241 -41.983 147.678 1.00 23.46 ? 79   MET B CA    1 
ATOM   1965 C C     . MET B 1 79  ? 27.666 -42.036 146.254 1.00 21.59 ? 79   MET B C     1 
ATOM   1966 O O     . MET B 1 79  ? 28.053 -42.887 145.450 1.00 20.76 ? 79   MET B O     1 
ATOM   1967 C CB    . MET B 1 79  ? 29.526 -41.159 147.709 1.00 24.85 ? 79   MET B CB    1 
ATOM   1968 C CG    . MET B 1 79  ? 29.407 -39.790 147.110 1.00 28.44 ? 79   MET B CG    1 
ATOM   1969 S SD    . MET B 1 79  ? 31.009 -39.264 146.515 1.00 31.39 ? 79   MET B SD    1 
ATOM   1970 C CE    . MET B 1 79  ? 31.786 -38.977 148.002 1.00 30.71 ? 79   MET B CE    1 
ATOM   1971 N N     . VAL B 1 80  ? 26.696 -41.168 145.983 1.00 19.70 ? 80   VAL B N     1 
ATOM   1972 C CA    . VAL B 1 80  ? 26.060 -41.062 144.674 1.00 18.33 ? 80   VAL B CA    1 
ATOM   1973 C C     . VAL B 1 80  ? 26.484 -39.713 144.070 1.00 20.15 ? 80   VAL B C     1 
ATOM   1974 O O     . VAL B 1 80  ? 26.447 -38.670 144.749 1.00 20.09 ? 80   VAL B O     1 
ATOM   1975 C CB    . VAL B 1 80  ? 24.503 -41.106 144.778 1.00 17.46 ? 80   VAL B CB    1 
ATOM   1976 C CG1   . VAL B 1 80  ? 23.862 -40.925 143.410 1.00 12.11 ? 80   VAL B CG1   1 
ATOM   1977 C CG2   . VAL B 1 80  ? 24.049 -42.405 145.423 1.00 16.10 ? 80   VAL B CG2   1 
ATOM   1978 N N     . CYS B 1 81  ? 26.894 -39.735 142.805 1.00 20.06 ? 81   CYS B N     1 
ATOM   1979 C CA    . CYS B 1 81  ? 27.319 -38.533 142.108 1.00 19.27 ? 81   CYS B CA    1 
ATOM   1980 C C     . CYS B 1 81  ? 26.368 -38.350 140.919 1.00 18.46 ? 81   CYS B C     1 
ATOM   1981 O O     . CYS B 1 81  ? 26.154 -39.302 140.168 1.00 18.38 ? 81   CYS B O     1 
ATOM   1982 C CB    . CYS B 1 81  ? 28.778 -38.695 141.660 1.00 19.52 ? 81   CYS B CB    1 
ATOM   1983 S SG    . CYS B 1 81  ? 29.441 -37.266 140.788 1.00 25.15 ? 81   CYS B SG    1 
ATOM   1984 N N     . THR B 1 82  ? 25.756 -37.162 140.794 1.00 17.24 ? 82   THR B N     1 
ATOM   1985 C CA    . THR B 1 82  ? 24.794 -36.845 139.722 1.00 16.29 ? 82   THR B CA    1 
ATOM   1986 C C     . THR B 1 82  ? 25.146 -35.518 139.055 1.00 16.62 ? 82   THR B C     1 
ATOM   1987 O O     . THR B 1 82  ? 25.805 -34.687 139.665 1.00 17.40 ? 82   THR B O     1 
ATOM   1988 C CB    . THR B 1 82  ? 23.369 -36.636 140.290 1.00 17.41 ? 82   THR B CB    1 
ATOM   1989 O OG1   . THR B 1 82  ? 23.395 -35.572 141.248 1.00 20.25 ? 82   THR B OG1   1 
ATOM   1990 C CG2   . THR B 1 82  ? 22.845 -37.860 140.981 1.00 19.83 ? 82   THR B CG2   1 
ATOM   1991 N N     . GLY B 1 83  ? 24.694 -35.298 137.825 1.00 15.86 ? 83   GLY B N     1 
ATOM   1992 C CA    . GLY B 1 83  ? 24.953 -34.020 137.180 1.00 16.28 ? 83   GLY B CA    1 
ATOM   1993 C C     . GLY B 1 83  ? 26.002 -33.902 136.088 1.00 18.29 ? 83   GLY B C     1 
ATOM   1994 O O     . GLY B 1 83  ? 25.866 -33.050 135.216 1.00 19.63 ? 83   GLY B O     1 
ATOM   1995 N N     . ALA B 1 84  ? 27.051 -34.721 136.122 1.00 18.57 ? 84   ALA B N     1 
ATOM   1996 C CA    . ALA B 1 84  ? 28.098 -34.651 135.102 1.00 18.42 ? 84   ALA B CA    1 
ATOM   1997 C C     . ALA B 1 84  ? 27.564 -34.886 133.699 1.00 18.55 ? 84   ALA B C     1 
ATOM   1998 O O     . ALA B 1 84  ? 26.568 -35.580 133.497 1.00 20.05 ? 84   ALA B O     1 
ATOM   1999 C CB    . ALA B 1 84  ? 29.206 -35.647 135.409 1.00 15.66 ? 84   ALA B CB    1 
ATOM   2000 N N     . LYS B 1 85  ? 28.275 -34.342 132.727 1.00 19.90 ? 85   LYS B N     1 
ATOM   2001 C CA    . LYS B 1 85  ? 27.920 -34.471 131.319 1.00 20.24 ? 85   LYS B CA    1 
ATOM   2002 C C     . LYS B 1 85  ? 28.577 -35.668 130.636 1.00 20.04 ? 85   LYS B C     1 
ATOM   2003 O O     . LYS B 1 85  ? 28.319 -35.919 129.465 1.00 21.75 ? 85   LYS B O     1 
ATOM   2004 C CB    . LYS B 1 85  ? 28.273 -33.189 130.558 1.00 19.55 ? 85   LYS B CB    1 
ATOM   2005 C CG    . LYS B 1 85  ? 27.512 -31.955 131.018 1.00 18.31 ? 85   LYS B CG    1 
ATOM   2006 C CD    . LYS B 1 85  ? 26.035 -32.164 130.837 1.00 20.74 ? 85   LYS B CD    1 
ATOM   2007 C CE    . LYS B 1 85  ? 25.261 -30.855 130.872 1.00 21.93 ? 85   LYS B CE    1 
ATOM   2008 N NZ    . LYS B 1 85  ? 23.788 -31.115 130.767 1.00 24.84 ? 85   LYS B NZ    1 
ATOM   2009 N N     . SER B 1 86  ? 29.437 -36.394 131.342 1.00 19.92 ? 86   SER B N     1 
ATOM   2010 C CA    . SER B 1 86  ? 30.073 -37.571 130.759 1.00 20.82 ? 86   SER B CA    1 
ATOM   2011 C C     . SER B 1 86  ? 30.544 -38.493 131.857 1.00 21.28 ? 86   SER B C     1 
ATOM   2012 O O     . SER B 1 86  ? 30.663 -38.085 133.013 1.00 22.02 ? 86   SER B O     1 
ATOM   2013 C CB    . SER B 1 86  ? 31.270 -37.186 129.900 1.00 21.12 ? 86   SER B CB    1 
ATOM   2014 O OG    . SER B 1 86  ? 32.364 -36.814 130.722 1.00 23.35 ? 86   SER B OG    1 
ATOM   2015 N N     . GLU B 1 87  ? 30.866 -39.720 131.472 1.00 21.22 ? 87   GLU B N     1 
ATOM   2016 C CA    . GLU B 1 87  ? 31.339 -40.735 132.390 1.00 21.14 ? 87   GLU B CA    1 
ATOM   2017 C C     . GLU B 1 87  ? 32.622 -40.287 133.068 1.00 21.41 ? 87   GLU B C     1 
ATOM   2018 O O     . GLU B 1 87  ? 32.774 -40.443 134.279 1.00 21.08 ? 87   GLU B O     1 
ATOM   2019 C CB    . GLU B 1 87  ? 31.588 -42.041 131.643 1.00 21.59 ? 87   GLU B CB    1 
ATOM   2020 C CG    . GLU B 1 87  ? 30.365 -42.635 130.953 1.00 22.59 ? 87   GLU B CG    1 
ATOM   2021 C CD    . GLU B 1 87  ? 30.211 -42.204 129.500 1.00 23.31 ? 87   GLU B CD    1 
ATOM   2022 O OE1   . GLU B 1 87  ? 30.668 -41.110 129.129 1.00 24.12 ? 87   GLU B OE1   1 
ATOM   2023 O OE2   . GLU B 1 87  ? 29.625 -42.969 128.715 1.00 24.08 ? 87   GLU B OE2   1 
ATOM   2024 N N     . ASP B 1 88  ? 33.535 -39.720 132.282 1.00 21.75 ? 88   ASP B N     1 
ATOM   2025 C CA    . ASP B 1 88  ? 34.810 -39.259 132.801 1.00 21.50 ? 88   ASP B CA    1 
ATOM   2026 C C     . ASP B 1 88  ? 34.610 -38.138 133.798 1.00 21.67 ? 88   ASP B C     1 
ATOM   2027 O O     . ASP B 1 88  ? 35.207 -38.137 134.873 1.00 22.85 ? 88   ASP B O     1 
ATOM   2028 C CB    . ASP B 1 88  ? 35.731 -38.803 131.670 1.00 21.93 ? 88   ASP B CB    1 
ATOM   2029 C CG    . ASP B 1 88  ? 36.458 -39.964 130.990 1.00 25.06 ? 88   ASP B CG    1 
ATOM   2030 O OD1   . ASP B 1 88  ? 36.538 -41.070 131.580 1.00 27.20 ? 88   ASP B OD1   1 
ATOM   2031 O OD2   . ASP B 1 88  ? 36.976 -39.766 129.864 1.00 25.25 ? 88   ASP B OD2   1 
ATOM   2032 N N     . PHE B 1 89  ? 33.764 -37.181 133.452 1.00 20.99 ? 89   PHE B N     1 
ATOM   2033 C CA    . PHE B 1 89  ? 33.498 -36.068 134.350 1.00 20.31 ? 89   PHE B CA    1 
ATOM   2034 C C     . PHE B 1 89  ? 32.926 -36.556 135.673 1.00 20.50 ? 89   PHE B C     1 
ATOM   2035 O O     . PHE B 1 89  ? 33.278 -36.054 136.740 1.00 21.46 ? 89   PHE B O     1 
ATOM   2036 C CB    . PHE B 1 89  ? 32.542 -35.075 133.693 1.00 19.97 ? 89   PHE B CB    1 
ATOM   2037 C CG    . PHE B 1 89  ? 33.201 -34.196 132.683 1.00 18.09 ? 89   PHE B CG    1 
ATOM   2038 C CD1   . PHE B 1 89  ? 34.466 -33.680 132.926 1.00 18.08 ? 89   PHE B CD1   1 
ATOM   2039 C CD2   . PHE B 1 89  ? 32.556 -33.873 131.504 1.00 19.02 ? 89   PHE B CD2   1 
ATOM   2040 C CE1   . PHE B 1 89  ? 35.076 -32.855 132.011 1.00 20.02 ? 89   PHE B CE1   1 
ATOM   2041 C CE2   . PHE B 1 89  ? 33.146 -33.050 130.575 1.00 18.43 ? 89   PHE B CE2   1 
ATOM   2042 C CZ    . PHE B 1 89  ? 34.406 -32.536 130.825 1.00 20.80 ? 89   PHE B CZ    1 
ATOM   2043 N N     . SER B 1 90  ? 32.082 -37.575 135.597 1.00 20.41 ? 90   SER B N     1 
ATOM   2044 C CA    . SER B 1 90  ? 31.451 -38.150 136.770 1.00 19.45 ? 90   SER B CA    1 
ATOM   2045 C C     . SER B 1 90  ? 32.490 -38.748 137.715 1.00 19.44 ? 90   SER B C     1 
ATOM   2046 O O     . SER B 1 90  ? 32.426 -38.541 138.923 1.00 20.16 ? 90   SER B O     1 
ATOM   2047 C CB    . SER B 1 90  ? 30.444 -39.203 136.333 1.00 18.51 ? 90   SER B CB    1 
ATOM   2048 O OG    . SER B 1 90  ? 29.608 -39.577 137.404 1.00 20.93 ? 90   SER B OG    1 
ATOM   2049 N N     . LYS B 1 91  ? 33.472 -39.450 137.161 1.00 20.22 ? 91   LYS B N     1 
ATOM   2050 C CA    . LYS B 1 91  ? 34.531 -40.070 137.967 1.00 20.58 ? 91   LYS B CA    1 
ATOM   2051 C C     . LYS B 1 91  ? 35.419 -39.016 138.610 1.00 20.42 ? 91   LYS B C     1 
ATOM   2052 O O     . LYS B 1 91  ? 35.795 -39.121 139.782 1.00 20.09 ? 91   LYS B O     1 
ATOM   2053 C CB    . LYS B 1 91  ? 35.377 -40.994 137.103 1.00 21.36 ? 91   LYS B CB    1 
ATOM   2054 C CG    . LYS B 1 91  ? 36.320 -41.854 137.878 1.00 22.60 ? 91   LYS B CG    1 
ATOM   2055 C CD    . LYS B 1 91  ? 36.723 -43.024 137.034 1.00 24.04 ? 91   LYS B CD    1 
ATOM   2056 C CE    . LYS B 1 91  ? 37.617 -43.934 137.836 1.00 29.58 ? 91   LYS B CE    1 
ATOM   2057 N NZ    . LYS B 1 91  ? 38.086 -45.137 137.081 1.00 34.55 ? 91   LYS B NZ    1 
ATOM   2058 N N     . MET B 1 92  ? 35.755 -38.005 137.819 1.00 19.80 ? 92   MET B N     1 
ATOM   2059 C CA    . MET B 1 92  ? 36.566 -36.897 138.273 1.00 19.47 ? 92   MET B CA    1 
ATOM   2060 C C     . MET B 1 92  ? 35.811 -36.183 139.389 1.00 20.45 ? 92   MET B C     1 
ATOM   2061 O O     . MET B 1 92  ? 36.387 -35.826 140.416 1.00 21.13 ? 92   MET B O     1 
ATOM   2062 C CB    . MET B 1 92  ? 36.797 -35.921 137.119 1.00 19.72 ? 92   MET B CB    1 
ATOM   2063 C CG    . MET B 1 92  ? 37.571 -36.510 135.958 1.00 19.43 ? 92   MET B CG    1 
ATOM   2064 S SD    . MET B 1 92  ? 37.745 -35.371 134.559 1.00 20.84 ? 92   MET B SD    1 
ATOM   2065 C CE    . MET B 1 92  ? 38.165 -33.844 135.402 1.00 16.90 ? 92   MET B CE    1 
ATOM   2066 N N     . ALA B 1 93  ? 34.522 -35.950 139.170 1.00 19.60 ? 93   ALA B N     1 
ATOM   2067 C CA    . ALA B 1 93  ? 33.701 -35.283 140.163 1.00 19.53 ? 93   ALA B CA    1 
ATOM   2068 C C     . ALA B 1 93  ? 33.736 -36.119 141.440 1.00 20.08 ? 93   ALA B C     1 
ATOM   2069 O O     . ALA B 1 93  ? 34.112 -35.628 142.502 1.00 20.61 ? 93   ALA B O     1 
ATOM   2070 C CB    . ALA B 1 93  ? 32.267 -35.124 139.648 1.00 18.55 ? 93   ALA B CB    1 
ATOM   2071 N N     . ALA B 1 94  ? 33.413 -37.400 141.317 1.00 20.55 ? 94   ALA B N     1 
ATOM   2072 C CA    . ALA B 1 94  ? 33.419 -38.310 142.451 1.00 21.79 ? 94   ALA B CA    1 
ATOM   2073 C C     . ALA B 1 94  ? 34.759 -38.291 143.217 1.00 23.98 ? 94   ALA B C     1 
ATOM   2074 O O     . ALA B 1 94  ? 34.777 -38.192 144.451 1.00 24.69 ? 94   ALA B O     1 
ATOM   2075 C CB    . ALA B 1 94  ? 33.090 -39.713 141.974 1.00 20.77 ? 94   ALA B CB    1 
ATOM   2076 N N     . ARG B 1 95  ? 35.878 -38.373 142.491 1.00 25.72 ? 95   ARG B N     1 
ATOM   2077 C CA    . ARG B 1 95  ? 37.205 -38.350 143.113 1.00 25.52 ? 95   ARG B CA    1 
ATOM   2078 C C     . ARG B 1 95  ? 37.417 -37.054 143.902 1.00 24.47 ? 95   ARG B C     1 
ATOM   2079 O O     . ARG B 1 95  ? 38.050 -37.061 144.946 1.00 24.57 ? 95   ARG B O     1 
ATOM   2080 C CB    . ARG B 1 95  ? 38.315 -38.492 142.070 1.00 28.31 ? 95   ARG B CB    1 
ATOM   2081 C CG    . ARG B 1 95  ? 38.511 -39.870 141.439 1.00 33.27 ? 95   ARG B CG    1 
ATOM   2082 C CD    . ARG B 1 95  ? 39.794 -39.829 140.585 1.00 37.85 ? 95   ARG B CD    1 
ATOM   2083 N NE    . ARG B 1 95  ? 40.040 -40.972 139.696 1.00 40.66 ? 95   ARG B NE    1 
ATOM   2084 C CZ    . ARG B 1 95  ? 40.079 -40.896 138.359 1.00 43.25 ? 95   ARG B CZ    1 
ATOM   2085 N NH1   . ARG B 1 95  ? 39.857 -39.740 137.731 1.00 42.24 ? 95   ARG B NH1   1 
ATOM   2086 N NH2   . ARG B 1 95  ? 40.477 -41.951 137.650 1.00 43.13 ? 95   ARG B NH2   1 
ATOM   2087 N N     . LYS B 1 96  ? 36.918 -35.937 143.395 1.00 23.48 ? 96   LYS B N     1 
ATOM   2088 C CA    . LYS B 1 96  ? 37.057 -34.675 144.108 1.00 24.96 ? 96   LYS B CA    1 
ATOM   2089 C C     . LYS B 1 96  ? 36.318 -34.706 145.446 1.00 24.60 ? 96   LYS B C     1 
ATOM   2090 O O     . LYS B 1 96  ? 36.768 -34.100 146.417 1.00 25.84 ? 96   LYS B O     1 
ATOM   2091 C CB    . LYS B 1 96  ? 36.525 -33.509 143.278 1.00 27.08 ? 96   LYS B CB    1 
ATOM   2092 C CG    . LYS B 1 96  ? 37.322 -33.199 142.030 1.00 30.32 ? 96   LYS B CG    1 
ATOM   2093 C CD    . LYS B 1 96  ? 37.614 -31.712 141.973 1.00 33.72 ? 96   LYS B CD    1 
ATOM   2094 C CE    . LYS B 1 96  ? 37.240 -31.104 140.633 1.00 35.63 ? 96   LYS B CE    1 
ATOM   2095 N NZ    . LYS B 1 96  ? 38.105 -31.543 139.508 1.00 36.71 ? 96   LYS B NZ    1 
ATOM   2096 N N     . TYR B 1 97  ? 35.170 -35.379 145.491 1.00 23.42 ? 97   TYR B N     1 
ATOM   2097 C CA    . TYR B 1 97  ? 34.385 -35.484 146.727 1.00 21.60 ? 97   TYR B CA    1 
ATOM   2098 C C     . TYR B 1 97  ? 35.057 -36.428 147.732 1.00 21.83 ? 97   TYR B C     1 
ATOM   2099 O O     . TYR B 1 97  ? 35.057 -36.171 148.934 1.00 22.23 ? 97   TYR B O     1 
ATOM   2100 C CB    . TYR B 1 97  ? 32.979 -35.967 146.415 1.00 18.64 ? 97   TYR B CB    1 
ATOM   2101 C CG    . TYR B 1 97  ? 32.145 -34.983 145.637 1.00 18.61 ? 97   TYR B CG    1 
ATOM   2102 C CD1   . TYR B 1 97  ? 31.736 -33.778 146.215 1.00 18.01 ? 97   TYR B CD1   1 
ATOM   2103 C CD2   . TYR B 1 97  ? 31.701 -35.279 144.346 1.00 16.58 ? 97   TYR B CD2   1 
ATOM   2104 C CE1   . TYR B 1 97  ? 30.897 -32.901 145.538 1.00 17.72 ? 97   TYR B CE1   1 
ATOM   2105 C CE2   . TYR B 1 97  ? 30.865 -34.405 143.657 1.00 16.37 ? 97   TYR B CE2   1 
ATOM   2106 C CZ    . TYR B 1 97  ? 30.459 -33.221 144.263 1.00 17.50 ? 97   TYR B CZ    1 
ATOM   2107 O OH    . TYR B 1 97  ? 29.571 -32.379 143.630 1.00 18.08 ? 97   TYR B OH    1 
ATOM   2108 N N     . ALA B 1 98  ? 35.635 -37.519 147.236 1.00 23.18 ? 98   ALA B N     1 
ATOM   2109 C CA    . ALA B 1 98  ? 36.349 -38.473 148.086 1.00 23.94 ? 98   ALA B CA    1 
ATOM   2110 C C     . ALA B 1 98  ? 37.559 -37.785 148.736 1.00 25.02 ? 98   ALA B C     1 
ATOM   2111 O O     . ALA B 1 98  ? 37.897 -38.067 149.878 1.00 26.64 ? 98   ALA B O     1 
ATOM   2112 C CB    . ALA B 1 98  ? 36.810 -39.662 147.257 1.00 22.36 ? 98   ALA B CB    1 
ATOM   2113 N N     . ARG B 1 99  ? 38.205 -36.885 147.995 1.00 26.42 ? 99   ARG B N     1 
ATOM   2114 C CA    . ARG B 1 99  ? 39.364 -36.140 148.483 1.00 27.03 ? 99   ARG B CA    1 
ATOM   2115 C C     . ARG B 1 99  ? 38.950 -35.081 149.505 1.00 26.08 ? 99   ARG B C     1 
ATOM   2116 O O     . ARG B 1 99  ? 39.702 -34.765 150.432 1.00 23.95 ? 99   ARG B O     1 
ATOM   2117 C CB    . ARG B 1 99  ? 40.110 -35.505 147.314 1.00 29.10 ? 99   ARG B CB    1 
ATOM   2118 C CG    . ARG B 1 99  ? 41.406 -34.823 147.715 1.00 36.06 ? 99   ARG B CG    1 
ATOM   2119 C CD    . ARG B 1 99  ? 42.324 -35.782 148.464 1.00 41.75 ? 99   ARG B CD    1 
ATOM   2120 N NE    . ARG B 1 99  ? 42.598 -35.343 149.835 1.00 45.73 ? 99   ARG B NE    1 
ATOM   2121 C CZ    . ARG B 1 99  ? 43.266 -36.061 150.739 1.00 47.23 ? 99   ARG B CZ    1 
ATOM   2122 N NH1   . ARG B 1 99  ? 43.726 -37.266 150.434 1.00 47.87 ? 99   ARG B NH1   1 
ATOM   2123 N NH2   . ARG B 1 99  ? 43.527 -35.550 151.935 1.00 47.55 ? 99   ARG B NH2   1 
ATOM   2124 N N     . ILE B 1 100 ? 37.761 -34.520 149.310 1.00 26.41 ? 100  ILE B N     1 
ATOM   2125 C CA    . ILE B 1 100 ? 37.204 -33.532 150.231 1.00 27.78 ? 100  ILE B CA    1 
ATOM   2126 C C     . ILE B 1 100 ? 36.939 -34.233 151.571 1.00 29.91 ? 100  ILE B C     1 
ATOM   2127 O O     . ILE B 1 100 ? 37.279 -33.713 152.634 1.00 30.56 ? 100  ILE B O     1 
ATOM   2128 C CB    . ILE B 1 100 ? 35.860 -32.945 149.717 1.00 24.94 ? 100  ILE B CB    1 
ATOM   2129 C CG1   . ILE B 1 100 ? 36.083 -31.988 148.552 1.00 22.97 ? 100  ILE B CG1   1 
ATOM   2130 C CG2   . ILE B 1 100 ? 35.134 -32.227 150.834 1.00 23.57 ? 100  ILE B CG2   1 
ATOM   2131 C CD1   . ILE B 1 100 ? 34.796 -31.416 148.007 1.00 23.14 ? 100  ILE B CD1   1 
ATOM   2132 N N     . VAL B 1 101 ? 36.340 -35.419 151.514 1.00 31.85 ? 101  VAL B N     1 
ATOM   2133 C CA    . VAL B 1 101 ? 36.045 -36.188 152.723 1.00 33.67 ? 101  VAL B CA    1 
ATOM   2134 C C     . VAL B 1 101 ? 37.348 -36.605 153.442 1.00 34.56 ? 101  VAL B C     1 
ATOM   2135 O O     . VAL B 1 101 ? 37.407 -36.612 154.675 1.00 34.62 ? 101  VAL B O     1 
ATOM   2136 C CB    . VAL B 1 101 ? 35.139 -37.426 152.401 1.00 33.71 ? 101  VAL B CB    1 
ATOM   2137 C CG1   . VAL B 1 101 ? 34.923 -38.278 153.652 1.00 33.07 ? 101  VAL B CG1   1 
ATOM   2138 C CG2   . VAL B 1 101 ? 33.787 -36.964 151.826 1.00 31.20 ? 101  VAL B CG2   1 
ATOM   2139 N N     . GLN B 1 102 ? 38.389 -36.933 152.680 1.00 35.82 ? 102  GLN B N     1 
ATOM   2140 C CA    . GLN B 1 102 ? 39.675 -37.299 153.276 1.00 38.27 ? 102  GLN B CA    1 
ATOM   2141 C C     . GLN B 1 102 ? 40.237 -36.100 154.028 1.00 38.63 ? 102  GLN B C     1 
ATOM   2142 O O     . GLN B 1 102 ? 40.714 -36.236 155.156 1.00 40.55 ? 102  GLN B O     1 
ATOM   2143 C CB    . GLN B 1 102 ? 40.685 -37.727 152.218 1.00 39.27 ? 102  GLN B CB    1 
ATOM   2144 C CG    . GLN B 1 102 ? 40.358 -39.019 151.541 1.00 42.22 ? 102  GLN B CG    1 
ATOM   2145 C CD    . GLN B 1 102 ? 41.401 -39.402 150.521 1.00 43.74 ? 102  GLN B CD    1 
ATOM   2146 O OE1   . GLN B 1 102 ? 41.819 -38.581 149.706 1.00 43.88 ? 102  GLN B OE1   1 
ATOM   2147 N NE2   . GLN B 1 102 ? 41.830 -40.652 150.558 1.00 45.40 ? 102  GLN B NE2   1 
ATOM   2148 N N     . LYS B 1 103 ? 40.206 -34.932 153.387 1.00 37.82 ? 103  LYS B N     1 
ATOM   2149 C CA    . LYS B 1 103 ? 40.687 -33.703 154.008 1.00 36.81 ? 103  LYS B CA    1 
ATOM   2150 C C     . LYS B 1 103 ? 39.830 -33.377 155.221 1.00 36.23 ? 103  LYS B C     1 
ATOM   2151 O O     . LYS B 1 103 ? 40.239 -32.632 156.101 1.00 36.61 ? 103  LYS B O     1 
ATOM   2152 C CB    . LYS B 1 103 ? 40.647 -32.555 153.011 1.00 38.41 ? 103  LYS B CB    1 
ATOM   2153 C CG    . LYS B 1 103 ? 41.531 -32.808 151.823 1.00 40.85 ? 103  LYS B CG    1 
ATOM   2154 C CD    . LYS B 1 103 ? 42.156 -31.532 151.311 1.00 43.81 ? 103  LYS B CD    1 
ATOM   2155 C CE    . LYS B 1 103 ? 43.270 -31.854 150.317 1.00 46.31 ? 103  LYS B CE    1 
ATOM   2156 N NZ    . LYS B 1 103 ? 44.295 -32.785 150.904 1.00 47.94 ? 103  LYS B NZ    1 
ATOM   2157 N N     . LEU B 1 104 ? 38.637 -33.953 155.262 1.00 35.02 ? 104  LEU B N     1 
ATOM   2158 C CA    . LEU B 1 104 ? 37.731 -33.763 156.370 1.00 34.33 ? 104  LEU B CA    1 
ATOM   2159 C C     . LEU B 1 104 ? 38.020 -34.813 157.447 1.00 35.07 ? 104  LEU B C     1 
ATOM   2160 O O     . LEU B 1 104 ? 37.152 -35.138 158.253 1.00 36.83 ? 104  LEU B O     1 
ATOM   2161 C CB    . LEU B 1 104 ? 36.290 -33.874 155.880 1.00 34.17 ? 104  LEU B CB    1 
ATOM   2162 C CG    . LEU B 1 104 ? 35.417 -32.619 155.937 1.00 33.28 ? 104  LEU B CG    1 
ATOM   2163 C CD1   . LEU B 1 104 ? 36.233 -31.354 155.767 1.00 33.43 ? 104  LEU B CD1   1 
ATOM   2164 C CD2   . LEU B 1 104 ? 34.366 -32.727 154.866 1.00 33.17 ? 104  LEU B CD2   1 
ATOM   2165 N N     . GLY B 1 105 ? 39.220 -35.382 157.423 1.00 33.72 ? 105  GLY B N     1 
ATOM   2166 C CA    . GLY B 1 105 ? 39.605 -36.354 158.424 1.00 32.67 ? 105  GLY B CA    1 
ATOM   2167 C C     . GLY B 1 105 ? 39.241 -37.814 158.260 1.00 33.13 ? 105  GLY B C     1 
ATOM   2168 O O     . GLY B 1 105 ? 39.680 -38.624 159.066 1.00 35.22 ? 105  GLY B O     1 
ATOM   2169 N N     . PHE B 1 106 ? 38.470 -38.193 157.249 1.00 32.90 ? 106  PHE B N     1 
ATOM   2170 C CA    . PHE B 1 106 ? 38.107 -39.612 157.099 1.00 31.48 ? 106  PHE B CA    1 
ATOM   2171 C C     . PHE B 1 106 ? 39.006 -40.333 156.115 1.00 31.61 ? 106  PHE B C     1 
ATOM   2172 O O     . PHE B 1 106 ? 39.340 -39.795 155.074 1.00 33.75 ? 106  PHE B O     1 
ATOM   2173 C CB    . PHE B 1 106 ? 36.649 -39.744 156.664 1.00 28.91 ? 106  PHE B CB    1 
ATOM   2174 C CG    . PHE B 1 106 ? 35.686 -39.043 157.578 1.00 26.82 ? 106  PHE B CG    1 
ATOM   2175 C CD1   . PHE B 1 106 ? 35.365 -37.704 157.375 1.00 25.98 ? 106  PHE B CD1   1 
ATOM   2176 C CD2   . PHE B 1 106 ? 35.117 -39.710 158.656 1.00 24.58 ? 106  PHE B CD2   1 
ATOM   2177 C CE1   . PHE B 1 106 ? 34.493 -37.038 158.230 1.00 25.44 ? 106  PHE B CE1   1 
ATOM   2178 C CE2   . PHE B 1 106 ? 34.247 -39.051 159.514 1.00 26.01 ? 106  PHE B CE2   1 
ATOM   2179 C CZ    . PHE B 1 106 ? 33.935 -37.711 159.298 1.00 24.85 ? 106  PHE B CZ    1 
ATOM   2180 N N     . PRO B 1 107 ? 39.386 -41.578 156.414 1.00 32.88 ? 107  PRO B N     1 
ATOM   2181 C CA    . PRO B 1 107 ? 40.259 -42.401 155.556 1.00 33.55 ? 107  PRO B CA    1 
ATOM   2182 C C     . PRO B 1 107 ? 39.587 -42.927 154.279 1.00 34.59 ? 107  PRO B C     1 
ATOM   2183 O O     . PRO B 1 107 ? 39.685 -44.120 153.960 1.00 35.31 ? 107  PRO B O     1 
ATOM   2184 C CB    . PRO B 1 107 ? 40.650 -43.543 156.488 1.00 32.56 ? 107  PRO B CB    1 
ATOM   2185 C CG    . PRO B 1 107 ? 39.404 -43.717 157.321 1.00 33.21 ? 107  PRO B CG    1 
ATOM   2186 C CD    . PRO B 1 107 ? 39.041 -42.292 157.655 1.00 32.66 ? 107  PRO B CD    1 
ATOM   2187 N N     . ALA B 1 108 ? 38.969 -42.018 153.526 1.00 34.53 ? 108  ALA B N     1 
ATOM   2188 C CA    . ALA B 1 108 ? 38.246 -42.353 152.305 1.00 33.58 ? 108  ALA B CA    1 
ATOM   2189 C C     . ALA B 1 108 ? 39.079 -42.972 151.190 1.00 33.71 ? 108  ALA B C     1 
ATOM   2190 O O     . ALA B 1 108 ? 40.200 -42.558 150.922 1.00 33.21 ? 108  ALA B O     1 
ATOM   2191 C CB    . ALA B 1 108 ? 37.517 -41.122 151.787 1.00 32.93 ? 108  ALA B CB    1 
ATOM   2192 N N     . LYS B 1 109 ? 38.498 -43.972 150.544 1.00 34.19 ? 109  LYS B N     1 
ATOM   2193 C CA    . LYS B 1 109 ? 39.111 -44.669 149.428 1.00 34.35 ? 109  LYS B CA    1 
ATOM   2194 C C     . LYS B 1 109 ? 38.154 -44.536 148.249 1.00 33.01 ? 109  LYS B C     1 
ATOM   2195 O O     . LYS B 1 109 ? 37.130 -43.870 148.353 1.00 33.81 ? 109  LYS B O     1 
ATOM   2196 C CB    . LYS B 1 109 ? 39.349 -46.134 149.784 1.00 35.79 ? 109  LYS B CB    1 
ATOM   2197 C CG    . LYS B 1 109 ? 40.315 -46.285 150.943 1.00 38.07 ? 109  LYS B CG    1 
ATOM   2198 C CD    . LYS B 1 109 ? 40.475 -47.719 151.342 1.00 41.76 ? 109  LYS B CD    1 
ATOM   2199 C CE    . LYS B 1 109 ? 41.597 -47.876 152.352 1.00 44.13 ? 109  LYS B CE    1 
ATOM   2200 N NZ    . LYS B 1 109 ? 41.891 -49.326 152.592 1.00 46.76 ? 109  LYS B NZ    1 
ATOM   2201 N N     . PHE B 1 110 ? 38.469 -45.179 147.135 1.00 32.16 ? 110  PHE B N     1 
ATOM   2202 C CA    . PHE B 1 110 ? 37.637 -45.073 145.941 1.00 30.20 ? 110  PHE B CA    1 
ATOM   2203 C C     . PHE B 1 110 ? 37.368 -46.467 145.409 1.00 30.37 ? 110  PHE B C     1 
ATOM   2204 O O     . PHE B 1 110 ? 37.924 -46.870 144.390 1.00 30.26 ? 110  PHE B O     1 
ATOM   2205 C CB    . PHE B 1 110 ? 38.382 -44.243 144.896 1.00 28.47 ? 110  PHE B CB    1 
ATOM   2206 C CG    . PHE B 1 110 ? 37.497 -43.607 143.875 1.00 26.30 ? 110  PHE B CG    1 
ATOM   2207 C CD1   . PHE B 1 110 ? 36.620 -42.589 144.239 1.00 24.90 ? 110  PHE B CD1   1 
ATOM   2208 C CD2   . PHE B 1 110 ? 37.547 -44.010 142.550 1.00 23.58 ? 110  PHE B CD2   1 
ATOM   2209 C CE1   . PHE B 1 110 ? 35.815 -41.989 143.306 1.00 21.24 ? 110  PHE B CE1   1 
ATOM   2210 C CE2   . PHE B 1 110 ? 36.740 -43.411 141.609 1.00 23.52 ? 110  PHE B CE2   1 
ATOM   2211 C CZ    . PHE B 1 110 ? 35.873 -42.398 141.991 1.00 22.82 ? 110  PHE B CZ    1 
ATOM   2212 N N     . LYS B 1 111 ? 36.488 -47.184 146.088 1.00 30.55 ? 111  LYS B N     1 
ATOM   2213 C CA    . LYS B 1 111 ? 36.165 -48.550 145.723 1.00 31.85 ? 111  LYS B CA    1 
ATOM   2214 C C     . LYS B 1 111 ? 34.903 -48.735 144.901 1.00 31.33 ? 111  LYS B C     1 
ATOM   2215 O O     . LYS B 1 111 ? 33.894 -48.081 145.128 1.00 32.36 ? 111  LYS B O     1 
ATOM   2216 C CB    . LYS B 1 111 ? 36.081 -49.383 147.002 1.00 34.81 ? 111  LYS B CB    1 
ATOM   2217 C CG    . LYS B 1 111 ? 35.622 -50.817 146.825 1.00 39.55 ? 111  LYS B CG    1 
ATOM   2218 C CD    . LYS B 1 111 ? 36.088 -51.696 147.993 1.00 43.35 ? 111  LYS B CD    1 
ATOM   2219 C CE    . LYS B 1 111 ? 35.409 -53.060 147.979 1.00 44.19 ? 111  LYS B CE    1 
ATOM   2220 N NZ    . LYS B 1 111 ? 33.985 -52.925 148.404 1.00 45.60 ? 111  LYS B NZ    1 
ATOM   2221 N N     . ASP B 1 112 ? 34.977 -49.637 143.935 1.00 29.78 ? 112  ASP B N     1 
ATOM   2222 C CA    . ASP B 1 112 ? 33.843 -49.982 143.091 1.00 28.09 ? 112  ASP B CA    1 
ATOM   2223 C C     . ASP B 1 112 ? 33.108 -48.858 142.370 1.00 26.39 ? 112  ASP B C     1 
ATOM   2224 O O     . ASP B 1 112 ? 31.875 -48.881 142.298 1.00 26.48 ? 112  ASP B O     1 
ATOM   2225 C CB    . ASP B 1 112 ? 32.824 -50.801 143.890 1.00 30.03 ? 112  ASP B CB    1 
ATOM   2226 C CG    . ASP B 1 112 ? 33.446 -51.992 144.595 1.00 33.86 ? 112  ASP B CG    1 
ATOM   2227 O OD1   . ASP B 1 112 ? 34.285 -52.693 143.974 1.00 35.61 ? 112  ASP B OD1   1 
ATOM   2228 O OD2   . ASP B 1 112 ? 33.096 -52.218 145.783 1.00 34.91 ? 112  ASP B OD2   1 
ATOM   2229 N N     . PHE B 1 113 ? 33.830 -47.877 141.845 1.00 23.24 ? 113  PHE B N     1 
ATOM   2230 C CA    . PHE B 1 113 ? 33.179 -46.802 141.098 1.00 21.95 ? 113  PHE B CA    1 
ATOM   2231 C C     . PHE B 1 113 ? 32.323 -47.422 139.969 1.00 22.07 ? 113  PHE B C     1 
ATOM   2232 O O     . PHE B 1 113 ? 32.795 -48.271 139.220 1.00 23.26 ? 113  PHE B O     1 
ATOM   2233 C CB    . PHE B 1 113 ? 34.219 -45.851 140.495 1.00 18.77 ? 113  PHE B CB    1 
ATOM   2234 C CG    . PHE B 1 113 ? 33.615 -44.814 139.608 1.00 15.84 ? 113  PHE B CG    1 
ATOM   2235 C CD1   . PHE B 1 113 ? 33.032 -43.683 140.150 1.00 13.91 ? 113  PHE B CD1   1 
ATOM   2236 C CD2   . PHE B 1 113 ? 33.522 -45.028 138.238 1.00 14.28 ? 113  PHE B CD2   1 
ATOM   2237 C CE1   . PHE B 1 113 ? 32.356 -42.788 139.347 1.00 11.34 ? 113  PHE B CE1   1 
ATOM   2238 C CE2   . PHE B 1 113 ? 32.848 -44.143 137.426 1.00 12.08 ? 113  PHE B CE2   1 
ATOM   2239 C CZ    . PHE B 1 113 ? 32.261 -43.023 137.981 1.00 11.55 ? 113  PHE B CZ    1 
ATOM   2240 N N     . LYS B 1 114 ? 31.081 -46.985 139.821 1.00 22.08 ? 114  LYS B N     1 
ATOM   2241 C CA    . LYS B 1 114 ? 30.222 -47.555 138.792 1.00 21.70 ? 114  LYS B CA    1 
ATOM   2242 C C     . LYS B 1 114 ? 29.232 -46.543 138.252 1.00 20.41 ? 114  LYS B C     1 
ATOM   2243 O O     . LYS B 1 114 ? 28.646 -45.791 139.017 1.00 20.33 ? 114  LYS B O     1 
ATOM   2244 C CB    . LYS B 1 114 ? 29.494 -48.774 139.388 1.00 24.18 ? 114  LYS B CB    1 
ATOM   2245 C CG    . LYS B 1 114 ? 28.151 -49.158 138.791 1.00 26.38 ? 114  LYS B CG    1 
ATOM   2246 C CD    . LYS B 1 114 ? 28.303 -49.930 137.513 1.00 31.41 ? 114  LYS B CD    1 
ATOM   2247 C CE    . LYS B 1 114 ? 27.003 -50.623 137.092 1.00 33.35 ? 114  LYS B CE    1 
ATOM   2248 N NZ    . LYS B 1 114 ? 26.622 -51.779 137.982 1.00 35.57 ? 114  LYS B NZ    1 
ATOM   2249 N N     . ILE B 1 115 ? 29.114 -46.480 136.929 1.00 19.96 ? 115  ILE B N     1 
ATOM   2250 C CA    . ILE B 1 115 ? 28.151 -45.601 136.240 1.00 18.91 ? 115  ILE B CA    1 
ATOM   2251 C C     . ILE B 1 115 ? 26.796 -46.333 136.354 1.00 19.86 ? 115  ILE B C     1 
ATOM   2252 O O     . ILE B 1 115 ? 26.650 -47.469 135.883 1.00 20.20 ? 115  ILE B O     1 
ATOM   2253 C CB    . ILE B 1 115 ? 28.511 -45.443 134.747 1.00 18.66 ? 115  ILE B CB    1 
ATOM   2254 C CG1   . ILE B 1 115 ? 29.901 -44.816 134.596 1.00 15.11 ? 115  ILE B CG1   1 
ATOM   2255 C CG2   . ILE B 1 115 ? 27.423 -44.671 134.006 1.00 16.48 ? 115  ILE B CG2   1 
ATOM   2256 C CD1   . ILE B 1 115 ? 29.981 -43.410 135.063 1.00 16.94 ? 115  ILE B CD1   1 
ATOM   2257 N N     . GLN B 1 116 ? 25.821 -45.682 136.982 1.00 19.67 ? 116  GLN B N     1 
ATOM   2258 C CA    . GLN B 1 116 ? 24.509 -46.280 137.218 1.00 18.92 ? 116  GLN B CA    1 
ATOM   2259 C C     . GLN B 1 116 ? 23.398 -45.874 136.258 1.00 17.88 ? 116  GLN B C     1 
ATOM   2260 O O     . GLN B 1 116 ? 22.431 -46.614 136.089 1.00 18.19 ? 116  GLN B O     1 
ATOM   2261 C CB    . GLN B 1 116 ? 24.075 -46.005 138.664 1.00 18.33 ? 116  GLN B CB    1 
ATOM   2262 C CG    . GLN B 1 116 ? 25.079 -46.490 139.721 1.00 20.00 ? 116  GLN B CG    1 
ATOM   2263 C CD    . GLN B 1 116 ? 25.031 -47.992 139.962 1.00 20.71 ? 116  GLN B CD    1 
ATOM   2264 O OE1   . GLN B 1 116 ? 24.309 -48.719 139.277 1.00 21.54 ? 116  GLN B OE1   1 
ATOM   2265 N NE2   . GLN B 1 116 ? 25.792 -48.465 140.947 1.00 18.76 ? 116  GLN B NE2   1 
ATOM   2266 N N     . ASN B 1 117 ? 23.526 -44.705 135.640 1.00 17.62 ? 117  ASN B N     1 
ATOM   2267 C CA    . ASN B 1 117 ? 22.518 -44.224 134.701 1.00 17.25 ? 117  ASN B CA    1 
ATOM   2268 C C     . ASN B 1 117 ? 23.093 -43.097 133.843 1.00 17.60 ? 117  ASN B C     1 
ATOM   2269 O O     . ASN B 1 117 ? 23.841 -42.244 134.324 1.00 17.72 ? 117  ASN B O     1 
ATOM   2270 C CB    . ASN B 1 117 ? 21.276 -43.734 135.457 1.00 17.80 ? 117  ASN B CB    1 
ATOM   2271 C CG    . ASN B 1 117 ? 20.123 -43.319 134.521 1.00 18.03 ? 117  ASN B CG    1 
ATOM   2272 O OD1   . ASN B 1 117 ? 19.883 -43.945 133.501 1.00 17.22 ? 117  ASN B OD1   1 
ATOM   2273 N ND2   . ASN B 1 117 ? 19.393 -42.278 134.900 1.00 17.26 ? 117  ASN B ND2   1 
ATOM   2274 N N     . ILE B 1 118 ? 22.769 -43.125 132.560 1.00 17.03 ? 118  ILE B N     1 
ATOM   2275 C CA    . ILE B 1 118 ? 23.223 -42.117 131.615 1.00 15.77 ? 118  ILE B CA    1 
ATOM   2276 C C     . ILE B 1 118 ? 21.997 -41.541 130.919 1.00 16.28 ? 118  ILE B C     1 
ATOM   2277 O O     . ILE B 1 118 ? 21.167 -42.296 130.400 1.00 16.15 ? 118  ILE B O     1 
ATOM   2278 C CB    . ILE B 1 118 ? 24.132 -42.738 130.556 1.00 15.28 ? 118  ILE B CB    1 
ATOM   2279 C CG1   . ILE B 1 118 ? 25.409 -43.269 131.221 1.00 15.03 ? 118  ILE B CG1   1 
ATOM   2280 C CG2   . ILE B 1 118 ? 24.418 -41.708 129.459 1.00 13.18 ? 118  ILE B CG2   1 
ATOM   2281 C CD1   . ILE B 1 118 ? 26.374 -43.984 130.274 1.00 13.77 ? 118  ILE B CD1   1 
ATOM   2282 N N     . VAL B 1 119 ? 21.867 -40.216 130.931 1.00 16.65 ? 119  VAL B N     1 
ATOM   2283 C CA    . VAL B 1 119 ? 20.723 -39.540 130.311 1.00 15.65 ? 119  VAL B CA    1 
ATOM   2284 C C     . VAL B 1 119 ? 21.255 -38.787 129.095 1.00 16.84 ? 119  VAL B C     1 
ATOM   2285 O O     . VAL B 1 119 ? 22.258 -38.068 129.195 1.00 16.90 ? 119  VAL B O     1 
ATOM   2286 C CB    . VAL B 1 119 ? 20.019 -38.552 131.325 1.00 15.48 ? 119  VAL B CB    1 
ATOM   2287 C CG1   . VAL B 1 119 ? 18.866 -37.800 130.667 1.00 12.43 ? 119  VAL B CG1   1 
ATOM   2288 C CG2   . VAL B 1 119 ? 19.510 -39.308 132.540 1.00 13.21 ? 119  VAL B CG2   1 
ATOM   2289 N N     . GLY B 1 120 ? 20.643 -39.022 127.939 1.00 15.64 ? 120  GLY B N     1 
ATOM   2290 C CA    . GLY B 1 120 ? 21.063 -38.349 126.728 1.00 17.06 ? 120  GLY B CA    1 
ATOM   2291 C C     . GLY B 1 120 ? 19.848 -37.810 125.998 1.00 18.88 ? 120  GLY B C     1 
ATOM   2292 O O     . GLY B 1 120 ? 18.736 -38.250 126.254 1.00 19.24 ? 120  GLY B O     1 
ATOM   2293 N N     . SER B 1 121 ? 20.036 -36.850 125.105 1.00 20.27 ? 121  SER B N     1 
ATOM   2294 C CA    . SER B 1 121 ? 18.908 -36.297 124.343 1.00 22.53 ? 121  SER B CA    1 
ATOM   2295 C C     . SER B 1 121 ? 19.363 -35.979 122.924 1.00 22.99 ? 121  SER B C     1 
ATOM   2296 O O     . SER B 1 121 ? 20.558 -35.828 122.678 1.00 23.75 ? 121  SER B O     1 
ATOM   2297 C CB    . SER B 1 121 ? 18.371 -35.007 125.001 1.00 20.77 ? 121  SER B CB    1 
ATOM   2298 O OG    . SER B 1 121 ? 19.339 -33.956 124.977 1.00 20.37 ? 121  SER B OG    1 
ATOM   2299 N N     . CYS B 1 122 ? 18.424 -35.940 121.987 1.00 23.73 ? 122  CYS B N     1 
ATOM   2300 C CA    . CYS B 1 122 ? 18.738 -35.584 120.609 1.00 25.85 ? 122  CYS B CA    1 
ATOM   2301 C C     . CYS B 1 122 ? 17.492 -35.093 119.918 1.00 26.35 ? 122  CYS B C     1 
ATOM   2302 O O     . CYS B 1 122 ? 16.385 -35.194 120.437 1.00 26.43 ? 122  CYS B O     1 
ATOM   2303 C CB    . CYS B 1 122 ? 19.362 -36.729 119.830 1.00 26.29 ? 122  CYS B CB    1 
ATOM   2304 S SG    . CYS B 1 122 ? 18.382 -38.153 119.889 1.00 31.62 ? 122  CYS B SG    1 
ATOM   2305 N N     . ASP B 1 123 ? 17.684 -34.577 118.724 1.00 27.87 ? 123  ASP B N     1 
ATOM   2306 C CA    . ASP B 1 123 ? 16.615 -34.002 117.955 1.00 29.29 ? 123  ASP B CA    1 
ATOM   2307 C C     . ASP B 1 123 ? 16.614 -34.677 116.594 1.00 30.48 ? 123  ASP B C     1 
ATOM   2308 O O     . ASP B 1 123 ? 17.560 -34.516 115.834 1.00 32.12 ? 123  ASP B O     1 
ATOM   2309 C CB    . ASP B 1 123 ? 16.932 -32.519 117.825 1.00 30.08 ? 123  ASP B CB    1 
ATOM   2310 C CG    . ASP B 1 123 ? 15.849 -31.740 117.167 1.00 32.44 ? 123  ASP B CG    1 
ATOM   2311 O OD1   . ASP B 1 123 ? 14.894 -32.341 116.640 1.00 34.24 ? 123  ASP B OD1   1 
ATOM   2312 O OD2   . ASP B 1 123 ? 15.963 -30.499 117.174 1.00 36.12 ? 123  ASP B OD2   1 
ATOM   2313 N N     . VAL B 1 124 ? 15.554 -35.418 116.280 1.00 30.13 ? 124  VAL B N     1 
ATOM   2314 C CA    . VAL B 1 124 ? 15.463 -36.114 114.997 1.00 28.78 ? 124  VAL B CA    1 
ATOM   2315 C C     . VAL B 1 124 ? 15.166 -35.187 113.834 1.00 29.65 ? 124  VAL B C     1 
ATOM   2316 O O     . VAL B 1 124 ? 15.095 -35.628 112.693 1.00 30.48 ? 124  VAL B O     1 
ATOM   2317 C CB    . VAL B 1 124 ? 14.399 -37.207 115.018 1.00 28.50 ? 124  VAL B CB    1 
ATOM   2318 C CG1   . VAL B 1 124 ? 14.785 -38.281 116.002 1.00 27.66 ? 124  VAL B CG1   1 
ATOM   2319 C CG2   . VAL B 1 124 ? 13.035 -36.605 115.352 1.00 27.62 ? 124  VAL B CG2   1 
ATOM   2320 N N     . LYS B 1 125 ? 14.897 -33.925 114.135 1.00 29.80 ? 125  LYS B N     1 
ATOM   2321 C CA    . LYS B 1 125 ? 14.636 -32.917 113.116 1.00 31.33 ? 125  LYS B CA    1 
ATOM   2322 C C     . LYS B 1 125 ? 13.309 -32.938 112.344 1.00 31.90 ? 125  LYS B C     1 
ATOM   2323 O O     . LYS B 1 125 ? 13.228 -32.428 111.225 1.00 32.93 ? 125  LYS B O     1 
ATOM   2324 C CB    . LYS B 1 125 ? 15.816 -32.845 112.142 1.00 32.43 ? 125  LYS B CB    1 
ATOM   2325 C CG    . LYS B 1 125 ? 17.108 -32.408 112.798 1.00 34.65 ? 125  LYS B CG    1 
ATOM   2326 C CD    . LYS B 1 125 ? 16.933 -31.086 113.498 1.00 36.29 ? 125  LYS B CD    1 
ATOM   2327 C CE    . LYS B 1 125 ? 18.205 -30.681 114.212 1.00 40.24 ? 125  LYS B CE    1 
ATOM   2328 N NZ    . LYS B 1 125 ? 18.050 -29.365 114.907 1.00 42.34 ? 125  LYS B NZ    1 
ATOM   2329 N N     . PHE B 1 126 ? 12.265 -33.498 112.938 1.00 31.29 ? 126  PHE B N     1 
ATOM   2330 C CA    . PHE B 1 126 ? 10.949 -33.530 112.306 1.00 29.12 ? 126  PHE B CA    1 
ATOM   2331 C C     . PHE B 1 126 ? 9.892  -33.834 113.376 1.00 30.03 ? 126  PHE B C     1 
ATOM   2332 O O     . PHE B 1 126 ? 10.181 -34.533 114.358 1.00 30.40 ? 126  PHE B O     1 
ATOM   2333 C CB    . PHE B 1 126 ? 10.901 -34.529 111.136 1.00 27.01 ? 126  PHE B CB    1 
ATOM   2334 C CG    . PHE B 1 126 ? 11.247 -35.962 111.505 1.00 26.96 ? 126  PHE B CG    1 
ATOM   2335 C CD1   . PHE B 1 126 ? 10.312 -36.792 112.113 1.00 25.68 ? 126  PHE B CD1   1 
ATOM   2336 C CD2   . PHE B 1 126 ? 12.482 -36.507 111.153 1.00 26.10 ? 126  PHE B CD2   1 
ATOM   2337 C CE1   . PHE B 1 126 ? 10.593 -38.130 112.354 1.00 25.26 ? 126  PHE B CE1   1 
ATOM   2338 C CE2   . PHE B 1 126 ? 12.769 -37.848 111.392 1.00 24.99 ? 126  PHE B CE2   1 
ATOM   2339 C CZ    . PHE B 1 126 ? 11.824 -38.656 111.989 1.00 25.59 ? 126  PHE B CZ    1 
ATOM   2340 N N     . PRO B 1 127 ? 8.681  -33.250 113.242 1.00 28.97 ? 127  PRO B N     1 
ATOM   2341 C CA    . PRO B 1 127 ? 7.606  -33.467 114.207 1.00 27.64 ? 127  PRO B CA    1 
ATOM   2342 C C     . PRO B 1 127 ? 7.091  -34.892 114.137 1.00 26.70 ? 127  PRO B C     1 
ATOM   2343 O O     . PRO B 1 127 ? 7.013  -35.463 113.055 1.00 26.29 ? 127  PRO B O     1 
ATOM   2344 C CB    . PRO B 1 127 ? 6.553  -32.455 113.763 1.00 27.83 ? 127  PRO B CB    1 
ATOM   2345 C CG    . PRO B 1 127 ? 6.713  -32.458 112.293 1.00 28.37 ? 127  PRO B CG    1 
ATOM   2346 C CD    . PRO B 1 127 ? 8.214  -32.375 112.150 1.00 29.33 ? 127  PRO B CD    1 
ATOM   2347 N N     . ILE B 1 128 ? 6.666  -35.421 115.279 1.00 26.28 ? 128  ILE B N     1 
ATOM   2348 C CA    . ILE B 1 128 ? 6.178  -36.790 115.380 1.00 25.34 ? 128  ILE B CA    1 
ATOM   2349 C C     . ILE B 1 128 ? 4.699  -36.940 115.790 1.00 26.40 ? 128  ILE B C     1 
ATOM   2350 O O     . ILE B 1 128 ? 4.196  -36.204 116.639 1.00 26.58 ? 128  ILE B O     1 
ATOM   2351 C CB    . ILE B 1 128 ? 7.064  -37.573 116.372 1.00 23.63 ? 128  ILE B CB    1 
ATOM   2352 C CG1   . ILE B 1 128 ? 8.531  -37.445 115.965 1.00 21.83 ? 128  ILE B CG1   1 
ATOM   2353 C CG2   . ILE B 1 128 ? 6.650  -39.035 116.434 1.00 23.99 ? 128  ILE B CG2   1 
ATOM   2354 C CD1   . ILE B 1 128 ? 9.461  -38.097 116.925 1.00 22.10 ? 128  ILE B CD1   1 
ATOM   2355 N N     . ARG B 1 129 ? 4.008  -37.866 115.129 1.00 27.37 ? 129  ARG B N     1 
ATOM   2356 C CA    . ARG B 1 129 ? 2.611  -38.192 115.408 1.00 29.87 ? 129  ARG B CA    1 
ATOM   2357 C C     . ARG B 1 129 ? 2.631  -39.238 116.516 1.00 29.16 ? 129  ARG B C     1 
ATOM   2358 O O     . ARG B 1 129 ? 2.592  -40.450 116.251 1.00 29.26 ? 129  ARG B O     1 
ATOM   2359 C CB    . ARG B 1 129 ? 1.917  -38.786 114.171 1.00 32.24 ? 129  ARG B CB    1 
ATOM   2360 C CG    . ARG B 1 129 ? 1.338  -37.757 113.224 1.00 35.09 ? 129  ARG B CG    1 
ATOM   2361 C CD    . ARG B 1 129 ? 0.536  -38.398 112.100 1.00 38.50 ? 129  ARG B CD    1 
ATOM   2362 N NE    . ARG B 1 129 ? 1.362  -39.276 111.277 1.00 40.91 ? 129  ARG B NE    1 
ATOM   2363 C CZ    . ARG B 1 129 ? 1.259  -40.602 111.267 1.00 41.15 ? 129  ARG B CZ    1 
ATOM   2364 N NH1   . ARG B 1 129 ? 0.358  -41.213 112.034 1.00 40.95 ? 129  ARG B NH1   1 
ATOM   2365 N NH2   . ARG B 1 129 ? 2.082  -41.318 110.513 1.00 41.55 ? 129  ARG B NH2   1 
ATOM   2366 N N     . LEU B 1 130 ? 2.683  -38.763 117.755 1.00 28.38 ? 130  LEU B N     1 
ATOM   2367 C CA    . LEU B 1 130 ? 2.753  -39.640 118.912 1.00 27.18 ? 130  LEU B CA    1 
ATOM   2368 C C     . LEU B 1 130 ? 1.650  -40.684 118.983 1.00 27.47 ? 130  LEU B C     1 
ATOM   2369 O O     . LEU B 1 130 ? 1.903  -41.826 119.374 1.00 27.41 ? 130  LEU B O     1 
ATOM   2370 C CB    . LEU B 1 130 ? 2.798  -38.799 120.190 1.00 25.78 ? 130  LEU B CB    1 
ATOM   2371 C CG    . LEU B 1 130 ? 3.963  -37.805 120.229 1.00 23.53 ? 130  LEU B CG    1 
ATOM   2372 C CD1   . LEU B 1 130 ? 3.988  -37.108 121.548 1.00 23.21 ? 130  LEU B CD1   1 
ATOM   2373 C CD2   . LEU B 1 130 ? 5.287  -38.521 120.009 1.00 23.77 ? 130  LEU B CD2   1 
ATOM   2374 N N     . GLU B 1 131 ? 0.449  -40.310 118.541 1.00 28.85 ? 131  GLU B N     1 
ATOM   2375 C CA    . GLU B 1 131 ? -0.717 -41.201 118.563 1.00 29.30 ? 131  GLU B CA    1 
ATOM   2376 C C     . GLU B 1 131 ? -0.559 -42.431 117.669 1.00 29.19 ? 131  GLU B C     1 
ATOM   2377 O O     . GLU B 1 131 ? -0.849 -43.558 118.085 1.00 28.81 ? 131  GLU B O     1 
ATOM   2378 C CB    . GLU B 1 131 ? -1.978 -40.424 118.188 1.00 29.64 ? 131  GLU B CB    1 
ATOM   2379 N N     . GLY B 1 132 ? -0.099 -42.217 116.442 1.00 29.97 ? 132  GLY B N     1 
ATOM   2380 C CA    . GLY B 1 132 ? 0.101  -43.337 115.539 1.00 31.65 ? 132  GLY B CA    1 
ATOM   2381 C C     . GLY B 1 132 ? 1.157  -44.281 116.090 1.00 33.02 ? 132  GLY B C     1 
ATOM   2382 O O     . GLY B 1 132 ? 0.957  -45.502 116.173 1.00 33.77 ? 132  GLY B O     1 
ATOM   2383 N N     . LEU B 1 133 ? 2.281  -43.696 116.496 1.00 33.10 ? 133  LEU B N     1 
ATOM   2384 C CA    . LEU B 1 133 ? 3.386  -44.446 117.063 1.00 33.03 ? 133  LEU B CA    1 
ATOM   2385 C C     . LEU B 1 133 ? 2.902  -45.306 118.228 1.00 32.87 ? 133  LEU B C     1 
ATOM   2386 O O     . LEU B 1 133 ? 3.116  -46.510 118.242 1.00 32.72 ? 133  LEU B O     1 
ATOM   2387 C CB    . LEU B 1 133 ? 4.492  -43.479 117.511 1.00 32.20 ? 133  LEU B CB    1 
ATOM   2388 C CG    . LEU B 1 133 ? 5.752  -44.049 118.162 1.00 32.33 ? 133  LEU B CG    1 
ATOM   2389 C CD1   . LEU B 1 133 ? 6.407  -45.081 117.269 1.00 33.63 ? 133  LEU B CD1   1 
ATOM   2390 C CD2   . LEU B 1 133 ? 6.711  -42.918 118.455 1.00 32.43 ? 133  LEU B CD2   1 
ATOM   2391 N N     . ALA B 1 134 ? 2.192  -44.698 119.165 1.00 33.51 ? 134  ALA B N     1 
ATOM   2392 C CA    . ALA B 1 134 ? 1.694  -45.425 120.323 1.00 35.81 ? 134  ALA B CA    1 
ATOM   2393 C C     . ALA B 1 134 ? 0.726  -46.553 119.968 1.00 37.47 ? 134  ALA B C     1 
ATOM   2394 O O     . ALA B 1 134 ? 0.789  -47.636 120.547 1.00 38.52 ? 134  ALA B O     1 
ATOM   2395 C CB    . ALA B 1 134 ? 1.041  -44.464 121.298 1.00 35.89 ? 134  ALA B CB    1 
ATOM   2396 N N     . TYR B 1 135 ? -0.168 -46.302 119.018 1.00 39.99 ? 135  TYR B N     1 
ATOM   2397 C CA    . TYR B 1 135 ? -1.160 -47.293 118.597 1.00 40.69 ? 135  TYR B CA    1 
ATOM   2398 C C     . TYR B 1 135 ? -0.463 -48.499 117.965 1.00 40.17 ? 135  TYR B C     1 
ATOM   2399 O O     . TYR B 1 135 ? -0.716 -49.648 118.333 1.00 39.06 ? 135  TYR B O     1 
ATOM   2400 C CB    . TYR B 1 135 ? -2.142 -46.620 117.622 1.00 43.96 ? 135  TYR B CB    1 
ATOM   2401 C CG    . TYR B 1 135 ? -3.208 -47.499 116.980 1.00 47.02 ? 135  TYR B CG    1 
ATOM   2402 C CD1   . TYR B 1 135 ? -3.583 -48.726 117.532 1.00 48.48 ? 135  TYR B CD1   1 
ATOM   2403 C CD2   . TYR B 1 135 ? -3.846 -47.087 115.805 1.00 48.84 ? 135  TYR B CD2   1 
ATOM   2404 C CE1   . TYR B 1 135 ? -4.561 -49.522 116.929 1.00 49.32 ? 135  TYR B CE1   1 
ATOM   2405 C CE2   . TYR B 1 135 ? -4.827 -47.873 115.197 1.00 49.77 ? 135  TYR B CE2   1 
ATOM   2406 C CZ    . TYR B 1 135 ? -5.178 -49.087 115.764 1.00 49.90 ? 135  TYR B CZ    1 
ATOM   2407 O OH    . TYR B 1 135 ? -6.147 -49.860 115.162 1.00 51.83 ? 135  TYR B OH    1 
ATOM   2408 N N     . SER B 1 136 ? 0.469  -48.222 117.063 1.00 40.20 ? 136  SER B N     1 
ATOM   2409 C CA    . SER B 1 136 ? 1.210  -49.272 116.373 1.00 40.78 ? 136  SER B CA    1 
ATOM   2410 C C     . SER B 1 136 ? 2.233  -50.001 117.246 1.00 40.17 ? 136  SER B C     1 
ATOM   2411 O O     . SER B 1 136 ? 2.806  -51.004 116.819 1.00 41.21 ? 136  SER B O     1 
ATOM   2412 C CB    . SER B 1 136 ? 1.918  -48.680 115.164 1.00 40.81 ? 136  SER B CB    1 
ATOM   2413 O OG    . SER B 1 136 ? 2.716  -47.586 115.569 1.00 43.82 ? 136  SER B OG    1 
ATOM   2414 N N     . HIS B 1 137 ? 2.527  -49.454 118.426 1.00 39.40 ? 137  HIS B N     1 
ATOM   2415 C CA    . HIS B 1 137 ? 3.493  -50.059 119.354 1.00 36.95 ? 137  HIS B CA    1 
ATOM   2416 C C     . HIS B 1 137 ? 2.903  -50.000 120.743 1.00 36.36 ? 137  HIS B C     1 
ATOM   2417 O O     . HIS B 1 137 ? 3.560  -49.570 121.687 1.00 36.57 ? 137  HIS B O     1 
ATOM   2418 C CB    . HIS B 1 137 ? 4.812  -49.289 119.353 1.00 34.46 ? 137  HIS B CB    1 
ATOM   2419 C CG    . HIS B 1 137 ? 5.415  -49.130 117.998 1.00 33.72 ? 137  HIS B CG    1 
ATOM   2420 N ND1   . HIS B 1 137 ? 6.446  -49.922 117.545 1.00 33.52 ? 137  HIS B ND1   1 
ATOM   2421 C CD2   . HIS B 1 137 ? 5.108  -48.292 116.981 1.00 32.94 ? 137  HIS B CD2   1 
ATOM   2422 C CE1   . HIS B 1 137 ? 6.745  -49.584 116.305 1.00 33.41 ? 137  HIS B CE1   1 
ATOM   2423 N NE2   . HIS B 1 137 ? 5.947  -48.598 115.940 1.00 33.54 ? 137  HIS B NE2   1 
ATOM   2424 N N     . ALA B 1 138 ? 1.660  -50.445 120.869 1.00 36.12 ? 138  ALA B N     1 
ATOM   2425 C CA    . ALA B 1 138 ? 0.979  -50.417 122.149 1.00 36.18 ? 138  ALA B CA    1 
ATOM   2426 C C     . ALA B 1 138 ? 1.746  -51.203 123.187 1.00 35.81 ? 138  ALA B C     1 
ATOM   2427 O O     . ALA B 1 138 ? 1.784  -50.812 124.343 1.00 37.38 ? 138  ALA B O     1 
ATOM   2428 C CB    . ALA B 1 138 ? -0.431 -50.942 122.009 1.00 35.47 ? 138  ALA B CB    1 
ATOM   2429 N N     . ALA B 1 139 ? 2.418  -52.267 122.756 1.00 36.29 ? 139  ALA B N     1 
ATOM   2430 C CA    . ALA B 1 139 ? 3.202  -53.111 123.663 1.00 36.32 ? 139  ALA B CA    1 
ATOM   2431 C C     . ALA B 1 139 ? 4.449  -52.441 124.265 1.00 36.09 ? 139  ALA B C     1 
ATOM   2432 O O     . ALA B 1 139 ? 5.030  -52.944 125.237 1.00 35.72 ? 139  ALA B O     1 
ATOM   2433 C CB    . ALA B 1 139 ? 3.603  -54.396 122.954 1.00 36.56 ? 139  ALA B CB    1 
ATOM   2434 N N     . PHE B 1 140 ? 4.870  -51.323 123.681 1.00 35.22 ? 140  PHE B N     1 
ATOM   2435 C CA    . PHE B 1 140 ? 6.052  -50.619 124.163 1.00 34.94 ? 140  PHE B CA    1 
ATOM   2436 C C     . PHE B 1 140 ? 5.756  -49.207 124.625 1.00 33.79 ? 140  PHE B C     1 
ATOM   2437 O O     . PHE B 1 140 ? 6.483  -48.660 125.449 1.00 33.94 ? 140  PHE B O     1 
ATOM   2438 C CB    . PHE B 1 140 ? 7.093  -50.494 123.050 1.00 35.91 ? 140  PHE B CB    1 
ATOM   2439 C CG    . PHE B 1 140 ? 7.552  -51.798 122.483 1.00 37.58 ? 140  PHE B CG    1 
ATOM   2440 C CD1   . PHE B 1 140 ? 8.506  -52.565 123.149 1.00 38.51 ? 140  PHE B CD1   1 
ATOM   2441 C CD2   . PHE B 1 140 ? 7.054  -52.248 121.268 1.00 37.40 ? 140  PHE B CD2   1 
ATOM   2442 C CE1   . PHE B 1 140 ? 8.958  -53.766 122.604 1.00 39.39 ? 140  PHE B CE1   1 
ATOM   2443 C CE2   . PHE B 1 140 ? 7.496  -53.440 120.720 1.00 38.24 ? 140  PHE B CE2   1 
ATOM   2444 C CZ    . PHE B 1 140 ? 8.450  -54.204 121.386 1.00 38.89 ? 140  PHE B CZ    1 
ATOM   2445 N N     . SER B 1 141 ? 4.718  -48.617 124.046 1.00 32.17 ? 141  SER B N     1 
ATOM   2446 C CA    . SER B 1 141 ? 4.353  -47.237 124.300 1.00 30.86 ? 141  SER B CA    1 
ATOM   2447 C C     . SER B 1 141 ? 3.382  -46.988 125.426 1.00 29.75 ? 141  SER B C     1 
ATOM   2448 O O     . SER B 1 141 ? 2.656  -47.872 125.840 1.00 31.17 ? 141  SER B O     1 
ATOM   2449 C CB    . SER B 1 141 ? 3.757  -46.632 123.028 1.00 30.35 ? 141  SER B CB    1 
ATOM   2450 O OG    . SER B 1 141 ? 4.543  -46.945 121.897 1.00 32.72 ? 141  SER B OG    1 
ATOM   2451 N N     . SER B 1 142 ? 3.363  -45.743 125.874 1.00 27.93 ? 142  SER B N     1 
ATOM   2452 C CA    . SER B 1 142 ? 2.470  -45.274 126.904 1.00 26.94 ? 142  SER B CA    1 
ATOM   2453 C C     . SER B 1 142 ? 2.332  -43.788 126.599 1.00 25.83 ? 142  SER B C     1 
ATOM   2454 O O     . SER B 1 142 ? 3.272  -43.020 126.741 1.00 24.94 ? 142  SER B O     1 
ATOM   2455 C CB    . SER B 1 142 ? 3.071  -45.521 128.275 1.00 28.67 ? 142  SER B CB    1 
ATOM   2456 O OG    . SER B 1 142 ? 2.174  -45.087 129.273 1.00 33.79 ? 142  SER B OG    1 
ATOM   2457 N N     . TYR B 1 143 ? 1.179  -43.402 126.078 1.00 26.84 ? 143  TYR B N     1 
ATOM   2458 C CA    . TYR B 1 143 ? 0.934  -42.009 125.696 1.00 26.52 ? 143  TYR B CA    1 
ATOM   2459 C C     . TYR B 1 143 ? -0.354 -41.443 126.303 1.00 27.17 ? 143  TYR B C     1 
ATOM   2460 O O     . TYR B 1 143 ? -1.461 -41.738 125.845 1.00 27.87 ? 143  TYR B O     1 
ATOM   2461 C CB    . TYR B 1 143 ? 0.877  -41.909 124.168 1.00 23.33 ? 143  TYR B CB    1 
ATOM   2462 C CG    . TYR B 1 143 ? 0.719  -40.515 123.641 1.00 22.58 ? 143  TYR B CG    1 
ATOM   2463 C CD1   . TYR B 1 143 ? 1.567  -39.491 124.050 1.00 22.15 ? 143  TYR B CD1   1 
ATOM   2464 C CD2   . TYR B 1 143 ? -0.269 -40.215 122.711 1.00 23.80 ? 143  TYR B CD2   1 
ATOM   2465 C CE1   . TYR B 1 143 ? 1.434  -38.197 123.545 1.00 20.89 ? 143  TYR B CE1   1 
ATOM   2466 C CE2   . TYR B 1 143 ? -0.406 -38.928 122.203 1.00 21.74 ? 143  TYR B CE2   1 
ATOM   2467 C CZ    . TYR B 1 143 ? 0.448  -37.929 122.630 1.00 22.32 ? 143  TYR B CZ    1 
ATOM   2468 O OH    . TYR B 1 143 ? 0.272  -36.651 122.153 1.00 23.09 ? 143  TYR B OH    1 
ATOM   2469 N N     . GLU B 1 144 ? -0.192 -40.625 127.335 1.00 27.04 ? 144  GLU B N     1 
ATOM   2470 C CA    . GLU B 1 144 ? -1.303 -39.989 128.016 1.00 25.44 ? 144  GLU B CA    1 
ATOM   2471 C C     . GLU B 1 144 ? -0.965 -38.506 128.087 1.00 24.11 ? 144  GLU B C     1 
ATOM   2472 O O     . GLU B 1 144 ? -0.576 -37.999 129.134 1.00 23.54 ? 144  GLU B O     1 
ATOM   2473 C CB    . GLU B 1 144 ? -1.447 -40.603 129.396 1.00 27.30 ? 144  GLU B CB    1 
ATOM   2474 C CG    . GLU B 1 144 ? -1.645 -42.128 129.345 1.00 32.10 ? 144  GLU B CG    1 
ATOM   2475 C CD    . GLU B 1 144 ? -3.017 -42.568 128.795 1.00 35.40 ? 144  GLU B CD    1 
ATOM   2476 O OE1   . GLU B 1 144 ? -3.677 -41.799 128.065 1.00 38.24 ? 144  GLU B OE1   1 
ATOM   2477 O OE2   . GLU B 1 144 ? -3.454 -43.692 129.112 1.00 37.29 ? 144  GLU B OE2   1 
ATOM   2478 N N     . PRO B 1 145 ? -1.180 -37.779 126.976 1.00 22.51 ? 145  PRO B N     1 
ATOM   2479 C CA    . PRO B 1 145 ? -0.905 -36.345 126.833 1.00 23.21 ? 145  PRO B CA    1 
ATOM   2480 C C     . PRO B 1 145 ? -1.412 -35.401 127.912 1.00 23.78 ? 145  PRO B C     1 
ATOM   2481 O O     . PRO B 1 145 ? -0.822 -34.347 128.132 1.00 24.30 ? 145  PRO B O     1 
ATOM   2482 C CB    . PRO B 1 145 ? -1.446 -36.017 125.436 1.00 21.49 ? 145  PRO B CB    1 
ATOM   2483 C CG    . PRO B 1 145 ? -2.476 -37.060 125.197 1.00 21.10 ? 145  PRO B CG    1 
ATOM   2484 C CD    . PRO B 1 145 ? -1.881 -38.296 125.787 1.00 22.21 ? 145  PRO B CD    1 
ATOM   2485 N N     . GLU B 1 146 ? -2.477 -35.774 128.607 1.00 26.29 ? 146  GLU B N     1 
ATOM   2486 C CA    . GLU B 1 146 ? -3.007 -34.926 129.676 1.00 28.07 ? 146  GLU B CA    1 
ATOM   2487 C C     . GLU B 1 146 ? -2.149 -34.993 130.940 1.00 28.28 ? 146  GLU B C     1 
ATOM   2488 O O     . GLU B 1 146 ? -2.143 -34.073 131.743 1.00 27.51 ? 146  GLU B O     1 
ATOM   2489 C CB    . GLU B 1 146 ? -4.461 -35.289 129.965 1.00 28.97 ? 146  GLU B CB    1 
ATOM   2490 C CG    . GLU B 1 146 ? -5.370 -34.824 128.844 1.00 30.41 ? 146  GLU B CG    1 
ATOM   2491 C CD    . GLU B 1 146 ? -6.654 -35.609 128.739 1.00 31.64 ? 146  GLU B CD    1 
ATOM   2492 O OE1   . GLU B 1 146 ? -6.842 -36.550 129.521 1.00 32.79 ? 146  GLU B OE1   1 
ATOM   2493 O OE2   . GLU B 1 146 ? -7.474 -35.300 127.853 1.00 34.57 ? 146  GLU B OE2   1 
ATOM   2494 N N     . LEU B 1 147 ? -1.392 -36.073 131.087 1.00 29.46 ? 147  LEU B N     1 
ATOM   2495 C CA    . LEU B 1 147 ? -0.515 -36.234 132.243 1.00 30.72 ? 147  LEU B CA    1 
ATOM   2496 C C     . LEU B 1 147 ? 0.895  -35.751 131.887 1.00 28.59 ? 147  LEU B C     1 
ATOM   2497 O O     . LEU B 1 147 ? 1.501  -34.990 132.634 1.00 30.43 ? 147  LEU B O     1 
ATOM   2498 C CB    . LEU B 1 147 ? -0.472 -37.702 132.683 1.00 34.05 ? 147  LEU B CB    1 
ATOM   2499 C CG    . LEU B 1 147 ? -1.768 -38.506 132.479 1.00 37.67 ? 147  LEU B CG    1 
ATOM   2500 C CD1   . LEU B 1 147 ? -1.625 -39.952 133.006 1.00 39.74 ? 147  LEU B CD1   1 
ATOM   2501 C CD2   . LEU B 1 147 ? -2.932 -37.795 133.157 1.00 37.43 ? 147  LEU B CD2   1 
ATOM   2502 N N     . PHE B 1 148 ? 1.397  -36.184 130.733 1.00 25.45 ? 148  PHE B N     1 
ATOM   2503 C CA    . PHE B 1 148 ? 2.726  -35.816 130.260 1.00 21.23 ? 148  PHE B CA    1 
ATOM   2504 C C     . PHE B 1 148 ? 2.677  -35.772 128.724 1.00 20.03 ? 148  PHE B C     1 
ATOM   2505 O O     . PHE B 1 148 ? 2.183  -36.688 128.070 1.00 19.22 ? 148  PHE B O     1 
ATOM   2506 C CB    . PHE B 1 148 ? 3.772  -36.834 130.767 1.00 21.08 ? 148  PHE B CB    1 
ATOM   2507 C CG    . PHE B 1 148 ? 5.206  -36.373 130.602 1.00 19.43 ? 148  PHE B CG    1 
ATOM   2508 C CD1   . PHE B 1 148 ? 5.655  -35.235 131.245 1.00 16.27 ? 148  PHE B CD1   1 
ATOM   2509 C CD2   . PHE B 1 148 ? 6.065  -37.023 129.714 1.00 18.05 ? 148  PHE B CD2   1 
ATOM   2510 C CE1   . PHE B 1 148 ? 6.933  -34.734 130.997 1.00 17.53 ? 148  PHE B CE1   1 
ATOM   2511 C CE2   . PHE B 1 148 ? 7.338  -36.529 129.461 1.00 18.07 ? 148  PHE B CE2   1 
ATOM   2512 C CZ    . PHE B 1 148 ? 7.772  -35.379 130.102 1.00 17.37 ? 148  PHE B CZ    1 
ATOM   2513 N N     . PRO B 1 149 ? 3.184  -34.689 128.127 1.00 19.95 ? 149  PRO B N     1 
ATOM   2514 C CA    . PRO B 1 149 ? 3.189  -34.521 126.672 1.00 20.23 ? 149  PRO B CA    1 
ATOM   2515 C C     . PRO B 1 149 ? 4.012  -35.516 125.868 1.00 21.56 ? 149  PRO B C     1 
ATOM   2516 O O     . PRO B 1 149 ? 3.844  -35.599 124.657 1.00 23.42 ? 149  PRO B O     1 
ATOM   2517 C CB    . PRO B 1 149 ? 3.757  -33.115 126.496 1.00 19.62 ? 149  PRO B CB    1 
ATOM   2518 C CG    . PRO B 1 149 ? 3.406  -32.429 127.790 1.00 20.65 ? 149  PRO B CG    1 
ATOM   2519 C CD    . PRO B 1 149 ? 3.725  -33.491 128.789 1.00 19.58 ? 149  PRO B CD    1 
ATOM   2520 N N     . GLY B 1 150 ? 4.901  -36.262 126.508 1.00 20.93 ? 150  GLY B N     1 
ATOM   2521 C CA    . GLY B 1 150 ? 5.733  -37.183 125.750 1.00 20.70 ? 150  GLY B CA    1 
ATOM   2522 C C     . GLY B 1 150 ? 5.319  -38.637 125.778 1.00 21.39 ? 150  GLY B C     1 
ATOM   2523 O O     . GLY B 1 150 ? 4.687  -39.104 126.732 1.00 20.46 ? 150  GLY B O     1 
ATOM   2524 N N     . LEU B 1 151 ? 5.663  -39.357 124.717 1.00 20.67 ? 151  LEU B N     1 
ATOM   2525 C CA    . LEU B 1 151 ? 5.351  -40.770 124.642 1.00 19.97 ? 151  LEU B CA    1 
ATOM   2526 C C     . LEU B 1 151 ? 6.466  -41.514 125.353 1.00 19.71 ? 151  LEU B C     1 
ATOM   2527 O O     . LEU B 1 151 ? 7.633  -41.273 125.075 1.00 19.62 ? 151  LEU B O     1 
ATOM   2528 C CB    . LEU B 1 151 ? 5.275  -41.228 123.190 1.00 18.58 ? 151  LEU B CB    1 
ATOM   2529 C CG    . LEU B 1 151 ? 4.855  -42.684 123.008 1.00 19.53 ? 151  LEU B CG    1 
ATOM   2530 C CD1   . LEU B 1 151 ? 4.000  -42.809 121.780 1.00 19.27 ? 151  LEU B CD1   1 
ATOM   2531 C CD2   . LEU B 1 151 ? 6.065  -43.593 122.934 1.00 18.46 ? 151  LEU B CD2   1 
ATOM   2532 N N     . ILE B 1 152 ? 6.096  -42.387 126.287 1.00 20.05 ? 152  ILE B N     1 
ATOM   2533 C CA    . ILE B 1 152 ? 7.047  -43.188 127.047 1.00 19.20 ? 152  ILE B CA    1 
ATOM   2534 C C     . ILE B 1 152 ? 7.233  -44.468 126.261 1.00 19.78 ? 152  ILE B C     1 
ATOM   2535 O O     . ILE B 1 152 ? 6.310  -45.262 126.145 1.00 21.54 ? 152  ILE B O     1 
ATOM   2536 C CB    . ILE B 1 152 ? 6.496  -43.595 128.449 1.00 19.18 ? 152  ILE B CB    1 
ATOM   2537 C CG1   . ILE B 1 152 ? 5.849  -42.397 129.165 1.00 18.23 ? 152  ILE B CG1   1 
ATOM   2538 C CG2   . ILE B 1 152 ? 7.598  -44.237 129.284 1.00 17.08 ? 152  ILE B CG2   1 
ATOM   2539 C CD1   . ILE B 1 152 ? 6.752  -41.243 129.388 1.00 19.24 ? 152  ILE B CD1   1 
ATOM   2540 N N     . TYR B 1 153 ? 8.412  -44.651 125.689 1.00 21.37 ? 153  TYR B N     1 
ATOM   2541 C CA    . TYR B 1 153 ? 8.715  -45.847 124.915 1.00 20.65 ? 153  TYR B CA    1 
ATOM   2542 C C     . TYR B 1 153 ? 9.735  -46.683 125.683 1.00 20.88 ? 153  TYR B C     1 
ATOM   2543 O O     . TYR B 1 153 ? 10.887 -46.288 125.870 1.00 20.32 ? 153  TYR B O     1 
ATOM   2544 C CB    . TYR B 1 153 ? 9.242  -45.479 123.524 1.00 19.39 ? 153  TYR B CB    1 
ATOM   2545 C CG    . TYR B 1 153 ? 9.239  -46.641 122.558 1.00 20.56 ? 153  TYR B CG    1 
ATOM   2546 C CD1   . TYR B 1 153 ? 10.226 -47.630 122.624 1.00 21.34 ? 153  TYR B CD1   1 
ATOM   2547 C CD2   . TYR B 1 153 ? 8.231  -46.778 121.596 1.00 19.67 ? 153  TYR B CD2   1 
ATOM   2548 C CE1   . TYR B 1 153 ? 10.207 -48.730 121.765 1.00 21.07 ? 153  TYR B CE1   1 
ATOM   2549 C CE2   . TYR B 1 153 ? 8.209  -47.864 120.737 1.00 19.38 ? 153  TYR B CE2   1 
ATOM   2550 C CZ    . TYR B 1 153 ? 9.198  -48.838 120.832 1.00 20.87 ? 153  TYR B CZ    1 
ATOM   2551 O OH    . TYR B 1 153 ? 9.162  -49.940 120.023 1.00 23.72 ? 153  TYR B OH    1 
ATOM   2552 N N     . ARG B 1 154 ? 9.273  -47.826 126.166 1.00 22.91 ? 154  ARG B N     1 
ATOM   2553 C CA    . ARG B 1 154 ? 10.095 -48.742 126.924 1.00 23.87 ? 154  ARG B CA    1 
ATOM   2554 C C     . ARG B 1 154 ? 10.624 -49.843 126.004 1.00 25.57 ? 154  ARG B C     1 
ATOM   2555 O O     . ARG B 1 154 ? 9.957  -50.856 125.762 1.00 26.76 ? 154  ARG B O     1 
ATOM   2556 C CB    . ARG B 1 154 ? 9.278  -49.289 128.093 1.00 23.17 ? 154  ARG B CB    1 
ATOM   2557 C CG    . ARG B 1 154 ? 8.997  -48.215 129.152 1.00 26.28 ? 154  ARG B CG    1 
ATOM   2558 C CD    . ARG B 1 154 ? 8.344  -48.782 130.405 1.00 28.44 ? 154  ARG B CD    1 
ATOM   2559 N NE    . ARG B 1 154 ? 8.361  -47.858 131.547 1.00 29.60 ? 154  ARG B NE    1 
ATOM   2560 C CZ    . ARG B 1 154 ? 7.397  -46.982 131.822 1.00 30.53 ? 154  ARG B CZ    1 
ATOM   2561 N NH1   . ARG B 1 154 ? 6.327  -46.876 131.041 1.00 30.78 ? 154  ARG B NH1   1 
ATOM   2562 N NH2   . ARG B 1 154 ? 7.459  -46.263 132.928 1.00 31.09 ? 154  ARG B NH2   1 
ATOM   2563 N N     . MET B 1 155 ? 11.809 -49.599 125.451 1.00 25.17 ? 155  MET B N     1 
ATOM   2564 C CA    . MET B 1 155 ? 12.458 -50.516 124.527 1.00 25.66 ? 155  MET B CA    1 
ATOM   2565 C C     . MET B 1 155 ? 13.038 -51.716 125.279 1.00 27.23 ? 155  MET B C     1 
ATOM   2566 O O     . MET B 1 155 ? 13.606 -51.563 126.368 1.00 28.13 ? 155  MET B O     1 
ATOM   2567 C CB    . MET B 1 155 ? 13.555 -49.750 123.775 1.00 25.63 ? 155  MET B CB    1 
ATOM   2568 C CG    . MET B 1 155 ? 14.133 -50.439 122.538 1.00 24.33 ? 155  MET B CG    1 
ATOM   2569 S SD    . MET B 1 155 ? 15.423 -49.431 121.765 1.00 23.97 ? 155  MET B SD    1 
ATOM   2570 C CE    . MET B 1 155 ? 14.478 -48.360 120.701 1.00 19.59 ? 155  MET B CE    1 
ATOM   2571 N N     . LYS B 1 156 ? 12.892 -52.904 124.694 1.00 28.92 ? 156  LYS B N     1 
ATOM   2572 C CA    . LYS B 1 156 ? 13.380 -54.155 125.300 1.00 29.18 ? 156  LYS B CA    1 
ATOM   2573 C C     . LYS B 1 156 ? 14.871 -54.432 125.091 1.00 27.47 ? 156  LYS B C     1 
ATOM   2574 O O     . LYS B 1 156 ? 15.539 -54.959 125.973 1.00 26.66 ? 156  LYS B O     1 
ATOM   2575 C CB    . LYS B 1 156 ? 12.584 -55.367 124.779 1.00 32.04 ? 156  LYS B CB    1 
ATOM   2576 C CG    . LYS B 1 156 ? 11.397 -55.827 125.629 1.00 36.43 ? 156  LYS B CG    1 
ATOM   2577 C CD    . LYS B 1 156 ? 10.156 -54.965 125.416 1.00 39.25 ? 156  LYS B CD    1 
ATOM   2578 C CE    . LYS B 1 156 ? 8.878  -55.686 125.876 1.00 40.31 ? 156  LYS B CE    1 
ATOM   2579 N NZ    . LYS B 1 156 ? 7.611  -54.990 125.452 1.00 40.82 ? 156  LYS B NZ    1 
ATOM   2580 N N     . VAL B 1 157 ? 15.379 -54.133 123.904 1.00 26.36 ? 157  VAL B N     1 
ATOM   2581 C CA    . VAL B 1 157 ? 16.780 -54.373 123.601 1.00 25.10 ? 157  VAL B CA    1 
ATOM   2582 C C     . VAL B 1 157 ? 17.329 -53.170 122.840 1.00 24.08 ? 157  VAL B C     1 
ATOM   2583 O O     . VAL B 1 157 ? 16.948 -52.923 121.694 1.00 25.40 ? 157  VAL B O     1 
ATOM   2584 C CB    . VAL B 1 157 ? 16.962 -55.653 122.731 1.00 25.75 ? 157  VAL B CB    1 
ATOM   2585 C CG1   . VAL B 1 157 ? 18.430 -55.949 122.510 1.00 25.91 ? 157  VAL B CG1   1 
ATOM   2586 C CG2   . VAL B 1 157 ? 16.317 -56.839 123.389 1.00 26.93 ? 157  VAL B CG2   1 
ATOM   2587 N N     . PRO B 1 158 ? 18.162 -52.354 123.498 1.00 23.23 ? 158  PRO B N     1 
ATOM   2588 C CA    . PRO B 1 158 ? 18.557 -52.550 124.889 1.00 22.92 ? 158  PRO B CA    1 
ATOM   2589 C C     . PRO B 1 158 ? 17.397 -52.117 125.776 1.00 23.66 ? 158  PRO B C     1 
ATOM   2590 O O     . PRO B 1 158 ? 16.404 -51.584 125.274 1.00 22.80 ? 158  PRO B O     1 
ATOM   2591 C CB    . PRO B 1 158 ? 19.777 -51.638 125.025 1.00 20.80 ? 158  PRO B CB    1 
ATOM   2592 C CG    . PRO B 1 158 ? 19.495 -50.560 124.099 1.00 21.32 ? 158  PRO B CG    1 
ATOM   2593 C CD    . PRO B 1 158 ? 18.948 -51.273 122.892 1.00 22.31 ? 158  PRO B CD    1 
ATOM   2594 N N     . LYS B 1 159 ? 17.482 -52.414 127.069 1.00 24.19 ? 159  LYS B N     1 
ATOM   2595 C CA    . LYS B 1 159 ? 16.424 -52.053 127.996 1.00 24.80 ? 159  LYS B CA    1 
ATOM   2596 C C     . LYS B 1 159 ? 16.606 -50.572 128.293 1.00 23.87 ? 159  LYS B C     1 
ATOM   2597 O O     . LYS B 1 159 ? 17.318 -50.186 129.221 1.00 23.54 ? 159  LYS B O     1 
ATOM   2598 C CB    . LYS B 1 159 ? 16.531 -52.905 129.261 1.00 27.63 ? 159  LYS B CB    1 
ATOM   2599 C CG    . LYS B 1 159 ? 15.309 -52.831 130.155 1.00 31.53 ? 159  LYS B CG    1 
ATOM   2600 C CD    . LYS B 1 159 ? 15.480 -53.680 131.387 1.00 35.28 ? 159  LYS B CD    1 
ATOM   2601 C CE    . LYS B 1 159 ? 14.253 -53.584 132.293 1.00 39.46 ? 159  LYS B CE    1 
ATOM   2602 N NZ    . LYS B 1 159 ? 14.051 -52.206 132.845 1.00 41.11 ? 159  LYS B NZ    1 
ATOM   2603 N N     . ILE B 1 160 ? 15.971 -49.744 127.480 1.00 22.75 ? 160  ILE B N     1 
ATOM   2604 C CA    . ILE B 1 160 ? 16.101 -48.298 127.595 1.00 22.33 ? 160  ILE B CA    1 
ATOM   2605 C C     . ILE B 1 160 ? 14.727 -47.653 127.528 1.00 22.17 ? 160  ILE B C     1 
ATOM   2606 O O     . ILE B 1 160 ? 13.795 -48.243 126.986 1.00 21.28 ? 160  ILE B O     1 
ATOM   2607 C CB    . ILE B 1 160 ? 16.993 -47.770 126.423 1.00 22.72 ? 160  ILE B CB    1 
ATOM   2608 C CG1   . ILE B 1 160 ? 18.457 -48.091 126.712 1.00 24.43 ? 160  ILE B CG1   1 
ATOM   2609 C CG2   . ILE B 1 160 ? 16.814 -46.290 126.185 1.00 20.16 ? 160  ILE B CG2   1 
ATOM   2610 C CD1   . ILE B 1 160 ? 19.010 -47.367 127.911 1.00 25.02 ? 160  ILE B CD1   1 
ATOM   2611 N N     . VAL B 1 161 ? 14.603 -46.464 128.114 1.00 21.07 ? 161  VAL B N     1 
ATOM   2612 C CA    . VAL B 1 161 ? 13.353 -45.729 128.097 1.00 20.25 ? 161  VAL B CA    1 
ATOM   2613 C C     . VAL B 1 161 ? 13.558 -44.413 127.344 1.00 20.35 ? 161  VAL B C     1 
ATOM   2614 O O     . VAL B 1 161 ? 14.509 -43.673 127.606 1.00 19.06 ? 161  VAL B O     1 
ATOM   2615 C CB    . VAL B 1 161 ? 12.810 -45.519 129.531 1.00 19.40 ? 161  VAL B CB    1 
ATOM   2616 C CG1   . VAL B 1 161 ? 11.514 -44.712 129.518 1.00 16.35 ? 161  VAL B CG1   1 
ATOM   2617 C CG2   . VAL B 1 161 ? 12.557 -46.871 130.149 1.00 18.32 ? 161  VAL B CG2   1 
ATOM   2618 N N     . LEU B 1 162 ? 12.716 -44.185 126.338 1.00 19.58 ? 162  LEU B N     1 
ATOM   2619 C CA    . LEU B 1 162 ? 12.797 -42.983 125.515 1.00 18.35 ? 162  LEU B CA    1 
ATOM   2620 C C     . LEU B 1 162 ? 11.533 -42.161 125.686 1.00 18.02 ? 162  LEU B C     1 
ATOM   2621 O O     . LEU B 1 162 ? 10.443 -42.716 125.791 1.00 17.21 ? 162  LEU B O     1 
ATOM   2622 C CB    . LEU B 1 162 ? 12.964 -43.368 124.036 1.00 19.67 ? 162  LEU B CB    1 
ATOM   2623 C CG    . LEU B 1 162 ? 14.096 -44.365 123.698 1.00 19.74 ? 162  LEU B CG    1 
ATOM   2624 C CD1   . LEU B 1 162 ? 13.603 -45.796 123.699 1.00 17.82 ? 162  LEU B CD1   1 
ATOM   2625 C CD2   . LEU B 1 162 ? 14.669 -44.039 122.342 1.00 21.15 ? 162  LEU B CD2   1 
ATOM   2626 N N     . LEU B 1 163 ? 11.691 -40.850 125.816 1.00 17.11 ? 163  LEU B N     1 
ATOM   2627 C CA    . LEU B 1 163 ? 10.564 -39.942 125.940 1.00 15.89 ? 163  LEU B CA    1 
ATOM   2628 C C     . LEU B 1 163 ? 10.591 -39.229 124.608 1.00 17.29 ? 163  LEU B C     1 
ATOM   2629 O O     . LEU B 1 163 ? 11.539 -38.506 124.301 1.00 17.17 ? 163  LEU B O     1 
ATOM   2630 C CB    . LEU B 1 163 ? 10.759 -38.937 127.065 1.00 14.99 ? 163  LEU B CB    1 
ATOM   2631 C CG    . LEU B 1 163 ? 11.049 -39.539 128.436 1.00 15.01 ? 163  LEU B CG    1 
ATOM   2632 C CD1   . LEU B 1 163 ? 11.064 -38.425 129.472 1.00 16.11 ? 163  LEU B CD1   1 
ATOM   2633 C CD2   . LEU B 1 163 ? 9.987  -40.563 128.782 1.00 15.98 ? 163  LEU B CD2   1 
ATOM   2634 N N     . ILE B 1 164 ? 9.548  -39.467 123.818 1.00 18.48 ? 164  ILE B N     1 
ATOM   2635 C CA    . ILE B 1 164 ? 9.392  -38.924 122.474 1.00 17.91 ? 164  ILE B CA    1 
ATOM   2636 C C     . ILE B 1 164 ? 8.367  -37.788 122.454 1.00 16.99 ? 164  ILE B C     1 
ATOM   2637 O O     . ILE B 1 164 ? 7.254  -37.937 122.960 1.00 17.15 ? 164  ILE B O     1 
ATOM   2638 C CB    . ILE B 1 164 ? 9.008  -40.095 121.527 1.00 17.49 ? 164  ILE B CB    1 
ATOM   2639 C CG1   . ILE B 1 164 ? 10.107 -41.155 121.607 1.00 17.39 ? 164  ILE B CG1   1 
ATOM   2640 C CG2   . ILE B 1 164 ? 8.811  -39.614 120.106 1.00 18.40 ? 164  ILE B CG2   1 
ATOM   2641 C CD1   . ILE B 1 164 ? 9.801  -42.427 120.922 1.00 19.45 ? 164  ILE B CD1   1 
ATOM   2642 N N     . PHE B 1 165 ? 8.764  -36.645 121.909 1.00 15.82 ? 165  PHE B N     1 
ATOM   2643 C CA    . PHE B 1 165 ? 7.893  -35.482 121.863 1.00 17.44 ? 165  PHE B CA    1 
ATOM   2644 C C     . PHE B 1 165 ? 7.487  -35.128 120.440 1.00 19.09 ? 165  PHE B C     1 
ATOM   2645 O O     . PHE B 1 165 ? 8.165  -35.505 119.489 1.00 19.67 ? 165  PHE B O     1 
ATOM   2646 C CB    . PHE B 1 165 ? 8.587  -34.313 122.549 1.00 14.38 ? 165  PHE B CB    1 
ATOM   2647 C CG    . PHE B 1 165 ? 8.992  -34.623 123.964 1.00 15.25 ? 165  PHE B CG    1 
ATOM   2648 C CD1   . PHE B 1 165 ? 10.227 -35.214 124.238 1.00 14.95 ? 165  PHE B CD1   1 
ATOM   2649 C CD2   . PHE B 1 165 ? 8.115  -34.387 125.021 1.00 15.23 ? 165  PHE B CD2   1 
ATOM   2650 C CE1   . PHE B 1 165 ? 10.588 -35.577 125.548 1.00 14.79 ? 165  PHE B CE1   1 
ATOM   2651 C CE2   . PHE B 1 165 ? 8.462  -34.745 126.337 1.00 16.51 ? 165  PHE B CE2   1 
ATOM   2652 C CZ    . PHE B 1 165 ? 9.706  -35.345 126.596 1.00 14.79 ? 165  PHE B CZ    1 
ATOM   2653 N N     . VAL B 1 166 ? 6.376  -34.412 120.289 1.00 20.64 ? 166  VAL B N     1 
ATOM   2654 C CA    . VAL B 1 166 ? 5.882  -34.029 118.963 1.00 21.82 ? 166  VAL B CA    1 
ATOM   2655 C C     . VAL B 1 166 ? 6.881  -33.162 118.204 1.00 21.23 ? 166  VAL B C     1 
ATOM   2656 O O     . VAL B 1 166 ? 6.952  -33.214 116.992 1.00 21.62 ? 166  VAL B O     1 
ATOM   2657 C CB    . VAL B 1 166 ? 4.534  -33.292 119.059 1.00 22.67 ? 166  VAL B CB    1 
ATOM   2658 C CG1   . VAL B 1 166 ? 4.685  -32.042 119.911 1.00 23.96 ? 166  VAL B CG1   1 
ATOM   2659 C CG2   . VAL B 1 166 ? 4.032  -32.933 117.670 1.00 22.57 ? 166  VAL B CG2   1 
ATOM   2660 N N     . SER B 1 167 ? 7.672  -32.388 118.933 1.00 21.97 ? 167  SER B N     1 
ATOM   2661 C CA    . SER B 1 167 ? 8.679  -31.519 118.342 1.00 21.97 ? 167  SER B CA    1 
ATOM   2662 C C     . SER B 1 167 ? 9.759  -32.298 117.623 1.00 23.10 ? 167  SER B C     1 
ATOM   2663 O O     . SER B 1 167 ? 10.429 -31.777 116.731 1.00 26.11 ? 167  SER B O     1 
ATOM   2664 C CB    . SER B 1 167 ? 9.339  -30.707 119.440 1.00 21.89 ? 167  SER B CB    1 
ATOM   2665 O OG    . SER B 1 167 ? 9.853  -31.572 120.432 1.00 22.26 ? 167  SER B OG    1 
ATOM   2666 N N     . GLY B 1 168 ? 9.961  -33.541 118.036 1.00 23.84 ? 168  GLY B N     1 
ATOM   2667 C CA    . GLY B 1 168 ? 10.988 -34.351 117.414 1.00 22.41 ? 168  GLY B CA    1 
ATOM   2668 C C     . GLY B 1 168 ? 12.137 -34.518 118.371 1.00 21.56 ? 168  GLY B C     1 
ATOM   2669 O O     . GLY B 1 168 ? 13.136 -35.128 118.022 1.00 22.66 ? 168  GLY B O     1 
ATOM   2670 N N     . LYS B 1 169 ? 12.034 -33.916 119.550 1.00 20.77 ? 169  LYS B N     1 
ATOM   2671 C CA    . LYS B 1 169 ? 13.073 -34.065 120.557 1.00 22.16 ? 169  LYS B CA    1 
ATOM   2672 C C     . LYS B 1 169 ? 12.878 -35.375 121.332 1.00 21.77 ? 169  LYS B C     1 
ATOM   2673 O O     . LYS B 1 169 ? 11.752 -35.796 121.591 1.00 23.65 ? 169  LYS B O     1 
ATOM   2674 C CB    . LYS B 1 169 ? 13.136 -32.849 121.470 1.00 22.98 ? 169  LYS B CB    1 
ATOM   2675 C CG    . LYS B 1 169 ? 13.553 -31.626 120.702 1.00 22.76 ? 169  LYS B CG    1 
ATOM   2676 C CD    . LYS B 1 169 ? 14.033 -30.544 121.589 1.00 26.27 ? 169  LYS B CD    1 
ATOM   2677 C CE    . LYS B 1 169 ? 14.119 -29.239 120.818 1.00 28.74 ? 169  LYS B CE    1 
ATOM   2678 N NZ    . LYS B 1 169 ? 12.757 -28.714 120.499 1.00 31.77 ? 169  LYS B NZ    1 
ATOM   2679 N N     . ILE B 1 170 ? 13.977 -36.049 121.640 1.00 20.40 ? 170  ILE B N     1 
ATOM   2680 C CA    . ILE B 1 170 ? 13.908 -37.332 122.306 1.00 20.00 ? 170  ILE B CA    1 
ATOM   2681 C C     . ILE B 1 170 ? 14.834 -37.359 123.517 1.00 19.85 ? 170  ILE B C     1 
ATOM   2682 O O     . ILE B 1 170 ? 15.935 -36.808 123.480 1.00 20.19 ? 170  ILE B O     1 
ATOM   2683 C CB    . ILE B 1 170 ? 14.402 -38.460 121.337 1.00 19.90 ? 170  ILE B CB    1 
ATOM   2684 C CG1   . ILE B 1 170 ? 13.731 -38.355 119.973 1.00 20.19 ? 170  ILE B CG1   1 
ATOM   2685 C CG2   . ILE B 1 170 ? 14.118 -39.821 121.902 1.00 20.49 ? 170  ILE B CG2   1 
ATOM   2686 C CD1   . ILE B 1 170 ? 12.274 -38.751 119.961 1.00 21.88 ? 170  ILE B CD1   1 
ATOM   2687 N N     . VAL B 1 171 ? 14.377 -37.982 124.593 1.00 18.47 ? 171  VAL B N     1 
ATOM   2688 C CA    . VAL B 1 171 ? 15.192 -38.153 125.776 1.00 16.71 ? 171  VAL B CA    1 
ATOM   2689 C C     . VAL B 1 171 ? 15.410 -39.665 125.881 1.00 16.14 ? 171  VAL B C     1 
ATOM   2690 O O     . VAL B 1 171 ? 14.496 -40.446 125.645 1.00 16.40 ? 171  VAL B O     1 
ATOM   2691 C CB    . VAL B 1 171 ? 14.520 -37.593 127.054 1.00 16.53 ? 171  VAL B CB    1 
ATOM   2692 C CG1   . VAL B 1 171 ? 15.307 -38.035 128.299 1.00 14.13 ? 171  VAL B CG1   1 
ATOM   2693 C CG2   . VAL B 1 171 ? 14.476 -36.066 126.986 1.00 12.65 ? 171  VAL B CG2   1 
ATOM   2694 N N     . ILE B 1 172 ? 16.638 -40.074 126.155 1.00 15.58 ? 172  ILE B N     1 
ATOM   2695 C CA    . ILE B 1 172 ? 16.963 -41.481 126.274 1.00 16.19 ? 172  ILE B CA    1 
ATOM   2696 C C     . ILE B 1 172 ? 17.591 -41.681 127.652 1.00 15.00 ? 172  ILE B C     1 
ATOM   2697 O O     . ILE B 1 172 ? 18.616 -41.085 127.963 1.00 16.07 ? 172  ILE B O     1 
ATOM   2698 C CB    . ILE B 1 172 ? 17.950 -41.903 125.148 1.00 17.93 ? 172  ILE B CB    1 
ATOM   2699 C CG1   . ILE B 1 172 ? 17.397 -41.487 123.779 1.00 17.55 ? 172  ILE B CG1   1 
ATOM   2700 C CG2   . ILE B 1 172 ? 18.167 -43.422 125.170 1.00 16.91 ? 172  ILE B CG2   1 
ATOM   2701 C CD1   . ILE B 1 172 ? 18.465 -41.133 122.739 1.00 16.82 ? 172  ILE B CD1   1 
ATOM   2702 N N     . THR B 1 173 ? 16.991 -42.524 128.480 1.00 15.29 ? 173  THR B N     1 
ATOM   2703 C CA    . THR B 1 173 ? 17.518 -42.730 129.824 1.00 15.17 ? 173  THR B CA    1 
ATOM   2704 C C     . THR B 1 173 ? 17.521 -44.177 130.305 1.00 15.92 ? 173  THR B C     1 
ATOM   2705 O O     . THR B 1 173 ? 16.818 -45.026 129.758 1.00 16.35 ? 173  THR B O     1 
ATOM   2706 C CB    . THR B 1 173 ? 16.779 -41.832 130.832 1.00 14.94 ? 173  THR B CB    1 
ATOM   2707 O OG1   . THR B 1 173 ? 17.450 -41.891 132.087 1.00 14.02 ? 173  THR B OG1   1 
ATOM   2708 C CG2   . THR B 1 173 ? 15.304 -42.240 130.988 1.00 12.54 ? 173  THR B CG2   1 
ATOM   2709 N N     . GLY B 1 174 ? 18.350 -44.463 131.301 1.00 15.96 ? 174  GLY B N     1 
ATOM   2710 C CA    . GLY B 1 174 ? 18.428 -45.810 131.831 1.00 17.59 ? 174  GLY B CA    1 
ATOM   2711 C C     . GLY B 1 174 ? 19.654 -46.608 131.416 1.00 19.54 ? 174  GLY B C     1 
ATOM   2712 O O     . GLY B 1 174 ? 19.813 -47.748 131.857 1.00 20.50 ? 174  GLY B O     1 
ATOM   2713 N N     . ALA B 1 175 ? 20.519 -46.041 130.575 1.00 19.66 ? 175  ALA B N     1 
ATOM   2714 C CA    . ALA B 1 175 ? 21.714 -46.766 130.123 1.00 20.48 ? 175  ALA B CA    1 
ATOM   2715 C C     . ALA B 1 175 ? 22.836 -46.751 131.145 1.00 20.93 ? 175  ALA B C     1 
ATOM   2716 O O     . ALA B 1 175 ? 22.971 -45.815 131.925 1.00 22.83 ? 175  ALA B O     1 
ATOM   2717 C CB    . ALA B 1 175 ? 22.230 -46.198 128.792 1.00 16.91 ? 175  ALA B CB    1 
ATOM   2718 N N     . LYS B 1 176 ? 23.619 -47.812 131.169 1.00 22.04 ? 176  LYS B N     1 
ATOM   2719 C CA    . LYS B 1 176 ? 24.759 -47.867 132.060 1.00 23.11 ? 176  LYS B CA    1 
ATOM   2720 C C     . LYS B 1 176 ? 26.003 -47.715 131.198 1.00 23.54 ? 176  LYS B C     1 
ATOM   2721 O O     . LYS B 1 176 ? 27.084 -47.423 131.713 1.00 24.19 ? 176  LYS B O     1 
ATOM   2722 C CB    . LYS B 1 176 ? 24.773 -49.174 132.837 1.00 23.19 ? 176  LYS B CB    1 
ATOM   2723 C CG    . LYS B 1 176 ? 23.674 -49.249 133.874 1.00 25.20 ? 176  LYS B CG    1 
ATOM   2724 C CD    . LYS B 1 176 ? 24.261 -49.572 135.230 1.00 28.41 ? 176  LYS B CD    1 
ATOM   2725 C CE    . LYS B 1 176 ? 23.205 -49.529 136.304 1.00 28.34 ? 176  LYS B CE    1 
ATOM   2726 N NZ    . LYS B 1 176 ? 22.181 -50.572 136.062 1.00 31.14 ? 176  LYS B NZ    1 
ATOM   2727 N N     . MET B 1 177 ? 25.812 -47.849 129.880 1.00 24.14 ? 177  MET B N     1 
ATOM   2728 C CA    . MET B 1 177 ? 26.867 -47.724 128.866 1.00 25.68 ? 177  MET B CA    1 
ATOM   2729 C C     . MET B 1 177 ? 26.337 -46.747 127.827 1.00 24.57 ? 177  MET B C     1 
ATOM   2730 O O     . MET B 1 177 ? 25.183 -46.875 127.427 1.00 24.30 ? 177  MET B O     1 
ATOM   2731 C CB    . MET B 1 177 ? 27.074 -49.054 128.161 1.00 28.63 ? 177  MET B CB    1 
ATOM   2732 C CG    . MET B 1 177 ? 27.189 -50.218 129.091 1.00 34.64 ? 177  MET B CG    1 
ATOM   2733 S SD    . MET B 1 177 ? 28.885 -50.648 129.345 1.00 44.49 ? 177  MET B SD    1 
ATOM   2734 C CE    . MET B 1 177 ? 29.448 -49.328 130.459 1.00 39.15 ? 177  MET B CE    1 
ATOM   2735 N N     . ARG B 1 178 ? 27.170 -45.820 127.348 1.00 24.38 ? 178  ARG B N     1 
ATOM   2736 C CA    . ARG B 1 178 ? 26.721 -44.846 126.339 1.00 24.93 ? 178  ARG B CA    1 
ATOM   2737 C C     . ARG B 1 178 ? 26.327 -45.495 125.013 1.00 24.81 ? 178  ARG B C     1 
ATOM   2738 O O     . ARG B 1 178 ? 25.556 -44.926 124.232 1.00 24.30 ? 178  ARG B O     1 
ATOM   2739 C CB    . ARG B 1 178 ? 27.763 -43.757 126.096 1.00 24.18 ? 178  ARG B CB    1 
ATOM   2740 C CG    . ARG B 1 178 ? 29.022 -44.251 125.430 1.00 22.76 ? 178  ARG B CG    1 
ATOM   2741 C CD    . ARG B 1 178 ? 29.758 -43.094 124.820 1.00 22.12 ? 178  ARG B CD    1 
ATOM   2742 N NE    . ARG B 1 178 ? 30.134 -42.112 125.825 1.00 22.09 ? 178  ARG B NE    1 
ATOM   2743 C CZ    . ARG B 1 178 ? 30.638 -40.919 125.546 1.00 22.01 ? 178  ARG B CZ    1 
ATOM   2744 N NH1   . ARG B 1 178 ? 30.824 -40.553 124.287 1.00 20.65 ? 178  ARG B NH1   1 
ATOM   2745 N NH2   . ARG B 1 178 ? 30.980 -40.104 126.533 1.00 23.56 ? 178  ARG B NH2   1 
ATOM   2746 N N     . ASP B 1 179 ? 26.873 -46.677 124.751 1.00 25.97 ? 179  ASP B N     1 
ATOM   2747 C CA    . ASP B 1 179 ? 26.536 -47.428 123.548 1.00 26.84 ? 179  ASP B CA    1 
ATOM   2748 C C     . ASP B 1 179 ? 25.074 -47.880 123.552 1.00 26.37 ? 179  ASP B C     1 
ATOM   2749 O O     . ASP B 1 179 ? 24.489 -48.073 122.487 1.00 27.15 ? 179  ASP B O     1 
ATOM   2750 C CB    . ASP B 1 179 ? 27.462 -48.623 123.391 1.00 29.00 ? 179  ASP B CB    1 
ATOM   2751 C CG    . ASP B 1 179 ? 28.745 -48.263 122.683 1.00 32.83 ? 179  ASP B CG    1 
ATOM   2752 O OD1   . ASP B 1 179 ? 29.157 -47.074 122.723 1.00 35.00 ? 179  ASP B OD1   1 
ATOM   2753 O OD2   . ASP B 1 179 ? 29.339 -49.176 122.066 1.00 35.93 ? 179  ASP B OD2   1 
ATOM   2754 N N     . GLU B 1 180 ? 24.486 -48.050 124.739 1.00 26.33 ? 180  GLU B N     1 
ATOM   2755 C CA    . GLU B 1 180 ? 23.073 -48.432 124.860 1.00 25.45 ? 180  GLU B CA    1 
ATOM   2756 C C     . GLU B 1 180 ? 22.216 -47.212 124.475 1.00 23.82 ? 180  GLU B C     1 
ATOM   2757 O O     . GLU B 1 180 ? 21.203 -47.344 123.793 1.00 23.57 ? 180  GLU B O     1 
ATOM   2758 C CB    . GLU B 1 180 ? 22.753 -48.893 126.280 1.00 26.09 ? 180  GLU B CB    1 
ATOM   2759 C CG    . GLU B 1 180 ? 23.539 -50.115 126.705 1.00 28.84 ? 180  GLU B CG    1 
ATOM   2760 C CD    . GLU B 1 180 ? 23.338 -50.514 128.178 1.00 31.06 ? 180  GLU B CD    1 
ATOM   2761 O OE1   . GLU B 1 180 ? 23.043 -49.654 129.033 1.00 30.27 ? 180  GLU B OE1   1 
ATOM   2762 O OE2   . GLU B 1 180 ? 23.504 -51.711 128.492 1.00 35.38 ? 180  GLU B OE2   1 
ATOM   2763 N N     . THR B 1 181 ? 22.672 -46.023 124.865 1.00 22.63 ? 181  THR B N     1 
ATOM   2764 C CA    . THR B 1 181 ? 21.993 -44.771 124.537 1.00 21.43 ? 181  THR B CA    1 
ATOM   2765 C C     . THR B 1 181 ? 21.941 -44.605 123.015 1.00 21.94 ? 181  THR B C     1 
ATOM   2766 O O     . THR B 1 181 ? 20.885 -44.333 122.441 1.00 21.56 ? 181  THR B O     1 
ATOM   2767 C CB    . THR B 1 181 ? 22.769 -43.578 125.139 1.00 20.77 ? 181  THR B CB    1 
ATOM   2768 O OG1   . THR B 1 181 ? 22.948 -43.812 126.535 1.00 20.47 ? 181  THR B OG1   1 
ATOM   2769 C CG2   . THR B 1 181 ? 22.020 -42.249 124.951 1.00 19.11 ? 181  THR B CG2   1 
ATOM   2770 N N     . TYR B 1 182 ? 23.091 -44.793 122.374 1.00 21.33 ? 182  TYR B N     1 
ATOM   2771 C CA    . TYR B 1 182 ? 23.227 -44.666 120.931 1.00 21.26 ? 182  TYR B CA    1 
ATOM   2772 C C     . TYR B 1 182 ? 22.429 -45.722 120.196 1.00 21.80 ? 182  TYR B C     1 
ATOM   2773 O O     . TYR B 1 182 ? 21.753 -45.427 119.211 1.00 23.01 ? 182  TYR B O     1 
ATOM   2774 C CB    . TYR B 1 182 ? 24.693 -44.803 120.540 1.00 22.49 ? 182  TYR B CB    1 
ATOM   2775 C CG    . TYR B 1 182 ? 25.590 -43.755 121.140 1.00 24.34 ? 182  TYR B CG    1 
ATOM   2776 C CD1   . TYR B 1 182 ? 25.079 -42.525 121.563 1.00 23.99 ? 182  TYR B CD1   1 
ATOM   2777 C CD2   . TYR B 1 182 ? 26.960 -43.978 121.268 1.00 26.07 ? 182  TYR B CD2   1 
ATOM   2778 C CE1   . TYR B 1 182 ? 25.905 -41.544 122.092 1.00 24.65 ? 182  TYR B CE1   1 
ATOM   2779 C CE2   . TYR B 1 182 ? 27.803 -42.994 121.800 1.00 26.07 ? 182  TYR B CE2   1 
ATOM   2780 C CZ    . TYR B 1 182 ? 27.265 -41.783 122.205 1.00 25.40 ? 182  TYR B CZ    1 
ATOM   2781 O OH    . TYR B 1 182 ? 28.096 -40.810 122.692 1.00 26.45 ? 182  TYR B OH    1 
ATOM   2782 N N     . LYS B 1 183 ? 22.537 -46.960 120.667 1.00 21.72 ? 183  LYS B N     1 
ATOM   2783 C CA    . LYS B 1 183 ? 21.843 -48.102 120.089 1.00 21.67 ? 183  LYS B CA    1 
ATOM   2784 C C     . LYS B 1 183 ? 20.312 -47.957 120.179 1.00 23.94 ? 183  LYS B C     1 
ATOM   2785 O O     . LYS B 1 183 ? 19.587 -48.340 119.255 1.00 25.57 ? 183  LYS B O     1 
ATOM   2786 C CB    . LYS B 1 183 ? 22.309 -49.362 120.812 1.00 21.62 ? 183  LYS B CB    1 
ATOM   2787 C CG    . LYS B 1 183 ? 21.743 -50.653 120.284 1.00 23.21 ? 183  LYS B CG    1 
ATOM   2788 C CD    . LYS B 1 183 ? 22.083 -50.856 118.831 1.00 23.69 ? 183  LYS B CD    1 
ATOM   2789 C CE    . LYS B 1 183 ? 21.523 -52.171 118.359 1.00 26.14 ? 183  LYS B CE    1 
ATOM   2790 N NZ    . LYS B 1 183 ? 21.726 -52.374 116.904 1.00 29.41 ? 183  LYS B NZ    1 
ATOM   2791 N N     . ALA B 1 184 ? 19.811 -47.444 121.300 1.00 23.66 ? 184  ALA B N     1 
ATOM   2792 C CA    . ALA B 1 184 ? 18.375 -47.252 121.468 1.00 22.00 ? 184  ALA B CA    1 
ATOM   2793 C C     . ALA B 1 184 ? 17.905 -46.198 120.475 1.00 21.93 ? 184  ALA B C     1 
ATOM   2794 O O     . ALA B 1 184 ? 16.876 -46.364 119.821 1.00 22.58 ? 184  ALA B O     1 
ATOM   2795 C CB    . ALA B 1 184 ? 18.069 -46.811 122.873 1.00 23.18 ? 184  ALA B CB    1 
ATOM   2796 N N     . PHE B 1 185 ? 18.652 -45.106 120.357 1.00 21.51 ? 185  PHE B N     1 
ATOM   2797 C CA    . PHE B 1 185 ? 18.276 -44.077 119.404 1.00 22.17 ? 185  PHE B CA    1 
ATOM   2798 C C     . PHE B 1 185 ? 18.301 -44.610 117.973 1.00 22.65 ? 185  PHE B C     1 
ATOM   2799 O O     . PHE B 1 185 ? 17.362 -44.390 117.214 1.00 23.84 ? 185  PHE B O     1 
ATOM   2800 C CB    . PHE B 1 185 ? 19.157 -42.837 119.495 1.00 21.26 ? 185  PHE B CB    1 
ATOM   2801 C CG    . PHE B 1 185 ? 18.869 -41.847 118.414 1.00 22.66 ? 185  PHE B CG    1 
ATOM   2802 C CD1   . PHE B 1 185 ? 17.653 -41.156 118.401 1.00 22.73 ? 185  PHE B CD1   1 
ATOM   2803 C CD2   . PHE B 1 185 ? 19.750 -41.683 117.345 1.00 21.34 ? 185  PHE B CD2   1 
ATOM   2804 C CE1   . PHE B 1 185 ? 17.319 -40.325 117.330 1.00 21.85 ? 185  PHE B CE1   1 
ATOM   2805 C CE2   . PHE B 1 185 ? 19.426 -40.855 116.268 1.00 20.89 ? 185  PHE B CE2   1 
ATOM   2806 C CZ    . PHE B 1 185 ? 18.215 -40.177 116.255 1.00 21.09 ? 185  PHE B CZ    1 
ATOM   2807 N N     . GLU B 1 186 ? 19.371 -45.306 117.601 1.00 22.38 ? 186  GLU B N     1 
ATOM   2808 C CA    . GLU B 1 186 ? 19.471 -45.869 116.258 1.00 22.72 ? 186  GLU B CA    1 
ATOM   2809 C C     . GLU B 1 186 ? 18.319 -46.845 115.972 1.00 23.28 ? 186  GLU B C     1 
ATOM   2810 O O     . GLU B 1 186 ? 17.837 -46.937 114.843 1.00 23.97 ? 186  GLU B O     1 
ATOM   2811 C CB    . GLU B 1 186 ? 20.834 -46.543 116.049 1.00 22.53 ? 186  GLU B CB    1 
ATOM   2812 C CG    . GLU B 1 186 ? 22.024 -45.566 116.075 1.00 23.83 ? 186  GLU B CG    1 
ATOM   2813 C CD    . GLU B 1 186 ? 21.966 -44.468 115.007 1.00 23.80 ? 186  GLU B CD    1 
ATOM   2814 O OE1   . GLU B 1 186 ? 21.478 -44.725 113.880 1.00 24.33 ? 186  GLU B OE1   1 
ATOM   2815 O OE2   . GLU B 1 186 ? 22.430 -43.347 115.285 1.00 21.86 ? 186  GLU B OE2   1 
ATOM   2816 N N     . ASN B 1 187 ? 17.859 -47.547 117.002 1.00 23.05 ? 187  ASN B N     1 
ATOM   2817 C CA    . ASN B 1 187 ? 16.748 -48.483 116.856 1.00 23.00 ? 187  ASN B CA    1 
ATOM   2818 C C     . ASN B 1 187 ? 15.441 -47.738 116.638 1.00 23.07 ? 187  ASN B C     1 
ATOM   2819 O O     . ASN B 1 187 ? 14.675 -48.051 115.731 1.00 25.28 ? 187  ASN B O     1 
ATOM   2820 C CB    . ASN B 1 187 ? 16.598 -49.361 118.102 1.00 22.98 ? 187  ASN B CB    1 
ATOM   2821 C CG    . ASN B 1 187 ? 17.649 -50.460 118.186 1.00 24.17 ? 187  ASN B CG    1 
ATOM   2822 O OD1   . ASN B 1 187 ? 18.255 -50.830 117.184 1.00 25.05 ? 187  ASN B OD1   1 
ATOM   2823 N ND2   . ASN B 1 187 ? 17.865 -50.988 119.392 1.00 22.83 ? 187  ASN B ND2   1 
ATOM   2824 N N     . ILE B 1 188 ? 15.188 -46.730 117.455 1.00 23.16 ? 188  ILE B N     1 
ATOM   2825 C CA    . ILE B 1 188 ? 13.932 -45.991 117.350 1.00 22.23 ? 188  ILE B CA    1 
ATOM   2826 C C     . ILE B 1 188 ? 13.811 -45.066 116.140 1.00 22.46 ? 188  ILE B C     1 
ATOM   2827 O O     . ILE B 1 188 ? 12.705 -44.814 115.672 1.00 22.87 ? 188  ILE B O     1 
ATOM   2828 C CB    . ILE B 1 188 ? 13.650 -45.179 118.648 1.00 21.16 ? 188  ILE B CB    1 
ATOM   2829 C CG1   . ILE B 1 188 ? 12.147 -44.950 118.818 1.00 20.28 ? 188  ILE B CG1   1 
ATOM   2830 C CG2   . ILE B 1 188 ? 14.414 -43.843 118.643 1.00 20.22 ? 188  ILE B CG2   1 
ATOM   2831 C CD1   . ILE B 1 188 ? 11.379 -46.202 119.155 1.00 19.18 ? 188  ILE B CD1   1 
ATOM   2832 N N     . TYR B 1 189 ? 14.941 -44.577 115.631 1.00 23.26 ? 189  TYR B N     1 
ATOM   2833 C CA    . TYR B 1 189 ? 14.964 -43.636 114.507 1.00 22.54 ? 189  TYR B CA    1 
ATOM   2834 C C     . TYR B 1 189 ? 14.139 -43.996 113.256 1.00 22.61 ? 189  TYR B C     1 
ATOM   2835 O O     . TYR B 1 189 ? 13.297 -43.200 112.822 1.00 22.46 ? 189  TYR B O     1 
ATOM   2836 C CB    . TYR B 1 189 ? 16.406 -43.277 114.144 1.00 22.44 ? 189  TYR B CB    1 
ATOM   2837 C CG    . TYR B 1 189 ? 16.519 -42.153 113.142 1.00 23.33 ? 189  TYR B CG    1 
ATOM   2838 C CD1   . TYR B 1 189 ? 15.910 -40.916 113.372 1.00 24.54 ? 189  TYR B CD1   1 
ATOM   2839 C CD2   . TYR B 1 189 ? 17.243 -42.321 111.967 1.00 23.39 ? 189  TYR B CD2   1 
ATOM   2840 C CE1   . TYR B 1 189 ? 16.025 -39.872 112.447 1.00 25.11 ? 189  TYR B CE1   1 
ATOM   2841 C CE2   . TYR B 1 189 ? 17.367 -41.293 111.046 1.00 23.17 ? 189  TYR B CE2   1 
ATOM   2842 C CZ    . TYR B 1 189 ? 16.761 -40.075 111.285 1.00 24.89 ? 189  TYR B CZ    1 
ATOM   2843 O OH    . TYR B 1 189 ? 16.905 -39.064 110.363 1.00 24.94 ? 189  TYR B OH    1 
ATOM   2844 N N     . PRO B 1 190 ? 14.388 -45.164 112.635 1.00 22.86 ? 190  PRO B N     1 
ATOM   2845 C CA    . PRO B 1 190 ? 13.577 -45.480 111.451 1.00 22.73 ? 190  PRO B CA    1 
ATOM   2846 C C     . PRO B 1 190 ? 12.111 -45.788 111.811 1.00 23.32 ? 190  PRO B C     1 
ATOM   2847 O O     . PRO B 1 190 ? 11.286 -45.990 110.937 1.00 23.14 ? 190  PRO B O     1 
ATOM   2848 C CB    . PRO B 1 190 ? 14.312 -46.672 110.828 1.00 22.02 ? 190  PRO B CB    1 
ATOM   2849 C CG    . PRO B 1 190 ? 14.989 -47.305 111.979 1.00 23.54 ? 190  PRO B CG    1 
ATOM   2850 C CD    . PRO B 1 190 ? 15.470 -46.148 112.814 1.00 22.57 ? 190  PRO B CD    1 
ATOM   2851 N N     . VAL B 1 191 ? 11.796 -45.865 113.103 1.00 23.80 ? 191  VAL B N     1 
ATOM   2852 C CA    . VAL B 1 191 ? 10.421 -46.081 113.531 1.00 23.84 ? 191  VAL B CA    1 
ATOM   2853 C C     . VAL B 1 191 ? 9.798  -44.698 113.563 1.00 24.67 ? 191  VAL B C     1 
ATOM   2854 O O     . VAL B 1 191 ? 8.678  -44.501 113.113 1.00 25.79 ? 191  VAL B O     1 
ATOM   2855 C CB    . VAL B 1 191 ? 10.323 -46.678 114.939 1.00 23.80 ? 191  VAL B CB    1 
ATOM   2856 C CG1   . VAL B 1 191 ? 8.878  -46.739 115.377 1.00 24.44 ? 191  VAL B CG1   1 
ATOM   2857 C CG2   . VAL B 1 191 ? 10.921 -48.069 114.965 1.00 24.09 ? 191  VAL B CG2   1 
ATOM   2858 N N     . LEU B 1 192 ? 10.557 -43.723 114.046 1.00 26.16 ? 192  LEU B N     1 
ATOM   2859 C CA    . LEU B 1 192 ? 10.075 -42.348 114.126 1.00 27.54 ? 192  LEU B CA    1 
ATOM   2860 C C     . LEU B 1 192 ? 9.799  -41.710 112.764 1.00 27.89 ? 192  LEU B C     1 
ATOM   2861 O O     . LEU B 1 192 ? 8.865  -40.921 112.634 1.00 28.06 ? 192  LEU B O     1 
ATOM   2862 C CB    . LEU B 1 192 ? 11.073 -41.473 114.888 1.00 28.11 ? 192  LEU B CB    1 
ATOM   2863 C CG    . LEU B 1 192 ? 11.531 -41.916 116.279 1.00 28.40 ? 192  LEU B CG    1 
ATOM   2864 C CD1   . LEU B 1 192 ? 12.496 -40.880 116.848 1.00 25.87 ? 192  LEU B CD1   1 
ATOM   2865 C CD2   . LEU B 1 192 ? 10.321 -42.115 117.190 1.00 27.93 ? 192  LEU B CD2   1 
ATOM   2866 N N     . SER B 1 193 ? 10.634 -42.004 111.766 1.00 28.66 ? 193  SER B N     1 
ATOM   2867 C CA    . SER B 1 193 ? 10.454 -41.439 110.422 1.00 28.97 ? 193  SER B CA    1 
ATOM   2868 C C     . SER B 1 193 ? 9.171  -41.950 109.810 1.00 29.04 ? 193  SER B C     1 
ATOM   2869 O O     . SER B 1 193 ? 8.661  -41.385 108.848 1.00 29.10 ? 193  SER B O     1 
ATOM   2870 C CB    . SER B 1 193 ? 11.620 -41.792 109.510 1.00 28.31 ? 193  SER B CB    1 
ATOM   2871 O OG    . SER B 1 193 ? 11.864 -43.178 109.563 1.00 30.53 ? 193  SER B OG    1 
ATOM   2872 N N     . GLU B 1 194 ? 8.653  -43.024 110.383 1.00 30.01 ? 194  GLU B N     1 
ATOM   2873 C CA    . GLU B 1 194 ? 7.418  -43.615 109.921 1.00 31.89 ? 194  GLU B CA    1 
ATOM   2874 C C     . GLU B 1 194 ? 6.174  -42.863 110.394 1.00 32.14 ? 194  GLU B C     1 
ATOM   2875 O O     . GLU B 1 194 ? 5.095  -43.051 109.845 1.00 33.16 ? 194  GLU B O     1 
ATOM   2876 C CB    . GLU B 1 194 ? 7.344  -45.039 110.405 1.00 33.90 ? 194  GLU B CB    1 
ATOM   2877 C CG    . GLU B 1 194 ? 6.088  -45.725 110.025 1.00 38.91 ? 194  GLU B CG    1 
ATOM   2878 C CD    . GLU B 1 194 ? 6.358  -47.118 109.582 1.00 42.36 ? 194  GLU B CD    1 
ATOM   2879 O OE1   . GLU B 1 194 ? 7.195  -47.794 110.237 1.00 42.76 ? 194  GLU B OE1   1 
ATOM   2880 O OE2   . GLU B 1 194 ? 5.748  -47.516 108.565 1.00 45.18 ? 194  GLU B OE2   1 
ATOM   2881 N N     . PHE B 1 195 ? 6.313  -42.033 111.421 1.00 30.93 ? 195  PHE B N     1 
ATOM   2882 C CA    . PHE B 1 195 ? 5.178  -41.289 111.932 1.00 30.18 ? 195  PHE B CA    1 
ATOM   2883 C C     . PHE B 1 195 ? 5.472  -39.818 111.992 1.00 30.77 ? 195  PHE B C     1 
ATOM   2884 O O     . PHE B 1 195 ? 5.134  -39.165 112.960 1.00 29.98 ? 195  PHE B O     1 
ATOM   2885 C CB    . PHE B 1 195 ? 4.793  -41.787 113.315 1.00 29.01 ? 195  PHE B CB    1 
ATOM   2886 C CG    . PHE B 1 195 ? 4.516  -43.251 113.362 1.00 28.12 ? 195  PHE B CG    1 
ATOM   2887 C CD1   . PHE B 1 195 ? 5.554  -44.161 113.479 1.00 27.97 ? 195  PHE B CD1   1 
ATOM   2888 C CD2   . PHE B 1 195 ? 3.223  -43.726 113.282 1.00 27.16 ? 195  PHE B CD2   1 
ATOM   2889 C CE1   . PHE B 1 195 ? 5.313  -45.530 113.514 1.00 27.32 ? 195  PHE B CE1   1 
ATOM   2890 C CE2   . PHE B 1 195 ? 2.972  -45.088 113.317 1.00 27.60 ? 195  PHE B CE2   1 
ATOM   2891 C CZ    . PHE B 1 195 ? 4.026  -45.992 113.432 1.00 27.35 ? 195  PHE B CZ    1 
ATOM   2892 N N     . ARG B 1 196 ? 6.101  -39.296 110.949 1.00 32.77 ? 196  ARG B N     1 
ATOM   2893 C CA    . ARG B 1 196 ? 6.421  -37.873 110.879 1.00 35.07 ? 196  ARG B CA    1 
ATOM   2894 C C     . ARG B 1 196 ? 5.137  -37.077 110.616 1.00 35.77 ? 196  ARG B C     1 
ATOM   2895 O O     . ARG B 1 196 ? 4.261  -37.530 109.883 1.00 35.85 ? 196  ARG B O     1 
ATOM   2896 C CB    . ARG B 1 196 ? 7.426  -37.621 109.751 1.00 35.44 ? 196  ARG B CB    1 
ATOM   2897 C CG    . ARG B 1 196 ? 7.827  -36.165 109.617 1.00 37.88 ? 196  ARG B CG    1 
ATOM   2898 C CD    . ARG B 1 196 ? 8.756  -35.943 108.438 1.00 39.29 ? 196  ARG B CD    1 
ATOM   2899 N NE    . ARG B 1 196 ? 9.292  -34.582 108.412 1.00 41.75 ? 196  ARG B NE    1 
ATOM   2900 C CZ    . ARG B 1 196 ? 8.555  -33.474 108.354 1.00 42.72 ? 196  ARG B CZ    1 
ATOM   2901 N NH1   . ARG B 1 196 ? 7.230  -33.543 108.315 1.00 42.80 ? 196  ARG B NH1   1 
ATOM   2902 N NH2   . ARG B 1 196 ? 9.148  -32.287 108.328 1.00 43.85 ? 196  ARG B NH2   1 
ATOM   2903 N N     . LYS B 1 197 ? 5.008  -35.905 111.218 1.00 37.09 ? 197  LYS B N     1 
ATOM   2904 C CA    . LYS B 1 197 ? 3.815  -35.108 110.998 1.00 40.26 ? 197  LYS B CA    1 
ATOM   2905 C C     . LYS B 1 197 ? 3.970  -34.313 109.716 1.00 42.30 ? 197  LYS B C     1 
ATOM   2906 O O     . LYS B 1 197 ? 4.821  -33.427 109.644 1.00 42.70 ? 197  LYS B O     1 
ATOM   2907 C CB    . LYS B 1 197 ? 3.552  -34.166 112.177 1.00 40.03 ? 197  LYS B CB    1 
ATOM   2908 C CG    . LYS B 1 197 ? 2.839  -34.830 113.329 1.00 41.26 ? 197  LYS B CG    1 
ATOM   2909 C CD    . LYS B 1 197 ? 2.855  -34.009 114.603 1.00 41.81 ? 197  LYS B CD    1 
ATOM   2910 C CE    . LYS B 1 197 ? 2.196  -32.664 114.421 1.00 43.80 ? 197  LYS B CE    1 
ATOM   2911 N NZ    . LYS B 1 197 ? 3.218  -31.574 114.427 1.00 45.95 ? 197  LYS B NZ    1 
ATOM   2912 N N     . ILE B 1 198 ? 3.168  -34.649 108.702 1.00 44.81 ? 198  ILE B N     1 
ATOM   2913 C CA    . ILE B 1 198 ? 3.213  -33.941 107.417 1.00 47.01 ? 198  ILE B CA    1 
ATOM   2914 C C     . ILE B 1 198 ? 2.440  -32.620 107.533 1.00 47.51 ? 198  ILE B C     1 
ATOM   2915 O O     . ILE B 1 198 ? 1.185  -32.676 107.535 1.00 47.59 ? 198  ILE B O     1 
ATOM   2916 C CB    . ILE B 1 198 ? 2.589  -34.760 106.238 1.00 48.36 ? 198  ILE B CB    1 
ATOM   2917 C CG1   . ILE B 1 198 ? 2.971  -36.244 106.318 1.00 49.63 ? 198  ILE B CG1   1 
ATOM   2918 C CG2   . ILE B 1 198 ? 3.060  -34.178 104.902 1.00 48.45 ? 198  ILE B CG2   1 
ATOM   2919 C CD1   . ILE B 1 198 ? 1.809  -37.165 106.720 1.00 49.15 ? 198  ILE B CD1   1 
ATOM   2920 C "C4'" . DG  C 2 1   ? 16.757 -61.520 78.382  1.00 56.12 ? 201  DG  C "C4'" 1 
ATOM   2921 O "O4'" . DG  C 2 1   ? 16.837 -62.062 79.697  1.00 55.08 ? 201  DG  C "O4'" 1 
ATOM   2922 C "C3'" . DG  C 2 1   ? 15.676 -60.454 78.516  1.00 56.74 ? 201  DG  C "C3'" 1 
ATOM   2923 O "O3'" . DG  C 2 1   ? 14.962 -60.307 77.290  1.00 59.99 ? 201  DG  C "O3'" 1 
ATOM   2924 C "C2'" . DG  C 2 1   ? 14.738 -61.001 79.602  1.00 55.21 ? 201  DG  C "C2'" 1 
ATOM   2925 C "C1'" . DG  C 2 1   ? 15.491 -62.211 80.148  1.00 52.95 ? 201  DG  C "C1'" 1 
ATOM   2926 N N9    . DG  C 2 1   ? 15.455 -62.325 81.627  1.00 50.26 ? 201  DG  C N9    1 
ATOM   2927 C C8    . DG  C 2 1   ? 16.370 -62.952 82.434  1.00 49.95 ? 201  DG  C C8    1 
ATOM   2928 N N7    . DG  C 2 1   ? 16.057 -62.952 83.702  1.00 48.96 ? 201  DG  C N7    1 
ATOM   2929 C C5    . DG  C 2 1   ? 14.847 -62.275 83.745  1.00 47.38 ? 201  DG  C C5    1 
ATOM   2930 C C6    . DG  C 2 1   ? 14.025 -61.985 84.854  1.00 46.25 ? 201  DG  C C6    1 
ATOM   2931 O O6    . DG  C 2 1   ? 14.205 -62.297 86.029  1.00 44.30 ? 201  DG  C O6    1 
ATOM   2932 N N1    . DG  C 2 1   ? 12.888 -61.292 84.474  1.00 45.75 ? 201  DG  C N1    1 
ATOM   2933 C C2    . DG  C 2 1   ? 12.575 -60.924 83.181  1.00 46.28 ? 201  DG  C C2    1 
ATOM   2934 N N2    . DG  C 2 1   ? 11.439 -60.247 82.995  1.00 45.35 ? 201  DG  C N2    1 
ATOM   2935 N N3    . DG  C 2 1   ? 13.351 -61.204 82.133  1.00 46.85 ? 201  DG  C N3    1 
ATOM   2936 C C4    . DG  C 2 1   ? 14.467 -61.879 82.484  1.00 47.96 ? 201  DG  C C4    1 
ATOM   2937 P P     . DC  C 2 2   ? 15.414 -59.229 76.182  1.00 63.22 ? 202  DC  C P     1 
ATOM   2938 O OP1   . DC  C 2 2   ? 14.722 -59.574 74.915  1.00 62.58 ? 202  DC  C OP1   1 
ATOM   2939 O OP2   . DC  C 2 2   ? 16.895 -59.108 76.223  1.00 62.46 ? 202  DC  C OP2   1 
ATOM   2940 O "O5'" . DC  C 2 2   ? 14.795 -57.848 76.717  1.00 60.29 ? 202  DC  C "O5'" 1 
ATOM   2941 C "C5'" . DC  C 2 2   ? 13.379 -57.705 76.829  1.00 56.56 ? 202  DC  C "C5'" 1 
ATOM   2942 C "C4'" . DC  C 2 2   ? 12.991 -57.256 78.227  1.00 53.61 ? 202  DC  C "C4'" 1 
ATOM   2943 O "O4'" . DC  C 2 2   ? 13.520 -58.128 79.220  1.00 50.21 ? 202  DC  C "O4'" 1 
ATOM   2944 C "C3'" . DC  C 2 2   ? 13.683 -55.947 78.558  1.00 53.00 ? 202  DC  C "C3'" 1 
ATOM   2945 O "O3'" . DC  C 2 2   ? 13.002 -54.853 77.920  1.00 54.28 ? 202  DC  C "O3'" 1 
ATOM   2946 C "C2'" . DC  C 2 2   ? 13.543 -55.922 80.083  1.00 50.31 ? 202  DC  C "C2'" 1 
ATOM   2947 C "C1'" . DC  C 2 2   ? 13.414 -57.400 80.433  1.00 46.93 ? 202  DC  C "C1'" 1 
ATOM   2948 N N1    . DC  C 2 2   ? 14.397 -57.862 81.442  1.00 43.69 ? 202  DC  C N1    1 
ATOM   2949 C C2    . DC  C 2 2   ? 13.941 -57.910 82.733  1.00 41.68 ? 202  DC  C C2    1 
ATOM   2950 O O2    . DC  C 2 2   ? 12.810 -57.510 82.976  1.00 40.68 ? 202  DC  C O2    1 
ATOM   2951 N N3    . DC  C 2 2   ? 14.756 -58.384 83.711  1.00 40.10 ? 202  DC  C N3    1 
ATOM   2952 C C4    . DC  C 2 2   ? 15.994 -58.799 83.422  1.00 40.09 ? 202  DC  C C4    1 
ATOM   2953 N N4    . DC  C 2 2   ? 16.761 -59.285 84.401  1.00 39.33 ? 202  DC  C N4    1 
ATOM   2954 C C5    . DC  C 2 2   ? 16.493 -58.748 82.078  1.00 40.63 ? 202  DC  C C5    1 
ATOM   2955 C C6    . DC  C 2 2   ? 15.659 -58.272 81.127  1.00 42.40 ? 202  DC  C C6    1 
ATOM   2956 P P     . DA  C 2 3   ? 13.703 -53.396 77.783  1.00 56.41 ? 203  DA  C P     1 
ATOM   2957 O OP1   . DA  C 2 3   ? 13.203 -52.740 76.545  1.00 55.93 ? 203  DA  C OP1   1 
ATOM   2958 O OP2   . DA  C 2 3   ? 15.165 -53.554 78.003  1.00 54.78 ? 203  DA  C OP2   1 
ATOM   2959 O "O5'" . DA  C 2 3   ? 13.095 -52.604 79.053  1.00 52.19 ? 203  DA  C "O5'" 1 
ATOM   2960 C "C5'" . DA  C 2 3   ? 11.688 -52.593 79.316  1.00 45.88 ? 203  DA  C "C5'" 1 
ATOM   2961 C "C4'" . DA  C 2 3   ? 11.401 -52.431 80.815  1.00 40.76 ? 203  DA  C "C4'" 1 
ATOM   2962 O "O4'" . DA  C 2 3   ? 11.868 -53.548 81.563  1.00 37.64 ? 203  DA  C "O4'" 1 
ATOM   2963 C "C3'" . DA  C 2 3   ? 12.178 -51.262 81.382  1.00 38.07 ? 203  DA  C "C3'" 1 
ATOM   2964 O "O3'" . DA  C 2 3   ? 11.453 -50.072 81.164  1.00 35.86 ? 203  DA  C "O3'" 1 
ATOM   2965 C "C2'" . DA  C 2 3   ? 12.236 -51.588 82.860  1.00 36.31 ? 203  DA  C "C2'" 1 
ATOM   2966 C "C1'" . DA  C 2 3   ? 12.390 -53.093 82.810  1.00 34.09 ? 203  DA  C "C1'" 1 
ATOM   2967 N N9    . DA  C 2 3   ? 13.775 -53.565 82.930  1.00 30.46 ? 203  DA  C N9    1 
ATOM   2968 C C8    . DA  C 2 3   ? 14.796 -53.578 82.020  1.00 28.59 ? 203  DA  C C8    1 
ATOM   2969 N N7    . DA  C 2 3   ? 15.867 -54.179 82.457  1.00 28.85 ? 203  DA  C N7    1 
ATOM   2970 C C5    . DA  C 2 3   ? 15.524 -54.580 83.743  1.00 27.97 ? 203  DA  C C5    1 
ATOM   2971 C C6    . DA  C 2 3   ? 16.208 -55.271 84.747  1.00 27.80 ? 203  DA  C C6    1 
ATOM   2972 N N6    . DA  C 2 3   ? 17.451 -55.736 84.643  1.00 27.68 ? 203  DA  C N6    1 
ATOM   2973 N N1    . DA  C 2 3   ? 15.547 -55.482 85.881  1.00 28.52 ? 203  DA  C N1    1 
ATOM   2974 C C2    . DA  C 2 3   ? 14.308 -55.048 86.022  1.00 28.02 ? 203  DA  C C2    1 
ATOM   2975 N N3    . DA  C 2 3   ? 13.565 -54.398 85.163  1.00 28.11 ? 203  DA  C N3    1 
ATOM   2976 C C4    . DA  C 2 3   ? 14.251 -54.198 84.028  1.00 28.58 ? 203  DA  C C4    1 
ATOM   2977 P P     . DA  C 2 4   ? 12.276 -48.879 80.542  1.00 35.26 ? 204  DA  C P     1 
ATOM   2978 O OP1   . DA  C 2 4   ? 11.322 -47.857 80.067  1.00 38.73 ? 204  DA  C OP1   1 
ATOM   2979 O OP2   . DA  C 2 4   ? 13.279 -49.458 79.619  1.00 36.36 ? 204  DA  C OP2   1 
ATOM   2980 O "O5'" . DA  C 2 4   ? 13.032 -48.288 81.825  1.00 34.44 ? 204  DA  C "O5'" 1 
ATOM   2981 C "C5'" . DA  C 2 4   ? 12.299 -47.650 82.874  1.00 30.00 ? 204  DA  C "C5'" 1 
ATOM   2982 C "C4'" . DA  C 2 4   ? 13.212 -47.025 83.905  1.00 26.77 ? 204  DA  C "C4'" 1 
ATOM   2983 O "O4'" . DA  C 2 4   ? 14.107 -47.987 84.478  1.00 27.30 ? 204  DA  C "O4'" 1 
ATOM   2984 C "C3'" . DA  C 2 4   ? 14.091 -45.985 83.252  1.00 27.18 ? 204  DA  C "C3'" 1 
ATOM   2985 O "O3'" . DA  C 2 4   ? 14.346 -44.943 84.183  1.00 29.13 ? 204  DA  C "O3'" 1 
ATOM   2986 C "C2'" . DA  C 2 4   ? 15.361 -46.763 82.920  1.00 27.14 ? 204  DA  C "C2'" 1 
ATOM   2987 C "C1'" . DA  C 2 4   ? 15.464 -47.715 84.107  1.00 25.52 ? 204  DA  C "C1'" 1 
ATOM   2988 N N9    . DA  C 2 4   ? 16.127 -48.983 83.734  1.00 23.63 ? 204  DA  C N9    1 
ATOM   2989 C C8    . DA  C 2 4   ? 15.821 -49.840 82.712  1.00 22.69 ? 204  DA  C C8    1 
ATOM   2990 N N7    . DA  C 2 4   ? 16.554 -50.920 82.691  1.00 23.28 ? 204  DA  C N7    1 
ATOM   2991 C C5    . DA  C 2 4   ? 17.415 -50.770 83.776  1.00 22.38 ? 204  DA  C C5    1 
ATOM   2992 C C6    . DA  C 2 4   ? 18.436 -51.577 84.307  1.00 21.70 ? 204  DA  C C6    1 
ATOM   2993 N N6    . DA  C 2 4   ? 18.800 -52.755 83.795  1.00 21.01 ? 204  DA  C N6    1 
ATOM   2994 N N1    . DA  C 2 4   ? 19.075 -51.122 85.387  1.00 20.95 ? 204  DA  C N1    1 
ATOM   2995 C C2    . DA  C 2 4   ? 18.733 -49.957 85.902  1.00 20.90 ? 204  DA  C C2    1 
ATOM   2996 N N3    . DA  C 2 4   ? 17.803 -49.112 85.504  1.00 22.58 ? 204  DA  C N3    1 
ATOM   2997 C C4    . DA  C 2 4   ? 17.167 -49.590 84.415  1.00 23.24 ? 204  DA  C C4    1 
ATOM   2998 P P     . DT  C 2 5   ? 15.037 -43.593 83.688  1.00 29.03 ? 205  DT  C P     1 
ATOM   2999 O OP1   . DT  C 2 5   ? 14.486 -42.455 84.460  1.00 28.19 ? 205  DT  C OP1   1 
ATOM   3000 O OP2   . DT  C 2 5   ? 15.024 -43.572 82.210  1.00 29.52 ? 205  DT  C OP2   1 
ATOM   3001 O "O5'" . DT  C 2 5   ? 16.539 -43.881 84.175  1.00 27.48 ? 205  DT  C "O5'" 1 
ATOM   3002 C "C5'" . DT  C 2 5   ? 16.927 -43.613 85.519  1.00 24.47 ? 205  DT  C "C5'" 1 
ATOM   3003 C "C4'" . DT  C 2 5   ? 18.410 -43.851 85.697  1.00 23.38 ? 205  DT  C "C4'" 1 
ATOM   3004 O "O4'" . DT  C 2 5   ? 18.741 -45.206 85.489  1.00 21.46 ? 205  DT  C "O4'" 1 
ATOM   3005 C "C3'" . DT  C 2 5   ? 19.147 -43.126 84.605  1.00 23.01 ? 205  DT  C "C3'" 1 
ATOM   3006 O "O3'" . DT  C 2 5   ? 19.403 -41.810 85.092  1.00 27.75 ? 205  DT  C "O3'" 1 
ATOM   3007 C "C2'" . DT  C 2 5   ? 20.421 -43.951 84.394  1.00 21.05 ? 205  DT  C "C2'" 1 
ATOM   3008 C "C1'" . DT  C 2 5   ? 20.120 -45.244 85.146  1.00 19.99 ? 205  DT  C "C1'" 1 
ATOM   3009 N N1    . DT  C 2 5   ? 20.346 -46.472 84.365  1.00 18.66 ? 205  DT  C N1    1 
ATOM   3010 C C2    . DT  C 2 5   ? 21.285 -47.359 84.840  1.00 18.02 ? 205  DT  C C2    1 
ATOM   3011 O O2    . DT  C 2 5   ? 21.978 -47.126 85.820  1.00 16.76 ? 205  DT  C O2    1 
ATOM   3012 N N3    . DT  C 2 5   ? 21.427 -48.532 84.135  1.00 18.56 ? 205  DT  C N3    1 
ATOM   3013 C C4    . DT  C 2 5   ? 20.728 -48.894 83.008  1.00 18.79 ? 205  DT  C C4    1 
ATOM   3014 O O4    . DT  C 2 5   ? 20.934 -49.989 82.496  1.00 19.53 ? 205  DT  C O4    1 
ATOM   3015 C C5    . DT  C 2 5   ? 19.771 -47.899 82.572  1.00 18.62 ? 205  DT  C C5    1 
ATOM   3016 C C7    . DT  C 2 5   ? 18.919 -48.141 81.337  1.00 19.40 ? 205  DT  C C7    1 
ATOM   3017 C C6    . DT  C 2 5   ? 19.614 -46.749 83.247  1.00 18.57 ? 205  DT  C C6    1 
ATOM   3018 P P     . DA  C 2 6   ? 19.570 -40.539 84.121  1.00 27.88 ? 206  DA  C P     1 
ATOM   3019 O OP1   . DA  C 2 6   ? 19.057 -39.364 84.863  1.00 30.79 ? 206  DA  C OP1   1 
ATOM   3020 O OP2   . DA  C 2 6   ? 19.019 -40.883 82.788  1.00 29.26 ? 206  DA  C OP2   1 
ATOM   3021 O "O5'" . DA  C 2 6   ? 21.150 -40.397 83.939  1.00 24.28 ? 206  DA  C "O5'" 1 
ATOM   3022 C "C5'" . DA  C 2 6   ? 22.058 -40.197 85.022  1.00 22.72 ? 206  DA  C "C5'" 1 
ATOM   3023 C "C4'" . DA  C 2 6   ? 23.415 -40.737 84.636  1.00 21.15 ? 206  DA  C "C4'" 1 
ATOM   3024 O "O4'" . DA  C 2 6   ? 23.300 -42.137 84.482  1.00 21.04 ? 206  DA  C "O4'" 1 
ATOM   3025 C "C3'" . DA  C 2 6   ? 23.779 -40.261 83.239  1.00 22.09 ? 206  DA  C "C3'" 1 
ATOM   3026 O "O3'" . DA  C 2 6   ? 24.458 -39.011 83.365  1.00 27.47 ? 206  DA  C "O3'" 1 
ATOM   3027 C "C2'" . DA  C 2 6   ? 24.705 -41.359 82.720  1.00 19.37 ? 206  DA  C "C2'" 1 
ATOM   3028 C "C1'" . DA  C 2 6   ? 24.262 -42.581 83.522  1.00 19.40 ? 206  DA  C "C1'" 1 
ATOM   3029 N N9    . DA  C 2 6   ? 23.688 -43.679 82.702  1.00 16.80 ? 206  DA  C N9    1 
ATOM   3030 C C8    . DA  C 2 6   ? 22.735 -43.634 81.725  1.00 16.09 ? 206  DA  C C8    1 
ATOM   3031 N N7    . DA  C 2 6   ? 22.454 -44.800 81.210  1.00 16.12 ? 206  DA  C N7    1 
ATOM   3032 C C5    . DA  C 2 6   ? 23.283 -45.675 81.897  1.00 15.33 ? 206  DA  C C5    1 
ATOM   3033 C C6    . DA  C 2 6   ? 23.482 -47.057 81.815  1.00 16.64 ? 206  DA  C C6    1 
ATOM   3034 N N6    . DA  C 2 6   ? 22.832 -47.845 80.964  1.00 18.93 ? 206  DA  C N6    1 
ATOM   3035 N N1    . DA  C 2 6   ? 24.388 -47.598 82.636  1.00 17.53 ? 206  DA  C N1    1 
ATOM   3036 C C2    . DA  C 2 6   ? 25.051 -46.824 83.477  1.00 16.32 ? 206  DA  C C2    1 
ATOM   3037 N N3    . DA  C 2 6   ? 24.955 -45.521 83.645  1.00 16.74 ? 206  DA  C N3    1 
ATOM   3038 C C4    . DA  C 2 6   ? 24.036 -45.001 82.806  1.00 16.40 ? 206  DA  C C4    1 
ATOM   3039 P P     . DA  C 2 7   ? 24.510 -37.919 82.176  1.00 29.68 ? 207  DA  C P     1 
ATOM   3040 O OP1   . DA  C 2 7   ? 25.006 -36.654 82.767  1.00 31.46 ? 207  DA  C OP1   1 
ATOM   3041 O OP2   . DA  C 2 7   ? 23.240 -37.965 81.422  1.00 26.31 ? 207  DA  C OP2   1 
ATOM   3042 O "O5'" . DA  C 2 7   ? 25.646 -38.460 81.211  1.00 27.20 ? 207  DA  C "O5'" 1 
ATOM   3043 C "C5'" . DA  C 2 7   ? 26.991 -38.510 81.663  1.00 23.81 ? 207  DA  C "C5'" 1 
ATOM   3044 C "C4'" . DA  C 2 7   ? 27.770 -39.425 80.749  1.00 22.79 ? 207  DA  C "C4'" 1 
ATOM   3045 O "O4'" . DA  C 2 7   ? 27.347 -40.765 80.919  1.00 21.89 ? 207  DA  C "O4'" 1 
ATOM   3046 C "C3'" . DA  C 2 7   ? 27.420 -39.122 79.293  1.00 22.51 ? 207  DA  C "C3'" 1 
ATOM   3047 O "O3'" . DA  C 2 7   ? 28.120 -37.914 78.916  1.00 22.84 ? 207  DA  C "O3'" 1 
ATOM   3048 C "C2'" . DA  C 2 7   ? 27.979 -40.398 78.657  1.00 20.68 ? 207  DA  C "C2'" 1 
ATOM   3049 C "C1'" . DA  C 2 7   ? 27.605 -41.460 79.700  1.00 19.52 ? 207  DA  C "C1'" 1 
ATOM   3050 N N9    . DA  C 2 7   ? 26.431 -42.259 79.305  1.00 18.11 ? 207  DA  C N9    1 
ATOM   3051 C C8    . DA  C 2 7   ? 25.263 -41.867 78.698  1.00 17.87 ? 207  DA  C C8    1 
ATOM   3052 N N7    . DA  C 2 7   ? 24.449 -42.852 78.430  1.00 18.22 ? 207  DA  C N7    1 
ATOM   3053 C C5    . DA  C 2 7   ? 25.125 -43.978 78.895  1.00 18.49 ? 207  DA  C C5    1 
ATOM   3054 C C6    . DA  C 2 7   ? 24.818 -45.350 78.893  1.00 19.02 ? 207  DA  C C6    1 
ATOM   3055 N N6    . DA  C 2 7   ? 23.696 -45.875 78.390  1.00 19.46 ? 207  DA  C N6    1 
ATOM   3056 N N1    . DA  C 2 7   ? 25.729 -46.176 79.419  1.00 19.56 ? 207  DA  C N1    1 
ATOM   3057 C C2    . DA  C 2 7   ? 26.853 -45.678 79.907  1.00 18.63 ? 207  DA  C C2    1 
ATOM   3058 N N3    . DA  C 2 7   ? 27.255 -44.426 79.965  1.00 18.34 ? 207  DA  C N3    1 
ATOM   3059 C C4    . DA  C 2 7   ? 26.328 -43.618 79.432  1.00 18.14 ? 207  DA  C C4    1 
ATOM   3060 P P     . DA  C 2 8   ? 27.943 -37.109 77.543  1.00 21.02 ? 208  DA  C P     1 
ATOM   3061 O OP1   . DA  C 2 8   ? 28.451 -35.744 77.762  1.00 22.86 ? 208  DA  C OP1   1 
ATOM   3062 O OP2   . DA  C 2 8   ? 26.575 -37.318 77.036  1.00 21.85 ? 208  DA  C OP2   1 
ATOM   3063 O "O5'" . DA  C 2 8   ? 28.936 -37.864 76.556  1.00 20.28 ? 208  DA  C "O5'" 1 
ATOM   3064 C "C5'" . DA  C 2 8   ? 30.351 -37.915 76.753  1.00 19.48 ? 208  DA  C "C5'" 1 
ATOM   3065 C "C4'" . DA  C 2 8   ? 30.980 -39.061 75.945  1.00 18.43 ? 208  DA  C "C4'" 1 
ATOM   3066 O "O4'" . DA  C 2 8   ? 30.531 -40.330 76.410  1.00 17.56 ? 208  DA  C "O4'" 1 
ATOM   3067 C "C3'" . DA  C 2 8   ? 30.560 -38.972 74.490  1.00 18.98 ? 208  DA  C "C3'" 1 
ATOM   3068 O "O3'" . DA  C 2 8   ? 31.526 -38.135 73.848  1.00 22.32 ? 208  DA  C "O3'" 1 
ATOM   3069 C "C2'" . DA  C 2 8   ? 30.654 -40.439 74.048  1.00 15.84 ? 208  DA  C "C2'" 1 
ATOM   3070 C "C1'" . DA  C 2 8   ? 30.246 -41.196 75.315  1.00 16.71 ? 208  DA  C "C1'" 1 
ATOM   3071 N N9    . DA  C 2 8   ? 28.812 -41.611 75.347  1.00 15.90 ? 208  DA  C N9    1 
ATOM   3072 C C8    . DA  C 2 8   ? 27.677 -40.850 75.226  1.00 16.05 ? 208  DA  C C8    1 
ATOM   3073 N N7    . DA  C 2 8   ? 26.567 -41.531 75.294  1.00 17.07 ? 208  DA  C N7    1 
ATOM   3074 C C5    . DA  C 2 8   ? 26.993 -42.843 75.473  1.00 15.40 ? 208  DA  C C5    1 
ATOM   3075 C C6    . DA  C 2 8   ? 26.304 -44.065 75.599  1.00 14.67 ? 208  DA  C C6    1 
ATOM   3076 N N6    . DA  C 2 8   ? 24.975 -44.185 75.562  1.00 13.65 ? 208  DA  C N6    1 
ATOM   3077 N N1    . DA  C 2 8   ? 27.045 -45.168 75.745  1.00 14.69 ? 208  DA  C N1    1 
ATOM   3078 C C2    . DA  C 2 8   ? 28.362 -45.070 75.761  1.00 14.63 ? 208  DA  C C2    1 
ATOM   3079 N N3    . DA  C 2 8   ? 29.118 -43.992 75.651  1.00 15.85 ? 208  DA  C N3    1 
ATOM   3080 C C4    . DA  C 2 8   ? 28.357 -42.895 75.507  1.00 15.41 ? 208  DA  C C4    1 
ATOM   3081 P P     . DA  C 2 9   ? 31.220 -37.270 72.540  1.00 23.69 ? 209  DA  C P     1 
ATOM   3082 O OP1   . DA  C 2 9   ? 32.333 -36.316 72.383  1.00 26.51 ? 209  DA  C OP1   1 
ATOM   3083 O OP2   . DA  C 2 9   ? 29.826 -36.794 72.624  1.00 24.73 ? 209  DA  C OP2   1 
ATOM   3084 O "O5'" . DA  C 2 9   ? 31.306 -38.266 71.304  1.00 25.43 ? 209  DA  C "O5'" 1 
ATOM   3085 C "C5'" . DA  C 2 9   ? 32.567 -38.742 70.822  1.00 23.59 ? 209  DA  C "C5'" 1 
ATOM   3086 C "C4'" . DA  C 2 9   ? 32.361 -40.047 70.098  1.00 21.38 ? 209  DA  C "C4'" 1 
ATOM   3087 O "O4'" . DA  C 2 9   ? 31.603 -40.897 70.943  1.00 20.66 ? 209  DA  C "O4'" 1 
ATOM   3088 C "C3'" . DA  C 2 9   ? 31.474 -39.824 68.887  1.00 21.74 ? 209  DA  C "C3'" 1 
ATOM   3089 O "O3'" . DA  C 2 9   ? 32.302 -39.508 67.763  1.00 22.76 ? 209  DA  C "O3'" 1 
ATOM   3090 C "C2'" . DA  C 2 9   ? 30.767 -41.166 68.732  1.00 19.02 ? 209  DA  C "C2'" 1 
ATOM   3091 C "C1'" . DA  C 2 9   ? 30.640 -41.624 70.179  1.00 19.45 ? 209  DA  C "C1'" 1 
ATOM   3092 N N9    . DA  C 2 9   ? 29.264 -41.494 70.740  1.00 18.87 ? 209  DA  C N9    1 
ATOM   3093 C C8    . DA  C 2 9   ? 28.462 -40.385 70.884  1.00 18.04 ? 209  DA  C C8    1 
ATOM   3094 N N7    . DA  C 2 9   ? 27.284 -40.656 71.391  1.00 17.93 ? 209  DA  C N7    1 
ATOM   3095 C C5    . DA  C 2 9   ? 27.306 -42.033 71.599  1.00 17.44 ? 209  DA  C C5    1 
ATOM   3096 C C6    . DA  C 2 9   ? 26.369 -42.945 72.127  1.00 17.87 ? 209  DA  C C6    1 
ATOM   3097 N N6    . DA  C 2 9   ? 25.153 -42.612 72.562  1.00 17.82 ? 209  DA  C N6    1 
ATOM   3098 N N1    . DA  C 2 9   ? 26.743 -44.233 72.200  1.00 17.90 ? 209  DA  C N1    1 
ATOM   3099 C C2    . DA  C 2 9   ? 27.949 -44.589 71.785  1.00 16.10 ? 209  DA  C C2    1 
ATOM   3100 N N3    . DA  C 2 9   ? 28.903 -43.840 71.278  1.00 16.94 ? 209  DA  C N3    1 
ATOM   3101 C C4    . DA  C 2 9   ? 28.509 -42.549 71.210  1.00 17.26 ? 209  DA  C C4    1 
ATOM   3102 P P     . DG  C 2 10  ? 31.754 -38.598 66.564  1.00 22.01 ? 210  DG  C P     1 
ATOM   3103 O OP1   . DG  C 2 10  ? 32.888 -38.339 65.666  1.00 26.27 ? 210  DG  C OP1   1 
ATOM   3104 O OP2   . DG  C 2 10  ? 31.001 -37.467 67.136  1.00 24.25 ? 210  DG  C OP2   1 
ATOM   3105 O "O5'" . DG  C 2 10  ? 30.716 -39.532 65.801  1.00 22.02 ? 210  DG  C "O5'" 1 
ATOM   3106 C "C5'" . DG  C 2 10  ? 31.186 -40.619 65.024  1.00 23.10 ? 210  DG  C "C5'" 1 
ATOM   3107 C "C4'" . DG  C 2 10  ? 30.071 -41.302 64.254  1.00 25.76 ? 210  DG  C "C4'" 1 
ATOM   3108 O "O4'" . DG  C 2 10  ? 29.066 -41.854 65.109  1.00 26.38 ? 210  DG  C "O4'" 1 
ATOM   3109 C "C3'" . DG  C 2 10  ? 29.337 -40.333 63.347  1.00 28.01 ? 210  DG  C "C3'" 1 
ATOM   3110 O "O3'" . DG  C 2 10  ? 28.903 -41.074 62.239  1.00 33.98 ? 210  DG  C "O3'" 1 
ATOM   3111 C "C2'" . DG  C 2 10  ? 28.106 -40.001 64.154  1.00 26.31 ? 210  DG  C "C2'" 1 
ATOM   3112 C "C1'" . DG  C 2 10  ? 27.786 -41.388 64.675  1.00 24.58 ? 210  DG  C "C1'" 1 
ATOM   3113 N N9    . DG  C 2 10  ? 26.853 -41.332 65.809  1.00 23.41 ? 210  DG  C N9    1 
ATOM   3114 C C8    . DG  C 2 10  ? 25.810 -42.174 66.093  1.00 22.49 ? 210  DG  C C8    1 
ATOM   3115 N N7    . DG  C 2 10  ? 25.162 -41.859 67.178  1.00 23.22 ? 210  DG  C N7    1 
ATOM   3116 C C5    . DG  C 2 10  ? 25.822 -40.725 67.648  1.00 23.50 ? 210  DG  C C5    1 
ATOM   3117 C C6    . DG  C 2 10  ? 25.567 -39.937 68.804  1.00 24.02 ? 210  DG  C C6    1 
ATOM   3118 O O6    . DG  C 2 10  ? 24.693 -40.087 69.655  1.00 24.81 ? 210  DG  C O6    1 
ATOM   3119 N N1    . DG  C 2 10  ? 26.469 -38.891 68.919  1.00 23.01 ? 210  DG  C N1    1 
ATOM   3120 C C2    . DG  C 2 10  ? 27.492 -38.625 68.038  1.00 21.96 ? 210  DG  C C2    1 
ATOM   3121 N N2    . DG  C 2 10  ? 28.263 -37.571 68.325  1.00 21.87 ? 210  DG  C N2    1 
ATOM   3122 N N3    . DG  C 2 10  ? 27.734 -39.360 66.952  1.00 20.94 ? 210  DG  C N3    1 
ATOM   3123 C C4    . DG  C 2 10  ? 26.860 -40.392 66.820  1.00 23.27 ? 210  DG  C C4    1 
ATOM   3124 P P     . DG  C 2 11  ? 28.857 -40.422 60.802  1.00 36.81 ? 211  DG  C P     1 
ATOM   3125 O OP1   . DG  C 2 11  ? 30.102 -40.795 60.090  1.00 37.53 ? 211  DG  C OP1   1 
ATOM   3126 O OP2   . DG  C 2 11  ? 28.458 -39.002 60.937  1.00 37.09 ? 211  DG  C OP2   1 
ATOM   3127 O "O5'" . DG  C 2 11  ? 27.625 -41.252 60.212  1.00 35.09 ? 211  DG  C "O5'" 1 
ATOM   3128 C "C5'" . DG  C 2 11  ? 27.668 -42.673 60.114  1.00 34.76 ? 211  DG  C "C5'" 1 
ATOM   3129 C "C4'" . DG  C 2 11  ? 26.275 -43.236 59.925  1.00 35.08 ? 211  DG  C "C4'" 1 
ATOM   3130 O "O4'" . DG  C 2 11  ? 25.514 -43.130 61.130  1.00 34.47 ? 211  DG  C "O4'" 1 
ATOM   3131 C "C3'" . DG  C 2 11  ? 25.516 -42.428 58.886  1.00 35.77 ? 211  DG  C "C3'" 1 
ATOM   3132 O "O3'" . DG  C 2 11  ? 24.678 -43.301 58.153  1.00 40.06 ? 211  DG  C "O3'" 1 
ATOM   3133 C "C2'" . DG  C 2 11  ? 24.700 -41.453 59.738  1.00 34.08 ? 211  DG  C "C2'" 1 
ATOM   3134 C "C1'" . DG  C 2 11  ? 24.357 -42.303 60.955  1.00 31.15 ? 211  DG  C "C1'" 1 
ATOM   3135 N N9    . DG  C 2 11  ? 24.168 -41.452 62.160  1.00 26.95 ? 211  DG  C N9    1 
ATOM   3136 C C8    . DG  C 2 11  ? 24.874 -40.350 62.539  1.00 25.66 ? 211  DG  C C8    1 
ATOM   3137 N N7    . DG  C 2 11  ? 24.483 -39.825 63.660  1.00 25.47 ? 211  DG  C N7    1 
ATOM   3138 C C5    . DG  C 2 11  ? 23.433 -40.634 64.065  1.00 24.80 ? 211  DG  C C5    1 
ATOM   3139 C C6    . DG  C 2 11  ? 22.609 -40.551 65.224  1.00 24.42 ? 211  DG  C C6    1 
ATOM   3140 O O6    . DG  C 2 11  ? 22.650 -39.725 66.133  1.00 23.04 ? 211  DG  C O6    1 
ATOM   3141 N N1    . DG  C 2 11  ? 21.665 -41.567 65.251  1.00 23.93 ? 211  DG  C N1    1 
ATOM   3142 C C2    . DG  C 2 11  ? 21.529 -42.541 64.285  1.00 23.08 ? 211  DG  C C2    1 
ATOM   3143 N N2    . DG  C 2 11  ? 20.566 -43.434 64.465  1.00 22.69 ? 211  DG  C N2    1 
ATOM   3144 N N3    . DG  C 2 11  ? 22.301 -42.621 63.197  1.00 23.97 ? 211  DG  C N3    1 
ATOM   3145 C C4    . DG  C 2 11  ? 23.230 -41.637 63.151  1.00 25.38 ? 211  DG  C C4    1 
ATOM   3146 P P     . DG  C 2 12  ? 23.814 -42.788 56.898  1.00 42.78 ? 212  DG  C P     1 
ATOM   3147 O OP1   . DG  C 2 12  ? 23.947 -43.810 55.833  1.00 43.44 ? 212  DG  C OP1   1 
ATOM   3148 O OP2   . DG  C 2 12  ? 24.129 -41.368 56.616  1.00 41.97 ? 212  DG  C OP2   1 
ATOM   3149 O "O5'" . DG  C 2 12  ? 22.330 -42.845 57.508  1.00 41.45 ? 212  DG  C "O5'" 1 
ATOM   3150 C "C5'" . DG  C 2 12  ? 21.828 -44.068 58.039  1.00 41.48 ? 212  DG  C "C5'" 1 
ATOM   3151 C "C4'" . DG  C 2 12  ? 20.540 -43.841 58.796  1.00 41.32 ? 212  DG  C "C4'" 1 
ATOM   3152 O "O4'" . DG  C 2 12  ? 20.761 -43.028 59.940  1.00 40.05 ? 212  DG  C "O4'" 1 
ATOM   3153 C "C3'" . DG  C 2 12  ? 19.578 -43.078 57.910  1.00 42.54 ? 212  DG  C "C3'" 1 
ATOM   3154 O "O3'" . DG  C 2 12  ? 18.454 -43.907 57.648  1.00 46.69 ? 212  DG  C "O3'" 1 
ATOM   3155 C "C2'" . DG  C 2 12  ? 19.204 -41.814 58.697  1.00 40.20 ? 212  DG  C "C2'" 1 
ATOM   3156 C "C1'" . DG  C 2 12  ? 19.667 -42.133 60.108  1.00 37.29 ? 212  DG  C "C1'" 1 
ATOM   3157 N N9    . DG  C 2 12  ? 20.202 -40.954 60.805  1.00 33.81 ? 212  DG  C N9    1 
ATOM   3158 C C8    . DG  C 2 12  ? 21.268 -40.169 60.459  1.00 33.39 ? 212  DG  C C8    1 
ATOM   3159 N N7    . DG  C 2 12  ? 21.547 -39.243 61.337  1.00 33.29 ? 212  DG  C N7    1 
ATOM   3160 C C5    . DG  C 2 12  ? 20.595 -39.430 62.333  1.00 32.24 ? 212  DG  C C5    1 
ATOM   3161 C C6    . DG  C 2 12  ? 20.411 -38.739 63.550  1.00 31.08 ? 212  DG  C C6    1 
ATOM   3162 O O6    . DG  C 2 12  ? 21.073 -37.813 64.005  1.00 32.67 ? 212  DG  C O6    1 
ATOM   3163 N N1    . DG  C 2 12  ? 19.349 -39.247 64.269  1.00 30.62 ? 212  DG  C N1    1 
ATOM   3164 C C2    . DG  C 2 12  ? 18.559 -40.296 63.871  1.00 30.14 ? 212  DG  C C2    1 
ATOM   3165 N N2    . DG  C 2 12  ? 17.576 -40.652 64.681  1.00 28.81 ? 212  DG  C N2    1 
ATOM   3166 N N3    . DG  C 2 12  ? 18.732 -40.954 62.729  1.00 31.66 ? 212  DG  C N3    1 
ATOM   3167 C C4    . DG  C 2 12  ? 19.766 -40.469 62.012  1.00 32.57 ? 212  DG  C C4    1 
ATOM   3168 P P     . DC  C 2 13  ? 17.354 -43.488 56.549  1.00 49.38 ? 213  DC  C P     1 
ATOM   3169 O OP1   . DC  C 2 13  ? 16.742 -44.744 56.047  1.00 49.57 ? 213  DC  C OP1   1 
ATOM   3170 O OP2   . DC  C 2 13  ? 17.970 -42.530 55.597  1.00 48.56 ? 213  DC  C OP2   1 
ATOM   3171 O "O5'" . DC  C 2 13  ? 16.267 -42.683 57.440  1.00 46.60 ? 213  DC  C "O5'" 1 
ATOM   3172 C "C5'" . DC  C 2 13  ? 15.409 -43.365 58.360  1.00 44.30 ? 213  DC  C "C5'" 1 
ATOM   3173 C "C4'" . DC  C 2 13  ? 14.727 -42.387 59.300  1.00 43.65 ? 213  DC  C "C4'" 1 
ATOM   3174 O "O4'" . DC  C 2 13  ? 15.676 -41.677 60.085  1.00 42.05 ? 213  DC  C "O4'" 1 
ATOM   3175 C "C3'" . DC  C 2 13  ? 14.002 -41.322 58.493  1.00 44.26 ? 213  DC  C "C3'" 1 
ATOM   3176 O "O3'" . DC  C 2 13  ? 12.664 -41.807 58.241  1.00 48.59 ? 213  DC  C "O3'" 1 
ATOM   3177 C "C2'" . DC  C 2 13  ? 14.049 -40.093 59.423  1.00 42.22 ? 213  DC  C "C2'" 1 
ATOM   3178 C "C1'" . DC  C 2 13  ? 15.081 -40.448 60.499  1.00 39.35 ? 213  DC  C "C1'" 1 
ATOM   3179 N N1    . DC  C 2 13  ? 16.134 -39.410 60.633  1.00 36.79 ? 213  DC  C N1    1 
ATOM   3180 C C2    . DC  C 2 13  ? 16.209 -38.677 61.817  1.00 35.89 ? 213  DC  C C2    1 
ATOM   3181 O O2    . DC  C 2 13  ? 15.389 -38.835 62.718  1.00 35.73 ? 213  DC  C O2    1 
ATOM   3182 N N3    . DC  C 2 13  ? 17.203 -37.759 61.950  1.00 33.47 ? 213  DC  C N3    1 
ATOM   3183 C C4    . DC  C 2 13  ? 18.086 -37.561 60.969  1.00 33.51 ? 213  DC  C C4    1 
ATOM   3184 N N4    . DC  C 2 13  ? 19.055 -36.669 61.139  1.00 32.73 ? 213  DC  C N4    1 
ATOM   3185 C C5    . DC  C 2 13  ? 18.019 -38.298 59.747  1.00 33.99 ? 213  DC  C C5    1 
ATOM   3186 C C6    . DC  C 2 13  ? 17.029 -39.207 59.629  1.00 35.31 ? 213  DC  C C6    1 
ATOM   3187 P P     . DA  C 2 14  ? 11.382 -40.913 57.778  1.00 51.42 ? 214  DA  C P     1 
ATOM   3188 O OP1   . DA  C 2 14  ? 10.249 -41.844 57.543  1.00 50.94 ? 214  DA  C OP1   1 
ATOM   3189 O OP2   . DA  C 2 14  ? 11.818 -39.983 56.702  1.00 50.67 ? 214  DA  C OP2   1 
ATOM   3190 O "O5'" . DA  C 2 14  ? 11.017 -40.033 59.071  1.00 48.61 ? 214  DA  C "O5'" 1 
ATOM   3191 C "C5'" . DA  C 2 14  ? 10.161 -40.549 60.085  1.00 46.89 ? 214  DA  C "C5'" 1 
ATOM   3192 C "C4'" . DA  C 2 14  ? 9.530  -39.428 60.903  1.00 46.40 ? 214  DA  C "C4'" 1 
ATOM   3193 O "O4'" . DA  C 2 14  ? 10.549 -38.617 61.502  1.00 46.23 ? 214  DA  C "O4'" 1 
ATOM   3194 C "C3'" . DA  C 2 14  ? 8.702  -38.478 60.032  1.00 46.06 ? 214  DA  C "C3'" 1 
ATOM   3195 O "O3'" . DA  C 2 14  ? 7.682  -37.825 60.798  1.00 47.73 ? 214  DA  C "O3'" 1 
ATOM   3196 C "C2'" . DA  C 2 14  ? 9.749  -37.464 59.604  1.00 44.50 ? 214  DA  C "C2'" 1 
ATOM   3197 C "C1'" . DA  C 2 14  ? 10.595 -37.337 60.872  1.00 42.67 ? 214  DA  C "C1'" 1 
ATOM   3198 N N9    . DA  C 2 14  ? 11.967 -36.969 60.494  1.00 39.92 ? 214  DA  C N9    1 
ATOM   3199 C C8    . DA  C 2 14  ? 12.581 -37.143 59.277  1.00 40.09 ? 214  DA  C C8    1 
ATOM   3200 N N7    . DA  C 2 14  ? 13.787 -36.658 59.211  1.00 38.32 ? 214  DA  C N7    1 
ATOM   3201 C C5    . DA  C 2 14  ? 13.987 -36.123 60.477  1.00 37.21 ? 214  DA  C C5    1 
ATOM   3202 C C6    . DA  C 2 14  ? 15.071 -35.456 61.032  1.00 35.94 ? 214  DA  C C6    1 
ATOM   3203 N N6    . DA  C 2 14  ? 16.166 -35.209 60.318  1.00 34.41 ? 214  DA  C N6    1 
ATOM   3204 N N1    . DA  C 2 14  ? 14.964 -35.052 62.308  1.00 35.03 ? 214  DA  C N1    1 
ATOM   3205 C C2    . DA  C 2 14  ? 13.835 -35.304 62.966  1.00 35.23 ? 214  DA  C C2    1 
ATOM   3206 N N3    . DA  C 2 14  ? 12.737 -35.921 62.554  1.00 35.65 ? 214  DA  C N3    1 
ATOM   3207 C C4    . DA  C 2 14  ? 12.889 -36.310 61.272  1.00 37.55 ? 214  DA  C C4    1 
ATOM   3208 O "O5'" . DT  D 3 1   ? 19.593 -27.056 64.612  1.00 58.43 ? 215  DT  D "O5'" 1 
ATOM   3209 C "C5'" . DT  D 3 1   ? 19.529 -28.096 65.592  1.00 58.65 ? 215  DT  D "C5'" 1 
ATOM   3210 C "C4'" . DT  D 3 1   ? 18.141 -28.188 66.248  1.00 59.07 ? 215  DT  D "C4'" 1 
ATOM   3211 O "O4'" . DT  D 3 1   ? 17.183 -28.837 65.392  1.00 57.91 ? 215  DT  D "O4'" 1 
ATOM   3212 C "C3'" . DT  D 3 1   ? 18.185 -29.042 67.511  1.00 59.11 ? 215  DT  D "C3'" 1 
ATOM   3213 O "O3'" . DT  D 3 1   ? 17.080 -28.729 68.370  1.00 60.16 ? 215  DT  D "O3'" 1 
ATOM   3214 C "C2'" . DT  D 3 1   ? 18.032 -30.426 66.913  1.00 58.17 ? 215  DT  D "C2'" 1 
ATOM   3215 C "C1'" . DT  D 3 1   ? 16.966 -30.186 65.846  1.00 56.29 ? 215  DT  D "C1'" 1 
ATOM   3216 N N1    . DT  D 3 1   ? 17.186 -31.117 64.725  1.00 54.94 ? 215  DT  D N1    1 
ATOM   3217 C C2    . DT  D 3 1   ? 16.197 -32.035 64.433  1.00 54.03 ? 215  DT  D C2    1 
ATOM   3218 O O2    . DT  D 3 1   ? 15.174 -32.124 65.107  1.00 53.77 ? 215  DT  D O2    1 
ATOM   3219 N N3    . DT  D 3 1   ? 16.444 -32.863 63.346  1.00 53.19 ? 215  DT  D N3    1 
ATOM   3220 C C4    . DT  D 3 1   ? 17.581 -32.842 62.553  1.00 53.36 ? 215  DT  D C4    1 
ATOM   3221 O O4    . DT  D 3 1   ? 17.701 -33.601 61.597  1.00 53.15 ? 215  DT  D O4    1 
ATOM   3222 C C5    . DT  D 3 1   ? 18.558 -31.857 62.945  1.00 53.67 ? 215  DT  D C5    1 
ATOM   3223 C C7    . DT  D 3 1   ? 19.877 -31.745 62.182  1.00 53.25 ? 215  DT  D C7    1 
ATOM   3224 C C6    . DT  D 3 1   ? 18.336 -31.046 63.988  1.00 54.32 ? 215  DT  D C6    1 
ATOM   3225 P P     . DG  D 3 2   ? 16.945 -29.414 69.829  1.00 62.11 ? 216  DG  D P     1 
ATOM   3226 O OP1   . DG  D 3 2   ? 16.006 -28.589 70.627  1.00 62.26 ? 216  DG  D OP1   1 
ATOM   3227 O OP2   . DG  D 3 2   ? 18.311 -29.696 70.345  1.00 59.77 ? 216  DG  D OP2   1 
ATOM   3228 O "O5'" . DG  D 3 2   ? 16.228 -30.835 69.491  1.00 58.28 ? 216  DG  D "O5'" 1 
ATOM   3229 C "C5'" . DG  D 3 2   ? 14.970 -31.215 70.064  1.00 53.22 ? 216  DG  D "C5'" 1 
ATOM   3230 C "C4'" . DG  D 3 2   ? 14.739 -32.723 69.995  1.00 49.48 ? 216  DG  D "C4'" 1 
ATOM   3231 O "O4'" . DG  D 3 2   ? 15.058 -33.194 68.679  1.00 46.22 ? 216  DG  D "O4'" 1 
ATOM   3232 C "C3'" . DG  D 3 2   ? 15.676 -33.503 70.940  1.00 49.64 ? 216  DG  D "C3'" 1 
ATOM   3233 O "O3'" . DG  D 3 2   ? 15.123 -34.786 71.247  1.00 53.53 ? 216  DG  D "O3'" 1 
ATOM   3234 C "C2'" . DG  D 3 2   ? 16.838 -33.751 69.992  1.00 46.28 ? 216  DG  D "C2'" 1 
ATOM   3235 C "C1'" . DG  D 3 2   ? 16.034 -34.224 68.802  1.00 41.69 ? 216  DG  D "C1'" 1 
ATOM   3236 N N9    . DG  D 3 2   ? 16.848 -34.342 67.595  1.00 37.59 ? 216  DG  D N9    1 
ATOM   3237 C C8    . DG  D 3 2   ? 17.954 -33.638 67.231  1.00 36.60 ? 216  DG  D C8    1 
ATOM   3238 N N7    . DG  D 3 2   ? 18.454 -33.993 66.080  1.00 35.94 ? 216  DG  D N7    1 
ATOM   3239 C C5    . DG  D 3 2   ? 17.612 -35.009 65.656  1.00 35.00 ? 216  DG  D C5    1 
ATOM   3240 C C6    . DG  D 3 2   ? 17.647 -35.782 64.470  1.00 34.84 ? 216  DG  D C6    1 
ATOM   3241 O O6    . DG  D 3 2   ? 18.464 -35.735 63.560  1.00 34.69 ? 216  DG  D O6    1 
ATOM   3242 N N1    . DG  D 3 2   ? 16.611 -36.695 64.419  1.00 34.28 ? 216  DG  D N1    1 
ATOM   3243 C C2    . DG  D 3 2   ? 15.656 -36.850 65.395  1.00 34.30 ? 216  DG  D C2    1 
ATOM   3244 N N2    . DG  D 3 2   ? 14.727 -37.777 65.179  1.00 33.98 ? 216  DG  D N2    1 
ATOM   3245 N N3    . DG  D 3 2   ? 15.625 -36.125 66.516  1.00 34.43 ? 216  DG  D N3    1 
ATOM   3246 C C4    . DG  D 3 2   ? 16.627 -35.228 66.576  1.00 35.15 ? 216  DG  D C4    1 
ATOM   3247 P P     . DC  D 3 3   ? 14.309 -35.145 72.593  1.00 56.82 ? 217  DC  D P     1 
ATOM   3248 O OP1   . DC  D 3 3   ? 13.008 -34.430 72.587  1.00 55.46 ? 217  DC  D OP1   1 
ATOM   3249 O OP2   . DC  D 3 3   ? 15.245 -35.014 73.740  1.00 56.28 ? 217  DC  D OP2   1 
ATOM   3250 O "O5'" . DC  D 3 3   ? 14.005 -36.713 72.370  1.00 53.91 ? 217  DC  D "O5'" 1 
ATOM   3251 C "C5'" . DC  D 3 3   ? 13.356 -37.168 71.176  1.00 50.01 ? 217  DC  D "C5'" 1 
ATOM   3252 C "C4'" . DC  D 3 3   ? 14.095 -38.340 70.524  1.00 46.75 ? 217  DC  D "C4'" 1 
ATOM   3253 O "O4'" . DC  D 3 3   ? 15.028 -37.946 69.509  1.00 43.39 ? 217  DC  D "O4'" 1 
ATOM   3254 C "C3'" . DC  D 3 3   ? 14.910 -39.102 71.574  1.00 45.95 ? 217  DC  D "C3'" 1 
ATOM   3255 O "O3'" . DC  D 3 3   ? 14.636 -40.488 71.448  1.00 47.73 ? 217  DC  D "O3'" 1 
ATOM   3256 C "C2'" . DC  D 3 3   ? 16.340 -38.811 71.135  1.00 42.75 ? 217  DC  D "C2'" 1 
ATOM   3257 C "C1'" . DC  D 3 3   ? 16.132 -38.824 69.638  1.00 39.30 ? 217  DC  D "C1'" 1 
ATOM   3258 N N1    . DC  D 3 3   ? 17.291 -38.303 68.904  1.00 35.73 ? 217  DC  D N1    1 
ATOM   3259 C C2    . DC  D 3 3   ? 17.513 -38.821 67.647  1.00 33.97 ? 217  DC  D C2    1 
ATOM   3260 O O2    . DC  D 3 3   ? 16.761 -39.682 67.200  1.00 33.36 ? 217  DC  D O2    1 
ATOM   3261 N N3    . DC  D 3 3   ? 18.576 -38.351 66.934  1.00 32.58 ? 217  DC  D N3    1 
ATOM   3262 C C4    . DC  D 3 3   ? 19.386 -37.408 67.444  1.00 31.51 ? 217  DC  D C4    1 
ATOM   3263 N N4    . DC  D 3 3   ? 20.407 -36.959 66.721  1.00 30.81 ? 217  DC  D N4    1 
ATOM   3264 C C5    . DC  D 3 3   ? 19.165 -36.867 68.746  1.00 32.07 ? 217  DC  D C5    1 
ATOM   3265 C C6    . DC  D 3 3   ? 18.107 -37.345 69.435  1.00 34.05 ? 217  DC  D C6    1 
ATOM   3266 P P     . DC  D 3 4   ? 14.707 -41.457 72.720  1.00 49.75 ? 218  DC  D P     1 
ATOM   3267 O OP1   . DC  D 3 4   ? 13.331 -41.591 73.256  1.00 50.53 ? 218  DC  D OP1   1 
ATOM   3268 O OP2   . DC  D 3 4   ? 15.824 -41.016 73.594  1.00 48.63 ? 218  DC  D OP2   1 
ATOM   3269 O "O5'" . DC  D 3 4   ? 15.126 -42.862 72.048  1.00 46.74 ? 218  DC  D "O5'" 1 
ATOM   3270 C "C5'" . DC  D 3 4   ? 14.374 -43.390 70.951  1.00 42.47 ? 218  DC  D "C5'" 1 
ATOM   3271 C "C4'" . DC  D 3 4   ? 15.290 -43.830 69.817  1.00 38.64 ? 218  DC  D "C4'" 1 
ATOM   3272 O "O4'" . DC  D 3 4   ? 16.097 -42.738 69.347  1.00 38.94 ? 218  DC  D "O4'" 1 
ATOM   3273 C "C3'" . DC  D 3 4   ? 16.261 -44.870 70.360  1.00 36.14 ? 218  DC  D "C3'" 1 
ATOM   3274 O "O3'" . DC  D 3 4   ? 16.113 -46.105 69.675  1.00 31.42 ? 218  DC  D "O3'" 1 
ATOM   3275 C "C2'" . DC  D 3 4   ? 17.637 -44.249 70.125  1.00 36.71 ? 218  DC  D "C2'" 1 
ATOM   3276 C "C1'" . DC  D 3 4   ? 17.357 -43.286 68.972  1.00 37.16 ? 218  DC  D "C1'" 1 
ATOM   3277 N N1    . DC  D 3 4   ? 18.447 -42.271 68.895  1.00 34.86 ? 218  DC  D N1    1 
ATOM   3278 C C2    . DC  D 3 4   ? 19.212 -42.215 67.726  1.00 33.91 ? 218  DC  D C2    1 
ATOM   3279 O O2    . DC  D 3 4   ? 18.961 -42.936 66.759  1.00 33.44 ? 218  DC  D O2    1 
ATOM   3280 N N3    . DC  D 3 4   ? 20.241 -41.329 67.676  1.00 32.41 ? 218  DC  D N3    1 
ATOM   3281 C C4    . DC  D 3 4   ? 20.512 -40.534 68.710  1.00 31.06 ? 218  DC  D C4    1 
ATOM   3282 N N4    . DC  D 3 4   ? 21.531 -39.702 68.610  1.00 30.89 ? 218  DC  D N4    1 
ATOM   3283 C C5    . DC  D 3 4   ? 19.738 -40.571 69.911  1.00 32.28 ? 218  DC  D C5    1 
ATOM   3284 C C6    . DC  D 3 4   ? 18.717 -41.454 69.956  1.00 33.52 ? 218  DC  D C6    1 
ATOM   3285 P P     . DC  D 3 5   ? 16.916 -47.382 70.204  1.00 29.08 ? 219  DC  D P     1 
ATOM   3286 O OP1   . DC  D 3 5   ? 16.114 -48.598 69.948  1.00 31.42 ? 219  DC  D OP1   1 
ATOM   3287 O OP2   . DC  D 3 5   ? 17.417 -47.106 71.562  1.00 29.15 ? 219  DC  D OP2   1 
ATOM   3288 O "O5'" . DC  D 3 5   ? 18.157 -47.404 69.200  1.00 28.95 ? 219  DC  D "O5'" 1 
ATOM   3289 C "C5'" . DC  D 3 5   ? 18.014 -47.928 67.883  1.00 24.58 ? 219  DC  D "C5'" 1 
ATOM   3290 C "C4'" . DC  D 3 5   ? 19.295 -47.731 67.106  1.00 25.26 ? 219  DC  D "C4'" 1 
ATOM   3291 O "O4'" . DC  D 3 5   ? 19.665 -46.365 67.143  1.00 25.87 ? 219  DC  D "O4'" 1 
ATOM   3292 C "C3'" . DC  D 3 5   ? 20.449 -48.422 67.792  1.00 25.65 ? 219  DC  D "C3'" 1 
ATOM   3293 O "O3'" . DC  D 3 5   ? 20.462 -49.778 67.349  1.00 27.70 ? 219  DC  D "O3'" 1 
ATOM   3294 C "C2'" . DC  D 3 5   ? 21.652 -47.650 67.243  1.00 24.84 ? 219  DC  D "C2'" 1 
ATOM   3295 C "C1'" . DC  D 3 5   ? 21.071 -46.267 66.949  1.00 24.86 ? 219  DC  D "C1'" 1 
ATOM   3296 N N1    . DC  D 3 5   ? 21.578 -45.206 67.837  1.00 24.46 ? 219  DC  D N1    1 
ATOM   3297 C C2    . DC  D 3 5   ? 22.651 -44.450 67.407  1.00 24.39 ? 219  DC  D C2    1 
ATOM   3298 O O2    . DC  D 3 5   ? 23.177 -44.671 66.322  1.00 24.62 ? 219  DC  D O2    1 
ATOM   3299 N N3    . DC  D 3 5   ? 23.104 -43.464 68.221  1.00 24.58 ? 219  DC  D N3    1 
ATOM   3300 C C4    . DC  D 3 5   ? 22.533 -43.226 69.407  1.00 24.46 ? 219  DC  D C4    1 
ATOM   3301 N N4    . DC  D 3 5   ? 23.015 -42.257 70.185  1.00 24.87 ? 219  DC  D N4    1 
ATOM   3302 C C5    . DC  D 3 5   ? 21.424 -44.001 69.863  1.00 23.74 ? 219  DC  D C5    1 
ATOM   3303 C C6    . DC  D 3 5   ? 20.986 -44.976 69.044  1.00 24.24 ? 219  DC  D C6    1 
ATOM   3304 P P     . DT  D 3 6   ? 20.495 -51.039 68.343  1.00 27.26 ? 220  DT  D P     1 
ATOM   3305 O OP1   . DT  D 3 6   ? 20.347 -52.253 67.514  1.00 29.65 ? 220  DT  D OP1   1 
ATOM   3306 O OP2   . DT  D 3 6   ? 19.597 -50.792 69.487  1.00 25.91 ? 220  DT  D OP2   1 
ATOM   3307 O "O5'" . DT  D 3 6   ? 21.994 -51.005 68.868  1.00 27.63 ? 220  DT  D "O5'" 1 
ATOM   3308 C "C5'" . DT  D 3 6   ? 23.047 -51.192 67.930  1.00 25.03 ? 220  DT  D "C5'" 1 
ATOM   3309 C "C4'" . DT  D 3 6   ? 24.386 -51.026 68.594  1.00 24.45 ? 220  DT  D "C4'" 1 
ATOM   3310 O "O4'" . DT  D 3 6   ? 24.594 -49.687 69.036  1.00 24.71 ? 220  DT  D "O4'" 1 
ATOM   3311 C "C3'" . DT  D 3 6   ? 24.412 -51.895 69.820  1.00 23.67 ? 220  DT  D "C3'" 1 
ATOM   3312 O "O3'" . DT  D 3 6   ? 25.545 -52.731 69.720  1.00 24.34 ? 220  DT  D "O3'" 1 
ATOM   3313 C "C2'" . DT  D 3 6   ? 24.503 -50.926 71.011  1.00 23.87 ? 220  DT  D "C2'" 1 
ATOM   3314 C "C1'" . DT  D 3 6   ? 25.079 -49.664 70.383  1.00 23.35 ? 220  DT  D "C1'" 1 
ATOM   3315 N N1    . DT  D 3 6   ? 24.562 -48.432 71.030  1.00 21.59 ? 220  DT  D N1    1 
ATOM   3316 C C2    . DT  D 3 6   ? 25.477 -47.494 71.466  1.00 20.98 ? 220  DT  D C2    1 
ATOM   3317 O O2    . DT  D 3 6   ? 26.692 -47.662 71.394  1.00 20.85 ? 220  DT  D O2    1 
ATOM   3318 N N3    . DT  D 3 6   ? 24.942 -46.341 72.016  1.00 20.86 ? 220  DT  D N3    1 
ATOM   3319 C C4    . DT  D 3 6   ? 23.602 -46.052 72.169  1.00 20.03 ? 220  DT  D C4    1 
ATOM   3320 O O4    . DT  D 3 6   ? 23.251 -44.979 72.655  1.00 20.92 ? 220  DT  D O4    1 
ATOM   3321 C C5    . DT  D 3 6   ? 22.721 -47.090 71.697  1.00 19.62 ? 220  DT  D C5    1 
ATOM   3322 C C7    . DT  D 3 6   ? 21.232 -46.915 71.825  1.00 17.86 ? 220  DT  D C7    1 
ATOM   3323 C C6    . DT  D 3 6   ? 23.209 -48.217 71.155  1.00 20.95 ? 220  DT  D C6    1 
ATOM   3324 P P     . DT  D 3 7   ? 25.625 -53.998 70.649  1.00 22.74 ? 221  DT  D P     1 
ATOM   3325 O OP1   . DT  D 3 7   ? 26.420 -55.025 69.948  1.00 26.18 ? 221  DT  D OP1   1 
ATOM   3326 O OP2   . DT  D 3 7   ? 24.265 -54.292 71.138  1.00 23.72 ? 221  DT  D OP2   1 
ATOM   3327 O "O5'" . DT  D 3 7   ? 26.493 -53.478 71.882  1.00 23.75 ? 221  DT  D "O5'" 1 
ATOM   3328 C "C5'" . DT  D 3 7   ? 27.906 -53.331 71.764  1.00 19.72 ? 221  DT  D "C5'" 1 
ATOM   3329 C "C4'" . DT  D 3 7   ? 28.411 -52.535 72.931  1.00 20.04 ? 221  DT  D "C4'" 1 
ATOM   3330 O "O4'" . DT  D 3 7   ? 27.719 -51.310 72.989  1.00 19.34 ? 221  DT  D "O4'" 1 
ATOM   3331 C "C3'" . DT  D 3 7   ? 28.029 -53.205 74.252  1.00 20.54 ? 221  DT  D "C3'" 1 
ATOM   3332 O "O3'" . DT  D 3 7   ? 29.087 -54.080 74.614  1.00 21.62 ? 221  DT  D "O3'" 1 
ATOM   3333 C "C2'" . DT  D 3 7   ? 27.928 -52.025 75.231  1.00 19.31 ? 221  DT  D "C2'" 1 
ATOM   3334 C "C1'" . DT  D 3 7   ? 27.928 -50.817 74.299  1.00 19.22 ? 221  DT  D "C1'" 1 
ATOM   3335 N N1    . DT  D 3 7   ? 26.861 -49.866 74.603  1.00 18.73 ? 221  DT  D N1    1 
ATOM   3336 C C2    . DT  D 3 7   ? 27.243 -48.609 75.007  1.00 19.31 ? 221  DT  D C2    1 
ATOM   3337 O O2    . DT  D 3 7   ? 28.423 -48.288 75.149  1.00 18.40 ? 221  DT  D O2    1 
ATOM   3338 N N3    . DT  D 3 7   ? 26.218 -47.724 75.247  1.00 19.35 ? 221  DT  D N3    1 
ATOM   3339 C C4    . DT  D 3 7   ? 24.869 -47.980 75.123  1.00 19.63 ? 221  DT  D C4    1 
ATOM   3340 O O4    . DT  D 3 7   ? 24.052 -47.088 75.357  1.00 20.94 ? 221  DT  D O4    1 
ATOM   3341 C C5    . DT  D 3 7   ? 24.568 -49.329 74.698  1.00 19.60 ? 221  DT  D C5    1 
ATOM   3342 C C7    . DT  D 3 7   ? 23.118 -49.783 74.528  1.00 19.30 ? 221  DT  D C7    1 
ATOM   3343 C C6    . DT  D 3 7   ? 25.552 -50.207 74.458  1.00 19.00 ? 221  DT  D C6    1 
ATOM   3344 P P     . DT  D 3 8   ? 28.887 -55.293 75.607  1.00 21.76 ? 222  DT  D P     1 
ATOM   3345 O OP1   . DT  D 3 8   ? 30.003 -56.230 75.388  1.00 22.16 ? 222  DT  D OP1   1 
ATOM   3346 O OP2   . DT  D 3 8   ? 27.494 -55.748 75.502  1.00 23.34 ? 222  DT  D OP2   1 
ATOM   3347 O "O5'" . DT  D 3 8   ? 29.082 -54.593 77.043  1.00 22.51 ? 222  DT  D "O5'" 1 
ATOM   3348 C "C5'" . DT  D 3 8   ? 30.358 -54.067 77.447  1.00 19.10 ? 222  DT  D "C5'" 1 
ATOM   3349 C "C4'" . DT  D 3 8   ? 30.211 -53.074 78.596  1.00 19.53 ? 222  DT  D "C4'" 1 
ATOM   3350 O "O4'" . DT  D 3 8   ? 29.396 -51.967 78.234  1.00 19.32 ? 222  DT  D "O4'" 1 
ATOM   3351 C "C3'" . DT  D 3 8   ? 29.480 -53.727 79.755  1.00 19.47 ? 222  DT  D "C3'" 1 
ATOM   3352 O "O3'" . DT  D 3 8   ? 30.463 -54.271 80.642  1.00 18.94 ? 222  DT  D "O3'" 1 
ATOM   3353 C "C2'" . DT  D 3 8   ? 28.689 -52.576 80.403  1.00 17.78 ? 222  DT  D "C2'" 1 
ATOM   3354 C "C1'" . DT  D 3 8   ? 28.853 -51.416 79.426  1.00 16.90 ? 222  DT  D "C1'" 1 
ATOM   3355 N N1    . DT  D 3 8   ? 27.565 -50.780 79.089  1.00 17.15 ? 222  DT  D N1    1 
ATOM   3356 C C2    . DT  D 3 8   ? 27.444 -49.413 79.291  1.00 16.07 ? 222  DT  D C2    1 
ATOM   3357 O O2    . DT  D 3 8   ? 28.342 -48.723 79.769  1.00 16.28 ? 222  DT  D O2    1 
ATOM   3358 N N3    . DT  D 3 8   ? 26.245 -48.850 78.928  1.00 14.49 ? 222  DT  D N3    1 
ATOM   3359 C C4    . DT  D 3 8   ? 25.169 -49.507 78.390  1.00 16.25 ? 222  DT  D C4    1 
ATOM   3360 O O4    . DT  D 3 8   ? 24.153 -48.872 78.103  1.00 17.58 ? 222  DT  D O4    1 
ATOM   3361 C C5    . DT  D 3 8   ? 25.374 -50.935 78.214  1.00 16.96 ? 222  DT  D C5    1 
ATOM   3362 C C7    . DT  D 3 8   ? 24.263 -51.804 77.614  1.00 17.06 ? 222  DT  D C7    1 
ATOM   3363 C C6    . DT  D 3 8   ? 26.537 -51.515 78.561  1.00 16.87 ? 222  DT  D C6    1 
ATOM   3364 P P     . DT  D 3 9   ? 30.279 -55.689 81.391  1.00 19.96 ? 223  DT  D P     1 
ATOM   3365 O OP1   . DT  D 3 9   ? 31.639 -56.192 81.689  1.00 19.74 ? 223  DT  D OP1   1 
ATOM   3366 O OP2   . DT  D 3 9   ? 29.316 -56.532 80.639  1.00 19.61 ? 223  DT  D OP2   1 
ATOM   3367 O "O5'" . DT  D 3 9   ? 29.558 -55.288 82.773  1.00 19.27 ? 223  DT  D "O5'" 1 
ATOM   3368 C "C5'" . DT  D 3 9   ? 30.273 -54.627 83.811  1.00 19.07 ? 223  DT  D "C5'" 1 
ATOM   3369 C "C4'" . DT  D 3 9   ? 29.347 -53.789 84.675  1.00 18.32 ? 223  DT  D "C4'" 1 
ATOM   3370 O "O4'" . DT  D 3 9   ? 28.740 -52.781 83.907  1.00 18.27 ? 223  DT  D "O4'" 1 
ATOM   3371 C "C3'" . DT  D 3 9   ? 28.176 -54.586 85.157  1.00 17.78 ? 223  DT  D "C3'" 1 
ATOM   3372 O "O3'" . DT  D 3 9   ? 28.612 -55.279 86.322  1.00 21.59 ? 223  DT  D "O3'" 1 
ATOM   3373 C "C2'" . DT  D 3 9   ? 27.189 -53.478 85.507  1.00 16.88 ? 223  DT  D "C2'" 1 
ATOM   3374 C "C1'" . DT  D 3 9   ? 27.617 -52.309 84.624  1.00 15.85 ? 223  DT  D "C1'" 1 
ATOM   3375 N N1    . DT  D 3 9   ? 26.585 -51.886 83.652  1.00 16.02 ? 223  DT  D N1    1 
ATOM   3376 C C2    . DT  D 3 9   ? 26.288 -50.531 83.567  1.00 16.13 ? 223  DT  D C2    1 
ATOM   3377 O O2    . DT  D 3 9   ? 26.821 -49.674 84.266  1.00 15.07 ? 223  DT  D O2    1 
ATOM   3378 N N3    . DT  D 3 9   ? 25.324 -50.183 82.645  1.00 17.16 ? 223  DT  D N3    1 
ATOM   3379 C C4    . DT  D 3 9   ? 24.635 -51.054 81.808  1.00 18.21 ? 223  DT  D C4    1 
ATOM   3380 O O4    . DT  D 3 9   ? 23.779 -50.633 81.027  1.00 18.65 ? 223  DT  D O4    1 
ATOM   3381 C C5    . DT  D 3 9   ? 25.011 -52.438 81.966  1.00 17.52 ? 223  DT  D C5    1 
ATOM   3382 C C7    . DT  D 3 9   ? 24.332 -53.491 81.103  1.00 16.42 ? 223  DT  D C7    1 
ATOM   3383 C C6    . DT  D 3 9   ? 25.948 -52.805 82.857  1.00 15.47 ? 223  DT  D C6    1 
ATOM   3384 P P     . DA  D 3 10  ? 27.879 -56.571 86.926  1.00 24.30 ? 224  DA  D P     1 
ATOM   3385 O OP1   . DA  D 3 10  ? 28.931 -57.488 87.406  1.00 24.75 ? 224  DA  D OP1   1 
ATOM   3386 O OP2   . DA  D 3 10  ? 26.868 -57.040 85.954  1.00 23.16 ? 224  DA  D OP2   1 
ATOM   3387 O "O5'" . DA  D 3 10  ? 27.094 -56.024 88.204  1.00 22.09 ? 224  DA  D "O5'" 1 
ATOM   3388 C "C5'" . DA  D 3 10  ? 27.767 -55.439 89.305  1.00 20.57 ? 224  DA  D "C5'" 1 
ATOM   3389 C "C4'" . DA  D 3 10  ? 26.924 -54.308 89.870  1.00 21.45 ? 224  DA  D "C4'" 1 
ATOM   3390 O "O4'" . DA  D 3 10  ? 26.734 -53.283 88.890  1.00 21.29 ? 224  DA  D "O4'" 1 
ATOM   3391 C "C3'" . DA  D 3 10  ? 25.531 -54.802 90.188  1.00 21.47 ? 224  DA  D "C3'" 1 
ATOM   3392 O "O3'" . DA  D 3 10  ? 25.539 -55.337 91.511  1.00 23.73 ? 224  DA  D "O3'" 1 
ATOM   3393 C "C2'" . DA  D 3 10  ? 24.757 -53.483 90.137  1.00 21.38 ? 224  DA  D "C2'" 1 
ATOM   3394 C "C1'" . DA  D 3 10  ? 25.412 -52.764 88.969  1.00 19.10 ? 224  DA  D "C1'" 1 
ATOM   3395 N N9    . DA  D 3 10  ? 24.663 -52.991 87.713  1.00 18.85 ? 224  DA  D N9    1 
ATOM   3396 C C8    . DA  D 3 10  ? 24.256 -54.172 87.133  1.00 18.32 ? 224  DA  D C8    1 
ATOM   3397 N N7    . DA  D 3 10  ? 23.571 -54.007 86.034  1.00 18.63 ? 224  DA  D N7    1 
ATOM   3398 C C5    . DA  D 3 10  ? 23.520 -52.620 85.875  1.00 19.32 ? 224  DA  D C5    1 
ATOM   3399 C C6    . DA  D 3 10  ? 22.910 -51.785 84.916  1.00 18.94 ? 224  DA  D C6    1 
ATOM   3400 N N6    . DA  D 3 10  ? 22.208 -52.234 83.878  1.00 20.05 ? 224  DA  D N6    1 
ATOM   3401 N N1    . DA  D 3 10  ? 23.040 -50.468 85.078  1.00 18.38 ? 224  DA  D N1    1 
ATOM   3402 C C2    . DA  D 3 10  ? 23.723 -50.010 86.116  1.00 19.06 ? 224  DA  D C2    1 
ATOM   3403 N N3    . DA  D 3 10  ? 24.335 -50.676 87.078  1.00 18.05 ? 224  DA  D N3    1 
ATOM   3404 C C4    . DA  D 3 10  ? 24.188 -52.001 86.892  1.00 18.18 ? 224  DA  D C4    1 
ATOM   3405 P P     . DT  D 3 11  ? 24.560 -56.538 91.997  1.00 27.03 ? 225  DT  D P     1 
ATOM   3406 O OP1   . DT  D 3 11  ? 24.884 -56.794 93.423  1.00 26.22 ? 225  DT  D OP1   1 
ATOM   3407 O OP2   . DT  D 3 11  ? 24.622 -57.646 91.005  1.00 25.12 ? 225  DT  D OP2   1 
ATOM   3408 O "O5'" . DT  D 3 11  ? 23.068 -55.923 91.926  1.00 24.08 ? 225  DT  D "O5'" 1 
ATOM   3409 C "C5'" . DT  D 3 11  ? 22.636 -54.950 92.868  1.00 23.36 ? 225  DT  D "C5'" 1 
ATOM   3410 C "C4'" . DT  D 3 11  ? 21.345 -54.319 92.404  1.00 22.60 ? 225  DT  D "C4'" 1 
ATOM   3411 O "O4'" . DT  D 3 11  ? 21.510 -53.805 91.094  1.00 22.64 ? 225  DT  D "O4'" 1 
ATOM   3412 C "C3'" . DT  D 3 11  ? 20.270 -55.377 92.269  1.00 20.96 ? 225  DT  D "C3'" 1 
ATOM   3413 O "O3'" . DT  D 3 11  ? 19.650 -55.499 93.541  1.00 21.75 ? 225  DT  D "O3'" 1 
ATOM   3414 C "C2'" . DT  D 3 11  ? 19.331 -54.757 91.244  1.00 20.29 ? 225  DT  D "C2'" 1 
ATOM   3415 C "C1'" . DT  D 3 11  ? 20.228 -53.766 90.491  1.00 21.01 ? 225  DT  D "C1'" 1 
ATOM   3416 N N1    . DT  D 3 11  ? 20.343 -54.069 89.052  1.00 21.32 ? 225  DT  D N1    1 
ATOM   3417 C C2    . DT  D 3 11  ? 20.080 -53.041 88.178  1.00 20.48 ? 225  DT  D C2    1 
ATOM   3418 O O2    . DT  D 3 11  ? 19.803 -51.907 88.555  1.00 20.53 ? 225  DT  D O2    1 
ATOM   3419 N N3    . DT  D 3 11  ? 20.180 -53.349 86.842  1.00 21.22 ? 225  DT  D N3    1 
ATOM   3420 C C4    . DT  D 3 11  ? 20.523 -54.579 86.306  1.00 21.48 ? 225  DT  D C4    1 
ATOM   3421 O O4    . DT  D 3 11  ? 20.594 -54.733 85.088  1.00 23.01 ? 225  DT  D O4    1 
ATOM   3422 C C5    . DT  D 3 11  ? 20.785 -55.589 87.292  1.00 20.75 ? 225  DT  D C5    1 
ATOM   3423 C C7    . DT  D 3 11  ? 21.170 -56.977 86.839  1.00 21.43 ? 225  DT  D C7    1 
ATOM   3424 C C6    . DT  D 3 11  ? 20.691 -55.317 88.601  1.00 21.47 ? 225  DT  D C6    1 
ATOM   3425 P P     . DT  D 3 12  ? 18.927 -56.839 94.044  1.00 23.97 ? 226  DT  D P     1 
ATOM   3426 O OP1   . DT  D 3 12  ? 18.893 -56.839 95.519  1.00 26.10 ? 226  DT  D OP1   1 
ATOM   3427 O OP2   . DT  D 3 12  ? 19.506 -57.991 93.319  1.00 25.88 ? 226  DT  D OP2   1 
ATOM   3428 O "O5'" . DT  D 3 12  ? 17.442 -56.598 93.551  1.00 23.81 ? 226  DT  D "O5'" 1 
ATOM   3429 C "C5'" . DT  D 3 12  ? 16.701 -55.589 94.213  1.00 25.46 ? 226  DT  D "C5'" 1 
ATOM   3430 C "C4'" . DT  D 3 12  ? 15.283 -55.487 93.696  1.00 28.39 ? 226  DT  D "C4'" 1 
ATOM   3431 O "O4'" . DT  D 3 12  ? 15.234 -55.349 92.276  1.00 28.79 ? 226  DT  D "O4'" 1 
ATOM   3432 C "C3'" . DT  D 3 12  ? 14.486 -56.729 94.000  1.00 29.57 ? 226  DT  D "C3'" 1 
ATOM   3433 O "O3'" . DT  D 3 12  ? 13.135 -56.309 94.046  1.00 32.27 ? 226  DT  D "O3'" 1 
ATOM   3434 C "C2'" . DT  D 3 12  ? 14.779 -57.602 92.773  1.00 28.92 ? 226  DT  D "C2'" 1 
ATOM   3435 C "C1'" . DT  D 3 12  ? 14.748 -56.559 91.664  1.00 28.51 ? 226  DT  D "C1'" 1 
ATOM   3436 N N1    . DT  D 3 12  ? 15.621 -56.864 90.494  1.00 27.73 ? 226  DT  D N1    1 
ATOM   3437 C C2    . DT  D 3 12  ? 15.206 -56.363 89.285  1.00 27.57 ? 226  DT  D C2    1 
ATOM   3438 O O2    . DT  D 3 12  ? 14.150 -55.755 89.144  1.00 28.99 ? 226  DT  D O2    1 
ATOM   3439 N N3    . DT  D 3 12  ? 16.043 -56.583 88.220  1.00 26.42 ? 226  DT  D N3    1 
ATOM   3440 C C4    . DT  D 3 12  ? 17.238 -57.244 88.231  1.00 26.19 ? 226  DT  D C4    1 
ATOM   3441 O O4    . DT  D 3 12  ? 17.891 -57.344 87.192  1.00 26.53 ? 226  DT  D O4    1 
ATOM   3442 C C5    . DT  D 3 12  ? 17.600 -57.745 89.528  1.00 25.48 ? 226  DT  D C5    1 
ATOM   3443 C C7    . DT  D 3 12  ? 18.904 -58.498 89.689  1.00 26.17 ? 226  DT  D C7    1 
ATOM   3444 C C6    . DT  D 3 12  ? 16.804 -57.549 90.597  1.00 26.63 ? 226  DT  D C6    1 
ATOM   3445 P P     . DG  D 3 13  ? 11.972 -57.197 94.686  1.00 34.48 ? 227  DG  D P     1 
ATOM   3446 O OP1   . DG  D 3 13  ? 11.178 -56.329 95.583  1.00 34.72 ? 227  DG  D OP1   1 
ATOM   3447 O OP2   . DG  D 3 13  ? 12.511 -58.488 95.176  1.00 33.41 ? 227  DG  D OP2   1 
ATOM   3448 O "O5'" . DG  D 3 13  ? 11.148 -57.480 93.359  1.00 34.60 ? 227  DG  D "O5'" 1 
ATOM   3449 C "C5'" . DG  D 3 13  ? 10.598 -56.411 92.598  1.00 35.55 ? 227  DG  D "C5'" 1 
ATOM   3450 C "C4'" . DG  D 3 13  ? 9.957  -56.933 91.328  1.00 37.57 ? 227  DG  D "C4'" 1 
ATOM   3451 O "O4'" . DG  D 3 13  ? 10.946 -57.247 90.347  1.00 36.13 ? 227  DG  D "O4'" 1 
ATOM   3452 C "C3'" . DG  D 3 13  ? 9.219  -58.256 91.627  1.00 39.67 ? 227  DG  D "C3'" 1 
ATOM   3453 O "O3'" . DG  D 3 13  ? 8.088  -58.448 90.771  1.00 42.70 ? 227  DG  D "O3'" 1 
ATOM   3454 C "C2'" . DG  D 3 13  ? 10.290 -59.286 91.296  1.00 37.92 ? 227  DG  D "C2'" 1 
ATOM   3455 C "C1'" . DG  D 3 13  ? 10.859 -58.636 90.062  1.00 35.95 ? 227  DG  D "C1'" 1 
ATOM   3456 N N9    . DG  D 3 13  ? 12.178 -59.165 89.725  1.00 34.79 ? 227  DG  D N9    1 
ATOM   3457 C C8    . DG  D 3 13  ? 13.052 -59.965 90.421  1.00 34.66 ? 227  DG  D C8    1 
ATOM   3458 N N7    . DG  D 3 13  ? 14.131 -60.266 89.740  1.00 34.15 ? 227  DG  D N7    1 
ATOM   3459 C C5    . DG  D 3 13  ? 13.942 -59.617 88.525  1.00 33.18 ? 227  DG  D C5    1 
ATOM   3460 C C6    . DG  D 3 13  ? 14.757 -59.575 87.369  1.00 33.28 ? 227  DG  D C6    1 
ATOM   3461 O O6    . DG  D 3 13  ? 15.847 -60.115 87.179  1.00 34.43 ? 227  DG  D O6    1 
ATOM   3462 N N1    . DG  D 3 13  ? 14.171 -58.804 86.377  1.00 32.09 ? 227  DG  D N1    1 
ATOM   3463 C C2    . DG  D 3 13  ? 12.960 -58.165 86.498  1.00 32.98 ? 227  DG  D C2    1 
ATOM   3464 N N2    . DG  D 3 13  ? 12.524 -57.449 85.482  1.00 32.96 ? 227  DG  D N2    1 
ATOM   3465 N N3    . DG  D 3 13  ? 12.200 -58.210 87.575  1.00 33.27 ? 227  DG  D N3    1 
ATOM   3466 C C4    . DG  D 3 13  ? 12.754 -58.948 88.534  1.00 33.57 ? 227  DG  D C4    1 
ATOM   3467 P P     . DC  D 3 14  ? 6.816  -59.210 91.362  1.00 43.69 ? 228  DC  D P     1 
ATOM   3468 O OP1   . DC  D 3 14  ? 6.130  -58.298 92.305  1.00 43.99 ? 228  DC  D OP1   1 
ATOM   3469 O OP2   . DC  D 3 14  ? 7.248  -60.555 91.815  1.00 44.69 ? 228  DC  D OP2   1 
ATOM   3470 O "O5'" . DC  D 3 14  ? 5.924  -59.375 90.054  1.00 43.84 ? 228  DC  D "O5'" 1 
ATOM   3471 C "C5'" . DC  D 3 14  ? 5.679  -58.222 89.263  1.00 45.27 ? 228  DC  D "C5'" 1 
ATOM   3472 C "C4'" . DC  D 3 14  ? 6.406  -58.313 87.935  1.00 46.30 ? 228  DC  D "C4'" 1 
ATOM   3473 O "O4'" . DC  D 3 14  ? 7.714  -58.859 88.121  1.00 45.67 ? 228  DC  D "O4'" 1 
ATOM   3474 C "C3'" . DC  D 3 14  ? 5.688  -59.250 86.937  1.00 46.68 ? 228  DC  D "C3'" 1 
ATOM   3475 O "O3'" . DC  D 3 14  ? 5.663  -58.609 85.651  1.00 48.84 ? 228  DC  D "O3'" 1 
ATOM   3476 C "C2'" . DC  D 3 14  ? 6.621  -60.467 86.917  1.00 45.20 ? 228  DC  D "C2'" 1 
ATOM   3477 C "C1'" . DC  D 3 14  ? 7.952  -59.741 87.021  1.00 43.71 ? 228  DC  D "C1'" 1 
ATOM   3478 N N1    . DC  D 3 14  ? 9.116  -60.612 87.298  1.00 40.38 ? 228  DC  D N1    1 
ATOM   3479 C C2    . DC  D 3 14  ? 10.100 -60.685 86.328  1.00 39.00 ? 228  DC  D C2    1 
ATOM   3480 O O2    . DC  D 3 14  ? 9.974  -60.101 85.252  1.00 36.51 ? 228  DC  D O2    1 
ATOM   3481 N N3    . DC  D 3 14  ? 11.196 -61.440 86.595  1.00 39.06 ? 228  DC  D N3    1 
ATOM   3482 C C4    . DC  D 3 14  ? 11.325 -62.100 87.753  1.00 40.05 ? 228  DC  D C4    1 
ATOM   3483 N N4    . DC  D 3 14  ? 12.427 -62.819 87.974  1.00 40.14 ? 228  DC  D N4    1 
ATOM   3484 C C5    . DC  D 3 14  ? 10.309 -62.037 88.758  1.00 39.77 ? 228  DC  D C5    1 
ATOM   3485 C C6    . DC  D 3 14  ? 9.228  -61.281 88.481  1.00 40.03 ? 228  DC  D C6    1 
ATOM   3486 O "O5'" . DG  E 2 1   ? 9.196  -27.033 141.286 1.00 61.16 ? 201  DG  E "O5'" 1 
ATOM   3487 C "C5'" . DG  E 2 1   ? 9.397  -26.475 139.985 1.00 60.53 ? 201  DG  E "C5'" 1 
ATOM   3488 C "C4'" . DG  E 2 1   ? 8.389  -25.368 139.676 1.00 59.72 ? 201  DG  E "C4'" 1 
ATOM   3489 O "O4'" . DG  E 2 1   ? 8.597  -24.842 138.373 1.00 58.17 ? 201  DG  E "O4'" 1 
ATOM   3490 C "C3'" . DG  E 2 1   ? 6.956  -25.899 139.596 1.00 59.92 ? 201  DG  E "C3'" 1 
ATOM   3491 O "O3'" . DG  E 2 1   ? 6.372  -25.965 140.901 1.00 61.02 ? 201  DG  E "O3'" 1 
ATOM   3492 C "C2'" . DG  E 2 1   ? 6.248  -24.833 138.751 1.00 58.11 ? 201  DG  E "C2'" 1 
ATOM   3493 C "C1'" . DG  E 2 1   ? 7.414  -24.106 138.063 1.00 55.17 ? 201  DG  E "C1'" 1 
ATOM   3494 N N9    . DG  E 2 1   ? 7.289  -23.965 136.592 1.00 52.32 ? 201  DG  E N9    1 
ATOM   3495 C C8    . DG  E 2 1   ? 8.187  -23.350 135.759 1.00 51.46 ? 201  DG  E C8    1 
ATOM   3496 N N7    . DG  E 2 1   ? 7.827  -23.329 134.511 1.00 50.23 ? 201  DG  E N7    1 
ATOM   3497 C C5    . DG  E 2 1   ? 6.602  -23.976 134.504 1.00 49.08 ? 201  DG  E C5    1 
ATOM   3498 C C6    . DG  E 2 1   ? 5.745  -24.248 133.416 1.00 48.02 ? 201  DG  E C6    1 
ATOM   3499 O O6    . DG  E 2 1   ? 5.893  -23.928 132.242 1.00 46.79 ? 201  DG  E O6    1 
ATOM   3500 N N1    . DG  E 2 1   ? 4.614  -24.932 133.814 1.00 47.65 ? 201  DG  E N1    1 
ATOM   3501 C C2    . DG  E 2 1   ? 4.335  -25.307 135.110 1.00 48.50 ? 201  DG  E C2    1 
ATOM   3502 N N2    . DG  E 2 1   ? 3.200  -25.981 135.310 1.00 48.26 ? 201  DG  E N2    1 
ATOM   3503 N N3    . DG  E 2 1   ? 5.141  -25.044 136.144 1.00 48.28 ? 201  DG  E N3    1 
ATOM   3504 C C4    . DG  E 2 1   ? 6.255  -24.377 135.769 1.00 49.27 ? 201  DG  E C4    1 
ATOM   3505 P P     . DC  E 2 2   ? 6.124  -27.377 141.625 1.00 62.24 ? 202  DC  E P     1 
ATOM   3506 O OP1   . DC  E 2 2   ? 6.262  -27.176 143.086 1.00 62.47 ? 202  DC  E OP1   1 
ATOM   3507 O OP2   . DC  E 2 2   ? 6.940  -28.412 140.945 1.00 61.25 ? 202  DC  E OP2   1 
ATOM   3508 O "O5'" . DC  E 2 2   ? 4.577  -27.644 141.300 1.00 58.94 ? 202  DC  E "O5'" 1 
ATOM   3509 C "C5'" . DC  E 2 2   ? 4.162  -28.993 141.167 1.00 56.11 ? 202  DC  E "C5'" 1 
ATOM   3510 C "C4'" . DC  E 2 2   ? 4.117  -29.391 139.709 1.00 54.31 ? 202  DC  E "C4'" 1 
ATOM   3511 O "O4'" . DC  E 2 2   ? 4.842  -28.500 138.858 1.00 52.77 ? 202  DC  E "O4'" 1 
ATOM   3512 C "C3'" . DC  E 2 2   ? 4.897  -30.668 139.546 1.00 53.40 ? 202  DC  E "C3'" 1 
ATOM   3513 O "O3'" . DC  E 2 2   ? 4.095  -31.777 139.955 1.00 52.95 ? 202  DC  E "O3'" 1 
ATOM   3514 C "C2'" . DC  E 2 2   ? 5.178  -30.674 138.039 1.00 52.25 ? 202  DC  E "C2'" 1 
ATOM   3515 C "C1'" . DC  E 2 2   ? 4.917  -29.223 137.625 1.00 50.05 ? 202  DC  E "C1'" 1 
ATOM   3516 N N1    . DC  E 2 2   ? 5.954  -28.688 136.701 1.00 46.83 ? 202  DC  E N1    1 
ATOM   3517 C C2    . DC  E 2 2   ? 5.603  -28.552 135.371 1.00 44.66 ? 202  DC  E C2    1 
ATOM   3518 O O2    . DC  E 2 2   ? 4.495  -28.901 134.975 1.00 43.71 ? 202  DC  E O2    1 
ATOM   3519 N N3    . DC  E 2 2   ? 6.510  -28.026 134.510 1.00 43.59 ? 202  DC  E N3    1 
ATOM   3520 C C4    . DC  E 2 2   ? 7.722  -27.645 134.927 1.00 42.96 ? 202  DC  E C4    1 
ATOM   3521 N N4    . DC  E 2 2   ? 8.571  -27.118 134.046 1.00 42.05 ? 202  DC  E N4    1 
ATOM   3522 C C5    . DC  E 2 2   ? 8.106  -27.784 136.300 1.00 44.14 ? 202  DC  E C5    1 
ATOM   3523 C C6    . DC  E 2 2   ? 7.190  -28.309 137.144 1.00 45.88 ? 202  DC  E C6    1 
ATOM   3524 P P     . DA  E 2 3   ? 4.780  -33.199 140.259 1.00 52.40 ? 203  DA  E P     1 
ATOM   3525 O OP1   . DA  E 2 3   ? 4.113  -33.800 141.441 1.00 52.89 ? 203  DA  E OP1   1 
ATOM   3526 O OP2   . DA  E 2 3   ? 6.250  -33.018 140.246 1.00 51.54 ? 203  DA  E OP2   1 
ATOM   3527 O "O5'" . DA  E 2 3   ? 4.371  -34.055 138.978 1.00 48.54 ? 203  DA  E "O5'" 1 
ATOM   3528 C "C5'" . DA  E 2 3   ? 3.000  -34.081 138.595 1.00 43.80 ? 203  DA  E "C5'" 1 
ATOM   3529 C "C4'" . DA  E 2 3   ? 2.869  -34.062 137.089 1.00 40.03 ? 203  DA  E "C4'" 1 
ATOM   3530 O "O4'" . DA  E 2 3   ? 3.463  -32.911 136.508 1.00 38.21 ? 203  DA  E "O4'" 1 
ATOM   3531 C "C3'" . DA  E 2 3   ? 3.708  -35.166 136.536 1.00 38.40 ? 203  DA  E "C3'" 1 
ATOM   3532 O "O3'" . DA  E 2 3   ? 3.008  -36.379 136.742 1.00 38.97 ? 203  DA  E "O3'" 1 
ATOM   3533 C "C2'" . DA  E 2 3   ? 3.794  -34.775 135.072 1.00 37.02 ? 203  DA  E "C2'" 1 
ATOM   3534 C "C1'" . DA  E 2 3   ? 3.863  -33.257 135.179 1.00 34.87 ? 203  DA  E "C1'" 1 
ATOM   3535 N N9    . DA  E 2 3   ? 5.200  -32.705 134.949 1.00 31.76 ? 203  DA  E N9    1 
ATOM   3536 C C8    . DA  E 2 3   ? 6.256  -32.611 135.806 1.00 30.67 ? 203  DA  E C8    1 
ATOM   3537 N N7    . DA  E 2 3   ? 7.278  -31.970 135.311 1.00 30.38 ? 203  DA  E N7    1 
ATOM   3538 C C5    . DA  E 2 3   ? 6.865  -31.626 134.038 1.00 28.74 ? 203  DA  E C5    1 
ATOM   3539 C C6    . DA  E 2 3   ? 7.486  -30.929 133.003 1.00 29.29 ? 203  DA  E C6    1 
ATOM   3540 N N6    . DA  E 2 3   ? 8.717  -30.425 133.083 1.00 28.95 ? 203  DA  E N6    1 
ATOM   3541 N N1    . DA  E 2 3   ? 6.780  -30.769 131.881 1.00 29.03 ? 203  DA  E N1    1 
ATOM   3542 C C2    . DA  E 2 3   ? 5.554  -31.265 131.794 1.00 29.07 ? 203  DA  E C2    1 
ATOM   3543 N N3    . DA  E 2 3   ? 4.864  -31.935 132.694 1.00 28.86 ? 203  DA  E N3    1 
ATOM   3544 C C4    . DA  E 2 3   ? 5.598  -32.078 133.810 1.00 29.66 ? 203  DA  E C4    1 
ATOM   3545 P P     . DA  E 2 4   ? 3.832  -37.605 137.341 1.00 40.69 ? 204  DA  E P     1 
ATOM   3546 O OP1   . DA  E 2 4   ? 2.886  -38.683 137.711 1.00 41.69 ? 204  DA  E OP1   1 
ATOM   3547 O OP2   . DA  E 2 4   ? 4.794  -37.079 138.342 1.00 40.65 ? 204  DA  E OP2   1 
ATOM   3548 O "O5'" . DA  E 2 4   ? 4.633  -38.060 136.022 1.00 37.32 ? 204  DA  E "O5'" 1 
ATOM   3549 C "C5'" . DA  E 2 4   ? 3.905  -38.461 134.860 1.00 32.63 ? 204  DA  E "C5'" 1 
ATOM   3550 C "C4'" . DA  E 2 4   ? 4.785  -39.188 133.858 1.00 30.03 ? 204  DA  E "C4'" 1 
ATOM   3551 O "O4'" . DA  E 2 4   ? 5.700  -38.299 133.231 1.00 28.21 ? 204  DA  E "O4'" 1 
ATOM   3552 C "C3'" . DA  E 2 4   ? 5.630  -40.220 134.573 1.00 28.15 ? 204  DA  E "C3'" 1 
ATOM   3553 O "O3'" . DA  E 2 4   ? 5.898  -41.314 133.723 1.00 27.89 ? 204  DA  E "O3'" 1 
ATOM   3554 C "C2'" . DA  E 2 4   ? 6.904  -39.471 134.892 1.00 28.00 ? 204  DA  E "C2'" 1 
ATOM   3555 C "C1'" . DA  E 2 4   ? 7.030  -38.550 133.691 1.00 27.33 ? 204  DA  E "C1'" 1 
ATOM   3556 N N9    . DA  E 2 4   ? 7.659  -37.278 134.085 1.00 25.72 ? 204  DA  E N9    1 
ATOM   3557 C C8    . DA  E 2 4   ? 7.325  -36.438 135.110 1.00 25.51 ? 204  DA  E C8    1 
ATOM   3558 N N7    . DA  E 2 4   ? 8.068  -35.367 135.180 1.00 25.67 ? 204  DA  E N7    1 
ATOM   3559 C C5    . DA  E 2 4   ? 8.957  -35.509 134.124 1.00 24.50 ? 204  DA  E C5    1 
ATOM   3560 C C6    . DA  E 2 4   ? 10.001 -34.709 133.657 1.00 24.26 ? 204  DA  E C6    1 
ATOM   3561 N N6    . DA  E 2 4   ? 10.324 -33.546 134.207 1.00 24.40 ? 204  DA  E N6    1 
ATOM   3562 N N1    . DA  E 2 4   ? 10.683 -35.145 132.597 1.00 23.71 ? 204  DA  E N1    1 
ATOM   3563 C C2    . DA  E 2 4   ? 10.346 -36.298 132.038 1.00 23.93 ? 204  DA  E C2    1 
ATOM   3564 N N3    . DA  E 2 4   ? 9.389  -37.145 132.372 1.00 24.78 ? 204  DA  E N3    1 
ATOM   3565 C C4    . DA  E 2 4   ? 8.719  -36.674 133.450 1.00 25.36 ? 204  DA  E C4    1 
ATOM   3566 P P     . DT  E 2 5   ? 6.520  -42.610 134.395 1.00 27.09 ? 205  DT  E P     1 
ATOM   3567 O OP1   . DT  E 2 5   ? 5.907  -43.812 133.794 1.00 28.21 ? 205  DT  E OP1   1 
ATOM   3568 O OP2   . DT  E 2 5   ? 6.509  -42.424 135.864 1.00 27.19 ? 205  DT  E OP2   1 
ATOM   3569 O "O5'" . DT  E 2 5   ? 8.026  -42.496 133.889 1.00 25.51 ? 205  DT  E "O5'" 1 
ATOM   3570 C "C5'" . DT  E 2 5   ? 8.395  -42.672 132.524 1.00 21.91 ? 205  DT  E "C5'" 1 
ATOM   3571 C "C4'" . DT  E 2 5   ? 9.896  -42.483 132.369 1.00 21.35 ? 205  DT  E "C4'" 1 
ATOM   3572 O "O4'" . DT  E 2 5   ? 10.256 -41.133 132.534 1.00 18.34 ? 205  DT  E "O4'" 1 
ATOM   3573 C "C3'" . DT  E 2 5   ? 10.586 -43.150 133.539 1.00 22.01 ? 205  DT  E "C3'" 1 
ATOM   3574 O "O3'" . DT  E 2 5   ? 10.740 -44.540 133.210 1.00 24.90 ? 205  DT  E "O3'" 1 
ATOM   3575 C "C2'" . DT  E 2 5   ? 11.910 -42.372 133.655 1.00 20.53 ? 205  DT  E "C2'" 1 
ATOM   3576 C "C1'" . DT  E 2 5   ? 11.626 -41.086 132.880 1.00 19.91 ? 205  DT  E "C1'" 1 
ATOM   3577 N N1    . DT  E 2 5   ? 11.826 -39.838 133.643 1.00 20.93 ? 205  DT  E N1    1 
ATOM   3578 C C2    . DT  E 2 5   ? 12.802 -38.955 133.205 1.00 20.77 ? 205  DT  E C2    1 
ATOM   3579 O O2    . DT  E 2 5   ? 13.560 -39.192 132.268 1.00 22.11 ? 205  DT  E O2    1 
ATOM   3580 N N3    . DT  E 2 5   ? 12.901 -37.775 133.900 1.00 20.88 ? 205  DT  E N3    1 
ATOM   3581 C C4    . DT  E 2 5   ? 12.137 -37.398 134.977 1.00 21.09 ? 205  DT  E C4    1 
ATOM   3582 O O4    . DT  E 2 5   ? 12.297 -36.295 135.481 1.00 22.82 ? 205  DT  E O4    1 
ATOM   3583 C C5    . DT  E 2 5   ? 11.160 -38.373 135.382 1.00 20.71 ? 205  DT  E C5    1 
ATOM   3584 C C7    . DT  E 2 5   ? 10.284 -38.090 136.588 1.00 20.26 ? 205  DT  E C7    1 
ATOM   3585 C C6    . DT  E 2 5   ? 11.030 -39.537 134.720 1.00 20.79 ? 205  DT  E C6    1 
ATOM   3586 P P     . DA  E 2 6   ? 10.987 -45.656 134.341 1.00 25.98 ? 206  DA  E P     1 
ATOM   3587 O OP1   . DA  E 2 6   ? 10.593 -46.967 133.775 1.00 29.18 ? 206  DA  E OP1   1 
ATOM   3588 O OP2   . DA  E 2 6   ? 10.391 -45.182 135.609 1.00 25.89 ? 206  DA  E OP2   1 
ATOM   3589 O "O5'" . DA  E 2 6   ? 12.576 -45.634 134.499 1.00 25.19 ? 206  DA  E "O5'" 1 
ATOM   3590 C "C5'" . DA  E 2 6   ? 13.422 -46.132 133.459 1.00 23.86 ? 206  DA  E "C5'" 1 
ATOM   3591 C "C4'" . DA  E 2 6   ? 14.836 -45.645 133.654 1.00 21.86 ? 206  DA  E "C4'" 1 
ATOM   3592 O "O4'" . DA  E 2 6   ? 14.833 -44.231 133.680 1.00 21.21 ? 206  DA  E "O4'" 1 
ATOM   3593 C "C3'" . DA  E 2 6   ? 15.303 -46.031 135.036 1.00 22.37 ? 206  DA  E "C3'" 1 
ATOM   3594 O "O3'" . DA  E 2 6   ? 15.851 -47.346 134.959 1.00 25.11 ? 206  DA  E "O3'" 1 
ATOM   3595 C "C2'" . DA  E 2 6   ? 16.363 -44.987 135.322 1.00 19.81 ? 206  DA  E "C2'" 1 
ATOM   3596 C "C1'" . DA  E 2 6   ? 15.857 -43.776 134.557 1.00 19.04 ? 206  DA  E "C1'" 1 
ATOM   3597 N N9    . DA  E 2 6   ? 15.297 -42.695 135.401 1.00 18.01 ? 206  DA  E N9    1 
ATOM   3598 C C8    . DA  E 2 6   ? 14.357 -42.750 136.395 1.00 16.58 ? 206  DA  E C8    1 
ATOM   3599 N N7    . DA  E 2 6   ? 14.052 -41.576 136.890 1.00 17.15 ? 206  DA  E N7    1 
ATOM   3600 C C5    . DA  E 2 6   ? 14.846 -40.686 136.177 1.00 16.52 ? 206  DA  E C5    1 
ATOM   3601 C C6    . DA  E 2 6   ? 15.000 -39.295 136.222 1.00 16.66 ? 206  DA  E C6    1 
ATOM   3602 N N6    . DA  E 2 6   ? 14.337 -38.497 137.046 1.00 17.12 ? 206  DA  E N6    1 
ATOM   3603 N N1    . DA  E 2 6   ? 15.875 -38.748 135.378 1.00 17.88 ? 206  DA  E N1    1 
ATOM   3604 C C2    . DA  E 2 6   ? 16.552 -39.523 134.549 1.00 17.60 ? 206  DA  E C2    1 
ATOM   3605 N N3    . DA  E 2 6   ? 16.502 -40.832 134.406 1.00 17.43 ? 206  DA  E N3    1 
ATOM   3606 C C4    . DA  E 2 6   ? 15.609 -41.360 135.270 1.00 17.09 ? 206  DA  E C4    1 
ATOM   3607 P P     . DA  E 2 7   ? 15.839 -48.304 136.235 1.00 26.69 ? 207  DA  E P     1 
ATOM   3608 O OP1   . DA  E 2 7   ? 16.161 -49.672 135.789 1.00 29.06 ? 207  DA  E OP1   1 
ATOM   3609 O OP2   . DA  E 2 7   ? 14.614 -48.039 137.023 1.00 26.67 ? 207  DA  E OP2   1 
ATOM   3610 O "O5'" . DA  E 2 7   ? 17.079 -47.760 137.067 1.00 25.61 ? 207  DA  E "O5'" 1 
ATOM   3611 C "C5'" . DA  E 2 7   ? 18.411 -47.902 136.587 1.00 23.59 ? 207  DA  E "C5'" 1 
ATOM   3612 C "C4'" . DA  E 2 7   ? 19.311 -46.951 137.331 1.00 21.90 ? 207  DA  E "C4'" 1 
ATOM   3613 O "O4'" . DA  E 2 7   ? 18.845 -45.633 137.127 1.00 20.61 ? 207  DA  E "O4'" 1 
ATOM   3614 C "C3'" . DA  E 2 7   ? 19.140 -47.132 138.833 1.00 22.86 ? 207  DA  E "C3'" 1 
ATOM   3615 O "O3'" . DA  E 2 7   ? 19.900 -48.263 139.295 1.00 24.57 ? 207  DA  E "O3'" 1 
ATOM   3616 C "C2'" . DA  E 2 7   ? 19.717 -45.812 139.321 1.00 20.43 ? 207  DA  E "C2'" 1 
ATOM   3617 C "C1'" . DA  E 2 7   ? 19.209 -44.841 138.253 1.00 19.14 ? 207  DA  E "C1'" 1 
ATOM   3618 N N9    . DA  E 2 7   ? 18.068 -44.029 138.712 1.00 17.74 ? 207  DA  E N9    1 
ATOM   3619 C C8    . DA  E 2 7   ? 16.897 -44.416 139.324 1.00 16.81 ? 207  DA  E C8    1 
ATOM   3620 N N7    . DA  E 2 7   ? 16.114 -43.415 139.634 1.00 17.25 ? 207  DA  E N7    1 
ATOM   3621 C C5    . DA  E 2 7   ? 16.809 -42.292 139.200 1.00 16.88 ? 207  DA  E C5    1 
ATOM   3622 C C6    . DA  E 2 7   ? 16.533 -40.915 139.257 1.00 17.69 ? 207  DA  E C6    1 
ATOM   3623 N N6    . DA  E 2 7   ? 15.436 -40.399 139.803 1.00 18.24 ? 207  DA  E N6    1 
ATOM   3624 N N1    . DA  E 2 7   ? 17.451 -40.083 138.749 1.00 17.54 ? 207  DA  E N1    1 
ATOM   3625 C C2    . DA  E 2 7   ? 18.560 -40.589 138.225 1.00 17.70 ? 207  DA  E C2    1 
ATOM   3626 N N3    . DA  E 2 7   ? 18.939 -41.852 138.114 1.00 17.69 ? 207  DA  E N3    1 
ATOM   3627 C C4    . DA  E 2 7   ? 17.998 -42.662 138.633 1.00 16.76 ? 207  DA  E C4    1 
ATOM   3628 P P     . DA  E 2 8   ? 19.460 -49.073 140.612 1.00 25.07 ? 208  DA  E P     1 
ATOM   3629 O OP1   . DA  E 2 8   ? 19.860 -50.482 140.422 1.00 27.96 ? 208  DA  E OP1   1 
ATOM   3630 O OP2   . DA  E 2 8   ? 18.056 -48.743 140.928 1.00 25.43 ? 208  DA  E OP2   1 
ATOM   3631 O "O5'" . DA  E 2 8   ? 20.398 -48.401 141.725 1.00 24.80 ? 208  DA  E "O5'" 1 
ATOM   3632 C "C5'" . DA  E 2 8   ? 21.821 -48.448 141.589 1.00 22.25 ? 208  DA  E "C5'" 1 
ATOM   3633 C "C4'" . DA  E 2 8   ? 22.494 -47.301 142.318 1.00 20.79 ? 208  DA  E "C4'" 1 
ATOM   3634 O "O4'" . DA  E 2 8   ? 22.019 -46.064 141.807 1.00 21.14 ? 208  DA  E "O4'" 1 
ATOM   3635 C "C3'" . DA  E 2 8   ? 22.136 -47.325 143.780 1.00 20.63 ? 208  DA  E "C3'" 1 
ATOM   3636 O "O3'" . DA  E 2 8   ? 23.132 -48.098 144.451 1.00 22.03 ? 208  DA  E "O3'" 1 
ATOM   3637 C "C2'" . DA  E 2 8   ? 22.194 -45.843 144.159 1.00 19.60 ? 208  DA  E "C2'" 1 
ATOM   3638 C "C1'" . DA  E 2 8   ? 21.777 -45.137 142.866 1.00 19.16 ? 208  DA  E "C1'" 1 
ATOM   3639 N N9    . DA  E 2 8   ? 20.360 -44.704 142.858 1.00 18.65 ? 208  DA  E N9    1 
ATOM   3640 C C8    . DA  E 2 8   ? 19.231 -45.435 143.109 1.00 17.75 ? 208  DA  E C8    1 
ATOM   3641 N N7    . DA  E 2 8   ? 18.131 -44.741 143.043 1.00 19.24 ? 208  DA  E N7    1 
ATOM   3642 C C5    . DA  E 2 8   ? 18.556 -43.451 142.724 1.00 18.84 ? 208  DA  E C5    1 
ATOM   3643 C C6    . DA  E 2 8   ? 17.874 -42.224 142.545 1.00 18.34 ? 208  DA  E C6    1 
ATOM   3644 N N6    . DA  E 2 8   ? 16.546 -42.070 142.652 1.00 16.20 ? 208  DA  E N6    1 
ATOM   3645 N N1    . DA  E 2 8   ? 18.625 -41.150 142.272 1.00 18.31 ? 208  DA  E N1    1 
ATOM   3646 C C2    . DA  E 2 8   ? 19.933 -41.272 142.185 1.00 17.63 ? 208  DA  E C2    1 
ATOM   3647 N N3    . DA  E 2 8   ? 20.677 -42.352 142.333 1.00 20.01 ? 208  DA  E N3    1 
ATOM   3648 C C4    . DA  E 2 8   ? 19.914 -43.425 142.606 1.00 18.80 ? 208  DA  E C4    1 
ATOM   3649 P P     . DA  E 2 9   ? 22.762 -49.061 145.685 1.00 23.72 ? 209  DA  E P     1 
ATOM   3650 O OP1   . DA  E 2 9   ? 23.847 -50.044 145.841 1.00 24.39 ? 209  DA  E OP1   1 
ATOM   3651 O OP2   . DA  E 2 9   ? 21.372 -49.520 145.528 1.00 25.01 ? 209  DA  E OP2   1 
ATOM   3652 O "O5'" . DA  E 2 9   ? 22.799 -48.075 146.940 1.00 25.52 ? 209  DA  E "O5'" 1 
ATOM   3653 C "C5'" . DA  E 2 9   ? 24.031 -47.456 147.348 1.00 25.31 ? 209  DA  E "C5'" 1 
ATOM   3654 C "C4'" . DA  E 2 9   ? 23.792 -46.101 147.998 1.00 23.81 ? 209  DA  E "C4'" 1 
ATOM   3655 O "O4'" . DA  E 2 9   ? 23.068 -45.260 147.106 1.00 23.81 ? 209  DA  E "O4'" 1 
ATOM   3656 C "C3'" . DA  E 2 9   ? 22.915 -46.251 149.222 1.00 22.87 ? 209  DA  E "C3'" 1 
ATOM   3657 O "O3'" . DA  E 2 9   ? 23.756 -46.511 150.345 1.00 24.36 ? 209  DA  E "O3'" 1 
ATOM   3658 C "C2'" . DA  E 2 9   ? 22.287 -44.875 149.314 1.00 22.22 ? 209  DA  E "C2'" 1 
ATOM   3659 C "C1'" . DA  E 2 9   ? 22.160 -44.454 147.838 1.00 22.10 ? 209  DA  E "C1'" 1 
ATOM   3660 N N9    . DA  E 2 9   ? 20.776 -44.580 147.310 1.00 22.17 ? 209  DA  E N9    1 
ATOM   3661 C C8    . DA  E 2 9   ? 19.983 -45.689 147.225 1.00 21.64 ? 209  DA  E C8    1 
ATOM   3662 N N7    . DA  E 2 9   ? 18.792 -45.452 146.753 1.00 22.05 ? 209  DA  E N7    1 
ATOM   3663 C C5    . DA  E 2 9   ? 18.791 -44.089 146.505 1.00 21.16 ? 209  DA  E C5    1 
ATOM   3664 C C6    . DA  E 2 9   ? 17.816 -43.211 146.001 1.00 22.15 ? 209  DA  E C6    1 
ATOM   3665 N N6    . DA  E 2 9   ? 16.587 -43.591 145.636 1.00 23.05 ? 209  DA  E N6    1 
ATOM   3666 N N1    . DA  E 2 9   ? 18.157 -41.920 145.886 1.00 21.46 ? 209  DA  E N1    1 
ATOM   3667 C C2    . DA  E 2 9   ? 19.370 -41.536 146.243 1.00 21.34 ? 209  DA  E C2    1 
ATOM   3668 N N3    . DA  E 2 9   ? 20.363 -42.260 146.727 1.00 21.98 ? 209  DA  E N3    1 
ATOM   3669 C C4    . DA  E 2 9   ? 19.998 -43.549 146.836 1.00 21.23 ? 209  DA  E C4    1 
ATOM   3670 P P     . DG  E 2 10  ? 23.319 -47.497 151.545 1.00 24.99 ? 210  DG  E P     1 
ATOM   3671 O OP1   . DG  E 2 10  ? 24.511 -47.722 152.385 1.00 25.78 ? 210  DG  E OP1   1 
ATOM   3672 O OP2   . DG  E 2 10  ? 22.579 -48.653 150.990 1.00 25.39 ? 210  DG  E OP2   1 
ATOM   3673 O "O5'" . DG  E 2 10  ? 22.286 -46.624 152.366 1.00 23.43 ? 210  DG  E "O5'" 1 
ATOM   3674 C "C5'" . DG  E 2 10  ? 22.749 -45.520 153.108 1.00 26.36 ? 210  DG  E "C5'" 1 
ATOM   3675 C "C4'" . DG  E 2 10  ? 21.605 -44.802 153.786 1.00 28.48 ? 210  DG  E "C4'" 1 
ATOM   3676 O "O4'" . DG  E 2 10  ? 20.638 -44.389 152.824 1.00 28.21 ? 210  DG  E "O4'" 1 
ATOM   3677 C "C3'" . DG  E 2 10  ? 20.860 -45.703 154.772 1.00 29.61 ? 210  DG  E "C3'" 1 
ATOM   3678 O "O3'" . DG  E 2 10  ? 20.474 -44.929 155.901 1.00 33.26 ? 210  DG  E "O3'" 1 
ATOM   3679 C "C2'" . DG  E 2 10  ? 19.621 -46.080 153.983 1.00 27.73 ? 210  DG  E "C2'" 1 
ATOM   3680 C "C1'" . DG  E 2 10  ? 19.357 -44.757 153.310 1.00 26.81 ? 210  DG  E "C1'" 1 
ATOM   3681 N N9    . DG  E 2 10  ? 18.430 -44.871 152.184 1.00 25.16 ? 210  DG  E N9    1 
ATOM   3682 C C8    . DG  E 2 10  ? 17.362 -44.074 151.897 1.00 25.34 ? 210  DG  E C8    1 
ATOM   3683 N N7    . DG  E 2 10  ? 16.718 -44.424 150.824 1.00 25.90 ? 210  DG  E N7    1 
ATOM   3684 C C5    . DG  E 2 10  ? 17.413 -45.536 150.366 1.00 25.35 ? 210  DG  E C5    1 
ATOM   3685 C C6    . DG  E 2 10  ? 17.168 -46.349 149.239 1.00 25.38 ? 210  DG  E C6    1 
ATOM   3686 O O6    . DG  E 2 10  ? 16.271 -46.233 148.407 1.00 26.17 ? 210  DG  E O6    1 
ATOM   3687 N N1    . DG  E 2 10  ? 18.097 -47.375 149.140 1.00 24.20 ? 210  DG  E N1    1 
ATOM   3688 C C2    . DG  E 2 10  ? 19.134 -47.592 150.016 1.00 23.53 ? 210  DG  E C2    1 
ATOM   3689 N N2    . DG  E 2 10  ? 19.938 -48.625 149.764 1.00 23.62 ? 210  DG  E N2    1 
ATOM   3690 N N3    . DG  E 2 10  ? 19.365 -46.826 151.077 1.00 24.23 ? 210  DG  E N3    1 
ATOM   3691 C C4    . DG  E 2 10  ? 18.466 -45.819 151.190 1.00 25.38 ? 210  DG  E C4    1 
ATOM   3692 P P     . DG  E 2 11  ? 20.610 -45.518 157.379 1.00 34.70 ? 211  DG  E P     1 
ATOM   3693 O OP1   . DG  E 2 11  ? 21.839 -44.977 157.999 1.00 34.31 ? 211  DG  E OP1   1 
ATOM   3694 O OP2   . DG  E 2 11  ? 20.383 -46.979 157.337 1.00 35.41 ? 211  DG  E OP2   1 
ATOM   3695 O "O5'" . DG  E 2 11  ? 19.320 -44.827 158.028 1.00 34.10 ? 211  DG  E "O5'" 1 
ATOM   3696 C "C5'" . DG  E 2 11  ? 19.235 -43.411 158.127 1.00 33.28 ? 211  DG  E "C5'" 1 
ATOM   3697 C "C4'" . DG  E 2 11  ? 17.798 -42.935 158.219 1.00 33.84 ? 211  DG  E "C4'" 1 
ATOM   3698 O "O4'" . DG  E 2 11  ? 17.110 -43.089 156.980 1.00 32.55 ? 211  DG  E "O4'" 1 
ATOM   3699 C "C3'" . DG  E 2 11  ? 17.001 -43.737 159.233 1.00 35.38 ? 211  DG  E "C3'" 1 
ATOM   3700 O "O3'" . DG  E 2 11  ? 16.026 -42.877 159.800 1.00 40.59 ? 211  DG  E "O3'" 1 
ATOM   3701 C "C2'" . DG  E 2 11  ? 16.326 -44.782 158.351 1.00 33.81 ? 211  DG  E "C2'" 1 
ATOM   3702 C "C1'" . DG  E 2 11  ? 15.957 -43.928 157.138 1.00 31.17 ? 211  DG  E "C1'" 1 
ATOM   3703 N N9    . DG  E 2 11  ? 15.766 -44.758 155.912 1.00 27.56 ? 211  DG  E N9    1 
ATOM   3704 C C8    . DG  E 2 11  ? 16.492 -45.837 155.507 1.00 26.25 ? 211  DG  E C8    1 
ATOM   3705 N N7    . DG  E 2 11  ? 16.105 -46.338 154.375 1.00 25.39 ? 211  DG  E N7    1 
ATOM   3706 C C5    . DG  E 2 11  ? 15.046 -45.543 153.990 1.00 23.63 ? 211  DG  E C5    1 
ATOM   3707 C C6    . DG  E 2 11  ? 14.243 -45.618 152.832 1.00 22.94 ? 211  DG  E C6    1 
ATOM   3708 O O6    . DG  E 2 11  ? 14.326 -46.425 151.908 1.00 22.32 ? 211  DG  E O6    1 
ATOM   3709 N N1    . DG  E 2 11  ? 13.278 -44.624 152.820 1.00 21.21 ? 211  DG  E N1    1 
ATOM   3710 C C2    . DG  E 2 11  ? 13.110 -43.675 153.804 1.00 22.13 ? 211  DG  E C2    1 
ATOM   3711 N N2    . DG  E 2 11  ? 12.124 -42.800 153.645 1.00 20.29 ? 211  DG  E N2    1 
ATOM   3712 N N3    . DG  E 2 11  ? 13.872 -43.604 154.895 1.00 23.58 ? 211  DG  E N3    1 
ATOM   3713 C C4    . DG  E 2 11  ? 14.820 -44.568 154.922 1.00 24.70 ? 211  DG  E C4    1 
ATOM   3714 P P     . DG  E 2 12  ? 15.424 -43.182 161.252 1.00 43.70 ? 212  DG  E P     1 
ATOM   3715 O OP1   . DG  E 2 12  ? 15.787 -42.071 162.163 1.00 43.59 ? 212  DG  E OP1   1 
ATOM   3716 O OP2   . DG  E 2 12  ? 15.744 -44.583 161.618 1.00 43.16 ? 212  DG  E OP2   1 
ATOM   3717 O "O5'" . DG  E 2 12  ? 13.869 -43.093 160.938 1.00 43.76 ? 212  DG  E "O5'" 1 
ATOM   3718 C "C5'" . DG  E 2 12  ? 13.344 -42.047 160.134 1.00 42.94 ? 212  DG  E "C5'" 1 
ATOM   3719 C "C4'" . DG  E 2 12  ? 12.190 -42.588 159.335 1.00 44.72 ? 212  DG  E "C4'" 1 
ATOM   3720 O "O4'" . DG  E 2 12  ? 12.638 -43.541 158.394 1.00 43.47 ? 212  DG  E "O4'" 1 
ATOM   3721 C "C3'" . DG  E 2 12  ? 11.282 -43.407 160.249 1.00 46.66 ? 212  DG  E "C3'" 1 
ATOM   3722 O "O3'" . DG  E 2 12  ? 10.170 -42.578 160.591 1.00 52.47 ? 212  DG  E "O3'" 1 
ATOM   3723 C "C2'" . DG  E 2 12  ? 10.902 -44.643 159.403 1.00 43.13 ? 212  DG  E "C2'" 1 
ATOM   3724 C "C1'" . DG  E 2 12  ? 11.490 -44.292 158.044 1.00 39.07 ? 212  DG  E "C1'" 1 
ATOM   3725 N N9    . DG  E 2 12  ? 11.953 -45.446 157.267 1.00 34.47 ? 212  DG  E N9    1 
ATOM   3726 C C8    . DG  E 2 12  ? 12.997 -46.289 157.529 1.00 33.19 ? 212  DG  E C8    1 
ATOM   3727 N N7    . DG  E 2 12  ? 13.201 -47.180 156.600 1.00 32.62 ? 212  DG  E N7    1 
ATOM   3728 C C5    . DG  E 2 12  ? 12.215 -46.905 155.653 1.00 31.74 ? 212  DG  E C5    1 
ATOM   3729 C C6    . DG  E 2 12  ? 11.930 -47.552 154.419 1.00 30.48 ? 212  DG  E C6    1 
ATOM   3730 O O6    . DG  E 2 12  ? 12.530 -48.489 153.898 1.00 30.20 ? 212  DG  E O6    1 
ATOM   3731 N N1    . DG  E 2 12  ? 10.839 -46.979 153.779 1.00 29.56 ? 212  DG  E N1    1 
ATOM   3732 C C2    . DG  E 2 12  ? 10.118 -45.915 154.266 1.00 28.89 ? 212  DG  E C2    1 
ATOM   3733 N N2    . DG  E 2 12  ? 9.103  -45.498 153.526 1.00 28.34 ? 212  DG  E N2    1 
ATOM   3734 N N3    . DG  E 2 12  ? 10.387 -45.302 155.421 1.00 30.24 ? 212  DG  E N3    1 
ATOM   3735 C C4    . DG  E 2 12  ? 11.446 -45.849 156.058 1.00 31.90 ? 212  DG  E C4    1 
ATOM   3736 P P     . DC  E 2 13  ? 9.055  -42.986 161.689 1.00 56.49 ? 213  DC  E P     1 
ATOM   3737 O OP1   . DC  E 2 13  ? 8.497  -41.713 162.218 1.00 54.75 ? 213  DC  E OP1   1 
ATOM   3738 O OP2   . DC  E 2 13  ? 9.621  -44.007 162.611 1.00 54.87 ? 213  DC  E OP2   1 
ATOM   3739 O "O5'" . DC  E 2 13  ? 7.948  -43.715 160.762 1.00 52.65 ? 213  DC  E "O5'" 1 
ATOM   3740 C "C5'" . DC  E 2 13  ? 7.230  -42.937 159.809 1.00 49.95 ? 213  DC  E "C5'" 1 
ATOM   3741 C "C4'" . DC  E 2 13  ? 6.391  -43.802 158.896 1.00 47.66 ? 213  DC  E "C4'" 1 
ATOM   3742 O "O4'" . DC  E 2 13  ? 7.201  -44.611 158.041 1.00 45.01 ? 213  DC  E "O4'" 1 
ATOM   3743 C "C3'" . DC  E 2 13  ? 5.549  -44.772 159.716 1.00 47.89 ? 213  DC  E "C3'" 1 
ATOM   3744 O "O3'" . DC  E 2 13  ? 4.245  -44.828 159.150 1.00 51.90 ? 213  DC  E "O3'" 1 
ATOM   3745 C "C2'" . DC  E 2 13  ? 6.271  -46.092 159.494 1.00 43.95 ? 213  DC  E "C2'" 1 
ATOM   3746 C "C1'" . DC  E 2 13  ? 6.651  -45.919 158.041 1.00 40.04 ? 213  DC  E "C1'" 1 
ATOM   3747 N N1    . DC  E 2 13  ? 7.668  -46.885 157.617 1.00 35.94 ? 213  DC  E N1    1 
ATOM   3748 C C2    . DC  E 2 13  ? 7.553  -47.416 156.350 1.00 34.44 ? 213  DC  E C2    1 
ATOM   3749 O O2    . DC  E 2 13  ? 6.635  -47.068 155.617 1.00 33.84 ? 213  DC  E O2    1 
ATOM   3750 N N3    . DC  E 2 13  ? 8.478  -48.320 155.939 1.00 33.18 ? 213  DC  E N3    1 
ATOM   3751 C C4    . DC  E 2 13  ? 9.477  -48.683 156.751 1.00 33.15 ? 213  DC  E C4    1 
ATOM   3752 N N4    . DC  E 2 13  ? 10.371 -49.573 156.335 1.00 33.83 ? 213  DC  E N4    1 
ATOM   3753 C C5    . DC  E 2 13  ? 9.609  -48.140 158.064 1.00 33.18 ? 213  DC  E C5    1 
ATOM   3754 C C6    . DC  E 2 13  ? 8.680  -47.245 158.450 1.00 34.61 ? 213  DC  E C6    1 
ATOM   3755 P P     . DA  E 2 14  ? 2.987  -45.150 160.088 1.00 54.49 ? 214  DA  E P     1 
ATOM   3756 O OP1   . DA  E 2 14  ? 2.903  -44.099 161.132 1.00 53.72 ? 214  DA  E OP1   1 
ATOM   3757 O OP2   . DA  E 2 14  ? 3.057  -46.583 160.477 1.00 53.89 ? 214  DA  E OP2   1 
ATOM   3758 O "O5'" . DA  E 2 14  ? 1.774  -44.940 159.049 1.00 53.21 ? 214  DA  E "O5'" 1 
ATOM   3759 C "C5'" . DA  E 2 14  ? 0.927  -46.043 158.725 1.00 51.81 ? 214  DA  E "C5'" 1 
ATOM   3760 C "C4'" . DA  E 2 14  ? 1.209  -46.586 157.338 1.00 50.34 ? 214  DA  E "C4'" 1 
ATOM   3761 O "O4'" . DA  E 2 14  ? 2.558  -47.071 157.228 1.00 48.95 ? 214  DA  E "O4'" 1 
ATOM   3762 C "C3'" . DA  E 2 14  ? 0.314  -47.794 157.073 1.00 50.89 ? 214  DA  E "C3'" 1 
ATOM   3763 O "O3'" . DA  E 2 14  ? 0.028  -47.887 155.670 1.00 52.24 ? 214  DA  E "O3'" 1 
ATOM   3764 C "C2'" . DA  E 2 14  ? 1.250  -48.928 157.525 1.00 49.47 ? 214  DA  E "C2'" 1 
ATOM   3765 C "C1'" . DA  E 2 14  ? 2.519  -48.458 156.863 1.00 46.45 ? 214  DA  E "C1'" 1 
ATOM   3766 N N9    . DA  E 2 14  ? 3.722  -49.172 157.323 1.00 43.53 ? 214  DA  E N9    1 
ATOM   3767 C C8    . DA  E 2 14  ? 4.317  -49.187 158.558 1.00 42.61 ? 214  DA  E C8    1 
ATOM   3768 N N7    . DA  E 2 14  ? 5.424  -49.883 158.605 1.00 41.38 ? 214  DA  E N7    1 
ATOM   3769 C C5    . DA  E 2 14  ? 5.569  -50.364 157.307 1.00 41.06 ? 214  DA  E C5    1 
ATOM   3770 C C6    . DA  E 2 14  ? 6.548  -51.164 156.693 1.00 40.42 ? 214  DA  E C6    1 
ATOM   3771 N N6    . DA  E 2 14  ? 7.618  -51.623 157.342 1.00 39.26 ? 214  DA  E N6    1 
ATOM   3772 N N1    . DA  E 2 14  ? 6.387  -51.448 155.388 1.00 40.82 ? 214  DA  E N1    1 
ATOM   3773 C C2    . DA  E 2 14  ? 5.322  -50.960 154.755 1.00 42.03 ? 214  DA  E C2    1 
ATOM   3774 N N3    . DA  E 2 14  ? 4.338  -50.200 155.213 1.00 42.25 ? 214  DA  E N3    1 
ATOM   3775 C C4    . DA  E 2 14  ? 4.533  -49.937 156.523 1.00 42.26 ? 214  DA  E C4    1 
ATOM   3776 O "O5'" . DT  F 3 1   ? 9.278  -59.167 150.355 1.00 62.90 ? 215  DT  F "O5'" 1 
ATOM   3777 C "C5'" . DT  F 3 1   ? 9.124  -58.139 149.372 1.00 62.85 ? 215  DT  F "C5'" 1 
ATOM   3778 C "C4'" . DT  F 3 1   ? 7.645  -57.816 149.109 1.00 61.73 ? 215  DT  F "C4'" 1 
ATOM   3779 O "O4'" . DT  F 3 1   ? 6.989  -57.375 150.321 1.00 61.43 ? 215  DT  F "O4'" 1 
ATOM   3780 C "C3'" . DT  F 3 1   ? 7.517  -56.644 148.141 1.00 61.32 ? 215  DT  F "C3'" 1 
ATOM   3781 O "O3'" . DT  F 3 1   ? 6.179  -56.624 147.603 1.00 61.79 ? 215  DT  F "O3'" 1 
ATOM   3782 C "C2'" . DT  F 3 1   ? 7.759  -55.519 149.154 1.00 60.18 ? 215  DT  F "C2'" 1 
ATOM   3783 C "C1'" . DT  F 3 1   ? 6.817  -55.938 150.298 1.00 59.72 ? 215  DT  F "C1'" 1 
ATOM   3784 N N1    . DT  F 3 1   ? 7.167  -55.288 151.612 1.00 57.78 ? 215  DT  F N1    1 
ATOM   3785 C C2    . DT  F 3 1   ? 6.353  -54.249 152.105 1.00 56.39 ? 215  DT  F C2    1 
ATOM   3786 O O2    . DT  F 3 1   ? 5.321  -53.871 151.540 1.00 56.05 ? 215  DT  F O2    1 
ATOM   3787 N N3    . DT  F 3 1   ? 6.772  -53.669 153.308 1.00 55.31 ? 215  DT  F N3    1 
ATOM   3788 C C4    . DT  F 3 1   ? 7.895  -54.029 154.037 1.00 54.89 ? 215  DT  F C4    1 
ATOM   3789 O O4    . DT  F 3 1   ? 8.187  -53.441 155.077 1.00 54.34 ? 215  DT  F O4    1 
ATOM   3790 C C5    . DT  F 3 1   ? 8.657  -55.108 153.452 1.00 55.16 ? 215  DT  F C5    1 
ATOM   3791 C C7    . DT  F 3 1   ? 9.916  -55.599 154.153 1.00 54.77 ? 215  DT  F C7    1 
ATOM   3792 C C6    . DT  F 3 1   ? 8.287  -55.688 152.298 1.00 55.93 ? 215  DT  F C6    1 
ATOM   3793 P P     . DG  F 3 2   ? 5.783  -56.222 146.063 1.00 63.30 ? 216  DG  F P     1 
ATOM   3794 O OP1   . DG  F 3 2   ? 4.555  -56.974 145.696 1.00 61.64 ? 216  DG  F OP1   1 
ATOM   3795 O OP2   . DG  F 3 2   ? 6.996  -56.323 145.205 1.00 61.88 ? 216  DG  F OP2   1 
ATOM   3796 O "O5'" . DG  F 3 2   ? 5.381  -54.651 146.192 1.00 59.49 ? 216  DG  F "O5'" 1 
ATOM   3797 C "C5'" . DG  F 3 2   ? 5.037  -54.088 147.470 1.00 54.23 ? 216  DG  F "C5'" 1 
ATOM   3798 C "C4'" . DG  F 3 2   ? 5.889  -52.874 147.829 1.00 49.27 ? 216  DG  F "C4'" 1 
ATOM   3799 O "O4'" . DG  F 3 2   ? 6.426  -52.951 149.137 1.00 45.50 ? 216  DG  F "O4'" 1 
ATOM   3800 C "C3'" . DG  F 3 2   ? 7.144  -52.786 146.982 1.00 48.74 ? 216  DG  F "C3'" 1 
ATOM   3801 O "O3'" . DG  F 3 2   ? 6.887  -52.228 145.684 1.00 51.34 ? 216  DG  F "O3'" 1 
ATOM   3802 C "C2'" . DG  F 3 2   ? 8.042  -51.877 147.820 1.00 45.18 ? 216  DG  F "C2'" 1 
ATOM   3803 C "C1'" . DG  F 3 2   ? 7.331  -51.856 149.181 1.00 41.17 ? 216  DG  F "C1'" 1 
ATOM   3804 N N9    . DG  F 3 2   ? 8.310  -51.969 150.275 1.00 36.95 ? 216  DG  F N9    1 
ATOM   3805 C C8    . DG  F 3 2   ? 9.388  -52.801 150.373 1.00 35.36 ? 216  DG  F C8    1 
ATOM   3806 N N7    . DG  F 3 2   ? 10.088 -52.625 151.455 1.00 35.01 ? 216  DG  F N7    1 
ATOM   3807 C C5    . DG  F 3 2   ? 9.427  -51.604 152.125 1.00 33.92 ? 216  DG  F C5    1 
ATOM   3808 C C6    . DG  F 3 2   ? 9.733  -50.980 153.359 1.00 33.95 ? 216  DG  F C6    1 
ATOM   3809 O O6    . DG  F 3 2   ? 10.674 -51.203 154.112 1.00 34.26 ? 216  DG  F O6    1 
ATOM   3810 N N1    . DG  F 3 2   ? 8.821  -49.996 153.679 1.00 32.93 ? 216  DG  F N1    1 
ATOM   3811 C C2    . DG  F 3 2   ? 7.747  -49.650 152.904 1.00 33.05 ? 216  DG  F C2    1 
ATOM   3812 N N2    . DG  F 3 2   ? 6.969  -48.684 153.376 1.00 33.22 ? 216  DG  F N2    1 
ATOM   3813 N N3    . DG  F 3 2   ? 7.457  -50.231 151.740 1.00 33.62 ? 216  DG  F N3    1 
ATOM   3814 C C4    . DG  F 3 2   ? 8.337  -51.197 151.413 1.00 34.20 ? 216  DG  F C4    1 
ATOM   3815 P P     . DC  F 3 3   ? 5.769  -51.091 145.348 1.00 54.87 ? 217  DC  F P     1 
ATOM   3816 O OP1   . DC  F 3 3   ? 4.432  -51.557 145.800 1.00 53.82 ? 217  DC  F OP1   1 
ATOM   3817 O OP2   . DC  F 3 3   ? 5.953  -50.682 143.934 1.00 55.18 ? 217  DC  F OP2   1 
ATOM   3818 O "O5'" . DC  F 3 3   ? 6.232  -49.866 146.282 1.00 51.08 ? 217  DC  F "O5'" 1 
ATOM   3819 C "C5'" . DC  F 3 3   ? 5.262  -49.029 146.898 1.00 48.80 ? 217  DC  F "C5'" 1 
ATOM   3820 C "C4'" . DC  F 3 3   ? 5.911  -47.827 147.560 1.00 47.57 ? 217  DC  F "C4'" 1 
ATOM   3821 O "O4'" . DC  F 3 3   ? 6.791  -48.207 148.631 1.00 45.58 ? 217  DC  F "O4'" 1 
ATOM   3822 C "C3'" . DC  F 3 3   ? 6.769  -47.072 146.545 1.00 47.13 ? 217  DC  F "C3'" 1 
ATOM   3823 O "O3'" . DC  F 3 3   ? 6.581  -45.671 146.728 1.00 48.89 ? 217  DC  F "O3'" 1 
ATOM   3824 C "C2'" . DC  F 3 3   ? 8.173  -47.481 146.975 1.00 44.58 ? 217  DC  F "C2'" 1 
ATOM   3825 C "C1'" . DC  F 3 3   ? 7.980  -47.445 148.482 1.00 42.01 ? 217  DC  F "C1'" 1 
ATOM   3826 N N1    . DC  F 3 3   ? 9.126  -48.028 149.222 1.00 38.42 ? 217  DC  F N1    1 
ATOM   3827 C C2    . DC  F 3 3   ? 9.345  -47.577 150.514 1.00 36.87 ? 217  DC  F C2    1 
ATOM   3828 O O2    . DC  F 3 3   ? 8.608  -46.729 151.011 1.00 35.53 ? 217  DC  F O2    1 
ATOM   3829 N N3    . DC  F 3 3   ? 10.403 -48.085 151.204 1.00 35.96 ? 217  DC  F N3    1 
ATOM   3830 C C4    . DC  F 3 3   ? 11.213 -48.996 150.647 1.00 35.74 ? 217  DC  F C4    1 
ATOM   3831 N N4    . DC  F 3 3   ? 12.244 -49.464 151.343 1.00 35.33 ? 217  DC  F N4    1 
ATOM   3832 C C5    . DC  F 3 3   ? 10.998 -49.469 149.316 1.00 35.86 ? 217  DC  F C5    1 
ATOM   3833 C C6    . DC  F 3 3   ? 9.945  -48.957 148.648 1.00 36.88 ? 217  DC  F C6    1 
ATOM   3834 P P     . DC  F 3 4   ? 6.400  -44.685 145.466 1.00 51.14 ? 218  DC  F P     1 
ATOM   3835 O OP1   . DC  F 3 4   ? 4.949  -44.557 145.171 1.00 50.43 ? 218  DC  F OP1   1 
ATOM   3836 O OP2   . DC  F 3 4   ? 7.348  -45.112 144.405 1.00 50.21 ? 218  DC  F OP2   1 
ATOM   3837 O "O5'" . DC  F 3 4   ? 6.915  -43.275 146.073 1.00 48.31 ? 218  DC  F "O5'" 1 
ATOM   3838 C "C5'" . DC  F 3 4   ? 6.142  -42.588 147.063 1.00 43.96 ? 218  DC  F "C5'" 1 
ATOM   3839 C "C4'" . DC  F 3 4   ? 6.927  -42.353 148.350 1.00 40.43 ? 218  DC  F "C4'" 1 
ATOM   3840 O "O4'" . DC  F 3 4   ? 7.581  -43.540 148.774 1.00 40.32 ? 218  DC  F "O4'" 1 
ATOM   3841 C "C3'" . DC  F 3 4   ? 8.078  -41.408 148.127 1.00 38.91 ? 218  DC  F "C3'" 1 
ATOM   3842 O "O3'" . DC  F 3 4   ? 7.598  -40.081 148.191 1.00 37.07 ? 218  DC  F "O3'" 1 
ATOM   3843 C "C2'" . DC  F 3 4   ? 8.929  -41.685 149.356 1.00 38.80 ? 218  DC  F "C2'" 1 
ATOM   3844 C "C1'" . DC  F 3 4   ? 8.621  -43.133 149.659 1.00 38.15 ? 218  DC  F "C1'" 1 
ATOM   3845 N N1    . DC  F 3 4   ? 9.828  -43.971 149.532 1.00 35.86 ? 218  DC  F N1    1 
ATOM   3846 C C2    . DC  F 3 4   ? 10.640 -44.037 150.639 1.00 35.49 ? 218  DC  F C2    1 
ATOM   3847 O O2    . DC  F 3 4   ? 10.375 -43.368 151.636 1.00 34.38 ? 218  DC  F O2    1 
ATOM   3848 N N3    . DC  F 3 4   ? 11.736 -44.843 150.586 1.00 35.30 ? 218  DC  F N3    1 
ATOM   3849 C C4    . DC  F 3 4   ? 12.025 -45.553 149.489 1.00 34.29 ? 218  DC  F C4    1 
ATOM   3850 N N4    . DC  F 3 4   ? 13.096 -46.336 149.495 1.00 32.81 ? 218  DC  F N4    1 
ATOM   3851 C C5    . DC  F 3 4   ? 11.191 -45.484 148.327 1.00 34.98 ? 218  DC  F C5    1 
ATOM   3852 C C6    . DC  F 3 4   ? 10.107 -44.680 148.399 1.00 35.51 ? 218  DC  F C6    1 
ATOM   3853 P P     . DC  F 3 5   ? 8.513  -38.881 147.673 1.00 37.34 ? 219  DC  F P     1 
ATOM   3854 O OP1   . DC  F 3 5   ? 7.725  -37.636 147.802 1.00 39.50 ? 219  DC  F OP1   1 
ATOM   3855 O OP2   . DC  F 3 5   ? 9.068  -39.264 146.355 1.00 37.49 ? 219  DC  F OP2   1 
ATOM   3856 O "O5'" . DC  F 3 5   ? 9.735  -38.792 148.724 1.00 33.89 ? 219  DC  F "O5'" 1 
ATOM   3857 C "C5'" . DC  F 3 5   ? 9.554  -38.257 150.033 1.00 29.06 ? 219  DC  F "C5'" 1 
ATOM   3858 C "C4'" . DC  F 3 5   ? 10.790 -38.495 150.889 1.00 28.64 ? 219  DC  F "C4'" 1 
ATOM   3859 O "O4'" . DC  F 3 5   ? 11.166 -39.868 150.897 1.00 26.51 ? 219  DC  F "O4'" 1 
ATOM   3860 C "C3'" . DC  F 3 5   ? 11.975 -37.802 150.264 1.00 28.66 ? 219  DC  F "C3'" 1 
ATOM   3861 O "O3'" . DC  F 3 5   ? 11.990 -36.466 150.765 1.00 30.57 ? 219  DC  F "O3'" 1 
ATOM   3862 C "C2'" . DC  F 3 5   ? 13.173 -38.607 150.781 1.00 25.00 ? 219  DC  F "C2'" 1 
ATOM   3863 C "C1'" . DC  F 3 5   ? 12.572 -39.968 151.102 1.00 23.46 ? 219  DC  F "C1'" 1 
ATOM   3864 N N1    . DC  F 3 5   ? 13.092 -41.047 150.241 1.00 21.93 ? 219  DC  F N1    1 
ATOM   3865 C C2    . DC  F 3 5   ? 14.102 -41.845 150.734 1.00 20.98 ? 219  DC  F C2    1 
ATOM   3866 O O2    . DC  F 3 5   ? 14.594 -41.632 151.841 1.00 21.61 ? 219  DC  F O2    1 
ATOM   3867 N N3    . DC  F 3 5   ? 14.543 -42.856 149.951 1.00 21.37 ? 219  DC  F N3    1 
ATOM   3868 C C4    . DC  F 3 5   ? 14.031 -43.081 148.741 1.00 21.34 ? 219  DC  F C4    1 
ATOM   3869 N N4    . DC  F 3 5   ? 14.499 -44.088 148.007 1.00 22.36 ? 219  DC  F N4    1 
ATOM   3870 C C5    . DC  F 3 5   ? 12.995 -42.263 148.220 1.00 20.56 ? 219  DC  F C5    1 
ATOM   3871 C C6    . DC  F 3 5   ? 12.561 -41.261 149.008 1.00 21.60 ? 219  DC  F C6    1 
ATOM   3872 P P     . DT  F 3 6   ? 11.944 -35.197 149.786 1.00 31.89 ? 220  DT  F P     1 
ATOM   3873 O OP1   . DT  F 3 6   ? 11.782 -33.988 150.630 1.00 33.55 ? 220  DT  F OP1   1 
ATOM   3874 O OP2   . DT  F 3 6   ? 11.007 -35.474 148.672 1.00 28.76 ? 220  DT  F OP2   1 
ATOM   3875 O "O5'" . DT  F 3 6   ? 13.445 -35.218 149.226 1.00 29.45 ? 220  DT  F "O5'" 1 
ATOM   3876 C "C5'" . DT  F 3 6   ? 14.533 -35.114 150.147 1.00 27.60 ? 220  DT  F "C5'" 1 
ATOM   3877 C "C4'" . DT  F 3 6   ? 15.859 -35.265 149.434 1.00 26.81 ? 220  DT  F "C4'" 1 
ATOM   3878 O "O4'" . DT  F 3 6   ? 16.032 -36.600 148.965 1.00 26.19 ? 220  DT  F "O4'" 1 
ATOM   3879 C "C3'" . DT  F 3 6   ? 15.844 -34.371 148.209 1.00 26.13 ? 220  DT  F "C3'" 1 
ATOM   3880 O "O3'" . DT  F 3 6   ? 16.943 -33.470 148.279 1.00 26.90 ? 220  DT  F "O3'" 1 
ATOM   3881 C "C2'" . DT  F 3 6   ? 15.920 -35.330 147.013 1.00 25.23 ? 220  DT  F "C2'" 1 
ATOM   3882 C "C1'" . DT  F 3 6   ? 16.494 -36.600 147.616 1.00 24.42 ? 220  DT  F "C1'" 1 
ATOM   3883 N N1    . DT  F 3 6   ? 15.950 -37.820 146.979 1.00 23.28 ? 220  DT  F N1    1 
ATOM   3884 C C2    . DT  F 3 6   ? 16.844 -38.821 146.610 1.00 22.48 ? 220  DT  F C2    1 
ATOM   3885 O O2    . DT  F 3 6   ? 18.065 -38.720 146.721 1.00 23.40 ? 220  DT  F O2    1 
ATOM   3886 N N3    . DT  F 3 6   ? 16.286 -39.964 146.080 1.00 22.45 ? 220  DT  F N3    1 
ATOM   3887 C C4    . DT  F 3 6   ? 14.945 -40.200 145.881 1.00 21.36 ? 220  DT  F C4    1 
ATOM   3888 O O4    . DT  F 3 6   ? 14.584 -41.288 145.434 1.00 21.70 ? 220  DT  F O4    1 
ATOM   3889 C C5    . DT  F 3 6   ? 14.089 -39.100 146.282 1.00 20.66 ? 220  DT  F C5    1 
ATOM   3890 C C7    . DT  F 3 6   ? 12.585 -39.199 146.097 1.00 20.37 ? 220  DT  F C7    1 
ATOM   3891 C C6    . DT  F 3 6   ? 14.601 -37.976 146.806 1.00 21.14 ? 220  DT  F C6    1 
ATOM   3892 P P     . DT  F 3 7   ? 16.974 -32.174 147.341 1.00 26.36 ? 221  DT  F P     1 
ATOM   3893 O OP1   . DT  F 3 7   ? 17.720 -31.127 148.070 1.00 29.66 ? 221  DT  F OP1   1 
ATOM   3894 O OP2   . DT  F 3 7   ? 15.602 -31.917 146.836 1.00 25.52 ? 221  DT  F OP2   1 
ATOM   3895 O "O5'" . DT  F 3 7   ? 17.890 -32.652 146.120 1.00 24.44 ? 221  DT  F "O5'" 1 
ATOM   3896 C "C5'" . DT  F 3 7   ? 19.298 -32.827 146.295 1.00 19.16 ? 221  DT  F "C5'" 1 
ATOM   3897 C "C4'" . DT  F 3 7   ? 19.858 -33.650 145.159 1.00 19.94 ? 221  DT  F "C4'" 1 
ATOM   3898 O "O4'" . DT  F 3 7   ? 19.203 -34.895 145.082 1.00 18.99 ? 221  DT  F "O4'" 1 
ATOM   3899 C "C3'" . DT  F 3 7   ? 19.509 -33.005 143.823 1.00 20.94 ? 221  DT  F "C3'" 1 
ATOM   3900 O "O3'" . DT  F 3 7   ? 20.539 -32.058 143.516 1.00 22.98 ? 221  DT  F "O3'" 1 
ATOM   3901 C "C2'" . DT  F 3 7   ? 19.486 -34.198 142.847 1.00 20.40 ? 221  DT  F "C2'" 1 
ATOM   3902 C "C1'" . DT  F 3 7   ? 19.452 -35.410 143.783 1.00 19.92 ? 221  DT  F "C1'" 1 
ATOM   3903 N N1    . DT  F 3 7   ? 18.388 -36.386 143.449 1.00 19.26 ? 221  DT  F N1    1 
ATOM   3904 C C2    . DT  F 3 7   ? 18.786 -37.656 143.062 1.00 19.74 ? 221  DT  F C2    1 
ATOM   3905 O O2    . DT  F 3 7   ? 19.965 -37.979 142.920 1.00 19.58 ? 221  DT  F O2    1 
ATOM   3906 N N3    . DT  F 3 7   ? 17.767 -38.557 142.820 1.00 18.79 ? 221  DT  F N3    1 
ATOM   3907 C C4    . DT  F 3 7   ? 16.416 -38.314 142.922 1.00 17.20 ? 221  DT  F C4    1 
ATOM   3908 O O4    . DT  F 3 7   ? 15.612 -39.222 142.715 1.00 17.11 ? 221  DT  F O4    1 
ATOM   3909 C C5    . DT  F 3 7   ? 16.099 -36.964 143.319 1.00 17.44 ? 221  DT  F C5    1 
ATOM   3910 C C7    . DT  F 3 7   ? 14.640 -36.541 143.459 1.00 17.00 ? 221  DT  F C7    1 
ATOM   3911 C C6    . DT  F 3 7   ? 17.068 -36.065 143.565 1.00 17.82 ? 221  DT  F C6    1 
ATOM   3912 P P     . DT  F 3 8   ? 20.406 -30.907 142.414 1.00 22.77 ? 222  DT  F P     1 
ATOM   3913 O OP1   . DT  F 3 8   ? 21.575 -30.022 142.584 1.00 22.34 ? 222  DT  F OP1   1 
ATOM   3914 O OP2   . DT  F 3 8   ? 19.047 -30.355 142.456 1.00 23.78 ? 222  DT  F OP2   1 
ATOM   3915 O "O5'" . DT  F 3 8   ? 20.543 -31.704 141.030 1.00 21.31 ? 222  DT  F "O5'" 1 
ATOM   3916 C "C5'" . DT  F 3 8   ? 21.799 -32.245 140.635 1.00 18.86 ? 222  DT  F "C5'" 1 
ATOM   3917 C "C4'" . DT  F 3 8   ? 21.626 -33.207 139.479 1.00 18.77 ? 222  DT  F "C4'" 1 
ATOM   3918 O "O4'" . DT  F 3 8   ? 20.754 -34.262 139.831 1.00 18.65 ? 222  DT  F "O4'" 1 
ATOM   3919 C "C3'" . DT  F 3 8   ? 20.941 -32.534 138.311 1.00 18.24 ? 222  DT  F "C3'" 1 
ATOM   3920 O "O3'" . DT  F 3 8   ? 21.961 -31.909 137.529 1.00 17.65 ? 222  DT  F "O3'" 1 
ATOM   3921 C "C2'" . DT  F 3 8   ? 20.251 -33.716 137.575 1.00 16.04 ? 222  DT  F "C2'" 1 
ATOM   3922 C "C1'" . DT  F 3 8   ? 20.290 -34.842 138.608 1.00 17.14 ? 222  DT  F "C1'" 1 
ATOM   3923 N N1    . DT  F 3 8   ? 18.987 -35.464 138.911 1.00 17.56 ? 222  DT  F N1    1 
ATOM   3924 C C2    . DT  F 3 8   ? 18.851 -36.819 138.658 1.00 17.52 ? 222  DT  F C2    1 
ATOM   3925 O O2    . DT  F 3 8   ? 19.739 -37.499 138.142 1.00 18.39 ? 222  DT  F O2    1 
ATOM   3926 N N3    . DT  F 3 8   ? 17.650 -37.377 139.029 1.00 16.81 ? 222  DT  F N3    1 
ATOM   3927 C C4    . DT  F 3 8   ? 16.593 -36.722 139.620 1.00 16.64 ? 222  DT  F C4    1 
ATOM   3928 O O4    . DT  F 3 8   ? 15.582 -37.353 139.928 1.00 18.20 ? 222  DT  F O4    1 
ATOM   3929 C C5    . DT  F 3 8   ? 16.819 -35.313 139.843 1.00 15.93 ? 222  DT  F C5    1 
ATOM   3930 C C7    . DT  F 3 8   ? 15.749 -34.461 140.509 1.00 15.43 ? 222  DT  F C7    1 
ATOM   3931 C C6    . DT  F 3 8   ? 17.976 -34.741 139.488 1.00 16.01 ? 222  DT  F C6    1 
ATOM   3932 P P     . DT  F 3 9   ? 21.692 -30.555 136.695 1.00 22.07 ? 223  DT  F P     1 
ATOM   3933 O OP1   . DT  F 3 9   ? 23.012 -29.993 136.319 1.00 22.54 ? 223  DT  F OP1   1 
ATOM   3934 O OP2   . DT  F 3 9   ? 20.711 -29.717 137.421 1.00 20.93 ? 223  DT  F OP2   1 
ATOM   3935 O "O5'" . DT  F 3 9   ? 20.967 -31.097 135.363 1.00 21.66 ? 223  DT  F "O5'" 1 
ATOM   3936 C "C5'" . DT  F 3 9   ? 21.705 -31.802 134.354 1.00 19.98 ? 223  DT  F "C5'" 1 
ATOM   3937 C "C4'" . DT  F 3 9   ? 20.789 -32.564 133.420 1.00 17.59 ? 223  DT  F "C4'" 1 
ATOM   3938 O "O4'" . DT  F 3 9   ? 20.099 -33.521 134.170 1.00 16.79 ? 223  DT  F "O4'" 1 
ATOM   3939 C "C3'" . DT  F 3 9   ? 19.665 -31.707 132.904 1.00 17.82 ? 223  DT  F "C3'" 1 
ATOM   3940 O "O3'" . DT  F 3 9   ? 20.138 -30.934 131.791 1.00 21.34 ? 223  DT  F "O3'" 1 
ATOM   3941 C "C2'" . DT  F 3 9   ? 18.651 -32.780 132.491 1.00 17.48 ? 223  DT  F "C2'" 1 
ATOM   3942 C "C1'" . DT  F 3 9   ? 19.003 -33.969 133.398 1.00 16.47 ? 223  DT  F "C1'" 1 
ATOM   3943 N N1    . DT  F 3 9   ? 17.953 -34.383 134.353 1.00 17.14 ? 223  DT  F N1    1 
ATOM   3944 C C2    . DT  F 3 9   ? 17.686 -35.742 134.468 1.00 18.09 ? 223  DT  F C2    1 
ATOM   3945 O O2    . DT  F 3 9   ? 18.254 -36.605 133.796 1.00 19.57 ? 223  DT  F O2    1 
ATOM   3946 N N3    . DT  F 3 9   ? 16.720 -36.089 135.397 1.00 18.14 ? 223  DT  F N3    1 
ATOM   3947 C C4    . DT  F 3 9   ? 16.007 -35.221 136.206 1.00 17.81 ? 223  DT  F C4    1 
ATOM   3948 O O4    . DT  F 3 9   ? 15.152 -35.653 136.977 1.00 18.05 ? 223  DT  F O4    1 
ATOM   3949 C C5    . DT  F 3 9   ? 16.352 -33.831 136.017 1.00 17.04 ? 223  DT  F C5    1 
ATOM   3950 C C7    . DT  F 3 9   ? 15.654 -32.776 136.845 1.00 16.16 ? 223  DT  F C7    1 
ATOM   3951 C C6    . DT  F 3 9   ? 17.286 -33.462 135.122 1.00 17.04 ? 223  DT  F C6    1 
ATOM   3952 P P     . DA  F 3 10  ? 19.277 -29.714 131.176 1.00 23.13 ? 224  DA  F P     1 
ATOM   3953 O OP1   . DA  F 3 10  ? 20.201 -28.729 130.579 1.00 23.31 ? 224  DA  F OP1   1 
ATOM   3954 O OP2   . DA  F 3 10  ? 18.308 -29.275 132.198 1.00 23.48 ? 224  DA  F OP2   1 
ATOM   3955 O "O5'" . DA  F 3 10  ? 18.470 -30.427 129.980 1.00 22.00 ? 224  DA  F "O5'" 1 
ATOM   3956 C "C5'" . DA  F 3 10  ? 19.126 -30.805 128.766 1.00 20.74 ? 224  DA  F "C5'" 1 
ATOM   3957 C "C4'" . DA  F 3 10  ? 18.372 -31.926 128.089 1.00 20.93 ? 224  DA  F "C4'" 1 
ATOM   3958 O "O4'" . DA  F 3 10  ? 18.143 -32.941 129.055 1.00 23.46 ? 224  DA  F "O4'" 1 
ATOM   3959 C "C3'" . DA  F 3 10  ? 16.989 -31.487 127.688 1.00 22.18 ? 224  DA  F "C3'" 1 
ATOM   3960 O "O3'" . DA  F 3 10  ? 17.025 -30.975 126.364 1.00 25.41 ? 224  DA  F "O3'" 1 
ATOM   3961 C "C2'" . DA  F 3 10  ? 16.206 -32.794 127.729 1.00 21.96 ? 224  DA  F "C2'" 1 
ATOM   3962 C "C1'" . DA  F 3 10  ? 16.845 -33.516 128.905 1.00 21.65 ? 224  DA  F "C1'" 1 
ATOM   3963 N N9    . DA  F 3 10  ? 16.084 -33.368 130.165 1.00 21.14 ? 224  DA  F N9    1 
ATOM   3964 C C8    . DA  F 3 10  ? 15.684 -32.220 130.803 1.00 20.26 ? 224  DA  F C8    1 
ATOM   3965 N N7    . DA  F 3 10  ? 15.032 -32.434 131.906 1.00 19.91 ? 224  DA  F N7    1 
ATOM   3966 C C5    . DA  F 3 10  ? 14.992 -33.820 132.008 1.00 20.48 ? 224  DA  F C5    1 
ATOM   3967 C C6    . DA  F 3 10  ? 14.428 -34.677 132.952 1.00 20.17 ? 224  DA  F C6    1 
ATOM   3968 N N6    . DA  F 3 10  ? 13.767 -34.227 134.013 1.00 21.11 ? 224  DA  F N6    1 
ATOM   3969 N N1    . DA  F 3 10  ? 14.558 -35.998 132.755 1.00 19.82 ? 224  DA  F N1    1 
ATOM   3970 C C2    . DA  F 3 10  ? 15.208 -36.434 131.686 1.00 20.41 ? 224  DA  F C2    1 
ATOM   3971 N N3    . DA  F 3 10  ? 15.782 -35.727 130.725 1.00 21.45 ? 224  DA  F N3    1 
ATOM   3972 C C4    . DA  F 3 10  ? 15.631 -34.401 130.954 1.00 20.74 ? 224  DA  F C4    1 
ATOM   3973 P P     . DT  F 3 11  ? 16.072 -29.741 125.930 1.00 26.89 ? 225  DT  F P     1 
ATOM   3974 O OP1   . DT  F 3 11  ? 16.395 -29.399 124.532 1.00 28.32 ? 225  DT  F OP1   1 
ATOM   3975 O OP2   . DT  F 3 11  ? 16.139 -28.700 126.981 1.00 27.68 ? 225  DT  F OP2   1 
ATOM   3976 O "O5'" . DT  F 3 11  ? 14.602 -30.364 125.950 1.00 25.30 ? 225  DT  F "O5'" 1 
ATOM   3977 C "C5'" . DT  F 3 11  ? 14.206 -31.310 124.961 1.00 23.97 ? 225  DT  F "C5'" 1 
ATOM   3978 C "C4'" . DT  F 3 11  ? 12.955 -32.031 125.403 1.00 22.66 ? 225  DT  F "C4'" 1 
ATOM   3979 O "O4'" . DT  F 3 11  ? 13.112 -32.455 126.746 1.00 22.53 ? 225  DT  F "O4'" 1 
ATOM   3980 C "C3'" . DT  F 3 11  ? 11.807 -31.063 125.490 1.00 22.06 ? 225  DT  F "C3'" 1 
ATOM   3981 O "O3'" . DT  F 3 11  ? 11.227 -30.959 124.196 1.00 23.32 ? 225  DT  F "O3'" 1 
ATOM   3982 C "C2'" . DT  F 3 11  ? 10.875 -31.742 126.493 1.00 20.29 ? 225  DT  F "C2'" 1 
ATOM   3983 C "C1'" . DT  F 3 11  ? 11.814 -32.659 127.274 1.00 20.29 ? 225  DT  F "C1'" 1 
ATOM   3984 N N1    . DT  F 3 11  ? 11.837 -32.360 128.704 1.00 20.37 ? 225  DT  F N1    1 
ATOM   3985 C C2    . DT  F 3 11  ? 11.458 -33.364 129.574 1.00 20.80 ? 225  DT  F C2    1 
ATOM   3986 O O2    . DT  F 3 11  ? 11.180 -34.506 129.206 1.00 20.53 ? 225  DT  F O2    1 
ATOM   3987 N N3    . DT  F 3 11  ? 11.470 -33.026 130.914 1.00 20.85 ? 225  DT  F N3    1 
ATOM   3988 C C4    . DT  F 3 11  ? 11.830 -31.804 131.447 1.00 20.30 ? 225  DT  F C4    1 
ATOM   3989 O O4    . DT  F 3 11  ? 11.794 -31.629 132.661 1.00 21.16 ? 225  DT  F O4    1 
ATOM   3990 C C5    . DT  F 3 11  ? 12.224 -30.827 130.465 1.00 20.78 ? 225  DT  F C5    1 
ATOM   3991 C C7    . DT  F 3 11  ? 12.704 -29.447 130.908 1.00 21.00 ? 225  DT  F C7    1 
ATOM   3992 C C6    . DT  F 3 11  ? 12.211 -31.126 129.154 1.00 20.90 ? 225  DT  F C6    1 
ATOM   3993 P P     . DT  F 3 12  ? 10.476 -29.613 123.739 1.00 26.57 ? 226  DT  F P     1 
ATOM   3994 O OP1   . DT  F 3 12  ? 10.379 -29.622 122.264 1.00 26.31 ? 226  DT  F OP1   1 
ATOM   3995 O OP2   . DT  F 3 12  ? 11.095 -28.466 124.442 1.00 25.35 ? 226  DT  F OP2   1 
ATOM   3996 O "O5'" . DT  F 3 12  ? 9.006  -29.831 124.317 1.00 26.68 ? 226  DT  F "O5'" 1 
ATOM   3997 C "C5'" . DT  F 3 12  ? 8.228  -30.860 123.718 1.00 28.17 ? 226  DT  F "C5'" 1 
ATOM   3998 C "C4'" . DT  F 3 12  ? 6.808  -30.910 124.225 1.00 28.63 ? 226  DT  F "C4'" 1 
ATOM   3999 O "O4'" . DT  F 3 12  ? 6.743  -31.029 125.642 1.00 27.66 ? 226  DT  F "O4'" 1 
ATOM   4000 C "C3'" . DT  F 3 12  ? 6.076  -29.649 123.889 1.00 29.38 ? 226  DT  F "C3'" 1 
ATOM   4001 O "O3'" . DT  F 3 12  ? 4.703  -29.990 123.806 1.00 32.63 ? 226  DT  F "O3'" 1 
ATOM   4002 C "C2'" . DT  F 3 12  ? 6.386  -28.781 125.111 1.00 27.58 ? 226  DT  F "C2'" 1 
ATOM   4003 C "C1'" . DT  F 3 12  ? 6.286  -29.809 126.230 1.00 27.10 ? 226  DT  F "C1'" 1 
ATOM   4004 N N1    . DT  F 3 12  ? 7.159  -29.520 127.390 1.00 26.27 ? 226  DT  F N1    1 
ATOM   4005 C C2    . DT  F 3 12  ? 6.795  -30.069 128.607 1.00 26.97 ? 226  DT  F C2    1 
ATOM   4006 O O2    . DT  F 3 12  ? 5.785  -30.753 128.774 1.00 27.98 ? 226  DT  F O2    1 
ATOM   4007 N N3    . DT  F 3 12  ? 7.646  -29.811 129.651 1.00 26.02 ? 226  DT  F N3    1 
ATOM   4008 C C4    . DT  F 3 12  ? 8.801  -29.078 129.611 1.00 25.26 ? 226  DT  F C4    1 
ATOM   4009 O O4    . DT  F 3 12  ? 9.475  -28.936 130.629 1.00 27.87 ? 226  DT  F O4    1 
ATOM   4010 C C5    . DT  F 3 12  ? 9.107  -28.547 128.318 1.00 24.19 ? 226  DT  F C5    1 
ATOM   4011 C C7    . DT  F 3 12  ? 10.383 -27.746 128.130 1.00 24.27 ? 226  DT  F C7    1 
ATOM   4012 C C6    . DT  F 3 12  ? 8.298  -28.773 127.270 1.00 25.15 ? 226  DT  F C6    1 
ATOM   4013 P P     . DG  F 3 13  ? 3.663  -28.970 123.138 1.00 35.24 ? 227  DG  F P     1 
ATOM   4014 O OP1   . DG  F 3 13  ? 3.043  -29.654 121.977 1.00 36.46 ? 227  DG  F OP1   1 
ATOM   4015 O OP2   . DG  F 3 13  ? 4.322  -27.649 122.974 1.00 34.56 ? 227  DG  F OP2   1 
ATOM   4016 O "O5'" . DG  F 3 13  ? 2.557  -28.797 124.278 1.00 34.96 ? 227  DG  F "O5'" 1 
ATOM   4017 C "C5'" . DG  F 3 13  ? 1.931  -29.887 124.931 1.00 35.48 ? 227  DG  F "C5'" 1 
ATOM   4018 C "C4'" . DG  F 3 13  ? 1.439  -29.420 126.284 1.00 37.98 ? 227  DG  F "C4'" 1 
ATOM   4019 O "O4'" . DG  F 3 13  ? 2.529  -29.281 127.210 1.00 37.62 ? 227  DG  F "O4'" 1 
ATOM   4020 C "C3'" . DG  F 3 13  ? 0.841  -27.999 126.147 1.00 40.58 ? 227  DG  F "C3'" 1 
ATOM   4021 O "O3'" . DG  F 3 13  ? -0.319 -27.844 126.971 1.00 43.16 ? 227  DG  F "O3'" 1 
ATOM   4022 C "C2'" . DG  F 3 13  ? 1.974  -27.132 126.706 1.00 39.22 ? 227  DG  F "C2'" 1 
ATOM   4023 C "C1'" . DG  F 3 13  ? 2.367  -28.019 127.854 1.00 37.13 ? 227  DG  F "C1'" 1 
ATOM   4024 N N9    . DG  F 3 13  ? 3.579  -27.567 128.548 1.00 34.77 ? 227  DG  F N9    1 
ATOM   4025 C C8    . DG  F 3 13  ? 4.639  -26.813 128.114 1.00 33.97 ? 227  DG  F C8    1 
ATOM   4026 N N7    . DG  F 3 13  ? 5.547  -26.605 129.032 1.00 33.59 ? 227  DG  F N7    1 
ATOM   4027 C C5    . DG  F 3 13  ? 5.045  -27.271 130.145 1.00 34.02 ? 227  DG  F C5    1 
ATOM   4028 C C6    . DG  F 3 13  ? 5.580  -27.402 131.450 1.00 34.38 ? 227  DG  F C6    1 
ATOM   4029 O O6    . DG  F 3 13  ? 6.633  -26.956 131.894 1.00 35.52 ? 227  DG  F O6    1 
ATOM   4030 N N1    . DG  F 3 13  ? 4.751  -28.149 132.266 1.00 34.56 ? 227  DG  F N1    1 
ATOM   4031 C C2    . DG  F 3 13  ? 3.548  -28.706 131.879 1.00 35.54 ? 227  DG  F C2    1 
ATOM   4032 N N2    . DG  F 3 13  ? 2.877  -29.398 132.802 1.00 36.05 ? 227  DG  F N2    1 
ATOM   4033 N N3    . DG  F 3 13  ? 3.042  -28.585 130.649 1.00 34.71 ? 227  DG  F N3    1 
ATOM   4034 C C4    . DG  F 3 13  ? 3.845  -27.857 129.846 1.00 34.32 ? 227  DG  F C4    1 
ATOM   4035 P P     . DC  F 3 14  ? -1.618 -27.081 126.423 1.00 43.80 ? 228  DC  F P     1 
ATOM   4036 O OP1   . DC  F 3 14  ? -2.373 -28.008 125.553 1.00 43.98 ? 228  DC  F OP1   1 
ATOM   4037 O OP2   . DC  F 3 14  ? -1.212 -25.745 125.919 1.00 41.92 ? 228  DC  F OP2   1 
ATOM   4038 O "O5'" . DC  F 3 14  ? -2.428 -26.913 127.789 1.00 42.57 ? 228  DC  F "O5'" 1 
ATOM   4039 C "C5'" . DC  F 3 14  ? -2.528 -28.034 128.656 1.00 41.64 ? 228  DC  F "C5'" 1 
ATOM   4040 C "C4'" . DC  F 3 14  ? -1.805 -27.753 129.956 1.00 42.45 ? 228  DC  F "C4'" 1 
ATOM   4041 O "O4'" . DC  F 3 14  ? -0.527 -27.204 129.725 1.00 40.10 ? 228  DC  F "O4'" 1 
ATOM   4042 C "C3'" . DC  F 3 14  ? -2.491 -26.628 130.714 1.00 43.56 ? 228  DC  F "C3'" 1 
ATOM   4043 O "O3'" . DC  F 3 14  ? -3.584 -27.160 131.481 1.00 47.92 ? 228  DC  F "O3'" 1 
ATOM   4044 C "C2'" . DC  F 3 14  ? -1.365 -26.077 131.610 1.00 41.87 ? 228  DC  F "C2'" 1 
ATOM   4045 C "C1'" . DC  F 3 14  ? -0.122 -26.712 131.002 1.00 39.47 ? 228  DC  F "C1'" 1 
ATOM   4046 N N1    . DC  F 3 14  ? 0.993  -25.762 130.847 1.00 38.36 ? 228  DC  F N1    1 
ATOM   4047 C C2    . DC  F 3 14  ? 1.877  -25.616 131.903 1.00 37.94 ? 228  DC  F C2    1 
ATOM   4048 O O2    . DC  F 3 14  ? 1.689  -26.212 132.962 1.00 38.08 ? 228  DC  F O2    1 
ATOM   4049 N N3    . DC  F 3 14  ? 2.945  -24.793 131.739 1.00 37.03 ? 228  DC  F N3    1 
ATOM   4050 C C4    . DC  F 3 14  ? 3.137  -24.136 130.589 1.00 37.86 ? 228  DC  F C4    1 
ATOM   4051 N N4    . DC  F 3 14  ? 4.200  -23.348 130.454 1.00 38.14 ? 228  DC  F N4    1 
ATOM   4052 C C5    . DC  F 3 14  ? 2.226  -24.270 129.492 1.00 38.16 ? 228  DC  F C5    1 
ATOM   4053 C C6    . DC  F 3 14  ? 1.174  -25.092 129.672 1.00 38.47 ? 228  DC  F C6    1 
HETATM 4054 O O     . HOH G 4 .   ? 29.140 -49.554 108.779 1.00 40.72 ? 2001 HOH A O     1 
HETATM 4055 O O     . HOH G 4 .   ? 30.747 -51.863 98.393  1.00 35.01 ? 2002 HOH A O     1 
HETATM 4056 O O     . HOH G 4 .   ? 33.179 -52.072 101.977 1.00 32.33 ? 2003 HOH A O     1 
HETATM 4057 O O     . HOH G 4 .   ? 34.701 -52.046 97.835  1.00 43.61 ? 2004 HOH A O     1 
HETATM 4058 O O     . HOH G 4 .   ? 36.335 -50.847 93.748  1.00 43.25 ? 2005 HOH A O     1 
HETATM 4059 O O     . HOH G 4 .   ? 35.785 -52.832 91.124  1.00 32.54 ? 2006 HOH A O     1 
HETATM 4060 O O     . HOH G 4 .   ? 32.533 -36.676 62.152  1.00 49.40 ? 2007 HOH A O     1 
HETATM 4061 O O     . HOH G 4 .   ? 40.656 -55.730 85.141  1.00 39.33 ? 2008 HOH A O     1 
HETATM 4062 O O     . HOH G 4 .   ? 36.177 -59.973 62.429  1.00 50.99 ? 2009 HOH A O     1 
HETATM 4063 O O     . HOH G 4 .   ? 37.075 -62.589 67.932  1.00 40.79 ? 2010 HOH A O     1 
HETATM 4064 O O     . HOH G 4 .   ? 39.881 -63.835 65.613  1.00 55.10 ? 2011 HOH A O     1 
HETATM 4065 O O     . HOH G 4 .   ? 40.361 -38.852 90.125  1.00 54.06 ? 2012 HOH A O     1 
HETATM 4066 O O     . HOH G 4 .   ? 31.269 -56.191 58.320  1.00 43.21 ? 2013 HOH A O     1 
HETATM 4067 O O     . HOH G 4 .   ? 30.533 -46.290 59.969  1.00 54.73 ? 2014 HOH A O     1 
HETATM 4068 O O     . HOH G 4 .   ? 26.197 -53.295 65.743  1.00 47.62 ? 2015 HOH A O     1 
HETATM 4069 O O     . HOH G 4 .   ? 19.489 -49.713 63.976  1.00 48.02 ? 2016 HOH A O     1 
HETATM 4070 O O     . HOH G 4 .   ? 24.458 -57.981 68.815  1.00 49.11 ? 2017 HOH A O     1 
HETATM 4071 O O     . HOH G 4 .   ? 28.122 -51.541 64.370  1.00 39.71 ? 2018 HOH A O     1 
HETATM 4072 O O     . HOH G 4 .   ? 43.005 -59.346 74.798  1.00 46.81 ? 2019 HOH A O     1 
HETATM 4073 O O     . HOH G 4 .   ? 39.353 -57.378 83.487  1.00 36.24 ? 2020 HOH A O     1 
HETATM 4074 O O     . HOH G 4 .   ? 36.474 -55.486 83.320  1.00 28.58 ? 2021 HOH A O     1 
HETATM 4075 O O     . HOH G 4 .   ? 35.816 -58.103 76.574  1.00 31.81 ? 2022 HOH A O     1 
HETATM 4076 O O     . HOH G 4 .   ? 33.685 -56.311 77.533  1.00 28.80 ? 2023 HOH A O     1 
HETATM 4077 O O     . HOH G 4 .   ? 22.129 -36.465 87.243  1.00 29.56 ? 2024 HOH A O     1 
HETATM 4078 O O     . HOH G 4 .   ? 32.052 -44.167 62.226  1.00 35.72 ? 2025 HOH A O     1 
HETATM 4079 O O     . HOH G 4 .   ? 32.667 -40.979 61.933  1.00 44.53 ? 2026 HOH A O     1 
HETATM 4080 O O     . HOH G 4 .   ? 37.759 -36.753 71.899  1.00 43.41 ? 2027 HOH A O     1 
HETATM 4081 O O     . HOH G 4 .   ? 35.277 -33.202 86.509  1.00 49.35 ? 2028 HOH A O     1 
HETATM 4082 O O     . HOH G 4 .   ? 33.610 -55.172 83.913  1.00 35.28 ? 2029 HOH A O     1 
HETATM 4083 O O     . HOH G 4 .   ? 38.739 -53.771 84.487  1.00 23.75 ? 2030 HOH A O     1 
HETATM 4084 O O     . HOH G 4 .   ? 38.471 -40.587 89.534  1.00 22.99 ? 2031 HOH A O     1 
HETATM 4085 O O     . HOH G 4 .   ? 42.243 -46.095 88.840  1.00 33.06 ? 2032 HOH A O     1 
HETATM 4086 O O     . HOH G 4 .   ? 45.763 -47.754 90.035  1.00 24.76 ? 2033 HOH A O     1 
HETATM 4087 O O     . HOH G 4 .   ? 36.399 -48.590 80.044  1.00 15.87 ? 2034 HOH A O     1 
HETATM 4088 O O     . HOH G 4 .   ? 49.139 -47.125 72.271  1.00 46.09 ? 2035 HOH A O     1 
HETATM 4089 O O     . HOH G 4 .   ? 49.308 -49.893 78.766  1.00 43.91 ? 2036 HOH A O     1 
HETATM 4090 O O     . HOH G 4 .   ? 45.150 -38.436 76.008  1.00 26.68 ? 2037 HOH A O     1 
HETATM 4091 O O     . HOH G 4 .   ? 37.934 -37.715 74.459  1.00 20.45 ? 2038 HOH A O     1 
HETATM 4092 O O     . HOH G 4 .   ? 42.934 -38.266 81.979  1.00 46.37 ? 2039 HOH A O     1 
HETATM 4093 O O     . HOH G 4 .   ? 39.104 -37.838 83.138  1.00 45.36 ? 2040 HOH A O     1 
HETATM 4094 O O     . HOH G 4 .   ? 36.764 -36.508 83.509  1.00 36.27 ? 2041 HOH A O     1 
HETATM 4095 O O     . HOH G 4 .   ? 34.127 -34.986 76.256  1.00 42.34 ? 2042 HOH A O     1 
HETATM 4096 O O     . HOH G 4 .   ? 29.076 -43.273 90.096  1.00 21.58 ? 2043 HOH A O     1 
HETATM 4097 O O     . HOH G 4 .   ? 28.829 -53.979 95.096  1.00 48.51 ? 2044 HOH A O     1 
HETATM 4098 O O     . HOH G 4 .   ? 7.859  -44.014 105.827 1.00 25.62 ? 2045 HOH A O     1 
HETATM 4099 O O     . HOH G 4 .   ? 8.129  -48.947 100.345 1.00 30.05 ? 2046 HOH A O     1 
HETATM 4100 O O     . HOH G 4 .   ? 7.635  -47.516 102.694 1.00 29.72 ? 2047 HOH A O     1 
HETATM 4101 O O     . HOH G 4 .   ? 7.822  -40.180 104.392 1.00 29.05 ? 2048 HOH A O     1 
HETATM 4102 O O     . HOH G 4 .   ? 11.890 -33.072 98.513  1.00 46.51 ? 2049 HOH A O     1 
HETATM 4103 O O     . HOH G 4 .   ? 13.630 -36.113 90.193  1.00 35.40 ? 2050 HOH A O     1 
HETATM 4104 O O     . HOH G 4 .   ? 10.828 -35.759 90.662  1.00 39.70 ? 2051 HOH A O     1 
HETATM 4105 O O     . HOH G 4 .   ? 9.873  -51.467 94.046  1.00 37.52 ? 2052 HOH A O     1 
HETATM 4106 O O     . HOH G 4 .   ? 8.158  -39.670 88.528  1.00 35.50 ? 2053 HOH A O     1 
HETATM 4107 O O     . HOH G 4 .   ? 6.689  -42.142 84.453  1.00 54.78 ? 2054 HOH A O     1 
HETATM 4108 O O     . HOH G 4 .   ? 8.629  -53.626 92.388  1.00 42.47 ? 2055 HOH A O     1 
HETATM 4109 O O     . HOH G 4 .   ? 11.052 -46.814 89.888  1.00 19.72 ? 2056 HOH A O     1 
HETATM 4110 O O     . HOH G 4 .   ? 13.690 -52.523 95.052  1.00 22.43 ? 2057 HOH A O     1 
HETATM 4111 O O     . HOH G 4 .   ? 14.157 -38.749 90.220  1.00 26.98 ? 2058 HOH A O     1 
HETATM 4112 O O     . HOH G 4 .   ? 15.537 -40.138 82.931  1.00 37.52 ? 2059 HOH A O     1 
HETATM 4113 O O     . HOH G 4 .   ? 21.005 -35.511 89.371  1.00 31.21 ? 2060 HOH A O     1 
HETATM 4114 O O     . HOH G 4 .   ? 21.434 -32.512 96.369  1.00 30.01 ? 2061 HOH A O     1 
HETATM 4115 O O     . HOH G 4 .   ? 28.691 -35.320 88.185  1.00 46.14 ? 2062 HOH A O     1 
HETATM 4116 O O     . HOH G 4 .   ? 24.785 -37.440 86.909  1.00 29.09 ? 2063 HOH A O     1 
HETATM 4117 O O     . HOH G 4 .   ? 29.007 -37.806 83.915  1.00 39.37 ? 2064 HOH A O     1 
HETATM 4118 O O     . HOH G 4 .   ? 38.254 -39.663 86.831  1.00 27.88 ? 2065 HOH A O     1 
HETATM 4119 O O     . HOH G 4 .   ? 38.295 -37.908 92.570  1.00 38.67 ? 2066 HOH A O     1 
HETATM 4120 O O     . HOH G 4 .   ? 32.769 -34.159 86.942  1.00 47.22 ? 2067 HOH A O     1 
HETATM 4121 O O     . HOH G 4 .   ? 36.119 -48.342 95.155  1.00 25.92 ? 2068 HOH A O     1 
HETATM 4122 O O     . HOH G 4 .   ? 31.820 -43.553 100.549 1.00 35.33 ? 2069 HOH A O     1 
HETATM 4123 O O     . HOH G 4 .   ? 25.191 -50.542 106.902 1.00 32.87 ? 2070 HOH A O     1 
HETATM 4124 O O     . HOH G 4 .   ? 18.681 -47.364 110.765 1.00 27.76 ? 2071 HOH A O     1 
HETATM 4125 O O     . HOH G 4 .   ? 15.470 -52.275 115.063 1.00 39.46 ? 2072 HOH A O     1 
HETATM 4126 O O     . HOH G 4 .   ? 20.826 -48.567 109.517 1.00 24.63 ? 2073 HOH A O     1 
HETATM 4127 O O     . HOH G 4 .   ? 9.401  -51.669 101.183 1.00 47.81 ? 2074 HOH A O     1 
HETATM 4128 O O     . HOH H 4 .   ? 30.935 -40.519 116.219 1.00 45.98 ? 2001 HOH B O     1 
HETATM 4129 O O     . HOH H 4 .   ? 27.843 -46.961 119.248 1.00 55.93 ? 2002 HOH B O     1 
HETATM 4130 O O     . HOH H 4 .   ? 21.289 -37.016 109.888 1.00 44.17 ? 2003 HOH B O     1 
HETATM 4131 O O     . HOH H 4 .   ? 19.445 -39.422 108.914 1.00 35.30 ? 2004 HOH B O     1 
HETATM 4132 O O     . HOH H 4 .   ? 23.825 -34.646 112.827 1.00 36.92 ? 2005 HOH B O     1 
HETATM 4133 O O     . HOH H 4 .   ? 24.115 -34.892 115.977 1.00 44.43 ? 2006 HOH B O     1 
HETATM 4134 O O     . HOH H 4 .   ? 26.157 -34.705 120.416 1.00 54.09 ? 2007 HOH B O     1 
HETATM 4135 O O     . HOH H 4 .   ? 24.444 -36.002 109.035 1.00 58.58 ? 2008 HOH B O     1 
HETATM 4136 O O     . HOH H 4 .   ? 28.039 -36.256 124.472 1.00 46.27 ? 2009 HOH B O     1 
HETATM 4137 O O     . HOH H 4 .   ? 27.463 -33.445 127.287 1.00 33.97 ? 2010 HOH B O     1 
HETATM 4138 O O     . HOH H 4 .   ? 27.682 -37.283 137.782 1.00 21.95 ? 2011 HOH B O     1 
HETATM 4139 O O     . HOH H 4 .   ? 24.797 -24.890 144.821 1.00 56.09 ? 2012 HOH B O     1 
HETATM 4140 O O     . HOH H 4 .   ? 31.977 -25.037 145.667 1.00 37.79 ? 2013 HOH B O     1 
HETATM 4141 O O     . HOH H 4 .   ? 31.683 -30.566 132.453 1.00 42.14 ? 2014 HOH B O     1 
HETATM 4142 O O     . HOH H 4 .   ? 26.347 -38.885 161.304 1.00 40.32 ? 2015 HOH B O     1 
HETATM 4143 O O     . HOH H 4 .   ? 25.494 -24.903 141.773 1.00 51.26 ? 2016 HOH B O     1 
HETATM 4144 O O     . HOH H 4 .   ? 36.342 -19.549 148.472 1.00 52.57 ? 2017 HOH B O     1 
HETATM 4145 O O     . HOH H 4 .   ? 22.803 -28.874 158.016 1.00 44.25 ? 2018 HOH B O     1 
HETATM 4146 O O     . HOH H 4 .   ? 21.483 -40.030 158.096 1.00 39.92 ? 2019 HOH B O     1 
HETATM 4147 O O     . HOH H 4 .   ? 15.279 -40.356 156.886 1.00 43.16 ? 2020 HOH B O     1 
HETATM 4148 O O     . HOH H 4 .   ? 18.001 -39.974 157.521 1.00 47.75 ? 2021 HOH B O     1 
HETATM 4149 O O     . HOH H 4 .   ? 11.842 -38.202 154.820 1.00 44.39 ? 2022 HOH B O     1 
HETATM 4150 O O     . HOH H 4 .   ? 19.735 -34.545 154.256 1.00 32.12 ? 2023 HOH B O     1 
HETATM 4151 O O     . HOH H 4 .   ? 19.116 -28.812 147.086 1.00 56.06 ? 2024 HOH B O     1 
HETATM 4152 O O     . HOH H 4 .   ? 32.680 -21.817 139.281 1.00 35.70 ? 2025 HOH B O     1 
HETATM 4153 O O     . HOH H 4 .   ? 30.458 -25.104 142.924 1.00 41.41 ? 2026 HOH B O     1 
HETATM 4154 O O     . HOH H 4 .   ? 33.745 -25.905 143.782 1.00 33.04 ? 2027 HOH B O     1 
HETATM 4155 O O     . HOH H 4 .   ? 30.693 -20.769 135.532 1.00 30.84 ? 2028 HOH B O     1 
HETATM 4156 O O     . HOH H 4 .   ? 35.346 -27.256 140.928 1.00 48.28 ? 2029 HOH B O     1 
HETATM 4157 O O     . HOH H 4 .   ? 31.169 -28.883 134.466 1.00 33.40 ? 2030 HOH B O     1 
HETATM 4158 O O     . HOH H 4 .   ? 28.309 -31.139 134.954 1.00 30.19 ? 2031 HOH B O     1 
HETATM 4159 O O     . HOH H 4 .   ? 2.413  -40.985 131.235 1.00 34.66 ? 2032 HOH B O     1 
HETATM 4160 O O     . HOH H 4 .   ? 26.779 -28.037 141.351 1.00 31.70 ? 2033 HOH B O     1 
HETATM 4161 O O     . HOH H 4 .   ? 10.103 -55.472 118.613 1.00 43.99 ? 2034 HOH B O     1 
HETATM 4162 O O     . HOH H 4 .   ? 13.243 -51.098 118.805 1.00 41.49 ? 2035 HOH B O     1 
HETATM 4163 O O     . HOH H 4 .   ? 24.967 -29.783 140.457 1.00 23.92 ? 2036 HOH B O     1 
HETATM 4164 O O     . HOH H 4 .   ? 23.632 -42.058 155.788 1.00 25.23 ? 2037 HOH B O     1 
HETATM 4165 O O     . HOH H 4 .   ? 24.442 -45.052 155.924 1.00 37.33 ? 2038 HOH B O     1 
HETATM 4166 O O     . HOH H 4 .   ? 33.467 -45.019 131.162 1.00 60.05 ? 2039 HOH B O     1 
HETATM 4167 O O     . HOH H 4 .   ? 24.018 -48.256 117.126 1.00 48.90 ? 2040 HOH B O     1 
HETATM 4168 O O     . HOH H 4 .   ? 24.687 -31.263 133.754 1.00 44.54 ? 2041 HOH B O     1 
HETATM 4169 O O     . HOH H 4 .   ? 30.304 -32.508 133.694 1.00 18.69 ? 2042 HOH B O     1 
HETATM 4170 O O     . HOH H 4 .   ? 22.657 -28.865 132.400 1.00 46.14 ? 2043 HOH B O     1 
HETATM 4171 O O     . HOH H 4 .   ? 29.826 -36.230 126.450 1.00 42.31 ? 2044 HOH B O     1 
HETATM 4172 O O     . HOH H 4 .   ? 33.374 -40.210 129.289 1.00 28.43 ? 2045 HOH B O     1 
HETATM 4173 O O     . HOH H 4 .   ? 29.607 -45.663 128.797 1.00 28.63 ? 2046 HOH B O     1 
HETATM 4174 O O     . HOH H 4 .   ? 34.360 -43.841 133.608 1.00 38.67 ? 2047 HOH B O     1 
HETATM 4175 O O     . HOH H 4 .   ? 37.759 -38.055 128.057 1.00 37.25 ? 2048 HOH B O     1 
HETATM 4176 O O     . HOH H 4 .   ? 37.423 -46.967 139.713 1.00 47.76 ? 2049 HOH B O     1 
HETATM 4177 O O     . HOH H 4 .   ? 29.633 -48.372 143.341 1.00 20.57 ? 2050 HOH B O     1 
HETATM 4178 O O     . HOH H 4 .   ? 37.387 -51.451 143.077 1.00 36.95 ? 2051 HOH B O     1 
HETATM 4179 O O     . HOH H 4 .   ? 36.547 -47.992 142.245 1.00 47.44 ? 2052 HOH B O     1 
HETATM 4180 O O     . HOH H 4 .   ? 30.582 -48.466 135.181 1.00 34.10 ? 2053 HOH B O     1 
HETATM 4181 O O     . HOH H 4 .   ? 28.292 -49.722 134.254 1.00 39.25 ? 2054 HOH B O     1 
HETATM 4182 O O     . HOH H 4 .   ? 20.633 -43.357 128.054 1.00 22.52 ? 2055 HOH B O     1 
HETATM 4183 O O     . HOH H 4 .   ? 19.254 -31.979 122.825 1.00 38.28 ? 2056 HOH B O     1 
HETATM 4184 O O     . HOH H 4 .   ? 20.406 -33.920 118.125 1.00 36.56 ? 2057 HOH B O     1 
HETATM 4185 O O     . HOH H 4 .   ? 19.904 -33.186 115.612 1.00 41.01 ? 2058 HOH B O     1 
HETATM 4186 O O     . HOH H 4 .   ? 16.580 -36.391 110.571 1.00 28.62 ? 2059 HOH B O     1 
HETATM 4187 O O     . HOH H 4 .   ? 1.107  -35.674 117.992 1.00 44.31 ? 2060 HOH B O     1 
HETATM 4188 O O     . HOH H 4 .   ? -0.611 -37.698 117.741 1.00 23.37 ? 2061 HOH B O     1 
HETATM 4189 O O     . HOH H 4 .   ? -0.558 -47.794 123.682 1.00 47.49 ? 2062 HOH B O     1 
HETATM 4190 O O     . HOH H 4 .   ? 9.079  -51.661 114.893 1.00 51.48 ? 2063 HOH B O     1 
HETATM 4191 O O     . HOH H 4 .   ? 5.634  -50.461 127.846 1.00 36.73 ? 2064 HOH B O     1 
HETATM 4192 O O     . HOH H 4 .   ? 1.353  -34.922 123.835 1.00 36.06 ? 2065 HOH B O     1 
HETATM 4193 O O     . HOH H 4 .   ? 0.201  -32.871 134.787 1.00 46.00 ? 2066 HOH B O     1 
HETATM 4194 O O     . HOH H 4 .   ? 5.092  -33.757 122.893 1.00 17.88 ? 2067 HOH B O     1 
HETATM 4195 O O     . HOH H 4 .   ? 2.411  -39.521 127.843 1.00 46.97 ? 2068 HOH B O     1 
HETATM 4196 O O     . HOH H 4 .   ? 11.210 -52.276 119.903 1.00 47.02 ? 2069 HOH B O     1 
HETATM 4197 O O     . HOH H 4 .   ? 5.610  -47.748 128.224 1.00 28.90 ? 2070 HOH B O     1 
HETATM 4198 O O     . HOH H 4 .   ? 8.558  -52.772 127.094 1.00 43.89 ? 2071 HOH B O     1 
HETATM 4199 O O     . HOH H 4 .   ? 12.744 -50.340 128.833 1.00 28.37 ? 2072 HOH B O     1 
HETATM 4200 O O     . HOH H 4 .   ? 12.494 -53.698 122.101 1.00 27.94 ? 2073 HOH B O     1 
HETATM 4201 O O     . HOH H 4 .   ? 14.599 -53.069 120.351 1.00 35.44 ? 2074 HOH B O     1 
HETATM 4202 O O     . HOH H 4 .   ? 13.750 -49.890 131.503 1.00 26.87 ? 2075 HOH B O     1 
HETATM 4203 O O     . HOH H 4 .   ? 19.792 -53.364 128.456 1.00 37.22 ? 2076 HOH B O     1 
HETATM 4204 O O     . HOH H 4 .   ? 16.331 -48.861 131.440 1.00 24.89 ? 2077 HOH B O     1 
HETATM 4205 O O     . HOH H 4 .   ? 11.421 -53.954 134.997 1.00 54.79 ? 2078 HOH B O     1 
HETATM 4206 O O     . HOH H 4 .   ? 20.680 -50.390 131.600 1.00 51.15 ? 2079 HOH B O     1 
HETATM 4207 O O     . HOH H 4 .   ? 29.827 -46.372 131.294 1.00 25.79 ? 2080 HOH B O     1 
HETATM 4208 O O     . HOH H 4 .   ? 31.512 -41.921 121.837 1.00 54.76 ? 2081 HOH B O     1 
HETATM 4209 O O     . HOH H 4 .   ? 31.742 -37.405 124.218 1.00 50.64 ? 2082 HOH B O     1 
HETATM 4210 O O     . HOH H 4 .   ? 29.580 -47.979 125.975 1.00 28.36 ? 2083 HOH B O     1 
HETATM 4211 O O     . HOH H 4 .   ? 25.949 -48.874 119.691 1.00 38.55 ? 2084 HOH B O     1 
HETATM 4212 O O     . HOH H 4 .   ? 23.964 -51.727 123.173 1.00 30.22 ? 2085 HOH B O     1 
HETATM 4213 O O     . HOH H 4 .   ? 20.262 -50.713 128.712 1.00 42.62 ? 2086 HOH B O     1 
HETATM 4214 O O     . HOH H 4 .   ? 27.311 -38.364 123.013 1.00 16.67 ? 2087 HOH B O     1 
HETATM 4215 O O     . HOH H 4 .   ? 23.412 -42.710 117.447 1.00 38.65 ? 2088 HOH B O     1 
HETATM 4216 O O     . HOH H 4 .   ? 19.392 -45.508 112.464 1.00 32.68 ? 2089 HOH B O     1 
HETATM 4217 O O     . HOH H 4 .   ? 20.074 -50.107 114.989 1.00 39.46 ? 2090 HOH B O     1 
HETATM 4218 O O     . HOH I 4 .   ? 16.810 -48.367 78.446  1.00 48.19 ? 2001 HOH C O     1 
HETATM 4219 O O     . HOH I 4 .   ? 11.021 -45.052 87.626  1.00 27.75 ? 2002 HOH C O     1 
HETATM 4220 O O     . HOH I 4 .   ? 29.190 -43.459 57.659  1.00 51.88 ? 2003 HOH C O     1 
HETATM 4221 O O     . HOH I 4 .   ? 18.843 -59.774 86.163  1.00 39.61 ? 2004 HOH C O     1 
HETATM 4222 O O     . HOH I 4 .   ? 16.879 -51.725 79.753  1.00 40.44 ? 2005 HOH C O     1 
HETATM 4223 O O     . HOH I 4 .   ? 11.639 -44.237 80.917  1.00 45.78 ? 2006 HOH C O     1 
HETATM 4224 O O     . HOH I 4 .   ? 11.112 -42.767 85.547  1.00 37.95 ? 2007 HOH C O     1 
HETATM 4225 O O     . HOH I 4 .   ? 20.434 -50.956 80.179  1.00 24.74 ? 2008 HOH C O     1 
HETATM 4226 O O     . HOH I 4 .   ? 18.530 -42.799 80.703  1.00 59.67 ? 2009 HOH C O     1 
HETATM 4227 O O     . HOH I 4 .   ? 20.061 -44.781 79.551  1.00 36.74 ? 2010 HOH C O     1 
HETATM 4228 O O     . HOH I 4 .   ? 22.136 -43.787 77.188  1.00 55.58 ? 2011 HOH C O     1 
HETATM 4229 O O     . HOH I 4 .   ? 21.917 -40.407 79.863  1.00 37.58 ? 2012 HOH C O     1 
HETATM 4230 O O     . HOH I 4 .   ? 20.508 -47.135 78.514  1.00 37.42 ? 2013 HOH C O     1 
HETATM 4231 O O     . HOH I 4 .   ? 24.297 -39.284 76.683  1.00 32.71 ? 2014 HOH C O     1 
HETATM 4232 O O     . HOH I 4 .   ? 26.132 -37.819 73.455  1.00 48.84 ? 2015 HOH C O     1 
HETATM 4233 O O     . HOH I 4 .   ? 23.447 -41.543 75.438  1.00 38.06 ? 2016 HOH C O     1 
HETATM 4234 O O     . HOH I 4 .   ? 35.264 -36.762 72.796  1.00 31.80 ? 2017 HOH C O     1 
HETATM 4235 O O     . HOH I 4 .   ? 27.575 -36.518 71.345  1.00 50.07 ? 2018 HOH C O     1 
HETATM 4236 O O     . HOH I 4 .   ? 31.767 -35.522 68.477  1.00 32.73 ? 2019 HOH C O     1 
HETATM 4237 O O     . HOH I 4 .   ? 24.041 -39.986 72.317  1.00 41.71 ? 2020 HOH C O     1 
HETATM 4238 O O     . HOH I 4 .   ? 27.405 -45.420 57.834  1.00 42.93 ? 2021 HOH C O     1 
HETATM 4239 O O     . HOH I 4 .   ? 20.693 -46.612 62.925  1.00 37.21 ? 2022 HOH C O     1 
HETATM 4240 O O     . HOH I 4 .   ? 22.879 -45.548 61.989  1.00 33.62 ? 2023 HOH C O     1 
HETATM 4241 O O     . HOH I 4 .   ? 31.213 -43.689 59.627  1.00 45.77 ? 2024 HOH C O     1 
HETATM 4242 O O     . HOH I 4 .   ? 27.785 -37.238 62.605  1.00 40.17 ? 2025 HOH C O     1 
HETATM 4243 O O     . HOH I 4 .   ? 16.960 -43.807 62.573  1.00 45.05 ? 2026 HOH C O     1 
HETATM 4244 O O     . HOH I 4 .   ? 17.984 -45.552 60.066  1.00 48.77 ? 2027 HOH C O     1 
HETATM 4245 O O     . HOH I 4 .   ? 23.172 -36.935 61.766  1.00 45.99 ? 2028 HOH C O     1 
HETATM 4246 O O     . HOH I 4 .   ? 20.483 -36.053 58.811  1.00 50.67 ? 2029 HOH C O     1 
HETATM 4247 O O     . HOH I 4 .   ? 17.431 -40.187 56.465  1.00 42.71 ? 2030 HOH C O     1 
HETATM 4248 O O     . HOH J 4 .   ? 20.934 -52.472 75.974  1.00 47.80 ? 2001 HOH D O     1 
HETATM 4249 O O     . HOH J 4 .   ? 23.218 -56.004 77.772  1.00 50.43 ? 2002 HOH D O     1 
HETATM 4250 O O     . HOH J 4 .   ? 25.002 -45.070 64.081  1.00 30.31 ? 2003 HOH D O     1 
HETATM 4251 O O     . HOH J 4 .   ? 21.972 -41.595 72.857  1.00 31.78 ? 2004 HOH D O     1 
HETATM 4252 O O     . HOH J 4 .   ? 20.539 -50.545 72.360  1.00 28.62 ? 2005 HOH D O     1 
HETATM 4253 O O     . HOH J 4 .   ? 23.982 -53.509 73.868  1.00 28.54 ? 2006 HOH D O     1 
HETATM 4254 O O     . HOH J 4 .   ? 21.669 -46.891 76.146  1.00 28.19 ? 2007 HOH D O     1 
HETATM 4255 O O     . HOH J 4 .   ? 31.559 -57.751 77.065  1.00 43.09 ? 2008 HOH D O     1 
HETATM 4256 O O     . HOH J 4 .   ? 26.136 -54.957 78.816  1.00 38.71 ? 2009 HOH D O     1 
HETATM 4257 O O     . HOH J 4 .   ? 21.481 -49.623 78.115  1.00 36.03 ? 2010 HOH D O     1 
HETATM 4258 O O     . HOH J 4 .   ? 26.865 -56.327 80.950  1.00 38.12 ? 2011 HOH D O     1 
HETATM 4259 O O     . HOH J 4 .   ? 30.196 -58.835 79.077  1.00 43.96 ? 2012 HOH D O     1 
HETATM 4260 O O     . HOH J 4 .   ? 33.714 -55.497 80.056  1.00 22.42 ? 2013 HOH D O     1 
HETATM 4261 O O     . HOH J 4 .   ? 31.147 -57.301 86.035  1.00 46.47 ? 2014 HOH D O     1 
HETATM 4262 O O     . HOH J 4 .   ? 28.121 -59.461 84.049  1.00 50.93 ? 2015 HOH D O     1 
HETATM 4263 O O     . HOH J 4 .   ? 22.997 -55.655 83.932  1.00 31.54 ? 2016 HOH D O     1 
HETATM 4264 O O     . HOH J 4 .   ? 25.716 -56.324 83.460  1.00 37.02 ? 2017 HOH D O     1 
HETATM 4265 O O     . HOH J 4 .   ? 26.501 -55.025 95.755  1.00 53.20 ? 2018 HOH D O     1 
HETATM 4266 O O     . HOH J 4 .   ? 21.953 -59.342 93.724  1.00 41.53 ? 2019 HOH D O     1 
HETATM 4267 O O     . HOH J 4 .   ? 20.115 -58.979 97.127  1.00 49.25 ? 2020 HOH D O     1 
HETATM 4268 O O     . HOH J 4 .   ? 9.800  -53.529 95.684  1.00 44.79 ? 2021 HOH D O     1 
HETATM 4269 O O     . HOH K 4 .   ? 1.949  -43.217 135.434 1.00 47.04 ? 2001 HOH E O     1 
HETATM 4270 O O     . HOH K 4 .   ? 29.376 -49.101 145.741 1.00 42.37 ? 2002 HOH E O     1 
HETATM 4271 O O     . HOH K 4 .   ? 10.829 -29.729 134.883 1.00 60.72 ? 2003 HOH E O     1 
HETATM 4272 O O     . HOH K 4 .   ? 2.703  -41.481 137.271 1.00 32.83 ? 2004 HOH E O     1 
HETATM 4273 O O     . HOH K 4 .   ? 11.977 -34.570 137.725 1.00 33.56 ? 2005 HOH E O     1 
HETATM 4274 O O     . HOH K 4 .   ? 7.042  -41.010 137.906 1.00 43.32 ? 2006 HOH E O     1 
HETATM 4275 O O     . HOH K 4 .   ? 11.766 -41.129 138.575 1.00 24.03 ? 2007 HOH E O     1 
HETATM 4276 O O     . HOH K 4 .   ? 10.012 -42.589 137.387 1.00 52.39 ? 2008 HOH E O     1 
HETATM 4277 O O     . HOH K 4 .   ? 12.238 -38.882 139.697 1.00 27.29 ? 2009 HOH E O     1 
HETATM 4278 O O     . HOH K 4 .   ? 12.842 -42.574 140.606 1.00 43.66 ? 2010 HOH E O     1 
HETATM 4279 O O     . HOH K 4 .   ? 13.537 -45.522 138.248 1.00 43.77 ? 2011 HOH E O     1 
HETATM 4280 O O     . HOH K 4 .   ? 15.150 -47.014 140.467 1.00 56.16 ? 2012 HOH E O     1 
HETATM 4281 O O     . HOH K 4 .   ? 24.654 -51.464 143.166 1.00 50.53 ? 2013 HOH E O     1 
HETATM 4282 O O     . HOH K 4 .   ? 19.653 -50.476 147.520 1.00 47.60 ? 2014 HOH E O     1 
HETATM 4283 O O     . HOH K 4 .   ? 15.146 -44.767 143.298 1.00 29.58 ? 2015 HOH E O     1 
HETATM 4284 O O     . HOH K 4 .   ? 21.645 -51.890 143.496 1.00 39.20 ? 2016 HOH E O     1 
HETATM 4285 O O     . HOH K 4 .   ? 15.712 -46.394 145.513 1.00 27.36 ? 2017 HOH E O     1 
HETATM 4286 O O     . HOH K 4 .   ? 26.685 -49.626 145.763 1.00 38.79 ? 2018 HOH E O     1 
HETATM 4287 O O     . HOH K 4 .   ? 14.774 -49.313 148.745 1.00 48.40 ? 2019 HOH E O     1 
HETATM 4288 O O     . HOH K 4 .   ? 17.672 -48.955 146.405 1.00 40.59 ? 2020 HOH E O     1 
HETATM 4289 O O     . HOH K 4 .   ? 23.926 -50.646 149.251 1.00 46.10 ? 2021 HOH E O     1 
HETATM 4290 O O     . HOH K 4 .   ? 12.941 -40.493 155.656 1.00 47.46 ? 2022 HOH E O     1 
HETATM 4291 O O     . HOH K 4 .   ? 22.691 -42.466 158.217 1.00 35.81 ? 2023 HOH E O     1 
HETATM 4292 O O     . HOH K 4 .   ? 14.143 -51.516 154.398 1.00 50.46 ? 2024 HOH E O     1 
HETATM 4293 O O     . HOH K 4 .   ? 8.313  -42.933 155.610 1.00 48.57 ? 2025 HOH E O     1 
HETATM 4294 O O     . HOH K 4 .   ? 14.283 -46.283 160.563 1.00 55.10 ? 2026 HOH E O     1 
HETATM 4295 O O     . HOH K 4 .   ? 5.520  -44.454 155.466 1.00 43.76 ? 2027 HOH E O     1 
HETATM 4296 O O     . HOH K 4 .   ? 2.700  -44.391 155.881 1.00 60.25 ? 2028 HOH E O     1 
HETATM 4297 O O     . HOH L 4 .   ? 8.875  -41.299 153.334 1.00 49.62 ? 2001 HOH F O     1 
HETATM 4298 O O     . HOH L 4 .   ? 13.677 -47.425 146.965 1.00 40.22 ? 2002 HOH F O     1 
HETATM 4299 O O     . HOH L 4 .   ? 13.083 -44.749 145.614 1.00 44.24 ? 2003 HOH F O     1 
HETATM 4300 O O     . HOH L 4 .   ? 9.678  -39.438 143.563 1.00 47.35 ? 2004 HOH F O     1 
HETATM 4301 O O     . HOH L 4 .   ? 16.434 -41.187 153.733 1.00 20.86 ? 2005 HOH F O     1 
HETATM 4302 O O     . HOH L 4 .   ? 12.735 -42.364 143.413 1.00 43.75 ? 2006 HOH F O     1 
HETATM 4303 O O     . HOH L 4 .   ? 12.276 -35.949 145.701 1.00 53.93 ? 2007 HOH F O     1 
HETATM 4304 O O     . HOH L 4 .   ? 8.471  -34.982 147.793 1.00 43.57 ? 2008 HOH F O     1 
HETATM 4305 O O     . HOH L 4 .   ? 12.959 -39.186 142.221 1.00 29.26 ? 2009 HOH F O     1 
HETATM 4306 O O     . HOH L 4 .   ? 15.420 -32.512 143.903 1.00 27.58 ? 2010 HOH F O     1 
HETATM 4307 O O     . HOH L 4 .   ? 12.820 -36.423 139.627 1.00 30.71 ? 2011 HOH F O     1 
HETATM 4308 O O     . HOH L 4 .   ? 17.358 -30.861 139.455 1.00 24.20 ? 2012 HOH F O     1 
HETATM 4309 O O     . HOH L 4 .   ? 22.997 -28.135 140.773 1.00 34.16 ? 2013 HOH F O     1 
HETATM 4310 O O     . HOH L 4 .   ? 17.463 -28.539 144.570 1.00 41.02 ? 2014 HOH F O     1 
HETATM 4311 O O     . HOH L 4 .   ? 23.410 -27.792 134.699 1.00 27.52 ? 2015 HOH F O     1 
HETATM 4312 O O     . HOH L 4 .   ? 24.920 -30.699 137.976 1.00 18.28 ? 2016 HOH F O     1 
HETATM 4313 O O     . HOH L 4 .   ? 21.188 -27.698 139.078 1.00 31.14 ? 2017 HOH F O     1 
HETATM 4314 O O     . HOH L 4 .   ? 18.279 -30.080 137.175 1.00 24.51 ? 2018 HOH F O     1 
HETATM 4315 O O     . HOH L 4 .   ? 20.699 -27.301 133.973 1.00 54.98 ? 2019 HOH F O     1 
HETATM 4316 O O     . HOH L 4 .   ? 14.348 -30.721 134.428 1.00 37.70 ? 2020 HOH F O     1 
HETATM 4317 O O     . HOH L 4 .   ? 18.894 -26.622 128.825 1.00 48.81 ? 2021 HOH F O     1 
HETATM 4318 O O     . HOH L 4 .   ? 16.962 -29.985 134.799 1.00 33.23 ? 2022 HOH F O     1 
HETATM 4319 O O     . HOH L 4 .   ? 13.492 -26.014 127.161 1.00 61.75 ? 2023 HOH F O     1 
HETATM 4320 O O     . HOH L 4 .   ? 13.925 -27.202 123.277 1.00 40.83 ? 2024 HOH F O     1 
HETATM 4321 O O     . HOH L 4 .   ? 9.043  -26.121 124.896 1.00 36.10 ? 2025 HOH F O     1 
HETATM 4322 O O     . HOH L 4 .   ? 1.188  -31.004 130.977 1.00 51.57 ? 2026 HOH F O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   THR 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   ?   ?   ?   A . n 
A 1 4   GLN 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   ?   ?   ?   A . n 
A 1 6   LEU 6   6   ?   ?   ?   A . n 
A 1 7   GLU 7   7   ?   ?   ?   A . n 
A 1 8   GLY 8   8   ?   ?   ?   A . n 
A 1 9   SER 9   9   ?   ?   ?   A . n 
A 1 10  ASN 10  10  ?   ?   ?   A . n 
A 1 11  PRO 11  11  ?   ?   ?   A . n 
A 1 12  VAL 12  12  ?   ?   ?   A . n 
A 1 13  ASP 13  13  ?   ?   ?   A . n 
A 1 14  LEU 14  14  ?   ?   ?   A . n 
A 1 15  SER 15  15  ?   ?   ?   A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  HIS 17  17  17  HIS HIS A . n 
A 1 18  PRO 18  18  18  PRO PRO A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ILE 21  21  21  ILE ILE A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  PRO 23  23  23  PRO PRO A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  GLN 26  26  26  GLN GLN A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  ILE 28  28  28  ILE ILE A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  THR 31  31  31  THR THR A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  ASN 33  33  33  ASN ASN A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  CYS 36  36  36  CYS CYS A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  ILE 43  43  43  ILE ILE A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  GLN 46  46  46  GLN GLN A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  ARG 48  48  48  ARG ARG A . n 
A 1 49  ASN 49  49  49  ASN ASN A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  TYR 52  52  52  TYR TYR A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  PHE 57  57  57  PHE PHE A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  MET 62  62  62  MET MET A . n 
A 1 63  ARG 63  63  63  ARG ARG A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  ARG 65  65  65  ARG ARG A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  PRO 67  67  67  PRO PRO A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  PHE 74  74  74  PHE PHE A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  MET 79  79  79  MET MET A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  CYS 81  81  81  CYS CYS A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  LYS 85  85  85  LYS LYS A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  MET 92  92  92  MET MET A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  ARG 95  95  95  ARG ARG A . n 
A 1 96  LYS 96  96  96  LYS LYS A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 GLN 102 102 102 GLN GLN A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 GLY 105 105 105 GLY GLY A . n 
A 1 106 PHE 106 106 106 PHE PHE A . n 
A 1 107 PRO 107 107 107 PRO PRO A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 PHE 110 110 110 PHE PHE A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 PHE 113 113 113 PHE PHE A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 GLN 116 116 116 GLN GLN A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 CYS 122 122 122 CYS CYS A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 PHE 126 126 126 PHE PHE A . n 
A 1 127 PRO 127 127 127 PRO PRO A . n 
A 1 128 ILE 128 128 128 ILE ILE A . n 
A 1 129 ARG 129 129 129 ARG ARG A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 TYR 135 135 135 TYR TYR A . n 
A 1 136 SER 136 136 136 SER SER A . n 
A 1 137 HIS 137 137 137 HIS HIS A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 PHE 140 140 140 PHE PHE A . n 
A 1 141 SER 141 141 141 SER SER A . n 
A 1 142 SER 142 142 142 SER SER A . n 
A 1 143 TYR 143 143 143 TYR TYR A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 GLU 146 146 146 GLU GLU A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 PHE 148 148 148 PHE PHE A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 TYR 153 153 153 TYR TYR A . n 
A 1 154 ARG 154 154 154 ARG ARG A . n 
A 1 155 MET 155 155 155 MET MET A . n 
A 1 156 LYS 156 156 156 LYS LYS A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 LYS 159 159 159 LYS LYS A . n 
A 1 160 ILE 160 160 160 ILE ILE A . n 
A 1 161 VAL 161 161 161 VAL VAL A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 ILE 164 164 164 ILE ILE A . n 
A 1 165 PHE 165 165 165 PHE PHE A . n 
A 1 166 VAL 166 166 166 VAL VAL A . n 
A 1 167 SER 167 167 167 SER SER A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 ILE 170 170 170 ILE ILE A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 THR 173 173 173 THR THR A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 ALA 175 175 175 ALA ALA A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 MET 177 177 177 MET MET A . n 
A 1 178 ARG 178 178 178 ARG ARG A . n 
A 1 179 ASP 179 179 179 ASP ASP A . n 
A 1 180 GLU 180 180 180 GLU GLU A . n 
A 1 181 THR 181 181 181 THR THR A . n 
A 1 182 TYR 182 182 182 TYR TYR A . n 
A 1 183 LYS 183 183 183 LYS LYS A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 ASN 187 187 187 ASN ASN A . n 
A 1 188 ILE 188 188 188 ILE ILE A . n 
A 1 189 TYR 189 189 189 TYR TYR A . n 
A 1 190 PRO 190 190 190 PRO PRO A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 SER 193 193 193 SER SER A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 PHE 195 195 195 PHE PHE A . n 
A 1 196 ARG 196 196 196 ARG ARG A . n 
A 1 197 LYS 197 197 197 LYS LYS A . n 
A 1 198 ILE 198 198 198 ILE ILE A . n 
A 1 199 GLN 199 199 ?   ?   ?   A . n 
A 1 200 GLN 200 200 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   THR 2   2   ?   ?   ?   B . n 
B 1 3   ASP 3   3   ?   ?   ?   B . n 
B 1 4   GLN 4   4   ?   ?   ?   B . n 
B 1 5   GLY 5   5   ?   ?   ?   B . n 
B 1 6   LEU 6   6   ?   ?   ?   B . n 
B 1 7   GLU 7   7   ?   ?   ?   B . n 
B 1 8   GLY 8   8   ?   ?   ?   B . n 
B 1 9   SER 9   9   ?   ?   ?   B . n 
B 1 10  ASN 10  10  ?   ?   ?   B . n 
B 1 11  PRO 11  11  ?   ?   ?   B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  ASP 13  13  13  ASP ASP B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  SER 15  15  15  SER SER B . n 
B 1 16  LYS 16  16  16  LYS LYS B . n 
B 1 17  HIS 17  17  17  HIS HIS B . n 
B 1 18  PRO 18  18  18  PRO PRO B . n 
B 1 19  SER 19  19  19  SER SER B . n 
B 1 20  GLY 20  20  20  GLY GLY B . n 
B 1 21  ILE 21  21  21  ILE ILE B . n 
B 1 22  VAL 22  22  22  VAL VAL B . n 
B 1 23  PRO 23  23  23  PRO PRO B . n 
B 1 24  THR 24  24  24  THR THR B . n 
B 1 25  LEU 25  25  25  LEU LEU B . n 
B 1 26  GLN 26  26  26  GLN GLN B . n 
B 1 27  ASN 27  27  27  ASN ASN B . n 
B 1 28  ILE 28  28  28  ILE ILE B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  THR 31  31  31  THR THR B . n 
B 1 32  VAL 32  32  32  VAL VAL B . n 
B 1 33  ASN 33  33  33  ASN ASN B . n 
B 1 34  LEU 34  34  34  LEU LEU B . n 
B 1 35  ASP 35  35  35  ASP ASP B . n 
B 1 36  CYS 36  36  36  CYS CYS B . n 
B 1 37  LYS 37  37  37  LYS LYS B . n 
B 1 38  LEU 38  38  38  LEU LEU B . n 
B 1 39  ASP 39  39  39  ASP ASP B . n 
B 1 40  LEU 40  40  40  LEU LEU B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  ALA 42  42  42  ALA ALA B . n 
B 1 43  ILE 43  43  43  ILE ILE B . n 
B 1 44  ALA 44  44  44  ALA ALA B . n 
B 1 45  LEU 45  45  45  LEU LEU B . n 
B 1 46  GLN 46  46  46  GLN GLN B . n 
B 1 47  ALA 47  47  47  ALA ALA B . n 
B 1 48  ARG 48  48  48  ARG ARG B . n 
B 1 49  ASN 49  49  49  ASN ASN B . n 
B 1 50  ALA 50  50  50  ALA ALA B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  TYR 52  52  52  TYR TYR B . n 
B 1 53  ASN 53  53  53  ASN ASN B . n 
B 1 54  PRO 54  54  54  PRO PRO B . n 
B 1 55  LYS 55  55  55  LYS LYS B . n 
B 1 56  ARG 56  56  56  ARG ARG B . n 
B 1 57  PHE 57  57  57  PHE PHE B . n 
B 1 58  ALA 58  58  58  ALA ALA B . n 
B 1 59  ALA 59  59  59  ALA ALA B . n 
B 1 60  VAL 60  60  60  VAL VAL B . n 
B 1 61  ILE 61  61  61  ILE ILE B . n 
B 1 62  MET 62  62  62  MET MET B . n 
B 1 63  ARG 63  63  63  ARG ARG B . n 
B 1 64  ILE 64  64  64  ILE ILE B . n 
B 1 65  ARG 65  65  65  ARG ARG B . n 
B 1 66  GLU 66  66  66  GLU GLU B . n 
B 1 67  PRO 67  67  67  PRO PRO B . n 
B 1 68  LYS 68  68  68  LYS LYS B . n 
B 1 69  THR 69  69  69  THR THR B . n 
B 1 70  THR 70  70  70  THR THR B . n 
B 1 71  ALA 71  71  71  ALA ALA B . n 
B 1 72  LEU 72  72  72  LEU LEU B . n 
B 1 73  ILE 73  73  73  ILE ILE B . n 
B 1 74  PHE 74  74  74  PHE PHE B . n 
B 1 75  ALA 75  75  75  ALA ALA B . n 
B 1 76  SER 76  76  76  SER SER B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  LYS 78  78  78  LYS LYS B . n 
B 1 79  MET 79  79  79  MET MET B . n 
B 1 80  VAL 80  80  80  VAL VAL B . n 
B 1 81  CYS 81  81  81  CYS CYS B . n 
B 1 82  THR 82  82  82  THR THR B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  ALA 84  84  84  ALA ALA B . n 
B 1 85  LYS 85  85  85  LYS LYS B . n 
B 1 86  SER 86  86  86  SER SER B . n 
B 1 87  GLU 87  87  87  GLU GLU B . n 
B 1 88  ASP 88  88  88  ASP ASP B . n 
B 1 89  PHE 89  89  89  PHE PHE B . n 
B 1 90  SER 90  90  90  SER SER B . n 
B 1 91  LYS 91  91  91  LYS LYS B . n 
B 1 92  MET 92  92  92  MET MET B . n 
B 1 93  ALA 93  93  93  ALA ALA B . n 
B 1 94  ALA 94  94  94  ALA ALA B . n 
B 1 95  ARG 95  95  95  ARG ARG B . n 
B 1 96  LYS 96  96  96  LYS LYS B . n 
B 1 97  TYR 97  97  97  TYR TYR B . n 
B 1 98  ALA 98  98  98  ALA ALA B . n 
B 1 99  ARG 99  99  99  ARG ARG B . n 
B 1 100 ILE 100 100 100 ILE ILE B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 GLN 102 102 102 GLN GLN B . n 
B 1 103 LYS 103 103 103 LYS LYS B . n 
B 1 104 LEU 104 104 104 LEU LEU B . n 
B 1 105 GLY 105 105 105 GLY GLY B . n 
B 1 106 PHE 106 106 106 PHE PHE B . n 
B 1 107 PRO 107 107 107 PRO PRO B . n 
B 1 108 ALA 108 108 108 ALA ALA B . n 
B 1 109 LYS 109 109 109 LYS LYS B . n 
B 1 110 PHE 110 110 110 PHE PHE B . n 
B 1 111 LYS 111 111 111 LYS LYS B . n 
B 1 112 ASP 112 112 112 ASP ASP B . n 
B 1 113 PHE 113 113 113 PHE PHE B . n 
B 1 114 LYS 114 114 114 LYS LYS B . n 
B 1 115 ILE 115 115 115 ILE ILE B . n 
B 1 116 GLN 116 116 116 GLN GLN B . n 
B 1 117 ASN 117 117 117 ASN ASN B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 VAL 119 119 119 VAL VAL B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 SER 121 121 121 SER SER B . n 
B 1 122 CYS 122 122 122 CYS CYS B . n 
B 1 123 ASP 123 123 123 ASP ASP B . n 
B 1 124 VAL 124 124 124 VAL VAL B . n 
B 1 125 LYS 125 125 125 LYS LYS B . n 
B 1 126 PHE 126 126 126 PHE PHE B . n 
B 1 127 PRO 127 127 127 PRO PRO B . n 
B 1 128 ILE 128 128 128 ILE ILE B . n 
B 1 129 ARG 129 129 129 ARG ARG B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 GLU 131 131 131 GLU GLU B . n 
B 1 132 GLY 132 132 132 GLY GLY B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 ALA 134 134 134 ALA ALA B . n 
B 1 135 TYR 135 135 135 TYR TYR B . n 
B 1 136 SER 136 136 136 SER SER B . n 
B 1 137 HIS 137 137 137 HIS HIS B . n 
B 1 138 ALA 138 138 138 ALA ALA B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 PHE 140 140 140 PHE PHE B . n 
B 1 141 SER 141 141 141 SER SER B . n 
B 1 142 SER 142 142 142 SER SER B . n 
B 1 143 TYR 143 143 143 TYR TYR B . n 
B 1 144 GLU 144 144 144 GLU GLU B . n 
B 1 145 PRO 145 145 145 PRO PRO B . n 
B 1 146 GLU 146 146 146 GLU GLU B . n 
B 1 147 LEU 147 147 147 LEU LEU B . n 
B 1 148 PHE 148 148 148 PHE PHE B . n 
B 1 149 PRO 149 149 149 PRO PRO B . n 
B 1 150 GLY 150 150 150 GLY GLY B . n 
B 1 151 LEU 151 151 151 LEU LEU B . n 
B 1 152 ILE 152 152 152 ILE ILE B . n 
B 1 153 TYR 153 153 153 TYR TYR B . n 
B 1 154 ARG 154 154 154 ARG ARG B . n 
B 1 155 MET 155 155 155 MET MET B . n 
B 1 156 LYS 156 156 156 LYS LYS B . n 
B 1 157 VAL 157 157 157 VAL VAL B . n 
B 1 158 PRO 158 158 158 PRO PRO B . n 
B 1 159 LYS 159 159 159 LYS LYS B . n 
B 1 160 ILE 160 160 160 ILE ILE B . n 
B 1 161 VAL 161 161 161 VAL VAL B . n 
B 1 162 LEU 162 162 162 LEU LEU B . n 
B 1 163 LEU 163 163 163 LEU LEU B . n 
B 1 164 ILE 164 164 164 ILE ILE B . n 
B 1 165 PHE 165 165 165 PHE PHE B . n 
B 1 166 VAL 166 166 166 VAL VAL B . n 
B 1 167 SER 167 167 167 SER SER B . n 
B 1 168 GLY 168 168 168 GLY GLY B . n 
B 1 169 LYS 169 169 169 LYS LYS B . n 
B 1 170 ILE 170 170 170 ILE ILE B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 ILE 172 172 172 ILE ILE B . n 
B 1 173 THR 173 173 173 THR THR B . n 
B 1 174 GLY 174 174 174 GLY GLY B . n 
B 1 175 ALA 175 175 175 ALA ALA B . n 
B 1 176 LYS 176 176 176 LYS LYS B . n 
B 1 177 MET 177 177 177 MET MET B . n 
B 1 178 ARG 178 178 178 ARG ARG B . n 
B 1 179 ASP 179 179 179 ASP ASP B . n 
B 1 180 GLU 180 180 180 GLU GLU B . n 
B 1 181 THR 181 181 181 THR THR B . n 
B 1 182 TYR 182 182 182 TYR TYR B . n 
B 1 183 LYS 183 183 183 LYS LYS B . n 
B 1 184 ALA 184 184 184 ALA ALA B . n 
B 1 185 PHE 185 185 185 PHE PHE B . n 
B 1 186 GLU 186 186 186 GLU GLU B . n 
B 1 187 ASN 187 187 187 ASN ASN B . n 
B 1 188 ILE 188 188 188 ILE ILE B . n 
B 1 189 TYR 189 189 189 TYR TYR B . n 
B 1 190 PRO 190 190 190 PRO PRO B . n 
B 1 191 VAL 191 191 191 VAL VAL B . n 
B 1 192 LEU 192 192 192 LEU LEU B . n 
B 1 193 SER 193 193 193 SER SER B . n 
B 1 194 GLU 194 194 194 GLU GLU B . n 
B 1 195 PHE 195 195 195 PHE PHE B . n 
B 1 196 ARG 196 196 196 ARG ARG B . n 
B 1 197 LYS 197 197 197 LYS LYS B . n 
B 1 198 ILE 198 198 198 ILE ILE B . n 
B 1 199 GLN 199 199 ?   ?   ?   B . n 
B 1 200 GLN 200 200 ?   ?   ?   B . n 
C 2 1   DG  1   201 201 DG  DG  C . n 
C 2 2   DC  2   202 202 DC  DC  C . n 
C 2 3   DA  3   203 203 DA  DA  C . n 
C 2 4   DA  4   204 204 DA  DA  C . n 
C 2 5   DT  5   205 205 DT  DT  C . n 
C 2 6   DA  6   206 206 DA  DA  C . n 
C 2 7   DA  7   207 207 DA  DA  C . n 
C 2 8   DA  8   208 208 DA  DA  C . n 
C 2 9   DA  9   209 209 DA  DA  C . n 
C 2 10  DG  10  210 210 DG  DG  C . n 
C 2 11  DG  11  211 211 DG  DG  C . n 
C 2 12  DG  12  212 212 DG  DG  C . n 
C 2 13  DC  13  213 213 DC  DC  C . n 
C 2 14  DA  14  214 214 DA  DA  C . n 
D 3 1   DT  1   215 215 DT  DT  D . n 
D 3 2   DG  2   216 216 DG  DG  D . n 
D 3 3   DC  3   217 217 DC  DC  D . n 
D 3 4   DC  4   218 218 DC  DC  D . n 
D 3 5   DC  5   219 219 DC  DC  D . n 
D 3 6   DT  6   220 220 DT  DT  D . n 
D 3 7   DT  7   221 221 DT  DT  D . n 
D 3 8   DT  8   222 222 DT  DT  D . n 
D 3 9   DT  9   223 223 DT  DT  D . n 
D 3 10  DA  10  224 224 DA  DA  D . n 
D 3 11  DT  11  225 225 DT  DT  D . n 
D 3 12  DT  12  226 226 DT  DT  D . n 
D 3 13  DG  13  227 227 DG  DG  D . n 
D 3 14  DC  14  228 228 DC  DC  D . n 
E 2 1   DG  1   201 201 DG  DG  E . n 
E 2 2   DC  2   202 202 DC  DC  E . n 
E 2 3   DA  3   203 203 DA  DA  E . n 
E 2 4   DA  4   204 204 DA  DA  E . n 
E 2 5   DT  5   205 205 DT  DT  E . n 
E 2 6   DA  6   206 206 DA  DA  E . n 
E 2 7   DA  7   207 207 DA  DA  E . n 
E 2 8   DA  8   208 208 DA  DA  E . n 
E 2 9   DA  9   209 209 DA  DA  E . n 
E 2 10  DG  10  210 210 DG  DG  E . n 
E 2 11  DG  11  211 211 DG  DG  E . n 
E 2 12  DG  12  212 212 DG  DG  E . n 
E 2 13  DC  13  213 213 DC  DC  E . n 
E 2 14  DA  14  214 214 DA  DA  E . n 
F 3 1   DT  1   215 215 DT  DT  F . n 
F 3 2   DG  2   216 216 DG  DG  F . n 
F 3 3   DC  3   217 217 DC  DC  F . n 
F 3 4   DC  4   218 218 DC  DC  F . n 
F 3 5   DC  5   219 219 DC  DC  F . n 
F 3 6   DT  6   220 220 DT  DT  F . n 
F 3 7   DT  7   221 221 DT  DT  F . n 
F 3 8   DT  8   222 222 DT  DT  F . n 
F 3 9   DT  9   223 223 DT  DT  F . n 
F 3 10  DA  10  224 224 DA  DA  F . n 
F 3 11  DT  11  225 225 DT  DT  F . n 
F 3 12  DT  12  226 226 DT  DT  F . n 
F 3 13  DG  13  227 227 DG  DG  F . n 
F 3 14  DC  14  228 228 DC  DC  F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 HOH 1  2001 2001 HOH HOH A . 
G 4 HOH 2  2002 2002 HOH HOH A . 
G 4 HOH 3  2003 2003 HOH HOH A . 
G 4 HOH 4  2004 2004 HOH HOH A . 
G 4 HOH 5  2005 2005 HOH HOH A . 
G 4 HOH 6  2006 2006 HOH HOH A . 
G 4 HOH 7  2007 2007 HOH HOH A . 
G 4 HOH 8  2008 2008 HOH HOH A . 
G 4 HOH 9  2009 2009 HOH HOH A . 
G 4 HOH 10 2010 2010 HOH HOH A . 
G 4 HOH 11 2011 2011 HOH HOH A . 
G 4 HOH 12 2012 2012 HOH HOH A . 
G 4 HOH 13 2013 2013 HOH HOH A . 
G 4 HOH 14 2014 2014 HOH HOH A . 
G 4 HOH 15 2015 2015 HOH HOH A . 
G 4 HOH 16 2016 2016 HOH HOH A . 
G 4 HOH 17 2017 2017 HOH HOH A . 
G 4 HOH 18 2018 2018 HOH HOH A . 
G 4 HOH 19 2019 2019 HOH HOH A . 
G 4 HOH 20 2020 2020 HOH HOH A . 
G 4 HOH 21 2021 2021 HOH HOH A . 
G 4 HOH 22 2022 2022 HOH HOH A . 
G 4 HOH 23 2023 2023 HOH HOH A . 
G 4 HOH 24 2024 2024 HOH HOH A . 
G 4 HOH 25 2025 2025 HOH HOH A . 
G 4 HOH 26 2026 2026 HOH HOH A . 
G 4 HOH 27 2027 2027 HOH HOH A . 
G 4 HOH 28 2028 2028 HOH HOH A . 
G 4 HOH 29 2029 2029 HOH HOH A . 
G 4 HOH 30 2030 2030 HOH HOH A . 
G 4 HOH 31 2031 2031 HOH HOH A . 
G 4 HOH 32 2032 2032 HOH HOH A . 
G 4 HOH 33 2033 2033 HOH HOH A . 
G 4 HOH 34 2034 2034 HOH HOH A . 
G 4 HOH 35 2035 2035 HOH HOH A . 
G 4 HOH 36 2036 2036 HOH HOH A . 
G 4 HOH 37 2037 2037 HOH HOH A . 
G 4 HOH 38 2038 2038 HOH HOH A . 
G 4 HOH 39 2039 2039 HOH HOH A . 
G 4 HOH 40 2040 2040 HOH HOH A . 
G 4 HOH 41 2041 2041 HOH HOH A . 
G 4 HOH 42 2042 2042 HOH HOH A . 
G 4 HOH 43 2043 2043 HOH HOH A . 
G 4 HOH 44 2044 2044 HOH HOH A . 
G 4 HOH 45 2045 2045 HOH HOH A . 
G 4 HOH 46 2046 2046 HOH HOH A . 
G 4 HOH 47 2047 2047 HOH HOH A . 
G 4 HOH 48 2048 2048 HOH HOH A . 
G 4 HOH 49 2049 2049 HOH HOH A . 
G 4 HOH 50 2050 2050 HOH HOH A . 
G 4 HOH 51 2051 2051 HOH HOH A . 
G 4 HOH 52 2052 2052 HOH HOH A . 
G 4 HOH 53 2053 2053 HOH HOH A . 
G 4 HOH 54 2054 2054 HOH HOH A . 
G 4 HOH 55 2055 2055 HOH HOH A . 
G 4 HOH 56 2056 2056 HOH HOH A . 
G 4 HOH 57 2057 2057 HOH HOH A . 
G 4 HOH 58 2058 2058 HOH HOH A . 
G 4 HOH 59 2059 2059 HOH HOH A . 
G 4 HOH 60 2060 2060 HOH HOH A . 
G 4 HOH 61 2061 2061 HOH HOH A . 
G 4 HOH 62 2062 2062 HOH HOH A . 
G 4 HOH 63 2063 2063 HOH HOH A . 
G 4 HOH 64 2064 2064 HOH HOH A . 
G 4 HOH 65 2065 2065 HOH HOH A . 
G 4 HOH 66 2066 2066 HOH HOH A . 
G 4 HOH 67 2067 2067 HOH HOH A . 
G 4 HOH 68 2068 2068 HOH HOH A . 
G 4 HOH 69 2069 2069 HOH HOH A . 
G 4 HOH 70 2070 2070 HOH HOH A . 
G 4 HOH 71 2071 2071 HOH HOH A . 
G 4 HOH 72 2072 2072 HOH HOH A . 
G 4 HOH 73 2073 2073 HOH HOH A . 
G 4 HOH 74 2074 2074 HOH HOH A . 
H 4 HOH 1  2001 2001 HOH HOH B . 
H 4 HOH 2  2002 2002 HOH HOH B . 
H 4 HOH 3  2003 2003 HOH HOH B . 
H 4 HOH 4  2004 2004 HOH HOH B . 
H 4 HOH 5  2005 2005 HOH HOH B . 
H 4 HOH 6  2006 2006 HOH HOH B . 
H 4 HOH 7  2007 2007 HOH HOH B . 
H 4 HOH 8  2008 2008 HOH HOH B . 
H 4 HOH 9  2009 2009 HOH HOH B . 
H 4 HOH 10 2010 2010 HOH HOH B . 
H 4 HOH 11 2011 2011 HOH HOH B . 
H 4 HOH 12 2012 2012 HOH HOH B . 
H 4 HOH 13 2013 2013 HOH HOH B . 
H 4 HOH 14 2014 2014 HOH HOH B . 
H 4 HOH 15 2015 2015 HOH HOH B . 
H 4 HOH 16 2016 2016 HOH HOH B . 
H 4 HOH 17 2017 2017 HOH HOH B . 
H 4 HOH 18 2018 2018 HOH HOH B . 
H 4 HOH 19 2019 2019 HOH HOH B . 
H 4 HOH 20 2020 2020 HOH HOH B . 
H 4 HOH 21 2021 2021 HOH HOH B . 
H 4 HOH 22 2022 2022 HOH HOH B . 
H 4 HOH 23 2023 2023 HOH HOH B . 
H 4 HOH 24 2024 2024 HOH HOH B . 
H 4 HOH 25 2025 2025 HOH HOH B . 
H 4 HOH 26 2026 2026 HOH HOH B . 
H 4 HOH 27 2027 2027 HOH HOH B . 
H 4 HOH 28 2028 2028 HOH HOH B . 
H 4 HOH 29 2029 2029 HOH HOH B . 
H 4 HOH 30 2030 2030 HOH HOH B . 
H 4 HOH 31 2031 2031 HOH HOH B . 
H 4 HOH 32 2032 2032 HOH HOH B . 
H 4 HOH 33 2033 2033 HOH HOH B . 
H 4 HOH 34 2034 2034 HOH HOH B . 
H 4 HOH 35 2035 2035 HOH HOH B . 
H 4 HOH 36 2036 2036 HOH HOH B . 
H 4 HOH 37 2037 2037 HOH HOH B . 
H 4 HOH 38 2038 2038 HOH HOH B . 
H 4 HOH 39 2039 2039 HOH HOH B . 
H 4 HOH 40 2040 2040 HOH HOH B . 
H 4 HOH 41 2041 2041 HOH HOH B . 
H 4 HOH 42 2042 2042 HOH HOH B . 
H 4 HOH 43 2043 2043 HOH HOH B . 
H 4 HOH 44 2044 2044 HOH HOH B . 
H 4 HOH 45 2045 2045 HOH HOH B . 
H 4 HOH 46 2046 2046 HOH HOH B . 
H 4 HOH 47 2047 2047 HOH HOH B . 
H 4 HOH 48 2048 2048 HOH HOH B . 
H 4 HOH 49 2049 2049 HOH HOH B . 
H 4 HOH 50 2050 2050 HOH HOH B . 
H 4 HOH 51 2051 2051 HOH HOH B . 
H 4 HOH 52 2052 2052 HOH HOH B . 
H 4 HOH 53 2053 2053 HOH HOH B . 
H 4 HOH 54 2054 2054 HOH HOH B . 
H 4 HOH 55 2055 2055 HOH HOH B . 
H 4 HOH 56 2056 2056 HOH HOH B . 
H 4 HOH 57 2057 2057 HOH HOH B . 
H 4 HOH 58 2058 2058 HOH HOH B . 
H 4 HOH 59 2059 2059 HOH HOH B . 
H 4 HOH 60 2060 2060 HOH HOH B . 
H 4 HOH 61 2061 2061 HOH HOH B . 
H 4 HOH 62 2062 2062 HOH HOH B . 
H 4 HOH 63 2063 2063 HOH HOH B . 
H 4 HOH 64 2064 2064 HOH HOH B . 
H 4 HOH 65 2065 2065 HOH HOH B . 
H 4 HOH 66 2066 2066 HOH HOH B . 
H 4 HOH 67 2067 2067 HOH HOH B . 
H 4 HOH 68 2068 2068 HOH HOH B . 
H 4 HOH 69 2069 2069 HOH HOH B . 
H 4 HOH 70 2070 2070 HOH HOH B . 
H 4 HOH 71 2071 2071 HOH HOH B . 
H 4 HOH 72 2072 2072 HOH HOH B . 
H 4 HOH 73 2073 2073 HOH HOH B . 
H 4 HOH 74 2074 2074 HOH HOH B . 
H 4 HOH 75 2075 2075 HOH HOH B . 
H 4 HOH 76 2076 2076 HOH HOH B . 
H 4 HOH 77 2077 2077 HOH HOH B . 
H 4 HOH 78 2078 2078 HOH HOH B . 
H 4 HOH 79 2079 2079 HOH HOH B . 
H 4 HOH 80 2080 2080 HOH HOH B . 
H 4 HOH 81 2081 2081 HOH HOH B . 
H 4 HOH 82 2082 2082 HOH HOH B . 
H 4 HOH 83 2083 2083 HOH HOH B . 
H 4 HOH 84 2084 2084 HOH HOH B . 
H 4 HOH 85 2085 2085 HOH HOH B . 
H 4 HOH 86 2086 2086 HOH HOH B . 
H 4 HOH 87 2087 2087 HOH HOH B . 
H 4 HOH 88 2088 2088 HOH HOH B . 
H 4 HOH 89 2089 2089 HOH HOH B . 
H 4 HOH 90 2090 2090 HOH HOH B . 
I 4 HOH 1  2001 2001 HOH HOH C . 
I 4 HOH 2  2002 2002 HOH HOH C . 
I 4 HOH 3  2003 2003 HOH HOH C . 
I 4 HOH 4  2004 2004 HOH HOH C . 
I 4 HOH 5  2005 2005 HOH HOH C . 
I 4 HOH 6  2006 2006 HOH HOH C . 
I 4 HOH 7  2007 2007 HOH HOH C . 
I 4 HOH 8  2008 2008 HOH HOH C . 
I 4 HOH 9  2009 2009 HOH HOH C . 
I 4 HOH 10 2010 2010 HOH HOH C . 
I 4 HOH 11 2011 2011 HOH HOH C . 
I 4 HOH 12 2012 2012 HOH HOH C . 
I 4 HOH 13 2013 2013 HOH HOH C . 
I 4 HOH 14 2014 2014 HOH HOH C . 
I 4 HOH 15 2015 2015 HOH HOH C . 
I 4 HOH 16 2016 2016 HOH HOH C . 
I 4 HOH 17 2017 2017 HOH HOH C . 
I 4 HOH 18 2018 2018 HOH HOH C . 
I 4 HOH 19 2019 2019 HOH HOH C . 
I 4 HOH 20 2020 2020 HOH HOH C . 
I 4 HOH 21 2021 2021 HOH HOH C . 
I 4 HOH 22 2022 2022 HOH HOH C . 
I 4 HOH 23 2023 2023 HOH HOH C . 
I 4 HOH 24 2024 2024 HOH HOH C . 
I 4 HOH 25 2025 2025 HOH HOH C . 
I 4 HOH 26 2026 2026 HOH HOH C . 
I 4 HOH 27 2027 2027 HOH HOH C . 
I 4 HOH 28 2028 2028 HOH HOH C . 
I 4 HOH 29 2029 2029 HOH HOH C . 
I 4 HOH 30 2030 2030 HOH HOH C . 
J 4 HOH 1  2001 2001 HOH HOH D . 
J 4 HOH 2  2002 2002 HOH HOH D . 
J 4 HOH 3  2003 2003 HOH HOH D . 
J 4 HOH 4  2004 2004 HOH HOH D . 
J 4 HOH 5  2005 2005 HOH HOH D . 
J 4 HOH 6  2006 2006 HOH HOH D . 
J 4 HOH 7  2007 2007 HOH HOH D . 
J 4 HOH 8  2008 2008 HOH HOH D . 
J 4 HOH 9  2009 2009 HOH HOH D . 
J 4 HOH 10 2010 2010 HOH HOH D . 
J 4 HOH 11 2011 2011 HOH HOH D . 
J 4 HOH 12 2012 2012 HOH HOH D . 
J 4 HOH 13 2013 2013 HOH HOH D . 
J 4 HOH 14 2014 2014 HOH HOH D . 
J 4 HOH 15 2015 2015 HOH HOH D . 
J 4 HOH 16 2016 2016 HOH HOH D . 
J 4 HOH 17 2017 2017 HOH HOH D . 
J 4 HOH 18 2018 2018 HOH HOH D . 
J 4 HOH 19 2019 2019 HOH HOH D . 
J 4 HOH 20 2020 2020 HOH HOH D . 
J 4 HOH 21 2021 2021 HOH HOH D . 
K 4 HOH 1  2001 2001 HOH HOH E . 
K 4 HOH 2  2002 2002 HOH HOH E . 
K 4 HOH 3  2003 2003 HOH HOH E . 
K 4 HOH 4  2004 2004 HOH HOH E . 
K 4 HOH 5  2005 2005 HOH HOH E . 
K 4 HOH 6  2006 2006 HOH HOH E . 
K 4 HOH 7  2007 2007 HOH HOH E . 
K 4 HOH 8  2008 2008 HOH HOH E . 
K 4 HOH 9  2009 2009 HOH HOH E . 
K 4 HOH 10 2010 2010 HOH HOH E . 
K 4 HOH 11 2011 2011 HOH HOH E . 
K 4 HOH 12 2012 2012 HOH HOH E . 
K 4 HOH 13 2013 2013 HOH HOH E . 
K 4 HOH 14 2014 2014 HOH HOH E . 
K 4 HOH 15 2015 2015 HOH HOH E . 
K 4 HOH 16 2016 2016 HOH HOH E . 
K 4 HOH 17 2017 2017 HOH HOH E . 
K 4 HOH 18 2018 2018 HOH HOH E . 
K 4 HOH 19 2019 2019 HOH HOH E . 
K 4 HOH 20 2020 2020 HOH HOH E . 
K 4 HOH 21 2021 2021 HOH HOH E . 
K 4 HOH 22 2022 2022 HOH HOH E . 
K 4 HOH 23 2023 2023 HOH HOH E . 
K 4 HOH 24 2024 2024 HOH HOH E . 
K 4 HOH 25 2025 2025 HOH HOH E . 
K 4 HOH 26 2026 2026 HOH HOH E . 
K 4 HOH 27 2027 2027 HOH HOH E . 
K 4 HOH 28 2028 2028 HOH HOH E . 
L 4 HOH 1  2001 2001 HOH HOH F . 
L 4 HOH 2  2002 2002 HOH HOH F . 
L 4 HOH 3  2003 2003 HOH HOH F . 
L 4 HOH 4  2004 2004 HOH HOH F . 
L 4 HOH 5  2005 2005 HOH HOH F . 
L 4 HOH 6  2006 2006 HOH HOH F . 
L 4 HOH 7  2007 2007 HOH HOH F . 
L 4 HOH 8  2008 2008 HOH HOH F . 
L 4 HOH 9  2009 2009 HOH HOH F . 
L 4 HOH 10 2010 2010 HOH HOH F . 
L 4 HOH 11 2011 2011 HOH HOH F . 
L 4 HOH 12 2012 2012 HOH HOH F . 
L 4 HOH 13 2013 2013 HOH HOH F . 
L 4 HOH 14 2014 2014 HOH HOH F . 
L 4 HOH 15 2015 2015 HOH HOH F . 
L 4 HOH 16 2016 2016 HOH HOH F . 
L 4 HOH 17 2017 2017 HOH HOH F . 
L 4 HOH 18 2018 2018 HOH HOH F . 
L 4 HOH 19 2019 2019 HOH HOH F . 
L 4 HOH 20 2020 2020 HOH HOH F . 
L 4 HOH 21 2021 2021 HOH HOH F . 
L 4 HOH 22 2022 2022 HOH HOH F . 
L 4 HOH 23 2023 2023 HOH HOH F . 
L 4 HOH 24 2024 2024 HOH HOH F . 
L 4 HOH 25 2025 2025 HOH HOH F . 
L 4 HOH 26 2026 2026 HOH HOH F . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 software_defined_assembly PQS trimeric 3 
2 software_defined_assembly PQS trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G,I,J 
2 1 B,E,F,H,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4930  ? 
1 MORE         -11.0 ? 
1 'SSA (A^2)'  14870 ? 
2 'ABSA (A^2)' 4880  ? 
2 MORE         -11.2 ? 
2 'SSA (A^2)'  15200 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-02-07 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    refinement       . ? 1 
DENZO     'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
X-PLOR    phasing          . ? 4 
# 
_pdbx_entry_details.entry_id             1QNC 
_pdbx_entry_details.compound_details     
;DNA MOLECULES BOUND WITHIN THE SERIES

        CHAIN C, E        CHAIN D, F
  1QN3 GCTATAAACGGGCA   TGCCCGTTTATAGC
  1QN4 GCTATAAAATGGCA   TGCCATTTTATAGC
  1QN5 GCTATAAGAGGGCA   TGCCCTCTTATAGC
  1QN6 GCTATAATAGGGCA   TGCCCTATTATAGC
  1QN7 GCTATATAAGGGCA   TGCCCTTATATAGC
  1QN8 GCTATTAAAGGGCA   TGCCCTTTAATAGC
  1QN9 GCTACAAAAGGGCA   TGCCCTTTTGTAGC
  1QNA GCTTTAAAAGGGCA   TGCCCTTTTAAAGC
  1QNB GCTATAAATGGGCA   TGCCCATTTATAGC
  1QNC GCAATAAAAGGGCA   TGCCCTTTTATTGC
  1QNE GCTATAAAAGGGCA   TGCCCTTTTATAGC
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NE  B ARG 65 ? ? O B HOH 2025 ? ? 0.79 
2 1 CD  B ARG 65 ? ? O B HOH 2025 ? ? 0.89 
3 1 CZ  B ARG 65 ? ? O B HOH 2025 ? ? 1.59 
4 1 NE  A ARG 48 ? ? O A HOH 2011 ? ? 1.85 
5 1 CD  A ARG 48 ? ? O A HOH 2011 ? ? 1.96 
6 1 CB  A ARG 48 ? ? O A HOH 2011 ? ? 2.08 
7 1 NH1 B ARG 65 ? ? O B HOH 2025 ? ? 2.08 
8 1 CG  B ARG 65 ? ? O B HOH 2025 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1  1 "O3'" E DG  201 ? ? 1_555 O2    F DT 215 ? ? 2_657 0.73 
2  1 "O5'" E DC  202 ? ? 1_555 "C1'" F DT 215 ? ? 2_657 0.83 
3  1 CD    B ARG 48  ? ? 1_555 OP1   E DA 208 ? ? 2_757 0.86 
4  1 "C5'" E DC  202 ? ? 1_555 "O4'" F DT 215 ? ? 2_657 0.92 
5  1 "O5'" E DC  202 ? ? 1_555 N1    F DT 215 ? ? 2_657 1.11 
6  1 CZ    A ARG 48  ? ? 1_555 OP1   C DA 208 ? ? 2_746 1.40 
7  1 "O5'" E DC  202 ? ? 1_555 "O4'" F DT 215 ? ? 2_657 1.48 
8  1 NH2   A ARG 48  ? ? 1_555 OP1   C DA 208 ? ? 2_746 1.51 
9  1 "O3'" E DG  201 ? ? 1_555 C2    F DT 215 ? ? 2_657 1.60 
10 1 N2    C DG  201 ? ? 1_555 C2    D DT 215 ? ? 2_646 1.61 
11 1 N2    C DG  201 ? ? 1_555 N3    D DT 215 ? ? 2_646 1.68 
12 1 "C3'" E DG  201 ? ? 1_555 O2    F DT 215 ? ? 2_657 1.69 
13 1 P     E DC  202 ? ? 1_555 "C1'" F DT 215 ? ? 2_657 1.74 
14 1 NH1   A ARG 65  ? ? 1_555 C2    C DG 210 ? ? 2_746 1.81 
15 1 "C2'" E DG  201 ? ? 1_555 N3    F DT 215 ? ? 2_657 1.81 
16 1 "C5'" E DC  202 ? ? 1_555 "C1'" F DT 215 ? ? 2_657 1.83 
17 1 NE    B ARG 48  ? ? 1_555 OP1   E DA 208 ? ? 2_757 1.83 
18 1 CZ    A ARG 65  ? ? 1_555 N2    C DG 210 ? ? 2_746 1.86 
19 1 NE    A ARG 48  ? ? 1_555 OP1   C DA 208 ? ? 2_746 1.88 
20 1 N2    C DG  201 ? ? 1_555 O2    D DT 215 ? ? 2_646 1.94 
21 1 "O5'" E DC  202 ? ? 1_555 C6    F DT 215 ? ? 2_657 2.05 
22 1 NE    A ARG 65  ? ? 1_555 N2    C DG 210 ? ? 2_746 2.06 
23 1 NH1   A ARG 65  ? ? 1_555 N2    C DG 210 ? ? 2_746 2.07 
24 1 OP1   E DC  202 ? ? 1_555 "C1'" F DT 215 ? ? 2_657 2.08 
25 1 NH1   B ARG 48  ? ? 1_555 OP2   E DA 208 ? ? 2_757 2.10 
26 1 CZ    A ARG 65  ? ? 1_555 C2    C DG 210 ? ? 2_746 2.15 
27 1 P     E DC  202 ? ? 1_555 O2    F DT 215 ? ? 2_657 2.16 
28 1 "C3'" E DG  201 ? ? 1_555 C2    F DT 215 ? ? 2_657 2.16 
29 1 "O5'" E DC  202 ? ? 1_555 C2    F DT 215 ? ? 2_657 2.18 
30 1 "C2'" E DG  201 ? ? 1_555 O2    F DT 215 ? ? 2_657 2.19 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            C5 
_pdbx_validate_rmsd_bond.auth_asym_id_1            D 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DT 
_pdbx_validate_rmsd_bond.auth_seq_id_1             222 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            C7 
_pdbx_validate_rmsd_bond.auth_asym_id_2            D 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DT 
_pdbx_validate_rmsd_bond.auth_seq_id_2             222 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.533 
_pdbx_validate_rmsd_bond.bond_target_value         1.496 
_pdbx_validate_rmsd_bond.bond_deviation            0.037 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.006 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" C DG 201 ? ? "C1'" C DG 201 ? ? N9    C DG 201 ? ? 110.23 108.30 1.93  0.30 N 
2  1 "O4'" C DC 202 ? ? "C4'" C DC 202 ? ? "C3'" C DC 202 ? ? 101.94 104.50 -2.56 0.40 N 
3  1 "O4'" C DC 202 ? ? "C1'" C DC 202 ? ? N1    C DC 202 ? ? 111.87 108.30 3.57  0.30 N 
4  1 C6    C DT 205 ? ? C5    C DT 205 ? ? C7    C DT 205 ? ? 118.64 122.90 -4.26 0.60 N 
5  1 "O4'" C DA 207 ? ? "C1'" C DA 207 ? ? N9    C DA 207 ? ? 110.43 108.30 2.13  0.30 N 
6  1 "O4'" C DA 208 ? ? "C1'" C DA 208 ? ? N9    C DA 208 ? ? 110.15 108.30 1.85  0.30 N 
7  1 "O4'" C DA 209 ? ? "C1'" C DA 209 ? ? N9    C DA 209 ? ? 112.11 108.30 3.81  0.30 N 
8  1 "O4'" C DG 210 ? ? "C1'" C DG 210 ? ? N9    C DG 210 ? ? 110.28 108.30 1.98  0.30 N 
9  1 "O4'" C DA 214 ? ? "C1'" C DA 214 ? ? N9    C DA 214 ? ? 111.60 108.30 3.30  0.30 N 
10 1 C6    D DT 215 ? ? C5    D DT 215 ? ? C7    D DT 215 ? ? 119.17 122.90 -3.73 0.60 N 
11 1 "O4'" D DG 216 ? ? "C1'" D DG 216 ? ? N9    D DG 216 ? ? 111.65 108.30 3.35  0.30 N 
12 1 "O4'" D DC 217 ? ? "C1'" D DC 217 ? ? "C2'" D DC 217 ? ? 101.08 105.90 -4.82 0.80 N 
13 1 "O4'" D DC 217 ? ? "C1'" D DC 217 ? ? N1    D DC 217 ? ? 110.48 108.30 2.18  0.30 N 
14 1 "O4'" D DC 218 ? ? "C1'" D DC 218 ? ? N1    D DC 218 ? ? 113.47 108.30 5.17  0.30 N 
15 1 C6    D DT 221 ? ? C5    D DT 221 ? ? C7    D DT 221 ? ? 118.80 122.90 -4.10 0.60 N 
16 1 C6    D DT 222 ? ? C5    D DT 222 ? ? C7    D DT 222 ? ? 118.89 122.90 -4.01 0.60 N 
17 1 "O4'" D DA 224 ? ? "C1'" D DA 224 ? ? N9    D DA 224 ? ? 111.55 108.30 3.25  0.30 N 
18 1 "O4'" D DG 227 ? ? "C1'" D DG 227 ? ? N9    D DG 227 ? ? 110.19 108.30 1.89  0.30 N 
19 1 "O4'" D DC 228 ? ? "C1'" D DC 228 ? ? N1    D DC 228 ? ? 110.48 108.30 2.18  0.30 N 
20 1 "O4'" E DC 202 ? ? "C4'" E DC 202 ? ? "C3'" E DC 202 ? ? 101.62 104.50 -2.88 0.40 N 
21 1 "C1'" E DC 202 ? ? "O4'" E DC 202 ? ? "C4'" E DC 202 ? ? 102.98 110.10 -7.12 1.00 N 
22 1 "O4'" E DC 202 ? ? "C1'" E DC 202 ? ? N1    E DC 202 ? ? 112.94 108.30 4.64  0.30 N 
23 1 "O4'" E DA 207 ? ? "C1'" E DA 207 ? ? N9    E DA 207 ? ? 110.78 108.30 2.48  0.30 N 
24 1 "O4'" E DA 208 ? ? "C1'" E DA 208 ? ? N9    E DA 208 ? ? 110.35 108.30 2.05  0.30 N 
25 1 "O4'" E DA 209 ? ? "C1'" E DA 209 ? ? N9    E DA 209 ? ? 111.39 108.30 3.09  0.30 N 
26 1 "O4'" E DA 214 ? ? "C1'" E DA 214 ? ? N9    E DA 214 ? ? 111.53 108.30 3.23  0.30 N 
27 1 "C4'" F DT 215 ? ? "C3'" F DT 215 ? ? "C2'" F DT 215 ? ? 97.54  102.20 -4.66 0.70 N 
28 1 "O4'" F DT 215 ? ? "C1'" F DT 215 ? ? N1    F DT 215 ? ? 112.75 108.30 4.45  0.30 N 
29 1 C4    F DT 215 ? ? C5    F DT 215 ? ? C6    F DT 215 ? ? 121.67 118.00 3.67  0.60 N 
30 1 C6    F DT 215 ? ? C5    F DT 215 ? ? C7    F DT 215 ? ? 118.95 122.90 -3.95 0.60 N 
31 1 "O4'" F DG 216 ? ? "C4'" F DG 216 ? ? "C3'" F DG 216 ? ? 101.84 104.50 -2.66 0.40 N 
32 1 "C1'" F DG 216 ? ? "O4'" F DG 216 ? ? "C4'" F DG 216 ? ? 103.19 110.10 -6.91 1.00 N 
33 1 "O4'" F DG 216 ? ? "C1'" F DG 216 ? ? N9    F DG 216 ? ? 112.78 108.30 4.48  0.30 N 
34 1 "O4'" F DC 217 ? ? "C1'" F DC 217 ? ? N1    F DC 217 ? ? 112.56 108.30 4.26  0.30 N 
35 1 "O4'" F DC 218 ? ? "C1'" F DC 218 ? ? N1    F DC 218 ? ? 112.43 108.30 4.13  0.30 N 
36 1 C6    F DT 220 ? ? C5    F DT 220 ? ? C7    F DT 220 ? ? 118.70 122.90 -4.20 0.60 N 
37 1 C6    F DT 221 ? ? C5    F DT 221 ? ? C7    F DT 221 ? ? 119.15 122.90 -3.75 0.60 N 
38 1 C6    F DT 222 ? ? C5    F DT 222 ? ? C7    F DT 222 ? ? 118.99 122.90 -3.91 0.60 N 
39 1 "O4'" F DT 223 ? ? "C4'" F DT 223 ? ? "C3'" F DT 223 ? ? 101.84 104.50 -2.66 0.40 N 
40 1 C6    F DT 225 ? ? C5    F DT 225 ? ? C7    F DT 225 ? ? 119.14 122.90 -3.76 0.60 N 
41 1 "O4'" F DG 227 ? ? "C1'" F DG 227 ? ? N9    F DG 227 ? ? 113.09 108.30 4.79  0.30 N 
42 1 "O4'" F DC 228 ? ? "C4'" F DC 228 ? ? "C3'" F DC 228 ? ? 101.69 104.50 -2.81 0.40 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 49  ? ? -79.35  44.98  
2 1 ASN A 53  ? ? -163.24 92.41  
3 1 PRO A 149 ? ? -69.20  3.15   
4 1 CYS B 36  ? ? -179.83 132.06 
5 1 ALA B 58  ? ? -75.91  23.61  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 B GLU 131 ? CG    ? B GLU 131 CG    
2 1 Y 1 B GLU 131 ? CD    ? B GLU 131 CD    
3 1 Y 1 B GLU 131 ? OE1   ? B GLU 131 OE1   
4 1 Y 1 B GLU 131 ? OE2   ? B GLU 131 OE2   
5 1 Y 1 C DG  201 ? "O5'" ? C DG  1   "O5'" 
6 1 Y 1 C DG  201 ? "C5'" ? C DG  1   "C5'" 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A THR 2   ? A THR 2   
3  1 Y 1 A ASP 3   ? A ASP 3   
4  1 Y 1 A GLN 4   ? A GLN 4   
5  1 Y 1 A GLY 5   ? A GLY 5   
6  1 Y 1 A LEU 6   ? A LEU 6   
7  1 Y 1 A GLU 7   ? A GLU 7   
8  1 Y 1 A GLY 8   ? A GLY 8   
9  1 Y 1 A SER 9   ? A SER 9   
10 1 Y 1 A ASN 10  ? A ASN 10  
11 1 Y 1 A PRO 11  ? A PRO 11  
12 1 Y 1 A VAL 12  ? A VAL 12  
13 1 Y 1 A ASP 13  ? A ASP 13  
14 1 Y 1 A LEU 14  ? A LEU 14  
15 1 Y 1 A SER 15  ? A SER 15  
16 1 Y 1 A GLN 199 ? A GLN 199 
17 1 Y 1 A GLN 200 ? A GLN 200 
18 1 Y 1 B MET 1   ? B MET 1   
19 1 Y 1 B THR 2   ? B THR 2   
20 1 Y 1 B ASP 3   ? B ASP 3   
21 1 Y 1 B GLN 4   ? B GLN 4   
22 1 Y 1 B GLY 5   ? B GLY 5   
23 1 Y 1 B LEU 6   ? B LEU 6   
24 1 Y 1 B GLU 7   ? B GLU 7   
25 1 Y 1 B GLY 8   ? B GLY 8   
26 1 Y 1 B SER 9   ? B SER 9   
27 1 Y 1 B ASN 10  ? B ASN 10  
28 1 Y 1 B PRO 11  ? B PRO 11  
29 1 Y 1 B GLN 199 ? B GLN 199 
30 1 Y 1 B GLN 200 ? B GLN 200 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1QNC 'double helix'        
1QNC 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 1  1_555 D DC 14 1_555 -0.556 -0.479 0.321  -10.355 -13.022 -3.771 1  C_DG201:DC228_D C 201 ? D 228 ? 19 1 
1 C DC 2  1_555 D DG 13 1_555 -0.451 -0.165 0.170  -9.788  -11.117 7.323  2  C_DC202:DG227_D C 202 ? D 227 ? 19 1 
1 C DA 3  1_555 D DT 12 1_555 0.399  -0.254 0.310  6.066   -10.588 10.000 3  C_DA203:DT226_D C 203 ? D 226 ? 20 1 
1 C DA 4  1_555 D DT 11 1_555 -0.315 -0.020 -0.381 -38.703 13.869  0.553  4  C_DA204:DT225_D C 204 ? D 225 ? 20 1 
1 C DT 5  1_555 D DA 10 1_555 -0.303 -0.154 0.167  -24.606 -12.167 5.712  5  C_DT205:DA224_D C 205 ? D 224 ? 20 1 
1 C DA 6  1_555 D DT 9  1_555 0.210  -0.191 -0.351 -1.320  -0.881  2.897  6  C_DA206:DT223_D C 206 ? D 223 ? 20 1 
1 C DA 7  1_555 D DT 8  1_555 0.347  -0.137 -0.291 15.775  -3.304  7.663  7  C_DA207:DT222_D C 207 ? D 222 ? 20 1 
1 C DA 8  1_555 D DT 7  1_555 0.048  -0.100 0.181  23.674  -4.929  7.812  8  C_DA208:DT221_D C 208 ? D 221 ? 20 1 
1 C DA 9  1_555 D DT 6  1_555 0.091  0.047  0.429  39.533  -2.778  6.201  9  C_DA209:DT220_D C 209 ? D 220 ? 20 1 
1 C DG 10 1_555 D DC 5  1_555 0.672  -3.518 -0.467 4.423   5.329   72.099 10 C_DG210:DC219_D C 210 ? D 219 ? ?  3 
1 C DG 11 1_555 D DC 4  1_555 -0.482 -0.319 0.036  -3.409  -9.022  -3.663 11 C_DG211:DC218_D C 211 ? D 218 ? 19 1 
1 C DG 12 1_555 D DC 3  1_555 0.227  -0.087 0.064  -4.302  -4.581  -0.506 12 C_DG212:DC217_D C 212 ? D 217 ? 19 1 
1 C DC 13 1_555 D DG 2  1_555 0.908  -0.577 -0.062 3.590   -2.088  -3.649 13 C_DC213:DG216_D C 213 ? D 216 ? 19 1 
1 C DA 14 1_555 D DT 1  1_555 0.653  -0.209 -0.282 17.358  -12.246 -9.957 14 C_DA214:DT215_D C 214 ? D 215 ? 20 1 
1 E DG 1  1_555 F DC 14 1_555 -0.417 -0.563 0.495  -2.810  -13.375 -8.087 15 E_DG201:DC228_F E 201 ? F 228 ? 19 1 
1 E DC 2  1_555 F DG 13 1_555 1.222  -0.584 0.250  -4.977  -8.820  0.251  16 E_DC202:DG227_F E 202 ? F 227 ? 19 1 
1 E DA 3  1_555 F DT 12 1_555 -0.019 -0.335 -0.031 4.304   -10.804 8.659  17 E_DA203:DT226_F E 203 ? F 226 ? 20 1 
1 E DA 4  1_555 F DT 11 1_555 -0.070 -0.135 0.145  -35.417 12.785  2.496  18 E_DA204:DT225_F E 204 ? F 225 ? 20 1 
1 E DT 5  1_555 F DA 10 1_555 -0.015 -0.175 0.237  -26.989 -7.118  4.059  19 E_DT205:DA224_F E 205 ? F 224 ? 20 1 
1 E DA 6  1_555 F DT 9  1_555 0.119  -0.158 -0.373 -0.806  -1.913  3.168  20 E_DA206:DT223_F E 206 ? F 223 ? 20 1 
1 E DA 7  1_555 F DT 8  1_555 0.129  -0.126 0.129  15.567  -2.759  7.118  21 E_DA207:DT222_F E 207 ? F 222 ? 20 1 
1 E DA 8  1_555 F DT 7  1_555 0.069  -0.066 0.115  26.422  -9.879  5.870  22 E_DA208:DT221_F E 208 ? F 221 ? 20 1 
1 E DA 9  1_555 F DT 6  1_555 -0.093 -0.050 0.280  35.670  -6.245  8.974  23 E_DA209:DT220_F E 209 ? F 220 ? 20 1 
1 E DG 10 1_555 F DC 5  1_555 0.761  -3.639 -0.074 1.011   10.056  71.730 24 E_DG210:DC219_F E 210 ? F 219 ? ?  3 
1 E DG 11 1_555 F DC 4  1_555 -0.411 -0.392 -0.023 -0.746  -12.813 -1.462 25 E_DG211:DC218_F E 211 ? F 218 ? 19 1 
1 E DG 12 1_555 F DC 3  1_555 -0.266 -0.239 -0.007 -6.988  -5.917  -3.267 26 E_DG212:DC217_F E 212 ? F 217 ? 19 1 
1 E DC 13 1_555 F DG 2  1_555 -0.729 -0.198 -0.157 7.546   -0.219  -2.268 27 E_DC213:DG216_F E 213 ? F 216 ? 19 1 
1 E DA 14 1_555 F DT 1  1_555 1.624  -0.164 -0.360 14.692  -9.912  -5.277 28 E_DA214:DT215_F E 214 ? F 215 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 1  1_555 D DC 14 1_555 C DC 2  1_555 D DG 13 1_555 0.143  0.447  3.329  2.072    -3.935   39.464   1.122  0.034  3.274  
-5.805  -3.056  39.704   1  CC_DG201DC202:DG227DC228_DD C 201 ? D 228 ? C 202 ? D 227 ? 
1 C DC 2  1_555 D DG 13 1_555 C DA 3  1_555 D DT 12 1_555 -0.050 0.924  3.139  1.067    0.339    36.122   1.444  0.225  3.145  
0.547   -1.720  36.138   2  CC_DC202DA203:DT226DG227_DD C 202 ? D 227 ? C 203 ? D 226 ? 
1 C DA 3  1_555 D DT 12 1_555 C DA 4  1_555 D DT 11 1_555 0.248  0.850  5.360  -3.483   52.606   21.859   -4.789 -0.637 2.901  
68.911  4.562   56.772   3  CC_DA203DA204:DT225DT226_DD C 203 ? D 226 ? C 204 ? D 225 ? 
1 C DA 4  1_555 D DT 11 1_555 C DT 5  1_555 D DA 10 1_555 -0.949 -0.303 3.322  -3.865   18.370   18.254   -5.728 1.036  2.259  
45.191  9.509   26.127   4  CC_DA204DT205:DA224DT225_DD C 204 ? D 225 ? C 205 ? D 224 ? 
1 C DT 5  1_555 D DA 10 1_555 C DA 6  1_555 D DT 9  1_555 -0.181 1.969  2.993  0.312    9.811    24.047   1.586  0.492  3.509  
22.391  -0.712  25.946   5  CC_DT205DA206:DT223DA224_DD C 205 ? D 224 ? C 206 ? D 223 ? 
1 C DA 6  1_555 D DT 9  1_555 C DA 7  1_555 D DT 8  1_555 0.606  1.404  3.192  1.201    22.720   14.142   -4.247 -0.926 2.913  
58.458  -3.090  26.740   6  CC_DA206DA207:DT222DT223_DD C 206 ? D 223 ? C 207 ? D 222 ? 
1 C DA 7  1_555 D DT 8  1_555 C DA 8  1_555 D DT 7  1_555 -0.155 0.996  3.452  -1.527   22.095   18.909   -3.892 -0.097 3.020  
49.875  3.447   29.045   7  CC_DA207DA208:DT221DT222_DD C 207 ? D 222 ? C 208 ? D 221 ? 
1 C DA 8  1_555 D DT 7  1_555 C DA 9  1_555 D DT 6  1_555 0.292  0.684  3.272  2.269    13.302   22.401   -2.351 0.014  3.183  
30.897  -5.270  26.107   8  CC_DA208DA209:DT220DT221_DD C 208 ? D 221 ? C 209 ? D 220 ? 
1 C DA 9  1_555 D DT 6  1_555 C DG 10 1_555 D DC 5  1_555 -1.850 5.257  -0.386 131.921  -17.575  -141.894 -2.651 -0.932 0.396  
8.940   67.107  -165.067 9  CC_DA209DG210:DC219DT220_DD C 209 ? D 220 ? C 210 ? D 219 ? 
1 C DG 10 1_555 D DC 5  1_555 C DG 11 1_555 D DC 4  1_555 -0.001 4.217  -2.117 -136.152 112.983  -171.876 -2.058 0.060  -2.302 
-56.494 -68.079 -179.782 10 CC_DG210DG211:DC218DC219_DD C 210 ? D 219 ? C 211 ? D 218 ? 
1 C DG 11 1_555 D DC 4  1_555 C DG 12 1_555 D DC 3  1_555 0.076  -0.205 3.320  -0.421   2.710    34.761   -0.758 -0.191 3.294  
4.527   0.704   34.866   11 CC_DG211DG212:DC217DC218_DD C 211 ? D 218 ? C 212 ? D 217 ? 
1 C DG 12 1_555 D DC 3  1_555 C DC 13 1_555 D DG 2  1_555 -0.247 -0.128 3.196  0.571    0.885    34.060   -0.355 0.510  3.188  
1.510   -0.975  34.076   12 CC_DG212DC213:DG216DC217_DD C 212 ? D 217 ? C 213 ? D 216 ? 
1 C DC 13 1_555 D DG 2  1_555 C DA 14 1_555 D DT 1  1_555 -0.452 0.474  3.009  6.409    9.880    32.565   -0.622 1.681  2.890  
16.943  -10.990 34.574   13 CC_DC213DA214:DT215DG216_DD C 213 ? D 216 ? C 214 ? D 215 ? 
1 E DG 1  1_555 F DC 14 1_555 E DC 2  1_555 F DG 13 1_555 -0.473 0.228  3.531  1.828    -5.841   47.739   0.772  0.734  3.462  
-7.183  -2.248  48.107   14 EE_DG201DC202:DG227DC228_FF E 201 ? F 228 ? E 202 ? F 227 ? 
1 E DC 2  1_555 F DG 13 1_555 E DA 3  1_555 F DT 12 1_555 0.145  0.105  3.167  3.399    1.792    24.390   -0.287 0.669  3.157  
4.208   -7.982  24.686   15 EE_DC202DA203:DT226DG227_FF E 202 ? F 227 ? E 203 ? F 226 ? 
1 E DA 3  1_555 F DT 12 1_555 E DA 4  1_555 F DT 11 1_555 0.200  0.844  5.281  -9.238   50.457   25.907   -4.352 -1.168 3.180  
63.912  11.701  57.069   16 EE_DA203DA204:DT225DT226_FF E 203 ? F 226 ? E 204 ? F 225 ? 
1 E DA 4  1_555 F DT 11 1_555 E DT 5  1_555 F DA 10 1_555 -1.031 -0.392 3.519  -0.737   17.921   19.127   -5.935 2.068  2.346  
43.491  1.789   26.164   17 EE_DA204DT205:DA224DT225_FF E 204 ? F 225 ? E 205 ? F 224 ? 
1 E DT 5  1_555 F DA 10 1_555 E DA 6  1_555 F DT 9  1_555 -0.073 1.969  2.960  2.778    9.929    23.160   1.533  0.995  3.464  
23.305  -6.522  25.322   18 EE_DT205DA206:DT223DA224_FF E 205 ? F 224 ? E 206 ? F 223 ? 
1 E DA 6  1_555 F DT 9  1_555 E DA 7  1_555 F DT 8  1_555 0.587  1.306  3.233  -2.841   21.032   13.878   -4.352 -2.329 2.796  
56.669  7.654   25.314   19 EE_DA206DA207:DT222DT223_FF E 206 ? F 223 ? E 207 ? F 222 ? 
1 E DA 7  1_555 F DT 8  1_555 E DA 8  1_555 F DT 7  1_555 -0.102 1.063  3.488  3.416    21.354   18.901   -3.751 1.150  3.088  
48.695  -7.790  28.647   20 EE_DA207DA208:DT221DT222_FF E 207 ? F 222 ? E 208 ? F 221 ? 
1 E DA 8  1_555 F DT 7  1_555 E DA 9  1_555 F DT 6  1_555 0.560  0.664  3.351  2.081    15.628   21.859   -2.996 -0.616 3.156  
35.823  -4.770  26.895   21 EE_DA208DA209:DT220DT221_FF E 208 ? F 221 ? E 209 ? F 220 ? 
1 E DA 9  1_555 F DT 6  1_555 E DG 10 1_555 F DC 5  1_555 -2.149 5.195  -0.388 130.842  -17.328  -142.182 -2.619 -1.078 0.469  
8.816   66.571  -164.847 22 EE_DA209DG210:DC219DT220_FF E 209 ? F 220 ? E 210 ? F 219 ? 
1 E DG 10 1_555 F DC 5  1_555 E DG 11 1_555 F DC 4  1_555 -1.419 -2.610 -3.524 135.777  -107.790 101.612  -1.962 -0.117 -2.410 
-54.359 -68.472 175.806  23 EE_DG210DG211:DC218DC219_FF E 210 ? F 219 ? E 211 ? F 218 ? 
1 E DG 11 1_555 F DC 4  1_555 E DG 12 1_555 F DC 3  1_555 0.123  -0.196 3.454  0.427    -0.546   33.074   -0.247 -0.140 3.458  
-0.958  -0.751  33.081   24 EE_DG211DG212:DC217DC218_FF E 211 ? F 218 ? E 212 ? F 217 ? 
1 E DG 12 1_555 F DC 3  1_555 E DC 13 1_555 F DG 2  1_555 -0.314 -0.333 3.022  -0.057   2.619    25.073   -1.468 0.705  2.973  
6.013   0.131   25.207   25 EE_DG212DC213:DG216DC217_FF E 212 ? F 217 ? E 213 ? F 216 ? 
1 E DC 13 1_555 F DG 2  1_555 E DA 14 1_555 F DT 1  1_555 -1.018 0.113  3.374  3.490    0.487    36.357   0.111  2.115  3.267  
0.778   -5.578  36.521   26 EE_DC213DA214:DT215DG216_FF E 213 ? F 216 ? E 214 ? F 215 ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#